3VW3H

Antibody 64m-5 fab in complex with a double-stranded dna (6-4) photoproduct
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
220
structure length
216
Chain Sequence
EVQLQQSGTVLARPGASVKMSCKASGYTFTNYWMHWIKQRPGQGLEWIGTIYPGNSDTTYSQKFKGKAKLTAVTSTSTAYMELSSLTNEDSAVYYCSRRNYGSSYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a double-stranded DNA (6-4) photoproduct in complex with the 64M-5 antibody Fab
pubmed doi rcsb
molecule tags Immune system/dna
molecule keywords Anti-(6-4) photoproduct antibody 64M-5 Fab (light chain)
total genus 34
structure length 216
sequence length 220
ec nomenclature
pdb deposition date 2012-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vw3H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vw3H02
3MA9H 1MQKH 3HTLX 4DVRL 3SJVA 3G6AB 1DBBL 1HXYB 5D1ZD 4FRWA 2CLZB 4R4BB 4G8IA 4WWID 3SE3C 3MJ9L 4L1HA 2ESVA 4LHUA 4MAUH 5FGBC 5J6GB 3CLEH 3C6LD 3QHFL 3HCVB 4BH7B 4MCYB 5CIPA 1U8NB 5FM8A 1FG2B 4QNPE 5JNYA 3GBMH 1IM9D 1EFQA 1C12A 4M93C 4OZHB 1U2CA 5MHSE 5EN2A 1TPXB 1JRHL 1M71A 3CFIC 4R7NB 1EA9C 3K80A 1HHIA 4JCLA 4LVHC 4PS4H 5JPNB 4DQOH 1QSEB 1HYSD 4WNQA 3MFFA 4OF7A 4PGEA 1YYML 3MXVH 5I1GL 2BSTA 5T3ZL 2Z31D 4X6DF 4E42B 3DMMB 1DBMH 1VACB 3HG1B 2YUWA 5I9QC 2FO1A 3G04A 2X40A 4RMSA 2XWJA 5FECB 3AAZA 1F11A 1O0VA 4M7ZC 4FQLH 3C8KB 2VXSL 4OZ4B 3THML 2IFFH 3BUTA 1FSKC 4N9GB 35C8L 1PDKA 3EO1B 1B4JL 3KPRB 4XC1H 2NW2A 1P7KA 5ELIA 2R0LL 2FECI 2GEEA 4W4OA 1YQ2A 3W9DB 2EKSA 3TCLB 2APXA 4PV9B 1YC8A 1A4JB 1FNGA 2YD5A 3WLWC 3VW3L 1IC4L 1XCTB 1IM3B 1ZE3C 2OTPA 4F57L 1TZGH 3F5WA 4KXZH 4KWUA 4X8JA 5ISZB 5IB1B 2OTWA 4M6NL 3QNZB 4O2EB 1OP3H 3MYZA 5FOBA 1WWCA 4G3YL 1D5ZA 4OGXH 4P5MA 2OSLA 3LKPA 4PUBH 1S7SB 1GPOH 4HWZB 3QUXA 5MEQB 2V5RA 2YXFA 1MUJA 2QSQA 5E6YA 1U8HA 2H41A 4NCC2 5HJ3B 5MEPB 1N6UA 3H9HB 3DUSA 1U3HC 3GB7B 1H3TA 3W5MA 3ULVL 3RDTC 1F3JB 3BAEH 1IBGH 3GMQA 5T5NF 1QEWA 1H0DA 2I24N 1LO2H 1GH7A 5EC1B 3DX9A 2R0KH 3T8XB 2YZ1A 3V6ZA 2XPGB 2EEDA 5E1AA 2J88L 3UYRL 4HUXA 1ITCA 4YE4H 2AV7A 2XYCA 3MCKA 4UIKL 1FAIH 2OZ4A 3QIUC 1JHTB 3QIUD 3TBWA 2AERT 4ONHA 4JY5H 3FO0H 4YDIH 1L7IL 1EV2E 4LKCA 4DCQB 4BSVB 2ATKA 2FIKA 2A0LC 4PJHF 4OGYL 4N1CA 1S7SA 1GGTA 2OQJB 4OFKA 4NNXB 2B8OT 4YHMH 4J3OC 4YDIL 2EYRA 4JY5L 5C0RH 3TYGL 5I74C 1F11B 3X13B 4MJ5B 2VABB 4IIQC 1SQ2N 4PLJC 5IBLD 3Q2CA 5HDBE 4LSVL 1BX2A 3DMMA 2DF3A 4PTUB 2D7NA 3D87B 1U92A 1FZJB 1RUMH 5KVFL 3EO0A 3RZWA 2ORBH 4Q0XH 5E6ID 1R3KB 5H35B 4R2GC 4MA8H 1P4BL 5GISH 3SDXA 4M6ML 4WTWA 4P5TB 4RSVA 3PGDB 2BNRA 3AS1A 4PJ7B 2NTFA 2OYPA 4KV5F 4MA3A 3GJFK 5C9JA 1W72H 4JZJB 1RIHH 5LGHL 3MJ7B 1SYSA 4RIRB 4OKVA 3KJ6L 2GI7A 3OJMB 5C0CE 4FQ1L 4Z6AT 3VXNB 5IB5B 5EORL 3G9VA 5CIPB 3O3EB 3PHSA 1ADQH 4NNPH 3GSUB 4YZFE 4MA1C 4FQIL 1TJGL 4JRWA 2DYPB 3ARFC 3TA3A 5IROA 1CIDA 3U7WH 2JJVA 1CGXA 4AM0B 3UTTA 4L5FH 4JQVA 3MSPA 5KOMC 4R7NA 1I1YA 3QDJE 4JEGB 1S7VB 1MHPH 5KJRH 3HPJB 1EJOH 4HKXA 2OSLB 3LKPB 3WBDA 2HVJB 4YXKH 2WV3A 2Y1VA 3KPOB 4OJFL 3D85A 1U3HB 1J10A 1IFHL 3MCLL 5IB1A 4MCYA 5FYLD 1DDHA 3BE1L 4ONFH 4P3CH 2WUCL 3VXSE 4H0GA 3FOLB 1JCKA 5FUOL 3QIUB 3NCYS 1IGIL 2XKNA 5GRZA 3V6ZB 3O8XC 4FQXD 5EOTA 2IFFL 3IGAB 1A4KA 2DLGA 1CDUA 2HVJA 4JN1L 5CCKH 4PJBE 2AJ3B 3SKNB 3DURA 1D3CA 1JGLL 3HFMH 1FZOB 1QSFA 1FYTD 3P30H 2UUDK 5C0AB 3V5KA 5FV2A 1T6VN 3W0WE 3V4PH 5FV1L 4RA3A 1MFCL 5FUZH 3QZWB 2HH0L 4A6YH 4RQQB 1BM3L 5D2NC 3O81A 3PWLB 4Y19A 3O9WB 3AROA 1BD2D 4KGLA 3T0EC 3DBXB 2VDNL 1INQB 3SO3C 1QBMH 3MPCA 2XWJB 2YHGA 4BJLA 3ARFA 5JORB 3SJVE 3WSQH 3JTSB 5FHBH 1A6WH 4MXVF 4YHOL 1T1WA 2VXQL 2NTFB 1YC7A 3ZT6A 4GRLC 5JR1H 5KSAC 5HHOB 4YDJB 3MFGB 2R2BB 4PJ7E 4S1DC 3V8CA 2NY6B 1SHMA 4DN3H 4J23A 4NQCE 3DETC 4JZJC 2FLBT 1MAML 4ZTPH 5CIPH 3HCVA 5BW7C 1NMBL 1QR1A 1YY8A 3C5SB 3OV6A 5DTFB 3GSXB 3DRQA 3W9EA 5CD3A 3BP5B 4OZGF 4PJGE 4QHNB 3VFUA 3VGDA 3M07A 4TNWK 3OKEB 4XCYB 3L9RA 2XNAB 4U7MA 3T08A 3I2CH 4GSDH 4PJHA 2HKFH 2C3GA 5E2WH 1Y6KR 4C59B 4FNLH 3SGKA 3ZE1E 5EU4A 1KOAA 5BVPL 2FX7H 3CXHJ 3GSQA 5IQ7H 3DTXB 5E8OB 1Z0NA 3HE6D 2KH2B 5GS1B 3O2DA 5L6YH 4L4VB 1T7ZA 3FFDA 3CLFL 4OLEA 3N85H 2VC2H 1JBJA 3IDMA 3K3QA 3OB8A 3MRLA 3MJ6A 5F7KC 4WHTB 2I9LA 1AGEA 4K9EH 4OKVB 1OY3B 5TF1L 3OR7A 2GFBB 4PJ9A 4TNVK 4MAYD 5HVGB 1KENL 3IF1B 3TM6A 1LK2B 5EC1A 3U4BL 2VRAA 2DQTL 5C0AE 4KJQD 4KVCL 1UC6A 1CGYA 3I02B 4RMTA 4APQB 2I26N 2XY2A 4WTXA 4WEBL 1CD8A 2YPLE 4WV1C 2EXWC 1UA6L 4XBEL 3P2TA 3RVVC 7FABH 3LVEA 1BX2B 1DQMH 5D7JB 5LBSL 4ZTOL 1IT9L 4QGTA 1XGUB 3CPLB 3ZE0E 1G84A 4FS0A 1F4XH 5JHDD 3ARXA 2EIBA 5L8JB 1KLGA 1WICA 4IRJA 2I25N 4O4YL 4HCRL 1HE7A 2YWYA 1A7BA 1T66C 5I66B 4YPGA 3Q1SH 2GYSA 2VWEE 1MVUA 2NW3B 1A22B 2A1WH 1BF8A 3TBSA 5ICYA 1WLHA 5SX4I 3RA7L 1HH9A 2GSGB 2SEBB 3BUYB 2HT2D 3U0PB 4D9QE 4WO4B 43C9B 4LLWA 3L5WB 1T1YB 1JNHB 5KAQG 1FE8L 1XR8A 2JIXB 1GCFA 1QLRA 4P23D 5IF0B 1FHGA 2X09A 4JHWH 4P46A 1P4LB 4CADA 3RX8A 5CZVH 3KYNA 2P5EE 4H1LH 2Q86B 1BQHG 5E2UL 1LO2L 4MNGA 1TZIA 4H5SB 1XGTB 3FQUA 3MLVH 4MJ5A 5ETUB 3MACH 3C5ZC 4NOFA 4FQJL 3IDUA 4OZFA 4TSBL 4U31A 2ZZUT 3BPOB 4KKNA 1DE4A 2R1YA 1C5BH 4X80L 2DQTH 4KJYA 2O5XH 4P57A 3O2WH 1EHNA 3ARDD 4QXGL 4N0UE 1CDHA 2E27L 3KPPB 