4F57H

Fab structure of a neutralizing antibody l1 from an early subtype a hiv-1 infected patient
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
225
structure length
225
Chain Sequence
b'EVQLVESGGGVVQPGGSLRLSCVASGFSFSDFGMNWVRQAPGKGLEWVAFVPFDRRINYYAESVRGRFTISRDDSKNTVFLQMDSLRPEDTAIYYCAKHRSQWNFWPREGGLDHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light chain of Fab of a neutralizing antibody L1
publication title Viral Escape from Neutralizing Antibodies in Early Subtype A HIV-1 Infection Drives an Increase in Autologous Neutralization Breadth.
pubmed doi rcsb
molecule tags Immune system
total genus 45
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2012-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f57H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f57H01
4FG6C 3CC5A 5IV2B 1F2XK 4H26B 4EI5C 3LQZA 2P5ED 4YDVA 2EEAA 4LLYA 1MNUL 3SKOB 1OT1A 1MCFA 1NAMH 2A0LD 4PLJC 3WUWG 1JPST 5CUSL 4PGBA 1F13A 4HGWA 3VMOA 5INDA 3FQTB 4GKZB 4IBLT 4YC2C 1F4WH 3UXFA 3TIEB 2Z93B 3PP4L 3H6JA 3NFNA 5GSRB 2W60A 2OTWA 2QQLH 3CFCH 5KVMC 5HJ3B 3RKPA 5B21A 1Z6JT 4P4KB 4K94H 4L29B 2IANA 5FYKU 1U58A 3OMZA 2NNAB 1BVZA 4ZQKB 1MHPL 1C5BL 3BP6B 1HCVA 3A67H 3ZKXC 2R23A 4KK9C 3BRGC 3K1DA 3MXVL 2D7TL 2A6JB 1FNGA 1H3UA 3D39B 5D7LD 4IOFC 4XCYA 1DUZB 1JF1B 3MLZH 2DD8L 3KXFE 1JF5A 2X6MA 4KK5C 2Z4QA 5D1XD 2AVGA 2YPLE 2BNQB 5K9KB 4HC1A 4YHIA 4G8EA 2R2HB 4NQTA 5IJKA 4LLUB 4P5KA 3RX7A 3ZYIA 4N5ED 1U8NA 3Q6GL 4MD5A 1RMFL 2OR9H 4KXZH 3SCMC 2GAZA 3JV4B 4OCSL 4QXTA 4MQTB 4PJCA 3LKPA 3VWJB 4XGZA 3GUTB 5JLZB 3TH2T 4MDJB 4U6HA 3MV9B 1A6VL 1N2RA 2V9RA 4M1DL 4EI6A 1JNNL 3HB3D 3AVEA 4QHMB 4LGPB 3B9VA 1CGWA 4P2OC 4TUKL 5C0EA 4RMRA 4MS8D 1SJVA 4JREC 5C0IB 1H5BC 3MGAA 1JCKA 1INQA 4UTBL 2ATPB 2IF7A 2ZOLA 4IJ3B 4GRLA 1IAIH 3WFHB 5C0CE 5F6IB 1JZ6A 5HBBA 3C60B 3RU8H 5TGBB 3MO1A 2J8UE 4PJBE 4KZEH 2DQEH 2IADB 2EZ0D 2XZCH 3T2QA 4GXUM 1MY5A 1EJ6A 1FCGA 1JTPA 5TJWK 2ICWJ 4I77H 1M7DB 1TCRA 3QIWD 1IT9L 1NUNB 2C3WA 5FKPB 4JE4B 4L4TD 3O2VH 1UYWH 2WQ8A 1YYLL 4KJQD 3WXVH 3HR5B 3MRBA 1J05B 1X4YA 1S9WA 4HKBA 2ADGA 2IG2L 2P42B 5JXAH 4ZSOB 4U1NA 5I1DB 1IGTB 2OXGA 3CDCA 2AXJA 3T0EB 3INUH 1N0XH 4HV8A 4ZFOA 4ZFZA 5MHSE 4JN1L 1UQSB 3BZ4A 4NFCA 3CXDL 3L6FB 3LS4L 4WW2B 3S98A 1ZS8B 4K8RH 4TULL 1OAQL 1QEWA 5JW3H 4ODBD 3DUHA 4RBPH 2X42A 1SM3H 5FDWA 3RNKB 2AEQL 3EDEA 4NDMA 1FH5H 1YJDL 3BISA 2OK0H 1EEYA 3LRHA 4OLXL 4I48A 4XNUH 4YHKH 4AEEA 5J6GA 2FJFB 2UUDH 1R0AH 3F7RA 3GMLB 4QHKJ 3AXLB 4M3JA 3GSRB 2OX5A 2CIKB 1I8IB 4PBXA 4JEGB 1YEIH 1CFQB 2EYTB 3NCFB 1JPTH 1J9CT 4BK4A 5BV7H 3V7MA 3DVNA 4TQEH 4WIQA 1S9YA 5ABDE 1K6QL 4JCMA 2A6DB 3LMJH 1SJXA 4WCYL 3ETBF 3S4SB 3L1OL 5EU4A 1YQ2A 2CH8A 3SOBL 5F9WB 43CAA 4OFVA 4M7KH 1NLDH 4PLNC 3VD3A 3EFDL 1OP3K 2GTZA 4QRPB 3KXFD 4FFWD 2VKWA 1HEZB 1EERB 2YPLD 3MGOB 1AR2A 3OKOB 1T5WB 4Y4HB 1DEDA 1VFBB 4U2YA 1NPUA 4R8WH 4OCLC 1S7SB 5J1SC 2Z9TA 5GRJL 1OAUH 5ID1B 5I8CB 1J0IA 5E8NA 4LQFH 5E6YA 1XCTA 5E9DE 3STLB 3BKYH 2ADIB 2IAMB 4IOIB 4JFXB 2AERT 1PEWA 3LEYH 4F3FB 4HMEA 2EXYD 1ADQH 2HT4C 1HHJB 3ARPA 1UA6H 1KFAL 4AJ0A 1FGVH 4OCYL 4HXBL 5E70A 5FAAA 3ZDZE 2JLLA 3OKEB 3QZWA 4F9PC 3KPSB 4YFEA 2GQHA 4HIHB 1RK1A 4P2YA 4XH2B 4GG8B 5E94A 1DQJA 4PRNA 1YN6B 5FIEA 1JZ7A 5C0CD 3WSQH 4Y88A 5KN5A 5FGRA 3ROLA 2Q86A 5CJXA 2MHAB 4PS4L 3EKCA 3RVXC 5CHNA 4LEOA 1QVOB 1RZKC 3QIUD 3IFNH 3IAGC 4FQ2L 5DWUH 5DZLA 4IRSD 1KJ3L 2VXQL 1JWSA 5T3XE 1A7NL 2DI9A 5I8KL 3REVB 1CR9H 4D8PB 3ARFD 1F3DH 2X4TB 3SKJL 2R1XB 3C5ZC 2X4PA 3QO1A 3VRJB 3MLTA 1QR1B 4H0HB 3MBXH 3UJIH 2FX7L 4Z9KB 2GK0A 5MHSD 4P4RA 1CBVH 1L6XA 4X98B 1CG9A 1NEUA 3L95B 2OL3H 3CH8A 3ARWA 3I50H 3ARDA 3TZVC 3D25B 1A0QH 2WMPA 2N7BA 4XP9H 5I71B 1RJYB 3BIAX 5I30H 2VOTA 1YMHB 2R1WA 4M62L 4WI2A 2Q7YB 3V5HB 2LQRA 4WO4A 4UQ3A 2W9DH 1X44A 4HWZA 3DX8B 4B41A 3GKZA 4PJFA 4YH6A 3CH1B 5E5UB 3MRDB 3BEVA 2OJEB 3GDBA 4LPXA 4ZUTB 1QRNA 5EN2B 3HZKA 4Y1AB 2BX5A 5I0ZA 1CGSL 2FEEL 5JQHC 3VE0B 2P8PB 3EYFB 4KGJA 4MSWB 2N4IA 4V1DE 3N85L 4YO0B 3VU2A 5KVGH 5BS0B 1AD0A 1R6VA 3QWOB 2L7UA 1ACYL 2I9LA 1RUMH 5DJ2B 1UJ3B 3CFKB 2BNUA 4KJYB 4JO1H 4UDUB 3TH4T 5FO9A 5FA3A 5LVEA 1TTGA 1BBJA 3L5XH 1S7TB 4JJHA 1CGUA 1YEHL 3SDCC 3OF6D 5J12C 4L8SB 3VGEA 5C0BA 1RUPH 1S7WB 3ULSA 3NABH 2P7TB 4G42A 1PJ9A 3GMPB 4X9HA 4QRTB 5GIRB 3BPLC 3C8KB 3V6OA 1HQ4B 4X9FA 1MVUB 4WUKL 4YDJB 1H3TA 4ZPVA 4U4BA 3D3VA 2IPTL 5ETUB 4KMQA 2IFFL 3O6KL 4U6XB 4PJHF 2AJUL 4DGIH 5C9JB 1GPOL 2DBJA 3O11B 5CEZL 3QUZA 2P48B 5E9DD 3V2AR 3TBVA 3V0WH 4KH2A 3LKSB 4R0LC 2HFGL 3QUYB 5DJ6B 3EOTH 4G9FA 1YN7B 5DD1H 5D1XC 1J0KA 2XTJE 1RVFH 1DL7H 4XVJL 5ADOL 1WT5C 4DUXA 4R6UA 5T33L 5B8CA 3AS3A 3DMMB 4N5EC 3G5VB 4N0UB 5DXWA 1YEJH 2HJKA 3F6LA 3WO3B 1MPAH 4PJIF 3OB0K 2DI7A 1NCNA 5EWIH 3B6SA 1DQDH 4GMSH 1KCSH 1P7QD 3QXDB 3BPNB 1L0YA 2YPKA 4UI2A 2DKMA 5F7YC 3MFFA 2W0KA 4EN3A 3HB3C 1B0GA 3SKUD 2ZNWA 2ORBL 5H37H 1MFCL 3W9DA 4KMTH 4ODXA 3SGJC 1PX4A 5T3XD 4MS8C 4PTUA 1NDGA 2O5XL 1Y0LA 2R4RH 3VXSE 5TQ0H 1P5UA 1CD9B 4X6CF 1U6AH 4JHAL 5EUOF 3NGBC 4NQEE 3O6FA 5IVXF 4NBXB 3DV4A 1MJ8L 1HXYB 3ZKND 4XPFH 2P46B 1FFOB 2EZ0C 5CSGA 5D9SB 2AV7B 3VG9B 4LAQL 3WHE1 2Y36L 5AEAA 