3TVMD

Structure of the mouse cd1d-smc124-inkt tcr complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Glycolipids that Elicit IFN-gama-Biased Responses from Natural Killer T Cells
pubmed doi rcsb
source organism Mus musculus
total genus 60
structure length 239
sequence length 239
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tvmD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tvmD02
5DD6A 3QEQE 3MCLH 1C5DA 2DJSA 5D2LE 1U8KA 5FM8A 5KOVC 1FVDA 3U36B 1AD9B 4NT6A 1QFWH 3LSOB 4Z7OF 3ARBC 3U0WL 1ZHKB 1F11B 3P9LA 4JVUA 4G6JH 3PDOB 4JFDD 1R3HA 3S6CA 1KJ2H 1SMOA 1ZHLB 3CUPB 1OAUL 2D2OA 2FEDC 4WTXA 1X4XA 4G7VL 4OQTA 1C5BL 1NCWH 1NGZA 5C3TA 1KSRA 1TCMA 5GGVY 2XNAA 1ITCA 5GSVA 1REIA 3NIFF 2G5BB 3V6BR 15C8H 4O2EA 4ALAL 3L3OA 3P77A 4ZUSA 5L7XL 4U0RB 3T4YB 1NGYB 2EIZA 2P8MB 3P9WB 3T0EB 3HZYA 5I17B 4QGYA 4YXLH 1H3XA 4QRTA 4RMWA 1H3PL 3TT1H 2DIAA 4JZJB 1W72B 1R24A 2NY5L 2I60L 1JGVH 3ULVC 3MRDB 3FFCE 3D87B 3QXUA 5GZOD 1ZGLP 4NNYA 4KRLB 1LDPH 3T3ME 2QHLA 4P5TC 4LVHC 3U0TA 5BVPH 1I85A 1YEGL 3HPLA 4TOYL 5F7NC 2YD2A 3SKJH 2Z91A 1MFAH 2WQRA 3UJTL 2NY1D 3QUZA 3E2HC 1AXTL 2OR8A 1KNOB 3DXAE 4HPYL 3MJ6A 1KC5L 4Q97A 5DSCB 5DGQA 5IOPA 1QVOA 4DJMA 5D6CA 3NPZB 4WY7L 3RZCD 1XGTA 4RMRA 4XVTH 1WZ1L 3VXME 4PRBB 3NACL 4NCC1 4JGUA 4LMQI 3ZKMD 1FZMB 3HNTL 4PJCB 3I02B 5I0DA 5CBEA 2X4SB 3GBNL 1TZHA 1KN4L 1EH9A 2F53D 4GW4A 5J6GB 3GSRB 4NGHL 3OKOA 5JR1L 3NVQA 1G9NH 3PE9A 4MD5B 5E95B 2QLVB 2VLRB 4QTHB 4IRSA 4IMKC 4LMQE 3HE7B 3ULUL 3QEGL 1LO2H 2V7NB 1OPGL 4QRUB 4X7SH 2ZUTA 4KWUA 4APQD 2PYEE 3MV8B 4O51A 3REVA 3ZDYE 3G6JF 4HX1A 3PHOB 3U4EB 3LKNA 1W0YT 5JPMA 1JPTL 1LDSA 1YEKH 1ZHNB 4RX4A 2XTLA 2HJFB 4PJIB 5EPMB 2MQ3A 3EO1A 2I9TA 4CW1A 5I1IH 4TVPD 1XIWD 1AE6H 4LSTH 4P2RA 4XXDB 4AZ8A 4C56D 1HHIB 5EZOH 5CIPB 3U83A 1BD2D 1SY6H 5ACZA 3LY6A 1S7TB 5IHUH 1JF1A 1G1YA 3CFKA 1BZ7B 4JKWA 1MRCL 4OBSA 5LBSL 2WUBL 4XBPB 1B0RA 5DD3L 2HTLD 3QNYA 2FYYA 5KSBB 1OM3L 3VFPB 1JPFB 2W59A 1J18A 3NIGF 4EN3C 2BNQD 3L3JB 5GS1C 3GM8A 1AO7A 2OYPA 4PBWD 5HI4C 3SDCC 3QDJD 3VE0A 3ZE2F 2EIDA 1WBYA 4UDTA 2MCPH 1WTLA 4U33A 4PTUA 1N59A 5J12C 4LEXL 1SHMA 1CD1A 3BEWB 4TSAH 4JHWH 4R97C 4CNIA 2ZPKH 3WN5A 2BSED 4EZMA 2P44B 2VLJD 3EDKA 1LE9A 1I8KA 3UROR 5J1TC 2BY3A 1U3YA 1FYHB 3DIFA 5I15H 4HUVA 1M71A 5CS7A 4WHTB 3LKPB 3MJ7B 5DRWA 1FN4B 1TIUA 4QTIL 2VR5A 2PXYA 3L5JA 1R3IL 1R5WB 1F4XH 1ZVYA 4ZAKB 4UT7L 3C87A 3B2VL 4P9MH 2X4NA 1WBZA 5CINH 5HGDB 4WW2C 4FMKA 3DMMC 4QGTA 3GJFA 4JFFA 1K8IA 3LQAC 3RWJA 4R0LB 5F7LB 4WFHD 1QTYT 1QSEE 1GC1L 3C60D 4XI5C 3S7GA 2WM0A 4XT1C 4KJYB 2CD0A 2APWA 5F9WC 5CEZH 4UV7L 5E9DB 4NKDB 5GZND 3QG6A 5F44A 3ABZA 1JMZA 2E7BA 5E03A 4N8VA 1MPAL 5DD1L 1IZJA 4MHHG 2F8VA 2OXHA 2FBJH 3CK0H 3HG1A 4UUJB 4Y4HD 3SDYL 4LDEB 1S7SA 3D0LB 2ERJB 4JPVL 5EZJA 4EI5C 1KG0A 1HXYB 3U9PH 1F3DH 4M7LH 1VFMA 5C0BA 4MXQC 4Z0BH 4TQEL 4PS4H 5GRVK 4OLXL 4MAYA 3E6HA 2IADB 2VDOH 3QXDA 3VMOA 3BIAX 3Q6GH 5E1HB 1CL7L 1TQCC 4TUKL 4WEBL 2DQUL 3EHBD 4QHUB 5C0AD 3HS0B 1YEJH 2R56H 3MYZA 1JGLL 3SJVD 4NP4L 4KI1A 1X5JA 3FO0H 1JPST 3RDTD 5I9QC 2HA1A 5IROC 3QA3B 2B5IB 1JVKA 3SE9L 6CGTA 3IXTB 3RU8L 2ICES 1NAMB 3NPSC 3UC0H 5IVXB 5K9KA 1BQLH 3AXLA 4MNGE 4KI5E 1DCLA 4O58L 5EU6A 5SWQB 2A74A 4I4WB 3MRHB 5B4MC 2OLDA 4RMTA 3FKUS 1CDHA 1JNLL 2EO9A 3PNWA 3OXSB 3RUGA 4Y1AA 5HHXH 4L4TE 4J23A 3TN0D 3QXAB 4K3DL 5EO9B 5DYOA 5JIPA 3TO4D 4LARH 2NY4C 1OHQA 3MACL 5D5MA 4S2SA 1MH5A 4WO4B 3X11A 5J6HA 1QR1A 2MKLC 5DJDA 2PR4L 1S9YB 5LGHH 1AR2A 3CC5A 3MV8D 4QEGA 5SWZB 3GSNL 3UO1H 3Q1SH 5EBMA 3WL9B 1I3GH 4F57H 2F19H 2EDWA 4XP6H 1C12A 4B7IA 5TDOB 4DKEH 1JUFA 1IQDA 5EA0L 2J2ZA 5ICZA 2MTPA 3GMPB 3TWCH 4P2OD 1VENA 5AEAA 4HJJL 4F9PC 5CJ8A 2O5XH 3O4LA 2X1OA 5C0FB 1WIPA 2P4AB 1KELL 2JJSA 2GIYA 5E8DH 1CE1H 3VXTA 4DKFH 1MWAB 4GAYA 3IFLL 1WEJL 3MUGB 2JE8A 4JG0L 1K4CB 4OZFA 3AREB 5HGHB 1G6RH 2P5WB 1MOEA 3TCXA 1QYGL 1A5FL 4NBXB 1J8HA 5B8CC 1S8DB 1S7QB 1DQLL 1RZFH 4XPFL 3BGFB 3N0PB 5JPNB 1E4XH 1ZVHA 2HJKB 4E41E 1Y0LA 2VE6A 1TTFA 4GFTB 3T3PF 3RL1B 3KJ6H 2AV7B 1JZ7A 4PY8I 3T65B 3QG7H 4BSJA 4NQDA 3O2DH 2DTSA 2FHCA 3MYJA 4DN4L 2XKUA 1E0OB 1UB6A 3JWDC 1LK2A 1G9MC 4GT7A 4QXTB 4OQ1A 5HJ3A 4TTDC 4OUUB 1KEMH 3FO2B 3BH9B 5TE7H 3X3FL 2BRRL 4PJDB 5J8OA 4D0BB 4BSVB 1U6AH 5FHBH 1BVLA 3FRUA 1B90A 3HG1E 3RNQB 3D1MC 2EXYD 1MIEH 5SWSD 1XT5A 1GGIL 4JY5L 5BV7B 5C6PB 1NQBA 1FNLA 3CMOL 1YA5A 2VXTH 3GI9L 1KLUB 1Y6KR 5C0BE 3IS0X 5D1ZA 2GITA 3F5WB 4I3SL 4KKAD 5EIVA 4FABL 5I71C 1KCUL 1VHPA 1IEAB 4OIIH 3G6DL 3CVHB 3SDDC 2E7CA 4PJCF 5BJTA 2NY6D 2J8OA 1TVHB 3W5NA 4KRPC 4D94A 1OAXH 3LRSA 5BV7L 2OL3L 1F58H 3F58H 1B0GA 3KXFA 2CKBB 2FNBA 1RZJH 3FQWB 4U3XA 4WU5B 2DMCA 4U7MA 5BZDA 3ARFD 3O0RH 4M5YL 2B0SH 4LPVA 5GSRB 3H2WA 5CWSB 1TQBC 4OKVA 1WC7B 3IU3B 4PJ7B 3AB0C 4KROD 5CP7B 2RCSH 4HXAL 4NN5C 4DTGL 4K7PH 1DQMH 1X5KA 3JTSB 4PJIF 5GGUA 4NQCE 4HKXA 1WICA 2NXZC 4Y0GA 4MJID 3M1BA 5C7XH 1I1FB 3QI9C 3HNVL 2P24A 2DL2A 3QUZC 4WWKB 4Y1AE 1A21A 3C5ZA 1IARB 2CQVA 3VDBA 3DGGB 3LS5H 2GJJA 4HDIA 1PBYA 3V7MA 4XBGB 2E9WA 4FQQB 4PJ5B 4P46C 4PJEF 2ITDA 2X89A 1JGUH 5KSBF 2ADJA 1DFBL 4BH7B 4A6YA 