4F57H

Fab structure of a neutralizing antibody l1 from an early subtype a hiv-1 infected patient
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
225
structure length
225
Chain Sequence
EVQLVESGGGVVQPGGSLRLSCVASGFSFSDFGMNWVRQAPGKGLEWVAFVPFDRRINYYAESVRGRFTISRDDSKNTVFLQMDSLRPEDTAIYYCAKHRSQWNFWPREGGLDHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Light chain of Fab of a neutralizing antibody L1
publication title Viral Escape from Neutralizing Antibodies in Early Subtype A HIV-1 Infection Drives an Increase in Autologous Neutralization Breadth.
pubmed doi rcsb
total genus 45
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2012-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f57H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f57H01
5J4MA 1A14L 4HBQA 4FQHA 5B4MC 4P4KB 4ELKA 4LDLB 1PYWA 1L4IA 4OKVA 3D85B 1ZLUK 3V6OA 3LZFL 3QI9D 1OGTA 3H7BA 3NIGE 2VLKE 4WI4A 1D6EA 3X3GH 2DLIA 1JHTA 3VFWA 2V2WA 4PJIB 3LN5A 5IJKA 4IRSB 3MFGB 4PP2A 2G5BB 1CL7I 1NCNA 1TJIL 3HMXA 4PP1D 4U1IB 2P5EE 3CFEA 3UEZA 1HHIA 1XIWB 2DQTL 1A6VL 3DX8A 3P4NB 3CCHA 2ARWA 5MEPA 4XVTH 4NOFA 1HYSD 1JGEA 4I4WB 3A6CL 4FFWC 4ODSH 2BVUA 1T1WA 1CDIA 4YHYC 2V2XA 2Y9RT 1IT9L 4ZPVB 3WXWL 3MUGB 1EHLL 5A2IH 2DBLH 4RIRA 4HH9A 3O45B 1QZ1A 3P0YL 4UAOC 2KH2B 2Q20A 2P5WB 3SKMA 5IQ7L 4JFYA 2BRRH 2BHUA 2YPLE 4QRRB 3VCLA 4JJHA 2I9LB 4S0TD 4BH8B 2CK2A 4A6YL 1SJHB 3BIKB 4Z7WF 2CO7B 2YMXL 1VADB 3VXTB 1BWWA 1K5NB 1OGAA 1MVFA 5CJBA 1IAOA 4FQCH 1S5IL 3IVKB 3RVVD 2AJXH 1BHGA 3VWKC 1CG9B 5ISZA 4X4XB 1KYOJ 5CSZB 1PGRB 3BPNB 1MRDL 1VACA 4MAYB 3QWRA 4LK4A 5ICZA 5IFHH 3DETD 3MRGA 5E7FA 1DQDH 4PJ5D 1FNAA 5C9KA 3SE3C 2CKBL 2UVFA 3K0WA 2Y06L 5K9OB 5DD1L 4AG4L 5D1XB 1S9VB 2XTJC 4KJYA 5D6CB 1S3KH 4NC0B 2PO6B 4OIIH 1MCLA 3RWGB 3E8UL 3BHBB 1WSST 4ZFGL 1F97A 1CBVL 1IKNC 2VLJD 4W6XB 4BQCA 4BFEA 3NIFE 4NO0A 1FC2D 2OJEB 5ANME 4IOFC 5BZDA 2AGJH 1H9VA 1A7BA 2FCBA 1WFTA 4QHMA 2XQYG 4MD5A 4G3YH 1NUDA 3OG4B 4OQTA 3VXPB 1TDQA 2VR5A 4ZAKB 2ZG3A 1HH6B 4I1NB 1NMBL 4Z77A 4EQ2A 1BQLL 3Q6FA 3BZEB 2XTLA 2NXYC 1R3IL 4JO4L 4ZTOL 1JNHB 3VH8B 3HC4L 3UP1A 3IAGC 3L95A 3OHXB 4X6EB 4QTIH 2NTFB 3BUYB 1DLHB 3UJJL 2GK0A 1KB5H 5BVPL 5GJSL 3B8SA 2VUOA 2WBWB 3PWPB 2HP4A 4JO1L 3MNVB 1H3WM 3TN0B 4JO2H 5FECB 3LQAL 1RIUH 1IC7L 3LD8B 2DOCA 3DTXA 1CICA 3T0EB 1BFTA 3O6KH 2VDPL 4EI6A 4EI5D 2QL1A 2X4TA 3PP4H 3MROB 2VXTL 5KJRH 3TBSA 1FNLA 1KB5B 4FMKA 1A3RH 4PJEF 2F74A 2P5ED 2Z4QB 4IJ3C 1OP9A 2HYMA 5FK9A 3B9KB 4H8WL 3EOTL 5FM5O 2VB5A 1ZHBB 5I8KL 4LLUB 1T0NB 1QQDB 4P9MH 5IJVA 5MEOA 4LARH 3VGFA 3VFSB 4W6YB 1EK3A 3HPLA 4DAGL 3VI3E 4XNZC 2DQFB 4F9LC 2BVOA 2OL3H 4HUWA 5D1QD 5T1LB 1Y0LB 3N1MC 5JQ6L 4MNGA 1LK2A 3E6HA 2WLYA 2YPLD 3LS5H 1W0WA 1QLRA 5EC1A 3GHEH 1RUAH 2EECA 5C0BA 4ZDHB 4LNVA 3NFSL 5BO1L 3D1MC 2XWJB 5HGDB 5EWIL 1FPTL 4APQB 5F1OB 2XY2A 1NKRA 3OG6B 2NPLX 3W81A 1KB9J 2OL3B 5JLZB 3BEVB 1KJVB 2HFTA 3KPLA 5DJDB 4I3RH 4TOYH 3U0TA 1KTRL 5T3ZH 1NMCC 3FO2B 5F9OL 1U8NB 3BE1H 4XNYH 1BVLA 5E4EB 1UH2A 1WWWX 1UJ3C 1CLYL 2V7HA 3UYPA 3OL2A 1DQMH 4OM0H 3C60B 4ZG1A 4P5KA 4ZO8A 4HWBH 5JHDB 3U4AA 1OT1A 1KC5H 1RZIA 2UZIH 2EH7L 5HDOA 3MCLH 2APWA 3NCJL 2OZ4A 3LKQB 2FHBA 1J1PH 3FONA 2DL9A 3CGTA 4RFOL 2ZPKH 4FN0A 1T7YA 2CUIA 4P23A 4OLXH 3MV8E 4YFDB 3UO1H 4HJ0D 2BSTA 4J3SA 4JANA 2R0ZH 4GAGH 3DO3A 1ED3B 2W0FB 5MENA 3JBG7 5FUCC 5DD6B 3OKDA 3PWLB 4Y5VA 1JK8B 2AS5M 4DZBA 1A7PL 3RU8H 4Y4KD 4U1MA 4X9FA 2DQHH 3VGBA 2DTMH 2P1YA 5FKPA 3UJIL 3QJHA 2Q7NA 1DJSA 1H5BA 2WAHA 1A7OH 1UGNA 5FYKU 1KT2B 5E00B 1F42A 3NCYP 1TTGA 4NSKB 2PTVA 2FO1A 1EHAA 4MVBC 1UM5L 1FFRA 2RCSH 4NHUB 2VZTA 2IGFH 2AQ1A 4L4VB 5JW4N 3DXAE 3RZCA 3G9VA 2IPKB 3HG1B 1I7ZB 1KELH 4WW1B 4WW2F 1MCJA 3BT2L 3O81A 4X8JA 4YBQC 4ZO7A 2H8PA 2MQCA 3FT4B 4XBEL 1AHWB 4I5BB 4OZFA 3X3FH 4DVBB 1MFCH 4FOMA 2NQCA 3JV5A 4ZXBD 4S2SA 2IH1B 3GUTB 5T33L 1AO7E 3EYQD 2PXYD 3V4UL 3MFFA 1D5ZB 2VITB 4JM4H 5DXWA 4ZUUB 2YBRA 1A7QL 15C8L 1TJGL 3QNXB 4ZS7H 4WHDA 3L3OB 5FM4A 4FS0A 3O4OB 4NQEA 3QULA 2WV3A 5TJWK 5GS1A 4MXWL 3ZDXE 4HDIA 5AD0B 1OSZB 4L8CA 1N2RB 3FO9A 4X5XB 4RX4D 4EN3D 1N5AB 3SGDI 3GMOA 2J2ZA 3TH3T 3FT3A 3OKEA 4GRWH 3C5ZC 3HE6A 3BP7A 4Y4HC 4F7CB 4PGBB 4UU9A 2YSSB 2CJUH 1RMFH 1C5CL 3PL6D 5F70A 3VRLE 5EO1B 3U46A 3QCUL 3QIWB 4URTB 3L5JA 3K1DA 5KSAA 1OTSD 5KVMC 4ZFFA 5KS9F 4ZFZA 2CK0L 1N6QL 1CR9H 1DEEB 3MLWL 4S1DD 3AS3A 1AD0B 3EDKA 3F12B 4GRWB 2FBJH 1KG0A 5B8CA 5FYKL 2YR3A 4MSWA 2NR6D 3ESVF 2BOBA 4N0UB 1HCVA 3TT1H 5I15L 3UBXB 1OWRM 3H42H 3H3KA 1F6LL 3QXVA 3QA3B 1BJMA 1CD8A 3BOVA 3VRIA 1VGEL 3RWIA 3SHSA 5HVHB 1D6VL 5D7IA 4HGWA 4HMCA 3C8DA 2PTTB 1RUMH 3ARBC 3L3GA 1XCTB 4O5LL 2FYYB 3F7YA 5C0AA 3UMTA 1RJYB 3EJYD 2WP3T 1H0DB 3OXSA 3BFOA 2CUHA 4OV5B 4TULL 3MV8D 5EUOF 4AIZA 2Z91A 3QZWA 2ADGA 1CIDA 5D2NC 4Y16A 5F9WC 4JRYB 5EBGA 4WVRA 3KHQA 3NFNA 3MRFA 1AI1H 4WI5A 3M17A 5DEFA 2AXHA 4YFLF 2A74A 3GSNH 1WAAE 2KL6A 1MFNA 3B2VH 4IEFB 3CXHK 4M93B 3ULVC 4CVUA 4G8IA 1MHPH 4XPGL 4RBPK 5F97E 2MWCA 1KULA 1KCRL 4RGNE 5E2VH 1HYRC 3W0WA 5IQ9A 1NSNL 4M7ZB 4UOW0 3DXAD 5D8JL 3HMWL 8FABB 4NYLA 3GSNB 4KK5C 3P30L 2IPUK 4Y1AA 4PLKC 1EHNA 2XNAB 3RPIA 3ZL4L 3DGGA 3EKCA 5DJCA 