4F57H

Fab structure of a neutralizing antibody l1 from an early subtype a hiv-1 infected patient
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
225
structure length
225
Chain Sequence
EVQLVESGGGVVQPGGSLRLSCVASGFSFSDFGMNWVRQAPGKGLEWVAFVPFDRRINYYAESVRGRFTISRDDSKNTVFLQMDSLRPEDTAIYYCAKHRSQWNFWPREGGLDHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light chain of Fab of a neutralizing antibody L1
publication title Viral Escape from Neutralizing Antibodies in Early Subtype A HIV-1 Infection Drives an Increase in Autologous Neutralization Breadth.
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2012-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f57H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f57H01
2DWDB 2QADC 4P4KD 3VI3E 2R0ZH 5E24E 3PABB 1WCQA 3FCTB 3NCJH 3IFNH 4YGVB 3MLUH 2FWOB 1YJDC 2N4IA 2OTUA 4PJFA 2DJUA 1FL6B 1NGZB 3D5OF 4IRJD 5TE7H 4LLWA 2BNRE 1WSST 4KQ3L 5TGBA 4WU5A 4UBDC 2BVYA 5GRWA 2BNRD 1YUHB 5MI0B 3PWJB 1GGUA 4POYA 3SEPA 2WUCH 3AM8A 3WFEH 1Q9WB 3QQ4A 3U9PH 1NAMA 1TETL 5FK9B 2ZCKL 2DF3A 2WNGA 4S1RL 5DC0A 2OR7A 5GGTA 5KBNC 3DUSA 1AIFA 4L8SB 2FGWH 2DQFA 5DJ0B 5I30L 5JUEH 1RJZB 2R69H 3TIDA 3SDDD 2HVJB 1VFAA 5D8JH 1VFMA 3PL6B 2KPNA 3ZT6A 4OM0H 3GI8H 4NBYB 1BEYL 1CXLA 3RTQB 2DM2A 4K8RC 1BQUA 3BP4B 3HE7D 5C0AB 3MRIB 4A6YB 2Z91A 5HHOD 5IW6B 3MOAL 2ZCLH 1JN6B 1KCRL 4JFOA 2XRAH 3F58L 3OGCB 5FUOL 2IPUK 4BFIA 4N0RA 1WT5A 4Y16C 2VDRL 4WDIB 4XP1H 1T5XA 1KXVC 2YRZA 3ROLB 4JFYA 4Y4KB 4AM0A 1GHFL 3KYAA 4HUWA 4RNRA 2VQTA 3MLRL 2RFXA 1T1XA 3PP4H 3WIHH 5ANME 5HJ3B 4Y5YB 2BMKB 4YX2L 4GS7B 3QEQA 3WLWC 1Q9LA 1QQDA 5CEZE 4DW2H 3F62A 4G42B 3RQ3A 5J3HC 4LBEA 1YC7A 3I85A 1MQKH 2HTKC 4GUPA 2AXFA 3EKCA 1AP2A 2VLRB 4P46C 4P9HL 3QO0A 4HK0A 3NACH 5DA0B 3QH3A 1UYWL 3QULB 2AXJA 2R1YA 3RWJA 3UAJD 1SHMA 4P57B 1MELA 3QIUB 1OVZA 4U6VH 3GI9L 3NMEA 2EC8A 3DHJA 5DO2D 1MCWW 3EO9L 5IIEA 4V2BA 3C6SA 4HFWA 1IZKA 4W6WB 3QI9B 3G6AB 4XP9H 5E8OB 1IC7H 1DVFB 1W0WB 1A6PA 2DLFL 2F8OA 2X4NB 9CGTA 1IBGL 1MCSA 3IF1B 2QHLA 2YSSA 1GAFL 4RIRA 2JELH 2C3HA 4I48A 5T3ZE 4PG2A 2E5EA 4HT1H 1JYXA 3V0AC 1AGFA 5T3ZD 2BSSB 4ODXA 1RZKH 4QCIB 3X12A 4EUPA 2XA3A 1JZ4A 2V9RA 1AE6H 2H26B 4EN3C 5DMJB 5EUKB 2UZYB 1MCFA 4PJ5B 2KZ1B 4RMWA 2XI9A 2OQJA 4X6DA 3LVEA 5ESAA 5MERB 5E7FA 3VXQB 1I8MB 3ARDB 4Y16A 5IHZB 1PZ5A 3QEQE 2AKRA 4P2OC 5JDSA 1QVOA 2QQLL 3TVMA 3TV3H 3MBXL 2IFFH 3QXAA 2GQHA 3MZTA 2QADD 4KKBD 1KCUH 1BMGA 2BP3A 2FECL 1NSNL 4KRPB 5L88H 1JPFA 1KGCE 4O2FB 1JNHA 1MNUH 2DWEA 4I5BA 1FNEA 4OZHA 4QTIL 3R1GH 4LNRA 3L3OB 4YDVB 1NFKA 3B9VA 1X7QB 5HYFA 1I1RA 2A74A 2ADGB 4P46A 3O6FC 2NTFB 2CLVB 2B1AH 4H8WC 3IDXH 4AIOA 3GRWA 3NZ8A 4ZFFB 1VA9A 3V6OC 4BA8A 1PG7X 5AAMA 4LKXA 2ZPKH 1LE9B 1I7ZB 4WUKH 3BGMA 1CGSH 1FV1B 4Z7UE 1NC4D 1N0XL 4ZO6A 1XR9B 1HWHB 4WFED 1JF5A 3S36X 5IB5B 1S7UA 1WITA 3GMLA 1QRNA 3L3IA 1UQSB 3EDKA 2DQCL 5B8CC 4LCIH 4WWID 5DTFB 4UV7H 5LGJA 4NO3B 3MLYL 4X7SH 4X6DE 4QXGH 4YBLB 1BECA 3OSKA 1F3DJ 2VC2H 1WISA 2IG2H 3LV3B 1NDMB 4EN3A 3QXDB 1J9CT 5EBLA 4Y16D 1A6WH 3TVMD 4N1HB 2Z4QB 4KJYB 4IJ3B 3R0MA 4RMSA 4BK5A 3BGFB 2Y6SD 5GQBA 2X09A 4J7RA 1XGTA 5SWSA 1INDL 3UTQA 5C2UB 5ID0A 5D2LF 3QEHB 1J1PL 1OSZA 1I8IA 2V5RA 4RBPH 3WLWD 2ZNWA 1MJ8L 2ZCHL 4NQDE 3TN0B 3IJHA 2LVEA 4E41A 5FYKE 1SBSH 3DX9B 4BSVA 3D18A 1A4JB 3SE9L 5CEXB 3OAYK 1S9WB 3MV7E 2VLKE 4YZFE 2CO6B 5IF0B 3FQXB 4P46D 4P2QA 3AMKA 1ACYH 3CXHJ 3QA3B 5T1DL 3BPNB 3HAEB 3PQYE 1XZ0B 2DKUA 1GXEA 3TJHC 3OKLB 4OCMC 1BZ9A 3K4ZA 5TDOB 1MJJB 4ODWA 1B4RA 1UWGL 2Q86B 1MRFH 4F2MA 4HWUA 4PJ9B 3RKPA 1CLYH 3L6FA 4KK9C 5F89B 2VXUL 2BVOB 1QRNE 1QRND 4R0LB 4PRAA 1QLFA 4DAGL 3QRGL 3OXSA 1E4WH 3EDFA 4Y4FB 3GSWA 2E9IA 4ENED 1T1YB 5JOEA 4P2CG 1T5WB 4JY5L 4FQXC 3E8UL 4MGXA 1RHHA 4KY1H 1QBAA 4FXGB 2PW1A 4L8CA 4UIKL 5FECA 2J5LB 4Q6IA 2ZUXA 5B38A 1EAJA 4EN3D 2ICWB 4OLYH 5IEKA 1B0RA 5B8CA 1T2XA 1YZZA 1A3LL 1DANT 4KDTC 4KMTL 1GSMA 4OFIA 4DQOH 3FOLA 5SWSE 4JHWL 1TQCB 5SWSD 1QG3A 2WM0A 3T0EE 3D25B 2YUVA 5B4MD 2VXQL 1FZMA 1RFDL 5I1HL 2ATKA 4R4FH 3AS2A 4E41D 4JDVB 4D8PB 4JRXA 1ZT7A 2AJZB 4KPHH 2XWBB 4GXVL 1M7DA 1U8PB 5TE4H 1CFNA 2R0WL 3IDYC 4P2QD 2CDFB 3IVKA 1KELH 3V0WL 2BSRB 5AZEL 4HS6B 4Q7DA 1FCCA 1YEJL 3DVNB 4EUPG 5HVHC 4OIIL 2BOBB 4PRHB 3GK8H 4M8QB 5EIIA 2P45B 1FG9C 1LQSR 1FIEA 2I9TB 5E8EB 5BVJB 1MCNA 5DD3L 1H0DA 4Z8FH 2EE3A 2NXZD 3PWNB 4FQLL 2RB8A 1F58H 4FZEL 5EOTA 4OZFB 2FLRT 1VGKB 3HHRB 3QUXA 3MOBH 3KNBA 4J23A 4LEOB 5JDJA 3ZHKA 3D2UB 4UUJA 4OZIA 1WZ1H 1FORL 3WSQH 43C9A 1G6VK 4TULH 1T3FA 3BZFA 1UM5L 3PNWB 2ITDA 4LL9A 4MB3A 2Y72A 5D1ZB 4G7YL 4P3DA 5C0BE 4W4OC 3B5TA 3WO4C 3O45A 5CEYA 1HNFA 2WBJB 4XBEL 1CBVL 4CVWA 1N59A 3THMH 4AT6A 4ZUVB 4JRXD 4Z7QE 1NFIA 5F9AC 1DCLA 5GRVK 1OY3B 2IEPA 3BIAX 3MRRB 4PJXA 5DHVA 2JIXA 1QSFB 1S7VA 1IJ9A 3NN8A 1ZE3C 5E8PA 2VDNH 3QCUL 3MNVB 1J11A 3HLAA 2DD8H 1UVQB 1HILA 4O2EA 4LCYB 1DEEB 3RL1A 1NFDB 5ADPL 4X8JB 4D0DA 1IVLA 3FFCB 3CLFH 4G6FD 2XYCA 3OPZH 1XCQA 3O41A 2GTWA 5T5FH 1FVEA 1UKTA 5LXGH 2VOTA 3LPFA 3WDHA 1IM3A 4K23L 2VYRE 3HS0B 1YPZB 3O2VL 5KW9H 4IHOA 1J87A 4Y4HB 4E0RA 2HRLA 2VLJA 3QUXD 3MACH 4UZGA 2OI9B 1QBLH 3K46A 3ZE1F 4OGYL 