4MZRA

Crystal structure of a polypeptide p53 mutant bound to dna
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
234
structure length
234
Chain Sequence
b'SSSVPSQKTYQGSYGFRLGFLHSGTAKFGTCTYSPALNKMFVQLAKTVPVQLYVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSSDSDGLAPPQHLIRVEGNLRAEYLDDPNTFRHSVVVPYEPPEVGSDYTTIYFKFMCNSSCMGGMNRRPILVIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRKKTMDGEYFTLQIRGRERFEQFRERNEALELKDAQAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
molecule tags Transcription/dna
source organism Homo sapiens
publication title Reversal of the DNA-Binding-Induced Loop L1 Conformational Switch in an Engineered Human p53 Protein.
pubmed doi rcsb
total genus 49
structure length 234
sequence length 234
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4mzrA00
1GZHA 2BINA 4IBWA 3WTUA 4AGOA 1CMOA 3D06A 5AB9A 3IGKA 3US0A 1T4WA 4G82A 5ABAA 3WTVA 2WGXA 4L18A 2P52A 3ZMEA 2MEJB 5AOIA 3KZ8A 2XWRA 4AGQA 5AOMA 4IBTA 2J6WA 1HJBC 2VUKA 2PCXA 4L0ZA 4AGMA 1YCSA 2ATAA 3D09A 2J21A 3D05A 2J1XA 4QO1B 3US1A 1TUPA 3VD2A 4LOFA 4GUQA 4HJEA 3WU1A 2GEQA 3KMDA 5LGYA 5BUAA 3WTSA 4AGNA 2J20A 2J1YA 2BIOA 1TSRA 3EXLA 4IBUA 3TS8A 4MZIA 2IOIA 2BIQA 1HJCA 2AHIA 4AGPA 5AOKA 1EANA 2BIPA 5G4MA 3Q06A 2ADYA 3QYMA 2BIMA 3Q01A 1LJMA 2FEJA 4XR8C 5AOLA 3QYNA 2IOOA 2OCJA 3Q05A 2RMNA 5AOJA 4IBZA 2J1WA 3WTWA 2XWCA 4L0YA 4AGLA 3VD0A 1H9DA 1KZYA 3WTXA 2IOMA 1E50A 2X0WA 4LO9A 3VD1A 4IBYA 4IBVA 3D07A 3EXJA 5G4NA 2YBGA 5A7BA 2X0UA 2J1ZA 1GZHC 5LAPA 3WTTA 1EAQA 4G83A 5KBDA 4GUOA 4A63A 1EAOA 1HU8A 2H1LM 4KVPA 5G4OA 1IO4C 3WTYA 5ECGA 4IBSA 3IGLA 2AC0A 1CO1A 2X0VA 1UOLA 4IJTA 3D0AA 4IBQA 4LOEA 4MZRA 3D08A
chains in the Genus database with same CATH superfamily