5KS9B 1P7QD 4F7EB 4UNTA 4WJ5B 5C70A 1F3JA 1DR9A 3SKUD 1AO7D 1M7IB 2DL2A 4PGZA 2FH6A 1SY6L 2MNUA 1JNLL 1ZS8B 1OHQA 5C0GA 3MA7A 3G6AB 4DFHA 2MKWA 3EUUA 3L3JB 5DUPL 3D0LA 1QRNE 1EJOH 1GGBH 1JGVH 1JHKL 1TVBA 4QRSA 2AERT 3NABL 2GJ6A 3UTTB 5IB5A 3R1GH 3E6FB 1KLUA 4UNUA 4UMGA 4YJZL 4PJXB 3VFNA 1LP9B 3HUJB 1XGRA 3VXRA 3U7WH 4KU1A 5DDHB 1UCBL 3ZHKA 3IT8D 4JN2A 4PGCA 4L8SA 3S36H 5CZVL 2DLFL 5TPWH 4DWHA 1U3JA 2HMIC 4K71B 1UACH 2PR4L 4U0RC 5E1AB 5EC2B 3IJHB 4G8GE 5ADPL 1IAKA 4YPJA 3NCYS 1CL7H 2YZ1A 5E4IA 5JDSA 4JRXA 3O3DA 3LKOB 3MGOA 1L7IH 4JM2F 2CRYA 2FIKB 5EZJA 5DD5H 5D7JC 5JORA 1IEBA 2J8UF 5L7XH 3KYNB 3BZFB 4KK8C 4PJFE 3MLSL 3QFJB 1XH3A 1CFNA 3N9GH 3O8XB 1I1CA 1S7XB 1BPVA 2N4IA 4PRPB 1F90H 4JZJB 3MLUL 2BNQB 3QPQD 2IAMB 3QISA 4GAYB 2ATPA 2IFFL 3PJSB 3W5MA 1MRCL 5IK3A 4IDLA 1SQ2N 4NKMA 4Y19E 5DMJB 3ZKMD 2H6PB 4OJFH 1MUJB 5FHAH 1BVKB 3QDME 1X44A 4M7LT 1G7IB 2M2DA 4JHZA 2P8MB 2J4WH 4LVNC 2QKIB 3MLYL 3DURB 4D94A 4PJHA 1N3NA 1JFQL 4X7SH 4D9LL 3GSXA 3BH8B 4BK4A 5GS2D 1F3DJ 3V5HA 3QAZB 3LV3B 4KJWC 3AY4C 1CGUA 5L0QC 4UV4L 5DI8B 4CNIA 2QQQA 1KPRB 3EHBD 3I9GH 2OK0H 2CLZA 5IFAL 3P0GB 4RGND 3QQNA 3BGAA 4WCYH 4ZS6D 1BX2A 4IRJD 2K9UA 1T21A 4OZIF 1MEXH 2P8PA 4PJCA 5EOQL 3MRMA 1CZ8H 1FNFA 1OAXL 3VXQB 3W9DA 1A1NB 1QFPA 3BZ4A 4FQLL 4OAWA 1U3HB 3GSWA 1FZJA 2FWOB 5D2LB 5IKCB 3WN5C 4HG4K 3K1KC 4JM2B 4MWFB 3S98A 4YNYB 4HUUA 1XF2A 3QI9C 3MXVH 1ZHLA 2VERN 4PG9A 1TQCC 3SDCD 1NJ9B 1ES0A 2DQCH 1AGBA 4PJGA 1A3LL 3FQTB 4WFFE 1M7DB 2WBJC 5GSVB 5D71H 4TVPH 1S7UB 3MA9L 3H9YA 3W9EA 4PP1C 3V9FA 2ITCB 1YEIH 2QHLA 5FGBA 1XEDA 5CILL 5CEZE 2G2RB 2ZSVB 4OZGA 3HC3H 1HYSC 2HKFL 3F5WB 5EIIA 1N64L 2NZIA 2E8ZA 4AEFA 4YHYB 5ICXB 4P2OD 4E5XB 5EB9A 2AI0L 2CKBA 5E9DE 2NY3D 4R9HA 1Q1JH 1GZQB 1BLNA 2XWTA 1N5YH 1JPTL 4UAOB 1MPAH 1YMHB 2V17H 2R0KH 1FVDB 4LQ1A 1LE9A 2OMNA 1QA9B 1PSKH 2XQBH 4G8GD 3O0RL 2VSDA 2EYRB 1A1OA 1MI5A 4AT6A 3KNBB 5H8DA 4M8VA 4ZFOA 1XF4B 4X7EC 3LPGA 3O2VL 5C08A 1A9EA 5I9QB 2P24B 1Y6MR 1JPSL 1OVZA 5F6IC 3L6FB 1UXWB 1FQ9C 2H32H 4XP6H 1FAIL 3UC0L 4PIRF 3K4DA 3PXJA 4R2GD 3FO1A 3VWKB 5CKAA 4TNWK 2AP2A 3RVVC 1F2QA 1VFAB 2VE6B 2XWBA 4M02A 4NNPH 1MFBH 4PJBE 2Q1EA 2O5ZL 3I75B 4ZD3L 3GSUA 5HYJE 1N7MH 4Y19D 2ED9A 3BIAX 3UTSE 4AIXA 3DV4A 4K55A 2O26U 1M1SA 1ONQA 3DETC 4OGYH 3ZE0E 2Q6WA 4Z7OE 5HDLA 3CFCL 3S3PA 3GKWL 3GSOA 4NGHL 3GJEA 5T5FH 2XTJB 4C83B 3QDJE 3LN5B 3PGFL 5DF0A 5F7DA 3FMGH 2OYPA 2YUVA 1CFVL 3FN0L 2Q8AH 3TYFB 1JGLL 2PYEA 1KENH 2Q8BL 3P9WB 4GW4B 1QYGH 2JK5A 5CP7B 4XWGL 3KYOB 4LCWB 1GGCL 4Q9RL 1JZ2A 2ADIB 2IANB 2CLVB 4UIKH 2E7LC 3KGRA 3B83A 1RUKH 1ZT7A 3MV11 5JXAH 3EOAA 4LLWA 3TBWA 1CWVA 1RD6A 4KV5E 5EA0H 4K3JH 2XZZA 4KRPD 4RIRB 3IDIB 2VDNL 2NXYB 3LQZA 3SKMB 3CLEL 4TSAH 2PN5A 4JR9H 2FRGP 1CQKA 3L7FA 4J1UA 1LDSA 5E5RB 4YGAB 4NUGL 3PNWA 1KOAA 5K9JL 3T1FA 5CEZL 3V79C 1KTDA 1YY8A 4IS6B 3M1BB 4WFEE 5H2BB 2FZ3A 2BP3A 4E42A 4RAVA 3EFDH 1NCCL 1WJ3A 4XI5D 5IROA 5F3HB 1Q38A 2VDLH 1EGJL 3T4AA 4C56A 5GJTH 4EI5C 3EO9L 4G8EA 4LDEB 1U9KA 4FQXD 3S35X 3WIIH 2N7BA 4YDJB 4CRPA 3LRGA 1FV1B 1MWAL 5JTWA 1LO3H 3DX6B 2GY5A 4WDIB 5CEZD 5KG9A 3C6SB 3MGTB 2GT9B 3FB7B 1FIGL 3WFHA 3ZDYF 4Z76B 1XR8B 3O6LL 4XNZB 5F89B 4D0CA 5IFJA 1DANU 3QZWG 4R7NB 3AXLB 3WHXA 1AKJA 1JPFB 4DTGL 3MRQB 4OF5A 3R8QA 3DI2B 5D1QC 3L7EA 3Q1SH 3SJVE 4GMSH 3PGCA 1ZHNA 1DL7L 1UKSA 2GUOA 4MAUH 4PLNC 2PW1B 5AYQA 3DMMD 4PY8J 4ZOCA 5EO0A 3FAWA 4GXVH 2DB8A 1NBZB 1XFPA 4JB9L 3V4VH 3RWJB 4MA3A 4Z77B 1QSFA 5EU5B 4D3CL 4QGYA 3INUL 5DRZB 3HR5B 3S37L 3RY5A 1KFAL 1IL1A 1PX4A 1PQZA 5SWSB 3QUZD 1P4IL 1C08A 5A2FA 3HNVH 4S1SH 1I1YA 1BFVH 1NMCB 5FO7B 3D87B 2R15A 2NY2D 3VMPA 3JWOC 2PNDA 5GS3A 5HYJD 4NRXB 5AUMA 5LBSH 4WNQB 3UTSD 4OGAD 4R4FL 5JIHA 1UJ3B 1QSEB 3DROA 3LEVH 4K3GA 2Z8VC 4CN1A 1VFUA 2XA3A 2GITA 3MBED 1YQVH 5GGSY 2ERJC 3SGDH 2R9HD 1T2QL 3PQYB 2X4TB 3QDJD 3EOBA 4JFFE 3S7GA 2V2TA 4LSSH 1J1XL 3TBSB 1PJ9A 3IJSB 1YNLL 5IT2L 4LF3A 2ZUTA 2J8HA 3WNMA 3MRPA 3QDHA 2UWEA 1JE6A 1H3PH 4OQ1A 4DKEL 1Q9LA 3B9EA 4ESKA 4DGIL 3FN3A 4KUZH 3N0PB 2AXGB 5LAXA 4AH2A 4HJ0C 5EU3B 5BV7L 1EBPA 1R5IB 1BFOB 1JWSB 5GGUB 1A7RH 3JWNC 2WUBH 4O2EB 4O2CA 5DVOA 2DMKA 3MRIA 4Y4KC 5LVEA 4YEEA 4X6BB 3I2CH 5EBLB 3FHQA 1FNSL 5KANI 4GQ9H 2VAAA 4JY4A 4U49A 3V8CA 4Z7QE 5BW7C 3TYGL 1BQUA 2OCFD 1T7VA 1X5IA 1A6TA 4PRHE 1YPZA 4WFED 1I85A 3UYOD 4KRLB 3U4EB 3ALXA 1LEIA 2ICEB 4HEME 4O4YL 1U2HA 5C09E 1RQ5A 1YNTA 1X5FA 3HA0A 3HPJA 4LFHG 5CD3A 3P9MA 4X6CB 4JO3L 2MFNA 4FG6D 4X6DA 3O3EB 3SDDA 3T2NL 1IM3A 1YEDB 3CDGA 3WIHA 2AJUH 4GXUM 5IEHA 3ARDD 5SX4I 4OLZH 1T2JA 2ARJB 3MRCB 1QBLH 1QLFB 4OCLC 1MCBA 2WP3O 4N8VA 3QG7H 3TP4A 3X13A 4CW1A 1MLBB 1T4KA 2AK4E 5E8NB 1MHHA 4P2QB 5F7UA 4JKPH 4CMHC 3NA9L 4ZXBC 4MQ7B 3EYQC 1AR1D 2PXYC 3RKDD 5C0JB 3RNQB 1I1FA 3IU4H 4BFIB 1PZ5B 3OV6A 4LSTL 2WZPD 3V0WL 1FN4B 3KPMA 3SJVD 4HH8A 3MRKA 4HKZB 4UT9L 5E5MB 1TQBC 4MZ2A 4WTZA 1OB1B 1JUFB 1RZGA 4YHOL 1UM6L 3RDTA 5T3XH 4EZMA 2H41A 4JANB 3KYKH 2O5YL 4EN3C 3IDYC 2DM4A 2WM0A 4Y4HB 4WWKA 1C5DA 2ICCA 3OKDB 5KSUB 5J9PB 4OFDA 2HKHH 1VGKA 3PL6C 4U7MA 3W82A 2D31B 4JY5L 4NM8H 4M6NL 1KPUB 1PKQE 1BVZA 1LWRA 1OTSC 3TC9A 4V1DA 1LO2L 4ZUSB 1U8KA 1B4RA 1PG7L 