3KYMA 4XXDA 4JDZB 4HUXA 5F96L 5BZWB 4QRQB 1A7QH 1UH3A 1C5DA 5C6WH 1VSCA 5DQ9B 1S9VB 1N59A 1JVKA 4KJQC 3IFPA 5ICXA 4LSPH 2PCPB 5JR1H 5I66A 3OZ9L 4ODWB 2HVKB 1MFNA 1TZGH 1DVFD 4ZFGH 3WN5C 3MODH 1A7OL 3OKDA 1MCIA 4R7DB 4OSUL 5E4EB 3NIGF 4PJ8D 4UOW0 5HYQA 4ZOEA 1XGYL 2BSED 3CMOL 4J3VA 3DYOA 4M4RA 3VI3E 5F7WC 1NSNH 2HFTA 4MA8L 4V1DD 4X80L 4HGMA 5JHLL 3ZMRA 1NCWH 5TE6L 1MHCB 4YHLH 1PQZB 3UYPA 4YAQA 1U8PA 4ZUUB 2X4RA 3EAKA 4FZEL 5C0DA 1KCVH 3QHZH 4NQDB 1W72B 1CDHA 2AQ1A 4YHZH 1MFEH 3KR3H 3GO1H 3QJFA 2HWZH 5IB2A 5HHOB 3VWKB 2H32B 3FT3B 2ICCA 5DQJB 5A40E 5E8EA 1IZJA 5EZIL 3D2UD 4PJEB 4RDQG 4X4ZA 3UTSB 1VPOL 4WHYH 4FNLL 1D5XA 1EUUA 3RZCA 4KY1L 1OTTD 5IV2A 5HVHB 2PXYA 2E7CA 2VLLA 3HC3H 4U3XA 2HAZA 4YDIL 1W0WB 4AQ1B 3KPMA 1T6WA 5IG7B 3RWCA 2GT9B 1Y6NR 1I8KB 1OAKL 2YKLL 1YEDB 4HJGB 2XT1B 4YPGA 1D7FA 3S7GA 3U0PA 3H7BA 2VDPH 1A14H 3CGTA 4UQ2B 3W39B 4OBRA 2Z93A 1LHZA 4JFFB 4FFWC 3BI9X 4HKZB 2XTJD 3T1FB 2DDQH 5GSRA 1I7TA 2VLJA 2QADD 3OJ2C 1IGIH 3P73A 4P4KA 5L8KB 4L29A 5FO7B 1BQSA 4HWNA 5EOTA 2C26A 3N1MC 3P30L 2NNAA 1NJ9B 1FNSH 2ARJA 3SO3B 1UG9A 3S96B 4LASH 2BSSA 3BP6A 2PYEA 5DGRA 3QAZC 3S5LG 2D4DA 3D39A 3VXPA 2EXYC 4K3DL 4M93B 3J8F7 4I2XE 4RAHA 5CEYB 3I2CH 5I9QB 3FMGH 3BDXA 1DEEB 2GKIA 4MJ6B 4HUKB 1KJ2B 1S8DB 3VXSD 3KYNA 2IQAB 2A9ML 2O5ZL 4PGDB 3VFUA 1X4ZA 1K2DA 2AP2A 5L0QB 2WWKT 4NQED 1J0JA 4U0RB 2BVYA 1AKJD 3JV4A 4OZHA 4P9HC 4PRHB 1KGCE 5TF0A 3B5GA 1FAIL 4OKDA 4ZAKA 3JTSA 1LE9B 1DQQA 3QIUC 1QA9B 1BEYL 3FTGB 5FF6B 5LGHL 2Z31D 4IRSC 2RJMA 2D7NA 1NMBH 3QHFH 4HZLB 3ARFC 1JZ4A 2ATPA 3FB7B 2H8PA 3BWUC 2EIDA 4JFEB 3WFHA 2GITB 5DD6A 4OFYA 2HKFL 3SE4C 4NUGH 3C60A 1CXFA 5TGBA 3H7LA 1A3RL 4ZUVA 2EDQA 2HLAA 5J1TC 4PJHB 3U9UA 3LEXA 2EKSB 1YNKH 3PWVA 4WUUB 1NMCC 1E4XH 2HKHL 4LLQB 3QH3B 3CVHA 3BKCH 3RA7H 1BD2A 5FYKH 3F62A 4F33B 1NUFA 1FNLA 4FXKB 5HHQB 1IKFH 4XVUD 5CILL 5D71H 2FD6L 1FE8L 2RCSH 2IGFL 4NO0B 5IW6A 1IM3A 2LV4A 3G6DL 1IGTA 1KJMB 4NPYB 1IFHH 2ZUWA 4LCUB 4S1QH 2XQBH 3RPKA 1NEZG 5EUKB 5HI4D 4WW2A 4G80A 5IESH 3W5NA 5C08B 1MCBA 3CCHA 3RNKA 3DX6A 1AGFA 2F53E 5J89A 4AT6A 3H8NA 1TLKA 2CJUL 3GMLA 7CGTA 2R0WL 4ZXBB 4U6VL 3WUWA 3GSRA 4GW5B 5EUOB 4FXLA 3VD9A 5IVXB 2Q8BL 2EYTA 3WMSA 4CDGC 3H0TB 4UT7H 1QLFB 4Z7NE 4KKBD 3S8WA 4LCCA 5M7QA 1CDGA 1A9BA 1BIIB 1GZPA 2ERJC 1CS6A 3PWPB 4GAYB 5FV2A 2YMXL 1G0DA 2NYYD 1LEKB 4AENA 4UIMA 1WICA 1EH9A 1KEGH 3B2VL 4JY4B 3X17A 4NM8L 4R90H 1NGQL 4GRWE 3IDGA 2A77H 1LQSR 2B0SL 4NZTH 2X1OA 4AIOA 5KOVC 3RUGA 4AIZB 2UZIH 4Q9RL 3KYKL 2GTWB 1ND0B 3BHBB 3KLDA 4NO2B 1LK2B 1XR8B 4TOYH 1KEMH 3QDMB 5F9JB 4BJLA 3B2UD 1TETL 5HYJB 1CFVH 5EU6B 1N8ZA 3TPKA 2GYSA 4WFEE 5DYOA 1KGCD 4G5ZH 3MLXL 3TA3B 2BSRB 2ADIA 4IOIA 4JFYB 1IAOB 4JFXA 4OQTL 1BECA 5JIKA 4XMKL 5I1KL 3L3DB 1YA5A 4PJDF 5CJBA 1I1CA 2VDQH 4F3FA 4N8CL 1RIVL 5MENB 4JHWH 3EO0B 2YRZA 2VDKH 4OIAA 4JCLA 2GJZA 3LKQA 3OKEA 1T7VA 1YDPA 1B0RB 5IHBA 5DR5L 4HIHA 4AM0B 4HULB 3EGSB 3BGAA 3R0NA 5EORL 3I75B 2HJFB 3ARGD 2A1WH 2C3GA 4XP1L 2NLJA 5AYQA 2O5YL 5F1SA 1Z2KA 1T1ZA 5FYLH 5D2LE 3WLBB 5CMAB 3ZKNC 2XA8H 4Y2DA 2MHAA 5DMJB 3I6KB 2G5BB 4JFZH 5E6IB 2GSGB 5DLMH 1MJUL 2ED8A 3MNZB 2AQ2A 1ZLWK 1E6JL 4P5TA 3WKML 5D7IB 3RDTB 4LCWE 3REVA 1MCWM 3BGFC 4NN7C 4PJAE 3CLFL 1QSFB 3GHBH 3LZFL 4X9IA 1H8SA 2YR3A 1DVFC 4NHCH 1TJIL 4YHYB 4UB0L 4AK1A 5GZOD 5KVFH 4PJ8C 3R1GL 4X98A 5F7UA 5BW7A 1SJEB 5KTEL 1G7HB 2Y7QB 4XAWH 2VDOL 1J1OL 2DMKA 5AUMB 5D1QB 1CGVA 4PPTA 1IGJA 1F2QA 3E3QE 4YGVB 2F53D 5F89B 3WNMA 4O2FB 4N8VG 4NWTH 1NC4D 4K2UH 5IQ7L 2IQ9L 2Q7YA 3V5HA 3ULVE 2E9BA 3MREB 5AZEL 2PYFB 2Y5TA 4MCYB 2UWEE 2AXFB 5EZLB 2JB6B 3MRDA 1JGEB 5FM4A 4JR9L 1AC6A 1BJ1H 2XKSA 3VDCA 2X9XA 4MA3B 4YO0A 4MGXA 4ELMB 3ZE0F 4XMPL 2YEZA 2VABA 4U1LB 4M6ML 1OTTC 1GOFA 5GRVL 2QSCH 3FFCB 4MA1B 5DHVH 4LSQH 4HUWB 1T66D 3L3HA 5JHDE 1UJ3A 1NBZA 5EA0H 2AGJL 2FX9L 1ODAA 1XGPA 4Q97A 1G6RL 5AWNH 1G9MH 1AO7E 1ZANL 4XC1H 1S7TA 3PGFL 4WRLA 4FQXD 1UWEL 5LWYH 4TSBH 3MCLH 1MCPL 1S7WA 3MLUH 2FL5A 4E5XA 3MLYH 2XTJC 2VSDA 3GMPA 4HCRA 3O3BB 1EGJH 3F58L 3MZTA 2VJXA 2QADC 3C8KA 1NCBH 1R3HB 2GCYB 3M8OH 2F58L 2ICEA 3VJ6B 4JPKL 4ZG1A 4WFED 1MWAB 2YWZA 3CJJA 5DEGB 1DQLL 1NANH 5EO9B 5ETUA 3DUUA 2MCPL 4KDWA 3HS0A 5C9JA 4M6OL 3O11A 5ESAB 4M1GH 1R3LA 4UINL 4PRDA 2UY7A 3LKSA 4EIGB 4R7NA 3VGHA 4WDIA 3QUYA 1YN7A 2AABL 3CLEL 3PV7A 3O9WB 3ZT6A 4CW1A 4CU8A 2YPVL 4K3JL 4CL7A 1R5VB 4OLWH 1T22B 5IHUH 1IQDB 1QD0A 1UWXH 4L4VE 5DRXA 4R96A 4KVCH 4GSDL 3I3EA 3QXDA 2AJ3A 3GSVA 4EOWL 5E2UH 5F1KC 5KSUB 1EXUA 2Z31C 3HNSL 1AHWC 2YD6A 4EI5B 1V3LA 1EVTC 4U05A 3W0WA 5DA0B 1UM4H 3O2WH 5C0JA 1KLUB 4LCWD 4PJCE 1ONQB 5DJ8A 1U93B 1V7NH 1ED3A 3DUSA 1YNLL 1FFQA 2CDEB 3S36H 4JRWA 5I16B 3JWOC 5IT2L 4P46A 4M7LH 5FECB 1RU9H 3DI2B 1HXYA 1MF2L 1ORSA 2F54E 3P11H 3CSYB 3WNNA 3RAJH 3GJFK 1I3GL 3QRGL 5D9SA 3FO1B 2W07A 2VLKE 4JDZA 5BZWA 4QRQA 1IEAB 3S37H 3D9AH 4TPRL 4DW2L 1N5AB 1S9VA 3S9DB 1A1NB 4YHNA 2QR0B 4DN3L 3ULVD 5D1ZD 3HUJF 3P4OB 4OLZL 3V8CA 5KOMC 1X5IA 1PY4A 3HI5L 1QLRA 5BJTA 3ZKXB 3WEXB 4X7EC 5C09B 4M61A 3MLSL 3QG7L 1LP9A 1VEPA 2COQA 4QGYA 1OW0A 4B50A 3MLRL 5HI4C 3S36X 3AS1A 4J12A 3REWB 1EBAA 3KNBB 3G5ZB 3HMXA 4ZDHA 3V4VH 3HR6A 4M9PA 