4IOFD 4GUPB 2F74A 3N9GL 3L95A 5DZOA 1C08A 1FLTX 4UU9A 2ZOKA 2HVKB 2J1KA 4OLYH 2WBJC 1MF2L 4HUXB 3JVGC 1J12A 3MLVL 2WIIA 1BECA 1DQLH 5F7WC 1AJ7L 1WBXB 4A2LA 3OKOA 3QEHB 4AH2B 4DFHA 5ESQA 5CGYC 5EULV 3JWDH 1W72A 3V7AE 1F45A 1JPFB 1QSFE 2Z92B 3DSFL 2YN3A 5D96B 5LGJA 2QKIA 3P73B 4RX4A 3S4SA 4KKBD 1PX3A 1UA6H 3F12A 3V4UL 1A9EA 1N4XL 1KG0A 1JPGB 1BD2E 5ERWA 3OKNA 5DHVH 3B2UD 4PRDA 1BVZA 1FLRH 1NUGA 5E24E 1OTUD 3MV9D 4M43L 2EC9T 2XWBB 4TUJB 5FYLH 3WDJA 3K8LA 3F7YA 1ZHBB 3C6LC 5C71A 1ZGLM 5T3XE 4M7JL 3PV6B 5I19L 3Q1SL 4Y16B 5KSVB 4NP4L 4K7PY 5DMGC 2D0GA 4H1LB 4I8DA 3C09B 2L0DA 4QO1A 1E6JH 2I60H 3ESVF 3GKZA 3UTPD 1AD0A 1IAIM 3IKCA 1JGVL 4HG4J 2HKHL 1Z9LA 5CZXD 4IRZL 4NN7B 4X9GA 3AXLB 1ZS8B 1JPFA 2DMCA 2ARJQ 3FKUS 1IGFH 3WFEL 3S3JA 4GLRI 4L8SC 2AK4A 4PJAF 2EYSA 1FVEA 4PJHE 2HT2C 1IEHA 1UXSA 2VISB 1ZT7A 5EU3A 1F90L 3RDTB 1BBJB 4U4BA 3LOWA 1UZ8A 4LEXH 1MCLA 4OLWL 2HTKC 5B21A 5EUOA 5IV2B 4I5BB 1A1NB 4HJGB 4OFDA 1UH2A 2B1AL 4OJFH 3NH7L 4LVNB 3U4EB 1GGIH 4KK8C 2VUYA 3QFJE 4ZPTB 5FDWA 2VC2L 4ZUUA 1RZFL 1ZSDA 4XH2B 1IQDB 2G5BA 2WWKO 3I50H 1CCZA 3WUWB 5TJWK 4NJAH 1HCVA 5LXGH 2PYEE 3MRDA 3RFZC 3FQNA 1T83C 1WWAX 1NC4A 3RWJB 3S4SG 2CK0L 4L4TD 2OTUA 4OV5A 2IQ9L 3OG4B 2B1AH 1U41A 5ALBH 4NNPL 2HKFL 3PWNB 4OCYL 4U1LB 4B0MM 1YY9C 4WY7L 1QR1B 2GSIA 4R97C 4AEHH 5EO1B 2CO6B 3BKCH 2JB5L 1WT5A 2VLRA 3U9UB 2DM4A 3NPSC 3WNLA 1EHLL 3W39A 3EFDH 1E4KC 5F7UA 4NC1C 4EVNB 4FABL 3UPAA 1NGPH 5A2JH 4HIXL 3A67H 3X12B 1RVFH 4OUOA 3DECA 4N8VA 1G7HB 1RUML 2Z8RA 4WWKB 4BFIA 5CSZB 3CFDB 5C2BH 1A6WL 1J0HA 1MCFA 1UCBH 5BRZD 2BSSB 1LP9F 1QBML 4EUPG 1YMME 4FN0A 2Z4QA 3QQ3A 3EZ8A 3WFZA 4BFIB 4QRSA 1JGUH 1XAUA 5SWSD 4I2XA 1HINL 4BQBA 1FYHB 2FDBP 1I1AA 3WE6B 3PDOB 4ODWA 1UCTA 1QSFD 3D39A 5FGCE 3RPKA 2DLIA 4H8WL 3VFNA 5JXAL 3S5LG 3WDIA 4YUEL 3SDDC 4RISL 1IC1A 3VXTB 2RQ8A 4UOW0 5HD8D 3L3DB 4JO2H 3SKJH 2I07A 4YPJA 3STLA 2G60H 5IMKA 4NBYB 1RULL 4HQQL 1Y18B 1GC1H 2QL1A 4GXUM 4OZIB 3MCLH 4NJ9L 5BOPA 3QNYA 2X1WL 2Y07L 1XF3B 1DUYB 5IG7B 5I8CB 3W0WD 5HHXH 4GT7A 3ARZA 5I1CL 2EH8L 1OGAB 4PRPE 3TA3B 2F53A 2R1WA 1X44A 3RNKA 5B38G 1OB1B 1Q9WA 4PGCA 3OSKA 3CVIH 5IGXL 1RZJL 5I1AB 5K9QI 2FCBA 4POYA 1M7DA 4MJIB 2IPKB 4X83A 4FQQA 3X11B 5KSUB 1ZGLA 1YNTA 5D2LE 5FYKE 4QTHB 3O6ML 4KJPC 2R9HC 1LP9E 3VFMB 4ZAKA 2BXZA 4QY8B 3FHQA 1LO3H 4JM4L 1A6TA 4MMXC 3S9DB 4Q97A 4UIKH 4X99B 4L29B 4U2ZA 1CE6B 4OT1H 1D9KC 1M4KA 1SBSH 3RL1A 3GI8H 3U46A 5BRZB 3VFOB 4JHAL 4YH6A 2JK5B 2R4SH 1AO7E 2YBRA 5IUSA 3MV7B 4LAQH 4KRPC 3M1BA 4DZ8A 4LEOA 1RJZB 2QHLA 5EPMB 3UAJC 2UYLB 2PYED 3BQUD 1HQRA 4YK4B 4I0PD 3PUCA 1LK3H 4OQTA 1R3LB 2P8PA 2ZUXA 3IKCB 2A38A 2IANE 3FB7B 5EO9B 1EZVY 3BYYA 1A9EB 1WWWX 1ORSB 1KIRB 3BOVA 2NZ9D 3O2VH 3TJHD 4TSCL 2V7HA 2IAMA 2UVEA 2P5WA 3F7YB 5DD0H 5I30H 4DGVH 1BWWA 2X9XA 1ED3A 3MREB 4YGVA 4XXCA 1NC4B 2ITCA 3RWJA 1BQLH 3GEWB 1YEHL 4PLJD 5K59E 1R6VA 1BBDL 3KXFD 2NY4C 3BIBX 4OTXL 2OM5A 2WLYA 4NBZB 1G7JB 3BKMH 4HGWB 3WIHA 5GJTL 1WCBB 1F97A 3N1MC 5IFAL 4BUGA 1J1PH 3VH8B 4A6YA 2VAAA 4WFEE 3HPLA 5ID0B 4KRNA 5DUPL 1FZMB 2PW1A 3EGSB 3MODL 2D31B 4OD2A 4B50A 5EIVA 3SO5A 3RAJL 3KLSA 3BPCB 3DROB 4M62L 1DLFH 3TO2A 3GM8A 4CJ0A 1CDGA 2H26B 1RJYB 4HZAA 1VA9A 5I1AA 2DQEL 5DD1H 3GSNL 4NCC1 5DJDA 3EOBB 2GK0B 2YUVA 4X6CB 1UB5B 3TBTB 5E00A 1I7UB 3SDXB 2PW2B 1FN4A 3C5JA 1I8KB 1D5XA 1ZVHA 2VDLH 4BZ2H 4NRXA 4HIJB 2DI7A 3GKWH 2YPLD 1H3XA 1ZEAH 2VZUA 4M7LH 4HD9A 5KSAA 4J8RB 2DI9A 4UT6L 5DD3H 3JV6B 4WHDA 2BRRH 2EDWA 3ZKXB 5D5MF 3LIZL 1WT5C 2IAMB 4NIKB 5I1IL 1YEFH 1AHWB 2MCPL 5BO1L 4XNQB 1I1AB 1RUPH 3ZL4H 1ZLWH 4JM2B 2PTVA 1AGCB 4U1HB 4K3DL 4RGNC 3IFLL 1HKLH 1GVIA 1TVBA 4LSUH 3CFCL 4WU7B 3TBWB 3DV6B 2V9TA 4Z8FL 2DBLL 3CDGA 2BVTA 3ARTA 4X5WB 5D1QD 2RCSH 4JGMA 3FQWB 2AXJA 4GRMB 2Q6WA 4DOHE 3C2AH 1NBVL 3HZKB 3VXMA 3P4NA 2BNUA 2QQNH 1OP3K 1BLNA 3ES6B 4LVHB 1G9NL 1JGLH 2DQHH 1HZHH 1XF3A 2W0FA 2UY6A 3IJSA 1CICB 5FGBA 2EDFA 3WS3B 1KIPB 3OBAA 1DQDH 4I48B 4ELMB 1QFWM 1QLFA 2QTEA 4JGUA 1SYVA 4NM4H 1ORQB 5I9QB 4H25B 1WAAE 5CEXB 3D39D 3RY4A 1BVLB 1IKFL 5F3HA 4FA8A 2M2DA 3GSWB 3KG5A 2BFVL 5TPWH 5F1OB 4BSWA 1OF2A 3GIVB 5IROC 1J86A 4G8EA 1TZIB 3HMXL 1PSKH 5GS1C 4U6XB 4BQ9A 3VGGA 4OIIH 4L5FL 1PQZA 1VB9A 4RA0C 4F3FB 1NL0H 3T3PF 2BXYA 3EYSL 3LQAC 3SDXE 3FRUB 4TVPE 4U1JB 1KCKA 1RJCA 4Q6IA 3OKEA 4QRPD 4HIIA 5DK2B 1HDMB 5L8KB 5D71H 1UB6A 2R1WB 3UTPE 1ZT4A 4XP9L 3D9AH 4Y0GA 3EKCA 2XQBL 3LQMA 3MBXL 1RIHL 2WBJD 4F37K 3QWRA 5A16A 5J9PA 3KPRD 4N68A 3BRGC 3TO4B 4O9HH 1E4WL 1UQSB 2DQUH 1EEYB 4QGYA 5IB2B 3JUYA 3CNKA 5A16B 4X4YB 5D7LD 5F1IB 4M7ZB 5E8NA 2YEZA 3NFSH 1UADC 2E3VA 2QQNL 2OZ4H 3J7HA 1MFDL 3RRQA 3ET9F 3IT8D 3PWNA 5M95B 2A0LD 5EU5A 4PJFB 4U1JA 3ARGD 1T1WB 1SMOA 4NUJA 4NQED 3IDXH 1MOEA 3ROOB 1NDMB 3O6KL 1IKNC 3LKRA 3SKMB 3LN5B 4H8WC 4F8TA 1F6LL 1JI2A 4QXUH 1KTDB 3OMZA 2DS4A 1L7TH 5HYSG 3L5HA 4NNYA 2UZIH 1BP3B 2XWTA 3N06B 4NUJB 1FAKT 3BEWA 4W70A 2P5EB 1AFVH 1SY6A 3HAEH 3OL2A 5ISZE 4DVBA 4M7LL 5JDJA 4CU8A 4OM0L 5EU3B 4GMTL 3EBAA 1A6ZA 1MREH 2FX9L 1RV6X 4FXKB 1G7MA 3F62A 4XNUH 4FXGB 4BZ2L 4ETQA 3LPGA 4PRIB 5E8OA 1OAXL 2B7DT 5KSBB 4X6DB 4IIQB 3WS6C 4GRMA 2DQIH 1KTKE 4CU6A 4LCCA 3KGRA 