4S1DC 4NZTL 2DWEB 4WRLA 4NZUH 2W91A 1I3GH 3VRJA 5F3BA 1ZTXL 2LU3A 5D7IF 4TSBL 4LPVA 2NR6C 1A6UH 1IARB 4Z5RA 4JFFD 5A43C 4P4RB 4IMKC 3FQWA 2W65A 1LE5B 2ZJSH 1LMKA 4YDKH 2VC2H 3ARBB 5DJ6A 3OGOE 5F1NA 4XH2A 1N59A 2IALA 4PRNB 3EJYC 2VLRB 3L3DA 3QPXH 1Q8MA 1I3RA 2Z92B 2FH8A 3VXMA 3F7VB 3KPOA 1DQJA 1JF6A 3MNWB 2E7BA 3ULVH 3AC0A 2BZDA 4QRQB 5HYQB 1VEPA 5D2NB 1O0VA 5HHME 5F9WB 1MJ8H 4DGVH 4K3DL 1I4FA 5EZLA 1WZ1L 4KRMB 2E3VA 1EERB 5DRWA 5IMKA 2XFXA 5DJYA 2R1YB 4AYFA 3QHTC 3ALPA 4ELME 1FL5A 4LP4A 1EFXB 4YXHH 4M5ZL 4LPUA 1W0VA 4OLYH 4HJGA 5E8PB 3TH4T 4QRPB 5IF0A 4PRHD 4OZHA 3KPRE 2OTUA 3IJYB 1SMOA 3UPCA 4OD1H 1HCFX 4J4PD 5I1HL 1G7LB 2ESVE 3V0AC 3GI9H 3L5XH 5IWLA 1QR1A 3CC5A 3WV0A 3UTZA 3QUML 2BVYA 4OFYD 1JP5A 5KN5A 4P2RD 2X4QB 5FFLA 1E4KC 4HS3A 1TCRA 2GHWB 4HCRH 5B8CB 3FAXA 5HHPA 5C9JB 3L3KB 3IXTB 1F6AB 1NC4B 3LHPL 5D5ME 3QIUC 2IMNA 5DMGC 4JZOB 1I7RB 1A6WH 3RAJH 5F9JA 3RWIB 2R2CA 4PJ8D 3SOBL 4L4JA 3UZQA 5F7EH 5KVGL 2AKRA 2YC1A 1MCOL 1BZ7B 1ZKAA 3F7QA 1JF1A 5FCUL 1I8MA 3U9UB 3MRBA 4M03A 4Z7VB 1I8IA 5BS0A 3G9AB 5E24E 4TVSa 5DHVA 4NKDB 1MHCB 3RY6C 1AGDA 1FH5H 1EVUA 1EBAA 3QEQA 4KMTL 4LRIC 4ODXB 4X4MA 2FX8L 3JV6A 4Y16B 1T1ZA 3HRZB 5HI3D 4YE4L 3D25A 2HT3D 4YHZL 1FP5A 4HV8B 5I18L 5J1SC 4U0RB 2A74B 1IQWL 5CWSB 1TETL 2PYFA 4NPYB 1N6UA 4NWUL 5D70H 4R26L 1Q0XH 1ACYL 4NKOB 2A6DA 2C1OA 3NH7L 1DQQB 3HLAA 5D7JB 5J6HB 3TBVB 3W0WB 4Z0BH 1IGTB 3VW3H 2E27H 5DVLA 5IQ9B 2R0LL 4AEEA 4H5SB 2B0SH 3CPLB 2HJKA 4HGMA 4OCSH 4JFEE 5DK3A 1AY1H 2Y5TA 3B5HA 4Y1AB 3JTSA 3QCVH 1NLBH 3QPQC 2APXA 3NCCB 5CUSH 5GRJL 3B3IB 4PJ9D 1EAPA 3NACH 4LHUA 1SJXA 3ZKMC 1IM9B 1A3QA 1YZZA 3WFBH 1XGTA 1J5OH 4LVNB 3DI3B 3CSGA 4PJHF 1MJ7H 2XIDA 5HHMD 4FNLH 3VXUB 4NQCE 4X99A 3B9AA 4F7MB 4QGTA 5SWQA 1W72H 1HQ4B 4YDIH 4EOWH 3EDJA 4JFOA 4PRAA 5HGBA 5F72S 4D8PB 4HWEL 3FB5A 4W81A 2B7DT 4KVNL 3V6BR 2GJ6B 3JXAA 3QQ9D 4K23L 4FFYL 2F58H 1ZE3C 4UINH 1DBJH 1MAKA 1YEGH 1IGFH 3TV3L 3QEHA 5L0QB 5E8EA 3RL2A 5GGVH 2A9MH 1BWMA 1K85A 2V5YA 1XGYL 4X5LA 4PJ7A 3K2UL 4PUBL 3EHBC 4PJCF 4HIJB 4X80H 1HSBA 3KPRD 4EUPA 2IPTL 4RGNC 4NRYA 1K2DB 2IH3A 4ZS6C 4U1NA 2FNBA 1IGMH 4GBXD 1RUPH 4IRJC 3HR6A 4HS8H 2ESVD 4O2FA 4EDXB 1EMTH 5DSCA 2X2YA 3ISWA 4NZDA 3T1WA 1BECA 1J8KA 1KN4H 4E0RB 2Z31A 2J3SA 2AK1L 1EV2E 4U2ZA 1YN7B 2I27N 1R5WA 4PJDB 4KHTH 2AXFB 2OQJB 1HKLL 1U6AL 3WN5B 5FKAA 1F4YL 4H1LA 4KROD 4IOSD 1C16B 4CVXB 3C6LD 4PJGF 4ZNCD 3QI9B 5TH2A 1GZPA 1TQCB 2X4OA 3GIVA 3LY6A 4TUJB 5F88A 2MPAH 3LZFH 1WQVT 2WBJB 1ZLVH 3SDCC 3P4OA 2I25N 1UJTA 3WD5L 4U6YB 1BIHA 1NANI 3OXRB 1SYSB 3FOLB 4OZGF 2FX9L 3RWHB 3TA3D 2Y36L 1TJIH 2A9NL 4LVEA 5I75C 4M3KB 4FQJL 1NAMA 1F11A 1TZGL 1KTKE 4PRIA 2DQTH 1A6VH 2OTWB 4N9GA 1PBYA 2H9GB 4YK4C 5CBAB 4P2OC 2QEJA 4UTBL 3L3HB 3A6CH 3RUGB 2ZCKL 3WIFB 3G5VB 4I9WE 1J0YA 3D39A 4LVHC 4PJHB 4JFZL 2NY3C 3QXUA 2AJYH 5HTSA 4QXGL 2PCPB 5DK2B 1U58A 2FHFA 2X4UB 1YMME 3G04A 3LOWA 5KSBA 1BBDL 4WV1C 1MH5A 5L8KB 1KLFA 3P0YH 2Z9TA 1IRAY 1CXKA 5IQ7H 4XWOD 4NO2A 1BIIA 3VGAC 4BKLA 1T0MA 4JHAH 3KPQB 4A6YH 3PUCA 3F7PC 1F4WH 3ECBB 4F3FB 4XZUA 2ZOKA 3BD3A 4YXKL 4R2GC 2H1PL 3BRGC 4X5WB 4Q74A 4NQVA 4ORZC 1KTLB 4U6TA 1S5IH 1ZGLA 1R3HB 2XQYK 5L8JB 4PRDA 3BQUA 1U8JA 4CL7A 3RI5K 4GAFB 1CIUA 4UOJA 1UQSA 3GSWB 4PJ5B 2VIRA 4A6YB 3FFCA 1QRKA 3EZJB 3DVFA 5LGKA 5JOEA 5KVDL 1YEEL 5FA3B 4NQCD 2PETA 12E8L 1OQXA 3QEGH 4G9FE 1AGBB 4L8DA 4WI2A 5DD1H 4EVNB 4AG4H 1FL3A 1MY7A 2HRPL 2VLJB 3TH2T 2W0KA 5HGGS 1UCTA 4ZFGH 4NQUA 4WUKH 1WK0A 4QRRE 1MWAA 5I74C 5L6YL 1ZHKB 5L9DH 3WJJA 5GIRB 3LMJL 2RB8A 2HFEA 4XCEA 5C0FB 4AEHL 1L6XA 3GMLB 3ZT5A 5ID0B 1S5HA 4Z95L 4HEPG 3CXDL 4KRPC 1NMBH 4RWYH 5JXED 1BQLH 5C8JA 2EE9A 4WHTA 4NO3B 3AROA 5DD0L 4ZTOH 2EC8A 5FV1L 3IDUA 2VDRL 4ZOAA 3ZSSA 3PP3H 1KXVC 3UJJH 4ZUWB 1J0IA 5GJSH 4DCQA 5CMAA 4LCCA 5D1ZC 5H37G 2R2BA 1J0JA 1U42A 3FO1B 4XI5C 1NH6A 5GGQL 3DOSA 1IC7H 4EI5B 2XZCL 3BD5A 4LKCA 4LASL 4X4YA 4LDOB 4AL8L 1JNNH 2V9TA 1FLRL 3S35H 1DUYA 2W60A 4I13B 3EYOA 1FZKB 2P5EB 2VXTH 4FQXC 2X9YA 4IBLT 1SM3L 2DIBA 1ONQB 3M8OL 4E9LA 4HX1A 4YO0B 4G6AD 4H8WH 3DUSA 3EOTH 4JFDE 2NX5E 3GMMA 2R4RH 1NGXA 5C3TA 5I8KH 3OAUL 1U8OA 3ABZA 3CJJA 2P45B 1CFTA 5I1EL 5D1QB 4DAGH 1BJ8A 2WIMA 1YMMD 4NN7C 3WJLC 5F44A 3U82B 3GGWB 3P40A 2Z35A 2YPLB 4OF0A 4MJ5A 5SX4H 1D9KD 5JQ6H 1DBMH 3AU1B 3DMMC 3PWPE 2FLBT 4RISH 3BI9X 5T5NG 4OLUL 5MERB 3SO5A 4PJAA 1YUHA 5EWIH 3T0EE 4FQ2H 1YEJL 4LCUA 4PREA 2VL4A 4XPFH 5AZ2L 1ADQL 3QUZC 2C3VA 1A6ZB 2NMSA 2AJVL 5DVNA 2NY2C 1AC0A 4JPVL 2YD7A 4OGAC 4HMEA 5LCVL 4XHJD 5HJ3A 5F9OH 3OKKA 2ERJB 4TUKL 3MBEC 4QOKA 3AUVA 3QXDB 1EUUA 2R9HC 4K8RL 4G9FD 1G0DA 2YXFA 5LGHL 1YN6B 3OAYH 5C07E 4OF3A 2UWEF 3ARXA 3WFEL 4PV8A 3STZA 3VD5A 3TO2A 2UY6A 5ANMB 3ARFA 4QRRD 3NCJH 4G6JL 4XVJL 4G42A 4NQDE 2R23A 3B8YA 4XCNB 4C54A 4D0CB 3QDGA 4NQSA 4M8QA 4HXBL 4K8RD 1TXKA 1QO3B 2DJSA 4R96B 1WFUA 1OPGL 4KGLA 4Y4KB 3CLFL 5EPMA 1FZMB 3ZDZF 2IQAA 1A7PH 3PV7A 1YPZF 2L7JA 3QQ4A 4I2XE 2V5RA 4MAYD 2V9RA 3UJIH 4O51A 3A67L 5GQBA 5DYOA 1E6OH 3NGBC 3U0PB 1U91B 2FGZA 4YHIB 3T2QA 5HSFA 2JIXD 2ADFL 2FBOJ 4X6DF 2UY7A 5LGJA 3ARGA 1UM5H 4LU5H 3K8KA 5FA4A 4I18C 5I1DA 3DX9A 4GUPA 3T8XB 1BQSA 4FG6C 1TENA 5J1AB 