2O93L 4MNGB 1MHCA 5IEHB 4PJDB 5JHDD 5I1CH 5DA4A 4F7MB 3E2HC 3SCMB 2N56A 1FIEA 4FFYH 4NQDA 5SWZA 4S10A 4JO3H 3S37X 1AO7D 1MCWW 3ARBD 5I1GH 2ITCB 1QQDA 3T3PF 3VWKA 5A16A 3BD4A 4PJXB 3IAQA 5DQJA 5I75C 1QFWL 4MXVF 4PJEA 2NQCA 4KKBC 1H5BB 4NJAL 2HVJB 3MRKA 2CO7B 5MEQB 3Q3GA 1IMHC 1EPFA 2DM3A 3BGMB 3U4EA 2NYYC 1T7ZA 4NKMB 5K9QG 5TPWH 4YFDB 4F8QA 2Q87A 5AD0A 3OQ3B 1I1AA 2OLDA 1R5WA 3LEVH 1INDH 1QYGL 4P23B 4NT6A 3HRZA 4UQ2A 5KS9E 2OBGA 2FHFA 3W39A 3EFFB 2JELL 2Y07L 4OZIE 2YA1A 1OM3H 3QUMH 5DUPL 1HXMA 1LNUB 2DM2A 2XNAA 3ZTJG 2G75B 4V2CB 5FO7A 4YIQA 4LSTH 4PB0L 5ISZB 4PLOB 1NJ9A 3QO0B 3C2SA 4L4VD 5JIHA 1H3XA 3CSPA 2ZSVB 4ONFH 4P59H 5F8QC 3MRFB 4KJPD 2FSEB 1EO8H 1V7ML 3MBEA 1SYVB 2IPUK 5CLTA 3ZDYE 4Z0BH 1QTYT 4P5MB 3SDXA 3QHTC 2G60L 3QCUH 5DD0L 5T1KD 1DEEA 2ZCHL 4JPWL 4I0PB 1S8DA 1YQVL 3E1F1 1G9NL 4GJTB 1CICA 4OZGF 4PGDA 2DBLL 3EOAB 1LILA 1FPTL 3TV3L 3ARGC 3H3PL 4TTDD 4PRHA 4L3EB 2X1XR 15C8H 5HGHA 4OFPA 4MJ4A 5J13C 5C2BL 1DN0B 2F54D 4TVSa 4XNMA 1CXHA 4EEEA 1QP1A 1CF8L 1LE9A 1FVEB 4U3HA 2B7DT 1QA9A 2VLKD 4GRLD 5FF6A 3TVMD 5MERB 1P6AB 4WV1A 1R3KA 4MQSB 3PXHA 3C5SB 2QKIB 1YECH 2W0LA 4HJJH 4HZLA 3VXRE 5D2NE 5ILTL 4L1DA 3HAEG 5C0AA 1EFXD 1KPRB 3IDNB 1KELL 1M1SA 3X11A 4H20L 1GHFH 5A2LH 4I0KA 3ECBA 5GZOC 3HPJB 3D87B 1L9NA 1IL1A 4OLYH 4U1MA 1XMWA 3FB5A 3Q6FB 3HI6H 1SHMA 5K9JL 4WUUA 2FEEI 3PWUB 4HS6A 1OGAA 3S34H 3BKJH 3T4AA 3D85B 4OTXH 4K23L 4ODTL 3TBYA 1NH6A 3QUKB 3S88L 1B4RA 4LDLB 4TVPH 3N9GH 1RULL 2JK5B 2ZCLH 4RWYH 1XGTB 3IXAB 1GGCH 4HGKC 5BO1L 1FP5A 3G04B 3K46A 2LAGB 4GAGH 1FZOA 5E2JA 4CADB 4LNRA 4NPYA 5I8EB 4ZD3H 2DQIL 1HINL 5CBAB 3T4YB 5DJXA 2CUMA 4QRRE 4C56B 4LSSL 2YA0A 4RQQA 3GGWB 3FO0H 3TBTA 3NAAH 4IS6A 4IRZL 4PJFE 1MEXL 1T66C 1QRNE 4PJ5B 3ALWA 4XCEB 4NQUA 5FHBL 1A1OB 4X5WA 1A3LL 1RJZB 4ZXBA 3U0WH 2LVEA 3D0VB 3O8XD 4FQXC 4QNPE 1FL5B 4M7LT 1MIML 4PJGA 2VAAB 1JPGA 5JQ6L 4NO5B 2EYSA 1QLFA 4RWHA 4Y19A 3MLWL 3PWPA 2HRPL 3C5ZB 4FZ8H 1EO7A 3A6CL 1LEKA 1EBPA 4XTRD 2K1MA 3QDJB 2OSLB 3HRPA 2H1PH 1X5AA 5C0BE 5GS1A 5HYSG 1M05B 5DT1H 3B3IA 1HNFA 3TZVB 1PG7W 3V6OE 3DYPA 4OM1L 4QO1A 2ZSWB 3C6SA 1JK8A 3JUZA 3S5LA 1JP5A 3MROA 1CE6A 4LRIA 1LK2A 3V5KB 1OB1B 2WIMA 3GBMH 3DURB 2OR8A 3B9KB 3QDMA 3TNNB 2KKQA 3FQNB 4ORGB 5T5FL 1ZA6B 2ENYA 4JZOB 2B39A 3V95A 4G9FE 4XMLL 5T3ZL 4RZCA 3OKNB 1BP3B 5FUOH 2BVQB 1BFSA 35C8L 1IGFL 1QR4A 5LBSL 3V7AE 4Z7OE 3MCKB 3JWDH 3QCTH 2P5EB 4P3CH 3EO0A 4P9MH 1NDMB 1PKOA 1Z9OA 3QXUA 3WIFB 1ERNA 3V5DB 2J8UF 3B83A 4PJBF 4LMQE 1JPSL 1W0VB 3JV6A 3VXRD 3W9EB 3HG1B 4JY6B 4LVHC 1EHLL 2HJFA 4HH9A 1EUTA 5J12B 4OIIL 1WLHA 1IC5L 5C8JB 5GGQL 3I6KA 5E6IA 1LEIB 1VACA 3JV0A 3BPLB 5DS8B 4WI5A 3E3QC 1U8HA 2P1YA 5E8DL 2IC2A 5D7IA 3U30C 3QR2A 1NUDA 4WI3A 3ULVC 5FKAA 5D1ZC 5DEZA 4UNUA 3H9HA 2CLVA 4MJ5B 3PP4H 2Q7NA 3ARQA 3H9ZA 4UV7H 5AG8A 32C2B 5TE7H 4R0LB 3LSOB 3PV6B 2J8HA 3WE6A 3EJYD 4QRRD 4JQIL 5JTWA 1SJEA 5D1XB 1G7HA 1NEZA 1MHPH 5AUMA 3G9VA 4OAWB 5I1AA 1KLGB 1QRND 1AP2A 4YGVA 3WYRA 2JTDA 3QEGL 4Z5RB 4XPTL 3G5YB 1UGNA 3SQOH 3MREA 4XX1E 1BVKB 3CUPA 3ARBC 3V6FA 3KYAA 2DD8H 3QPQD 1JTTA 4Y0GA 4S0TD 5EULV 2RR3A 1QFHA 2YUZA 2JB6A 1ZMYA 1B3JA 1V3MA 3IF1A 4KRPD 5GS0D 2CR3A 4XBEL 1WTGT 4R97B 1NGZA 2MMXA 3SGEI 5E00B 5T5NF 3Q6GH 5EB9A 4ELMA 3A6BL 2M2DA 3VGBA 3QG6B 5IR1B 4HS8L 5J4MA 5EZOL 4OZFB 1RZJL 2I25N 1KBGH 3N06B 4M8QB 5GS0L 4KRMB 3NGBB 4K71C 3LDBC 4E42A 4F8TA 4LSUL 4M1DH 2O61B 1RFDH 1JNNH 5I18H 3C09C 5C0BD 4RBPK 2WZPD 2VR4A 2I9TB 1MRFH 3JTTB 4YQXL 1CXIA 1P2CA 3H3BC 4EUPB 3FQRA 5TQ2L 3TN0B 3N1GC 4HXAL 3QIWB 1N5YH 1G7LB 4L4TB 3OAYK 1BF8A 3OGCB 4FRWA 4J8RB 2YWYA 2YA2A 3O3BA 3NH7L 2CLZA 1MQKL 3GB7A 1MFBL 3QUXA 5F7DA 5J7CC 3WN5B 3MA9H 4JFPB 1MWAA 1G9EA 2BY1A 4G9FD 4JZJB 5DJCA 1VADB 2KPNA 4Z7VA 2MFNA 3KDMB 2AJZB 1G9NC 4KJPC 4JPVL 5ESAA 2VLJE 5SWQB 5J06A 2OS7A 5IJKC 3ILPA 3SKMB 5L8LB 4EBQL 4HKXA 1NAKL 4A6YB 3VDBA 5D7SH 4JN1H 2X5PA 5DTFB 2PYEE 3LS4H 4EN3D 3H2WA 1T22A 4QYOB 3WXWL 4JZNA 2VZUA 4TTDC 1J1XH 3EYUL 1D5BB 4UZGA 2CPCA 4GG6F 1C8PA 2AEQH 1F90L 3V79C 4J4PC 1FAKT 1YJDH 3Q48A 3UPRB 3LB6C 4JJ5B 4X6BA 4OLXH 4GRLC 3F5WB 3TVMC 1L7TL 1J0HA 1CQYA 5F1IA 4FTVE 4EI5A 3QWQB 3H3KA 3O6FD 1S7XA 1KLUA 3CSBA 4JVWA 3RIFF 3PL6D 3CX5K 5GGVL 3UC0L 1U3HA 1YY8A 1O7SA 1P9MC 4JPIB 4NM4L 25C8L 3LAFA 3CZJA 3KXFB 1K6QH 4U1KB 3GSWA 1B6UA 1EEUA 1JGVL 2YPLB 4GAJH 3L1OH 3ZHLA 4LQ1A 4JFDE 5FB8A 1IAMA 4JRYA 3SOBH 4M6NL 1N5AA 4L8CB 1FBIH 2QR0A 4N8VA 1AI1L 3UAJD 4OCMC 3G9AB 2WK2A 4LLDA 1AQKL 4ETYA 2V7HA 3BUTA 4FABH 2G9HA 1P53A 3CFDB 1T20A 2EDJA 1BD2E 5H35A 4G8FA 2D7PA 4WTWA 3UEZA 1XAUA 4Y2OA 1JHLH 2X1WL 2XXMB 1JHKH 3FONA 5IM7B 1I1RA 3L7EA 1HOCB 3DRTA 1N4XH 1U41A 4JM2F 3QXVA 3MZGB 5BVPH 1FO0L 5C0CB 3P9MA 1NAML 4N9GB 4MCZA 3STBA 4A2MA 1JFQL 2J8UB 4NNXB 4PJBB 5JUEH 5EIIB 4XCCH 1D9KB 4OGYH 4Y5XA 1KFAH 3RZCD 1ZGLA 5C86A 1I4FA 4HXBH 2PXYD 2DQHH 3QIUB 3VFRB 3O8XC 3JZ7A 1CGYA 3QPXL 5DUBA 3VFPA 4IRSB 3SY0B 4P2OA 1NBQA 4U7SA 2QQLL 4NCC2 3LKNB 4F15C 1I1FA 5F9OH 4K94L 4NIKB 3ARFB 4RISH 1J7VR 3T0AA 3H9SB 3VW3H 2CKBB 1MUJB 5CIPB 1NCCH 2V7NB 4XTRC 1TDQA 1U8LA 4AQOA 1NQBA 1N0LA 2VDML 6FABH 1AY1H 2I5YH 5ALBL 2V5RA 5FM8A 4AYFA 4HK3J 4HKJB 4HK0B 4NZDA 