5IW1A 4NP4H 5EO0B 1I7RA 3KLQA 3QARA 4FLSA 3BWAB 2GCYA 1T83A 4F5CE 3DO4A 4J8RB 4JMNA 2ZOUA 3K2KA 4Y1AB 2P5EA 2WINB 2DV6A 3QO0B 1L6PA 1U8KB 4RMVA 2V5RA 4RFEB 3ARFB 3ZKXB 1CLVA 1TEYA 2GITB 1WRFA 3LN4B 3QWNA 1WBXA 1CG9A 4CMHB 1NM9A 3BP7A 1RURH 4K9EL 4P99A 4PQXA 3C09C 3D39D 4CSTA 4Q9QH 4HKJB 4XPBH 2DWSA 1FVCB 2V2WA 4W9GC 7FABL 3S35X 3F8UB 3SPVB 5FWQA 4ZO7A 3K6DA 3M8OL 5K69A 4H26B 2WLYA 1HKLH 1FNFA 3I85A 4NEHB 2CSPA 2OI9B 4L8CB 3CHSA 1ZLEA 2D3LA 4LLAA 4P5RA 4I5BA 1RZIA 4KV5F 4PPTA 1EFXB 4KXZH 2HT3D 3ZKNC 2YIHA 1XMWA 3MV9A 4C57C 2FHBA 1PG7W 2AF2A 5B3JF 2EXSA 5F3HB 2K6YA 4WUUE 2DM4A 3IFPB 4BE6A 3U0WL 3F7KA 2QT6A 1BEYL 4QPEA 3MUZ1 2DM7A 3V6OE 3FQWB 1IU1A 3DX6B 4LVOB 4XPGL 3RGVA 3HG3A 3KHOA 3Q6FB 4HFUH 5DWUH 3BRFA 4LL1A 2ZKXA 5AOJA 5FYKE 4XVOA 4BWTA 1M05B 2B1AH 1GJIA 2FAUA 3D9AL 3RRQA 3LPFA 1I8MA 1DJWA 3MUGB 2IGLA 4PS7A 1DFBL 1IIIA 2H5UA 1SXCA 4YL4A 1EZUA 2XXGA 4BFGA 1IARB 1AIZA 3AAZA 4HETA 3WFZA 5IHBA 3WUZA 4CVZB 3LTVA 3WMSA 1OAZH 1YEHL 4G8GE 1KC5H 4L1LA 4WWKA 3S37L 5KWYC 4PWGA 1IGIH 1IAKB 1ZHKA 4OD3H 5D7EA 2CIKB 1SXZA 2AXFB 2XOTA 2PXYC 5GSVB 1ZWIB 3BIAX 5D5MA 3QCTH 1Q9LB 4WWKD 5MERB 4JHBA 3EF4A 3LN5B 2IH3A 5EU3B 2Z65C 4YXKH 4WFHE 5EUOB 1N59A 2BNQD 1PG7H 4IMKA 32C2A 1T5WB 3RUGE 1Z5YD 4QRPB 2H8PA 3GJEA 2CNZA 4PAZA 4U1GC 5DJCB 1YEFL 5KOVC 5HGHB 2UY6B 4ALAL 3QA3B 5DZAA 2MTPA 1M05A 3NJIA 4AVHA 1II4E 1JDCA 2DEYX 1OCRB 2GTZB 4WEEA 3MLXH 1CB4A 2NNAA 3GM0A 2BNUA 2JF1A 2RH0A 3PWUB 3V7AG 2YPKB 1A7OL 5KJRL 4E9VA 1GZPA 1SF3A 3SGEH 3BDYL 2VO5A 3FOLB 4XOEA 2YGQA 1KGXA 4X6FA 3MJWA 3FU9A 1VRSA 3HA0A 1ZLVK 2ZTBA 1D7DA 4WI5A 3L3IA 3WS3B 4PJ9C 3DMMC 3FHAA 2VDRB 1WA1X 4ISVA 4LCUB 5IQ9B 4CVXA 2YAHA 4L4VB 3TO4B 3ECUA 4W81A 3DX4A 3Q2VA 5I1CL 5BUAA 1T3FA 