4UIMA 4MJ5B 3KDMB 3O4OC 2QHRH 3MLRH 4PJGB 1K8DA 4HIEA 1MHCB 2ILLA 1YMHA 2HKFL 3KYKH 1EHLH 5AG8A 12E8H 3OQ3B 3CFCL 3QWRD 1YDPB 4FOMA 4HKJB 4CAGA 3HI6H 2HT4C 4OM1L 1NLDH 2NNAB 3QEHA 1MJUH 5FAAA 4IRSC 4PR5A 5L88L 1T1YB 4KJPD 4Z7VF 4GW1B 4EBQL 3MXWL 5E4IA 4NRZA 3N1FC 4PJ8D 5CSZA 1RZ7L 1LD9A 1QBAA 4LFHG 4S0SD 3HRPA 4LKCA 1PG7L 5CBAB 2BHUA 1J8HE 1MRFL 3STLA 1HKFA 4OV5A 2EDTA 2VLLA 1IC5H 4EDXB 4S1RH 3RVUC 1ZA3B 3D25B 3MRRA 4F9LA 2VAAA 5HDBF 3QR2A 2F15A 4NBZB 5E00B 3IVKB 4UOW0 5F3HB 5GISH 1S9WB 4TNWF 5DMIH 5KN5A 1A7OL 2GKIA 4X99B 1CE6B 3BH8A 3C09B 2EDHA 5L2KA 2YPVH 1MFDL 4H0HB 3V5KA 4HGWA 1I8IA 3V5HA 4QRRA 3VCLB 4N0RA 2VLKA 3HAEA 3GJFK 5FHAH 3BKYH 1HWHB 3GMRA 2HJLB 2JB6A 4M6NH 5CJOH 5IW3A 1BX2A 4XP5H 4K3EH 4QO1A 4HKBA 3WN5C 4NNPL 2YRPA 3BAEH 5L0QB 1VESA 2EXWD 3DURA 4A2LA 2APBA 2R4RL 4ODSH 3FQUB 4GBXB 4LGRB 2QV2A 2Z31C 4HAFA 1D5BA 3S9DB 5E2TL 4KXZI 4Z7NE 2N1KA 3DYMA 1VSCA 3KXFE 3DRTA 4HLJA 4DCQA 1CQYA 2PXYC 1U42A 3LV3B 2AJXL 4XRCB 1EZVY 5LAXA 4ZNEA 2PYFB 5J9PB 5MEOA 3VFVB 1OF2B 1F42A 1DBAL 1QSFA 2R0KL 1FE8L 4Q6IB 5DLMH 4Z7OE 1YMMB 3F8UB 4HWEL 5IVXF 4X7FC 2WV3A 4I0CC 3ILPA 1SM3H 2HTKD 4HZAA 4OAWB 4JANA 1FORH 3TM6A 1NDMB 4GMSL 5TDPB 2UWEB 5DHVB 3VFMB 1A1MB 5ILTH 5T5NG 1L0YA 1A6WL 4JN1L 3A67L 3HCVB 2CIKA 2XTJD 3QO1B 4GS7B 4JR9H 3BHBB 2VDQL 4MLSA 4FQ2H 1U93A 1F45A 1EFXD 3VH8A 5EU5A 3C5SA 5CD3A 1N6QL 5AZ2H 2GSIA 5DJZB 5A16B 4ODTH 4YFLI 3GSXB 2QSQA 3UTZB 4LKXB 1RZKH 2BVOA 3R1GL 3FT3B 3EO0B 1KIPA 2YSSB 4QT5A 2E3VA 5CGTA 5C0JB 3DV6A 1DBBH 3ROOB 4JB9L 4P2QB 1FH5L 4W4OC 5DEGA 2Q87A 3NA9L 3H42H 3MLTB 1BFVL 2ZUWA 4ONHB 1VEOA 4PP1D 4FFVC 5D2NB 2P45B 1E6OH 2VIRB 2VR9A 1I1YB 4NZTH 5CZVH 2VISA 3DO7B 4ZFOB 4L3CB 1WVZA 4P4KD 5D1XC 2QKIA 5IW6A 1UA6H 1XGPA 2M1KA 3V6OA 2BJMH 4U1SA 5KSUA 1NMBH 2Q7YA 1S9VA 1SBBA 3CFEA 3QUXB 4G9DA 2YA1A 2M26A 4LIQE 3BPCA 2X4QB 5AWNH 3TNNB 2K9UA 5KAQG 4LASH 3OXRA 5EU7C 2VQTA 5I19H 4KTYA 1UZ8A 1IKFH 2EECA 5FOJA 2W91A 4PJHF 4J7RA 5KVGL 4BSWB 2OJZH 1RURL 4FTVB 1D5MA 1VERA 1U8IA 5FUCC 4HUUA 1R3JB 5L2KE 1OGAA 5ECJE 1MCJA 1NFIA 3BMVA 3ARBD 5HHOB 4Z77B 1BIIA 4J3OC 4PJDF 3TJEL 4YEEA 1MF2L 3KS0H 1I9JH 5GIRB 1F6LL 4QYOA 3ALWA 2IAND 1QKZL 3GM0A 4P59L 3KPQB 3P4LA 5JO5A 1IE5A 2FEDD 5EDXA 4BH8B 3QHZL 5IVZB 2KKQA 4XHJC 2VZOA 4EJ1C 5FCUL 4MAUH 2C4FT 2VKXA 3OKMB 4NJ9L 5GHWH 5EC2B 1ZLVK 5C70A 3AM8C 1I8MA 1BFOB 2DF3A 1C08A 1F6AA 4M93B 4FN0A 3IDGB 1D7FA 3ARUA 4ZSOE 1JPSL 3QDGB 4MNQD 2IBGA 2W9EL 3ULVD 4JE4B 2VDLH 5F1IA 3KLSA 3U2SB 5D6DA 2VLMD 5FYJH 4KJQC 1Y18A 4KGJA 4X9BA 2UV3A 1GJIA 3ZZ1A 3MJGX 3QJHA 3OJMB 3GGWA 4X5XA 5DJ6A 4JVPA 4PJ7F 3UTTB 1LNUA 4WW1A 1AGDB 3FONB 3N1MC 1QRKA 1FNEA 4Y4FC 1KULA 4N0CC 4KHTH 3SBWC 3V4UL 1D9KA 2ATKB 1EO7A 3I6KB 2JK5A 5LGKA 3DX9A 4OZHA 4IRJB 2F8OA 4KMTL 4KJWC 3CH8A 5KBNC 5EFIB 5IFAL 3NCYP 1XGRB 4QY8A 5BS0E 4XB7A 4ZPVA 5HHVH 5CKAA 4PREA 4FFYH 2JJTC 1U8LA 4BK4A 2H26A 1VGKA 4XMPH 1Q9KB 3ORJA 1P5VA 4I18B 3O9WC 3WFCH 1MJJA 4C55A 5D1ZC 5A43C 4OCXH 1EBPA 1JIBA 4U1GC 1T5XB 4Q6YA 2GTZB 1FZOA 1Z5LB 5IG7B 4O2FA 4C4KT 2R1YA 4X8JB 4PJGF 1T6WA 2JIXB 1KTDA 3X17A 2Y5EA 2ZSWB 3P4NA 2Q6WB 1U8OB 5IT2H 2J8HA 4Y4KB 1BJ1J 4KU1A 1NEZA 1VFBA 3RA7H 1JFQL 1KPRA 1AGBB 1U9KA 5F7FA 4Q7DA 5E56A 4KQ4L 3CFDB 3I9GL 3VRJA 3QNZA 2YMXH 4ZODA 5FO8A 1CD0A 2ESVA 1A6UH 1RIHL 4LRNH 3I6LE 4LLVA 3VA6A 1FAKT 2BERA 2HN7A 1A7PH 2APFA 1PG7X 4P2QD 2AJYL 4ELMA 3SDAA 3RWEB 3LPFA 1WBXB 2AI0L 4JM4H 4D9RE 4HH9B 1CGWA 3OB0H 1RSFA 3TA3B 3IFOA 4RMQA 3S36H 1J88A 5ACLA 3GO1L 3V6ZB 1MHHB 4EN3D 2XWTB 3BIKB 5HI4D 4NUGL 3SDCD 2E9JA 5C08B 3WDJA 2X70B 4GKOA 4PV8A 5J1AA 3SDXA 5C2BL 4HC1L 3QUXD 5JOPE 2F5AL 3UTSB 3D3VB 5T33L 1AY1H 3W39B 5I75C 1MUJB 4NO2B 4R2GD 4X80H 5I8KL 4YGVA 3M8OL 4YHKL 2DRUA 4PRIE 2QADB 1ZANL 4Y2OA 1IRAY 4PGZA 4D8PA 2DLFL 2YEZA 5GGTL 3G6AA 1TVBA 1J1OL 3OHXB 2BHZA 2JKXA 4RFEA 1DQDH 1P5UA 1I4FB 3PWJB 4IIQA 4JEGB 2ZCLL 5IQ7L 32C2B 4HZLB 4JFOA 3PIQB 4OFDA 1XGUA 7FABL 4Y5YA 4P9HH 3VFRA 3ME0A 5GPRA 1G84A 4XPHL 3ZDXE 5A2JH 2N7AA 4F7CA 3DMMD 1C16A 3ECBB 3NCJH 2FX9H 5CZXC 5ADOH 4KUZH 4LVEA 1IQWH 1YY8A 4XI5D 4X0KB 4YBLC 1RK0B 3GRWL 3RX8A 1PVHA 4Z7QE 1UM6H 5EUOB 3CXDH 1A6AA 4MX7A 3CFBB 3IGAA 4NN6C 3VGFA 2J4WH 3CMGA 1YYLH 3S97C 4WI4A 3BPNC 4GKZA 4QHNB 4F7EB 1TMCB 2EZ0C 4KTDH 4WI8A 3FAWA 4ZOCA 4U6XB 5DJ8B 4Z5RB 1CI5A 2C3XA 4XP1H 1GOGA 4R8WL 5J56B 2OSLB 2UWEF 3LKQA 4W70A 4EI5D 3QBTB 3HZVA 1SJHA 3EDDA 4N8VG 3CIQA 4WTZA 1ORQB 2JLLA 3CNKA 4MB3A 5I66B 2FD6L 4MXQD 1PZ5A 3H9SA 1P4IL 2CDFB 1TETH 1E4WL 4ERSH 1K5NB 3BP7B 5L6YL 4FQ1L 4M48L 2NTSP 5DK2B 3CSPA 3C08L 3C2AH 3ARDB 3MROA 1GOFA 1EMTL 1H0DA 3EOAA 1RHHB 1I3UA 5BMFH 1UM5L 2DQJL 3OKKB 5B39A 2ZOLA 1I7RA 4ZMAT 2DWEA 3MRGA 4JY4A 1G7MB 5F6HJ 5A40E 1RJZA 1AFVH 5MEQA 3S37L 5I8OL 4HIJB 5IB4B 1A1NB 2FGWL 5T1KA 2LU7A 2UY6A 5I8CB 2P5EB 3FHQA 4Y5XB 3VRLF 4O5LL 4HD9A 5C09D 4H20L 3SGEI 3I85A 3P4MA 2VH5L 1QACA 3MRLA 1A8JH 2IPKB 4DK3A 1NPUA 5E1AA 2MCG1 1BQHB 2PKDA 1EEZB 2C1PB 3WIIH 1U3HA 1QBLL 4PG9A 1V7NH 5F6IC 2X4PB 1X5GA 3BSZL 2VDNH 1S7VA 2Q1EA 2Y1VA 1U95A 3VXOA 2EEAA 3ULUE 1I7TB 1NUDA 3RGVC 1TZGL 4JFEB 5EC1A 4YBQC 3BEVB 