3L5XL 4Y16D 1QBLL 4XHJC 3L1OL 1W0VA 5IIEB 3WUWG 4KK6D 3IAQA 5DTFA 1SYSB 4D0DB 4UQ3B 1CT8B 4Z77A 3HMWL 4TSCH 2X89A 1I4FB 3QUYB 1MAKA 5IB3A 4DWHA 3PP4H 3ULVF 3A6BL 1FP5A 2R9HD 2UWEF 1FVCA 1ROWA 2EDNA 4M00A 1GGBH 3FQUB 4RMWA 3O3AA 4PRHB 2AGJL 1LEKA 4QOKD 3JWNC 4LGSB 3JWOC 2DQGH 1UKQA 3BGFB 5A43C 2P47B 2VLME 2AEPH 2A9NH 5GS0H 5D8JL 4AH2A 1NFKA 3QIWC 4WDIB 1H3GA 2XZAH 4TULH 4CW1B 1J0YA 5HTSA 4HDIA 2HJLB 3HA0A 5IOPB 2GSGA 5DJ8A 3DYOA 4AZ8A 2PYFB 4GRLA 4YEFA 1JZ7A 5DJXA 4DTGL 4KJWD 1VFMA 5IMMA 3V4VH 2AV7B 1CZ8H 3MCKB 4EDWL 5I15H 2VSCA 3TYFB 5DJ2B 1AXIB 3P77B 3BDXA 1H8SA 2ATPA 1K6QH 3KPOA 3OQ3B 5JOPD 4ELKA 2EEAA 4IRJB 5DQ9A 3QI9D 1IE5A 2HJFA 2AP2A 4M7KH 4P3DB 5D7IE 1TNNA 4M1GL 3NCEB 5I8OH 3S37X 4L3CA 4TTDC 3OHXB 1QSED 5CEXA 1FDLH 1IILE 2VDOH 4PP1C 3OJVC 3P77A 4MAUL 2O5ZH 1NMAH 2Y06L 4QCIB 4MVBC 3IXAB 1M6OB 2GQHA 2BVQB 2JJTC 2FO4A 3MV9E 4GW5B 3VFVB 4HUNB 5GGVY 3RTQA 3O4LE 2CR3A 4P46B 1T80A 4UQ2A 5IVXF 4HXAL 1FORL 1YN7A 3MUZ1 1QSVA 4F9PA 5DUBB 4NQTA 3HZMB 3QXTA 5BVJB 2X1PA 3DUSB 4Y1AE 3DI3B 3SGDI 2CQVA 1MCBA 5DJ8B 3VXRB 1HH9B 3AU1A 2VL4A 3EDDA 4XVUC 5D71L 5GRVL 2WUBL 3FL7A 5E6IB 3U2SB 1WJ3A 4NQCA 4XAWL 2HJFB 2VLKA 3D25B 5F9AC 4AT6A 3KR3L 4ZOEA 3RX7A 5D2LA 4Z95H 2PKDA 4NN7C 5ISZA 4OQTH 2A6JB 1Q72L 1WZ1H 1G9ML 3MROB 4ZOCA 3W2DL 4DK6A 3WIIL 3K1KC 2CRYA 3RL1B 4L3EB 1NCDL 4CVZA 4G6MH 4WUKL 1KLGB 2A6KB 1JVKA 2NY3B 1CXLA 3S35X 1MCHA 1X5FA 4OF5A 4QT5B 3S36X 4JO2L 4NKQB 1J0IA 5J06A 1AO7A 4WI3A 4QY8A 1SY6L 1YEIL 4HF5H 1UVQB 2DMBA 5JXAH 4ESKA 1I3VA 8FABB 4AG4L 3NCJH 4JFDE 4PLKC 4Z76B 5HVWA 5DR5L 1O7VA 2VXVL 2IAMD 4PG9B 5F72S 2APFA 1J8HE 5ICZA 4OZIF 4K8RH 3CFBB 4X7DC 4RWHA 3VXQA 1R0AL 4GXVH 5LKNA 1S9XA 4NUGH 1HNGA 3WLBA 3C8DA 1QP1A 5ALBL 5FB8B 6FABL 4NZTH 5J6GA 2RAMA 2DIAA 1EEZB 1T7YA 2IAMC 4LCWE 3QZWA 3O2DH 4K8RC 1Z3GH 1EK3A 1QLFB 3O6FD 4UI2A 1R5IB 1IM9A 4L8CA 5EO9A 2BNQB 3LIZH 4PGBA 2JCCE 5DQ9B 4Y19E 5TPWL 1KACB 3HE7B 3ESUF 3A67L 3HN3A 3REVB 3P4NB 1QLEL 3PL6B 4GG6E 3CH8A 5LVEA 4NM4L 3MRCA 2NY7H 3ALWA 4OLWH 1A5FL 1U8QB 3MV7A 5JIPA 2XZCL 2YN5A 4F33B 4XCNA 1NLDL 5FA4A 3WXWH 1RSFA 1T21B 4OLUL 3D39B 4LCWA 3L3IB 4LPXA 4L8BB 3QDGD 1A1OB 1CDCA 1A6TB 4NM8L 2Y36H 3QUMA 1S7RB 5FCUH 2VNCA 2WBWB 2WIMA 2GUOA 5DQJB 1BOGA 2AK4D 1KT2B 4Z7WE 4HZLA 1EEZA 5BV7B 3Q6FB 3RKDC 2L7UA 2Y23A 5IVZB 3B43A 1RK1B 2JKXA 1MIEL 1GOFA 3UTZB 4W6WB 4YHKL 3H9YA 5I15L 4KDWA 1BIIA 3DTXA 5I74B 4PJ5A 5AZ2H 4LEOB 2UWEB 5C09E 1GZQA 3DGCR 4DN4L 2YD9A 4EI5A 1MCPH 6CGTA 1RVFL 5GGTA 3KYOA 2Z8VC 4XMKH 1K4CB 2KL6A 4JJ5B 3IS0X 5FM4A 3GSXA 1AO7B 1S8DB 3MRRA 3TBTA 5I73C 2HRPL 1CN4A 2GK0A 3KYKH 4QNPF 4X6CA 3RX5A 2ZPKH 3GKWL 3QXAB 3T77B 2A73B 3WNMA 3CMGA 3MLRL 4MAYC 1IEBA 4BSJA 3ZT5A 4ZS7H 5DZNA 1JGVH 1HI6A 2A2QT 4YQXH 2ESVB 1YECH 3DROA 4I18C 4LHUB 5E5MA 5C08B 3RIAF 1H3PH 3OZ9H 5DRXA 4HUKB 5DF0A 2W38A 4OZFH 2D7TL 2APTA 4HKXB 4IRSC 3HUJA 3QNXB 3FO2B 3NZHL 3GSOA 3T3PE 1MFAL 1NBYB 1R5IA 1IGTA 5DD6A 2EO9A 3I9GH 5GSRB 3IVKB 5KVDL 1SEBA 2X42A 1ZMYA 5JHDA 2VZ1A 5D7IB 1IGJA 5KS9A 4WU7A 1QBLH 4LAQL 3L5XH 1J9CT 4XMLH 4KTYA 4C54A 5I1JL 1NFDA 5F7EL 2EH7L 4KAQH 3T1FB 1NCCH 1A6AA 4WIQA 3FQWA 3IU4L 4RBPK 5FYJE 1KGCE 1UJ3C 3MNVA 3FO9B 4OTXH 2BY2A 4ZAKC 2GCYA 3BIKB 1P1ZB 3E3QC 2X9YA 1CLYL 2G75A 2HMID 4PB9H 3MV9B 1N59B 4Z7WB 4OLXL 1KIPA 3EYQD 2NY1B 1HILB 4OZGE 4PJGF 5CZVL 4KV5E 4MHHI 5I17B 1KCUH 3QQ9D 2GTWB 5D5MA 4XNZC 3OAUH 3X14A 4H1LA 4NZRL 3WNPA 1D6VH 3QJFA 3TBVA 4IDJL 1J87A 3VWKC 4OUUB 1BREA 3ILQC 1MJ8L 1XR9A 3RUGA 2PR4L 1OLLA 4XCEA 1JF1B 4M43H 3BH9A 4B7IA 4OCRH 2EC9U 5F7DA 1FLRL 4MD0B 3ROLB 2HA1A 4LP5A 5JQHC 3WKNA 1VERA 4E5XA 1U3HD 1AGCA 4LQFH 3UTSB 3ARPA 1CFVL 3MCG1 1RJYA 1NQBA 4GBXD 1I7UA 3NCJL 2E8ZA 4K71B 1RZJC 1TQBC 3OXRA 4FQQB 1XEDA 2W65A 1P7QD 4JFOB 4N0CD 4MMZC 1FFNA 1WAAF 3NTCH 2EDQA 2M1KA 1R3HB 4LQFL 2X4PB 4EI6B 4PY7B 5HPMA 5FAAA 4H8WH 5H94B 4RMQA 4LASH 1I8KA 1S9KC 4C56D 3C60B 2KBGA 3X17A 1DP0A 4H20L 2QSTA 4X4XA 2ZUWA 2PYEB 3MLUL 3RWDB 2HN7B 3IDNA 4XNYH 3GNML 2KUTA 4RGNB 1S5HB 3RVVD 4QXGH 1D9KD 2GK2A 2A1WL 4OQTL 3WS3A 1VGKB 4N8CL 1R3JB 5T1LD 5D7LA 5IEKB 3TN0B 1X5LA 2Z8WC 5FYKD 1FYTA 4K3JH 3CK0H 1QO3A 2PTTA 1DTUA 4DEPC 4KZDH 5JOEA 1LE9B 4OLVL 4WFGE 3HZVA 3M8OL 4HS8H 4HUWA 3MACL 3OR6A 4LCWD 1UXSB 4EIGB 1XGYL 1OHQA 3V2AR 5M7QA 3GBNL 3DI2B 1GIGH 3L7FB 2R0ZH 5AAWA 4R4BA 2PXYA 3HPLB 5ID0A 2LV4A 4XTRD 4KUCD 2CDEA 5K59F 3KS0H 1VEPA 1KN4H 1O5DT 1S7UA 3T0AA 4WY7H 3VFGL 4EUPB 4Y5VB 3LHPH 4BKLA 2ICWI 1QRNB 4KDVA 4Z78A 2XKSA 1FDLL 2QQKH 5GGRA 5GGTL 5I8OL 4P2QA 1CR9L 2LTQB 4G6JH 3U79A 2ICES 3ABZA 3BD3A 1U36A 1UZ6E 1FH5H 4D0BB 2HLFD 4YC2C 5KS9E 3ARBB 1MLBB 3RIFK 5D1ZC 2FBJL 5GRXG 5T5FH 1FNHA 1JI1A 1MFEL 1KGCD 3O3DA 4DTGH 2AJUL 1JPSL 5AD0A 1CFBA 4XPAH 1M71B 1ITBB 2UWEE 4IRJC 4AENA 3VI3E 4R4ND 1JWMB 1CD0A 4KK9D 4ZXBB 4XP4H 3CCHA 3QUML 5HVHB 1ULVA 3QP3A 1AH1A 3UYPA 2P24A 1WBXA 2MTPA 2XQYG 3KWWA 4H1LG 3B9KB 1F4AA 3QUXD 4U1KA 1P69B 4UB0L 3T4AA 5DGRA 4EQ3A 5H37H 2OI9B 4MJIA 4P3CL 4ZOAA 2DN7A 5DD6B 1A6ZB 4H0IA 1OSZA 1RHHA 3O8XB 1CGWA 1NSNH 3G9AB 4HXBH 4PJ5E 5T5FL 1E6JL 4XBGB 4I4WA 4JDTH 3MNZB 5IFJB 3HC0A 4CAGA 4MB3A 5CWSB 2D7MA 4IEFB 3QIWD 1V3JA 4M7JH 