1GS8A 2V3FA 3AQDA 5FFLA 4PGDA 1XTLA 4LQFL 3CFDA 5C0RL 1J8SA 2J20A 1QNZL 4FQHB 3CPUA 2YOAA 3B9KD 2HKHL 2O6CA 5GZND 3SD5A 2DJUA 3RVXD 5KYXB 3ZSSA 4UV4L 1BBJA 3V6FB 3BZDA 4C4BA 5D7SH 5KYNA 4UT7H 2PCPA 1TJGH 1RXLA 4LHUB 2AQQA 3HUJE 1B3JA 2FL5A 4I0PC 3RJOA 3B7TA 4ZS6D 2AAAA 2CRMA 1GSMA 2VT0A 4YIQB 5MEPB 3C8KA 2XNAB 3O2DH 4M3HA 3EYFA 3U2JA 3K8LA 2GBAA 4N8CL 5F3HA 3N5AA 3T5WA 5FCUL 4G8GA 3NA9H 4J3OD 3CLWA 3OKEB 5EO0A 5IQMA 5EOCJ 3UTTA 3C6LB 4MA3A 1C9SA 5D7JD 3SKNA 1OPOA 4JEGB 3MLWL 1BVLB 1QHOA 1YNTA 4QHKI 4XOBA 3VXSE 4DVBA 4IU2A 2OP4L 4TPRL 1WS8A 1U2HA 3DNKA 4FFWD 1RV6X 2WJ7A 1SY6L 1UWEH 4RNRB 3DHUA 3QCVH 3BWUF 2Z1KA 4FQXD 3RJDA 3HVNA 1IGIL 2BFVH 3K6FA 1DL7L 1G6RL 5I1AA 5GRUL 4S0HA 2VWEE 3TBWB 4LBAA 3DOSA 1HHIB 1Y07A 2IQ9L 4YFLI 1GMEA 2IC2A 3IJEA 4KK5D 4OZGE 4WWPA 1OK0A 5I8EA 4ZW5A 4FXLA 1X5GA 2OR9L 3HB3D 1X3DA 1FLRH 4IGBD 4U1MB 5DHMC 5JZ7D 4X6EA 1Q0XH 1KCVL 2E8YA 1BF8A 3E2HB 3S37X 1I1AD 1SFDA 2YD6A 1JNLH 2X4PB 3FK3A 4QGTA 2A9CA 2BH0A 3MFFA 1MJJB 4WNQA 3F7RA 3OD3A 2XC8A 3BE1L 1LE5B 1WICA 3UTPD 4J4PA 3JTBA 4WUUD 1F3DH 2HLAA 3IS0X 2Z91A 4YBLB 4KY2A 3MFFB 4WHYH 5AOMA 3ZN6A 3SQOH 2R2HA 4RBPH 2XQBL 2VW7A 4OFQA 1ZV5A 5CFAA 1E5AA 1V10A 5SX4I 2ZXWB 2AQRA 2J25A 4S11A 3VE0B 1AXIB 2IWKA 2HUHA 4OZFH 1X7SA 3IFOA 5TF1L 4F2MB 5LBVA 3MRBA 5E2UL 5D8JH 3WY1A 5B1AB 3IGFA 3GLDA 1A6VL 1KY7A 3FFDB 3H1ZA 1T2QL 1BFVL 4JM2A 2VR6A 3HRZA 4ZUTA 2PW2B 3D2UA 5K1VA 3UJJH 4B50A 3NACH 4MXVF 2CK0L 4HPYH 1MAMH 2PKDA 1Z3GL 2R56H 3IXTA 5EF0A 3TV3L 5CGMA 5IBLC 2Y2TA 4EVNA 5A40E 5HYQB 5JDJA 3IFNL 3WFHA 2O6DA 2MH4A 1SZNA 1NCAL 5IB1B 1G7HB 3H3PH 3FQ4A 3ZDYE 5JW5A 3OAWA 2EDEA 3F01A 1NFDB 5DMYA 4POZD 3FUIA 4AXWA 2VAAA 2GSGA 4J3OH 1VB9A 2HVJB 5EBLB 2JLLA 3DGGB 3HPLA 1MVFA 4KKCC 