4GG8B 3CD4A 4PGDB 3VJ6B 4MD5A 3DNKA 1SMAA 3UX9B 5I18H 1TCRA 2JK5A 3HNSH 5CBAA 3AFLA 1YN7B 3MRCB 2JJTA 4IS6A 4I13B 4PP2B 1SY6H 4NM4L 3LDBB 5EN2A 2APXA 2GK0A 5KS9F 1HK6A 4KDVA 5JQHC 5E4EC 2Z31B 5F88A 2VLLA 5K9OB 5T33L 1IGMH 1XGUA 3VXSB 4W4OA 1CQYA 3G6DH 3QEUA 1MHPL 4YHPB 5F1NA 1TZIB 1YYLL 1MCWM 4HJJL 5FCUH 1ITBB 4P9HC 1FN4A 1OP3H 4WFFE 4PJXE 3LQAL 5IMKA 1CTNA 2AI0H 3PG2A 3ULVH 2JIXD 1JZ8A 3JV4A 4JFHE 2NY4B 3C8HA 3RVVC 3BP7B 3CX5K 5DMGD 4UOW1 5DFWH 4KK6D 4L4JA 4HCRA 4Q0XH 3F12B 5J0BA 1ZXQA 5BZWA 1KB5A 2C5DC 1TDQA 3FQUB 4LVHC 3U7WL 3HMXH 3MO1A 4JFDA 1S9VA 3MNWA 4F7EB 1G7IB 1P84J 3OKNB 1QSVA 4RAUB 3WN5A 1D5ZB 4JFEB 1UB6A 4Z77B 3BPCA 4LCCB 5MEOA 2R39A 5F1IB 5B38G 2P7TA 4TVPL 2VLJD 3N1QC 1WEJH 3PWUA 1E27A 2IBZY 5F1SA 3CVHH 4JDTL 3B2UC 4KRLB 1A7PL 5H37G 5AG9A 3P4LA 1BBJB 1XF5B 1S3KL 3RWIA 4FQCL 2CGRL 2A6KB 3IDJB 2BK8A 2HFGL 3QISA 3O8XC 4XPAH 3RI5K 5IROC 1BHGA 4ODSH 4PUBL 4BSWA 4M6ML 5D1XB 2B5IC 2XQYK 2FX7H 4J3WA 4Y1AB 4U6XB 5E08H 1T03L 4K7PH 2FYYB 3DIFA 3L3JB 3VFTB 4GRWH 3GMMB 3H7BA 1L7TL 2FH6A 5DRZA 2OSLA 4LKCA 5DD1L 4RFOH 2E8ZA 5J6HB 2E9WA 1MLBB 3KR3L 4MQXC 4W6XB 5IHBA 4JFDE 3N1GC 1FVDA 3GMRB 3BJLA 3UBXB 3JBG7 4JFDD 1PLGH 1M1SA 5ADOL 3EOAB 2BVEA 1S9YB 1I3RA 1RJLB 3DSFL 4MSWA 5EU4A 1V7ML 4XNQA 4FFWC 3MYJA 2MJWA 5BXFA 3VFNB 3WS6A 4XWOC 3MRGB 2HT2D 5HI3D 1HCFX 2J6EL 2FEDC 3X3FH 4D0CB 5GGUA 1IC5H 1DTUA 2CUHA 1E4JA 2P8LB 3QUML 5CEZL 1TJHL 2RHEA 5KAQG 5HVWA 3L5IA 3FT3A 5DT1L 1YDPA 2Q8BH 4HV8B 1OLLA 4NT6B 1RULL 4PV8B 4APQA 5INDB 2YKLL 2HG5A 5BQ7B 4X9BA 4N0UA 4GFTB 1I9EA 1BBDH 2R56L 1JRHI 4IBLT 1GZPA 4TN9A 4YHNA 4ZSOE 5EO9B 2X70B 1AH1A 3PXHA 1R3HA 1MCIA 1ZT1A 2E6JA 4CVZA 1GGTA 4P5KA 2H2PD 4BQBA 4HWBA 3ISWA 5IMOB 2MTPA 3O6KL 1UM6H 3REVB 5D96C 5SX4H 1JGUL 4MWFB 4YQXH 4C59B 3LEYH 2JCCE 3EOTH 2VITA 1IFHL 1T7XA 4PJGF 1HOCB 1EFXA 1WZLA 3T3PE 4U49A 1NBZB 3PUCA 3EAKA 1S78C 3EJZC 2H6PA 1GZQA 2JB5L 3RUGA 2X5PA 5EO1A 4PLOB 3RVVD 1UWXH 5DMIH 2F53A 3EFFA 4XNXH 3NCEB 3ZDZE 1DUZA 2D7NA 4NJ9L 5JW4M 4KZEH 1IE5A 2AXGA 3P11L 2EZ0C 1H5BC 5DJDB 2W92A 1F4WH 2GTZA 3KYKL 1ITCA 4QHNA 2BCKA 4OLVH 5FUZL 1A6ZA 4PRNA 5C7XL 4MXWL 4DVRH 5A2FA 3NPSB 4HIHA 1RV6X 2NYYC 1LDPH 1AGBA 4APQD 4MXQC 2NR6D 4PV9B 5FGCE 5JXEA 4N0UE 2DJ4A 1D6EB 1A1NA 3VRLE 1BVKA 2DBLL 3B2UD 4WEBH 4M9OA 3LN9A 3RU8L 2XPGA 5CMAA 1HEZB 2J2ZA 2IGFL 3ULSA 1W72L 4NP4H 1KJ2B 1AO7B 3IETB 2BRRL 3DGGA 2FDBP 4U3CA 1S9XA 1RZKC 3KYOA 2X4OB 4KK8C 1Z9SA 5A3ID 5SWZE 3TYFB 3VXRA 4N8PA 2H8PB 5GGVH 2ZKHH 4K7FA 4G8GA 1EFXD 1ZGLB 5I8KL 1X5AA 4NSKB 3RUGE 3MUHL 3O2WL 3TA3B 4FZ8H 3RWEB 2V9TA 3EHBD 4M93B 1IKFH 5AYUH 2G5RA 4D94A 2C4XA 2Q8AL 4OGAC 2F53D 1IGTA 5ISZA 1QZ1A 3W82A 3SDAB 3WIHA 1J5OL 4M7JH 3VFOA 4F7CA 1JF6A 1N5AB 4CN6A 4R2GD 1S7WA 2VXTL 1MJUL 4XPTH 2AJ3B 3QQ9D 3O3BA 4RGMC 4BZYA 1MCBA 2VQ1B 5GGQH 3KPRA 1H5BA 1MRDH 3L5XL 3C6LA 4XXDB 1FYTB 1S7XB 5FO7A 4POUB 5JXED 1EAPB 4PFEA 4U1NA 5C0RL 4HUUA 1UB5B 1OOAA 4UV4H 1Z5LB 1A6AA 1WFTA 4PD4J 2Y7QB 3ORJA 4H88L 3AY4C 5J6GA 4HUXA 2B4CL 4XWGH 5I2IA 1BAFL 4L9DA 3HNTH 2Y4SA 3U4EA 4RMQA 4YFEA 3VXTB 3HB3C 1PQZA 2IWGA 1IILE 1BOGB 3BH9A 4QY8B 1WTGT 4TUOA 2OR8A 5D5MF 1W8OA 1RZJL 4QNPE 5EZIL 1YYML 4X6BA 3VXRD 1KCSH 2NLJB 5DYOB 4FMKA 5I74C 4EI5A 1AI1L 4G8GD 1QSEA 3ZT5A 3F7PC 1YMHB 1GOGA 5KVEL 4KTEL 1JNJA 2J8HA 4X80L 1LEGB 1K3ZA 2HVKB 2H41A 5ISZD 1U8IA 4Z0BH 3EJZD 4NQEB 1QEWA 4ONFL 1R5VA 5DVLA 3UJTH 5HYQB 4JHAH 1KIQA 3T65B 2MKLC 3ROOB 1M7XA 4MA1B 1G0DA 3D85A 3WNMA 2XZCH 5KANI 4GJTB 1BLNB 4NNPH 5TF0A 4U6TA 5C2BL 1MVUB 5ITFB 2GJZA 3QPXL 3KPRE 4AG4L 2G9HA 4YDKL 4N1EA 4XPFL 2EZ0D 3KPRD 2PCPA 2DI7A 1R5WA 4IRSA 5ACMA 3C6LD 2MOVA 1FL5B 4DKFL 3D3VA 3HR5B 5KANG 2OP4L 4JFZH 3BKCL 2NYYD 3ARBB 4JG1H 4ZD3L 1HQ4A 3ES6A 1D5IL 3I2CH 1YEIH 3HPJB 4PREA 4HIIA 1Q9OA 1OAZL 3OKMB 1UJ3C 3MXWL 1MWAH 1AQDB 3CUPB 3WUWB 2AV1B 2YEZA 4ZTPH 3FN0L 4HJ0C 3ARUA 3S37H 2C1PB 2NY2D 2IJ0C 1QA9A 2X89A 2AK4B 5E2VL 1BF8A 2CDEB 4PLJC 4H0HB 3WD5H 4JPIB 4JM2C 2KDGA 1I7UB 1QSED 3LQAC 3FO9A 4KK8D 2KZWA 1NGXB 5GZOD 2UVEA 4LGPB 4NZRH 2APFA 3B9AA 4Q9QL 1EEZB 5I17B 2VZSA 1WV7T 2PXYB 3OJMB 4PJDE 4JQVA 5CD5D 3WNPA 1FGNL 3Q5OA 2AV7A 2YRPA 5JIHA 3LN5A 2NXYB 2P8PA 2YUXA 2X1XR 1JNNH 2X4SB 3BD4A 5C09A 4N5EC 5KTEH 5KSBB 1N4XL 4FOMA 3D85D 3OAZK 3VD4A 4PJ7F 1KTDA 2ZSVA 4WHDA 3MV9E 2ARJA 1BX2A 4Z7WA 1FGVL 4E42B 5E94B 3K3QA 3O9WC 5L8KB 1JTOA 1NCWH 2QLVB 5FYKU 3TNNA 5C8JB 2ORBH 4UU9B 5D7SH 1AGEB 2D2OA 3NABL 4IRSD 2YN3A 2A9NL 3OR7A 1ZLUK 2NY1C 1OGAA 3QXWA 2L4OA 3D3VE 3SKJH 3CZFB 1ZLVK 4TUKL 1WIOA 3D3VD 5I1EH 2CD0A 4EBQH 2XN9E 2VABB 3UDWC 3UJIL 3DO7B 4ELME 5I1JL 4PJIE 4Z95L 3P9LB 4BKLA 4N9OB 5ALCH 1JFQL 3PWPA 4XPHH 3ZE0E 3BQUC 4GBXC 3V6FB 3T2PA 4GT7A 5ERWA 4P2RA 3VWKB 4F3FB 1BQLH 2MSPA 3HI5H 2X89D 3ZKMD 1HSAA 4O02H 1A7RH 3KXFB 2ERJC 3V4VH 1CXEA 3EBAA 3BESR 3KPPB 3L1OL 2EIEA 1NBVL 3GMNB 2W65A 1EJ6A 5GS1C 3SDYH 2GAZB 3BDXA 3BT2H 2A73A 3RY6A 1U91A 2ZUQC 4J6RH 3LS5L 3SO5A 4QT5B 2LU7A 3EIFA 5FO9A 4QF1A 2JJSC 3QNZB 4F9LA 3RKDD 2DTMH 3DXAB 5BW7C 5C09E 5IBLD 2FLBT 5BS0B 4B41A 5DJAA 4O51A 5C09D 4DUWA 4CU7A 5CLWA 4OT1H 4C83B 5EOCJ 3OR6B 4HF5H 1K6QH 4NHCL 4Z7WE 1A7QH 5HDBF 4HK3N 1OAXH 2V5YA 