4YGAB 4RIRB 1GGBH 3C5JA 4HXBL 4OT1L 1T04B 1JYVA 3G5ZB 4ORGB 2DS4A 1AP2A 1IAOB 5I18L 4J6RL 5D7LD 4PRPA 1KLGB 4OFYD 3KYNA 2VLRE 5EORL 35C8H 3P0VH 4TVPL 4KC3B 5DHXB 3RX7A 2YD1A 1QEWB 3G08A 5DWUL 2DJUA 4X4MA 2D7MA 2X4TA 1LEGA 4LNRB 5DZOA 3HHRB 4GRLA 4EUPG 2L7UA 3OKNB 2OR9H 3LRHA 4PLNC 1KT2A 5CGYC 1U8HA 1RZ8B 3F12A 2Q76B 4RDQF 2VDML 1G7IB 1KYOJ 5IJVB 3R0MA 2DQGH 5EN2B 1ZT4A 2ENSA 3IFPB 4Z9KB 4ZTOH 5CGMA 1PG7W 3GSNA 5IM7B 4X7TA 1OB1A 3TT3L 5FO7B 3U0PB 3WEXB 1WISA 3EGSB 5TH2A 4OZFG 3BD4A 5I30H 4X6BA 2FJGB 1OAYH 4P99A 3IRPX 4PJBA 5F9OL 5KSAB 2FX8L 1XGQB 4YHPA 3OG4B 3PHSA 4PRDB 1A02N 2COQA 2KQMA 3RI5F 4GKSB 1JHLH 5JHDA 2PCPA 5D1QB 4P2CG 5KSBE 1T22B 5DJYB 4U6VL 1A6VL 1PQZA 2R15A 3DNKA 4HUXA 5JW5B 1FVCB 4S1QL 3EFFB 4GG8A 4YE4L 4X6FA 5K9OB 1T1WA 5HHNB 1BAFL 5F7WC 4LDOB 3DUUA 5HHMB 4BZ2H 4WU7B 1N3NB 5KJRH 4KVNL 3FTGB 2OTWA 4GXVH 4G8FB 1CFQB 5EU3A 1J5OH 3MNVA 1PLGL 3ZE0F 2ZNXA 4XAKE 1G6RB 1ZS8B 2D9CA 4LAQH 4M61B 4M03A 1A2YB 4BZ1H 4F3FB 4J2XA 2WBKA 3GFUA 1FAIH 1QBML 4IBLT 5IMLA 3EDEA 5EO0A 2KBGA 1MLCA 3DRQA 2QQNH 3QIWB 3U4AA 3I3DA 4ZQKB 2DB8A 1XF5B 5E2VL 3PL6A 5FECA 2CDEB 4U49A 1FZKA 3SDDD 2IAMB 3CVIH 3MJ9L 3O6FC 4K9EC 4KRPD 4Z0XA 3DSFH 3VWJC 5HDBE 1MNUH 1QSVA 2KPNA 4G8GA 4AEIL 1NDGB 2CLVA 2XWJA 4OGZA 3TO2A 1SVCP 1UQSA 4G9FA 5E7FA 2E6QA 1CFNA 2XXMB 1CL7I 1JTOA 1V3LA 5E9DE 4M3KB 5D6DC 4AH2B 2XACC 1C7SA 1M7XA 4JPKH 2YUZA 3WNPA 1OY3B 2UVEA 3IJHB 4FQJL 2NXZD 5JW4R 1OSZA 4LU5H 4N0UA 2OL3A 2LTQC 5TGBB 3QI9D 4ZUVB 4JN2B 5ANMB 5IB3B 1NCNA 4NSKB 4MSWB 3LIZL 3CGTA 5DVLA 2YKLH 4L4VB 2DBLL 5EOQL 4MCYB 4IS6B 3HC0A 4JREC 3WIHL 5IKCB 5I1AA 2IEPA 1L4IA 1LEKB 3PABA 5CLTA 1T4KA 3DI3B 3KPOA 4OZGB 2IGFH 4P46D 5GJTL 2P5ED 3QCTH 3T2QA 3D0VA 4GUPA 1HCVA 1DLHB 1RIVH 3MCKA 3JWOC 5LQBL 1I8LC 1JZ2A 1B9ZA 1QOKA 4RFOH 5ESAB 1TLKA 1A6ZB 4X4ME 2X4OB 4Z95H 3DVIA 2HT4D 1M7IA 4UV4H 1MEXL 5IVXE 2JB5L 2VXVL 5FA3A 4L3ED 3B9KC 1EXUA 3V5DA 3RTQB 1CS6A 2X7LB 1FSKC 2F54B 2M8XA 4Z78A 1XEDA 4RNRA 5DD5L 1SJVA 2VZSA 1A3LL 2AXHA 4Q9QH 1XCQB 1IGIH 1LP9A 4F33B 5F70A 1TJGH 4KDWA 4XNXH 4MJ2A 1TNMA 1UCBL 3MRKB 2D7QA 1UJ3B 2H32H 2BCKB 3QDMA 4PJBE 2OTUA 3V0WL 5D7JA 5I8EA 4JKPL 1KEGH 5BZWB 2B2XH 3WFZA 2H6PB 4YC2B 4H8WH 1E27A 3RHWK 3VWKB 5JHDE 1PSKL 4IRZL 2R69L 3GHEH 5SWZE 5CJ5A 1CDBA 2R8SH 4LVNB 3S35H 4NO5A 3OJDB 3BRDA 5BQ7B 1K3ZA 1SQ2N 4LGPB 4JM2C 4KKCD 1FLRH 3T0XA 4J3XA 4Q9RL 2W60A 5EUOF 2GFBB 4YWGL 2AXGB 5TFSL 2HH0H 2AK1H 4KZEH 4HFWA 3WFHA 4KTEH 4LSPH 4TPRL 3FO9B 4UIKH 5FUZL 2P43B 4F7MA 3CLFL 5MENB 1S5HA 1C5CH 1EUUA 2EDOA 2H2PC 3VI3F 1NC4B 3HAEG 2WIIB 3QQ4B 3MRJA 5IVOA 4J4PA 5FB8A 4OGYH 2NXYC 4AM0B 1QRNA 2C3GA 2D0HA 4YR6A 1A7NL 4OLWL 3K4ZA 2Z31D 5HYFA 3KLAA 3FB7A 3UBXI 4QXUH 5LGJB 3HUJB 2BNRD 2FH8A 3K2MC 3MLUH 1MFNA 2ZOKA 1YN6B 4LF3A 3QUYB 4IIQC 3CXHK 5BXFA 2PTTB 3U9UB 4Y5VC 5EO1A 2D4DA 4JLRA 4G9FE 3WXWL 1KB9J 1F4WH 2XZZA 4XNYL 4JRXA 4CVWA 4PJFA 1IAIL 3CJJA 5IB2A 2CK0H 4UINH 5E2UL 5DRNB 4MCZA 4EOWL 4HCRL 2GY7B 3DHJA 2BFVL 5E7BA 4I0PB 4ZPTA 4LBEB 3QFJA 5ETUA 3S37X 3PWVA 4NCDA 3V9FA 3EYQD 4P3DB 2BOBB 2IAMD 4ODUB 5E4EC 1IZKA 5DF0A 1CDYA 2IFGA 4TUOA 4O9HH 2DDQL 2DTML 4YDLC 4BELD 2VQ1A 2W9DH 1A7RH 3FB6A 3VFOA 3C8HA 1UADC 2X1PA 5L8LB 4R4NC 4LLYB 3D85B 1JCKA 4RMSA 4GG6B 1CF8H 4Q0XH 1YECL 1J05A 4OCYH 5E8NA 4RSVA 3BPLC 2P8PB 4I3RL 4P3CH 3CCHB 2B7DT 4S1DC 5AD0A 3PXHA 2R9HC 3OAUL 2Q86A 3VH8G 1AC0A 4PGEA 1I1RA 4ONFL 1A6PA 1G7LB 4XMLL 1CVSC 2QQKL 4ODXB 1DVFA 2VMFA 3LHPL 4N90E 4NWTH 3VXUA 2RB8A 3EZ8A 4FFVD 4NCC2 3TZVC 1P2CB 1T2XA 3C9NB 4L4VD 4X4XA 5DJCB 4CUCA 1IT9L 5D1XD 4O02H 1YN7B 1N4XL 1BFTA 3FFDB 2A77L 1HHKB 1Q8MA 2A9NL 4Z76A 3EYUL 1X6NA 1VEMA 3IDNB 1NAKL 1NLBL 2R29H 4U1KB 3TIDB 5I76B 3WJJA 3QDME 4P4RB 5TDNB 5I16B 1FRGL 2F58L 4WI3A 1FL6A 1AXSB 4CBPA 1IBGL 1UVQA 2D31A 5DI8B 2YBRB 4NO0B 3OB8A 2FWOA 1FNGB 1YEIL 3OKLA 3Q6FA 3LB6D 1U8MB 1EBAA 1Q0YL 4V2CB 2WIMA 1Q9LB 3VFGH 5DUPL 4U7SA 2EDLA 5DFTA 2WW8A 4CN1A 4OI9A 4CMHB 2P48B 4HS8L 5CD5D 2V9RA 4XC3H 1WT5A 1T1ZB 5EU4A 5TQ2H 5BRZE 5J0BA 3VXNB 3TV3H 2Z0BA 4V1DB 3LKRB 4X4YA 1CVRA 4WUUD 4HFUL 1RY7B 3TBYB 4ODVH 1YPZA 1BZ9A 4J3UA 3GK8L 4HMCA 4XHJD 2A6KB 3BDYH 3P0YL 4GRLC 4PLJC 4JFHD 1GXEA 3GJFH 1MIMH 2X41A 4MD0B 4LLUA 1JK8A 4HJGB 1QRNE 4JHAL 1DQQB 1YEDA 1I3RA 2DD8L 2LVCA 2VZVA 3BN9C 4I1NB 4JZOB 3W9DB 3PGFH 3V4VL 5JW3L 1N5YL 4RZCB 1OAZL 4UT6L 5GGSA 4OLZH 1U8JB 3VFTB 3RIFK 1MLBA 2IQ9H 5I1JH 2EEBA 2Q8BL 2H9GB 1AR1C 1FO0A 1JRHH 2B4CC 1DN2A 4KJQD 4JCLA 5F71A 3L3IA 2RGSA 4LCUB 4OZIE 4KGLA 2F5BH 2E8YA 3GI8L 4JRXE 2V7HB 4Z7UB 4PJFE 3F6IA 4NQDD 2WBJA 5D7SL 3AY4C 4LPCA 2YOCA 5KVMC 3FT4B 4Y4FD 4QF1B 1D6EB 1SEQL 1G6VK 4RQQA 4H8WC 4NIKB 4F2MB 1BM3L 4GRWB 1NGWB 4KJWD 1EGJL 4PJXE 4LPUA 5D96B 1JNNH 1EPFA 4S1SH 4F37K 4M7JH 4Y16B 1Q9WB 3ZTJH 3WS6A 5E8PB 2EKSA 3O11A 3FB5A 1CICC 1OAQL 5JDSB 1CLOH 4J1UB 1EEUA 1AGFB 1XH3B 3W0WA 4YX2H 2V2WA 3O9WD 4XWGH 5CAYB 2J8UB 4KAQH 4NHCH 4OZGF 4YDIL 2C3VA 1G9EA 3LN4B 3HMWL 3DUHA 4I0PD 3PL6C 4BFGA 5C9JA 2ZJSL 2Y7QB 4PJ9B 3MV7B 1P9MA 4J3TA 2L4OA 1IM3B 2ICEB 3PQYE 1QR4A 4JFPA 3RPIB 2XG5A 4U2ZA 2ZSVA 3TNMA 4D9LH 4LVOB 4ZFGL 2IWGA 