3H3BC 3MGAA 1T1ZA 2HH0H 5C08A 4PJEF 3OGCB 4ODXA 2QQKL 1M7IA 3DWTA 5HDOA 2V7NB 3BWAB 3MRMA 4NPYA 4PP1D 1JWMA 4PJ8A 1F90H 2OXGA 2F53D 2APWA 5E7FA 1B90A 1XMWA 1QQDB 3FQRB 3O45B 3ECBA 2IF7A 5EIIB 3QEQD 3IFOB 4F9LA 3I6GB 4YIQA 3QWQB 3CJJA 1IFHH 2VR4A 1ZK9A 3N1QC 3ES6A 3BZFA 1AGBB 4OGZA 2I07B 4S0TD 1FG9C 3T1FA 1MF2H 1T20A 3H3PL 4P59L 1NGWA 1DBKL 2VDML 1WF5A 1DR9A 3CFKA 2ADGA 4Y16C 3B5HA 4EVNA 3QQNA 4ZS6C 4Y5VA 5BRZE 3TYGH 4J4PC 4YDLC 4UBDC 1S7TB 5D2LF 5CWSA 1KT2A 2J5LB 4N5ED 2QQLH 1CLOH 3DLQR 2ADIB 2CUHA 1JYXA 3FFDB 1PKQE 5IW6B 4HJJL 1NANH 1HNFA 2ZUYA 3VGBA 4G42B 1DZBA 3SE8L 1YEGL 3E8UH 3TPKA 4P2OD 3QRFM 3REWB 4BK4A 2BSSA 3OPZH 1CGUA 2YWZA 2ZNWA 2X4OA 4HX1B 1F2QA 4LCYA 4XT1C 3TJHC 2C3WA 4ZUSB 1KELL 3MRCB 4RRPA 3VD7A 5KVFH 3Q3GA 2F74B 5FDWB 3BP7A 3VWJD 4BYHA 3RNKB 2BNRE 5C0ND 5EFIB 1SVZA 1KCVH 2A73A 1FZKB 1H3WM 5AD0B 3OKLB 5E00B 1XH3B 4FMKA 4JFDD 4ZAKD 3FTGB 5I71C 1J0JA 1T22A 5L2KD 4Z7VA 4M93B 4QRPE 1S7QA 5IM7A 3D1MC 1YNKH 1A2YB 1G1CA 4RFOH 2AXGA 4XAWH 3DGGA 5FYJL 1I3GH 2H26A 4LCUB 4PLKD 1HYRC 1Q1JL 2FX8H 2WUBH 4NOBA 3MRFA 1ZLUK 1B2WL 3WKMH 4JQVC 1U8IB 2FJFB 4P5KA 4O2CA 3KJ6H 3IU3A 2ZSVB 5J57B 4G7VH 1MELA 2Z91B 2AABH 5ADOL 4X9IA 1OARH 1PSKL 3OAZK 3O41A 3STZA 1WBZB 4PJXA 3W11D 4Y16A 3OB0K 3VDCA 3O4LB 1XF2A 4KRLB 5HHMB 4P9MH 4F9PC 1W0WA 4ZNEE 4V1DB 5C0AA 4DAGL 4XBEH 4Y4KB 4OI7A 3EDKA 3V6OE 1BZ7A 3K4DA 4P2QD 5KTEH 3UPRA 4N1HB 4UZGA 4KVCH 1XFPA 3R06A 1DBJL 3CC5B 4KUCF 2A83B 1TJHL 1S78C 5FEBA 3PWJB 1RIUL 1ZHBA 3MGTA 3ARQA 3QPQD 3QHZH 5EBWB 1NCTA 2VLLB 3QB7C 2DM3A 5JO5A 4YGAB 5JZ7C 1X9QA 3N1PC 3K74B 3SBWC 2NY1C 5KW9H 3V4VL 3PWPB 5EBMB 3S5LA 2G75B 1UG9A 1MEXL 5E9DE 2H9GB 1QHPA 4Z7UB 1KCLA 1HKLL 4ISVA 5IQ9A 4D9RD 4GUPA 4C58B 3L3GA 1CD1B 3MJGX 1R3HA 3RTQB 3KDMA 4CDHA 2H3NB 4JO3H 3ULUD 5ICZB 5J12B 3HNVL 5DC9B 3UPRB 3HNSH 4ZNCD 3ULUH 4X6EB 2C3XA 5DHYA 4GH7B 3VGAB 4KJYB 1ZEAL 3TC9A 4W68A 4PRPB 4LSSH 2Z92A 1YEEL 1UT9A 4XMKL 1OT2A 1KCRL 4EI5C 4N8VG 2W0KA 5D93B 5D1XD 4AEHL 1VGEH 2DMKA 4U6VH 1P4IL 3MA7A 2ZOLA 2DYPD 5EUKB 2A6IA 3KWWB 1H9VA 1XF4A 4PS4L 3BP4A 4JY6B 4OIAA 4RGND 4JVPA 5MENE 3BQUB 2D7OA 4XCYA 1VPOL 1WIUA 5JIHA 3KPPA 2FEDC 1XCTA 2HJLA 2V9RA 1PG7X 4P99A 1C5DA 3U9PL 5HSFA 5GSVB 3I50L 3O6FC 1T22B 2EEBA 1MFCH 5DRZA 4GKOA 4NKOB 4JANA 2ATKB 5C92A 2KPNA 3HE7C 3TBYA 2BNRD 4LLVB 1LGVA 3VXUD 4GKZB 4KMTH 4JG1L 3U6RB 5HYFA 5L7XL 1DBBH 1HQRB 3JV4B 5E1AB 2Y72A 3L5WA 1N0XH 3AAZB 3PXJA 5C08D 3TVMB 1NBQA 5EC2A 4HSQA 4XX1G 3WFEH 1ZHLB 3X13A 3BXNB 2A77L 1F8TL 4K71C 3MV8B 2XA3A 1E6OL 2WP3O 3HI6H 2AJUH 5ESAA 4DGVL 3O2DL 3T0VA 2I60L 4ZFZA 4MZ3A 2P48B 4XPFH 5T1DL 3GSNB 4K7FA 3ZKSD 2J8HA 3PIQB 2EICA 1C12B 3MMEB 3NCBB 5HGDB 2XA8L 2EDEA 3MRNB 2V2TB 3MOAH 1CR9H 4G6JL 4A6YL 1CVSC 5HXMA 4QRRD 1U9KA 5F7FA 2R2HB 5I66A 1D5BB 5GZND 4XVUD 3RVUD 1NMCB 5MHSD 5GISL 5L2KA 5EBGA 2LFGA 1I1YB 3SDYL 1IGIH 4HPYL 5IG7A 4FFWD 1FCCA 3IDYB 4XZUB 4ONFL 3LQZB 1IGTB 3E1F1 4G8GA 5KTEL 3T0DA 4OT1L 4NO0D 1GZQB 1JIBA 1ES0B 4P4KD 4I1NB 4WEUD 2R0ZL 1GIGL 3HAEB 4U7SA 4LMQI 4LVOC 1FFNB 3QPQC 4OLVH 3PGCA 4MCZA 4TQEL 1LO0L 4KKBC 1DVFD 4ZO8A 4HUUB 4E0RA 4JO4H 3QIBD 1TZHA 4HJJH 1P7QA 1C7SA 2BNRB 3MLXL 5MERB 3HC0B 3KYOB 1A7NL 4LPYA 3V0WL 3QXDB 4JE4B 4NC0B 2DQCL 1J8KA 4NN6C 1E28B 4EN3B 2D2OA 4PJDF 3UTSA 3GNMH 1BFSA 4Z7VF 2NR6C 1AI1L 4MD4B 2JIXD 4GW4B 4E41E 4PJAB 1I1FB 5A40E 4X4YA 3P3YA 4TSBH 2DTSA 5DJ6B 3KPRE 1U8OB 5GS0D 4WFFD 5JW4M 4J6RL 2BCKB 4R96A 1VESA 2Y07H 3LMJH 4PREB 3HRPA 5HYJB 1NDGB 3DMMC 4UTBL 5SWQB 4PJ8C 2C9AA 1RULH 3I6LE 4LKXA 2C1PA 3JWOH 5CBAA 1G7MB 4FXKA 4LGRB 1I8MB 2V17L 4MXVE 1OP5H 1F02I 2ILLA 4WCYH 1DEDA 4PJ5D 2RFXB 3SPVA 1B2WH 4L9LC 4YNYA 3CFCH 3MRJB 4U0RB 1Q1JH 2FX8L 3VFWB 5KVDH 4P5TD 3NIFE 3JTSA 3INUL 4L8BA 4NNYB 4NQXB 4LCWB 1XT5A 4LU5L 1YA5A 1ZVSB 4P9HL 4OCSL 3WJJC 1G9EA 4JB9L 4F57H 2WNGA 3GSNA 4K7FB 4AIZB 3FONA 4KKLD 5DEGA 5ECJE 4Z0BH 1M6OA 1ES0A 2AVGA 4O4YH 3ZYIA 3O9WA 4Q6IC 4KMQA 5ESAB 1BIHA 4M1CC 4U1MB 4YE4L 4WTZG 1EDQA 1XF5A 4OF8A 1R5VB 2CDEB 1U8MA 5D8JH 3WNKA 1V8HA 1ONQA 3CU7A 5I1DB 3WFDH 3OKOB 1UACH 2HTLC 3AUVA 5T33L 4BUHA 2MFNA 3QDJD 3TT1L 3TH2T 3DYMA 2GJ6E 1YJDH 3OKYA 5JHLH 2PN5A 2AXFA 4DKFL 1CXEA 4KKAD 4G43B 5D7KE 4M5YL 3LPWA 2H1PH 5T3ZH 3P9WB 2BY1A 5DEFB 4QTIL 1KSRA 2B0SH 2ZCHL 4LBEB 2FNBA 2H32H 4CW1A 4NQCB 4LLDB 2AJXH 3PWPE 1CVRA 4FQ2H 1B0GA 4O02H 1WZLA 5AWNL 1U91A 4V2BA 3IDNB 1AHWA 3RQ3A 4ZFZB 3QJHB 4QRPB 4XMPH 3MROA 4G9FB 1H5BA 4TUOB 3AS0A 1LEKB 4YHPA 1TITA 4RAVA 3IDIA 3SCMC 3DX7A 3HI1A 3I2CL 4NQDE 1EFXB 3I75B 4LEXL 3K46A 4KROD 2L4OA 3LH2L 4LFHG 2ID5A 4JRXE 2RJMA 5GHWH 2VQUA 1QYGH 2APVA 1KN4L 5DUML 2QADB 3VCLB 4HG4K 4LLVA 4LLYA 4I0CC 5I0DA 2NNAB 3NFPB 1S7XB 1QLRB 1AP2B 3VE0A 5ENWB 3LKNA 1QLEH 4UBDD 2CIKA 1BEYH 3BPOC 3WLWD 1DQTA 2BVPB 4P2RE 3S96A 1CDBA 1RZKH 2PXYB 3VD4A 5IR1B 5D1ZA 3CXDL 1OAUH 2R2HA 3TF7C 5GSVA 3WSQL 4ZFGL 5BVJA 3HZMA 1IZJA 3QUYC 2DQDL 3NA4A 2W07A 4FTVB 1CL7L 1LK3L 3AM8C 1OP5K 5D1ZB 1OM3H 1E4XH 4L3CB 1FH5L 2NY2B 5I8EB 4FXGA 4Y2OA 3EYUH 3B2VH 2B4CL 4I3RL 2BNQA 3TFKD 1X7QA 2X4TA 5EUOF 1HSBB 1CFQA 1XF5B 1MH5B 3HRZA 2OR8A 3SE3A 1DSFH 2ICCA 4P4RA 1CDIA 1EHXA 3BFOA 1KEML 4C56A 1SBSL 