4I18A 1UC6A 4QRTA 4JB9L 1CCZA 3S8WA 3MFFB 1OGAE 2X44D 3KYNB 4JZJB 3UZVB 1OGAD 5ID1A 2OBGA 3MV01 5D7IA 3C60B 1K4DA 3QWOA 1ZLWK 5GRJL 3P0YL 2AK1L 4X7DC 5JMOC 1CGTA 1FQ9C 3PWPE 3WL9B 3PWPD 4MVBD 2FEEI 4R9HA 5I1KL 3LEXB 3GJFK 2Q3AA 5HGAB 4P2RD 3UDWA 5FHAL 5IW3A 1JI2A 4OZ4B 5HGBB 4LLUA 5E6ZA 3VGAB 4L8DA 1KACB 5IEHA 3X3GL 4Q9BA 4HJ0D 4NN5B 4LLQB 1JHLH 5DEGA 1VB9A 1ZHLB 1KUMA 1D5MA 4U1HB 3KPOA 1J10A 3VW3L 2R2BA 5M94B 1K8DB 4JG0H 1OAQH 3O0RL 4MAUH 2G5BA 3KJ4B 4P5MB 1OGTB 3V5DB 3NFSL 2Y06H 3DVFA 1U8KB 3WHE0 3C5SA 2NW2B 4QLRA 1MAKA 3PP3K 3TIEB 1TVHB 3MLWL 1NANH 1U6AL 4NRXA 4YNYB 3EJJX 1DZBA 1FZJA 3SKMB 3VFVA 2OL3B 2G2RA 5BRZE 1F2QA 1M71A 1LO3H 4N5ED 2IAMC 3AS1A 4M03A 3WS3A 1GGCH 4JLRA 1T80A 4HS3A 4LRNH 2ZUYA 1I1YB 3I50L 1ZANL 4ZXBB 4WHYH 4ZNCD 3QUZC 1OAYH 3F7VB 1JGEA 1V7NL 3HI1B 4OCWH 3GSVB 1MLCA 4KJWC 2NY1D 2CLRA 2L7JA 3BZEB 4M4PA 1CDJA 1MFAL 3CDYA 1A9EA 1NCAH 5D7KD 2R23A 3MX0A 1MIMH 3PIQB 4R97C 3B9KA 2P5EA 3TCLA 4LK4A 1LD9A 4NN6B 1IEBA 4L5FH 2DQUL 3L3KA 4DCQB 1F42A 2WQ8A 3MTRA 4KDWA 4MXVE 2X4TA 4PJEF 4WW2B 3W2DL 2W9DL 2YA2A 5A40E 3QCTL 1RURL 1U93A 4ZNEA 4ZFOL 1MHHB 1KJVB 4BZ1H 4JFFE 3SCMA 3JXAA 5E2TH 1NQBA 2XTJE 4H1LH 5CIPB 1BFVL 4LLVB 4PTUB 3SPVA 5DJXA 2EH7H 1C16B 5I73C 5BMFL 3ARFC 35C8H 4FQHB 3STLA 3DURA 2L0DA 4WHTA 1NAKH 1A3RH 4QRSA 2DLHA 3HZMB 3VXOB 4U1SA 4YXKH 4RWYH 2C1OB 3VXMB 4CGTA 5I9QC 4L4TE 5E99L 2XIDA 4ZYKB 3NIGF 4Q2ZA 4PRDA 4Y5VA 4NKIL 4XC1L 3GJFB 2BFVH 4OUOA 4N8CH 3S36H 5JPNB 5JR1L 3DGCR 2OZ4L 2B0SL 4OSUH 4Y5XA 5DQ9A 2IAMA 2NY7L 4V2CB 1I3UA 5LWYL 5I15L 5TE6H 5F6IC 4LHUA 5IQ7L 2D7TL 2P8MA 1GL4B 2D0FA 3GSNB 3QB7C 2GJ6A 2UV3A 3MXVH 5FHBL 3OWEA 2X1PA 2P5EE 5FYLH 3B9KD 2P5ED 2ED9A 3DUUB 2YMXL 3UZEA 2B4CC 4JPVL 5TH2A 2OMBA 4YBQD 3CFJB 1LHZA 5D7JC 6FABH 4X4YB 1YNLL 3FFDB 3HMXA 5HDQL 2YWYA 5HDOA 4FNLL 3WFHA 1J8HA 3ZYJA 4EVNB 3MLVH 3P4NA 2I07A 1UEMA 3GBMH 4ZNEE 5DVMA 2EDYA 4MCYB 5CHNB 1JHTA 4HWZA 4D0BA 2Z8WC 5F3BA 5HI4D 4YBHA 5ENWA 1N6QL 5CKGA 4EDXB 3CVHA 1GRWA 5IWLC 4L8BA 1CDIA 3TT3H 1LP9F 5BV7B 4GAJL 4GRLB 2VLMD 1MFCL 4AH2B 5CP7A 2DQIL 4PJHB 2D03H 5J89A 3VDCA 4DKEL 2VXSH 4HEPG 1J0IA 3G5XB 4C54A 3VG0H 5DR5L 1JV5A 3FONA 4YPGB 4L3CA 1T0MA 1P9MA 4MHHI 1C08B 2VAAB 4KROC 5EFIA 5LCVL 1RZFL 2IBBA 1JUFA 4UQ2A 2PTUA 3CFEA 1DQMH 3NTCH 3IFLL 3TO4B 4DJMA 1BD2B 3VXUA 4HKBB 1H15A 2IAMD 2VUOA 3ULVE 1FE8L 3QDMB 4RGNC 1UGNA 4LHUD 5CJQH 3EYFB 4U4BA 2VDOH 4MJIB 1A7NL 2GJ6D 3MRJB 4GMSH 4LASL 4ZUUA 3W81A 3RY4A 5TDPA 4MHHG 3A6CH 4S2SA 3KLAA 4EOWH 5J12B 1TVDA 4P4KB 4KI5E 1HYSD 3C5ZC 4KI5D 3L9RA 4N0CD 1AC0A 1J8HE 5F9WB 4JFQA 2H3NA 1J12A 4LSSH 4A2MA 1J8HD 2A6IB 5J06A 4XH2B 3S5LG 1G7PB 4HBCL 3KPQA 4YO0A 3G6JA 4YEFA 2IQAA 1CVSC 5FYJE 2BNRB 2HRPL 1XEDA 2QSQA 1Q0XH 5TQ2L 3L7FA 3L95B 2EEDA 4TYUA 3HUJE 5I1DB 5TE7L 2WW8A 3QUKA 1BQHB 5FOJA 5E6IC 3QG6B 5DGQA 1DEDA 5FFLA 4G8IB 2WUCL 2J3SA 5BZDA 4JKLA 4NKDA 3RVTC 1YEGL 5IWLA 3SDDB 2V2XA 1E4XH 5LJYH 3QO1A 3OKEA 2CJUH 1B0GA 1ZS8B 5IV2B 4PGEA 3D1MC 1CL7H 3DPBA 2DB8A 4XVTH 2O26U 3HE7B 4NM8H 4ZPTB 3EYSL 1KEML 4GG6E 2HLFC 1A14L 4Z78B 5HHOB 3VXUE 3TBSB 1UXWB 4MDIB 5EOCL 3VXUD 3S88L 5I71C 4GRWE 2UZIL 1AD0B 3MLXH 1RUML 1IC4L 3O6LH 1D3CA 3P0VL 2ZUWA 4YFLF 2GW5A 4NRYB 5F9JA 4HQQH 3P30H 4BFGA 4XTRC 3QNXA 4ZS7H 5C3LD 1PG7L 2A6DA 2E7HA 1AC6A 4LSTL 1ZVHA 4PJHF 4ZOCA 1DQDH 4WEMB 1G9NH 1QBML 2OTUB 1YEEL 4PJCF 5F1OB 4PJFB 3G6JE 4JM2F 4P9MH 3V4UH 5KVDH 2HKFH 4LLWB 5D7JD 1JMZA 4MNQE 5TGBB 4WU5B 2IBZX 1NCUA 1FYHB 5FCSH 1HDMA 1F4YH 4TOYH 3QQ4B 4WCYL 1NAMB 4DGYL 1E4KC 2ZOLA 4X9HA 1JP5A 1XIWA 1O7VA 3HI6L 5EORH 3DUSB 2DDQL 1BFTA 4FP8H 1TPXB 3HC0A 3WDJA 3IKCB 3PGFH 1S8DA 2DQFB 2AVGA 3K81A 4KKLC 3I9GL 1PVHA 3TIDB 1H3GA 1RIHH 1VFAB 4YHLH 5JIIA 4P3CH 3O4OC 2NY5L 4G6AD 1HHHA 2BSTA 2EDOA 2Z91B 2R2EA 5D6DA 1F13A 4M6OL 4CDGC 5HGHA 2BNQA 3DI3B 4BFIB 5IGXH 1AY1H 1SM3H 3SE3C 2JELL 3DLQR 1T5XB 3WKMH 4JFYB 2R29L 4FQJH 2EH8L 3MODL 4AM0B 1D6VL 3LB6C 1OTSC 1J1XL 1MPAL 4HUWB 4RNRB 2AEQH 2LE9A 2RFXB 1I1AC 3E2HC 3G9VA 4K2UL 4Z7VA 3QEQB 1Q9LB 1QQDB 3MLTA 1XR8A 4P59L 1MIEL 5F6HJ 3S3SA 5I76A 4LPYA 4NZDA 4LBEB 1Y0LA 3TEUA 4GXUM 1OT1A 4M62H 3RWHA 4GUPB 3N9GH 4DTGL 2AXFB 1BVLA 1AP2B 3QO0B 4U7MA 4WI9A 1GC1L 4HK0B 4AMKL 1NLBH 2W0PA 2R1YB 4KXZH 3RWJB 1OSPL 3ZTNL 2OXGA 3D87B 1XIWD 3QFDA 4LLYA 3DYOA 1I3GH 4OB5H 3F5WA 5IIEB 2R0LH 1BGXH 2HT3D 3C6SB 4HFWB 5IK3A 5IJKC 1T2JA 5JZ7C 4OKVA 5I1LA 4HKZA 3TPUA 1MFBH 2QSTA 4JO4L 4YXLH 4UI2A 4Z7UB 4RIRB 4I48B 1PY4A 1RZIA 3RVTD 1AGFB 3BRFA 3X12B 2BNQE 5J13B 2BNQD 3PHQA 1U8MB 4DWHA 3MJ7A 3MJ9H 4JDZA 1CWVA 2A77H 1EIBA 2ZOKA 5KVGH 1KXQE 5HHVL 2OQJB 1QFUL 2XXCB 3BD5A 4X6DB 4JFPA 5ESAB 3UJJL 5C6TL 2H1PL 1JHKH 4Z7VE 4NQUA 1PZ5B 2AKRB 3MLZL 4UV7L 4F8TA 5JDSB 1QVOB 3TVMB 5GGRA 1Z3GL 2FIRT 4TQEH 4EXPX 4XTRD 1JL8A 1QO3A 5INCA 1A7BA 2KH2B 1JBJA 3MV8E 5I1GL 1JPFB 3RPIA 4CL7A 1JNHB 1NEZG 2DWEB 4JANB 3TJEL 4I5BB 3GM0A 1EERB 1FNEB 1JWMB 3U0PA 3VFGL 1CK0H 3CPLB 4OZHB 4ZO9A 1OHQA 4OLZL 1WWAX 4LNRB 1UWEH 3Q6FA 5SX4I 1KB9J 4FTVA 3GDBA 4XCFH 2A74B 4P46B 3MV7B 2VLKB 3ALPA 3KPSA 4ALAH 4PY8J 1GJIA 4CMHC 3NZ8B 4G9FA 3WFCL 3CXDL 2F5BH 3H9HA 2D4FA 3Q5TA 3INUH 2R2CA 4OGZA 2PTTA 3BDYL 