2XA8H 4NWUH 1NMAH 1FCGA 4D3CH 4ZXBA 3V4PL 1JWMB 5DUBA 4M4PA 1SJXA 1C1EH 1MRDL 1U91A 1NEZG 1IM9D 3MLZL 3QZWA 4I2XB 3GSWB 3IRZA 5DR5L 3O2WH 4NM4L 2NTFA 5FM5O 1YUHB 3B3IA 1R0AH 1AKJA 4M1DH 4U1IA 4EUPH 3TBTB 1ZT1B 4OLUH 4LSRL 4L9DA 3RWDB 5MHSE 3MV01 2HAZA 3WDIA 2AK4D 5E8EB 5JZ7C 3OG6B 3L5WA 3TVMA 1BQSA 3O3EA 4GW5A 2RQ8A 3R8QA 1MCNA 3EYSL 4TNVF 1DN0A 3BP4B 3F7YB 4YPGB 2P7TA 3BP5A 1NFKA 3MBEB 2DAVA 1L7IL 4QHMB 4K7PY 2JCCB 3GMNB 1IC4L 4OZFH 2W0LA 4LRIA 1SBSL 4JZNA 4K94C 4NQSA 1KYOK 4FQXA 4XH2B 5CLWA 5F1NB 4YDKL 2Y9RT 3SN6N 1E28A 1Z2KA 5CJBA 1WWWX 4HAGA 2Q8AL 5EOCL 4KHXL 4GLRI 3G9AB 2O61B 2R1XA 5A2KH 5C0IB 4KI5C 5C0GA 3BZEB 3VW3L 5D93B 2AGJH 4LEOB 4DN3H 4DK6A 1J1XH 1I1AB 3MRQA 3GMMB 1Q0XL 4LCWD 1CFVH 1JWSA 2Y07L 3VXRB 1BLNA 3GB7A 4XBEL 1P84J 1MFCH 5IK3B 4UAOC 1RZIB 43CAB 3T4AA 2EDQA 1ZLVH 2IH1B 5BO1H 2V2XB 4M7LT 1CFSB 3PWPA 3JUYA 5CZXD 2FSEB 3J8F7 3RX5A 4OFIA 4FTVE 5TE4L 1ADQA 3MNWB 2R2BA 1FYTB 3RVWC 3DV4A 3HE6A 1W2KT 1T66C 3VGEA 1HSBB 2VL5B 1ZLUK 1D5XB 2EZ0D 5HHOE 5HPMB 1CLZH 1KFAL 5F7KC 2DM3A 4ODBD 5GXBB 4P5TB 2MHAB 1MAMH 2XG4A 3S4SA 5FCSH 2ZWLT 3ALPA 3IF1A 4MXWH 2CJUL 3KPMB 1MI5B 3T77B 4QRRD 2ZUYA 4DVBA 3ULVL 4OD2B 1N64L 2BDNH 3TJHC 5K9JL 1KIRA 3MRPB 1D5IH 1W0VA 5E2JA 4JFDA 2EE9A 3KPSB 2W1NA 1A0QL 2B1AH 1I75A 3CSYA 4WTZG 1NBYB 4GG6F 3PJSA 3W0WE 4M3JA 1OQOA 2ZCHH 3TBVA 3QDGE 4KXZH 1P7HL 1NBZA 1L9MA 3HR5B 4U1LB 4I0KA 4N1EA 4HWBA 2FB4H 5H37G 3HI1A 4X98B 5T1LD 4F7TA 3FJTA 1T20B 5B39G 5IFHH 4NC2B 4TSBH 3EJYC 4RAVA 1F3JB 4WV1B 1FBIL 2DQHL 1AGCA 1XF3B 2FIKA 2WINA 4QRPD 1AHWA 4G6KH 4UQ2B 3ZKNC 5C3LD 3IDMB 1A7QH 4N1CA 4ZOEA 3BKJH 3ZHDA 2A1WL 4MDIA 1A4JB 3ISWA 5F89A 5FYJD 3S34L 4PGDA 1FGNL 1V3MA 5T5FL 1ZSDA 3BIBX 2UY7A 3MCG1 5AAWA 1XGYL 4QWWC 3EDJA 1JN6B 4UZGA 4X6CF 1ZEAH 4LCCA 4PJ9D 4DZBA 3MV7D 3RGVD 3RZCA 5D9SA 2KL6A 4YBQD 1HYSC 1IFHH 4NKIL 3VXSD 4LCYB 4OGXL 5HGBA 3THMH 4U3HA 4X5WA 2FZ3B 1MCOH 3M45A 4E9LA 5IMOB 4FXLA 3MR9B 3IDIB 5I1DA 2LFGA 1P7QB 2QTEA 5JUEL 1WGOA 4ZNCD 4RGNE 3O3DA 4HULB 4HHAA 3ZO0A 2F53A 4S10A 3BO8B 2GT9B 4OF5A 3ARGC 1NGPH 3C6SB 1SYVB 5C07B 2HP4A 4NN7B 5DDHA 2CO6B 1Q38A 1BF8A 5CGYD 4LIQH 1X5IA 3L5XL 1W8OA 2CDGA 5T1DH 5DRXB 5EZLA 2C1OA 4APQA 2OMNA 5FKAA 2Y5TA 3VMPA 2DQCL 5INCA 3PDDA 4R97B 3WMSA 4YHYB 2BOCA 2K1MA 5JORB 1SJEB 4XCEB 3MBED 5FGSA 2R4SH 3SGDI 4UQ3B 2XQYK 1H3GA 3BUTA 1S7UB 2GK0B 3G5XA 1XIWA 4L9LB 1NL0L 4KPHH 5C2UB 1Q72L 3AGVA 1ONQA 4C56A 1DLFL 3N85H 4MA3B 3QULB 1BGXL 2D03H 2DJ4A 4PP2A 1BD2A 4YNYB 3PWPE 4NKOB 3HAEH 1OGTB 3WJJC 5K59F 2VWEC 1CFBA 4P23C 1H3VA 3O8XD 1E4JA 3HMXL 4Z7UF 5HHQA 4QHKJ 4I77H 5C08E 4UNTA 4RWYL 4NOBA 5DK0B 1N6UA 3A6BL 5HYJB 4XPBL 3GMQA 1V7MH 1FNAA 3BZ4A 4M1CD 5E5MB 5ID0A 5IQ9B 2BNQA 4HK0A 3UTSE 3D3VE 5DT1L 3TBSB 3T1WA 3PWNA 2H2SD 5D8JL 3MOBL 3QDJA 5FGBA 3VXRD 1D5ZB 4OV6F 3D18A 4GRWF 1DSFH 4CMMB 1GHFH 3H3KA 1XF2B 5DS8B 1KCVL 2VABB 3QEQB 4PUBL 2ZKHL 3LQAL 5D2LB 1M7DB 2NLJA 2Z93A 3IJSB 4JFDE 3DX7B 3LKSB 4PRHD 5DQJA 2XRAH 1LEIB 2VLJA 3MODL 1QFPA 5FA4B 2PO6B 3GJEB 5DJAA 4HEME 2VJXA 3DROA 4U3CA 4XTRC 3O6FD 5FF6A 2J8UF 2CIIA 3VWJD 3EOBB 3QO0A 1EV2E 4XZUB 4CVZB 5I1HH 3F7VA 2EO1A 4MMXC 4MXVE 5EIIA 3LD8C 4NRYA 4C58B 1UH4A 1B6DA 3SPVA 1DUZA 4FXGB 1ZLSL 4CL7A 5C0EA 1T0NB 3DX8B 3O6MH 4XCNA 3Q5YA 1ZT7B 3OR7A 3WHXB 5GS0H 5H2BB 1J12A 4YHOH 5F8QC 1K6QH 2IH3B 4XPTH 4PYHA 1OCWH 1BFSA 1AH1A 3C60A 2QBWA 4UBDC 3KAAA 3KPRD 1GGYA 3MC0A 4M5ZH 3RI5K 4QXGL 5I9QB 2AXJA 5DTFA 3UBXG 1GSMA 1FL3A 3MV9D 3NAAL 2NCMA 4TRPH 1JHKL 3AAZB 1YEEL 2FATL 3QUML 4JO3H 1F00I 3BWAA 4OFVA 4EDWL 1X5AA 3K46A 4YIQB 1HI6B 1NGYA 4Y4HA 3KYMA 4JHZA 4XMKL 4NQED 1YJDC 1RI8A 4Q58C 5CUSL 1IGFL 1QD0A 3KHQA 1FIGL 3WS6C 4JGJA 4XVJH 4NO3B 3S5LB 5CEZE 2JCCF 1QP1A 3VXMB 4IHOB 5H35A 2FJHA 6FABL 2F53E 4POYA 3BJLA 2V2TA 4ZYKB 5EWIL 5GJSL 5C0AA 1OLLA 1T03L 3SJVA 3HB3C 3BDXA 5T3XL 2PW1A 3QIUB 4L8SA 5ITBL 2R23B 2VITB 1HNFA 1OARL 3RAJH 3RDTA 4XNQB 3B9KD 5CCKL 1CGSL 2XN9D 3CSGA 2C7UB 4KFZC 1FP5A 2Y72A 2W0KA 4FG6D 1NFDA 1GAFL 4ZUUA 3IS1X 4WDIB 3GKWH 1LO4H 5DQ9B 1FZMA 3SO3B 3PWUB 4O2CA 4PJCA 4ODWB 4TVPE 4JFEE 2ESVD 2HVJA 5B8CB 1DUYB 2XZAL 2ZG2A 2DM4A 1TPXC 4U1MB 3IDYB 3MLSH 1FNSH 5DO2C 1OP5K 3FOMA 4HIIB 4JQIL 5LWYH 3TO4A 5JTWA 4GSDL 1UWGL 5EZIH 1GGTA 1EDQA 4JM2D 1YNLH 4FQCL 2P8LB 1OWRM 5E2WH 1ZWIA 2NZIA 3MV8A 3VDCA 2XQBH 1Y6NR 3MA9L 1CIUA 4HG4K 3V8CA 4JDTL 3DVNA 4LRIC 3JV6B 1HQRA 1F8TL 1UZ6E 4P2OA 4LFHD 1A6TA 4PGCB 5DD6B 2H2PD 4HV8A 1C5DB 2HRPL 3U0WH 1UACL 5F3BB 4CKVX 3UPCA 2H32B 1U8KB 1TZIA 4LHJB 1FVDB 3JWDL 1BVKA 1G9ML 3OKYA 4GRMB 1OAUH 4G7VH 1G7JA 1C5BH 1YY9D 4PJEA 3UTPE 1R3HB 1UKQA 1LO0L 1W8NA 2VXQL 3OAYK 3UPAA 4ALAH 1NGZB 1IC7L 3QXTA 5L7XH 2HLAB 5GSVB 4MB4A 1AQDA 1H3PH 4O2EB 4K07A 2NY5H 3L3OB 2VYRE 2WWMC 2I60H 3P77B 5F1KC 1GH7A 3B9DA 4NZUL 5B3JE 4WFHE 3MA7A 3HZYB 1PW3A 4Z7VA 1T7YA 2MNUA 1DR9A 4OQTL 2AJUL 4U0QB 1R24B 4JHBA 1YQVL 1J0IA 3IETA 3HE6C 3GZKA 2EDNA 2DMKA 1YEGH 3LKPA 4YHLL 1Q1JL 4TOYH 1MCLA 4NNYB 4JQVC 3AS0A 4KKLC 3D2UD 3UJTH 1AXTH 3GSOA 4TYUA 4HPYH 3HPLB 4ZAKA 4R4ND 4FXKA 5SWSA 1KC5H 3B43A 1F6FB 4R3SA 2Z91B 1GZQA 1HQ4A 3QUZB 4WY7H 4R0LA 