2PPFA 2DI7A 3RBSA 1AGFA 3LB6D 3VFPB 4NKDA 5SWZB 2CRYA 5BJTA 5F9JA 1PYWB 4FNSA 2Y1ZA 3TBYA 4AKPA 4KROC 4FTDA 3AREB 1DVXA 4X7SH 1PZ2A 1CJYA 3MBWA 1V7NL 3RPKA 4K3DL 4Q6YA 1AZCA 1GAFL 2BK8A 4D94A 4YK4B 3RHWF 4LAJH 5I74B 2BSSB 5DJ0B 3G6JB 1BBJB 3C08H 4JO2L 5KYXA 4M00A 3QJZA 4G8FA 5B1BB 2OYLA 2BC4A 3EO1B 3BPNC 3ARGA 4LAQH 3JWDL 4JCMA 3QQ4A 5AZ2H 3JVGA 1R1CA 4Y1SA 1CDHA 1AD0A 3U36A 4GQZA 2CDGB 5SWQB 4ALAH 4TTGA 4LKXB 4P57A 2LFGA 4RAVB 3T77A 4I8DA 1CFQA 4ENED 2Z8RA 3PGCA 4LSPH 4I3SL 4W70A 4PRDB 3TC9A 3UCRA 4JFTA 5KVDE 5KVGL 1CO1A 1GY1A 4JRYE 4FI8A 1B6UA 1D5ZA 3OQRA 1XFPA 1Z5HA 1AACA 1PZAA 1UZGA 3EW3B 2H3KA 4NRXA 1P6FA 3E9UA 4Z3IA 1CLYH 3OMAB 4Y2DD 4NZUH 1CVRA 1NIEA 4JFQA 3EYUL 2ADGA 3F58L 1PCSA 5HDBE 5IVXF 3KYMA 3L95A 3FQNA 3SCMA 3TBSB 3QI9A 4HAKA 2NNAB 3BEWB 1NBYB 4TSAL 3NQIA 4NM8H 3TN0B 3VRLE 2ADJB 1DQTA 4PRBA 1FZOA 4YHYC 1IMHC 4PJFE 5MEQB 1I75A 2EEXA 4JQIL 4ADIA 4OLVH 2GKIA 4NO5A 4PJFB 5E08H 2UX6A 3HE7B 1EBPA 2XV6B 2E7LA 5H2BB 4HYTB 3AM8A 2DJSA 1B2WH 3OGCA 4WU7B 5LCVL 3S3PA 1K2DA 3ATAA 4MGXA 5DMIH 2V2TB 2FB4H 4I7ZC 4FJYA 5EBWB 3UCQA 4JFDB 5I1IH 3GMOA 1RP8A 2AXHA 5TDPA 3TLRA 2D7OA 1NDGA 5DD6A 1B90A 1KTBA 4JRYB 2ARWA 1DE4A 3QNFA 3DBXA 4IS6B 4HEPA 1BEYH 1ZHLA 3BYYA 3BKJL 2ODHA 1FI8C 1YY8A 3WJLA 3P3RA 3WY4A 5C0CD 4NIKB 1ORQA 2OMVB 1XR9B 2J5WA 2PPCA 3SE9H 3IDXH 4OZIB 3QZBA 1MCKA 1QSFE 1OVZA 1MN4A 3Q1SH 2B1AL 1AO7B 1A7PH 2PWGA 2WCSA 1LP9B 3ZE1F 1JGUH 1KCLA 4QRPD 2UXVA 4F37F 2FECL 1RZ8A 4DP6X 4R26L 1QW9A 1U2CA 2P44B 4FYRA 5AWNH 5IP4A 3R0MA 2ZSVA 4GRWB 3HG4A 5HI5C 1WJ3A 4N6QA 4K23H 4Z8FL 2EKJA 4KXAA 2DWEB 4E41A 3QG6B 3TJHD 3HI1B 3FCGA 5JOFA 3UTSD 5DJYA 5SX5H 2WGNB 1R33A 1XR9A 3IMTA 1EXHA 3LZRA 1N6VA 4HBQA 3EXJA 5EO1B 3HFML 3FONB 3JXAA 4J6RL 