4LKXB 1UCBL 3QJFA 5TPWL 1X6NA 3MUGA 1MWAA 1BIIA 5IJKA 2CXGA 1H3XA 1HI6A 3T77A 3GMLB 1QRNB 4QKXB 5F7DA 1M05A 1S7QA 2VH5L 3L3IB 5DQJA 4DKDC 2VKXA 3RIFK 1QHOA 2XNAA 2FJHA 1KSRA 5LGJB 5JIKA 3CSBA 2V17L 2V7HA 5IUSA 3DMMA 1DSFH 3LH2L 3WFZA 3P4MA 2EICA 5EWIL 2CSPA 5EU7E 4EN3B 1CDHA 5EBLB 2BVPA 5F21B 3R06A 1B2WL 4YHML 1RJCA 4FQQA 1OTSD 4QEGA 4M6NH 1XGTB 5SWSB 3UTQB 1URLA 5ID0B 4F9PA 3QHFL 3J8F7 3QG7H 1OSZB 2XZQL 1I8IB 4OGXL 4Z7UF 5L2KE 3HG1A 3T0EB 3GSQA 3MGAA 2V6HA 3IJHB 4NKMA 1QNZH 3CLEL 3S34L 4E41B 5DWUH 5DFTA 2V7NA 1IGIL 1ORSA 4BSVB 2NY6D 3D18B 3HE6C 3JTTA 3L7EA 4WU7A 4FTVD 3KPSE 1AXIB 4P2QB 3BPLB 3KPSD 1KG0A 5DK2A 4R4FL 5D70L 4X6DF 1O5DT 4G9FD 2VMFA 4KAQL 5D72H 1HH9A 3WFDL 1BZ9B 2DLIA 5E2WH 5EH1A 2ARWA 4HS8H 4ODWB 4F2MB 4WI8A 3L6FB 1DDHA 1XGPA 3H3PL 3ZKXC 3BRDA 3JWOC 5DHYA 4PRAB 3OXSB 3WBDA 4NBZB 4XP5H 4S0TD 1MHCA 5IVXA 4MA7L 2NXZB 4WO4C 1WBZA 4FABL 4JRYA 3FB5A 3MZGB 1RHHB 3DMMD 3FL7A 2VXVL 2PW1B 4L8CB 5FECB 5HHME 2GT9A 4IMKC 4Q6IB 4F57H 3U7AA 5B38B 4F7TA 5HHMD 2O61A 5IEKB 1B0RB 5B8CB 3U36A 4G43A 1SBBA 3K2UH 1D9KC 4XC3L 3FOLB 4KUZH 4LSUH 1NMAH 1QBBA 3TESA 3NH7L 1TVBA 3G9AB 1K5NA 3HG1E 3GKWH 3HG1D 4S11A 4XHQA 5DK0A 1FZMB 1FJ1A 2MQ3A 2ATKB 3MA9H 4OLUH 3PHSA 5K59E 1JPSL 4NC0B 5FB8A 2QV2A 1ZT7B 4JRXB 3OZ9H 1M7DB 5I19L 3HRPA 2D9QB 1CFNB 1SJHA 3GSXA 2X42A 2CMRL 2WUBL 4GSDH 3T8XA 4UNVA 3WXVH 4HUKB 1I8KA 3T2NL 3VXPA 5IESL 3V6BR 4MAYC 5DZNA 3ME0A 3GBNL 3TBWA 1BZ7A 1NBYA 1WVZA 2WIIA 3NPZB 5EIIB 3SO3C 4M7ZC 5EOQH 3ZL4L 1H0DB 5IVXE 4NUJA 1CICC 4YHKH 1Y18A 4JRYE 4WI7A 1VGEL 2E3VA 3OPZL 4UINH 5EOTB 4JRYD 4K55A 1ZEAH 5ACZA 3QUXB 3UP1A 3KNBB 1B4JH 2NY3C 5LXGL 3K80A 3O3AB 4N90D 1FG2A 4J2XA 1DQQA 4QOKA 4UUJB 2E7BA 4OZIB 5C71A 43C9B 3FHQA 3RAJH 1T3FB 1PGRB 3BZFB 1ZWIA 3V0VA 2ITDB 4NWUL 4AEHL 4P3DB 3AS3A 4M4RA 2ARJQ 3O45B 4YPJA 5CEYB 5I18L 4R4ND 1LO5A 1N59B 2CKBH 1N5YL 4AT6B 1GH7A 1KIRA 1SY6L 1G9MH 1NFIB 1ZA6A 4YHYC 4UT7L 3EUUA 1U8HA 3X14A 4PJXB 5DHVB 1KFAH 1S7VB 4R8WH 3NN8B 3HLAB 1I9RL 2FATL 4LARH 1HILB 2J88L 4O2EB 5C3TA 3RL1B 3ARYA 3IDYB 3TBTB 3BW9A 3ULVL 4P99A 4D0DB 2GSIB 5I1CH 1JTPA 1XCQB 3O41B 2GTWB 4WY7H 2P4AB 1RVFH 2ESVD 3DTXA 3HC3H 5FA3A 5ICZA 2NY5C 4HIEA 3BPOB 1IM3B 2FGZA 4B7LA 2QKIB 2VSCA 5HVHB 4IHOB 3I3EA 4PRPA 4E0RB 4R96B 1DBAL 1AQKH 2VLJB 3ILPA 3JWDH 1D5BA 2AJYH 3O2DA 4Z7QF 5CGTA 3ULUL 2FBOJ 4MD5B 4OTXH 4QOKE 5H8DA 1TCRB 4QOKD 1YN6A 1U8OB 2X4PA 1WWCA 5CBAB 5I8OH 3LY6A 5FYJL 1QR4A 2QHRH 4IS6B 4XNZB 3L3HA 4H1LA 3RIFF 1MF2H 4YAQA 3SDCC 2FO1A 3CU1A 2I5YH 5J8OA 2DIJA 2RBLA 5F88B 2VLLB 1RUPL 1XGUB 3OG6B 2K7PA 3K4AA 3L3DA 3QEUB 1CTOA 4PS4L 1B9ZA 1BWWA 1GC1C 5AAWA 5FO8A 5IMKB 4LLAA 4DKAA 3JV4B 5JW3L 4TSAL 4MJ6A 3NGBC 5FM5M 5KJRL 3FB8A 3BX7C 1KB5B 4G6KH 2ADFH 5JOPE 4Y19A 3MO1B 1WIUA 4JFDB 3MGOA 1S9VB 2N7BA 1L0XA 3MNWB 4AIXA 3PJSA 4PRHE 4U3HA 4EXKA 3WN5B 3OTTA 4PRIA 2J4WL 2Y25A 5HHXH 1KN2L 5DJZA 3FRPG 3BPCB 2VE6A 4PRPE 5I0DA 5MEOB 5IQ9A 2P7TB 4PRPD 4WV1B 1AXTH 1RUKL 4IMLA 4N9GA 5EU6A 3PWUB 1E27B 4IDJH 2DQTL 3ZYOA 1RU9H 4LOUC 1T66C 5IR1A 5LAXA 1A6UL 3EDEA 4XNYL 5IBUG 1GOFA 3FT2A 4QRQA 3RWIB 1V3LA 1TENA 3W11D 4RFNC 2NY3D 2A0LC 4HZLB 5F7HA 2N56A 1RMFL 3A6BL 4H0GA 4BSWB 3CFCH 1Q72H 5I75B 4BZ2H 1F8TH 1UH2A 4X5WB 4MMZC 1SVZA 4QXUL 3DETD 1R6VA 3QIBA 3Q3GA 2DYPA 4XBGA 1PSKL 3LRGA 3FKUS 1JYVA 2A1WL 3H7BB 5EPMA 3CDFA 2HKHH 3NAAL 5DRZB 2OSLB 3AREC 4LKCB 4LHQB 1DLHA 7FABL 1TTUA 1FRGH 1YQVL 1MAML 1KC5L 2VZ3A 2Z93A 1MRCH 4C55A 1U92A 1KT2A 1NFDE 1FVDB 3PV6A 4Y19D 3VG9B 1G7HB 2A38A 5FYLE 4G8EA 4H20H 3IAPA 3ARPA 1P4IH 1DP0A 1I3RB 1MH5A 2LTQB 4PRID 3T0BA 1K2DA 4MSWB 5EU4B 1NH6A 4XNQB 3SBWA 3MYJB 4NO0A 5BXFB 1G1CA 2UYLA 4ZAKA 4HMCA 1DQLL 3TYGL 3LPGA 3ZT7A 1YPZE 2EYRA 5EU6E 4KFZC 5FYJU 3BI9X 3QXVA 5GGUB 4PJAF 4BQ6A 1E6JL 5EU6D 4TSCH 2YWZA 2EDNA 4ZMAT 3FT3B 3QDJA 1YDPB 3GSUA 2AJXH 1KLUA 1PD6A 2VDKH 2GY7B 3FT4A 4APQB 3MRDA 2R4SH 4JJHA 4KRMB 4N0UB 1MCPL 1JE6A 4K3DL 4JAMA 3UC0L 1GZPB 4YHNB 1EA9C 5IT2L 4OFVA 4JR9L 4LPWA 1R3HB 1C5CH 1ZTXH 1ZT1B 4NJAL 4CVZB 3A6OA 4GLRH 3TLRA 1FLRL 4P5KB 3KHQA 5E9DD 1EHLL 4WHYG 4C56A 4CAGA 3JUYA 1P5UA 4YDLC 2CRYA 2DYPD 2FL5A 1IAKA 2DAVA 2J8UA 2QQNH 4HAGA 4FS0A 2VITB 1EFXB 5F7EL 2ICWJ 4Q6YA 2H6PB 1GZQB 3IDIA 3RUGB 5EO1B 4GRMA 2EDTA 3PXJA 5F9OH 4BSJA 4Y2DC 2ZP0T 3RPKA 1C12A 5IKCA 1YY9C 2F53B 3EFFB 2FRGP 1TJIL 4EKXA 1DUZB 4XP6H 4UTBH 3U82B 5EZJA 4M48L 2AXGB 3KYMA 1DBBL 2W60B 2VDMH 2N7AA 1JI1A 3VH8A 2GTZB 1NMBH 2AGJH 4X0KB 4P5TC 3UTSA 4QHNB 2BCKB 4NHUA 4R2GB 5TQ0H 3RGVA 1IAIL 1A6ZB 4PRNB 3QDJE 5EBMA 4QHLA 1M4KA 3QDJD 4HIHB 4H1LG 2G75A 1NCDL 1AGBB 1SJVA 3AXLA 4HC1L 2JCCF 2VR9A 1VCAA 1A1NB 3BEWA 4RISH 3ZSSA 2K9UA 4WNQA 1BVKB 3T3PF 4ETQA 5GGQL 1R0AH 1FFNA 2XPGB 5CMAB 1Z9LA 3ULSB 3C2AH 4R6UA 3I6GA 1ERNA 5C9JA 3DGGB 3TT1H 1EMTH 1PX4A 3VFSA 1S9XB 3KYOB 3ZDZF 4GMTH 4C56D 4Y1AE 2FB4L 3B9EA 1UA6H 4DFHA 3TWCL 3VA2C 2J8UE 1DBKL 3VU2A 3U6RA 1I8LA 3VXRB 1Z2KA 2Q1EA 4JO3H 2R9HD 4K7FB 4R90H 4UAOC 3EYOA 4A6YL 1AHWC 3N0PB 4QGYA 2O5ZH 3O6MH 1FO0A 2ZJSH 3VRLF 1IGTB 1EO8L 5ISZB 3ARTA 4D9QD 5F96H 5M7QA 1MCEA 2F5AL 2IMNA 3TP4A 4LSQL 3VFOB 5FGBA 4MJ2A 4F7CB 3J7HA 2VL4A 3UTSD 3RGVD 5GS0H 1S7WB 