4GQ9H 1Z5LB 1JV5A 1JNJA 1S9YA 2C1OB 3BZ4B 1XCQA 5DK0B 3RHWF 3WEXA 3GZKA 3I02A 5KANI 4P3DA 3HS0B 1J5OH 2E9WA 4QRRA 5F1SA 4RAUA 1NJ9B 1PEZA 4JCMA 4JFEB 5I2IB 4YFLF 1ACZA 4WDIA 3FN0H 1XGYH 1EJOL 2IALA 2IBGA 4XWOC 4UT7H 1G7QA 1NKRA 1U8HB 1UM5H 2LQRA 4WU5B 4JLRB 1BJ8A 1ZTXH 1JTTA 3UYOD 3TZVD 1G1YA 2H2SC 1BJ1H 4DW2H 3RVWD 4JKMA 1ZLSH 4MDJB 3FMGH 1K85A 1KTRL 2OTWB 3E6FA 3BZEA 3DGGB 4UT7L 1D5IH 3KNBB 4J4PA 4JFQA 3IFNH 2ZOLB 3TZVC 3GSRB 1W72L 4IRJD 5TFSH 5KVMC 1FORH 3CC5A 4Q9RL 1AQDB 5IWLC 4PD4K 1MCQA 2Y5TB 1FZKA 4EN3D 4GAGL 5KVEL 4DCQA 3NIGF 3CMOH 4PBWD 5DD5H 4JPWH 5JNYB 2W60A 3UROR 1NCCL 4NN5B 2O61A 2YSSA 1CU4H 4S1RL 2FJGB 3ZZ1A 4QRUA 3ARUA 5HGBA 1OAZH 1WFOA 4M9PA 5BS0B 1FPTL 1JGDA 1BIIB 1CE1H 3G5YA 4M1GH 1KTDA 3GIVA 3A0OA 4J1UA 4P46D 4F7PB 1KJMA 1YEDA 2EDKA 4ISVB 1AE6H 3FQTB 1UGNA 1IM9B 1J1XL 5FA3A 4KHXH 2VZSA 4PJIA 4R90L 3SPVB 4V1DD 5E2VH 3IFPB 1SJEB 3UC0L 2NZIA 2NY5L 4JQXA 2VLMD 2ADGB 1G9NC 2FYYB 3K8MA 4NZRH 4G7YH 2A9MH 1U8KA 3A6CL 2IFGA 4N9OB 3VXTA 5DJYA 3MV01 2FH6A 2FSEB 4W6XB 5E03A 4XPBH 2DQGL 4R7DB 1JYVA 3VD5A 4R2GB 5AYUH 5C09A 5SWSE 4GFTB 3NABH 4R3SB 4PJ9C 3BH8B 4APQC 5K9JL 4Z7OE 3UTTB 5FGRA 5GRUL 1UB6B 5HYSB 3SQOH 2DLTA 3BRFA 4QTHA 5IW1A 4XNZB 5SV3A 4HCRA 1KEGH 3BGMB 3WHE0 5F93C 4HUUA 5I8KH 4E0RB 1ZVYA 4PJ5B 3E6FB 3QISA 5IB5A 4U6XA 4PJ7F 1KN2H 1MCRA 2NX5E 5IHBA 3RAJH 2D03H 4NQDD 3HAEA 4P4KA 3UDWC 3BGMA 2BRQA 3DVIA 4JFYB 3RPIB 1NLBL 4JRXD 1EZVX 5DA0B 5BJTB 2AKRB 2F54D 2HRLA 3IU4H 4OCWH 4NKOA 4DEPB 1IGCH 5DRZB 2EDJA 1WAAA 3QIBA 1PG7H 3DHMA 2DL9A 4L9DA 1AY1H 4PJCB 4F7EA 3NBNA 5GGSY 1JWSA 5F96H 3NFNB 1SVCP 2QR0B 3H9SA 3MRHB 5MI0B 5M94B 2JB6B 3UAJD 5TDPA 3GK8H 2AI0H 3FFCB 4FFYH 4DN4H 2ED8A 1I9IL 4I0KA 4JVUA 5FYKH 2AJYL 3AMLA 3U36A 3G08B 3PWVB 2MSPA 2QBWA 3PDOA 4ODWB 3SBWA 25C8L 1TJIH 1Z9SA 5DVOA 1NCAL 3QUXC 4FHBD 5C3TA 2CDGA 3KPSB 4D0BA 1P53A 3O11A 4WFGD 4KU1A 3NCMA 2HLAB 1N4XH 1CK0H 1X5GA 1BD2A 2VISA 2VSDA 1KPRA 4P49A 1T0NA 3QCVL 4HH8A 4YJZL 2H8PA 4OB5L 2AV1B 3HR6A 3RUGE 3CX5K 2EDTA 3HMXA 1RJLA 3W81A 4AG4H 5FGCB 4FTVE 4HGMA 2R29H 5T3XD 4RDQG 2CIKB 3VGAC 1MRCH 4X5WA 2ZNXA 1HEZB 2ED9A 4MXQD 1JUFB 1QPPA 3RWHA 1DBAH 4JFFB 1NLBH 4O2FA 3TBYB 3ZKQD 5T1KB 3L3JB 3BW9B 4M3KB 4JPIB 1GZPA 1NCDH 1D5ZB 4P5MB 1ZANL 4MQ7B 2QEJA 4JY4A 4PRIE 5ICXA 5KG9A 1UWXK 1B6UA 1RFDL 2PXYD 2WQ8A 1AXTL 4NFCA 1QRKA 2A6JA 1A7NH 3C5JB 3R0MA 4POZC 3IAGC 1YUHB 3KPMA 1S9VB 3KHQA 1U91B 4EUPH 1ZLUH 3S8WA 2E9BA 2VJXA 4Z77B 3HE6A 5JA8B 5D7SL 3QQ4B 2IPTL 4FFVD 5F6HI 3RBSA 5FM5O 3X3FH 2X5PA 1JYNA 5IVNA 2C26A 3KHOA 1N64H 1QKZH 2DLEA 2NY2D 4ONHB 1QFWH 2X4PA 4WW2F 4ZMAT 3QFJA 3X11A 1NEZA 3LB6C 5IMLA 3IU3B 4GLRH 4K8RD 5SWSA 1NCBL 2P49B 4G7YL 1MHHB 1WFNA 4HPYH 1MCCA 2A6DA 4KKCD 1GHFL 4UV4H 5CGTA 4ZQKA 2ITCB 4L4TE 4K07A 3VFVA 3QFJB 1G9NH 2AXGB 4NC1E 5J1AA 3CZFB 3QIWB 4U3XA 3CFJB 4NDMB 1K5NA 4PJBB 4JFED 3ZSSA 3SEPA 1E27B 4YBQC 2EDLA 1E4XL 4GS7C 1TMCB 4JVWA 3IJSB 4S2SB 2IG2H 5T1DH 2O5YH 5H94A 3W5NA 4RFEA 5C6TL 2IGFL 1CZ8L 4LHJB 4W4OC 1YY9D 2XTLA 4XAKD 4HIHB 4MJID 1MCDA 2BVOB 3QO1B 1RZKL 1RUQL 5DD5L 1ZXQA 3EHBC 5EBMA 3BDYL 1YPZF 2CLZA 2ZUVA 4QOKE 3BMVA 4NFDA 4OD3L 1J05A 3SGJA 4UAOC 4CVXA 2JJSA 2R2EA 2WLZA 3I84A 2GJJA 4AEEA 4G6ML 2AQ3A 3DIFB 5IBLC 5DDHA 4ZNEA 4MAYA 1S7XA 2XXCB 2O93L 3FT4B 2X4RB 4BELD 5CEZD 3WIHL 2JCCB 4ODHL 2IPTH 3EYUL 3ILQD 5F7DB 3BH9B 5CEZH 3CFKB 1GGBL 1EJ6A 3CX5J 4H88L 5ILTL 2H45A 5E9DD 5A2IH 3G6JE 5TF0A 4P0DA 3VRLE 3QG7L 1AXTH 1H5BB 1XF2B 3P4OA 4IHOA 4P2OB 3QEQB 4OGXL 4R26L 3VFPA 4HS6A 1B9ZA 3UCRA 1OB1A 3PABB 1J88A 1EO5A 3FAXA 1R3JA 1HSAA 3WS6A 1EUUA 1P4IH 2C3VB 2P5ED 2EKJA 4LCCC 4NHCL 1HYSC 3TCXA 3P9MB 4NO3B 1AGFA 4FQCL 4CBPA 5DD3L 2Y4SA 3BWAA 4QRQA 5JW5B 2ZG2A 2JCCF 4OV5B 2EDOA 5IBTH 5D6DA 2XZZA 3ARSA 5E08H 2VITA 4B41A 4PY8J 1V05A 2NY1D 4MJ2A 2BJMH 1BFOA 4L3EE 4HMEA 5HYQB 5IMLB 4G8IB 2CGRL 3RVTC 4PRIA 2AKRA 1JN6B 2XZQH 4HH9B 5DJ0A 5I1EH 4QF1A 2VE6B 5JW4R 1F4YL 4J4PD 3AS3A 3QEQA 5DS8B 1NCAH 1U93B 4ZFGH 1PKOA 4NBXB 2ZCHH 5GS1A 4OQ1A 5FF6B 4NQVB 3C6LA 2YPLB 3G5ZB 4QF1B 3KPQB 4Z7NE 5CBEA 1VHPA 3U36B 1INDH 1WFUA 1F4YH 3HFML 3OAYH 4PGDA 5MEOB 4S1QL 5FO7A 4G9DA 1K4DB 5ACZB 3DX8A 4HC1L 2CGRH 3V4UH 4LPUA 2ZJSH 3IYLW 3H9SE 2VXUH 4MS8D 4YXLH 4JPIA 1J1PL 1FV1A 3PDGA 3JWOL 4JHAH 4JPVL 2GITA 1DVFA 4Q7DA 5FA4B 1VFBA 4LOUD 1D9KA 5CP3H 5KZCD 1BLNB 4UMGA 3GHEH 2ZWLT 3WIFA 4Y2DB 4Y8AA 4JFFE 2OJZH 1RJLB 4JKPH 1IZKA 4Z7WF 4IRSD 5IHLB 2D03L 3A6BH 2FYYA 3O6MH 4QHMB 2JK5A 3I3EA 4XHJD 3N9GH 1D9KB 3WCYA 1UWGL 3GMRB 1A0QL 1EERB 4YIQB 5DJCB 3HB3C 3K2UL 3LEYH 3BIAX 2LAAA 4RMUA 3VXSD 43CAB 3UBXA 2QSCH 3U9UA 1EAJA 3FT4A 3CDFA 3FRPG 5BV7C 4PTTA 1UJTA 4KPHL 2N4IA 2V17H 1RZJH 1S9XB 3BT2H 1CS6A 1A4KB 2A6DB 5EUKA 3BGFC 1UACL 1TQCB 3EYFA 4N0FB 2JB6A 1IJ9A 4WI7A 2ICEB 2OZ4L 4XBPA 1IKFH 4PPTA 4D8PA 4GMTH 4OM0H 4XBGA 3HE7A 1AGFB 4NHUA 1N3NB 2VDRH 4F7EB 4HH9A 5DJ0B 1CDYA 1PZ5A 4L4TB 4MQTB 3T4YA 3KPNA 4RISH 2EXWD 4CVZB 1ND0B 5C0FB 3RKDD 4GW1A 4QXUL 5JTWA 4NWTL 5J4MA 1DE4B 5C6TH 1NC2B 4LU5H 3CFEB 4PB0H 3TP4A 4XC3L 3UJIH 1EO8L 1CIUA 2DM2A 5A2LH 2AEIT 4O58L 1K9TA 5E0QA 2LABA 4XP9H 1KTLA 1LEIB 5GGUB 2V2WB 5EZJB 3VWKA 4TVSa 2E6QA 