4GG8A 3TVMA 4NNYB 5D7LD 4NZRL 3DVIA 3ARDC 2BC4A 1RJZB 1CT8B 1G9MC 2QTEA 1T5WB 3BT2H 2WIIA 4PJEE 2IBZY 4HHAA 4CMHB 1F00I 3D9AH 4XBEH 3QNZA 4ZXBB 1SHMA 5TQ2L 3MRHA 1F02I 1QTYT 4K94L 4GO6B 4LPWA 2PXYB 1J1OL 4JFDD 2NX5D 2BY2A 2DLEA 3U9PL 1AR1C 3RKDC 4L29B 4ZAKD 3KXFA 4UB0L 4RQQB 2VUYA 1OAUL 3P77A 1ND0A 1EJ6A 2BY1A 1J05B 15C8H 3GHBL 1VDGA 1NFDA 4F58L 1FNHA 1TQBB 4MXQD 3CVHL 1KCVH 4P5TD 4NWTH 1R3LB 2XRAH 3PWJB 5IW1B 3SKNB 2ZKHL 5DS8B 5M94B 4EN3B 3IDYB 3PWPD 4XPAL 1CD9B 3V2AR 1SEBB 2APVA 3Q0HA 1G6RA 1MJJB 2AV1A 1FJ1A 4ODWA 1FG2B 4PY7B 5TDPB 3H0TA 4P2CG 5ESAB 5INDB 1A6AB 3HG1E 5H35B 2XN9A 3DVGA 1OF2A 2NY7H 1KNOB 3VG9C 3C2AL 2GFBA 4JFPA 3PHOA 3DSNA 2JELL 1URLA 3E0GA 3MV9D 5DFWH 1IMHC 1RZKC 1A6TB 1K8DB 2DMBA 3HE7D 4U6HB 2CK0H 5EOCH 5KW9L 1LEIB 3MLWH 3PDOB 1UA6L 4Z6AT 3PIQB 5CD3B 1NCWH 3PDDA 5I15H 5C07D 1NGZA 3ARTA 1W8NA 1VGEH 4W4OC 1MCSA 3ULUL 3WHE0 1D6VH 1HXMA 1BOGB 1QEWB 2R8SL 2VISA 1MCKA 3T04D 1IJ9A 5E0QA 3N1QC 1YJDC 1T4KB 3VE0B 3CFKA 2LFGA 1FE8L 2QV2A 1H15A 3MV8B 2F53D 1MREL 4NQDD 1EHXA 2IADB 3KPSE 3MLRL 4G43B 4TULH 4YWGL 4G8FB 1JV5A 4HAGA 4XVSL 3VFOA 4L9DA 1U0QA 3T65A 2Y1VA 4HKBB 3MQIA 2O61B 4XBGA 2Y07L 3ES6B 3KPMB 5LKNA 5DFTA 1CLZH 2EYSB 2XKSA 4PG2A 5DRXA 4OZHF 1I7UA 4NQXB 1A9BB 4CADB 5DD3L 2ZSWB 3OKMB 4KHXL 5FO8A 4E41A 4GRWE 2C7UB 5H37H 1CU4L 3BJ91 3GMNA 1KJMA 4M6OL 1E28A 2GSGA 5F6HJ 3SGEI 1HDMA 5HYSA 2UUDH 4XPGH 3T77A 1LQSR 1VERA 1ZA6B 4OZ4B 2CDGA 4OV6F 1KCRH 1SJEB 3DXAB 3OKLA 4J4PC 3T3PF 2JJWA 1AC6A 1NSNH 3D2UD 4ETQB 2EE2A 4OCRL 4XNUL 3DIFA 2GI7A 3QWOB 3VFVA 3P30H 2NYYD 1BOYA 1TMCB 1P7QB 3HI1A 2EDJA 3IFNL 3QIUB 5IESH 3QH3A 3QXAA 3EO1B 4HUXA 1AO7B 2VDML 4J12A 1UB5A 2HH0H 2D7TL 3IFOA 4JRYE 3REWA 1SY6H 4PJ8C 4HFUL 1JNLH 3PABA 2GSIB 3IDJA 4NFBA 1FLTX 3BGMA 4XH2B 4I0CC 2Y72A 5DUPH 3MLXL 1UYWL 5FOJA 2YD2A 3O3BB 4WY7H 4HWUA 3WUWA 3F58H 5JW3L 2DAVA 4ZPTB 5IHBA 4H20L 2R2HB 2VMFA 2EDBA 3NABH 4PY8I 5JW4Q 4M4RA 4WHYG 5KAQG 1I4FB 1T7ZA 1WC7A 4Y4FA 5EZLB 1WBYB 4YUEL 4AENA 2VLKA 5DJXA 3K7UA 4P59L 5HI3C 2G5RA 3CFJB 2ZUWA 2W07A 1S9YB 2HT3C 5DJYB 5BRZE 5IMMA 2EDEA 5BMFL 1UCBH 3QHZL 2VZ1A 2C4FT 3DVNA 3HG1D 1PZUB 3JUZA 5E5UB 2DLFH 1LNUA 3OZ9H 2X05A 3VJ6A 1EX0A 2CRZA 1NANH 4HJGB 5DHXB 3SDAD 5KS9E 2W0PA 5TDNB 5IM7B 1S9WA 4OZHB 3CDCA 5FB8B 1UC6A 1AP2A 5F1KC 1PLGL 2OTUB 1P4LB 3BYTA 2CIIB 3T4YB 1HOCB 1FVEA 4NCDA 1EXUA 5E6YA 1FZOB 4RMUA 3DARA 2D3VA 3UYRL 2AV7B 5ILTL 4GRMA 3BRDA 1DVFD 3MLSH 1ZLUH 5H94A 3GBNL 1GYAA 5L88L 3MCKB 4HIXL 1CGYA 4PJ9C 1HNGA 1MIMH 4OCMC 2IFFH 1S7VA 5GS2H 1EDQA 1MRCH 1GH7A 4UIMB 1GVIA 2NTSP 2OM5A 2FL5B 4PJXE 3BP6B 3KPSD 3I02B 2OI9C 3MZGB 4FXKA 3CNKA 4FQQA 3O9WD 3AAZA 3W11D 4WWID 5TQ0L 4RGMB 1Z9MA 1XGUA 2DI9A 1NFKA 1A4KA 4MB5A 3C5JA 3MOQA 2YA1A 4FTVD 4Y0GA 4FXGA 5HHOE 5K93A 3MRBB 4BZ2L 4KQ4L 4D9LH 4CU7A 3QUXA 2X7LA 1AE6L 3SQBA 4PJ7F 3MRNA 1RK1B 3QQ9C 1EPFA 3V5KA 5GXBB 3TIDA 3FCTA 3MSPA 1P9MC 4M1DL 2ZG2A 4G6KL 4UV4H 4OD2B 3D25B 4RGNB 2VAJA 2NXZD 4R8WH 2XPGA 4IIQA 4IRJB 3QO1A 3QFJE 1NL0L 4CJ1A 4GBXC 1I1RA 3O2WL 3CFDA 3IAPA 1NQBA 1YNKL 5CZXD 3HFML 4KMLB 4C58B 5DMKA 1VPOH 5EOQH 3CXHJ 5AG8A 3LEXA 3B9DA 3HZMA 2C1OB 2GEEA 3Q3GA 4MQXD 1ZAGA 2FJFB 4ZMAT 5DUML 4F15C 3QUYD 4Z7NF 3HZKA 4KROC 3Q48A 4MCYA 1F4XL 4EBQL 2X4PA 2P47B 1RURH 3C6LC 4RMTA 5CINL 5DA0B 3S34L 4QT5A 1JN6B 3SDCB 5JIKA 1V7MH 1K3ZA 1YECL 5F1IA 2BXZA 1BP3B 3LB6C 1RY7B 1A3LH 3LKSA 5I75B 3WO4C 5SV3A 4PLOB 3TA3C 5DJAB 3JZ7A 4NHCH 4ZQKA 1J0KA 4O9HL 1G7HB 4YK4B 4P2OB 5B22A 2YA0A 3QG6A 4OGXH 2HKFH 2NY3B 4GKZA 5KSBF 1HK6A 3GIZL 5C0EA 5BRZD 4RAUB 3BDXA 5I0ZA 5DK0B 4WV1B 4QHKJ 3VG0H 1JPTH 1CXLA 4JDVB 1QPPA 4NKIL 4EIGB 3AM8A 3FQXA 1NFIB 1GGUA 4XWOC 3C8KB 4KPHL 4LEXL 4NUJA 1T20B 3ILPA 4UT7H 4YHNA 5EBMB 5IB2B 1HQRB 3O2VH 5DQ9A 1JPSH 2FB4L 4EKXA 3IF1B 4ZUTB 1M05A 2FJGB 1U8QA 1FAIH 4X7TB 1HI6A 4XNMA 5EFIB 2XZQL 2ARJQ 5DQDH 1CD0A 1G9NL 3FQRA 1K6QH 2P7TB 4KTDL 5GS0L 2N7AA 1HH9A 1MCEA 3IXAB 4PPTA 5CEYA 4Y19B 2B1AL 3SCMA 4GFTB 3WO3B 1PX3A 4FZ8L 2EEAA 4I0PA 3L1OL 6FABL 1T80A 4U1LB 3ROOA 1IGJB 1GZPB 2ZUXA 1DBKL 3H9SA 4JN1L 5TDOA 1CTOA 3GKWH 4NGHH 3R8BB 3GJFA 3DX7B 2YWZA 3WKML 4PTTB 3PGFH 1WEJL 5KAQF 1CFVH 5HHOD 1T7WA 3FN0H 4Q6YA 1I9RL 3I6LE 5GS0D 4Q7DA 2Q8BH 4XWGH 5I74B 1GGCH 1T22A 2BFVL 5BXFB 1U93A 4Q9RH 2WSKA 3C09B 1YDPA 3MUY1 3OX8B 4JHWL 3HZYA 1IGIL 3ORJA 3QFJD 1RJLB 3RBGA 3L9RA 4HW6A 2V6HA 2VDNH 2CMRL 5JXEC 4OZIE 3O4LD 5JOFA 4L3CB 4JCLA 4U3HA 5GHWL 1RFDL 3IDMB 4P49A 3MJ7B 5KBNC 32C2A 3Q5TA 4NUGH 1VEMA 2XKUA 4X0KB 4RMRA 5CJQL 1K8IA 5D1ZB 2I24N 4W4NA 4CDHA 5CEZH 3V6OE 2F5BL 2AJ3B 3RVWD 1D5BB 3DLQR 4U1JB 5IVZA 1AJ7L 3U1SL 3WNLA 5ESQB 5E6IA 1I1AA 2VJXA 4ZODA 3K4AA 1FO0A 3G6DL 3SGKC 1EGJH 1IEAA 5C2BL 2H26A 4BQBA 3DRTA 3MR9B 2A83A 1J8HA 1UXSA 4LCWE 3V6ZB 2X4RB 1I8LC 5F7YC 2IANE 3FFCB 4FP8H 4FQ1L 4WHYH 4HG4J 1U8HA 1EZVX 4NO5B 4GRLA 4Y5YA 1F6FB 1KIRB 4G6AC 3G6JA 5DJ0A 3VFTB 3LS4H 1EVTC 3S4SG 4XB8A 1FIGH 2YUWA 5JHLL 2R2EA 5EU7E 5C0DA 4NN7B 3O6LH 5DJZB 4YPGA 1AR2A 2IC2A 4Q2ZB 5DZOA 3C2SA 1E4KA 2KKQA 2Q7YA 4DTGH 4PB9L 2A77L 4LLYB 1MWAB 5CZKA 1IBGL 5C71A 4PJAF 2I07A 3E2HC 4O02L 9CGTA 1D9KC 5A16A 1DL7H 3MRDB 4HK0A 1U3HD 4LLDB 3AREA 