1P4LB 2VLJD 1NMCB 5TDPB 1S3KH 3U1SL 2VLME 1IGCH 1WBXA 3Q5TA 6CGTA 5I8KH 1SBBA 1VESA 3MLZL 5SWSB 1D5IH 3HZVB 1PZ5B 3SKJH 1E28B 3EFFA 4LHJB 1RPQA 1UM5H 4P2QE 5FOBB 5ITBH 4YJZL 4M43H 4H5SB 4ONHB 5H94B 1LNUA 3BRDA 1SY6A 3RVUD 3QB7C 4UTAH 2PYED 4O5LH 1MAJA 2OR9L 3PWLB 5D5ME 1QUNA 4K7PX 2XXCB 4YXHL 3VI4E 5KSBF 4H1LG 3PHQA 4NP4H 2E9IA 4BKLA 5D6CB 3C6LA 3MRFA 4G6KH 1FZJA 5F9AC 1NKRA 3KYOA 1SYVA 4BSJA 4FTVD 4P5MA 4X0KA 1IAIL 2XN9E 5D2NC 2FYYB 1U8JB 2FHBA 4X6EA 1C5CL 4ZAKD 2AEWA 4WEBH 3BJ91 1F42A 4HJ0D 3RU8L 1ZSDB 3AS2A 4KZEL 1Q94A 2XZCL 1R3IH 3EYSL 2B5IC 1KB5L 1KC5H 2GFBB 3N1FC 4RX4D 3ZZ1A 1UYWL 3EYQD 2ERJB 4JFDD 1WC7B 1AGDB 1MLBB 1W72H 1GC1H 4K8RD 2FATH 5IFHH 3VFNB 1NFDA 2H32H 3VI3F 3PABB 5BCAA 2WUCH 5IOPA 4JANA 3INUL 1A7RH 1N0XL 1T1XB 1UVQB 2DWEB 3IDNA 5E9DB 1H0DB 1BD2D 1NCTA 1OF2A 5KANG 4OV5A 4K8RL 1WCBA 3EJYC 2EDRA 3WIHL 5JW3L 1VGKB 1SM3L 2YN5A 5SX4I 1F6AB 2W1NA 4S1RH 2IFFH 3P40A 3NIFF 3O6KH 1FH5L 2HFEB 2QSTA 5E95B 5FYJE 4HUUB 5CEZH 4XNUL 2JK5A 4YHKL 2AXGA 1PDKA 1MI5B 1P7QB 3W2DH 3ARTA 3QPQC 4CADA 2PW2B 1A6TB 4MLSA 1RZJC 5GS0C 4KRPC 3T4YA 4XVJH 5FHAL 5ADOH 3FHQA 3NA9H 4KTYA 3H42H 5BV7L 4BA8A 5LXGH 4GG6B 3TO4D 2LFGA 2YD4A 2DQGH 1KULA 3ARZA 1ZE3C 1LGVA 1Y18A 3MV11 4NQVA 1N26A 3GBLA 1T4KB 3STZA 1DBJH 2JCCF 1OGTB 2MCG1 3CD4A 2LU7A 2ORBH 4M7KL 1NLDL 2C4FU 1WBYB 5J6HA 2VLMD 5F88A 3D0VA 3CX5J 3V6OC 2O5XH 3CDFA 4UT9L 1P7HL 3FT4B 1AIFB 4HS3A 1KJ2H 3F7VB 3FT2A 2DWDB 5BRZB 4P2QD 2C1PB 2ITDA 3LN5B 4RAVA 4UILH 3BGFB 4PY8J 5HPOA 4YXLH 1OAUL 1DVFB 4LQFL 1ZHNB 5CCKH 3MNWB 4LAQH 2BNRB 1HSBA 2Y36H 4PJ8B 5IW1B 1RUKL 1NBYB 2OSLA 4OLVH 1P6FA 4U1IB 5F96H 1G0XA 1NGXA 2P24B 4JDVB 5E1HB 3BKYL 1YMMA 4K3HA 5F9DC 4V1DB 2Q20A 3LEYL 4XP5H 4Q58C 1ADQL 5B8CC 1AD9A 3THMH 4MDIB 5DJDB 3OZ9H 3UTQA 2ZSWA 1UA6L 4PY7B 2QL1A 5I1IH 1OB1A 4HBCH 4OF5A 3ZSSA 4KKAD 3HPLA 3DURA 2D7MA 2XN9D 5F1OB 3FQNA 3TNNA 4Q2ZA 2NY0C 5EFIB 5DDHA 2D7OA 3GMMA 3WSQL 4EN3C 3C8DA 3KPOB 4RFEB 2VLRA 5E8OA 3KPTA 3D2UB 3UTTB 4ZOBA 2HN7A 3L5HA 5DQDL 2GSIB 3IFNL 3BVNA 3HNTL 4H1LH 5TDOA 3EOYG 5JPNB 5DWUL 4FZEH 4U1GC 3H9YA 1NFKA 4L8DB 2XYCA 3MCKA 3NN8B 4FHBD 4Y5YC 2P5EA 1Q9LB 3O6FC 2JF1A 5IB4B 1CR9L 1GSMA 4HHAB 1BGXH 4Y2DD 3PL6C 3MBXL 3T1WA 2P5WE 4YBHA 4ZS6D 3HAEA 3QISA 5C6TL 1CBVL 3QI9B 3SDCA 2EIZB 3W0WE 1TNNA 4P5TD 5DVOA 5C8JA 3QEHB 1A0QL 4K7FB 2XTJB 4YDIH 5KW9H 1U92B 5IHZA 1BQHB 1LEIA 3TF7C 4KDVA 1FVDB 3L3GB 5FYJD 1KOAA 2QADB 2BOBB 1FCCA 4XP9L 5BXFA 4W6XB 3HCVB 1CDJA 2YD1A 3VD5A 1JV5B 4F58L 2W9DL 3SGDH 4RRPA 2ZUYA 3C08H 3UAJC 2NTFA 4PFEA 1MLCA 5EBLA 1L9MA 2LVCA 5GJSL 1ZXQA 5DK3A 3UZVB 1URLA 4XCNA 3DV6A 3EOBB 1S7QB 4DEPC 1HKLH 4R0LA 2DTMH 1AXSB 4JFQA 5D7LA 1MVFA 3PV6A 5I15H 5KVGL 5B38B 2VNCA 4O2EB 5EO1B 1JWMB 1QFWI 1T04B 2D0HA 4PRPE 3VXSB 2FIKA 2FX8H 1WT5A 3DSFL 3WLWD 3BH9B 4OAWA 1I8MB 4M5ZH 1KLGA 5JOFA 1LP9E 5GJTL 1WAAF 4Z5RA 1AKJB 3MYJB 4OZ4B 4Z76B 5TDNB 4QCIB 3L5XL 2ZWLT 5IB5B 4Z7NF 1XGRB 4P99A 3MR9B 4K94C 2LTQB 5BOPA 3GI9H 5JXEC 1YPZA 1TPXC 3RZCC 4HLZG 2Z31B 1RUPL 1AHWB 2O5ZH 3NABL 2UZXB 1QG3A 3SGJA 2W91A 4GRWF 1LD9B 5SWZE 5ID0A 5CZVH 4YE4H 1T1WA 4BSVB 3QG6A 1MCJA 5CSZB 5IR1A 2ARJQ 4QF1A 4M8QA 4O2CB 5EC2A 1FAIH 5F72S 4DGIL 4GRMB 1BEYH 5LGHH 4M1CD 4J3WA 5EBWA 3IJSB 4DN4H 3NOIA 3V0WL 3JTTA 3LD8C 4XP4L 4HAFA 3EOTL 4I4WB 4CMMB 3G08A 3DVGA 5DD1L 1I7RB 3OGCA 1RVFL 1DL7L 3DROA 1EV2E 2HKFH 5HGDB 3RVUC 4CNIA 2ICWA 5ACZB 4GXUN 1F6FB 3WN5A 2EDDA 5EWIL 1BVLA 1IJ9A 3DETD 1DQDL 1KTRL 5JIIA 1JNLH 1KCSL 4JFPA 4DKFL 4BQCA 3U36A 4D9QE 2CDGB 3O4LE 4CDHA 3BH8A 2BRQA 4NHUA 1XF2B 4KMTL 1MH5B 2FJGA 4Y8DC 3G6DH 2R4RL 3KLAB 5F6HJ 4I13B 5I6XC 3OX8B 3QIBA 5DTFA 2P5WD 3X12A 3BQUB 2PO6D 4HJ0C 1BBDH 2F5AH 4XPFL 3W0WD 3SDXE 2YSSA 2BVTA 2A6IA 2CRIA 4PJAF 1JN6B 5AYUH 1A7QL 2WIIB 3EYQC 5IVZB 4U1JB 3G6JF 5TFSH 4ZMAT 4LSPL 1TFHA 4OCNC 1U8MB 1RURH 4U6VH 4K8RC 2J8OA 3C8HA 2XZAL 2GUOA 2H3NB 4ZFGL 3P4LA 1BREA 1UT9A 3OB0H 5FYKE 4Z7WF 4BFEA 1DBAH 4QT5B 3EO9H 4PJ7F 3L9RA 3IDUA 2NY4D 2M26A 3JV5A 1MCOL 4I2XB 3T0DA 4U1KA 4K07A 3ULVF 2B20A 1NCWL 3B2VH 4CN1A 4PRPD 5GGTH 3KLHD 3TEUA 2J88H 4DTGH 2B0SH 1N6VA 1L0QA 2LU4A 4E0RB 1CU4H 1KCVL 2FH8A 3QHZL 3QNYB 4YHZL 1MFEL 1XF3B 3GO1L 3IVKB 1B6DA 1FFNB 1FG2B 5L2KA 1ZWIA 3TO2B 2XWBA 1BLNB 1ZA3B 1LO5A 2WP3O 3HFMH 4HDIB 4XPBL 1WZKA 3TO4C 1MSPA 1I9IH 5SWZD 3DBXA 3LHPH 4G7YH 1HOCA 3MLXH 3CFBB 4O58L 3ARGB 3SQBA 2FLBT 1V3JA 4MAUL 4PG9A 2HTKD 4N9GA 1AR1D 1XF4A 5JW4R 4XMKH 3PQYE 1RK0B 3QEQB 5EIIA 2UVEA 2W38A 2AJVL 3FL7A 4LCCC 5JO5B 2J6EL 3VG0L 2VDPL 2X4NB 1FZMB 3IXTB 3GSNL 3QIUA 5B39G 3S35X 3TH3T 5I1EH 2BRRL 5JORA 5DR5H 3MRHB 4IRSA 2DQUH 2DDQL 5EORH 4H8WH 4Q9BA 4HLZH 1IGIL 4GW1B 2O5YH 5E4IA 3TCLB 3LOWA 4JGJA 3D1MC 2VITA 1MUJA 3IFLH 3ULUH 1OOAA 1HE7A 2MPAH 3P4NB 4PJGE 1LE5A 3SE4A 4D9QD 1MJUH 4Y7MA 4I5BB 3O4LD 1VENA 5EO0A 4HKJA 5L2JB 1KT2B 4YNYA 1NCDH 5TDPA 2BHZA 3WS3A 5HHNB 3CLFH 3LZFH 1TZHB 3I2CL 3HZVA 3ZLQC 1IKNC 3K4AA 4WWKC 4ZOCA 1TJIH 3MXWL 2F53B 2A2QT 3EO1A 5FOBA 1A6AB 3ALPA 5HVFB 4KKAC 1NC4B 3AREA 3DO7A 2XWJB 4H5SA 3R1GH 4ONHA 4NN6C 5H94A 2HMID 4HWBA 4LDOB 1JZ3A 3MBED 4U1HB 5DD3H 1Z3GH 3IGAB 2BC4B 2NY7H 1Y6MR 3GK8H 5D6CA 5K33A 4UU9B 4KRLB 