1HK6A 3CFJA 4NDMA 4RMVA 1IRAY 1FO0H 4M4RA 1CE1L 4O51A 4ZFOL 4WCYL 2GT9B 1RK1A 1E4JA 5IGXH 2ZG3A 3PWLA 2J88H 3UYRH 3VXUE 1RUPL 2XTJC 3VH8G 4D9LL 4YX2H 2IALB 5B22A 2YZ8A 5KSVA 2GHWB 3VI4F 2O26U 1I8IB 4LPTA 4UV4L 5CJOL 3IJYB 2FRGP 3TNMA 4OCXH 1W2KT 2LU7A 5DT1L 2W9LA 3ULVH 1NGPL 1KJVA 5E9DA 1GC1L 4PY8I 4HQQH 1XF1A 3QDMB 5F8RC 1QRNA 2GJZB 2BVQA 4RAHA 3ULSA 1LHZA 4I3SL 1C1EH 3RUGB 4EI5D 4UDTB 1S9VA 1AIFA 4XPGH 1JWUB 4XCFH 1TQBB 2X6MA 4P4RB 3VWJB 3T0XA 2DQHL 2C7UA 1DN2A 1L0XA 4KI5F 4UTAH 5LG1A 2CLVA 4S2SA 3H6JA 3HPJA 2OP4H 1GL4B 1FO0A 1IMHC 4QRTB 1KJ2B 2EC8A 4Z8FH 4KQ4H 1S5HA 3V52L 1P2CB 4OZFG 4OGAC 4U7KA 4P57B 3RWHB 4N0UA 2DKUA 4Z5RA 3WL9A 2C4FU 2BVOA 4LCIH 4U1LA 1FIEA 3MZTA 2YD1A 3VW3H 4K3DH 1QRNE 1L9MA 5T3XH 4HWEL 1GOHA 1U3YA 3M17A 3T65B 4J1UB 4G9FD 4TNWF 3CX2A 1UXWA 1ZAGA 1H0DB 3S36L 1Z6JT 4PJDE 3O3BA 3TA3D 4MSWA 5JHDB 4Y1AD 1I7TA 2ZUQB 3K7UA 2FHFA 4FQLL 3T65A 3QI9C 3HAEG 5A2FA 2D4FA 3MJ9A 3OHXA 2B20A 4XWOD 4ALAH 3ZDYF 1DBML 5HPMB 3T3MF 2EZ0D 4TSAL 4CDGC 3DX7B 4IJ3B 2Y25A 2B4CC 3U9PH 4UV7L 4G6FD 1P5VA 4M8VA 2DD8L 3RGHA 3TA3C 1A6VL 3LSOA 3T2QA 4X8JB 1IC5L 1T4KA 4YGVB 5B3NA 2QR0A 4XPFL 4LRNH 2FGWH 5F88B 3BDBA 1A47A 2COQA 1HIML 2Q76B 3FFCA 3FB6B 1ZS8A 3QJFB 1A6VH 1XGTA 4FXLA 2P44B 4NNXA 5BO1H 1YMMB 3I6KB 3Q5TA 4UIMA 1I9IH 5FYKL 3V6FA 3UBXB 4WO4A 43C9A 5ITBL 5E2TH 3RTQC 5C1MB 2A77H 4PRAB 3VRLF 3FT3B 3O6LL 3CSBA 4XCEB 1RZKC 5CCKL 1CFSB 5ICYB 4LHQB 3QRGH 2GCYB 3Q5OA 5D4QA 1N0XL 4OBSA 5DVNA 3ULUL 2NNAA 3TESA 5L7XH 3R8BB 3WFBH 3U0PA 1T7VA 2DLFH 3MA9L 5ALCL 5EOCJ 1KJ2H 2BVUA 3MYJB 4PLOB 4LSDA 2H8PB 1QBBA 3VXSA 1N6QL 3BKML 4E41B 2XN9D 3B6SA 3VFSA 4HGKC 3CIQA 4UILH 1JV5B 4QOKB 4XPHL 1Y0LA 3QO0A 4IRZH 1MEXH 2I9LB 4ZG1A 2BMKB 3BH8A 3AB0B 3F58L 1HKFA 3NPZB 5HGAA 1DLFL 1YYLL 1ZGLB 5I8KL 3NVQA 4NYLA 4CVUA 3JTTB 2OR7A 3T3ME 4KH2A 5D2NA 5JLZB 3QHZL 2XTJD 1DCLA 4LVEA 4D0DA 4XPGL 1RIUH 3ROOA 2O5XL 3EOAB 4F7TB 2HVKA 4U1NB 3EW3B 1CICC 2PCPB 4KC3B 5GSRA 3IVKA 1H15A 1IEBB 5C6PB 3LKQA 3V6OA 3UO1L 4HDIB 1AXSB 3HI5L 1JMZA 3C09C 4C83A 2DLHA 5HHXL 5EUOB 3KPTA 5CJOH 4ZS6D 2WM0A 4TOYL 4L8CB 1XH3A 5DRXB 3U30C 3DV4A 4LSQL 4I18B 5EO1A 3TPUB 4C83B 2WZPD 2XQYK 1AKJB 1X5IA 3HZYB 4F8QA 5FKAB 3RGVD 3L5IA 5C0RL 4QEGA 2P5EA 43CAA 1J18A 3MV7E 3BQUC 5C0CB 1AHWC 3MV7D 5HHNA 3LB6D 3T04D 4OCSH 1X4XA 2M26A 1V7NL 5HI3D 2HMIC 5GXBB 4IRSB 3B8YA 2FR4A 4M6AA 1BFVL 3EJZC 4QRUB 2YKLH 1A7OL 4PV8B 3VFWA 1JGUL 5F9JA 3ZHKA 5IKCA 1CT8A 1IEAA 4NT6A 4P9HC 4PJFA 3GIZL 4F2MA 1AQDA 1UYWH 4RAUB 3OKKA 3GHBL 3G6DH 3QO0B 2J5LC 2SEBA 4CMMA 4Z7UE 2ADFH 4KJWC 3DHJA 3U7AA 2P8LA 1J0ZA 4LKXB 1Z0MA 1LDPH 2EYRB 1T20B 1OAYH 3TPUA 1DDHB 3MO1A 1NC4D 5ANMA 5GQBA 2X4QA 3ELAT 3SOBL 1X5YA 5E70A 3SCMA 3BZFB 3RKPA 5CBEB 2VLKB 4LSPL 1YMHB 2EDDA 4L3AA 3G6DL 5MEND 5DJ6A 3U4BH 4RRPG 3CSPA 2AJ3A 3SKNA 3QUZC 4GG6F 4Q9QH 2BNQE 2CDFB 2VLRD 2J12B 3KS0J 5B8CA 1OGAD 1H15B 4JM2C 4XCNB 4K9EL 4D94A 5DJYB 4ZUWA 3ULVD 2MCG1 3VXUA 3ZDYE 1G7IA 1QRND 2R23B 2F54A 3HLAA 4MX7A 1AO7D 1FNSH 2NYYC 5T1MA 3NZHH 3QFDB 1AQKH 1T4KB 5ANME 1MCEA 5HGAB 2AJZB 3P0VL 4P2RA 5SX5K 3MUGA 5DK0A 5ADPL 3ZHDA 1AGEB 3GDBA 4Y4FC 4QRRB 3KLHC 1NCWH 3FRPA 4KJPD 4WGWB 1G6RB 3C60A 5B38B 4XC1L 3DX6B 1J5OL 3P0YL 3HG1D 5DVKA 3CDCA 3QEHA 5JHDE 5HBBA 3DXAA 1PG7W 2ZPKL 1DANU 3MX0A 3OTTA 4OD1H 1ZA3B 1WITA 3EYOA 5J12C 2GTZA 5HHVH 2NY0D 2W60B 2A74A 3F5WB 4LNVA 2K1MA 4AL8L 5HGGS 2NPLX 4GW4A 2BHUA 4MD4A 5SX4H 5CJBA 3ME0A 4OI9A 2K9UA 2OS7A 2J8UA 5C0BB 1TCRA 4X7CC 3RWCA 2VDNH 3AREB 2YD6A 2VDKH 3VGFA 1E6OH 3QULB 4M7LT 3NAAL 4L8DB 3FN3A 5IQ7L 1NUNB 2ESVE 4R8WH 1PVHA 5HHVL 2YA0A 4FABH 1QEWB 4XP6L 1KJ2L 1P6AB 4QHKI 5ALCH 3CH1B 3EFDL 3BXNA 3PHOB 5GZOD 4ACPA 4YHIB 1UM6L 1BFTA 1RZ7L 4LSRH 4KI1A 3JVGA 3M45A 1XGRB 4KRPD 5BS0E 5HY9A 2UVFA 2WUCH 1NGQH 2CKBH 1CFSA 3MUGB 1A6AB 4J7RA 3IXTA 5T1KD 2WWKT 3LKOB 1I85A 4JZOA 3CGTA 3QPXH 4FZEH 1K2DA 2R23A 4LVNC 4MNHB 1IGML 4OLZH 4FQXA 4L9LB 5D6CA 3RBGA 4E41D 4DKEL 1Q8MA 2V2WA 5DVMA 5ILTH 2VOTA 1FRGL 4ODBD 3ZE2F 2JE8A 4Q9BA 4KROC 1RURL 2VERN 2X1OA 4EKXA 4HPOL 5JQ6L 4UTAL 2DJUA 2VQ1B 2AW2A 12E8H 4GXVL 4M9OA 5I1DA 1LP9A 1RU9H 1S7VA 1SJVA 2VXTL 1Q38A 3T0EA 4X9FA 3MLUH 4KY1L 5BXFA 2KDGA 2DQJL 4CN1A 5JHLL 2PO6B 2DYPA 1XGRA 1RJZA 4YFDB 5DXWA 1P4BH 5HDLA 4P46C 3PHOA 3MRIB 3RVXD 4QHUB 2FHBA 5DJZB 3QDMA 1LO4L 4OF0A 5DURD 4JM2F 1I7TB 3K0WA 4TTGA 3IKKA 3LCYA 3NIGE 4PJDB 1MI5B 2V7HB 2NY6C 4V1DA 1NAKH 4TRPH 4IBLT 1QPXA 5T3XL 2J4WH 1UXWB 4YDVA 3NFPA 5FXCH 2Q1EA 3QJHA 4JQIH 2IG2L 3ZKND 1QOKA 5C07B 3ILPA 2X7LB 4FZ8L 1A1MA 5BZDA 2GT9A 2MKWA 5CINH 5LQBH 2C1PB 1BOYA 1GGCL 3IDIB 4G8FB 3RU8L 3R0NA 1MCWW 2UYLA 4ODTL 1DQJA 2PR4H 4PJCF 3WNOA 3U7YL 4FFVC 3TBSB 1MIML 3GJEB 2X4UA 5CP7B 5AUMA 1C5BL 4QLRA 4X6DA 1CE6A 5KSBA 2Y7QA 2A83A 5CUSL 5E8DL 1HXYA 5J8OA 5I1KH 1WK0A 3R06B 2YK1L 3RI5K 1Q0YL 5FIEA 5T1LB 3DURB 2HFFB 4MNQE 2E7CA 1FV1B 3BSZL 1VEMA 4WEBH 2YD4A 2FECL 5IMKB 3IJYA 3FHAA 4OLYL 3TNMB 2X4SA 5CUSH 5IEHA 3FRUA 1I1AD 3DX8B 3MNVB 1D5MB 5C7XL 4C4KT 1N5YL 3VDAA 3KPLA 2YC1B 3CK0L 3DARA 4KPHH 1G0DA 1WQVT 5KSUA 1F6FB 3ALPA 3G6AA 3LD8B 4LLUB 4EXPX 4MQSB 4WI8A 3OX8B 2X4NB 5EU7C 4Z7UA 4O58H 1Q9WB 3QDAA 3IFPA 