3NIFE 4R7DA 1P4BL 5H35A 3KPRB 4EIGB 1H5BB 5DUML 1V8HA 4I3RL 2BJMH 3C6LB 4K9EH 5FO7B 3EDJA 2A9ML 1WFNA 4U1NB 1CU4H 1DBMH 3V52L 4HUUB 4XAWH 1DUYA 2IC2A 4YR6A 1A6AB 3STBA 4MA8L 1MFDH 1G6RH 3RUGF 5MHSE 2I25N 3IDMA 4LVNC 1SMOA 4HUXB 5J6GB 3IT8D 5AWNH 5HGDA 5GXBB 5EUOA 4RBPK 5I2IB 1LNUA 5TFSL 3U4EB 4KVNL 1HKLH 5CFHA 1PQZB 3NA4A 3IXTB 2E7CA 3BH9B 2NY2B 3B8YA 3O3UN 5CJ8A 5EG6C 4X6BB 4EI5B 4HBQA 2R8SH 3DV6A 5DRNA 2VDQH 3B8SA 3RVXC 1QSEB 1NC2A 5IOPA 4HDIA 3MJ9A 5E7BA 4LU5H 4YLQT 1F45A 2E6PA 4K71B 1E6OH 2AJUL 3LMJL 3RNQA 1U8IB 3SHSA 2FSEA 5LKNA 1OAUL 1QEWB 1R5VB 4JO2L 2DBJA 1KIQB 4NZRL 3SGJC 3T3ME 3D85B 2Z92A 3UYRL 3UPCA 4OF5A 3I3DA 1E4XI 2GJZB 5IVZA 2G9HB 3MBEA 1WC7A 2OR9H 2PCPB 4OD3L 1R5WB 1CL7I 4ISVA 4QNPF 4IRSB 5K93A 3SKNA 3LSOA 1FFQA 3ULUC 3D3VB 2R4RL 3RL2A 4RGMB 3I6LE 3REWA 2P1YA 3I6LD 1A8JH 1DLFH 2P44B 5D7SL 1HQ4B 3EO1A 3ES6B 4BYHA 4ELMB 4PREB 5EUOE 1Q9OB 4M3JA 3GHEH 5EZLA 4KVCH 3LEVL 2YEZB 3QUYA 1Q38A 3DX8A 4PJBA 3TNMA 4M7LL 4NZTH 1QA9B 5KVFL 4MQ7A 2ZG3A 1ZLSL 4EUPH 1OQOA 1WLHA 1IGJA 5C07A 4K8RH 5I6XB 2SEBB 1E0OB 1NC2D 3FO9B 5KN5A 5GISH 5D9SA 4HGKC 4M61A 1WZKA 4YK4B 4ZDHA 3VH8G 2AV7B 4DZ8B 3KGRA 2P8PB 5FV2A 5JW4Q 1ADQH 4I3SH 5C09B 5CP3H 1I4FA 1CYGA 3MCKB 1DJSA 1KTDB 2ZSVB 3GIZL 4N0FA 2ARJB 4UQ3A 2C3XA 1BX2B 4ZS6D 4Z7WB 4NNXB 1FSKB 1KJ3H 2DTML 4LRIA 1T83A 5D1QC 3TNNB 5JW4N 3T0VA 3U2SA 5IB2A 1EBPA 3IJSA 3OR7B 1OGAB 1FYTE 1A21A 1VFUA 6CGTA 2AQ1A 3S97C 3UTOA 1GGIL 2F19L 3SQOH 4PLNC 4AIZA 4UILL 2KBGA 4BJLA 4X6CA 5GZNC 4LDEB 4BKLB 1RAMA 1NCBL 3PWPB 3T09A 2EDHA 1Z9MA 2W07A 2CIIB 1KCKA 4PJBE 4PJDF 3QUYD 5ERWB 5JHDA 5K9JL 4P2RB 1NL0L 1HSAB 3CIQA 1C5BH 1QPPA 4CBPA 1OAKH 5C07D 4N8VG 5L6YL 4XNUH 4LPXA 1BM3L 2HFEA 5HPOA 3Q0HA 3QHZH 5KSUA 3ZMRA 2W65B 1C8PA 3H9SA 3BE1H 5CAYB 2A73B 3GMPA 2Q76A 2XG4A 1ACZA 1U91B 3EFDL 1RD6A 2WLYA 2XG5A 5FO9B 3N06B 4KXZI 3RVXD 4QF1B 3TZVA 3PWVA 4JQIL 2EDFA 2HMIC 5GJSL 4ELMF 3LQZA 5DJAB 3CX5J 2CIKA 3MUY1 4O51B 2HTLC 4YEEA 4PJIF 3L5JA 3ILQC 3MJ8A 2X7LA 4GKSA 1S7RA 1IRAY 4I18B 1RSFA 5IHLB 3M17A 4QRTB 2BDNL 4WW1A 3MMEA 1NJ9A 5IHUH 3FMGL 2V9QA 5ID1B 1Q0YL 4XGZA 4ZPVA 5HYSA 4S1DD 3BZ4A 4BK4A 5D7IB 3RDTC 1K4DB 3QWOB 1QUNA 4X6CE 2F54A 2Y9RT 2AQ2A 2NY1B 2G60H 5E8NA 3ULUD 4HIJB 4DN3L 1GPOL 4UNTA 5B3JE 2QBWA 1T22A 1HINL 3C8KA 2EDLA 2OM5A 5JHDD 3S3PA 1S9KC 1L6ZA 5T5NG 2VZTA 1OP3K 1CXIA 4LLUB 4TPRH 5KOMC 4Z7WF 3OKDA 4L8DB 4IRZH 2IANA 4ERSH 3RA7L 2B8OT 3ZKND 3H9SE 5DEGB 3H9SD 3D9AH 1A5FH 2ERJB 1D5MB 1QFWH 1NCCL 3KPOB 4JFFB 2R2BB 4OIBA 4L4VA 1MHEA 3S4SA 5C0DB 2G5BB 3TZVD 3ARGA 1EV2E 5H37H 4OIAA 4XMKL 3C5SB 4JQXC 4OCYH 5KSBE 5IP4A 3UPRA 2GCYA 1T7YA 4NRXB 1OM3H 2DRUA 4O5LH 1ZA3A 2AABH 2G2RB 2AAVA 1M71B 1F4HA 4YE4L 1B88A 2JB6A 35C8L 5BO1H 4JLRB 3U0TA 2CKBA 4OV6F 4HS3B 1I9IL 1NAKL 4LCUA 3F8UB 4NQVA 4Z18A 2E7MA 1JGEB 5J11B 3B83A 4DGIL 4I77L 5DK3A 5IJVA 2F58H 2F54E 2XZAH 4Q9RL 2Z35A 1MLCB 2F54D 15C8L 5MI0C 1X4YA 1MFEH 2CLRB 1MCOH 2BFVL 3FO2B 5SV4A 1A9EB 4PG9A 4J3SA 2R23B 2NCMA 5HI5C 3TCLB 3B9KB 1XGYH 2P5EB 3JVGC 1LD9B 4ONHA 5FGRA 1IEBB 4QWWC 3U30C 3WJLA 5GZND 4L8SC 3RWDA 3L3KB 1ODAA 4LLDA 4YJZL 2IANE 2JTDA 43CAA 4JKMA 5ESQA 2CK2A 2X4TB 2F8XC 3IU4H 2MFNA 4AEIL 3D48R 2ED7A 2OJEA 1U93B 3CVIL 2AJSH 3PL6C 5LGHL 1K85A 1YECL 1VFBB 4QXTA 2GY5A 4WI6A 4KJPC 3DVGA 3RTQC 3SCMB 4CJ1A 5HYIA 4L4VE 4TRPH 5EULV 4XI5D 1RIVL 3NVQA 4L4VD 3E3QC 1B6UA 1J0ZA 3ARGD 3SPVB 3U48A 5DJXB 3LS4H 3DXAE 2X4QA 3S3JA 2NZ9C 5BS0E 1IZJA 1HQRA 1FDLH 1RY7B 5C0ND 3DURB 4WHTB 2O5XL 4QRSB 4Y4KC 2DQJL 1ETZA 3S35X 1AFVL 2HMID 4U1SB 4S1SH 5FAAA 4JQXA 4KUCF 4Y5YC 5DQDH 5JIPA 4GS7C 4Q2ZB 1CR9L 3ILQD 3BVNA 4PRDB 4Y5VB 2OS7A 1BIHA 4CU8A 4MXVF 1BFOA 1NGPL 2XWJA 4WI3A 4BH7A 3VG0L 2DM3A 4Y5XB 5DQ9B 5A2LH 2EIBA 2IAMB 1NLDH 4JREB 4LHUB 4JN1H 2P8MB 1ZAGA 5E5MA 2C3VA 2GJ6B 1Q1JH 2AERT 2YZ1A 3SY0A 1KNOA 1TJGH 1RZGA 4NZUL 2VUYA 4PP1D 3GNMH 1EUUA 5DXWA 3SOBH 3QIUC 5TH2B 3U79A 4X6EA 2W0FA 3VD7A 2XY2A 3WFHB 1J8HB 4JVPA 1UZ6E 3QI9C 3JVGA 3P4NB 2I07B 4M1DH 1HNGA 1IC1A 4WRLA 5T3XH 3SE4C 3QIWA 1JHTB 5K9QI 4HWZB 4NCC1 1AGDA 4D0BB 4PY7A 3QFJA 4PPTA 5F3BB 4U31A 1G0YR 4M5YH 1WTLA 1VPOL 5ENWB 4PB9L 3CVHB 1UWXK 1WAAF 2CLZA 4KH2A 3Q6GH 4L8BB 4LSDA 1YEFH 1GYAA 4OLXL 2DN7A 5CP7B 1U3HA 1SEQH 3VMPA 5IG7A 2P46B 3W0WD 5KSVA 5GRVL 3ARDC 5HYSG 1JV5B 3FONB 1WBXA 4OUUA 4L3CB 1T0MB 3C2SA 5EFIB 2HT4C 4UT9L 3R8QA 1JUFB 4UQ2B 1A02N 3CFEB 4LSVH 1AKJA 4JGUA 1CIUA 4JRWA 5DVNA 4GG6B 1H3PL 4UDUA 1KPUA 3VXUB 1H15B 4KRPC 1CL7L 3LKPA 4GRWB 4O00A 5CWSA 5C0CA 5IW1A 1TETH 5TDPB 4S2SB 2ZCKH 3KLAB 4S1RH 1Z9OA 5CZVL 4QHKJ 1DN0A 2X4UA 3L9RB 3O6LL 4I0PA 3L5HA 2H3NB 5AEAA 5I30H 4ONGL 1FVCA 5HI5D 4MS8D 1SYSA 3EYQC 1MREL 3W9DA 1PBYA 2A6JA 3KPQB 1MCQA 3AC0A 3G6JB 3QIWD 4QWWD 4YO0B 5E1HB 5C08A 3CNKA 2IQAB 1BEYH 4B7IA 3QFJD 2IPTL 1BOYA 1O0VA 2RAMA 4MNQB 2AP2A 1MCLA 1FLTX 5JQ6L 3L7FB 5IBTL 4E5XA 3MOAH 2Y36L 3SE4A 1KCRH 1EGJL 1LO2H 5D2LA 3F58H 3QUKB 5FUOH 5MEPA 3ULVF 2X6MA 5HBBA 5ILTL 1U3HD 5BOPA 1YNTA 1HHIA 2PO6B 4G9DA 4IOFC 4YBLC 5BZDB 4NKDB 2BSED 2AEPL 1GHFH 2YHGA 3NA9L 3GUTA 2V2XB 4R4BA 3MLRH 2NZ9D 1B0GB 4RCAA 4PGEB 4FQ1L 4YX2H 2YD9A 4PYHA 1DFBL 1KJMA 1CVRA 