3DVIA 2EIEA 2QQQA 4G8GE 1TZIB 1MOEA 3OXRB 4N1HB 5IQ7H 5FYLE 3QT2A 3O45B 3SO5A 3NZHL 3KWWB 3QHFL 1WWCA 1TTUA 2ADJA 1F4YH 3RWIB 4GRWB 1VB9A 1EEZB 1OPGH 4Y2DC 4R4BB 2FYYA 2BSTA 1NBVH 4HQQL 5FYKD 2H2PC 3ESVF 4ZS6C 1A1MB 1RIHH 3SHSA 1YNTA 4NUGL 2YC1B 4PR5B 3ZYJA 2QBWA 3OF6A 5I8OH 4M6MH 1Q0YH 4P5TC 3WFBH 3IDYB 1HHIA 2X7LB 3KPNA 1JE6A 4OD3H 3BKCL 2FX9H 3RA7L 4HG4K 3T3MF 3K74B 4EDWL 1WC7A 3SDDD 2C7UA 5J9PB 5D71L 1ROWA 5IFJA 5EU7E 3VFNA 1CFNA 2HG5B 3PABA 4Z78B 5L6YH 2R0ZH 4G43B 4X9GA 1J10A 1IFHL 2DWEA 1MCPH 2XQBL 2Z91B 5DMKB 4HPOH 5D70H 3DHMA 1UXSA 3K1KC 2RBLA 4EKXA 5I0DA 1F6AA 1ES0B 3HI1B 3X14B 5KSVB 3WLWC 4L9DA 2KZWA 2HFEA 3MJ8B 3B4NA 4L3CB 1VA9A 4U3CA 2GW5A 3RL1B 2JJTA 2V9QA 5JOPE 1HSAB 3MRJB 4YEFA 2EEBA 3PQYD 2HT2C 1NLBH 2WSKA 2GIYA 3HZYB 1JYXA 3RWGB 1ZLSH 1A6TA 1D6EA 5ESQB 2AABH 4X83A 5GGRB 1CCZA 1DSFH 1OQXA 1DUYB 3VGFA 3IJHB 4CU6A 4UT7L 1G0YR 1EHAA 4OKVB 4KGLA 1U8IA 4PJAB 2VXVL 1G7MA 4GSDH 4LVHB 3CSGA 3RTQB 3OJDB 2OMBA 4PRBB 4MD4B 2A77L 2X1PA 4M1CC 3HNSH 3VFVA 1TIUA 2EDBA 4WU7B 5ERWB 1DFBH 1WBZB 4LIQH 4LVOB 3VXQB 4OD1H 2UZIL 1WBYA 3PWJB 3RJDA 4XPAL 3UBXB 3FT4A 1ZHLB 4PJ7B 4MNQA 2X89D 1KEML 5HHMB 3UDWA 4PTTB 3IS0X 3LN5A 3U30B 2ZKHH 1CFVL 5D1ZB 2YD5A 4XZUB 1DVFA 4NO3B 2UWEB 1I3GH 1ZHNA 1JRHI 3DETC 4MXWH 4WY7H 4G5ZL 1MFAL 4QOKB 3DO3A 3FQWA 4PJ8A 3QNXA 4R3SB 1QBML 4U1IA 4Y5VA 3LRSA 4PRIE 3O3DB 4G8GD 4ODHH 1JMXA 7FABH 4V1DA 5IMMA 1VFMA 2VDQL 2KL6A 4WU5B 4DN3H 4JHWL 5DJDA 5FYLD 2VDKL 1CGXA 3B9EA 2V17H 5E1AB 1M71B 5JHDB 3HI5H 1EX0A 2ZUQB 4Z7VE 5DK2B 4I18A 3TNMA 4PJIA 3QG7H 1FGNH 2A1WL 1INEH 1AO7B 5EFIA 3ARBB 3CC5B 1EAJA 2PO6C 5LKNA 5FYLL 4ZNCD 3KPOA 3LQZB 4YDVB 2XA8L 4JFZL 4LLYB 3U83A 5DLML 2GSIA 4WW1A 2WNGA 1E6OH 5A2FA 4RNRB 1MAKA 4PGBB 4CKVX 4M48L 1Q9LA 2DM4A 5INDB 5IB4A 4K71B 1OTSD 3LDBB 1IEBA 5D7JD 4NHCL 3C09B 2X05A 1ZLUK 4EZMA 1OHQA 4QGTA 3NFNB 1W2KT 2W60B 2OTWB 5T1MA 1FYTE 3TT1H 3V0AC 2IANB 2EIZA 1DZBA 2NY4C 1U58B 4XAWL 1CI5A 4K7FA 1OT2A 1S5IH 4LOUD 3KLHC 2BOBA 4NWTL 3FO9A 3HCVA 1G1YA 4K2UL 5JOPD 1JV5A 1QYGH 4NBYB 1CD1B 1OW0C 2VRAA 4N0YH 2Z4QB 4FA8A 2Y07H 2YRLA 4YHIB 3ZE2E 3EOBA 1S7QA 4PJFF 4JRYE 2P8MA 1AXSA 1U8NB 1N7MH 2GAZB 4QXTB 2NY1D 3MLPA 3BE1H 1BPVA 2XZQH 5T1KB 4PJCB 2QSCL 5L8JB 4XGZB 3BH9A 4U6HB 5TF1H 1N2RB 5EA0L 4EI6B 1NKOA 2D31A 4NQEA 2AAVA 2HTKC 5C0EB 4OZ4A 4HF5H 2YZ8A 4XC1L 2RAMA 2XG4A 2VZOA 5MEOB 2M1KA 3L5WA 3NBNA 3MJ7B 2YHGA 2ZCHH 2ZOLB 4JPWH 3KPPA 1YQVH 1KIQA 2EDXA 2VLKB 4GRLB 3MCLL 4TSBL 2Z31A 4P2CG 3TVMB 3VXME 5J11C 1AHWA 3MLUL 3MLYL 2DBLH 3IS1X 1K8IB 3PWNA 1MAMH 1AGCA 3ZKQD 1PG7H 3MO1B 4QRUB 3MRNB 5KZCB 2E5EA 3M8OL 1Q9KB 4MYWB 4QY8A 1BZ7B 4HG4J 3B9AA 1TCRB 2R0KL 4KXZI 4X7TA 3U7WH 1II4E 4FQJH 1OP5K 5FOJA 4KROC 4PRID 3IJSA 3MRBB 4RMWA 2BY2A 5MP6L 1OAYH 2ADGB 2B1AH 3QUXD 5JMRA 5B4MD 2OJZL 4X6DE 4I4WA 4U1NB 4CMMA 5ILTH 8FABB 4DVRH 4ZO7A 1KELH 4HV8B 4ZFOB 4ZFZB 4PGEB 1S9KC 1GOHA 3BZ4B 3LQMA 1N64L 1NC2A 5HGDA 5KSAD 4GQPH 4U2ZA 4OLWL 5FUCE 2DQFB 1QEWB 1IAII 1FYHB 2VZTA 5FDWB 2HH0L 4S2SB 3T04D 4KVCL 3CAFA 5IBLD 5FGBA 4NDMB 1KTKE 2MSPA 1EEYB 5E2UL 3S88H 1KCRH 3GMRA 4NKDA 5SX5K 1XF2A 4NUJA 1HZHL 4YDKH 1UM4L 1BWMA 1MH5A 3DRQB 1LDSA 2E9WA 4N1EA 1FNEB 5E6ZA 4JB9H 1V7NL 4ZUSA 3S36L 4XXCA 3OX8A 4MVBD 2CIIB 2PTUA 1FYTD 4M7LL 1L7IL 4WV1C 3O8XB 1BFOB 1U91B 4OZIB 2F19H 2Q76A 3MMEB 1MEXH 5EU4B 5CP3H 4F15B 4XVSH 5FEBA 3S37L 2WIIA 3D9AL 5IVZA 4U1JA 1FDLL 1OAZH 4GQ9H 5CKAA 1U3HD 5FHBH 3SDDC 4APQC 1PBYA 5EBMA 2V2XB 5HYFA 2E7MA 2GTZB 3BP4B 1FL3A 1MIMH 3R0MA 1HYSD 5ITFA 4TVPE 2ID5A 4BYHA 2FECI 4KUCD 1FFRA 4D9RE 5CFHA 4QT5A 5F7KC 3FB6B 1WWWX 4JRYD 3MRCA 5BMFL 5KVDH 3MLWH 4TYUA 3BIKA 2ZG1A 5E8NB 4PLKD 4KZDH 1FIGL 3A6CH 4JKPH 4OZFH 4XCFL 3NIDE 1NFDE 3ARUA 1J8HA 3BP7B 3MCG1 5D6DC 4EJ1C 1FV1B 3M1BA 1OY3B 1AJ7L 2CSPA 5I1CL 4OQTA 4KK9D 4I3SH 1PFCA 2DLGA 4JKMA 3D0LB 1I7UA 3K2MC 4WEUD 4PYGA 4EUPH 3QNYA 2ESVA 3BXNA 1WZMA 1C7SA 3OJVC 1N3NB 3TO2A 3QZWB 1RK1B 4FMFA 5E94B 3VXMD 3WO4C 1DQJB 5GGUA 1NCAH 4PV8A 5DFVC 5KN5B 4IRJD 4X4XA 4CVWA 5BZDB 4YZFE 5T3ZH 4QHUA 4NN5C 1FQ9C 2Q3AA 2BJML 1JWSB 3LEVL 1INDL 2C4FT 2YK1H 1HHHA 2OTPA 1FZMA 2X4PB 3QO1B 4A6YH 3MLTB 2QHRL 1OM3L 3QUML 2GK0B 1TQCB 4P4RB 4KWUA 3MOAH 3TCLA 2YZ1A 2YOCA 2FEDD 3ARDB 1IC5H 1H9VA 3RWDA 1AXIB 4ONFL 4LRIC 4GS7C 2SEBA 1EO8L 2E6JA 3HZMA 3OKLB 4I5BA 4QRRB 4BQ9A 1KNOB 2R1WB 1KIRB 4I9WE 1KT2A 4Z0BL 2V5TA 4RCAA 2AJXL 4HWZB 1UC6A 4PJFB 3BEVB 1JYVA 1J5OH 1QRNB 2F53A 3HZKB 1JWUA 1QFPA 5FM5M 3C6LD 1A6AA 1NC4A 4HFWA 1MCNA 2R4SH 1YMME 2NY2D 3A0OA 4LKXA 1PGRB 2W0FA 1AD0B 2H6PA 4ZSOE 2A9NH 4S11A 4B7LA 15C8L 4JDTL 4FQQB 2XI9A 4OZHF 4FXGA 4UU9A 1G6RA 5GGVY 2BNUB 2NW2A 1IGYA 4XPTH 5FA3B 1BBJB 1U36A 4YDLC 2VLRE 3CXHK 2DQDH 1OTSC 5EU7C 5D7JC 1B2WH 3IU4H 5C0BB 4WGVB 4QHLA 4XBEH 3ULSB 2QQNH 4G42B 1GHFL 5KJRH 3FZUD 4LARH 1U42A 4TVPD 4NFDA 1RV6X 4NRYB 1CDBA 4D9RD 4Y4KA 2YC1A 3LQAH 2GEEA 4FQXA 4OM0H 3FCTA 3HI6L 3D3VB 3S3PA 1JGUH 1UACH 3BKJL 3RBSA 4LOUC 3N9GL 3QXWA 2ZCLL 4P9HH 3WFCL 4RWYL 2H9GB 3KPLA 5TQ2H 4GAGL 4G9FB 2WLYA 3A6OA 4J23A 3PF2A 4Z78A 1PY9A 5IGXH 2R2EA 3K2UL 1JZ8A 5B8CB 4Z7UA 2Z91A 1P4BH 1CIUA 1DJSA 1MFBH 1G9MC 4LLMA 4DKAA 1JNJA 5A3ID 