4HCRA 1WZ1H 4S1DD 1CR9L 3C6LB 5IOPB 5DMGD 3IKCA 1QVOB 2YUXA 5IF0A 3E6FB 5D6CB 1T3FA 4IJ3C 4JFZL 5ISZD 5CZKA 5LVEA 3NACH 2OX5A 1BEYL 3D48R 4GH7B 1WAAF 1FGVL 1XGTB 3GNML 4WHCA 3FFCD 3HNTH 3H6JA 3BZFA 4A2MA 3GBNH 2BX5A 2EH8L 1KN4H 3VXQA 1B0WA 4NGHH 3SGKA 1A9EA 4UTAL 5JR1H 5CBEB 3ARFA 3TZVD 2VXUL 1XZ0A 3ULUH 2FLBT 3QEGH 1D3CA 1VB9A 5I6XC 1OPGH 1HXYA 4ENEC 1P69B 2AEPL 3ARXA 4ACPA 4H88L 3DXAD 4HWZA 5GZOC 3RJDA 1AHWC 3NH7L 4DOHB 4IRSB 1NFDE 3U1SL 1U58B 1S5IL 4P3WA 5ANME 1JPTH 2DQIL 4F58L 2XI9A 3D39D 4O51B 3REVB 4HX1B 4PRAA 4MJIA 5KZCB 3GUTA 5JPMB 5I2IB 2MMXA 3QQ3B 2NY1C 4MNGB 2ICCA 3BD3A 4XCFL 2AW2A 3EO1B 2I9TB 4CW1B 1LO3L 4TSCL 3WKML 2QQLL 3HC3L 1TJHL 1CXIA 4P2RB 3QJFA 3QAZB 3X13A 4L4TB 3KJ4B 1MRCH 1HN1A 3FL7A 4QNPF 3WIFA 5LBSH 1FFOB 1L9NA 1CD9B 2WUBH 4WHDA 5DD3H 3ZKMC 3NABL 1OM3H 4BYHA 1JF1B 2XKNB 3CFKB 5CIPH 3IFNL 5SWQA 2PYED 4I4WA 3VJ6A 3EBAA 1WFNA 1B0RB 3QNYB 2FYYB 3IJYA 3QWRA 2H3NA 4UU9B 1IEHA 2F54E 4PLJD 1RJYA 4LEXH 2APVA 5D2LF 3CH1B 4JRYE 3MLVL 2VTFA 5EO9A 3P4OB 4NUJA 1TCRA 1WBYB 4UDTB 4GAJH 2A2QT 2LABA 4PTUB 1PEWA 1N59B 3GBML 4LDLB 4PJ8A 3BN9D 3QIBB 4M7ZC 4CNIB 4Q74A 5E6IC 1LE9B 1I8KB 1JZ6A 4QTIH 1MCPL 3DIFB 3HI5L 3VGBA 1M71B 4LLAA 3GBLA 4HUVB 1R3IH 4EVNA 1XIWC 4UT7H 4HMDA 3FN0L 2BC4A 3B2VH 5DC9B 1X5HA 5LXGL 1QLEL 1H8SA 4AEFA 4DKAA 1INQA 4NC0B 5C86A 4E41B 4RGMB 1PJ9A 2X4NB 1WBZB 1GC1H 2ZG3A 8FABA 2X4RB 1C7TA 3GJFB 4JFFB 1K8IB 1IAII 3RWJB 1S7WB 3V7AG 1EX0A 1WUNT 2DICA 4UV7H 5A2LH 2EYRA 5H37H 3T3MF 1NMCC 1S8DA 1LO5A 1U8NB 1S7QA 2J1KA 3S8WA 1SYSA 1MPAH 5DD1H 5FGBC 1QNZL 1XF4B 3QG6B 1CICD 5SWSE 3E0GA 1KF9B 3SDYH 5B21A 3MUJA 4N8VB 4Y2DC 5T5NF 2YS4A 1UKSA 4EI6B 4JPVH 3SE4A 2AABL 4XVUC 1ES0B 3HUJE 3MZTA 4PJHA 3HG1B 4L5FL 4TQEH 3LEYL 3D9AL 4OLXH 1KG0B 3RP1A 2HG5A 5F1OB 5C0BB 3NBNA 2ZUVA 4LLWA 3CFIC 1IGCL 1CL7H 4G8GD 1CCZA 1QSED 4TUKH 4WEBH 2DQUH 4MAYB 1EJOL 3E6HB 2MQCA 3JZ7A 3QXDB 1JGLH 4BSVA 3RJQB 4NP4H 1HEZA 4MB5A 1WFTA 2PF6A 3GIVA 2OK0L 3SE9H 2D9QB 1O0VA 3RU8H 5I1GL 3C6LD 2EIBA 4AT6A 4G6FB 3BUYA 1RK1A 3K8LA 3RWIA 3WFDL 3CVHA 1AGEA 3ETBF 4O58H 5T1MA 3QZWG 5GRWA 3ZDYF 1TVHA 5K9KB 1R3KA 4GG6E 1JNLH 1RPQA 5JZ7D 4LLDA 3DBXA 5J1SC 3FQWA 5EU6B 2A74B 4U0RC 1FFPA 4NQCB 4Y4HC 3T0EC 4K3DH 3RVXC 4LLMB 1EFXA 5KAQF 3FRPA 5GSRA 5CWSA 2FHBA 3MACH 4Y1AB 2WSKA 2VOTA 1WC7A 3IU3A 2PR4H 5DYOB 3GSNH 2PNDA 3PP3K 3MTRA 5BVJA 5D5MB 4PJAA 3QSKB 1MH5B 5K33A 3X11B 5J6HB 1QR1B 5DJDB 3TYFA 3CC5B 2FO4A 1QFUL 1RUML 3AVEA 3WO4B 5EA0H 5EBMB 5F72S 4ZFZA 5I73B 4P5KB 4AIZB 2EEDA 4KI5D 4HJJH 1JUFB 5CP3H 3WUZA 5ICZB 2W07A 3RDTC 1KELH 3DGGA 4JFXB 2YN5A 4WIQA 3IFLH 1WEJH 4P4KA 4JG0H 2XFXA 4FQQA 3O4LB 4Y19D 4DGVL 2I26N 5ESVA 4GAYB 3JV5A 1QYGH 1A5FH 2ENYA 4OZFB 3O2VL 1DQLH 4PJGA 1MHCA 4XPFH 1BHGA 3RVWD 1J8HB 4L8DB 5JLZA 4HKJA 5C6WH 2AXFA 3G04B 4DN4H 3TO4C 4XP9L 1T1YA 4OCMC 3N1PC 1Y0LB 4WEUD 2Y06L 1VPOL 4V1DE 4YAQB 1DANT 5E6YA 4BUHA 2XPGA 3L9RB 2G75B 1U36A 4NKMB 2CXKA 1OP3K 3ARBA 2YK1L 1UB6B 1LK2B 3TJHD 4JQXA 3X3FH 2BRRH 3JUZA 4OCSL 3S4SG 1TNNA 3WE6A 2IFFL 1T7XA 4G8EA 5IEHB 2IANA 1ZA3A 1MELA 2DQTL 1GZPA 1GGIH 4JY5H 3CMOH 4G5ZL 3GI9H 3DSNA 1ODAA 2RIKA 3FRUB 2SEBA 4UILL 4I3SH 4E41D 4FABH 3BZDA 1SMAA 1KCUH 4X99A 3VU2A 2BMKA 3IU4L 3G6DH 3NGBB 1ITBB 2GITB 4MNQA 1ZOXA 3VGAB 4Z7UE 5BV7H 2OL3H 4LAJH 3EJYD 5BJTB 1FZJA 3ZKND 3HNSL 4FHBD 3LRSB 5T3ZD 1B0GB 3BKCL 4M5YH 3EYOA 1T2JA 3KXFB 3TFKC 1X4ZA 1DJSA 3HTLX 1NUFA 4GRWE 4H1LA 4J8RB 1JZ5A 4Y8DC 1NH6A 4HXAH 4D2NA 1GL4B 1J0JA 2ZCKL 1CFTB 4DTGH 4OKVB 2CLZB 4KH2A 2AP2A 5E6ZA 2EDDA 4ONGL 2D4FA 4KQ3L 3B4NA 1IILE 5JXED 4L8CA 4CRPA 1HYSD 3QRGL 2RFXA 2J8UE 3HNVH 4NC1E 2XTJE 5GGUB 1QO3A 4ZAKC 4Q9CA 4B41A 2EXYC 2YC1A 3M1BB 4U7KA 4XXCC 2P24B 4L3AA 1KXTB 3C5ZB 4R0LC 3TYGL 2YD9A 3ARGD 3CDFA 2NY3B 5DJXB 4OAWA 5HYEA 1DFBH 4HDIB 3ZDZE 2Z8VC 4IMKA 2HKFH 4TULL 3VFMA 3I2CL 2E27L 4LSSL 4KVCL 3RPKA 2ADJB 3CFCH 4UIMB 3SGKC 4CDGC 4HIEB 4OM1H 3OSKA 1WJ3A 5L88H 2ERJC 4EBQH 5IBUB 3L6FA 2YPLD 3MXWH 4MQ7A 2GJ6D 1BQHG 2R0LL 3AMKA 2APXA 4NHUA 3KR3L 5AYUL 1RZ7H 3QEHB 4KROC 4MJ6A 4PR5B 5ELIA 5A16A 2X9WA 1PG7H 2BNUB 4A6YL 4NRZB 1MRFH 2VKWA 5CSZB 5EB9A 1M4KA 1LD9B 5HHPA 4D9QE 3HRZA 4P2QA 4LKCB 2CUMA 5DQDL 2JCCE 4P23D 3STLB 4OV5B 4YFEA 2R2CA 5DHYA 4I48A 4BKLA 2UYLB 4XGZA 5D2NA 3MRRB 4K55A 1RJLB 4EN3A 5GS1A 2VAAB 4L3CA 4C59B 1A7OH 2DQFA 3SDCA 2KZWA 3EFDL 4HGKC 3H9ZA 4HUWB 1MFDH 1ZLUH 4K23L 4U1JA 4R4BA 1UWEL 4OI8A 3SO5A 2Q7NA 3QUXA 5KN5B 3BH8B 4QOKD 3NZ8B 4AEHL 5L2KB 3ZYIA 1KBGL 2IANE 1IAKA 3LH2L 3V5KB 4HQQL 3V5HB 3HMXA 4HS6A 1IGML 4KV5F 2RR3A 4X9FA 1HDMB 1PYWA 3HAEB 4I9WE 1WSST 4XTRD 3ES6A 5I74B 4KJPC 4NNPH 5JNYB 3QHFL 5C0CE 2JB6B 1TFHA 4LHUD 4WO4C 2R4RH 2D7OA 5J3HD 4MNQE 1FYTE 3DURB 5E2TH 3DMMA 2IJ0C 4LLQA 4TUJA 4WJ5A 4MQTB 1NCBL 1EEYB 2VLME 2AJXH 3GSQB 3KPQA 3P30L 3DRTB 4DCQB 1PX4A 1ZE3C 2FL5A 2B1HL 3V0AC 4YEFA 1MI5E 2R0KH 1DBAH 1FE8H 2VDKL 4FZEL 5EC2A 1DTUA 4HWEH 3EOTL 3L7EA 5MEOB 3AREC 3KPSE 1QSFB 4MNHA 3QXVA 4GMSH 4W6WB 4EI5A 3DTXB 3STZB 1OLZA 2WUCL 3ILPB 2EICA 1A6WH 4JANB 1VCAA 4JN1H 3W5MA 3A67H 1H3TA 2AEWA 3BGFC 4M62L 2BY1A 1UB5B 2VDQH 2W65A 