2QEJA 2H32H 1AKJD 4IJ3C 4Z9KB 3BGFC 2NY0D 5GS3A 2Z8RA 5L9DH 5CUSL 5IHZA 3MR9A 5FA4A 3JZ7A 5C0CE 1INEL 4P9HH 2QR0A 2VDPL 3TN0C 3WIIH 1UYWH 1KENL 5F9JB 5DUBB 5TDNA 3HUJF 2RIKA 3QNXB 5DF0A 1OD7A 3GI9H 5IGXL 3ARQA 2A6DB 4GOSA 3G5YA 4GW5A 1QKZL 3RVWD 4I0PD 1MQ8A 2EDQA 3BPNC 5FIEA 1FC2D 4G6ML 2DLFH 5C08D 2DIAA 2DIBA 2O5YL 2GYSA 2HWZL 1IBGH 2ADGA 4IRJA 5D93B 4LPUA 4YC2B 2FO4A 1GAFH 3TC9A 1A1OA 4PJ9C 1HDMB 1EFQA 4GG6F 1BJ1J 2WK2A 1X5HA 2ZOLB 4R0LC 5D2LE 3VGHA 1XIWB 4Y4FC 1Z0MA 4Y8DC 4GRWF 4EDWL 5A2KH 4GW1A 5E95B 1S8DB 1EEYA 3HFMH 2GITB 5MP6L 4M43L 1RQ5A 1T1ZA 2QQLH 3OMZA 3MBXH 2R0LL 1HHHB 2BSTB 1KJ2L 1G7LA 2R2EB 2VTFA 3OKOB 1Q9KA 5DJ2A 2LAAA 1TQCC 3WDIA 4Z6AT 1NSNH 5KZCB 2BNQB 4RQQA 1VEOA 4WFHE 2DMKA 4MJIE 5A2JH 3CDCA 4YDJA 5DLML 4KJQC 3HRZA 1H8NA 3LZFL 4MNHA 3VFPA 5I71B 4KRPD 1JJUA 3KS0J 4Z7VB 3UTPD 1IT9L 1NGQL 3MLTB 1XR8B 1XGRA 5GGSA 5HHPA 5I76B 1QYGL 1Y0LB 5EU3A 3RWHB 1N0XH 3MV8B 1BVLB 1P2CA 2ADJA 1UG9A 4NCC2 3I02A 3FJTA 2IALA 1TITA 2DQCH 3QFDB 1J1OL 4LLYB 3NCBB 2PETA 4ZOBA 4YHZL 5L2JA 3W9EA 3F5WB 3MLYH 2BVOA 1CK0L 4FRWA 3T4AA 5IK3B 4HXBL 4KK5C 2EXWC 4WWKA 4OKVB 1G6RA 1UWEL 4HKZB 3BYYA 3TPUB 1UZ8A 3GGWA 3Q48A 8FABA 1IGCL 4ALAL 5T1KB 3LKSA 4F37K 1RZIB 4IOFD 5D1ZC 2OTWA 2QQQA 3HNVH 1CGYA 3W39B 1INDH 5HHOE 2ICWA 4U1LB 1J1PH 2Q7YA 2WBJC 2ZG1A 4JKPL 3MLPA 4X7CC 3PHQB 4XPBL 4LPCA 1MJ8H 3MJ7B 3S98A 2ZCHH 1KTLA 4JDZB 2ZOKB 1PEWA 4LMQE 3C09B 2WWMC 3VGBA 1KBGL 4JFPB 3AAZA 4JFXB 2P43B 3QAZB 3SE9H 3T0WA 1ZHNA 3ESVF 5F44A 3U7YL 1JWSA 4PB0L 1OWWA 4X9FA 4PBVC 1QO3B 4L3EA 5INCB 3SDXA 4PJFE 3C08L 1UWGH 4AQOA 3RPIB 3UO1L 5L2KB 4GLRI 5GS0D 5J1TC 3U0PB 5I1IL 2VXUH 1I7TA 4I1NB 4CNIA 3WNKA 4DK3A 5JHLL 1JCKA 5ICYA 4DAGH 4AJ0A 3QRGH 3P4OA 3Q6FB 2NY6B 4BFEA 3VD3A 4FTVB 3RBGA 5KS9A 4Y4HC 3BJ91 3KPSB 3E8UH 4ESKA 2OI9C 4UIKH 1IL1A 4G9FB 2XFXB 5D2NC 2I9TA 3H9HB 3VWJC 4WWKD 2PTTB 4XHJC 3H2WA 3OAZH 5DJCA 1RZ7H 3QJFB 4IIQC 4Z7VF 1A3LH 4KMTH 3MUGB 2BY0A 4X7EC 4FMFA 1MWAB 1NC4A 5DJYA 1MY5A 1BIIB 1CN4A 4JHWH 1HI6B 3T77B 1OP5H 5F7DB 1M05B 1S7QB 3LDBC 5DQJB 1QPXA 2FJHB 2VXQH 1ZLVH 3RWCA 1RFDH 3HN3A 4LHJB 2Z31C 5I1HH 2V7HB 3DHMA 3DMMB 1L7IL 1VACA 4GXVH 1CF8L 3ZTJG 4HEME 4M7KL 5HHMB 3CSGA 4AQ1B 2NQCA 4NO2B 2BVPB 4YHOL 3K8MA 3R06B 1TCMA 3T08A 1UACL 5C0EA 2NY4C 1QFPA 3V0WH 4PGZA 5AZEH 2HH0L 1XF2A 1GVIA 4L3EE 1CXFA 4FQQB 3SDXE 3B3IA 3MRKA 1ULVA 1YEJH 3BIKA 1PFCA 4L3ED 1CFBA 1ADQA 2F15A 5CP3A 2IPUG 3HG1B 3C8DA 3OB0H 3GSQB 4OIIH 4NKMB 1OCWL 4LAQH 5HDLA 4N68A 1DQJA 4DEPB 2V7NB 4LCYA 5DD3H 1ORSB 1MJ7L 3JTTB 1UXSA 1LO0L 3L7EB 4WU7B 4LCCC 4X8JA 5KS9E 4FQLH 4FZEH 5A43C 4UBDD 1AR2A 1UADC 1KG0B 2FJFA 5DK2B 3HCVA 5DJ6B 4LMQI 4W70A 1OARL 2EIZA 1HH9B 1FORH 1FBIL 3LCYA 4XMLL 3MA7A 1L0YA 4M6AA 1UM5H 1DDHB 1XGPB 5D2NA 4WFEE 4G7YH 3VWJA 5DHYB 4IIQA 1KCVL 4MMXC 4XBEH 1CBVH 3WLBA 1MHCB 5D1XC 5F7YC 5IVXB 2NNAA 4U1JA 1A6TA 1WBZB 3EJYC 2H9GA 4JRYB 4K8RD 1RIUL 1A0QL 1JIBA 2B1HL 4P23C 2XKSA 1FNGA 2GT9B 4V1DA 2V2WA 4XP4L 2O61B 4F7TB 4BM7A 5D6CA 3EYUL 1N7ML 5FM5O 3U36B 4G43B 3DX6A 4XVJL 3RWGA 3RRQA 2Z31A 2EE2A 2J1KA 3VXSA 4G3YL 3QCUH 3V2AR 1ZVSA 1TVBB 4ZTOL 3HAEG 1K5NB 2DQGL 3OGOE 5ADPH 3EOYG 1K9TA 1QSFD 5DK0B 4K3JL 2PR4L 4PBXA 1FJ1B 1GIGL 4P2OA 5FB8B 5C0FA 4OZHE 3ZLQC 4UNUA 5J3HD 4M8VA 2QTEA 4GXUN 4K23H 1SJHB 3O2VH 2CRIA 3GSXB 2HTKD 4LQFL 4I4WA 3A67L 3T8XB 4OGYH 3TCXA 1LO4L 1KPVA 5IB1A 1I8KB 1IM9B 3PP3H 1N64L 1CGVA 3ELAT 2EKSA 2VN7A 2OCFD 3TBWB 3O6FA 1NBYB 4PJGA 2WIIB 3VWJD 3N85L 3NCYP 1YMMA 4XHJD 3QXTA 5GSVB 1HYRC 3V6OA 4HPYL 4BQCA 4NUJB 3ZE2F 3MV11 3BXNA 1Y18B 1A9BA 1J05A 1QFHA 3MYZA 4YDIL 5T33H 5ACZB 1IGFL 2F74A 5K59F 4V1DE 1MHPH 1FNSH 3TBYA 4FG6C 1YYLH 4V1DD 4HJJH 1FG2B 4NZJA 4R26L 4FQ2L 3LQAH 4QOKB 25C8L 4K3GA 2ZZUT 3V7MA 4AL8L 3QCVL 2Z31D 5MENA 1ZWIB 4P23A 3V0VB 3VXSD 3F65A 2XOTA 5C1MB 4UB0L 4U0RB 3NBNA 3SGDH 3UYOD 4ZFGL 3G5ZA 3RX8A 2AEWA 5CCKL 4ORGA 1S7SA 5JOFA 1FZOB 1LO5B 1VEPA 1I1FA 3U7WH 3GHBL 32C2A 1KIRB 4P2OD 3HPLA 5SX5H 1HXYA 1F5WA 4E41E 1ZA6B 1UCTA 3QR2A 4X83A 1MLBA 1U8HB 2IMMA 5C92A 3X14B 2OL3L 4XRCA 3U46A 4TVPH 5CBEA 3SE8L 4P2QE 1PYWA 5DD5L 1P7KA 2WWKT 4JDTH 4OZFG 4BFBD 1A7PH 1EK3A 3NPSC 5JNYB 2DM4A 4WFGD 1EHAA 4YIQA 4Z7OE 1F3JA 1S3KH 5LQBL 4FQCH 5ETUA 4D0CA 2CGRH 4U1GB 5AG8A 4OD1L 3O6FD 1YMME 1YMMD 3PGCA 4NQXA 5FA3B 3V6OE 5ICZB 2W0LA 2HJKA 3LIZH 2X9XA 4HIEB 2PW2B 1I3VA 4M6MH 3V8CA 1XT5A 2ADFL 5AD0A 1F3DH 1R3JB 3DRQA 4PRPB 2B2XL 4FFYL 3ILPB 4G5ZL 2UUDK 1D5BB 4RGOL 3EZ8A 4TSBL 1EEQA 1T03H 4JN2A 4ACPA 1YN6B 2X4PB 1CE6A 5MENE 1AXTL 5MEND 1IAMA 4WUUA 1L7TH 3QEGH 4GAGL 1F6FB 4M02A 1FFOB 4P23D 4CRPA 2VR4A 2NY3B 3L3HB 4FQXA 4H1LB 2Q6WA 2BVUA 4WTWA 5DD1H 4YAQB 4HUNB 3DX7A 4G6JL 3KR3H 4MWFA 2NW3A 3TA3C 3MRLB 1J0KA 4S1QL 4BUGA 4KDTA 2ICCA 3IFPA 4JO1L 4XX1G 3HZKA 5ADOH 3I84A 3FQNA 5DDHA 3SDAC 3EGSA 3CAFA 3DSFH 4JRXE 1A4KA 1V7MH 1R24A 1CDGA 5FO8B 2J6EH 3V4PL 4MJ6B 5DD0L 3QUMH 3SGKC 5CEZH 1TJHH 1EH9A 4X6FA 2ADIA 5IFHL 1T2QL 5DT1H 3FB8B 5HPMA 4HK3J 5D5MA 1UFUA 1RULH 3IKKA 2FCBA 2YKLH 4Y19B 3MGOB 2MMXA 2GFBA 1G84A 2GUOA 4BELD 4OQTL 3PJSB 1A2YB 2R56H 3GSNL 1V3KA 1U95A 4PRIB 5DJZB 3TJHD 2VE6B 5IQ9B 1D6EA 5CINL 3K8KA 2QQKL 