2NY1C 5IQ9A 2CKBH 5FUZH 3B6SB 3NAAL 4QRPE 5CIPH 4WW2F 4B5EA 2Z8VC 3HI1A 4JN2A 1X4XA 3MJ8A 3UYRH 3P4MA 3MUZ1 1YEGH 3ZE1E 4EN3B 1B0GB 3RL1A 4XPHH 5D7LE 1NUGA 3VFGH 4KPHH 3W9DB 5ACMA 4ODXB 2NW3B 3ARSA 5D2LA 1JUFB 1NDGB 1OD9A 3HZYA 1Y0LB 1XR9A 3RWGA 1NAKH 2AK4A 5EOCH 5ESQA 3DGGA 2IPKA 4U1GB 1DUYA 4ERSL 4OGZA 4Q0XH 5I2IA 3IJHA 2CMRL 4Y5YB 3RKDC 4YFLI 2HT3D 3O6FB 5JA8B 2CUIA 2XPGA 3DV4B 1XF1A 3VMNA 5CD3A 4LCWA 2E7LC 1T3FB 3EYUH 1X5LA 3O2DH 3RVXD 1YPZE 3KPSE 3PL6B 1JIBA 3U82B 2PN5A 2H1PL 4XXDB 4PRBA 4MD4A 4HUXB 3GZKA 3P0YL 1C5DB 1GGUA 3BO8A 4M7ZB 1XEDA 1N59B 3IFPB 2CUHA 5DT1L 4WU7A 5ERWA 1BFTA 1BOGA 4I9WD 1WBZA 1FFPA 2VXTH 5I66B 3VFOA 3IB4A 3L3JB 3QUXC 5B4MC 3RUGF 1E4WH 3VI4F 3GBML 4LVNC 5HDQH 3UC0H 3ZL4L 1YMMD 5KSAC 5D1ZA 2IJ0C 4RSVA 2YUVA 3GNMH 1ZK9A 2UWEA 4L9LC 3FOMA 5F1NA 5IBLC 1KIPB 4N1CA 4DZ8B 2OXHA 1NAMB 2VQUA 1U8PB 3BT2H 2X4RB 4ZFFA 1UKTA 5C0DB 5GHWH 4M6NH 1ZHKA 4NKOB 1I9JH 4UDTB 3JWDL 5DGQA 3O3EA 3TWCL 4WU5A 4P3CL 4P9ML 4GKOA 2VLRD 2XQYG 5E8EB 4RGNE 4IEFB 5B3JE 4ZO9A 3X13B 5I73B 3OXSB 4XWGH 2ZPKL 1AO7A 3ARBA 4MVBC 3UPAA 4OD2A 1TPXB 3RZCB 4MX7B 3O3UN 3KPRA 2PXYB 2R2CA 1M6OA 3QQ3B 3MRIB 2VLLB 4B0MM 4Y1AE 1X3DA 3KPMB 1OCWH 3S97C 1FO0H 1JPFB 3RWCB 3TJEH 4EDXB 1TENA 4ZODA 4RNRA 1JFQH 1U3HC 4YPGB 5D96B 3U0PB 3NCJL 3H7BB 3QSKB 3SDCD 5CJ5A 1DCLA 3IDJB 4YR6A 1QBBA 4UV7L 1FL6A 1OSZA 3QPXH 3HLAB 1HYSC 5TE7L 3LD8B 1I7TB 2VLJB 4ODSH 4LK4A 5T3XH 3P73B 4Z77B 4LF3A 3GMQB 5EOTB 3NPSB 2ARJB 4PLKC 4QRPD 2V2WA 3ZT5A 3AS0A 2BSSB 3LY6A 1K4DA 2VDMH 5ICZA 5ALBH 5ICYA 2PYEB 1RJCA 1C08A 1FLTX 3SQOL 3U1SH 3VXPB 3ZKMD 1CD1A 4L4VA 3LVEA 3V0VA 5I17A 4XC3H 3KYNB 3VFUB 1KN4H 1K2DB 3KJ4B 1X5YA 4OLUL 2AW2A 4OZHB 5TH2A 4IRJC 4YXHH 2HP4A 5T1KA 1F3JA 5L2KE 1KBGL 4CUCA 4Y5XC 4O4YL 3KPSD 4ZAKB 3JTSB 3TM6A 1DQQB 1UJTA 2WBKA 1RFDL 5D93B 5I18L 5GZND 3U2SA 4U6YA 1EEQA 3CXHJ 1MRFL 5C2UB 4Z7QE 2N7AA 5E5MA 3OKKA 2DI8A 2F54A 5ENWB 5MEOA 4J4PA 3MJ7A 1N5YL 3U7YH 1J86A 5IMLA 2H8PB 2VXUL 2VDNL 2VLKA 3TVMA 4JFDB 5DD6B 3HE6C 1C5CH 3GM0A 1K8IA 1A2YB 3FRUA 1T1YB 3L5JA 4ZUVB 3MA9L 2HLAB 3MRNA 4QRUA 3U9UB 3C5JA 3LEXB 2FEDC 3EYSH 1Q9KA 3PWVB 4NZUH 5FUCC 1BM3H 4YWGL 1XIWD 1BZ7A 5HGAA 2AS5M 1EFXA 1KB5H 3FB8B 3MRMB 4JKWA 5GS2H 1SVZA 2DIBA 3CVHB 3K8KA 4RMUA 1P9MA 1BD2B 5C92A 4RA0C 1BX2A 1IZKA 2Z92A 2QQKL 5AZ2H 1Q1JH 3SPVA 5IW6B 1IM3B 3RWEA 8FABA 4MB5A 5D7SL 4W70A 3QYCA 4RGND 4PGEA 3V4PH 4XB8A 4ELKA 3C6LC 2VYRE 2NY2C 2F74A 3OTTA 1TVBB 4G80B 3QULB 2DQFA 3VA2C 1ZT1A 3WIHH 5HHPA 4JQXC 5E56A 1UCBH 4YPJA 1J1XL 2UY6A 4S2SA 3CCHB 3O41A 2YBRB 5AAMA 1VDGA 2VQTA 3DX6B 1AGFB 4Y1AD 3OAYH 5C0GA 1E4XI 4AT6B 2LE9A 3QIBD 5DO2D 1O5DT 1PD6A 3FRPG 5L7XL 2VE6A 1Z9MA 3WUWB 3DRQA 4OZGA 2X41A 1HH9B 1FNEA 3TESA 4N0FB 5B3NA 5FHAH 3SE3C 1BZ9B 4F80A 4LCCB 3FZUC 2CIIA 4ODUA 3CDGB 1A9BB 1GZPB 4KI5F 2YRPA 1LVEA 2L0DA 3O8XA 1BFOA 1K4CB 4AENB 5KS9A 4NC1E 4QXGH 3GRWH 4UIMB 1U91A 4GAJL 5CS7A 3O6LL 4OZIA 3MMEA 4P2QB 1OAXH 3IDGB 3C2AH 3WNLA 4W4OA 3BX7C 5F7HA 5I74C 3RUGB 1FBIL 5D5MB 1Z9SA 2V2XA 3VFTA 4UT9H 1Z5LA 3BP4A 5DJYA 4FABL 1VKXA 3X3FH 4GLRH 3GJFA 4XNZB 5A43C 5CEZE 1FZKA 4DFIA 3FB6A 1RIUL 4LLWB 1N8ZB 3ROOA 4KC3B 3VXUE 3BZEA 3K8LA 3AM8C 1JHLL 2MOVA 2VR9A 4RFNB 5DYOB 1JHKL 5A3IC 5DMYA 4MA7H 4BFGA 1ZLVK 3BP7A 4JFFE 1N4XL 2I26N 3EW3B 4AMKL 5L2KD 5DRWA 1RUKH 5H37G 5C3LD 2XN9B 4IDJH 1FV1A 5BVPL 3OG6B 3TGXA 2WINA 5J57B 1DBKL 2DMBA 4IDLA 3D0LA 5JUEL 4XCCL 4OGYL 1CLOL 1N6QH 1IARB 2GJZB 4X6FA 1N3NA 2DQHL 3LKQB 3GJEA 4Q6IA 1TVDA 1YDPB 3CPLA 4TSCL 1WK0A 4U1SB 3PG2A 4UOJA 3MV01 1SJHA 4K7PL 2FB4L 1F3RB 2NLJB 4BH8A 2HT3C 2OL3B 5F9OL 1T1ZB 4PRAB 43C9B 4PJEF 4HWUA 1CT8A 4RISL 3P77A 1CTOA 3I6LE 3VW3L 3VXRA 3IDXL 4Y2DB 5D2NA 5BZDA 2DLHA 1NCCL 2PW1A 5DQDH 4IJ3C 6FABL 3HNTH 1AY1L 2I5YL 2OZ4H 1U3YA 5F6IC 1Z0MA 4P5TB 1EMTL 5C0RL 5DJ0B 1S3KL 1IGCL 1U8KA 3S3JA 1D5IL 2Z35B 2NZIA 1UM5L 2AEPH 5ITBL 4M43L 3SEPA 5C6TH 3UO1H 1TQBC 4UTAL 4O5LL 1MFDH 3JWDC 2RFXB 3AU1B 1F4XH 4NP4L 4XNYH 2I60H 1Q38A 2BY3A 4JFEE 4DCQB 4G6KL 4MNQE 3QA3B 1IGJB 5CP7A 2BVOA 3FQXA 1T7WA 2BVUA 2PUQT 1S9XB 3OKLA 4Y4FD 4QRRA 4JM4H 1KNOA 4GW4A 3ARED 1KIRA 3GBNL 4F58H 2Y5TB 2WP3T 1WIOA 4YHML 4WHYG 4HPYL 4GMTL 3F7YA 5HDBF 5GJSH 2OQJA 2W9LA 4MNHB 3SDXF 1FLRL 4WEBL 1F6LL 5DC9B 3BP5A 1IGMH 3FJTA 5GRZA 2IWGA 2YEZB 2VABB 5EU3A 4LPWA 1R3IL 5FM5O 3DSFH 1CDCA 1KTLA 3L3HB 4FQQA 5GQBA 1KC5L 1NBZB 4PJIE 1XGPB 5GJTH 4LHUG 1D5ZA 4D0DB 1W72L 1GC1L 3VFMA 5F7NC 2FATL 2BOCA 5IFHL 3NFSH 3QDAA 4BQBA 1S5HB 5JW5B 2WUCL 4L3AA 4TUOA 5BVJA 4LRNH 1A7RL 3FHAA 2FL5B 4E5XB 1IC7L 5CEZD 5F9WC 2X4UB 4NRYA 3C9NA 4MJIE 4X6CE 3VXUD 2W92A 2ICEB 5CJQL 3WJJC 3DUUB 4S1RL 4JRXA 4JFFD 3VXNB 3HS0B 5GPRA 2K3TA 2AI0H 1R3LB 4PRDB 2K7QA 2H9GA 4R7NB 4LHQB 4WI4A 4WDIB 4XP4H 3ZKMC 3W2DL 5F3BA 2HRLA 3NA9L 3H42L 4CW1B 4UUJA 1LO0H 4KK6D 2IAMC 4O02H 5LXGL 2FRGP 3IKCA 5E5RB 2QJDA 2DQGL 3KHOA 3D6GA 2BCKA 5DRXB 4WTZG 3MNVA 4R96B 3AY4C 3I6LD 4DKFH 2AJ3B 3GSVB 3DVFA 4MB4A 1DBJL 1UB5A 2P43B 1FC1A 2P5WB 3WS6C 4ETQA 2JJUA 2PO6B 5GZNC 1EXUB 5EU6E 1WFOA 3W0WB 4YBLB 2NW3A 5A1AA 1REIA 1RQ5A 5C0JB 1JUFA 4H25A 3MJ9H 5CJOH 2BHYA 5DJ8B 1KJ2L 4LCIH 5DHYA 5J0BA 1ED3B 1X5JA 3DUSB 