3MRIA 1N7ML 2CIKB 1KJ2A 2C4XA 5DHVH 1B88A 4ZTPL 3ZHLA 4XNZB 3FONA 1N6QH 3QUMA 1I9IL 1U93B 2AJVL 4KUCF 3HB3D 5D5MF 3VH8B 5TQ0H 3I6KA 1N26A 3R1GH 2OBGA 5EU5B 3ZTNL 1WZKA 5CD3B 3L1OL 5C1MB 2GSIB 4IRJA 1YNTA 4JB9H 1FH5H 3ESVF 1EA9C 5EFIA 3NA9H 2AEQL 2BVOB 1O7SA 5FYLD 1KIPB 4QT5B 1N2RA 3MFGB 1BFVH 3DV6B 4R26L 1ED3A 5C09A 1T7ZA 3H7BA 3IAPA 3PV7A 4I18A 2MSPA 4HKZA 3O81A 3FQTA 4K2UL 1OAKL 2LE9A 1EAPB 5JOFB 2VISB 4JO1L 4OGAC 3QRFM 2QKIB 2HT3C 3SKUD 2V5RA 5IW6B 1XGPB 5DO2D 4X8JA 4U1SB 2ZSWA 5KSUB 5MP6L 2Q6WA 1RVFL 2Q7YB 5KS9A 1G7QA 1S9VB 3CFEB 5C92A 3GMLA 5DZLA 4G9DB 3FT2B 2G60L 3BPCB 1AGBA 3DECA 2LU4A 4JAMA 1KUMA 3OXRB 3SCMB 5F7DB 2I07A 4PB0L 5D7LA 5KVGH 1RURH 4OFYA 1UZ8B 1TTGA 1URLA 4PRNA 4DW2L 3JV0A 4GLRH 2IPTL 2AV1A 1AXIB 4F9PA 2BXYA 1D5MB 1H8OA 2OI9C 1U8IB 2X4UA 3BW9A 4HUUB 3TJEH 1MF2H 1OGAB 3K81A 1GGCL 1QKZH 4P59H 3QHZH 3JSSA 1BIIB 3KPNA 3UYRL 4WWKC 1A47A 5FCUH 2F74A 4PD4K 2MKWA 43C9B 4FZ8L 4QYOB 5JO5B 2P42B 4NJ9H 3ARZA 1H5BB 3O3BB 3BIKA 3P9MB 2ADGB 3DHMA 4L1DA 4QRSA 2X70A 3L3HA 1B4JL 1JPSH 1NC2D 1I8MB 4OCNC 1OL0A 2WWMD 1F6AB 2W9EH 3OB0K 3W39A 5AAMA 5HYJE 5H94A 2NYYC 5DJ0A 3LN5A 4Z7NF 4H0IA 4PV9B 3FQXA 3ET9F 4M00A 3EUUA 3DUSB 4K9EL 1QFWM 4R7NA 5HGGS 2IBZY 1Y18B 1S7RB 3I6GA 4AIOA 3GIZH 4KKLD 4NNXA 3HLAB 1QFWI 5IMKA 3AS1A 3V4UH 3PWJA 2BHYA 3QJHB 3GGWB 4H5SA 4HZLA 4OJFL 2A83B 4X5XB 1F4YL 5DJ6B 3PIQA 4B50A 3PV6A 3BI9X 2X05A 3FAXA 1FNEB 4KMTH 4JQXC 4ZDHA 1HXMA 1D9KB 3WUWA 5IFAH 3DX9B 2VZ3A 1DBKL 4OZHB 4CADA 3SDDA 2FJFA 1PD6A 5EUOA 1OP9A 3FHAA 1U41A 2NX5D 4QY8B 1H9VA 3EYFA 4KUZL 4MA8L 3ROLA 4F7PA 5MI0B 4ZPVB 1CZ8L 4PREB 1U8LB 5IHZA 3N9GL 2H26B 1VGKB 2A73A 1JNJA 1MJJB 3P11L 4YHIA 1NGXA 4JFQB 5J13B 4ENED 5JMOC 4O2FB 1RQ5A 3F65A 2CDFA 2R1YB 1JFQH 2AQ3A 5JHLL 3P4NB 3JWOL 4KQ4H 5GS0D 2E6JA 1NEZB 1FSKB 3I9GH 1KPRB 3T09A 5BS0D 4YFLF 2OZ4L 5L0QC 3QI9A 1ZKAA 4F8QA 3VRIA 4OCRL 2DBJA 1FJ1A 5T3XE 4GBXC 3VFSA 1RIHH 3QNZB 5FO8B 1YNKL 2EC8A 4OF7A 1HK6A 5KS9E 2HMIC 4W68A 2V6HA 3OX8B 2AJYH 2VZUA 4P46A 4LLVB 2AI0H 1OP5H 1F4HA 4RMUA 5I8CA 2HN7B 2P5EA 2FHFA 4PBVC 4LQFL 1JMXA 2CRYA 4ELMB 3SDAB 3V0VA 3GO1H 1HKLL 3QPXL 2V5TA 3WJLC 4ZUTA 3WD5L 3KGRA 4NUGH 4Q6IC 3IFOB 5D7IA 1KPUA 1EEQA 5JW4Q 3QHTC 4DAGL 4NYLA 4RRPA 5C2BH 5IMMB 4HC1H 1DL7L 5T33H 5GRUL 4L3EA 3TC9A 3SGDH 4PV8B 1IEBA 5J1AB 1T1XA 3T0WA 4LSVL 3SDXB 5I8KH 1KLFA 2KDGA 3M8OH 1UWXK 2VN7A 4TN9A 4YHKH 1QPPA 1ND0B 4RIRA 1TITA 1ZANH 2YXFA 3VDAA 2R2EA 3I6LD 3G5ZA 4GS7C 2DLFH 4JJHA 5E6ID 4HIHA 2NXYB 4YGVB 5GGTH 1J1OH 4FFWD 5IQ7H 4D8PB 2ZCLH 4D9RD 1KJ3L 1OWWA 4KDVA 2YEZB 1RUKL 7FABH 4XPHH 1UXSA 4MD4A 3CZFA 3OAYH 4RFEB 4IIQB 3OKNA 4YHNA 1OT1A 1K3IA 1XGUB 3U4BL 4Y5YB 5ESQB 1JTPA 5GS3A 4F7CB 2J3SA 3E8UL 3GRWH 1C16B 2M2DA 5JOPD 1N5AA 1QBBA 3ULSB 5D2NC 3VXPB 3T2NL 1YY8B 1L7TL 3SY0A 1U0QA 4PRID 3WHE1 4MX7B 1A6AB 3B9EA 3IGAB 1P53A 4R8WH 1N0XL 3O6KL 4GKZB 3UZQA 2PTUA 5DC0A 4Y2DD 4YDLB 1INEL 3QUXC 4XVUD 4U1HA 1ORSA 5FGRA 2FD6H 2E9BA 4R2GC 1P4IH 1FPTL 4KKNA 2Y36L 1E4WH 2DOCA 3LKQB 3HZVB 1SJHB 1DQJA 4ZS7L 4G80A 4N5EC 2ATPB 2HFEB 2Z31A 4WI7A 5L6YH 4FQ1H 3N50A 4M48H 1PZ5B 1WFOA 3H9SB 4U6YA 3C08H 2BNRA 4R7DA 1NGQL 1EMTH 3W11D 1UM5H 1JHTA 2DQJH 2D0GA 4WHYG 4MJ4A 1ROWA 3MROB 1ZS8A 2O26U 1H0DB 3EOAB 3EKCA 1QZ1A 4M61A 1A2YA 5ALCL 3VFUA 5B39B 1J5OL 4OSUL 2ZOLB 2GJZA 3EYVB 4UI2A 3S37H 4K8RC 1F4AA 3AC0A 5DD0L 1NJ9A 2DWEB 3MRGB 2FGWH 4JY4B 5AG9A 2WNGA 1A9BA 3TIEA 2ED8A 4ZQKA 1RJZB 4O5LH 5MEQB 3RKDC 4H20H 5EUKA 1JF6A 1J0KA 2VH5H 2GY5A 2IAMA 5T1KB 4YHZL 5C8JA 3S88L 1QBLH 1JGEA 3MRLB 5FM5M 3VMNA 4M93C 1YEHL 3BSZH 1VFAB 3EO9L 3T0ED 4N0YL 3RVXD 1U3HB 4PG9B 1MNUL 1JBJA 4I13B 1N0LA 4NQVA 1TZGH 2IF7A 4IEFB 3I75A 5FV1L 4AH2A 4HXBH 4OF3A 1U95B 3LEVL 3VXOB 3VG0L 4OT1H 3MBXL 5EC1B 5I18H 1OW0A 4J6RH 5KSVA 3C5JB 3RY5A 1W0WA 5EORH 5ENWA 4W4OA 3RNKA 4TVPH 3MFFA 1AP2B 5DWUH 5IB3A 4PRPB 1T7WA 2UZIL 3KYNB 4DOHE 4NSKA 5C71A 5KVEL 3FB8A 4IRJC 2JF1A 4L3EE 4L4VA 1CGYA 3MJ8A 3U7YL 2VDMH 3G08B 1EO8L 4FQHA 5D1XA 2XT1B 2GSGA 2X4TB 1LEGB 4XPAL 4GRLB 1KOAA 1KB5L 1KT2B 1U8HB 3F12B 1CTNA 1CD8A 3TT3H 1DLHA 5JQ6L 1ZT4B 4I18C 3GSNB 3SQOL 1S7XA 1JZ8A 5F9OH 4X7TB 3U82B 2FX8H 4P2RE 5ESAA 4OD1L 5TH2B 3LMJL 4MA1B 4NPYA 4X6BB 2VLRD 2VZTA 4PJBB 3HE7D 5CILL 4YHPB 5SX5K 3ZT5A 4C54A 3ZDXF 1B4RA 1A6VH 1J7VR 1CQKA 4S1QH 5JHDB 4YE4H 2PCPB 1RU9L 5C0NC 1EJ6A 3MRFA 4GXUN 1BAFH 2ZUQB 4JKLA 3UTQA 5IFJA 1PQZB 4HUXB 2NW2B 3LZFL 3LS4L 4KVNH 2B4CL 3UCRA 2FEEL 4GG8B 1AO7E 4WUUA 4Z7QF 3WNMA 5HXMA 4X6FB 1PLGH 3D69A 3MRKA 1T1WB 4RCAA 1M05A 4IM8A 3DUUB 3AROA 4YK4B 3OJVC 1Z9OA 1EAJA 3QWOA 2OTWB 5DVOA 5EU3B 3MNVB 4POZD 1BVZA 3X3GL 1QBMH 1Z9LA 4GQ9L 1KIQA 3AM8A 4JO2L 3VI4E 1PAMA 4NM8L 5E2VH 5CJXA 1G9NC 5EO0B 2GFBA 1MLCB 3DRQB 3INUL 2BNRE 3MJ9H 3OZ9L 5FECB 5C0RL 2KQNA 4AEIH 3MMEB 5K9QI 25C8L 3BFOA 2X1XR 3OWEA 5F93C 1UGNA 3TFKD 4JFFE 5FKPA 2JELL 3V79C 1VFUA 2XWJB 4XAKD 4Y4FA 1UQSB 4G9FB 2BZDA 4PLKD 3SBWA 3OTTA 1RUPL 1CFNB 3KWWB 3FO1A 3UBXB 3ZSTA 3KS0J 2D7PA 4H1LG 4FQJH 5LJYH 4KDTC 4R96A 4GKNA 4HJ0D 1G7HA 4KV5E 4EKXA 1YN6A 2LAGB 1CLCA 4J3WA 1CN4A 2XOTA 4TTGA 2QR0A 1R3LA 1Q9OA 