4XMLL 2G60L 1FFNA 1ITCA 1NGWA 1TZIA 4JM2D 2BY0A 4GKNB 1NDMB 4JB9H 5IHUL 4D3CH 5I1CL 3INUH 5C8JB 5ISZE 3QUZB 1AD9A 3TBTB 4PJBB 2J5LC 3I3DA 1OAKH 1XGPB 1CE6A 5HGHA 1B0RB 2NY2B 5IP4A 2BMKB 5HYJB 2K7QA 4XXDA 1FL6A 3U2SA 4FQIL 1VKXA 4IMLB 4KKNA 5TE7H 4KZDL 4XHJC 1RHHB 5BVJB 3MBEB 2YD6A 2EDYA 3RTQA 4F7PA 1UWGL 3O2DL 3QDJB 3V0VA 4MQSB 2VQ1B 1PD6A 3G5ZA 4U4BA 1JWMA 3EYOB 3RWEA 1JGDB 2FEEL 1G7PB 3QIBA 3AFLA 3I6LD 4R7DA 4OUUA 3GSQB 5FDWB 3H3BC 2AQ2A 2YKLL 4JFQA 5I16B 1YNLH 1KJ2A 4MLSA 5EO9A 4ISVB 5IHZA 1JTOA 2P48B 4XPTH 2ZZUT 3Q6GL 3SBWA 4WO4D 4DZ8B 3QT2A 4M7JH 3T3MF 4DGIH 4Z9KB 2COQA 1NGXB 1GIGL 3UAJD 3ZTNH 1VESA 4BFBD 4UOW1 3WS3A 1WTGT 4K8RC 4LIQE 3HMXL 3HS0A 2VXSL 4F7TA 5CIPH 4WU7B 4HWNA 5DHYA 5CCKL 2JB6A 2VXVL 5T1MB 2HT2D 3DUUA 3CVHA 4MAYC 3NGBB 1G9MH 1X4XA 1RULL 1FNSH 4N0YL 3JV0A 3LKNB 3BUTA 4Y2DA 1YUHB 4GG6A 1CVSC 4ZUVB 1ZLVK 2AEPH 3MGAA 1B9ZA 2HFGL 3ELAT 4QF1A 1I9IH 1LO5B 4I18B 2B20A 3DYMA 1QHOA 4ONHB 4OIBA 4O4YH 5CIPB 2NLJB 1D5XA 2QSVA 4JO3H 3ARDB 4PGDB 3S88H 3EGSB 5FUOH 4UV7L 5F21B 4ERSL 3EFFB 3MRLA 4MNQA 3QEUB 2PUQT 4XPBL 2ZNWA 5DJ8A 3MO1B 4LSVH 4U7KA 3CIQA 5K9QI 4L9LC 3BGFC 2YZ8A 2BCKA 3TO4A 4DW2L 1LO4H 1OP3K 3NA9H 1T83C 1JWUA 1DE4B 4ZAKC 3SGEH 1NFDF 5I1JL 1AGCB 5JNYB 3ZDYE 3GFUA 2YEZB 3BD4A 4MNGE 3SJVB 1Q0YH 1PY9A 1GAFL 3SE9H 4RAHA 4YHMH 3V0WH 4MXQC 4DN4H 5C0BE 4P5TC 3P4LA 1CDGA 5BCAA 2OBGA 4IOIB 1E27A 1RZKH 4YHOH 1UM6H 1OGAD 5DRNA 2O5YH 4LLQA 4YAQA 2F19L 4RBPH 4X6CE 4MHHI 3HB3D 5CKGA 1QRNA 3VG9B 3VI4F 5ISZD 3GNML 3OPZL 4HQQL 5E7BA 4F9PC 1MIEL 4JY5H 1U95A 3QWRD 1BAFL 3BAEL 3MRJB 4O51B 5DYOB 1YJDH 3KPNB 2DIJA 3HE7C 5IEKB 3FRUA 1CFQA 4NT6A 5CJOH 1JRHL 1G9EA 4OQTL 1V3KA 2ADJA 3GBMH 4U7SA 5I17A 2ATKA 3DX9B 3WL9A 4TSBH 4U1KB 4F2MB 4LIQL 1AXSA 2NY4D 3O3AB 5GRUL 3HRPA 1V3JA 4G9DB 2BC4B 1FNGB 1EO8L 2F54B 3ZO0A 2GCYB 1CTNA 4NO0D 5IMOB 25C8H 3TJEH 1MHEB 4RDQG 3ULSA 4ETYA 4DVRH 5BZWA 2FR4A 1AGFA 2FECL 4GW1A 5C0IB 1NGPH 1FFOA 4P3CH 1NCAL 3ROLB 3N1FC 4I77L 4OLWL 4PJFA 5MENE 5IIEA 1S7SA 1ZMYA 2Z93B 3IFPA 4K7FB 2X1QA 4UQ3A 2AXJA 1J7VR 5E08L 2P49B 1WZ1H 3EDEA 4ONGL 43CAA 5DT1L 3PP3K 4PD4K 1KCLA 4M7KH 5I8CA 4B7LA 2OR8A 4GMTL 1R3JA 3QDMA 4MDJA 4HZAA 3BH9A 4KGJA 4ZSOA 1G7QB 2DQJL 4L8BA 5B39A 5GGTH 2E6PA 4H88H 4B53A 3KYMA 4X9BA 5DUBA 2ZP0T 5TE4H 1PVHA 1VENA 1OWWA 4P2RB 1MFEL 5IB4A 1E4XL 2NYYC 2VLRE 3N1GC 3QUMH 4XP4L 3OR6A 2XG4A 3RL1B 3PV6A 2VZVA 4QTHB 3GRWA 2Z8SA 3TNMA 1PFCA 1UFUA 3LHPH 5D2NE 3WS6A 1TLKA 2M26A 3ZKQD 3K80A 4PJ8B 5CGYC 3VWJA 3BO8A 3FQUA 3QFDA 1LDPL 1ZLSL 3GK8L 4ZNEA 3MJ8B 3I6GA 5IVXB 2EIZA 1WCBB 2EYTA 3QUMB 3BEWA 1ZT4A 5I73C 4UQ2A 5KVGH 4JQIL 5HY9A 2DQDH 1XF1A 3IB4A 3IKKA 3S4SB 5FCUH 5C0BD 1P6AB 3ULVE 1BGXH 4N8CL 1QR4A 4NDMA 1IE5A 4BSVB 3BDYL 3VFOB 3IRZA 3GMRB 4ZYKB 4D0BB 2FX8H 2NY5L 2DQIL 4O00A 3DBXB 4DK6A 4YE4H 1ORSA 1JVKA 4YHZH 5ICYA 4FQXA 5DQJA 3RPKA 1PKQB 5EORH 1I7UB 4MD0B 1T1XB 4HAFA 3BP5A 1S7TB 1NC2A 2R29L 1QUNA 3SDAC 5C6PB 1TETH 3KJ6L 3NMEA 3IFLL 4ENED 4PS4H 1ACYH 3OAYK 3IDNA 1MAMH 3NH7H 5E9DA 4UUJB 4JKLA 4HKJA 3OKLB 1UZ6F 3OJMB 1NCTA 1RUQL 5K9QG 1JHLL 3WJLA 1M4KA 4JG1L 1DVFC 3IRPX 4YHPB 2JJTC 4PJ9B 1IGYB 3OF6A 3K3QA 4Z7VE 1AFVL 4P23D 4LSRL 3OGCA 5GRJH 5TF0A 4Q9QL 3RHWK 3DYPA 2YPVH 2AJZB 3I50H 4HUXB 1A5FL 2OI9B 2L0DA 2HTLD 1ETZB 4Y8AA 3NZ8A 5HHMB 4XCCL 4OFPA 5MEND 3O9WC 4XP1L 3W11C 2EO1A 4QRUA 1TJHL 5CAYB 4NJ9L 1YEKL 5KVFL 1OY3B 5GGVY 1CLCA 2C3WA 3CFBB 2ENSA 1RZ7L 3HNTL 2WINA 3RWDB 2A38A 1RZ8A 1Q94A 1MVUA 4C4KO 3QQ3A 3SGJC 4HWEH 3C9NA 3UTSA 1ORQA 4GSDL 4R0LA 4K23H 1SYVA 3QNYB 4FFYH 2DQEL 3KS0H 4NFDA 3CDFA 3TV3H 5I1KH 2EC9T 3W0WE 5D6DA 5DJXB 1XGYH 3LKRB 2NXZC 3K2UH 5JIPA 4PUBH 4GBXB 3CSPA 3RZCD 4BQ6A 2ESVB 2IPTH 5I66A 4Y1AE 5CZXC 5E8OA 4J7RA 3AGVA 2D4DA 3S96A 1T89C 4MQXC 4F15B 4WW2C 3BWAA 3LSOA 5D5MB 3QUYC 4KROB 4LAQL 3KPPA 3C6LB 4GKSB 1HKLH 1U6AH 4H0GA 5C0CA 1F4YH 1D5MA 3HZVA 4QCIA 1IC5L 4GRMB 1Z9SA 1U8IB 3WFDL 5ACLA 3AMKA 4XPHL 2HFFA 4YR6B 1V7NL 4NQED 4XC3L 5JR1H 4YHLH 3WO4B 3WD5H 2C3GA 4DOHB 3OKOB 2GJ6E 3BKMH 1BBJB 2YWYA 5DC4B 3MJ9H 4Q9CA 5IW6A 2Y36H 4P57B 4F37K 2A9NH 1AQDA 4Y5XC 4M93C 3NAAH 5J12C 3AAZB 5KTEL 1TZGH 3HE6D 2HT4D 3G5YB 5EU6A 2VDKH 3TZVA 4AEIH 2CDEB 2EIBA 2CPCA 1CDYA 3CD4A 4N0RA 5GSRA 2ZCKH 5C86A 5KSAD 4XVTL 2V7NA 4KDTA 2M1KA 4QXGH 3CZFB 4HFWB 3FZUD 5L8LB 3V5KB 1K4CB 4JRXE 1BBDH 4PJDE 4HIEB 1SBBA 4JPKH 5EOTB 1EEZA 2LV4A 2HVKB 3A0OA 3OJDB 3VGEA 1TVHA 2X4SB 5FF6A 2LQRA 3DV6A 2D7QA 1HN1A 1KIQB 1OL0A 4I48B 2DWDA 2BRRL 5FOBB 3TGXA 3QXTA 5GZND 3G08B 3JV4B 1V3LA 3MJ6A 3T2PA 4YXKH 5M7QA 5C0AD 1N8ZA 4RMWA 4JKWA 3UPRA 3I6KA 2CDFB 3SY0A 5BQ7A 3KWWB 2J88H 2DF3A 1S7WB 2A73B 4FQCL 1X6LA 1K4DA 3E3QC 3OTTA 3MBXH 1G7MA 4Y16D 3ZKXB 4NQCB 4P46A 5KVDH 1UB6B 4PJHE 1YEEH 2ORBH 4QHNA 4WU5A 1UWXH 2CLRB 5E6ZA 3LKSB 4WIQA 4QXTB 1I7TA 3V6FA 2DD8L 1DQDL 4HUVA 5DTFA 1G9NC 3BKJL 4K71C 5GS0C 4XGZB 2MHAA 4JDZA 5ERWB 1OP5H 2UUDK 3HAEA 2WQ8A 5IHLB 1Z5LA 2ID5A 2B39A 2A6IA 4JQXC 5L6YH 1HHHA 4MDIA 2SEBA 3W0WD 2WWMD 1J0ZA 4JFFA 1NEZA 1T6VN 2GYSA 2R1XA 4PJCE 2K1MA 2A1WH 4AEHH 3OR7B 1HXYA 1IKFL 4Q6IA 4Z95H 3CXDH 2YD4A 2AGJL 4Y1AD 1OW0A 3F8UB 4LKXA 4Z78B 3BW9A 1XMWA 4OFVA 5I19L 