1A02N 2ATKA 2QSQA 5SX4H 4Y5YA 5LGKA 4UILL 4P46B 4PJGF 4CMHC 1P69B 5DHXB 3LPGA 3TP4A 1X5HA 4YXLL 3IRZA 1T3FA 1ORSB 3FOLA 3HC4H 3PL6A 5CCKL 1T0MA 1XIWC 1CD8A 5IW3A 4OLVL 4JFED 2JJWA 4MNQD 3MACH 3O0RH 2OR7A 4W6YB 4YHNB 4XP5L 2ED9A 2OP4L 3MA7B 3THML 3DYMA 1QPXA 3L3JA 2XZAH 4PRPB 3SKNA 1QLRB 2H41A 5BJTB 4GRWH 4LL9A 5I1IL 4HBCL 5H2BB 4M61B 1VFAA 1YJDC 1LP9B 4RGNC 1A7PL 1M7XA 4OV6F 4YLQT 1MJJA 5I71C 3PGCA 1MCOH 3QFJA 3EHBD 1CIDA 4ZDHB 1DQMH 1SQ2N 2X4OA 3DJ9A 2Y72A 1FO0A 1KIPA 2Q6WA 4DZ8A 1NAMA 4HEME 2CK0H 4NKOA 5SWZB 1RZ7L 4UDTA 1JHTB 3QIBC 5DO2C 3LKOB 3TYGL 2F5BL 1QQDB 4U6TA 1RSFA 5A16B 1RZ8B 4NQSA 1BGXL 3AB0B 4HK3N 2R2BA 4LGRB 4G3YL 4U49A 1UB6A 3X13A 4XPBH 3IDIA 4H88H 3OXSA 4QHNB 3MRKB 5JXEA 4MX7A 3Q3GB 4MJID 5GGSY 4F7TB 3QQ3A 3ABZA 3MRIA 1E4JA 3U4EB 5J11B 5KW9L 4O58H 2KH2B 4P49A 4MAUH 4EDXA 1JPFA 5AD0B 1I1AB 5IKCA 1R5WB 2EEDA 2KUTA 3VG0H 2AJVH 4JLRA 2J6EH 4NT6B 3HRZB 3C08L 3FFCE 3IDJA 2FNBA 3E6HA 3GSNH 5DZOA 5D7IF 2BRRH 3HLAA 3O4LB 4UOW1 4LEXH 2R69H 1HKLL 1HXMB 2XNAB 4LPTA 2DTML 4P0DA 1ZT7B 5I15L 4RMVA 1PKQA 4Z77A 4MQ7A 4YIQB 3GMQA 4I1NB 4MMZC 3U48A 2WBJA 2DQCH 2D3VA 2XICA 2FX8L 1DE4B 3ILQD 4M5ZL 1RAMA 1Q0XH 3MBEB 1MRCH 4GBXA 5EU6D 3DMMC 1CWVA 5HD8D 4M4PA 3QBTB 3SDXB 3NCMA 2C3VA 3GI9L 3PHOB 1BZQK 1J8HE 3ARYA 3MXWH 5KVEH 3BPNC 3TA3D 1CICB 3KGRA 4JG1H 3QFDA 1CE1H 3FFDB 5F7LB 4FTVA 3ULVH 1FNHA 1TMCB 5CZVL 5C3TA 4YE4L 5JDJA 2ESVE 5HGHB 2BK8A 3IYLW 1UFUA 1YEKH 4J3SA 4XNMB 4ELMF 2CGRL 4OFKA 2ILLA 2BXZA 3HTLX 3IAPA 4WV1B 2HFFA 2G2RA 1R3KB 4DN4L 2KBGA 5EH1A 4AL8L 3NZHH 5ENWA 4RX4A 3VG9C 1IAKB 5GRYA 5C0AB 3KVQA 1KXTB 2AV1B 2B1HH 3X11B 4JFDA 3SDDB 1S7RB 4HUVA 3I9GL 4HQQH 3ECBB 5F7EH 1IL1B 3TCXA 4JFOA 4LCYA 1A2YA 1J11A 4U1MB 4WHDA 1T1YA 3FB5B 4AH2A 3MRQA 1F00I 3VH8G 4HS6B 1OGAB 1JNLL 3FB8A 3T4AB 1GVIA 3MRMA 4DOHE 3TBYB 5K59F 3OJMB 1XZ0A 3VMPA 3IRPX 2R56L 5DJZA 4EDWH 2J4WH 4Z7VF 4Y4FC 2WLZA 2X4SA 3AREC 3F7PC 1NC2D 2VO5A 1VGEH 1HQRA 4PJ9A 4GXVL 1FZOB 1KJVA 4LNRB 2ADFL 4PP2B 1KPUA 4DUVA 5DJXB 4CAGA 5KSBA 1EAPA 1CDIA 1TVBA 4RQQB 3QULA 5IJVB 1BBDL 1U3ZA 2F5AL 2PTVA 2ZCKH 3TBTB 1P7KA 4IS6B 3V9FA 2YBRA 3WO4B 4E41A 4NC1C 2APXA 5T1LA 5C09E 3N50A 5AYUL 3TO4A 1EHXA 3ULUF 4OFDA 4NKIL 3VGAB 5TFSL 4X5WB 4BFIB 5CZXD 1RURL 5BQ7B 1JNHA 1HH9A 3FFCD 4OLEA 4PREA 5JNYB 4HC1H 2A74B 4N0FA 4PJGB 1JPGB 3MQIA 1J18A 1I1YA 3PDOA 2EYSB 1CL7H 1BZ9A 3DX7B 1DBAL 4Y19B 3EO9L 3Q2CA 3CDGA 1ZVSB 4ZUWB 4FOMA 2VXVH 2VIRB 5F70A 1JGDB 1K4CA 2P47B 4NNPH 1GAFL 2NY3B 5SV3A 1RHFA 5GGTL 4P2QA 4ZO6A 5GS1B 2J88L 4DTGL 5ANME 5JOEA 4PGZA 1CU4L 3TT3H 4UT6L 3B3IB 4X4ME 1ADQA 3DI3B 3BEWA 4KUCF 5D5MA 4BSWB 3MUGB 3C6SB 1JK8B 5DK0A 3S5LB 1CE6B 3MROB 4XPAH 2BY0A 3BW9A 4GS7B 5E99L 4NYLA 3L3KB 4PGCA 4WFGE 3CFEB 5LJYH 1J8HD 4G8GB 3HFML 1U0QA 4LLWA 4KK6C 5DD5H 1IKNA 2JJTC 1I9IL 4WWKA 1AFVH 3LHPL 2ESVD 3SDAD 1MWAL 1ETZB 1NMAH 4G7YL 4RZCB 3RL2B 1MFAH 3WNKA 4W4NA 4F37K 1C1EL 1IC4H 2XN9A 1QBMH 4NQCE 1A6UH 3O9WD 3GKWH 4Z7UE 1HWHB 4TUJA 4X5LA 4NNYA 3UZQA 4HLJA 5L0QC 4U0RC 2DICA 5DFWH 5K9QI 3JV6B 4U1SA 3RNQA 5I1EL 3FO2A 5CAYB 1WZ1H 4U7MA 2DQUL 2NXZB 4PJXF 4H8WL 2VQ1A 1OLZA 4HH9B 4LIQE 2OL3A 2JCCA 4PRAA 2KQMA 43C9A 1L4IA 4UNVA 1ZGLM 3IFLL 4JVPA 1AGBB 3ULUL 3BWAA 2AK4E 2MPAL 1VACB 3ZE0E 2WANA 4ISVA 3LV3A 3SE8H 1ITBB 3DECA 4XPGL 3O81A 3UDWC 2Z8WC 1U8HB 4OB5H 4MAYD 1NCDL 5DJ0A 4M48H 2JIXD 5FKAB 4Z6AT 2Z35A 4GUPA 3ZYZA 3H9HB 2CLVB 5I1LA 1OTUD 5EIVA 4LGSB 2P8LB 3E6FA 1H15A 2Z0BA 2ED7A 4Y5VC 1KIUA 3NTCH 3WE6B 2IBZX 3V6BR 5DD3L 4TNWK 1Z3GL 4X5XA 3EHBC 1NEZB 2RFXA 2NY7L 3AU1A 3GK8L 2Y6SD 1CDYA 5SV4A 4DCQA 1A9EA 5I1AB 4DQOL 3QA3A 5F44A 5C09D 1AP2B 2BMKA 1S9XA 5HDOA 5JPMB 4I18C 3NCEB 5FYJU 4J6RH 1G7QA 2NY1B 5CEXA 3CUPB 3V6FB 2Y06L 3DSNA 1FNFA 3KLSA 5DMGC 1F4YL 3IF1B 2R39A 5J8OA 2YUWA 1OPGL 4MNHA 1WFTA 1NBVL 1NGZB 1RIHL 3UROR 4XBPB 1WEJL 1MCDA 3BIBX 5I8OL 4N8PA 1Q0YL 4W6WB 3WFBL 3MOBH 1V5JA 4OD3L 1U8OB 4E42B 5I19L 3P0VH 1LEGB 3UJJH 4D0DA 4KV5F 3U46A 3VD7A 5C7XL 1P2CB 3FQRB 3KPRE 4Y4KD 2CKNA 1S5HA 5JW5A 1K3IA 5L6YL 2R0ZL 4QTIH 4WFGD 3NIDF 1NFDF 3WD5L 5C70A 1HNGA 1K3ZA 4L5FL 5HHVH 2CLZB 3GB7B 1CFTA 1W8NA 2X4UA 3QUXB 4HPOL 4Q74A 5F7DB 1Z9LA 5IFAL 1L6ZA 5D70L 4O9HL 1IC1A 2Q8AH 4Z7VB 2R0KH 5DJCB 2VUOA 3VXNA 3ILQC 4N0CD 5KSAB 1FRGH 5BOZG 4NQCD 3NCBB 5IROC 3QNZA 3ILPB 5MP6H 3KS0J 5DVLA 3UMTA 2OJZH 1NLBL 5HD8C 3GMNA 4HKXB 1ZLSL 4X8JA 4L4JA 1P4IH 5EG6C 1DSFL 2J3SA 1T21B 3TA3C 3HUJE 1N64H 2YXFA 1SY6L 1AE6L 1CVRA 1R24B 4JZNB 2E6QA 2HH0H 4F37F 4CJ1A 4FS0A 3MC0A 2VN4A 4I0PD 2AK4D 2P5WA 4FQHB 4X6BB 1QKZH 2PO6A 1I3RA 3DXAA 5LG1A 1HZHH 5F1IB 4G6MH 1DFBL 4LIQL 4MHHI 4OD1L 1S7XB 3JSSA 3RI5K 3EDDA 4HT1H 4RAUA 1U3HB 1YY8B 4NWUH 3K81A 3T3PE 4TTGA 1F02I 2ARWA 2ZKHL 4YC2B 4S1SH 1L7IH 1QRKA 4PUBH 3RDTC 3GSWB 2XKUA 2APWA 2CRZA 3RHWF 3ALXA 4MXWL 4WY7L 1GXEA 2XFXA 1BQLH 3ZT7A 2ICWI 4OFIA 5FB8B 4JRYB 3K8MA 1T5XA 1FDLH 2J7LA 4ODHL 7FABL 1JTOA 1WIPA 4ZYKA 2BFVL 2X1QA 1R3JA 4MWFA 1B90A 3MA7A 4N8VB 4U33A 2CLRA 4OT1H 4LLDB 5EU5A 3LIZL 2V17L 4PRPA 3ZHKA 1XF5A 2V7HB 2G9HB 5H2BA 1A21A 1T20B 2FBJH 3WCYA 2PR4H 1UZ6F 5FGBC 5H35B 4G8FB 4R2GD 3G5XA 1FGNL 1INEL 2E8ZA 4TNWF 5C71A 5BMFH 3L3IA 