4N9GB 5EU6B 4KK9D 3O6KH 4FFVC 2EO1A 2QJDA 1PKOA 5J7CC 5IR1B 5LAXB 1JGUH 3B9DA 4Y89A 4WUUE 4OZIE 3FT2B 4QRQB 2GIYA 4WUUD 1IFHH 1X4ZA 3TH3T 3E0GA 4FQXD 4JZNA 4F33A 4MD0B 3BKJL 3DSNA 1OL0A 4LIQE 2JB5H 4O58L 4EEEA 2CDGA 3B4NA 5BV7L 3BHBB 4DN4L 4NGHL 2D7QA 5FDYA 2A83A 5BVPL 3WXWL 1T89C 4NJ9H 1R3IL 3QIBB 1FNHA 3Q3GB 3P11H 3DYMA 3KLSA 4R7NA 1MSPA 1DL7L 4XBGB 3KYKH 4B50A 5B39A 1AD9B 5EPMB 1HZHL 5FUZH 3QQ3A 4HMDA 2N1KA 1NBQA 5C7XH 2VN4A 4MXWH 1DLHB 1IMHC 2FD6L 4QYOA 4FFZL 2Z93B 1U92B 1KT2B 2XKNA 1QFWI 1N5AA 3SGKA 1CFTA 2LAGB 5EA0L 4G8EB 5EIVA 3ZDYF 2ZUTA 1IQDA 2DBLH 2XWTA 4POZC 3SJVA 3BKYL 5T1LA 4HHAA 3RU8H 1MH5B 5DI8B 4F8QA 2X4RA 1K2DB 3ARBC 1W72H 4NO0B 5JXAL 2UYLB 4ZAKB 1CLOL 1IKNC 5GJTL 1FH5L 2BRRH 3VRJA 4PLKC 4ZO8A 2DOCA 1HIML 4XAKE 4QRPA 1U0QA 1PKQA 1F11A 4G7VL 4XAKD 2VLJE 3O11B 2DQDL 5T3XD 4XP6L 3QDJB 4NQSA 3GSUB 2H45A 4K3HA 4WI5A 1KLUB 2RCSL 3FT4B 2VDML 3MRDB 4F7MA 4PJ7A 4C57C 3UMTA 4LVOB 3UPAA 5CZXC 1R5IA 4QY8A 3VCLA 1YNKL 5I8KH 4JAMB 12E8L 3B5HA 3O2WH 2C7UA 2XT1B 1NFDF 4G80A 1CZ8L 4MCZA 5E5UB 3WNNA 4U33A 4RFNB 2Q8AH 1BP3B 2FX8L 2PXYC 3UBXG 5F70A 3U0WL 4C56B 2NXYC 3MLSL 1J5OH 5SV3A 1YEHL 3SN6N 2FL5B 7CGTA 1IAKB 3VXNA 2J8UB 3MOQA 5F97E 1YPZF 1FZKA 2H32A 2EDEA 2VXTH 1MJUH 2PUQT 3GMOA 4I2XA 4OF3A 3FB7A 3MRBA 5CZKA 3IDIB 3L5XH 3DOSA 4GRMB 1WCBA 5C0RH 3P77A 4R90L 1C12B 5IKCB 5IMMA 3CDGA 3SJVD 2BVQA 5T1LD 3QZWA 5EZJB 4H88H 4TNVK 5DFVC 3KYMB 3K1DA 4FXLA 2B4CH 1WZMA 2O5ZL 5GRYA 2LFGA 4HXAL 1BAFH 4QRPE 4W6YB 3VH8B 1PKQE 4WI2A 4QRPD 2AXHA 1OW0C 4NHUB 3RGVB 1XH3A 2IF7A 5EBMB 2IADA 3G08A 3WFBL 4ODUA 3VWKC 2I27N 1SJEA 2MPAL 2G75B 1PX3A 4OI9A 1YYMH 5EZIH 3AXLB 3OKMA 4RMRA 4OCXL 1AI1H 4OKDA 2AV1A 3DBXA 4RFEA 3BEWB 4WNQB 4ZG1A 4BQ8A 4ETQB 1FFNB 1NAML 5KVEH 4KTEH 3I6GB 4WHCA 3F7RA 4KHXH 5C9JB 1F4XL 5GGTL 3M8OL 2IH1A 3VFSB 4CVXA 4GQPH 4ONFH 4K94L 3O8XA 3ARSA 5IROA 1WFOA 3BO8A 4YFDB 3U6RB 3PHOB 4CADA 3QRFM 1LILA 1W0YT 2PXYA 5C2BH 1EJOL 2V5MA 3EYOB 3BKML 3QPXH 4AG4H 1CIDA 1BREA 4XPFH 2ZUSA 1FCGA 3V7AG 5T3ZL 2FZ3A 5I1AA 1A6VL 4UIMA 1RHFA 4JZJC 1HH6A 5LG1A 5GSRA 4OI7A 4DKFH 2XQYG 2EDJA 2OP4H 2R0KL 1A7OL 3BKCH 4JVUA 2X05A 1LK3L 2FR4A 1N0LA 4ZD3H 1D5IH 4J4PC 1OAZH 4XPGL 1U3YA 2D7PA 3CZFA 3MXWH 1W2KT 1WIPA 3HC4L 1N26A 1IEAB 3FN0H 2YN5A 4R7DB 3DO7A 5H35B 4HULB 4GKZA 5E2VH 5I16A 2CO7B 3P9LA 4PLKD 4ODTL 5HDBE 3VGAC 4DVBA 4LCWA 4GQ9L 1PG7W 3VWKA 1YJDL 4NN5C 4YR6B 2HYMA 2AK4D 5F7NC 3IDMB 2FH8A 3UTTA 2APWA 5HGDB 4Q9QH 5L7XL 5EUOB 1LNUB 2BHZA 3G04A 3O3DA 4TVSa 3KJ4C 1MEXL 2OK0L 1FGNH 5B39G 5I8EA 4HPOL 3ZYZA 3O8XD 5JW5A 1N4XH 4RRPA 5C0JA 3DV4A 5LBSL 1VKXA 1C1EL 1OPGL 3V5KA 4KVCL 1JZ7A 2PXYD 1XCTB 1FGVH 2OXHA 3DV6B 5DRNB 1FIGL 3NIFF 4MNGA 4D9LL 4U6HB 1NC2B 2WBKA 4ODVH 5IOPB 1UM4L 4HDIB 4NRZA 3NABH 5IFJA 2A9NH 1LE5A 4JCLA 4D3CL 4TUKH 5E2UL 3T4YA 3KPTA 4PJEA 3RNQB 4WTXA 2F53E 3ALXA 5DMKA 4YGAB 4PIRF 3UJIH 3WJJC 1KLFA 5I1JH 2WV3A 4Z95H 3GSRA 4PYGA 3VI4F 5DEFA 2Z92B 5DURD 4MQXD 1JFQH 4KTDL 2FX9L 5IVZB 3MBEB 1LMKA 4MQTB 5DFVD 4NN6C 1WC7B 4HKXA 4ISVB 4FFWD 1QR1A 5EC1A 4X9GA 3LSOB 3SKNB 4ZFZA 3HKFA 4XWOD 3KJ6L 4HLZG 4LCWD 1LK2A 3WNOA 2FEDD 3L1OH 4WW2C 1NBVH 4JZOB 3RL2B 3VWKD 2P5WA 1I9JL 3LRSA 3REWB 1BFSA 3CFBA 3KXFD 3EO1B 3UTTD 3BUYA 5FYKL 1X3DA 3GBLA 3CH1A 5ABDE 4U1IA 3KDMA 3LS5H 5EZLB 2EIDA 3QUYB 4H0IA 4M5ZL 4PJBB 2FBJL 3GRWL 3TNMB 1JGVL 1T4KA 1ZHLA 4MQ7B 3T3MF 4ZOEA 4NHCH 3VXRE 1IGJB 5C07B 2IQ9L 2Q87A 4X7TA 4G8GE 3RI5F 5AUMA 2ZUUA 2E8YA 3PDGA 3NFPA 5KN5B 3MJGX 1JPGA 2ATPA 2MCPL 4JB9H 4ZODA 2M8XA 3MCLL 3QZWG 5D9SB 4M61B 3OX8A 3VD9A 4ZDHB 4UT6L 3U4BL 1X5ZA 5ISZE 3QHZL 1S78D 5GRJH 3FQTA 1VEMA 3P0YH 2AK1H 2HP4A 5CSZA 1I4FB 5EUOF 4MB5A 4N0FB 1TZGL 4UQ3B 1S5IL 5I1KH 2WWKO 2Y07L 4HLJA 4NDMA 4Q74A 5FHAH 1LP9A 2MQ0A 4F15B 4P4RA 5IB2B 3U2SB 3BZEA 4M1CC 4XZUA 5FF6A 1YEKL 3IJSB 1VADA 3KLHC 1NUGA 3GB7A 3X3GH 2P5WE 1CD1A 1HKFA 5TF1L 2P5WD 4LQ1A 4AIZB 1VHPA 4ZO7A 5JTWA 4Y88A 4DCQA 3LKOA 1GGBL 1FAIL 4X6CB 5IHUL 3VW3H 4H26A 4MXQD 4HJGA 4DGVL 3NFSH 1ONQA 4RZCA 5JHDB 4OCSL 5BV7C 3S35L 1OTUC 3AY4A 3BH8A 3MLWH 1U6AH 5CIPA 2YPVL 4H8WL 2HFEB 4ELKA 1QSEE 5KSUB 3H9SB 3GMPB 2Q76B 5CKAA 1QLEL 1ZANH 3ARRA 3I50H 3V79C 3K74B 3CFKA 3TO4C 2EYTA 3TZVB 3LOWA 3PWVB 2X2YA 1V7NH 3U1SL 2XICA 1JGLL 2P48B 4LVEA 4NQCA 3WUZA 3LQZB 2CIKB 1YY8A 1TZHA 1MFAH 3D39A 4JJ5A 5JPNA 4CKVX 3MJ8B 4LLMA 4OZGA 5J1SC 2X7LB 4GKSB 1S7RB 3MRNA 4OGAD 1NUNB 5J12C 4P4KC 4WW1B 2DQUH 3MMEB 2E7LC 1NJ9B 5DRXB 3MRQA 5F9WC 2WAHA 2DMBA 3LKNA 3PDOA 4XGZB 1F3RB 4ZPVB 5DMYA 3W2DH 5HYSB 2W9DH 1RUQL 3BZ4B 1RURH 3QCTH 4NWTL 3FZUC 3CK0L 2D4DA 2CR6A 2F54B 4LSPL 5BO1L 1JZ2A 5E8NB 4RRPG 3QHTC 2EDWA 3B6SA 1BFVH 1T22B 3C8KB 4MCYA 3RHWK 1SQ2N 1E28A 1HHJA 4NUGL 1R3KA 2W9LA 1BVZA 3GO1H 5BMFH 4LEXL 3BAEL 5J57B 3OKDB 1ZHBA 2IANB 1UJ3A 2Q7NA 1PZUB 3OKYA 3UEZA 1X5XA 4O9HL 3HB3D 1WGOA 5E99H 4PRBA 3GMQA 2YK1L 5EBWA 1G7MA 4NKIH 4XC1H 2GJJA 4KHTL 3HE7C 5JR1H 4L4VB 1MHEB 3S4SB 2OZ4H 2B0SH 4PJCA 1ES0A 1F6LL 3ARGB 1CFSA 4NQCE 3JUZA 4JM2A 3TFKC 2Y5TA 2YRLA 2NY7H 4NQCD 5LWYH 5I15H 4X6CF 5IQ7H 2D7TH 1MY7A 4OLWH 3MCG1 1JGDA 3D39D 4OZGE 3FO0L 3UPRB 2GCYB 4GO6B 4JHZA 4W81A 4GW4A 5L0QB 2VWEE 