3O6FA 4JGMA 4M4PA 3IU3A 1AIFA 3F7RA 5DD0H 4XNQB 1GRWA 1OAYH 1GCFA 1A0QL 3STLB 1R24B 2VDRH 2ICWI 5DLMH 4LPTA 3MREA 1DDHA 3MXWL 4QNPF 5E56A 3RVWC 5ESVA 5IV2B 3FB6A 3U6RA 3P11L 4JJ5B 4NZJA 2NY0C 1DUZA 4PJGE 2F8OA 4Y88A 1A4JB 1XZ0B 4JKMA 5C7XL 1KB5L 3BMVA 2XZCH 5ETUB 3D18B 1L0QA 2GTZA 2VLJE 4GS7C 4R90L 4R6UA 5EU4A 5LQBH 1QFWM 3DPBA 2GJ6D 4MNHB 2HN7A 1RIUL 3FB8A 3G6JF 3PGDA 4OZGE 4QYOA 1BF8A 4TUOB 4PRHA 1W0YT 3VFRA 3M8OH 2LE9A 4HBCL 1NGYA 2DQUH 3PP4L 5C09A 2HJFB 5HHVL 3BXNA 2BNUA 2B2XL 4RNRA 1A3RL 3O2DA 2ZUUA 3MMEA 5EZOH 4QHLB 4IHOB 5DEGA 5I1EH 5HGAB 4OFYA 5EN2B 4Z7UA 2FJHA 5HDQH 1RK0B 4JRXD 2AK4A 3E2HB 3P4MB 1D9KB 3N85L 4P9ML 4YFLI 5C08E 3RQ3A 4LFHD 3OAZH 4ALAL 2JJSA 5GGTA 3TWCL 1U3HC 4XC1H 1Z2KA 1HHGA 2X4NA 2OL3L 2IBBA 5IG7A 4YIQA 3P73B 1QFUL 2IWGA 2BSRB 1BQHG 1WVZA 4JM2C 4NC1E 4R3SA 1Q9OB 3ZDXF 3LS5L 5GGSA 2WBJD 2J5LB 4OD3L 2O5XL 1I9EA 1RUAL 3MV01 1MQKH 1INEL 5AZ2H 1ADQH 4K7PL 3K74B 1FYTA 2CXKA 2ZG1A 3FRPA 5L2JA 2AJVH 4JPVH 3CSYA 1PEWA 3KLAA 1DBAH 2ZUVA 1MQ8A 4HSQA 5J7CC 5EBWB 4PRBB 4G9FB 3V4PL 3K8MA 2APBA 1IEAB 2YOCA 5T3ZL 2PYEE 2YD1A 3NN8A 2KZWA 4K8RH 1LD9B 1F2XK 3BE1L 4XNYL 1P1ZB 4JDTL 4KUCF 1FBIL 1XAUA 1WBXA 1A7NL 1TZHA 2JCCA 4FFZL 4HWBL 3D3VA 5I9QC 4G6JH 4WO4C 4XVJH 3V5DB 1KC5L 4HC1H 4AIOA 2UZIL 2VSCA 3UAJC 1FNEB 1FFPB 4HKXA 2YXMA 5CBEB 3MCLL 5FO9A 3G5XB 1J1PL 1MCDA 2BK8A 2FSEA 4HUKB 3RGVA 2ZPKL 2RBLA 4HXBH 4KKBD 5HHXL 5F9DC 1OPGH 4HPYL 3GMPB 3EJJX 1QVOB 3CLFH 1S7RA 4GG6F 2HT2C 2R0ZL 1H3UA 4G7VL 4GAGL 2Z0BA 1ZVYA 5INCB 5F7HA 4JREC 1MJUL 2JIXB 1NBYA 3A67H 3H6JA 1GOHA 1MF2H 1Y6NR 1CK0H 3NCFB 1A8JH 4MJIA 3V6OC 2GAZB 3RU8L 4LPYA 2DQHL 3B5GA 1BREA 4POUB 4BZ1H 4C56E 4FZEH 5K9KB 2DTML 4K3EH 1FGVL 3MTRA 5IJKC 3X17A 2P46B 3QUKA 3T0DA 2I9TB 3L5HA 5D7LB 3H9HA 1J0HA 4MS8D 5I76A 4ELMA 3B6SB 3U7AA 4CJ0A 3RWCA 1IEHA 2ED7A 3HI6L 4ZFOL 4G6ML 1OD9A 1U8MA 4BUGA 2RCSL 4GAJL 4L9LB 1OSPL 2H2PD 3BGFB 2NW2A 3TESA 1J87A 3W2DL 2VOTA 4JFDB 2NX5B 3KPRA 2FO4B 5HPMA 3X12A 5EZIL 5TQ2H 5GISL 4U1HB 4BQ8A 3ULUF 1WICA 1J1OH 3QRGH 4WTXA 3ZLQC 3U9PH 5EU7C 3WNPA 1KIPA 1OAUH 2PW2A 1MFCL 4JFQB 3BKYL 1MI5D 2OSLB 1X7QA 3ARRA 4P5TB 3GHBH 4F58H 5C08D 3LQMA 5I1AB 3EYVA 1UZ8B 4LNRB 4PV9B 5B38A 4Z7WB 4XPAH 2MJWA 1EEYB 3JTTB 1N6VA 2QR0A 2IMMA 3HB3C 5FHBH 2YD8A 4JFXA 5EUKA 4U1SB 2EDOA 1NUFA 4PLJD 5DHYB 1C12B 3NFPB 4LCYA 3ZT7A 2EEBA 1BD2A 4HLJA 4PB0L 2BXYA 1Q9KB 3MV9B 3C2AH 5L2KA 2DS4A 2BVPA 2Q86A 3HE7B 4N0CD 1HILA 2VABB 4EDWL 4GG6B 1P5VA 2CJUL 3L3IB 1JYVA 3H2WA 2C1PB 3VFUA 3TFKD 1HEZB 1QFWL 2ITDB 3MNZB 3UJTL 4YDVA 5C07B 3MYJA 2NY4C 2PYED 1DQLL 3ZMRA 2VDOH 5IB3A 4JAMA 2UWEE 3ULUH 1WT5C 4LEOB 3RWFB 4AQOA 2R8SH 3AB0C 4MA8L 5ID1A 4XVUD 4PJFF 4HIIB 2F53B 3BP4A 4PFEA 2D7PA 2RIKA 1FE8H 4NQDB 3SE8L 1Z6JT 4F33A 2G75A 1ZGLP 2CIKB 3EYSH 3VDBA 4J8RA 2YD9A 3FQNB 4JFEA 5T1KA 1XF5A 4MQTB 3GMQB 1HHKB 1A1MB 1TTUA 2UV3A 2AEQL 1XCQA 1L7TH 2Y07H 1JZ7A 4CBPA 4I2XB 1IQDA 1CDCA 2H3NB 4D9RE 2E7CA 5E94A 4X8XA 1YPZE 5DD3H 4L3EA 4KHXH 3VXSA 2E9WA 5F7NC 1S8DA 2XKNA 1HSAA 4ZO9A 3GSRB 4C56D 4MA7L 4Q0XL 3D2UB 5AWNL 5JO5A 4LSQL 1MCWM 2QBWA 4MXVF 3OMZA 1RU9L 2GJZA 4UILL 4HJJH 4OCRH 5FUZL 4XNUH 3TCLB 2ZWLT 5E2VL 4PJEB 3PWVA 3MV7B 1CFQB 2XZAL 5J6GA 5CEXA 5FYKE 2DM3A 4W6WB 4J3UA 4M1GH 1ZVSA 4NJAL 2G9HA 2J6EA 1FVCA 5IOPB 4MCZA 4QRTB 2HLAA 2ZUYA 1AXSB 3TEUA 2AJSL 4HZLA 2VDMH 1AKJD 4HS6B 3O11B 2Q87A 4AZ8A 3FOMA 3S5LA 2FGWH 4HFUH 5I73B 5I1IL 1XGQB 2OP4L 3CDYA 5I2IA 2EKSA 3UDWA 3MLXH 2BNRA 1UYWH 2WMPA 1T3FA 3WFCH 4WUUA 2X9XA 5JW3H 1I8KA 4CAGA 3MLTB 1QSFD 3HAEG 1HHJA 4I3SL 4D0DB 3GO1H 1GGBL 1PKOA 2BOCA 1U8PA 2VZUA 2X44D 4YUEH 4MJ6A 5DJ2B 3BWUC 43CAB 3LEYL 3R1GL 4AJ0A 1NEZG 2P8LB 4V1DE 3QHZH 2VLLA 2BVQA 2B4CL 4H26A 3SDAB 3U7WL 3SKJH 3EO0A 3WEXB 1B6DA 1BQHB 4U6XA 3LN4B 4ZSOB 4I8DA 3RIFK 5CJ8A 3VXNA 4ENEC 1C5BH 4HIHB 2XV6B 2GTWA 3QJFA 1ACZA 4PR5A 4UDTA 5EG6C 1EO5A 5TPWL 1E6JL 2VL5A 1UACL 2ZOLB 1PLGH 2NNAA 1ZLWH 2Q76A 1DVFB 4P99A 1U92B 3UXFA 1MLCB 1DLFL 1IZJA 3VFPB 1Y18B 4Z0XB 3C5SA 3IKCB 3UZEA 1EA9C 3KHOA 4ODUA 4BSWB 3HC0B 4P23C 4HIXH 5L7XL 3PV6B 3VXME 4P4KA 1BJ1H 4PTUB 4JG0L 3TNMB 3U4BL 4G7YL 3KPSB 4LBEB 2HTLC 1F90L 3D85A 3O9WB 4XAKE 4AY0A 3NCBB 4OF7A 1ZA3B 3S6CA 4PJIA 4Y5VC 3MJGX 4IRSA 1H3TA 5JQHC 4FTVB 2EYTB 2G5BA 3WIHL 2B1HH 4OJFL 5D93C 5JDJA 3SE4A 4U1IA 4DN3H 4Z7OF 1H5BC 1XIWA 3P4NA 4BZ2H 1ZVHA 1FDLL 1AE6H 2DYPB 4XBPB 4D9RD 4I4WA 4OZHE 4KXZI 4XXCA 4XT1C 4YZFF 1OLLA 1MCIA 2X70B 4V2BA 4X7SL 4WEBH 4ZPVA 2NXZB 4HK3N 3NTCL 3MUGA 4G6KH 3FT2B 2WQRA 3RRQA 3SDDD 3RZCC 3O45A 4H0IA 5IB1B 1NL0H 1YEFL 3NIDF 5CP3H 2P5WA 3T3PE 2KPNA 1AGEB 3O2WH 3DO7B 3LIZH 3HFMH 4QRRA 3I9GL 2I9LA 4WW2B 3VMOA 4BH8A 4KV5F 4IRZH 4WCYL 2CUMA 1SJHA 3BIKA 1VHPA 3QUYB 3TPUB 5FYKD 3VXTA 3PWUB 2DRUA 1K5NA 3PXHA 3FJTA 1WTLA 4JPIB 1C7SA 4LLMB 1G7JB 1UEMA 1ZOXA 3DRQA 3IVKA 4MJ2A 4EBQH 1F4XH 5HHQA 4HPOL 2HG5B 4LSPL 4RA3A 1CG9A 5CINH 1T04B 3S34H 3IGAB 1TNNA 2YRPA 1YECH 1IGCL 3QHFH 5CSZA 1OLZA 5GS1C 3RA7L 1R6VA 3RDTD 4HT1L 4Y5XB 4JY6B 4KI1A 3RNKB 4X4ZA 5GRWA 4XCFH 3MXVL 5J12B 3BPCB 4X4ME 4WWKD 2DQCL 4KI5F 3HE6C 5K9OA 1KJ3H 2GY7B 1OARH 2QSCL 4L4TB 5D71L 2HT4C 5D1XA 1S9VA 5F7WC 4S1RH 