5HGBA 3N1PC 2C1OA 4OF7A 1GRWA 1EHNA 1U9KA 1FIGH 3FONB 4XCFH 5CBEB 3NZ8A 3L7EB 5DMIH 3DRTB 3VXMB 4C83A 3VA6A 2GHWB 1AJ7H 3OWEA 1TJGH 1E6OL 3P9MB 4P2RA 2F15A 4MCZB 4Y16D 2FJHB 2CQVA 4IRJB 4KHTH 4U31A 4XXCC 1JHTA 4HIIA 4Y5XB 3LKOA 2IH1B 5CZXC 1ZGLB 1I4FB 4KTEL 4N68A 3KPRD 2D03H 4QHKI 1RZ8A 3IDMA 4MA1C 4Z8FH 5DUBB 3VFPB 2VMFA 3BMWA 4P2OB 1JRHH 4JREB 5DEFA 3TT1L 1I1FB 4QHNA 5ADPL 4X7SH 3UTPD 4Z95H 4OZGE 4X6DB 4F7TA 2E3VA 2CXKA 1NFIB 1DP0A 1C16B 3L5IA 1U8LB 1OARL 2FWOA 1QHPA 1S5IL 4MB3A 2BJMH 2XG5A 3RX5A 2RHEA 5L9DL 1WBXB 1JYNA 1EVUA 4KDTC 4N0YL 3EYVB 4ONGH 5D8JH 1DDHA 1ZTXL 2AEIT 3VFWB 3OAUL 1EJOH 3IETB 4MXQD 2QHRH 3O4LA 4C4KO 3OKMA 5MEPA 3T2PA 1N7ML 1ZT7A 3TBWA 4YXKL 3LN9A 1GZQB 3BE1L 2APBA 1U8QB 2UYLA 2XZQL 3VCLA 3PHQB 4BKLB 3SDAC 3C6LB 1XGUA 5TF1L 1MREH 4WTZA 1DE4A 1FZJB 5CJ8A 2NY2B 3U7AA 5CD5D 3KYOB 3O9WC 1B9ZA 1ZLUH 4H8WC 2OCFD 4HF5L 1AQDA 3OG4B 2AJXH 2DKUA 4X0KB 3VFSA 3MRGB 3WFDL 5T3ZE 5HY9B 4G6JH 3PHOA 3UZEA 3QQ4B 1T2QL 3WNOA 1QBAA 4X6EB 3T08A 1D6VH 2R29L 2WW8A 5E2VH 5JW4N 3FFDA 1MAML 4DGVL 1PG7L 1Q94B 3WKNA 1QSVA 4JDTH 4J4PD 3LB6D 3TIDA 3U7WL 3HG1D 1QFUH 4FQJL 4PG2C 3D48R 1HK6A 1K8DB 3AC0A 3RI5F 5GGSA 1OAYL 2B1AL 4MAYC 3KPQA 1NFDB 5JIPA 5IOPB 4JANB 4DVRL 1IAKA 1T80A 1OTUC 3CFJA 2AV1A 4CVZA 5I74B 5KAQG 4EVNB 3SDDA 1S7RA 3GEWB 4APQA 3MUY1 4XVTH 3MRRA 1OF2B 1IILE 5J1AA 4OV5B 1WCBB 5GRXG 4F7CB 3S4SG 4BK5A 3DARA 4R26H 2Y6SC 3BRFA 2DS4A 1EA9C 1KCRL 3MV8A 5E08H 5B3JF 3U6RB 1OL0A 3WFCH 2AXGB 1M4KA 1MCHA 4YDKL 2H26B 5D6DA 2W65B 5ALCH 4JB9L 4PP2A 1HH6A 5FO8A 4OUOA 3K2UH 1A4KA 1RZIA 4OF3A 3PGDB 5C07A 3PQYA 3BN9C 5IJVA 4QRSA 4Q6YA 1OP5H 3KG5A 1OQOA 5ACLA 1Y18B 2PNDA 4NQVB 2F19L 5CWSA 3STZB 2CRMA 2GY5A 1H3WM 4XVSL 3R06A 4HWEL 1OAZL 4GQ9L 2A6KB 5E7FA 3F7QA 1HN1A 5ESVA 4BFIA 4AEIL 4Z0XB 5BQ7A 5J6HB 5F88B 1JF6A 1OSPH 4Y4KC 3BFOA 2ZG2A 4DK3A 4HS3B 3WJLC 2VAJA 2ZZUT 5JNYA 1K5NA 2A74A 3FT2B 3BAEH 2NXYD 3V6ZA 4ERSH 2CMRH 2ITDB 4POYA 3P0GB 1CLZH 4RAVB 3DX7A 3QQ9D 5KVDL 1ZVSA 4ZUWA 2DF3A 4MHHG 5DC4B 3EDKA 5C9KA 4L8BA 4P23C 2VIRA 4QTHA 1JGDA 5SX5H 3TN0D 4JKPL 3QRFM 4KZDL 2X89A 4M8VA 1HSBB 1PX3A 1KXQE 1TQBB 2DN7A 1NGXB 3P0YH 1YMMB 4I3SL 1Q72L 4N0CC 1MRDH 1AD9B 1KYOK 4BSWA 1WIUA 3H9SE 3UTQB 3MUGA 1A5FH 5T3ZD 3I6GA 3L3KA 4JRXE 3CFEA 3HPLB 4G8GA 4LLAA 2NY6D 2C3XA 3ZL4H 3D18A 4ZNEA 4Q2ZB 1NCAL 5DDHB 3GMMB 1DLFH 5SWSE 3L3OB 4ODVH 2VLRB 5E8OB 4HAGA 1NGWA 3DHJA 2V2TA 1BFVH 4Z7QF 1ETZA 3AAZA 3RL2A 3RWFA 1ITCA 4KAQH 2HN7B 3CVHH 3BVNB 4I0PC 5TDOB 4OCXH 3UJTH 3PNWA 5F8RC 4D94A 3RWHA 3TWCH 3B8YA 4AZ8A 2YK1L 2NY5H 4F7EB 4A6YL 1SEQL 4XBGB 3RIFK 3HAEB 5C0ND 2ZPKH 4QXUL 1QSEA 3SDCB 2B4CH 3MOAL 4BM7A 4R4FH 5D7JA 1PYWA 1PLGL 1AGBA 1KENL 3NACL 5IHZB 3VH8A 4RMTA 5BXFB 1Q8MA 3SJVA 3DX9A 1K85A 3NCJH 4NGHL 2K9UA 1T0PB 3EZJB 2NTFB 1MLCB 5EBLB 4YK4C 5ELIA 3RWJA 4BZYA 3BN3B 1J5OL 1KG0B 1RZGB 3RVVD 4LSRH 4XCNB 3DV6B 2P8LA 2MKWA 2R4SL 4JFQB 5D7LB 1I7ZA 4R2GC 4RIRA 5T1DH 1CVSC 5IMOA 4IIQA 1KB9K 3VRLE 2A9NL 1MHEA 5DHVA 1HILA 2FIKB 4BELD 5CGMA 5JOFB 1HWGB 4ZPTA 1CFBA 5JPMA 2ZJSL 4Y16C 2FO4B 5F93C 1FHGA 3QFJE 5LCVH 5IB1B 4B7IA 1YPZB 1FN4B 2DQDL 5IVNA 1B2WL 3IU4L 1X7QB 2QQNL 3SGDI 4HIJB 1DBML 5KJRL 4LARL 5JA9A 1EGJA 2FLRT 4OLUH 4XBPA 1MI5E 2VISA 5ID0B 1IM9A 1T1WB 3LQAL 4OM0L 1D9KD 2EDKA 4QF1B 1JGUL 1UACL 5EC2B 1RZFH 4KUZH 4ENED 4O4YH 1U8OA 4CMHB 3UX9B 4P9HL 4GG6E 2QLVB 5EBWB 5KANI 1LEGA 4NZJA 2E7LA 3OPZH 1KCUH 4KTDL 1XIWB 1B88A 1KPVA 5HYSB 3CZFB 2FR4A 2XKNA 3MV7E 3H9SD 3G08B 2Y23A 3DVGB 2Y1VA 2XWTA 2VXUH 2VDNH 2UZYB 3RGVD 5IGXL 3BZFA 4JO2H 4MXQC 4JRXD 3T8XA 5EOCJ 3DROB 4PRIA 3VXTB 1P4BL 4GOSA 4CNIB 2ICWB 1AXTH 1CGTA 1I75A 4KI1A 1BVLB 2CKBL 5FUZL 4YWGH 5SWSD 5E2WH 4YHPB 3UYOD 4RMQA 4RGNB 3SDYH 3U36B 5BRZE 2R1YA 4J3UA 2VXSL 2Q1EA 3BH8B 3UYRL 3ZDZF 1BOYA 4NHUB 5KSAA 5LQBH 1YEGL 4X7FC 3B9KC 5CD5C 4XPHL 4PD4K 3P2TA 4K7PY 3VFGL 2E6PA 4KPHL 5C0FA 1PKQE 2QQKH 4L9LA 4UBDD 2AXHA 2FJGB 3HC0A 2BNRE 4XNQA 2ZOKA 4PYHA 4WEMB 5EOCL 5FYJH 5DRZA 5IEKA 3FQUB 4Q0XL 1T21A 3QIBB 2NY0D 3DPBA 5EIQA 3X12B 1ZKAA 4HWBL 1BAFH 1R24A 1NGYB 4LPCA 2QHLA 3O2DL 2YSSB 3GM8A 1QLEL 2R0LH 2A6IB 2EH7H 4OUUA 2A0LC 4FQHA 5EZJB 2QEJA 4EXPX 2FDBP 1FYTA 5K9OA 5L7XH 2VXTL 5IF0A 2GUOB 1E4WL 3UTTE 4I8DA 2Z8SA 3HN3A 5HDQL 5IIEA 3ZTNH 3W5MA 4IHOB 2GJJA 3GSQA 3L9RB 2C5DC 1SYSA 2EYRA 1V8HA 3LH2H 4HX1A 3GNML 5GRWA 2EDEA 3WHE0 1MCQA 1CLYH 3O6LH 4KMLB 5E2TH 4WNQB 4P3DA 1V3KA 2DQJH 3BT2L 1J12A 5FCUL 1FVCB 1KYOJ 5GHWL 5DJAA 1I9JL 3UTPE 1F11A 3QWRA 3QFJD 5L2KB 1ZWIB 2XWBB 3MRLA 5EC1A 1LO5B 5D4QA 1EO5A 3QAZB 1MY7A 5KBNC 3Q5OA 2H45A 1HI6A 2D2OA 4HCRH 4XWGL 1LO3H 3AUVA 1RIUH 1MI5D 3DBXB 5HI3D 5B22A 1WWBX 5CBEA 4LFHG 4AMKH 3GSUB 3VXMA 1JMZA 5DFTA 4KHXL 1OCWL 4PG9B 3TJEL 5C1MB 5KSBE 2VDLH 1XF4B 3BDYH 1DBKH 2FJHA 2HJLA 4IRJA 3N0PB 4R97C 3VGGA 2F9BT 1S78D 3KAAA 4FQLL 1CLOH 2IH1A 5JXED 4WFHE 3MV7D 4J1UB 5INCA 4TSCH 1X5KA 5JORB 3WFEH 4E41E 5IVOA 3QUMA 1VFOA 2NXYC 4XT1C 2NX5A 3VXOA 4K7PH 2FB4H 4ODSL 5T3XL 3QQ9C 1E27A 4W4OC 4G8IB 4CBPA 4WFFE 4X6DA 2VITB 4QEGA 3IDXH 3LKRA 4HH8A 3TN0C 1NFIA 5IMKA 3HE6A 1C16A 1GIGH 3QIWC 3K3QA 4IMLA 4XB7A 1LE5B 5JMOC 1XH3A 4D0CA 5BRZD 3QDGA 4OI9A