2YMXH 1ZA3B 2J8OA 2CUMA 4JPVH 4ZUWB 1ROWA 4MZ3A 4LIQL 2JB6B 1YNLH 3U0TB 2CKBB 5HDQH 3BP5A 4FNLH 5KG9A 2X1WL 4LCUB 1KXTB 4F58L 4NQVB 3O9WA 4M00A 4AZ8A 5IJVB 1UH3A 2DL2A 4HFUL 2Z35B 2E27L 3WEXA 3KLHD 1JNLL 3AM8C 1N6QH 1X5FA 4PG9B 2OJZL 4EIZC 3UAJC 4ONHB 4P2RE 4GAJH 1JRHL 4LSRL 4PTTA 1MFCH 5KSBF 3RWDB 5DUPL 1TPXC 1MCKA 1OT2A 2DQIH 5DO2C 4LLDB 1UH4A 1N3NA 1Y6KR 4RWHA 43CAB 3S9DB 5ESQB 4K94C 4DKEH 2DS4A 3VFMA 1JMXA 4YXHL 5DJ8A 3BQUA 3NZHL 5DR5H 2OJEB 3C5JA 4GBXA 3SOBL 3JWOH 4YUEH 3RZWA 4HIXL 3DVGB 5LCVH 1RZFH 5JW4R 4PLJD 3ECBA 3S96A 3IFLH 3S5LA 1KOAA 1NKOA 3HR6A 3HMWL 4JM2D 3FOMA 1T6WA 5L8JB 3K7UA 1FNLA 1FE8H 2X4QB 1WT5C 4NN7B 4OM1L 5GS1A 4KZDL 1A7NH 4LASH 2QSCL 5JO5A 5DA4A 1BD2D 3LHPL 4UOJA 1ETZB 3OJDA 1EXUA 3V9FA 1J88A 2JJSA 4YWGL 5J56B 5HY9A 3IU3A 3ARZA 3X13B 5BW7A 3CX2A 3HZVA 1RUAL 2VDLL 3BVNB 1XF1A 4KC3B 1SEQL 4ODHL 5B3NA 1BFOB 5E6YA 4HBCH 2XWJB 4KKBC 4BH7B 3O9WD 5CJOL 5D7IE 4TVPE 4QO1A 5ANMA 2HRPH 4TVPD 2DQHL 2J6EA 3QUMA 3EOBA 2C3VB 5E5MB 4LSVL 5TQ2H 3SY0B 1KNOB 1RZGB 5D7KE 3FZUD 3T1FA 3IDGB 4HCRL 4X6EB 2W0FB 5I8CA 1CFVL 2DQEL 2YD8A 1KB5L 3H0TA 3MSPA 1YEGH 1T7ZA 5ITBL 3MRFA 3BQUD 4GKNA 3RZCC 4GBXD 4K3EL 3QNYA 3QIWB 3U30B 1V5JA 3BEVA 1CXKA 4WVRA 3O2DH 1AGDB 4KQ4H 4PY7B 1T0PB 3IKCA 3QFJB 4F80A 4B0MM 3AS0A 3EYSH 4PG2C 1KEMH 1A14H 2X10A 1KF9B 2CLZB 5EOCH 4MA3A 1KN4L 3S88H 3OL2A 5J13C 2UZIH 3Q1SL 2VZ1A 4MX7A 1KV3A 1RUMH 1N6UA 1IC4H 1U3HB 3P0VH 1T7WA 2EXYC 5D71H 2EECA 5EZOL 5IG7B 3CC5A 5KSVB 3TFKD 4FQIL 1LO2L 3D6GA 1PG7H 5JORA 4LSTH 1WBXB 4OUUB 3TVMC 1DBJL 3DI2B 1CGXA 4J3TA 3K1KC 4YFLI 1QBMH 1YEEH 1AKJB 1UZ6F 2NY0B 2Y6SC 2CK0L 4OCRL 3I75A 1FPTL 4UDUB 1VENA 1KPUB 1NGWA 1H8SA 2MHAA 1KEGL 1F90L 3VFUA 5IB3A 3LKPB 2AJVL 4U2YA 5CWSB 1ZMYA 3JV0A 5C0CB 5CEZD 5IW1B 4WCYH 4DGYH 1JPTL 1Y6NR 3BSZL 5L9DL 2W0KA 1X5YA 3QUZA 3HI6H 2XA8L 2B7DT 2DDQH 1DN0B 5F7FA 2X4UB 3FAXA 4HUMB 4I0PB 4HW6A 3WIIL 1FVCB 1U8JA 3LD8B 3SGDI 1SYSB 3I9GH 4HX1A 3W9DB 2A6JB 1JF1A 5C08B 1W72A 5E8DL 4D2NA 1RZJC 4Z0XA 5HYJA 1M6OA 3RWFA 2NY5H 1XF3B 4WTZA 3RHWF 4E5XB 3WHE1 3LKRA 1Q94A 4M6OH 3RZCA 4X5LA 4OJFL 4NPYA 5D2LB 2MKWA 5MEPB 4CW1A 5AZ2L 3WHXA 1AJ7L 4Z7UA 4ENEC 1CE1L 4J8RA 2VLME 3MRMA 2I60L 3DROA 1YNTB 1HHIB 2R29H 4Y2OA 2EH8H 3MODH 4G9DB 4M1GL 1D6VH 3GUTB 4XMPL 2ZSWA 1MPAH 1J1XH 4R4BB 2BRQA 3D0VA 4Z7NF 1U8MA 3AVEA 4K2UH 3IGAA 1KJMB 3DARA 5FXCH 3ARFA 4JM4L 4P59H 1W0VA 1MIEH 3HFML 5GHWL 1JK8A 1MFNA 4A2LA 1WWBX 4WW2F 2C4FU 4HWBL 4JPWL 4DTGH 3MR9B 5FA4B 3QEQD 3T0EC 4HGMA 4PGCA 5B4MC 2QR0B 1RK0A 1GC1H 4AMKH 2D31A 4UTAL 1FNAA 2GJ6E 3PGDA 5J9PA 1CLZL 5TDNB 1OSPH 3VE0A 3ZTNH 3QUZD 5CD3A 2P24A 1BQHG 3G5YB 3FQWA 4GW5B 4XVSL 3VD5A 1KGCD 3BPLC 4KJWD 4JANA 4JPKL 1JWMA 4NQDA 1R3LA 1YEDA 1WUNT 2W9EL 3CPLA 3QDGA 1BQSA 5D4QA 3STZA 2BY2A 5HYJE 2CQVA 3FQRA 1QACA 5E1AA 5HYJD 4JO4H 4IRJB 3MV7A 2VLKA 3QJHA 2FO4B 2R0ZL 1A1OB 2BVTA 5D7JA 3NCJL 2EDXA 3IFNL 3MLUL 3MREA 4HH8A 2EYSA 3RZCD 3PQYA 3KG5A 1NMCB 4OFKA 1OP9A 2ICEA 1SYVA 2NXZC 4GW1B 1J18A 1NEZA 5IB4A 4DOHE 1EEYB 1ORQB 3B43A 4OAWA 5HHVH 4QRRA 2X41A 1QFUH 2BXZA 3WFEL 4Q6IC 3P0GB 3U9PL 3UJJH 5C6TH 1U8LA 2H1PH 3MLZH 5DVKA 1T1ZB 2X1QA 1CDYA 3ARFD 2EXYD 2VSDA 1Z3GH 2FGWL 1G7LB 1UKSA 2IH3A 1Q9KB 5E5RB 5DJ2B 5JUEL 2R69L 4H5SA 5I1GH 4ZUSA 5I0ZA 5D8JL 4RQQB 5DEZA 3SGEH 1QLRA 2K7QA 1MUJA 4OM0L 3GI8L 4HAFA 3TJEH 3VFGH 1K8IA 4MLIA 3HNVL 1G9EA 4YDJB 4OLZH 3HRZB 4MNHB 3R8BB 3VFPB 5GRUH 2ZCLL 4CN1A 3DJ9A 3MRPA 3T0EA 2XRAL 4NQDD 2JJUA 3QDGE 1XGRB 2UY6A 5GGSB 5HHPB 4XP1L 3QDGD 3WFCH 3CXDH 3OAUH 5FYKD 3BDYH 4UDTA 5FKPA 3BWUC 5EU3B 2DKMA 3A0OA 1UCBH 2BY1A 3IDNA 4MDJA 5TPWH 3MV7D 2VLKD 3PP4L 2WLZA 3WIHL 1P2CB 4XXCC 3C5ZA 2ADJB 4XBPA 2BHUA 4DW2L 5BOZG 3PQYD 3I02B 3T04D 2VH5H 2IALB 1I7RA 2R2HA 3N1FC 1MQKL 5L2JB 3W9EB 2V17H 1AIFB 4QRRE 4XCNA 2PYEA 3QUXC 3MJ6A 4QRRD 3LH2H 3T4AB 3NACL 5EWIH 4WWKB 1G6RB 4R3SA 1DQTA 4HKJA 1UZ8B 3GGWB 2DL9A 5E6IA 3FN9A 3VI3F 4U6VL 8FABB 2UY7A 1X4XA 1B2WH 4YHMH 3LKSB 2OTWB 2HAZA 3E1F1 3QHFH 4XP9L 3ZKSD 1RZ7L 1XMWA 2XZQH 2Q7YB 1IC7L 4OGXH 5GGSY 4JFOB 4RDQG 1KTLB 3CLEH 4KROD 3S34H 3VA6A 2IFGA 4L1DA 5C0BA 5SWQA 4HT1L 3AAZB 1A22B 1FO0H 1IGIH 3DVIA 1RZKL 1NCTA 4F7PA 5IMLA 3T0ED 4O2CA 4RGNE 1ZHNB 1AE6L 1JWSB 1T1XB 3LRHA 4RGND 5D70H 5DMGC 3BFOA 4KK6C 4WTZG 4KAQH 4L3EB 2FEEL 3SDXB 3AGVA 1F6AA 3JTSA 3WFDH 1IARB 4NFDA 2QADB 3ZSTA 1VERA 3BP6A 3C5ZD 2JE8A 4ZOAA 3LN4A 1I7TB 3H3PH 4C58B 1Z0NA 3NOIA 3TV3L 4CNIB 2BNUA 5ICYB 3QH3B 2IFFL 3B2VH 4Z5RA 3P4OB 1BF2A 2VL5A 4UOW0 3BPOC 4MYWB 1KCUL 3H42H 4MA7H 2D7OA 4XXCA 4FABH 5KS9B 2PYEE 2X9YA 5L88L 2PYED 4LAQL 1MNUL 2VXVH 1IL1B 2CRMA 1E4KA 5DJCB 4WGVB 3IFOA 1SEBA 1JWUA 3R1GL 5E6ID 3RFZC 4XC3H 1NC4B 2JJTC 4S10A 4XNZC 5DJYB 4LGRB 2YSSB 3O3AA 2B1AL 4RAVA 3IDXL 3NH7H 4PJFF 4ODXB 4Y0GA 2ZPKL 4EUPB 4WUKL 4JKKA 5EB9A 5FKAA 1CGSL 3RWCB 1L9NA 3RNKA 4LNVA 5E56A 2EDBA 1JPSH 1VACB 5C0BD 2KQMA 3BWAA 2HLFD 5I19H 2YR3A 5A2IH 5FM8A 2CMRH 5C0EB 2WUBH 4Y16B 1INQA 4LCIL 3CFDA 3SE3A 1XF2B 3B3IB 3BIKB 3MRKB 4HGWA 4X7SL 3T2NH 4QXGL 3SQBA 5IESH 3GJEA 3QXAB 2VC2L 2IG2L 2AQ3A 3GBNH 1I1AA 3GIVA 3W5MA 1A6WL 2FNBA 3WN5C 1DQJB 3ZL4H 2HFFA 1TTFA 3TBTA 3QWRA 1UXSB