5D6CA 5F7FA 3V7AG 2PO6A 2RFXB 5BRZB 1M71B 3BHBA 1S7QB 5KSAC 1LILA 2VDQL 1OAQL 4V1DD 2DM7A 3FZUC 3MACL 1IVLA 2OJEA 3IETB 4R0LB 3VD7A 3JUYA 1XR9B 1X5AA 4HLZG 3EDDA 4NKIH 5B8CC 3QIUD 2R1WB 5DMGD 1FHGA 1X4ZA 2ICWB 2YPKB 1CGXA 3VXPA 4KPHH 4LEXH 2V17L 4ZAKA 5TE6H 1HH6A 2R0KL 2XQBL 5KSVB 3BZEA 5GZNC 5E8OB 1JNHA 4XRCB 3VH8A 7FABL 2IF7A 3KLSA 3OHXA 1F58L 3PDGA 4X6EA 2NY1D 2XZQH 2NTFA 3BUYA 1DLHA 4GW5B 4F57H 1G9NH 5GS0H 1CD1B 3VXMD 1PEZA 3PWPA 4OI7A 2B1AH 4K2UL 4QXUL 3TN0A 5FECA 1CLOH 2DMCA 2HRLA 4FZ8H 4XAKD 3HNSL 5EUOB 1EFQA 4Y16C 3T0EA 4L5FH 5TGBA 2D03H 1JZ6A 4DQOH 1DBKH 3EOYG 3CSBA 3T2OA 1CFSB 5HHOB 1KB5A 4XX1G 4OGYL 3MUHL 2Z4QA 2D9QB 2RQ8A 1I9RH 3B9KA 1F8TL 5T5FL 4QKXB 1ZGLM 3KDMB 2W9EL 3B43A 4PJ7E 1ZHBA 3Q2CA 3LRSB 4LLUA 1T0NA 1QQDA 2Q8AL 3VFSA 2WWMC 1KENL 2FATL 1QYGL 2WUCL 2O93L 5GSRB 4RRPA 4JHWH 2DQFA 1YYLL 2XI9A 2V7NB 1IGIH 4NRZB 5T1LA 1Y0LA 1RZJL 3O4LB 3PWNB 4QEGA 5CJXA 1FSKC 5IBUG 1U8LB 2CMRH 3CU1A 5IR1B 5BJTB 4KWUA 5I1LA 2RAMA 5EA0L 4ZDHA 4K3JL 2XWJA 4RFEB 5HGDA 1P7KB 3Q5YA 3SPVB 2VZ3A 4APQA 1Z9LA 4J23A 1Z3GL 1R3KB 2NY0B 3MRRB 2OL3A 4Z7NE 5JLZA 2F5BH 3BEVA 1EEQA 1KJVA 1VSCA 1ZV5A 1AJ7H 3U1SH 1S9XB 4OCXH 5DJDA 4WEMB 4GS7B 5FCSH 3A6BL 5C2BH 5BQ7B 4DKFL 3FO2A 4MX7B 5HDBF 4X6FB 4YDLB 3KG5A 5AAWA 1KCSH 3EYFB 4JGJA 4YFEA 3QEQD 4TTDD 3SKOB 5GJTL 5BOPA 3GI8L 2RHEA 3D0VB 3D39E 1BEYH 4G80B 3C60A 4QHNB 3ZKSD 5JHDA 4Z7UF 2EDNA 4L8SC 1ZSDB 4Q97A 1I7TB 4PGEB 5KSBE 1WF5A 4YGVB 3X11B 2A6KB 3LKQA 3EYUL 1FCGA 1DFBL 5KOMC 1XF3B 5E2TL 5SV4A 1YYML 4PB9H 5I71B 2A77H 3WDIA 4JZNB 3MUZ1 3RX7A 5I8EB 4NP4L 2A6IB 2QSTA 3ZE2F 4O02H 1ZT1B 4JEGB 1NLDH 4HWBA 1ED3A 2W0FA 4U6VL 4XMLH 2DN7A 4LMQE 5DD6A 3PWLA 2CQVA 1JK8A 3R06B 3Q1SL 2J8UB 4CMMB 4BH7B 3L5WB 5IHUH 3WHE1 1VFMA 4RMSA 5I1CH 4R4BB 1CVRA 5D9SB 3VFMB 4N0FB 4TSCH 4U1GC 2NW3B 2EDKA 3FFCE 5E00A 3OKNA 3N1PC 4NSKA 4M61B 1MFAL 4FQIH 3GB7A 4K7PX 4MMXC 2BSSB 4NHUA 4XAWH 4L4VA 2BVTA 3HNVL 4ODBD 2E6JA 1BFVL 2IPKA 1LEKB 1I7ZA 2LVEA 3ZYZA 4WW1A 1UH4A 2JCCF 3EZ8A 4Q9BA 2HN7B 3FT4A 1AHWA 2R56H 4I5BA 3W39B 1RJCA 4DVBA 1ZEAH 2XXMB 1UVQB 2YKLH 3IS1X 3WLBA 4WO4B 2HVJB 2IH1A 5F1SA 3GUTA 2Y23A 3O41B 2QQLH 4CU8A 1D5ZA 1M6OB 5MEQB 1GIGH 1MOEA 4ZUUA 3X14B 3QNXA 1KXQE 2ZCHL 2VXQH 3BISA 2R69L 1ZWIB 4RMVA 4TQEL 3CH1B 1SVZA 4KVCH 4OZIB 4KKBC 5J13B 2Z31D 4FHBD 1T5XB 3UTQB 1N0LA 3HMXH 2DIAA 1NAML 4W68A 4FQHB 1OSZA 5AD0A 5CCKH 1N2RA 2VN4A 4M7LL 4X5XA 1X5YA 4JREB 4ELKB 1E0OB 2EZ0D 1PYWB 1N5AA 4OKVB 1OTUD 3OWEA 4Y2OA 4OZFG 5IG7B 2WUBL 4N0YH 1OGTB 3H7BB 4F7CA 1D6EB 4PGBA 1JHTB 2YSSA 3VFWB 2V2WB 4P2YA 5E2UL 4ELMF 5EO1A 4PP2B 3I2CL 3QIWA 4KDWA 2B5IC 5JMOC 5GRVK 4MS8C 4OF8A 1P2CA 3CFEB 1HHIB 3DX8B 1DEEA 3CCHB 5MEPB 5FGBC 4YH6A 1IZKA 1AD0A 1TITA 4UV7H 3F12A 1JGEB 4ERSH 2QHRH 1YQ2A 1T1WB 2H2PC 4XPBH 2V2XB 4V2CB 1V3MA 2VXUL 4N0UA 1RZFH 3UBXA 2FEDD 5DWUL 3D39D 4DW2H 1TTFA 2XACC 4HH9B 1QBLL 3QG7L 4JFYB 2PTTA 2D0HA 1XCTA 2FYYA 4JKPL 3NPSC 4LVOC 3VCLB 4HLZH 2IG2H 5F9AC 5FYLL 1L0XA 2H2SD 2BHZA 3U36A 1MFDH 4PJAE 1OGAB 5D1ZD 3OB0H 2ENYA 4TNWF 1IAOB 3WXVH 5FO9B 3H9ZA 4JRYA 3O6MH 4NC1C 2IBZX 3K81A 3SDXA 4JHBA 2HAZA 4XNXH 5ISZB 4OT1H 2QJDA 1Q72L 4PLJC 1P69B 1KEMH 3BQUD 3B9VA 1VACB 3KYKL 5ICZB 3OPZH 1MIEH 3MRGB 4MMZC 1J86A 5AZEL 3FFCD 1BAFH 3BAEH 4S10A 4N0CC 3IDGA 1NGQL 2HKHL 1UWXK 4UT6H 4QOKE 3LQAC 4JQVA 4KJYB 2X89A 5FXCH 4OQTH 3TFKC 2VR4A 2NY4B 8FABA 2EDWA 3GSNA 1OP5K 3BJLA 5J1TC 4LIQH 1MCFA 4NO0B 5GRUH 2XNAA 2I5YL 3AB0B 5BZDB 3REVA 1EO8H 4UTAL 4F7EA 4WJ5A 2QQNL 4XVUC 2OR9L 1FRGH 4H8WC 4QHMB 3WNKA 4MD5B 3T08A 1M7IA 3QDGE 2ZJSL 2VC2L 1ZS8A 2JJVA 4RGOL 1NCAH 3T3ME 4I77H 5C3LD 4OLWH 2EDDA 3G6AA 3Q6FB 4ZTPL 2XXCB 3L3JA 2NZ9D 1OD7A 3L95B 5E08H 1MRFH 3O3UN 1C7TA 2GK0B 2ILLA 4JCMA 4ONGH 1LK3L 3UTTA 5DT1H 3E6FA 4WHCA 4GMTH 1E4JA 4PJXA 1LP9A 3HUJA 3DTXB 1CICB 5DDHA 2APTA 4EI6B 4WTWA 1MAJA 2DQJH 3HI5L 5IBUB 1JIBA 4PBXA 5EUKB 4MB4A 3BPOC 1ZANL 2Z8RA 4LGRB 4OCYL 4YXHL 3FO0L 3CK0H 2EH8H 5I0DA 1QACA 2F74B 4EJ1C 5E1AA 2F54E 4B41A 5L2KB 2APFA 5FK9B 1ZXQA 3WNNA 1ERNA 3VH8G 2BDNL 5TF1H 2F5AL 1MFEH 3LKOA 2FIKA 5I1GL 4XP4H 2FD6H 1A22B 1HZHL 3F65A 5MEOB 5IVNA 5IJVB 3L5XL 3KYNA 1MELA 3BZFA 3HPLB 4KXZH 3KXFE 4YDVB 2KBGA 3O8XA 2BVOB 1T66D 4PRPA 4JZJA 4HUWB 4HCRL 2BNQA 5DC9B 2IAMA 4B5EA 1LDPH 2BJML 1ZLSH 4GAYA 1NFDE 4MNGB 3PJSA 1LK2B 3E6HB 3K4ZA 3OAZK 1QPXA 3MYZA 1QLRB 1W0WB 1WCQA 5EC1B 2H6PA 2IQ9L 1YEHH 5C0BB 2LABA 1MUJA 4JQIH 2K3TA 1G7IA 2P8MA 2QKIA 5F7EL 3DURA 3BDYH 5ALBH 3KPLB 5HPOA 4TYUA 4KK9C 2XN9E 5A2LH 2NY5H 2DQIH 3BH8A 3U0TB 3SDYL 4P2RE 1AQKL 3VI4E 1UM4H 2OZ4H 1BVLB 3LV3A 2I60H 4M48L 4CKVX 5DI8A 2R29H 1KPRA 2V7HB 5IBTL 5E1HB 2WBKA 4MD4A 2E8YA 4QOKD 4P5KB 1Q9WA 2J1KA 1LO0L 5LWYL 1RZIB 1NBVH 5D70L 5IVXE 3VXQA 4KJQD 1JHLH 4M9PA 3FONB 5SX5H 4OM1H 2VNCA 1A1NA 3ARFD 4P23B 3PWVB 2B4CC 2B0SL 1U3HA 5HYFA 1AFVH 2BSTB 1ZVSB 4LSRH 2FWOA 5D2LA 4OCSL 4PJIF 4Q9QH 35C8L 5IKCA 1DSFL 4MWFA 3QDGD 5MENB 4YNYA 1NLBL 4M6AA 4Y5VB 3M07A 4POZD 1NJ9A 4XCCH 4DZBB 3FQTA 1M7DA 5D93B 5GSVA 4U1MB 1YEKH 5KVFH 1S7UA 5FKPB 1T03L 3QJHB 1H5BB 2ITCA 4LHQB 3HNTH 4E41E 2ZSVA 4OZFH 3F5WA 1I8KB 1W72L 1I85C 5ICXA 4E5XA 2DQEH 3DSFL 