4PGCB 1BVKB 1QSEE 1UEMA 1MJJB 3MJ8A 5K9OA 5DLML 1GGCH 2VL5B 1M7DB 3MRLB 1I1AC 3LEVH 3OKMB 1LO0H 4NRYA 2CMRH 5L6YL 2CSPA 4NO0A 3TEUA 3SGKC 1OD9A 3MXWL 3AB0C 3EO9H 1L7IH 3QUXB 5MEQA 4XPHH 4G5ZH 4XZUA 3QAZC 1R3IL 4J12A 4K94C 3GHEL 3G6JB 3IB4A 3VXME 4FNLL 1EGJA 1HH6A 2AJSH 5JXED 5CEYB 4ERSH 2I5YH 5DQDL 2YPKA 4JRYE 2NXZB 1AXSA 4XNXL 35C8H 2OX5A 1DQML 4DZBB 3OKDB 5C07E 4GKZA 5C07D 5I1HH 3Q6GH 4NQDB 4PRBA 2ICEA 3QUKA 2VIRA 2VR9A 5IVXB 1EX0A 4DGIH 3VRIA 2NLJA 3O45A 1V3KA 3Q48A 4YAQB 5IKCB 1QBAA 2OR9L 5ITBH 3H0TA 4NO5B 5C0JA 4M6OL 3VU2A 3KNBA 4JFQB 4YDLB 5TE4H 5MERA 2VAJA 4ODXB 1TCMA 4RGMC 1K3IA 3VFTA 3RJQB 1YEKH 3QA3B 1BF2A 1CI5A 4Z7UF 4I2XB 2AEQH 1BQSA 1QA9B 1WC7B 3C2SA 4FQHA 3TZVB 1OTSD 1QG3A 2XN9A 5FKAA 2BSED 4ENEC 5K9KB 1MFBH 4ENED 3WHXA 4RGOH 2CK2A 1JGEA 3JZ7A 5HHOD 4PJGA 4W81A 5E2WL 1S7WA 3P30L 3W82A 1J0KA 2HRPH 1S7RA 1JJUA 4XP1H 5DUBA 3ZDXE 2W91A 2CXGA 3FT3A 3T8XA 5EN2B 4OZHA 3LD8C 3GM0A 4I77L 4WO4D 1OQXA 1G7PB 1BAFH 1BGXL 3OKMA 1JHKH 2WSKA 4Z7OF 4N5EC 3DJ9A 2EIDA 4S1QH 3GSWA 5D1XB 1Q9LB 3O6LH 5J11C 2OTUB 2H9GA 2R0WL 3GMPA 3CUPB 5GRJH 3OX8A 5HYJE 4QWWD 4X7TA 2IH1B 3MMEA 2DAVA 3OAYK 3O3DB 3KPQA 4J3UA 4PR5B 3RNQB 1YYMH 3MXVL 2C4XA 2YC1A 4NGHH 4JGJA 5JO5B 5CHNA 4UT9H 2FGWL 2BMKA 4U1SB 4H88H 3SE4C 3WUWA 4NZTL 3VXMB 1YECL 3I6LD 1F13A 5DHYB 5FUCC 1OW0A 1T7XA 4U6VL 3AVEA 3VJ6A 2XZQL 3WJLA 1QSZA 1U3ZA 5D6CB 4ODHH 3ZDXF 1BM3H 3B5GA 3GBML 5IHUH 2GAZB 1JN6A 1OL0A 4P3WA 4NRZA 1I1RA 3MJ9H 1FYTE 1NBZA 2EE6A 1UWXH 5CP7A 5AUMB 3TV3L 4Z76A 5J1TC 3SDAD 4X7SL 4MA8L 3H9HA 4HIEB 3FCTA 5JW5A 5JOFB 4W4NA 3O3UN 2ORBL 3T0ED 4XI5D 4CKVX 2NY5H 2D3VA 2BERA 5F7YC 2JJWA 5F9OH 1ZHKB 1JPSH 1T83A 1CXFA 3FB7A 3QXWA 5FOJA 2FBOJ 4G8FA 4BFGA 1Z3GL 1OGAE 4J8RA 1Q9OA 4WFHD 3MGOA 4WU5A 5A2KH 1QNZH 4YLQT 3DRTB 1WZ1L 1Q72H 4KZEL 5MP6L 4G9FE 3E6HA 2YPVL 2QSVA 1DEEB 3BVNA 3O4LD 1I3RA 1JHLL 4Y5VC 4LARL 4G80A 2PW2A 4ZYKB 4FQIH 1OAQH 4GW1B 1CU4L 4AT6B 4PRHE 1E27A 4EQ2A 4MQ7A 1A4JA 1FNGB 1GRWA 1W0WB 3VFGH 2OL3B 4M1CD 4XRCB 3U4EA 4PJCE 1UENA 3QEUA 1NLDH 4Q9QL 2BFVH 4F7MB 3VFMA 5TDOB 1X5ZA 2FB4L 3KLAB 4F37F 3ARVA 4ZUVA 4C55A 4OAWA 5TFSL 5CHNB 1DQDL 1LEGB 1KB9J 2Q86A 5HHPB 1IBGL 2H3NA 5KJRL 3KLAA 4YX2L 3DUUA 5DMIL 4D9LH 4A6YB 3OXSB 4GRWE 2DRUA 5SWZE 2IGFH 2ADIA 2EXYC 5MEPA 5GGUA 2ZOKB 3QT2A 1Q9LA 4E5XB 2NY5C 3SGDH 2VDPL 5EORH 3I3BA 4YHML 5LGKA 4KZEH 1NFDE 2BVPA 5CJ5A 4G3YH 2XWTB 1IC7L 4QYOB 4DKDC 1EAPA 3VG0L 2ERJC 2C7UB 4R4FL 3G5VB 4ZDHB 3OJDA 1MVUB 1XIWD 2NW3A 1TTFA 1T2QL 2WMPA 4PRPD 5CJ8A 3JSSA 3M1BB 3QCTH 4LK4A 4JKPL 1FGVL 1M7XA 2VDQH 4DUVA 5F7NC 3MGOB 3H9SD 1SY6H 2BRRL 4EI6A 1GZPB 1CLZH 1KCVL 5I76A 5GS0C 1NEUA 4KK8D 3DNKA 1NMAL 2Y06H 4LSVH 3SGJC 2X4OB 4WHYG 3B8SA 2VDOL 5IVOA 3LS4H 4YXLL 1FC2D 2VXUL 1IQWH 5HYJA 1CQYA 2YD3A 1CGTA 1ZA6B 4XGZB 1B0RB 5HDQL 1F6AB 5I6XB 2R1XA 3FCTB 3NN8A 3FQXB 4OF3A 5D70H 4NQSA 3VFOA 1T1ZB 1HQ4B 2OL3H 2BVYA 1NBZB 4HUWB 4K7PH 4UDUA 3RIFF 3HG1A 3V79C 2DKMA 2VIRB 4YPGB 1EBAA 2DIBA 3FO1A 4ZYKA 1MRFL 4NN5C 5IMOA 3UZVB 1JP5A 4K3EL 4HLZG 1JF6A 1X5AA 3S7GA 3QDHA 5IM7B 1FQ9C 5JDSA 3K2UH 3TN0A 4KHTH 2FD6L 5EZOH 3IFOA 1ND0A 5EB9A 1JRHH 2HT3C 5E99L 5TE7H 2YRZA 2AK4E 3DX6A 5E1HB 2IC2A 4JREB 4FG6C 1WCQA 1CLYH 4P23C 1INEL 3QUKB 5IVXA 4EBQL 3PL6D 3MV9A 3STLB 2NCMA 4I3GA 3S88H 4BH7A 3GMPB 4OCWL 2NX5B 1K4DA 2O5ZL 4K3HA 5ACZA 4JFHD 1I9RL 3MRMB 4CL7A 2ZJSL 4BQ6A 1NFDB 4ZDHA 1RZIB 1CK0L 3JXAA 1S7WB 5I18L 1ZGLP 1MFBL 2H32A 3BEVA 5L2JB 1MLBA 4ORZC 1C16B 3DVNA 1INDL 4OZHF 1XR8B 2HTLD 2JIXA 3MV8E 4NQVA 5DJAA 5ID1A 3HMWH 5J13B 2NXYD 2YXMA 3TIEA 5B8CB 3D3VB 3P11L 3PNWB 4LCYB 5EU6E 2AJYH 1KIUA 3DUUB 5JIKA 3W0WB 4LRNL 2P24B 2OL3L 2IH1A 2VZ3A 1IGYB 1K8IB 4Y19B 5IESH 3MC0A 4TYUA 3PP3H 2ZCKL 4QHNA 1VFAB 3L3OA 3V7AG 5FO9A 3T1WA 1VFBB 3RWIA 1MREL 2FX9H 5GJSL 4NO5A 2BOBB 1AD0B 5TE6H 5C0JB 3R1GH 3UTSD 4MJ6B 2RB8A 4PGZA 3ZT7A 3EUUA 1KBGH 3QIBB 3BGAA 3QAZB 5GIRB 5DHVA 5DSCB 3MRRB 4JDZA 5FO7B 1RUQH 5BZDB 2VDQL 3DSNA 4O9HL 1GOGA 3RL2B 3MXWH 4G80B 3UC0H 4Y4KC 5CZKA 4R9HA 2P45B 3WNNA 3OGCA 2WINB 4HUVA 4HWNA 3FQNB 1FYTB 5C0AD 5DO2D 4LNRB 3BZEB 1MI5A 4PJDA 2GFBA 4PJ9B 2XQBH 3PQYB 1RMFH 5EA0H 4HFUH 5IFJA 3BP6A 2FATH 2VDPH 5DS8A 1X3DA 4AEIL 1ZT4B 3VFTB 4YWGL 4P2OC 1BZQK 1G0YR 3V5DB 1A1MB 4NO0B 2X7LA 3TIDB 1MFDH 3TJEH 1YEDB 1GAFH 2PO6A 5D1QC 4BZ1H 3VXQB 4OIIL 1KCSL 2EH8H 3C5ZB 1BFOB 3PE9A 3GSQB 2Q8AL 1X4ZA 2KQMA 4Y4FD 1OAXH 1U6AL 1MHHA 5EUOE 3B3IB 4JZJA 3BN9C 4G8EB 2EYTA 4RGNE 5D7IF 4DVRH 5IEHB 1Q0YH 1T89C 3S37L 4MYWB 4X4ZA 2QLVB 3PHQB 1MCJA 4JZNB 3BKJH 3VFUB 4XNMA 3OR6B 2VB5A 1WCBA 1QFWL 2C1OA 1FL3B 3BZ4A 4N5UA 4Y2DC 3SKOB 1EMTH 5F89A 2F8VA 5JA9A 4PJAE 5D2NB 1U6AH 1OLZA 1EAPB 1JFQH 3T0EB 3NOIA 4PD4J 5MENB 5E2VL 5KZCB 3P9LB 5HHOA 1W8NA 5FYKU 4OZFB 3TGXA 4K3JL 2HN7A 6FABH 1PYWB 2DBLH 5HY9B 5KG9B 1U3JA 4TQEH 5DWUH 2P7TB 3LQAL 4ZD3L 4Q2ZA 5EA0L 3TBVB 3O0RL 5F71A 2OK0L 4Z78B 3U2SA 5D1XA 4LLUA 1GSMA 3FN0L 1N0LA 3OKNB 3KYAA 4CJ1A 1MLCB 4H20H 4JHBA 3G5YB 3W11C 3HR5B 4HMCA 1FFPA 1HOCA 4HZLB 4LASL 1LNUA 3TFKC 3UJTH 3P4MB 4XTRC 3EDJA 4OAWB 2F54E 5ESVA 5I2IA 1DBAL 3CU1A 2WW8A 3VMOA 1YN7B 1IL1A 4K9EC 4WV1A 5SWZA 1AIFB 1MY7A 3VXOA 