4ZAKD 4M02A 1OSZB 1RULL 2JJTA 4CVXA 1D6VL 3LIZH 5IIEB 2OL3B 4Z8FL 2DBLH 3W2DL 2NY0B 4GXUM 5EOQH 3WIHH 3O9WA 1RFDL 3U7WL 1GGUA 1T5WA 1UFUA 2DQEL 4XCYA 4I0PA 4JDVA 5GJTH 3ULUF 2MPAH 5I1AB 4ELMF 3PABB 5E9DD 1T4KB 3KPOB 5LQBH 1CXLA 3D0VB 3PP3H 4GUPB 1YYML 3OKDA 5HY9A 3MCKB 5DURB 2ORBL 3MUHL 3R8BB 4LLYA 1MEXH 3RL2A 2JB5H 2VXVH 3IB4A 3MSPA 3SDXF 1IM9A 4K94L 2NZ9C 4G6AD 5DD5H 5HGAB 4DEPB 3K7UA 5FA3B 1A3LH 1EXUB 5EU6E 2LU3A 4YHML 4X6EA 5F7EL 3RHWF 3ZT6A 1XR9A 3ARDC 2EYSA 4RNRB 1PX3A 1G7LA 1UCBH 4W6XB 3T1FA 3V0WH 1CT8A 2AK4A 4JKPH 5GRJL 1G7PA 3T2PA 3RUGE 1LP9B 3B2UC 4MZ3A 1WWAX 5IGXL 1VKXA 1MAKA 3U46B 1X6LA 1PSKH 2UZXB 2OMBA 2R69H 2OTUB 3QDMB 5D7JB 5I8EB 2DKSA 3BVNA 3UJJL 2O5YL 5D5ME 3QFDA 1MCQA 3LPWA 4LK4A 5FUCE 1YN7A 4OCWL 1E27B 3V6FA 5EULV 4Q9RH 4YXHL 4YWGH 5TFSH 1GVIA 4Y5XC 4NO5B 4X6DA 1HHKA 1T0MB 4K7FA 1FVEA 4TPRH 4X6CA 5FUZH 1T89C 4MVBC 3IDNA 4HT1L 3TP4A 2GAZA 5I76A 2C5DC 4XC1L 4HFWB 4P4RA 3CLFH 4F15B 3NN8A 1KGCE 1OP3H 5BRZB 1FL5A 2O5ZL 1AXSA 3O4LE 4NDMA 4JFHE 1TJIL 2YBRA 4WWID 1EO5A 2V9QA 3BMWA 1U8MA 4RAHA 1Q9LA 4LCWA 1NSNL 1S5HB 3CX5K 1N6VA 5ID1A 4WO4D 4MGXA 4WRLA 1A7NH 1HIML 2R0ZL 4NFDA 3MRJB 4OLWH 5SWZD 3UJIL 3RY4A 3IXAA 5FB8B 4NZJA 5GRYA 1QRNB 3VXNA 4LSDA 4YR6B 3A0OA 3WS3A 1K2DA 3KLAB 3FB7B 1WLHA 1HH6A 3KPPA 4AL8L 3WXWH 4XNYH 4KMLB 4NQDE 4FP8L 4LF3B 1IAIH 2A6KA 3OPZL 5BXFB 3TH4T 5EO1B 1INDL 5E2UH 4JLRB 5FV2A 4EOWH 2I9LA 4HCRH 4CJ0A 4OZIB 2BFVH 4JRXB 5CFHA 4KKCC 3VG9B 3C8KB 4HJGA 4PJFB 3IDJB 1DQQA 2E8ZA 4JZOA 5IB2B 3ARED 1KCSL 1E6JL 4YFDB 5I0ZA 4MCZB 4HK3J 2P5WD 4ZPTB 3R06A 2FBOJ 3QFJB 5TPWL 4H25A 2DDQH 2DTMH 3FCTA 5D71L 5GGQL 5ETUB 5IV2B 3PWVB 1DP0A 1NCAL 3T0DA 3C8DA 5T3ZL 4PJXB 4TUOB 3K74B 4OF6A 2CK2A 2VQ1B 3VFOB 1J11A 3FB6B 4HIXL 1YECH 5LG1A 3F62A 5D1QC 4I3RH 4FQLL 4DQOL 3FT4A 4M1GL 3HA0A 4LP4A 3NFSL 3BD5A 5FOBB 1CU4L 1RUQL 3OAUH 1J05B 5E8NB 2NQCA 1ZAGA 4ONFH 5T1LA 1HSAA 4XMLH 5IWLC 3WLBA 4H0GA 2QQKH 4PGEB 2P47B 4LP5A 4QRPA 3LHPH 4XCCL 4H26B 1OTSC 5M94B 3PQYB 1HILB 1XH3A 1DVFB 1IT9H 3GHBL 1N4XH 1A4KA 4LSQL 2A77H 5C0DA 3RBGA 4X4XB 1UYWL 4OGAD 3GSVA 3EYQC 2HT3D 3CZJA 4KY1L 2IAMC 4MWFA 2A9NH 3EYUH 1TVDA 5J11B 2Y7QA 4PJ9A 3MV7A 3EOYG 1NAKH 1LK3L 1NLBH 3RGVA 1BZQK 1NCTA 1X9QA 2AK4E 3G5VA 1FRGH 3VXSA 2F58H 4Z76B 3B6SA 3ELAT 5IEKA 1IBGH 2XWBA 5DURD 5INDA 4PJBF 1JGDA 4M9PA 1YEIH 1JJUA 3S5LG 2YD5A 1Q0YH 1O5DT 2DI8A 1FL6B 4G6ML 5DUPH 1UVQB 2AKRA 4HS8H 1CBVL 1OTUC 1NBVL 3OKLB 1RHFA 1UH3A 3OF6D 1BMGA 1NCUA 3S3JA 1OW0C 1RIUL 3TBTA 4X83A 3GSUA 4HFUH 4LL9A 5ICYA 1BPVA 4M8QA 5EU4B 4WNQB 4NFBA 1BQUA 3QPQD 4WWKD 3GK8H 4JO4L 4X4YB 4J3SA 1JV5A 3P0YH 3BP4A 3F7YA 1YPZB 3MBEA 4NZRL 4HF5L 5DK3A 1RZJC 2HFTA 1F3RB 4XVSL 5D7KE 4DUVA 3RIFF 2X2YA 4JHAH 1S9XA 4PJ5D 1KV3A 2DD8H 3V4VH 5JW3H 1N5YH 3ZKXB 4LLUB 1OAZH 4UT6H 1JK8B 4X8XA 1YEDB 4JDZA 1I3RB 3MV11 4IDLA 3IAGC 3WNOA 4D0CA 1FHGA 2Q8BH 2XV6B 1A3RL 2H8PB 4N8CL 2NYYD 5GGSB 2P49B 3O8XA 2BSTA 2CXGA 3GI8H 5BRZD 1VADA 2C26A 2C9AA 4DFIA 4XX1G 1OSPL 1FO0B 5D7SH 3L3IB 2VSDA 3LB6C 3CDGA 4NJAL 4YQXL 3RTQC 5ERWA 3VXRA 2WBJB 4WHYH 4M7KL 5FYKL 4F37F 1SEQH 4G42A 4LSUL 1N8ZA 5CD5C 1BM3H 4HS3B 3UYPA 4X9GA 2VO5A 4QRRE 4JY6A 4S11A 1EGJH 2VLKE 1E4KA 2IH1A 3BOVA 3ILQC 4OF8A 1FO0L 4OB5L 5E94B 4PRHA 1UJ3C 2KH2B 5FDYA 5CKGA 1OAQH 3WUWG 4YC2C 3O6FA 3VWKC 4GRWH 3VWJA 2EKSB 3O11B 3TEUA 3FB5B 4LVNC 4YDIH 3HMWH 2R0WL 3CPLA 5CJXC 1MCWW 2DM2A 3W0WB 2I5YL 2V2WB 4QKXB 3MXVL 2ZJSH 4O4YL 2C3VB 1YJDL 4ISVA 5GGVL 2MOVA 4M43L 2UUDK 4MQXC 3VD7A 1MY7A 4XPGL 4ZNEE 1F97A 5EBWA 1ZA6A 3KPRA 4ZFGH 2YPKB 1JNHA 3FN3A 3V4PH 4JFPB 1QSFE 2D7TL 3MV9A 1MRDH 2ZSVB 3K8KA 4IOFD 3MLZH 2EDXA 3F6LA 5DR5H 1A14L 3FOLA 4NM4H 2AJSL 1BBDL 4ZXBB 2HFGL 5DUBB 1JWUA 2IQAB 4U1LA 1U91B 4GBXD 4IOIB 3QZWB 4AMKL 4HK3N 4NQEA 4LSRH 2HMID 2NTFB 4P57B 3B3IB 3P0GB 5FYLL 3WV0A 1AKJB 2FGZA 1LP9F 3QUYC 4U1IB 4ODHL 1RZGA 4KKBC 2R1WA 4UDUA 1J0ZA 1MQKL 3BDBA 1ZHBA 4KK8D 1L7IH 3L5WB 3TVMB 2BSSB 1AI1L 1I8LA 3O3EB 4GW5B 3PQYD 2EC9U 1X5LA 1DN0B 2VDPL 2P7TB 1YMMD 3BP5B 2OZ4A 1SBSH 4I0PC 4RGNB 5HVWA 3OV6A 4YDKH 1RAMA 4JZNB 3B9KA 4NQSB 2HVKA 2XN9A 4FQXB 2Q8AH 5EOCH 4KHXH 5B22A 4PB9L 1E28B 4MDJB 3VW3H 3PHQA 2FZ3A 3UYOD 4GO6B 3KYAA 2V5SA 5I1KL 5MHSD 3IDIA 2A6JA 1M6OB 1Q0XH 1WAAA 2R1XB 4WENB 3IDXL 3V6OE 2Y07H 3L95B 5C0GB 4WFFD 4XBEH 2FR4A 2PN5A 3MRQB 1FIEA 3C6SA 3D6GA 1JWSB 1BLNB 2H1PL 1KJMA 3FMGL 5ITFA 1MFBL 3QXWA 4LGSB 5DRXA 4JM2A 2FX7L 5TE4H 1R5VA 2RAMA 1IGJA 2W38A 3PWPB 5FEBA 4OZ4A 1U8PA 5CHNA 2EYTB 4OZIF 1CGXA 2R2BB 1KFAH 1Q94A 3O3UN 3DV4B 4PJFF 3HE6B 2X40A 1OGAE 1JPGA 5DFVC 2CJUH 3V8OA 5CMAA 3QULA 3ULVH 1YEFL 2X42A 4XP4L 4Y89A 1N64H 3S4SB 5K9JH 3CLEL 4PRHE 1B2WL 2ADIB 3IF1B 4N0FB 4ZUWA 1O7VA 1ADQL 4ZO9A 4OUOA 1A0QH 5J7CC 4PJXF 4ZO6A 4DVBB 1RZKC 4Z6AT 4N5ED 1KIRB 1X7QB 1W0VB 4JFDB 5F88A 5GS2H 2ICWJ 3REWA 5DK0A 4H1LH 3K1DA 4DVRL 2N4IA 4FTVD 2DN7A 3CSYB 3QH3A 2QSCL 4K71B 4Y5VA 5FK9B 1JYWA 3TBSA 4CMHC 5H8DA 5J4MA 1D5ZA 1MHEA 2IMMA 4OLEA 5HHOD 3Q5TA 3E3QE 3AUVA 2GCYA 4K8RD 5D2LA 3DARA 2A6DA 1U8QA 1FBIH 2DQHH 2GEEA 3RGHA 3SOBL 1P7KA 5FA4A 2R2HA 2YWYA 3RKDD 3NTCL 4RAVB 3MV9E 