3ARGD 1JMXA 1GZQA 3RZCB 4ACPA 4PD4J 3SDDC 1DBJL 3TVMD 1IGFL 2VH5L 3ZTJG 1YMHA 1FVDA 5GGVL 4X8JB 4L1DA 1QA9A 2H8PB 4C59B 3J8F7 2F54D 4JFHE 4OZFB 2EYRA 4WEUD 3KNBA 2F8VA 2P24A 4S2SB 1IGML 4PR5B 4UDTB 3ESUF 4HS8L 1G6RL 1EMTL 3MFFB 4U3CA 2EE6A 1UXWA 1EUTA 2NNAB 3LCYA 3KXFD 4LAQH 1B4JH 2Q76B 2YBRB 3VWKA 1L6ZA 4JRWA 5SWZA 1VFAA 2VE6A 2C3XA 1IC5H 4OCWL 1F5WA 1MCPL 4NQEB 3QULB 4KHTL 4TTGA 4TRPH 5GS1B 3I75A 4HDIB 4XPHH 1V7NH 4XC3H 4L8CB 3FO9B 4M43L 3DGCR 3RDTC 3GMOB 3SE3A 3BPLC 3FT3B 2H32A 3OKEB 2ZUQC 3HE6B 2MPAL 3BP7B 4WWKC 3DECA 4UU9B 3SQOH 4C83A 5KTEH 3U46B 1IKNA 4B7IA 3TYFA 4CVZA 2XN9D 5KSAB 1T2XA 4ZFFB 4GW4A 3UTOA 5CP7A 3KYOA 4LCWA 4ZFZB 5C6TL 2ADIA 3H7LA 1YC8A 1H3GA 2IANA 2CLVA 1KG0B 4KTEL 4F80A 5EULV 1BF2A 5A2JH 4MSWB 3H3PL 3P0VH 2AJYL 3UCRA 2BOBB 5KZCB 3MLVL 3VRIB 3WSQH 3IDIA 5D7IB 3CX2A 4HGWB 4BZYA 3QXWA 3T0XA 2YUZA 3L3GB 1CFBA 3F7YB 5JMRA 1UZ6E 5C0AB 3WMSA 3OXSB 2NY1C 3ARSA 4DOHE 4JHAL 1F4WL 2D7NA 4AIZB 4IS6A 3M1BA 5H2BA 2Z91B 5GRXG 3QZWB 2DICA 2FHCA 2X09A 2ADGB 3ARUA 1CF8H 3DRQB 2VO5A 4PYGA 5F3HA 5HHQB 1GHFL 3NFNB 2W9DL 3MRFB 1O7VA 3M17B 2ZCLL 5DEFB 3UBXG 3NZHH 2AQ3A 1RSFA 3CU7A 1HWHB 3RVTD 2YD3A 3U79A 1S9KC 4YDJA 3W5NA 1FV1A 5B3NA 2DD8H 1L9MA 3ET9F 1NCBL 3DX6A 4ODTL 4E41D 3BKJH 4WDIA 3C6SA 1QLEL 4G8IB 5GGRY 2EICA 5JA8B 4HULB 3MGTA 3QEGL 5TFSL 2GT9A 3FB7A 1CDJA 5IVOA 1HWGB 4Z76A 1XR8A 5F89A 4F9LA 4R7NA 3AXLA 4NYLB 4WUKL 1JPFA 3ARVA 5IWLC 1WZLA 3MRQA 5DC0A 1QSVA 1FSKB 1WT5A 3RPIB 2VZSA 5L9DL 3DGGB 1IKFH 4JFHD 5DJCB 3C08L 4XP9L 2PW1A 1F3JB 5I19H 1RVFH 2QLVB 1FGNH 3DUHA 5DO2D 2D7MA 1NBZA 2CR6A 3RWJA 5C0GB 1T1YA 4RWYL 1A0QH 5EU5A 4M00A 1EZVY 3MA7B 3CMOH 1IC4L 5DRZA 3MXWH 3HR5A 4RGMC 3D0LB 4HD9A 4WI6A 5JPNA 4D9QE 3P11H 4EQ3A 2P4AB 1J88A 5SWSA 1TVBB 3DJ9A 4QRSB 1RZJC 5C7XH 5FO7A 3VMNA 2D9CA 5IB5B 4NRXA 1KLUB 1BFSA 4WNQA 4R90H 2GW5A 4S1QL 1UJ3A 3VFNB 1QSEA 4MLIA 1XGRB 3VXRB 4TTDC 4Y4FD 5TGBB 4KC3B 2VLKD 4WGVB 1JNNL 2JB5L 3S35L 5JUEH 2DI7A 3K2MC 4HBCH 3PQYA 4JN2B 4PBWD 4PGCB 5ABDE 4L8SB 5HHVH 1WIPA 1IAIM 1B0GA 2B2XH 3U30C 1DN2A 1JYWA 4YQXH 4ZO6A 1GGYA 3IJSA 4N1EA 1IAKB 5J3HD 1C8PA 5JDSB 1YY9C 1N0XL 4JRXB 1EH9A 5C6WH 3O3DB 1P5UA 2DJUA 3MGOB 2R4RL 4JVPA 2AXGA 5EZJB 1CXHA 3N85H 4R4ND 1A14H 5JORB 1IEBB 5EU3A 4KKCD 4JPWL 1ZLWK 4ALAH 1TVDA 1R5IA 3TWCH 1FYHB 1XH3B 1BFOA 1CFNB 1G0YR 4KH2A 1JWSA 5GGUA 4QLRA 5EOCJ 4O2EA 1QFUH 3LB6D 2ATPB 3JWOL 1DBML 5IK3B 4X6BA 4NKMB 4RISL 5EBLA 4OD3H 5I1LB 5MP6L 2O5XH 4U1GB 5IMLA 2FX7L 1INEH 5KVEL 1G84A 4K7PH 4DFIA 4FQ2L 5EIVA 3U4EA 2ICEA 3H9SE 3HKFA 4XPFL 4J3VA 4NKQB 4X6CA 1N3NB 1IT9H 3CVIL 3WXWH 3O3EA 1YEDA 3GSXB 1OP3H 4YLQT 3V4PH 1EHLH 3QUXD 3V5HB 2ARJA 1HINL 3MRCA 4LQFL 1QLFA 3SEPA 4LSDA 3LPWA 1MLBA 4JDTH 4X7DC 5E8NA 1FBIH 3H8NA 4CNIB 4P2QA 1A7NH 2CLZB 1CI5A 1ITBB 4FFZH 4MQ7A 2YMXH 5HHNA 1BX2B 4RWHA 1T21B 5C0JA 4FXLA 3ZTJH 2MKLC 2P8PB 3RNQA 4PJCB 3EBAA 3MRMB 1N4XL 2X40A 4NBZB 4BFIA 1PZ5A 2R0WL 3U7YL 3W9DB 2FLRT 1FN4A 1EO7A 4HKZA 2Z31C 3THML 3QBTB 5E5MA 3GDBA 4BELD 3BZ4B 5HHXH 4HPYH 5F96L 1OB1A 1WBZA 1JUFA 3OB8A 4OAWB 1FZJB 1MRDH 2BY3A 2OLDA 2Z8WC 3OBAA 2EZ0C 4NN6C 3C5ZA 2OS7A 4G7VH 3FTGA 4YHKL 3VGDA 3AS1A 4Y4HA 4N8VG 1OTUC 1OQOA 2MCPL 4HUUB 5KSUA 1XF2B 1MJUH 4PG9B 1ZHLB 1YC7A 5J9PA 1FORL 1ES0B 2CKBH 4NQTA 2Y06H 4PJGB 4QNPE 2K7PA 2D31A 4D9QD 8CGTA 2B5IB 2CH8A 3D48R 1F13A 3W9EB 1KPUA 4GRWF 1FGVH 1J8HE 1E6OL 3WDHA 1DEDA 3E8UH 1CBVH 4ZUSA 5AG9A 3OKNB 4OZGB 2DWEA 5EIIB 3GB7B 3HI6H 3OJVC 4G6MH 4W70A 4LU5L 3G6JE 4GAJH 3C09C 2CKBB 4WTZG 1OSPH 1PAMA 3RFZC 3LH2L 3W2DH 4M5YL 2FEDC 1KEGL 1BLNB 2XWTB 4P4RA 3U48A 5EZIH 5GISH 1LE5A 3ARBA 2AEIT 2WWKT 5IBLD 1LE9B 3D9AL 3NPSB 4LVOB 1A1OB 1MI5B 4AT6B 2Y25A 1R3IH 4JO4H 4PRNA 2VLRA 4ZFOB 3HC4H 2Z92A 3B2UD 5C08B 1A9EB 2BSED 3S3JA 3BKYH 3WLBB 3F7VA 2H2SC 4DJMA 2EDRA 4YBLC 3MNWA 1I3UA 1UWEL 4QRQA 5BVPH 3JVGC 5HYQA 2E6QA 5D2NA 5CHNA 1ZK9A 2X10A 1GGTA 5AYUL 4JO1H 3SDXF 3LQAH 2XWBB 2D2OA 1KCVL 4NWTL 2R1YA 4NM4L 5D7LE 2VDPH 2XRAL 3RI5F 4ODHL 5DMYA 3WCYA 3GSUB 3BQUC 1EFXA 3B4NA 3SCMD 4KY1L 3DV4B 1V5JA 4I0PD 4OI9A 4PB0H 2Q6WB 5E8PA 4QRPA 3GSOB 3GJEB 4EDWH 3H9SD 4KK6D 3IJYA 5F7DB 3NVQA 2NY7L 5T1DL 1SBSL 5E2WL 1G7LA 2PYEB 1QFWH 4KQ3L 3UJTH 1R0AL 2JK5B 1P2CB 3P9LA 5EOCL 4LAJH 1DQLH 2X4QA 1RIVL 3E1F1 3CAFA 3VGGA 5C9JA 3L3KA 3IXTA 1ZT7B 1F6AA 1NC4A 2D0FA 1IAIL 1NCWL 3WJJC 1NMAL 2CGRL 1DBBL 4MA8H 4JZOA 4N5ED 3EOAB 1I7RA 1JNJA 4LLWB 2VKXA 3TBWB 3I85A 3SE8H 3NFSH 4Z7WE 5BO1H 1FPTH 3LQZB 1FO0L 3LAFA 2NZ9C 3ARQA 4HCRA 3L7FB 4J1UB 5DR5L 1BZ7A 4JGUA 2MOVA 4N9OB 3U9UA 4PJXF 4Z7VA 3S37X 3HUJF 1LP9F 1NKOA 3PNWB 2I26N 2AEQH 3MV9E 3T1FB 3U36B 1KTDB 1KGCE 1QFOA 1YY8B 4E42B 2FZ3B 4NKDA 3LVEA 1MHCA 3K8LA 4RAVB 5J8OA 4GG6E 1LGVA 5E95B 4ODXA 4LCCC 2C26A 3HRZA 4OLEA 4LMQI 5E6ID 3T4AB 4OI8A 1I1AD 4C56B 1CLYH 1CLZL 3BPOB 4G8EB 3SDXB 4HV8A 1B0WA 4P5MA 4MA7H 4Q0XH 5CWSA 1J8HD 5AWNH 2YN3A 4MNQE 2XY1A 4ONFL 2EH7H 3DWTA 4LSQH 4NPYA 5GRYA 3QO0A 5KG9B 1RIHL 4NKOA 1RU9H 3IDGB 4UILH 1DQQA 2F53E 4GRLD 4RFOH 2XA8L 5FUZH 5D7JA 5J6HA 3TBVA 3WFHB 3ZE1F 1IGTA 2XZAH 4H5SA 5ACMA 3CPLA 5IFJB 4NJAH 3WHXB 1AKJB 1A02N 1NBQA 1T66C 3LKPA 5DMIL 3L7EB 3ULUE 2AJSH