1RK0B 4Y5YA 1KPVA 3RWGA 3UJTL 3QHTC 4QT5A 3R1GL 1CLCA 1YMMD 3IFNL 3TLRA 5F9WB 4HEME 2JB5H 3BKCL 2AJVL 2IANA 3MOAL 4HWBA 4NKDB 5J13C 3F65A 2K7PA 3GJEA 3IRPX 3P73A 12E8L 1QD0A 2C4FT 2Z93B 3HKFA 4KQ3L 4Z95L 3MLTA 2GJ6B 2IH3B 3P9LA 5E6IC 3U4AA 5HVFB 2WQRA 1JNNL 25C8H 4OLZL 3ZL4L 2FATL 2W9DL 1EFXD 2WWMD 5DD1L 3HI6L 5DJ2A 4JFPB 4IMKC 1JTOA 2IAND 3MRFB 4Z7WA 1JK8B 1QFUL 4HKJA 1GGIL 2ICWA 4MHHG 2HG5B 3RGVA 4NZJA 4ZQKB 3N1FC 4Z0XA 5D7JC 2PW1B 4HBQA 4U6HB 1I9RH 5D2NE 1Q0XL 1SEBB 3LY6A 5TGBA 3RGVB 4D3CH 4JG1H 1KNOB 4GQ9L 4DKAA 1KPRB 1ONQB 4XVJL 2GY7B 1JGEB 1R3KA 2EH7H 4OZIA 1GAFL 3RPIA 1MUJB 1U95A 4HGWA 4XMLL 1G7JA 1KYOJ 5I71B 1CGVA 2Z0BA 5JIIA 2BC4B 1OQOA 5DRNA 4JHZA 2IBBA 1T66D 3FONB 5T5NG 3F7VA 4U2YA 3O4OB 4KHTL 3V6BR 2ATPB 1MFAH 1P4LA 1VKXA 3UZQA 1BOGB 3KJ4C 2VZVA 3CUPA 1OAUL 3MODH 4YO0A 1X5XA 4PRHD 3AY4A 4NFBA 3X14B 5E7BA 3QXAA 3T77A 4UQ3A 3L5JA 4LF3B 4WI9A 1I75A 2NLJB 3IRZA 5F70A 1KBGL 1P7KB 1PKQB 5EOQL 4HFWB 1IL1B 3TCLA 1YMHA 1HEZA 2R4RH 1QYGL 5DUMH 2AXFB 1BZ9B 5EU6B 3HNSL 2YRPA 1U0QA 2G9HA 2AGJH 5IWLA 1VACA 5AG9A 4G6AC 5CJXA 5DURB 1BD2B 5C0GB 2G5RA 4S1SH 5F7HA 1AD9B 5IVZA 2DWDA 2G2RA 3QEGL 4GRWF 3G5XB 1MI5E 2ARWA 1NGXA 4Z0BL 2EDHA 3D3VA 3QCTL 5B4MC 5B4MD 3MRKB 5TE7L 3VWJC 5B38A 1LILA 1PZUB 4P9HH 3BI9X 4NZUL 4PGEB 1UH3A 4M61B 5AWNH 2VTFA 1X5KA 1XGQB 2AS5M 3H0TB 5EZIH 3ULUE 3H9ZA 5C6WH 3GJFH 2J8UB 4UINL 3IF1A 4X7EC 4WENB 5EG6C 5DUPH 3TO4C 4U0RC 4KK9C 4M5YH 3D3VD 2GW5A 5D7KD 1QTYT 4JZNA 1IQDA 2VN4A 3CVIL 5IIEA 4JDVB 4WUUE 4QHUA 4F33A 3KLDA 4KTDH 4FQJH 1CWVA 1A7QL 5HGHA 2F53B 3VA6A 1FNLA 1XZ0B 4WFED 5IK3A 4F9LC 1ACYH 2F5AL 4AM0A 1MCOL 2ADFL 3D0VA 4P23A 4IOIB 5T3ZD 1FL6A 5DD0L 2FD6H 1U8OA 1G6RL 3ZMRA 5LJYH 2X4QB 4JR9L 4GJTB 1KPUB 2E7HA 3WKML 5FA3B 5FYLE 4JO1H 1KB5A 1Q9KB 2NY6D 4WI5A 3WLBB 3NACH 2AJZA 3K1DA 4DW2L 2N7BA 5IB4A 3L3KB 2VR5A 4WWKC 5CKAA 5C09D 1ZHNA 4HHAB 2G9HB 3BYTA 4F2MB 4XPTH 2PNDA 1H3UA 1FZJA 2IQAB 1U92B 3MV11 5C8JB 1WTLA 4FQXC 4YNYB 4TVPD 5D7JD 1CFNB 4LPCA 5IFHH 1MHEA 1ZHNB 3FAWA 1F4HA 2HFFA 3LRSB 1CTOA 1FNFA 1IAIL 2C5DC 1T3FB 5FO9B 4X9BA 1EXUA 1FJ1A 4KUZL 2CO7B 3LMJL 3TVMC 1HHKA 4PGDB 5MEOA 4IDLA 4L3EA 4X7SH 4JM4H 1NANI 1FGVH 3HRZB 1U3HA 3VRJB 5BOZG 4RZCA 1XIWA 1T2QH 4ZUTB 1REIA 3GJFB 3ZSTA 3SE8H 3PJSB 2HFTA 1QKZL 2FIKB 1PLGL 4XVSL 1G7LB 1VFOA 3W39B 4JRYA 3ZKXC 3T09A 3E2HB 5I75C 4ZD3H 5DWUL 2OK0H 5IP4A 2PCPA 1KC5L 1O7SA 3MNZA 3MRPA 3KR3H 3IJHB 1CL7H 1MCKA 3ILPB 3DXAD 3PL6A 1B88A 1IAKA 1KJMB 3N85L 3D85B 2H6PB 1JHLH 4PBXA 1JPTL 4NQUA 1IGMH 1A3LH 3LN5A 4U6HA 1FBIH 5C0IB 1A9BB 4GOSA 4XVTL 2IADA 1KFAL 1BEYL 4JKKA 3ZTNH 3HC4L 1F8TH 1T0MA 2MKLC 1ERNA 1AKJA 1YQVH 2CD0A 2FEDD 4LIQE 5D72H 1K8DA 2XY1A 4J3TA 4ZO6A 3SDYH 4JJHA 4LSRL 5EWIH 1DQQA 4Y4HB 4ELMA 1CBVL 2Q8AH 4MNGB 3ARWA 3MLSH 1KEMH 3TNNB 1EEQA 1CG9A 1IGFL 1NAMA 4MA3B 5C9JB 3C2AL 5F6IC 1QUNA 3F6IA 5E2TL 3IETB 1JRHI 4LSTH 2EZ0C 3GMMA 4FTVA 4ODSH 4RGOL 4HK3N 1JWUA 2B4CH 4I3RH 4R4NC 2VMFA 2XA8H 4LRIA 5FHBL 2VKWA 2V2TA 1K6QL 1S3KH 4KRPB 3V6FB 1RHFA 3MLZH 1PKQA 2XI9A 4BSVA 1CL7I 4JZOB 4NKIH 1T03H 4QRTA 1RK0A 4Y5YB 5KSAD 2VH5L 3D6GA 2MCPH 3GJFA 3ARBC 4UNUA 2K3TA 3OWEA 4JFEA 4ZO9A 2OR9H 5KANG 2FEEI 5HHMD 2RBLA 1VKXB 2IANB 2XZAL 4PJFF 3D2UA 3S6CA 3N0PB 1DQQB 1U58A 4JN1H 2BP3A 3VFSB 4XXDA 3QO1A 1MWAA 1K8DB 5F96L 3PWUB 3O3AB 1VSCA 4PRHA 3TT3H 3LRSA 4Q2ZB 3FJTA 3QUZD 4B53A 5BMFH 2PXYC 4XP1L 4ERSL 2R56H 1E0OB 1A7RH 5JMOC 4UNTA 1N5AA 4AK1A 2PO6D 2W0FB 5IB3B 2Q3AA 1MHPL 3U0TB 2CUMA 5JMRA 2WIIB 2XTJE 3EOBA 1PZ5B 2DQEH 3QWOB 4MNQB 1YN6B 4KQ4L 3V52H 1ZLVK 4CNIA 4FQ2L 5DJXB 4YHYC 1YPZE 3WN5B 3F7RA 2AQ1A 4GKSA 2D7PA 3CFEA 1MFNA 3BP4B 4JY6A 4QTIH 5LAXA 3BPCA 3EYFB 1VGEL 2MHAA 4I77H 4X6FA 4I13B 4I3SH 2D31A 4OD2B 3LKNB 1MJUH 5LGHH 1AP2A 3VE0B 1NEZB 5K9JH 4O2EA 5E5UB 5LCVL 2B39A 3RY6A 5TDPB 4OBRA 3TIDA 5E5MB 5AAMA 3BSZH 1FGNH 2VLRE 2R39A 5KAQF 2Z35B 2Z31C 3QQ4A 5EZLA 5IBUB 3LS5L 5FCSH 1LWRA 4Y2DD 2CLRB 1FSKB 4FFZL 1A9BA 2EYTB 2QADC 1EXUB 1FJ1B 5KS9F 2UY7A 2MWCA 1LQSR 1AFVL 2F58H 1ZLWK 5B39B 1KJVB 1L6XA 1AC0A 1RQ5A 2D7QA 3E6HB 2P5WB 2VYRE 3H42L 5C8JA 2F19H 3SDDA 5TH2A 3CSYB 3C6SB 1JNHA 3LEVL 4ONGL 2DDQH 4O2CB 3ZDZE 3NA9H 5JPMB 1V7NH 2XICA 2Z8SA 3KJ4B 4DK3A 1V7ML 4AJ0A 2CDFA 4KK5D 4EJ1C 4Q58C 2F19L 4Y7MA 1P1ZA 1NC2A 2ZG1A 4LCCB 3UTOA 4HCRH 3LQZA 5ANMB 2P46B 1AGBA 1S9WA 3GRWA 3QBTB 1DUYA 1WIPA 5DVLA 5I8CA 4R3SA 1IT9H 4X6CF 1YNLH 3BKYH 4P2RD 4WI2A 1CFVH 4G5ZL 4LIQL 5D7JA 1E4WH 5E95B 1IAMA 3ZKMC 3HI5H 4D8PB 2LU3A 2XKNB 4Q9RH 2CPCA 5LCVH 1CQKA 4KRMB 1N3NA 3S35H 4DGYL 3QXDA 1QR4A 1IAOA 4WFFE 5CMAA 2DWEB 3T2NH 3D9AL 4PGBB 2Q7NA 3NZ8B 4ZSOB 5F3HB 4IDJH 3ARED 4H25A 1ZTXL 4XWGL 3BPNB 2OMBA 4JO4L 3RUGF 4XHQA 4LCUA 4L8SB 2FWOA 3QZWG 4I4WB 2VDMH 4KDTC 4ORGB 3UTSE 5DMIH 3P9MA 1P84J 3QEQE 2Z31B 3DOSA 4D2NA 4HT1H 3BESR 5I73B 5CBAB 4JFXA 3ULUF 2YEZB 3T4YB 4TRPL 4UUJA 4I0PA 5BS0A 2CKBL 4FTVD 5HGBB 4Y88A 2E8YA 5GGQL 1JZ5A 3B9KA 1L0YA 3SKJL 2ZUUA 1LD9A 2FB4H 2P8MB 2P5WD 1ETZB 1Y18A 1I3UA 4P4KB 3M17B 1NGZB 5FO8B 1I7ZA 4UDUB 2I27N 4DN3L 3DV6A 4R8WL 1Q94B 2JELL 4K23H 3QDGB 3C6SA 4JAMA 2YR3A 1CDJA 2VABA 1R5WA 2ZCLL 3TWCL 2PUQT 4LF3A 3EJYC 1EH9A