1ETZB 2A1WH 1AGCB 4OBRA 2FIKB 2WINB 5ALBL 3D2UA 3S34H 1FGNH 5T5FH 5K9QG 4HWBL 2EIEA 1XGYH 4MDIB 1AD0B 4X7EC 1LE5A 1CLYL 1WWBX 5F89B 4OZHE 3QDGD 3FZUC 4FXGA 4OIBA 4PGDB 4NQEE 2YD3A 3DX8A 2NY1B 3H8NA 1ZT7A 4PY7B 3MRMB 5E99L 2Z35A 2VRAA 4NKIH 4OGXH 1VACA 2I24N 2BSRB 4LCCB 2G2RA 5ISZA 5CEYA 2F9BT 3RZCB 5D9SB 4JPWL 5JUEH 1I7ZA 3FFCA 3NIDE 1I7UA 5HGBB 3RWCA 1DZBA 3UTTD 4X5WB 3MNZA 1MHPL 1CXHA 5FUOL 4KZDL 2VC2L 4FQIL 5I1DB 1JYNA 3T08A 4U6HA 1I3VA 2LV4A 4YIQA 3O3DB 3TZVA 1IGYA 4HHAB 2F53B 4IRJD 3L5XH 1T2QL 2XN9E 1QHOA 5D96C 1HOCB 1KPVB 3OGCA 4OIAA 3DXAA 5DDHB 4Y16C 3MX0A 3DVGA 2DQCH 3OL2A 2VUYA 4E42A 4BFIA 2CDGB 4WI2A 1YPZF 4I5BA 5EZLB 2C1OB 4APQB 1UWXH 3D39A 5FKAB 1NKOA 2Y5TB 3W9EA 1H15A 5INCB 4IHOA 3PWLA 4NC1C 4RAUA 2BOCB 2DMBA 1VFOA 2ESVE 3MRNA 4YO0A 1NL0H 2J6EL 2OQJA 5TF1L 1Q72H 2AJZA 5HYSA 3BPOC 4XNUL 1DLFH 3SKNA 1BGXH 3ZL4L 3GMOA 2JIXD 2X09A 4PJ9C 3G5XB 1XIWB 4EEEA 1FV1A 3G5YA 4ELME 1ONQB 4C56B 2HWZL 2C7UA 5GGRB 4Y4KD 4PP2B 1BD2B 3SKOA 2W0FB 1KB5A 4QRQB 4RMVA 2J5LB 5C0ND 4LVOC 4HBCL 4RWYH 1WIOA 3A6BH 1J8KA 2CUHA 4WDIA 4XPBH 5KVDL 2PYEA 3LEXA 5FO9A 1KXVC 4C83A 5HHQB 5DT1H 4ODWA 5D8JH 3MOBH 1IKNC 3SDXE 4NRXA 1P4LA 1DUYA 3BZ4B 1KCVH 2BNQB 2YN3A 4PUBH 3WFBL 2ZKHH 3PWNB 3LQAH 3QDJB 5IB5B 1DBML 3CFJA 3MODH 3UPRA 2NLJB 2Z93B 2YUWA 3MLWL 5DQJB 3TA3D 1GYAA 1ZVSA 2VLJB 3MBEC 4LNVA 1PKOA 3IT8D 3TPUA 5DJAB 5JIHA 3L3GA 3DROB 5C08D 5FF6B 2CIIB 1MCBA 1ZLSH 3QO0B 3K2UL 3F7VB 1MCWM 5IVNA 3AY4A 3PGDA 5EIIB 1DE4A 3UTSD 5F3BA 1CG9A 2ICWA 3ARSA 3D3VD 4NRYB 2H32A 2VDRL 3SPVB 1DUZB 4BQ9A 5C0EB 4XCNB 4GRMA 3O8XC 2WLZA 2QADD 3OR7B 4QXGH 2AJ3A 2VERN 3MREA 2XZCL 5D93C 3NAAH 3C60B 1JHKH 1EIBA 1I1AC 1YEEH 2FATH 4M1CC 3QUMH 2HFFB 5DTFB 2H2SC 1L0XA 4EDWH 1FL3B 2HLAA 1CICA 2QSVA 4LCIL 4XMKH 3BWAB 1E4KC 2XZQL 4M8VA 5DUML 3H9SE 5CUSH 1WQVT 1IGFH 2YA2A 4JKKA 3KYOA 5D72L 4Y4HB 3KYMB 5ISZE 1FIGH 4ELKA 4PY8J 1QLFA 5IB1A 3KHOA 4HGMA 2E7MA 3RFZC 4WUKL 4L8BB 3MO1A 5I1EL 6FABH 1QSEA 4ZFFA 1UEMA 5CJQL 3BGAA 5EWIH 5GJSH 1T03H 5T3XH 5H35B 2FJHB 5ITBH 2V2TB 1CDUA 1OARH 1W72L 5C0AB 4Q2ZA 3DX6A 3LQZB 5CCKH 1CGSH 3SJVB 2PW1B 2RBLA 2EDEA 2NZ9D 5DRZA 3KNBB 4L8SB 4P9HC 3U6RA 2GUOA 3C6LA 3BRFA 3RDTB 1U3JA 1FFNA 3E6FA 1FQ9C 3MRCB 1GAFH 1KN2L 3FQNB 3V2AR 4Z7WA 1KCLA 3D39E 3T2OA 5ADPL 5B3NA 3ARDD 4QHLA 1XR8A 1NFDB 1A1OB 1F5WA 4UB0L 4ZUUB 2BVQA 2OP4L 3B2UD 2XZAH 1SEBA 3ARVA 4AJ0A 2HT2C 4O2CB 5CEZD 3JVGA 3TGXA 4PTTA 4GQPH 2OXGA 4JQIH 2HVJB 4GSDH 2Z92B 1UWGH 5J57B 2NY7L 5SX4I 2NPLX 3TN0B 4FQCH 4WV1C 1LILA 3FOMB 4R90L 3BP6B 4U1NA 3BT2L 1A7BA 1UM4L 3TO4B 5SX5H 1U58A 4M6ML 1UJTA 4PRPE 3MA9H 4MVBD 1ZWIB 1R5IB 4JDTH 4OM0L 5I2IA 2AVGA 3QQ3A 1F8TH 1MJ8L 4MNGA 5AYQA 4YXKL 3ZYZA 2HRPH 1UACH 3DVNB 1CK0L 2FEEI 4POUB 7CGTA 1HQRB 3NCEB 4RFNB 3H9HB 3JWDH 2QQQA 4P2OB 5IBUG 4JFED 3WSQL 1A6TB 1G9MH 4UT9L 4HV8B 4V2BA 2CRZA 2X44D 4L4TA 4Y19A 5DMJB 4FG6C 4JRYB 1TZIB 2OR7A 1P4BL 1BOYA 2ICWI 1FFOA 4ETYA 1BVKB 1HZHL 1RMFL 4E5XB 1LO0H 2FECL 2ID5A 1HINL 2XKNA 2YD8A 2VXQH 4B7LA 1KTLA 5HPOA 1G7JB 3EJZC 4PJEB 1IC7H 4AEEA 3S3PA 3WFEL 4UU9A 3QDHA 4QLRA 4MXVF 1H3UA 4NN7C 4NOFA 3IYLW 3KVQA 3CH1A 4NZUH 3P4OA 3ZKQD 4PPTA 1IGTA 2FLRT 1AQDB 1UXWA 4OQTH 2AJUH 5DMKA 1YQVH 2IG2L 3QIBA 1FDLL 3BKML 4YHYC 3MA7B 4GAJL 1I9EA 4Z7VB 4YHLH 1Q1JH 1DQTA 4XAWL 4L29A 3IETB 3WNKA 5F9JA 1S78C 3TCLB 5KSAD 3UTPD 3X14A 1QFOA 4L9LC 2HYMA 3RIAF 2IBBA 2XY2A 1KENL 3LKOA 4PGJA 1MCFA 5TF0A 3GSOB 1RUAL 5D1QD 5TJWK 2GI7A 4FXKB 5HYIA 1OOAA 5SWSB 1CR9H 4E41A 4R3SB 2DIBA 1GZQB 4JFZH 1HQ4B 5KG9A 3QCVL 2X4RA 3OAZK 1BEYH 1YY9C 1FGVH 1S7WA 3GNMH 3Q3GB 3IKCB 5IF0B 4IMLA 4PGBB 5HHMD 1WIUA 4G8GE 1T3FB 4YDVA 2C3HA 2EH8H 1U8NA 2NY6B 5EOTB 4OCLC 4UTAH 1GIGL 1ACYL 4GMTL 3BZFB 1XF4A 5F6HI 3QCUL 1OTSD 2VXUH 2L7JA 3VXQB 2XY1A 2E7LC 4EI6A 5B38A 2BVUA 1A9EB 2AEPH 3ARFB 1ES0A 4H88H 3QIWD 1K4DB 1XZ0B 3NH7H 2PO6C 3U1SH 1S5IH 2DQIH 4Z7WE 4F58H 1WCBA 5F9AC 4E0RA 4HWZB 2OTPA 1Z6JT 3MRBA 4KROB 4N0UE 4NKQB 2DLIA 5JXEA 2VXSL 4XCFH 2EDBA 4PRAB 5IW1A 4MJIB 2VN4A 3GUTB 4BA8A 1LO3H 4TSCH 3NFNA 4OLVL 3VA2C 1HHGA 1UT9A 3KPLA 3WKMH 2QQLH 4WFGE 4ORZC 5F1SA 3HC3H 1TJHH 4JPIA 5IBTL 5CSGA 1OTUD 3MLYL 5DMGC 3ARGA 2FH6A 4G43A 2W0PA 1X4YA 3NABH 3QJFB 4XNMA 3X13B 2DYPB 3IFNH 5C9KA 4WEMB 2CLRB 3WIFB 3MGOA 3O41A 1BOGA 2GTWB 1RV6X 1VGEL 2XXCB 3VJ6B 5JXAL 4NQCA 3MLVH 4LLMA 5MEPA 2NY2B 3IJYB 1UZ6F 2YPLA 2H3NB 4DZ8A 2GJ6A 2OCFD 3GBMH 4FNLL 1RJYB 4Y19E 1HH9A 4CU8A 1NAML 2ARJA 4NUJB 3H0TA 1TCRB 1KJVB 3N1GC 4XHQA 1LP9E 3QISA 2DL9A 4PJ8B 5GGRY 1AJ7L 5ACMA 4NQXA 1MCPH 3HI5H 4U4BA 4OTXL 1BBJA 4P23A 2Y6SC 3R4DA 3FN0H 4P5KA 4YUEL 4AIZA 5D70L 5LXGH 5A1AA 1QLEH 2OJEA 4EUPA 1H3WM 3UEZA 3O6LL 3QIUC 3RBSA 4EVNB 2BC4B 2BVEA 4JFXA 1J1PL 1CTOA 3RTQD 4OF0A 1MVUB 2F54D 1INQB 1SVZA 1TDQA 4G3YL 5B3JF 4JRYD 5ICXA 3UZVB 3I50L 1IMHC 3ILQD 3SO3C 8FABB 4QOKA 3UTOA 1QNZH 3AFLA 1X5XA 2EYRB 2ADFL 4L8DA 3UZEA 1LO5B 1T21B 3OBAA 5L9DL 3HZKA 4EIGB 1SYSB 3VWKD 3IDYC 4M6OL 2AABH 1MWAL 1UCTA 3G04A 4L5FH 3LEYH 4LHUA 1XCTA 3GKZA 4YAQA 3D9AH 3LDBB 3L9RA 2G75A 4PJHB 1JRHI 4NKMA 3TBWA 3N06B 1IGCH 2A9ML 3NZHL 4Z18A