3UEQA 5IB4B 1T5KA 4K5OA 2HT2C 1X7QA 4KQ4H 1TVBA 2EH7H 5T1LA 2X40A 3TTSA 3E6FB 2ESVE 3N50A 3BGAA 1QQDB 3VWKD 2OMBA 4M6NL 1MJ7H 3X11A 4DPRA 3EFDH 4I18C 4F93B 4G6KH 5D1ZD 3K1DA 5D2LB 1NFDF 2WMPA 2X0VA 2OSXA 3IDYC 3VD7A 1QSZA 1IEAB 3MNVA 4I88A 3KCWA 2JXMB 1EK3A 3MGOB 1XSJA 2NY3C 3GMMB 3SPVA 3CDGA 3PV7A 1E27A 3KS0J 2WVTA 3QJXA 4MJ5B 4AX3A 1KCSH 2NR6A 4LARL 1I9EA 1LEGA 3BN9C 4PWIA 5H2BA 1MFBL 2ZG2A 1CF8L 1IGFL 1NAMB 4H4NA 2PR4L 2LU5A 3JT0A 1RZQA 4HUKB 5CLYA 1H3PL 1LO2L 5F7DA 1FZMB 1X5YA 1ZXKA 3NJKA 5JIDA 3B3BA 4UDUB 4GRMA 4LLVB 2FBOJ 5JPNC 3RI5F 1SDDA 1YVLA 2XX0A 3HS0C 5KBNC 4XH2B 5DA4A 2VXVH 4MMYB 3V9CA 2OL3B 2XBTA 4K8RD 1CLZL 1TU2B 3MLVH 1FLRL 2GCYB 3R4RA 2A1WL 4N90D 4L4TE 4M4RA 2AEPL 4JRWA 1AIFA 3QZWA 4OLVL 1CFVL 3GM8A 1J1OL 3GSXB 2J6EA 4RFNB 1M2OA 5HJGA 1P2CA 2VNCA 5IMOB 4KBPA 4BV1A 3HZMB 4TV3A 4LOFA 1HOEA 2DYPA 1UT9A 1MJUL 1M9WA 2AXGA 3M8OH 4JJ5A 3QRFM 2HWZH 4YHOH 3AWGA 4FQXA 4LMQE 1DJYA 3U30B 4DGYL 3SDAA 2EDRA 3GFUA 2X2UA 3IPBA 1CFSB 1KUMA 2AEOA 3QE5A 1GGBH 5IJVA 1NAKH 4WTXA 1MJ8L 4M43L 1N7MH 4PRIB 5FYKU 3VFWA 2RA1A 2IMMA 3UTZA 4OGXH 5IVXB 3T0BA 3JVGC 1MHPL 5CEYA 5IFHH 1H9DA 4B9KC 3P30H 3PAYA 4YSUA 3OMIB 4PB0H 3QFJB 4ELKB 3GJFA 4LO9A 2W65A 5E5LA 2LU7A 3ZHFA 4UMSA 2BZCA 3MHZA 5ANHA 3E9TA 1PMYA 1HN1A 1FN4B 1K4DB 2O5NA 3PU7A 4B9YA 1S7SB 5GGSA 1QFWL 2YD9A 4D2NA 2BY3A 2C9XA 4ELKA 3RDTD 1KPUA 1KLFA 5AVWB 3KGUA 4FLQA 1T0OA 3IVKB 1HHGB 1H8NA 4OAWB 1CGYA 2G9KA 1FAKT 4BH7B 1EAQA 3EYQC 4GUOA 3CG8A 3I2CL 1XF3B 1WCBB 1P1ZB 2G5RA 2F54D 4KQ4L 4LLWA 4LE8A 4G1EA 1OGAD 1AH1A 3HS0B 3OKKB 2GT9B 1R17A 3F7QA 2IH1B 4Y4KB 4HS8H 1YYLL 1CK0H 3KR3L 5I5JA 5BPPA 3ZTJH 3SDYL 5DHYB 5E08L 1ID5I 3T0DA 1BMZA 5D7IA 3ULVL 2B8OT 1NA8A 4Y4HC 5IROD 2JI3A 2EJ1A 1YAIA 4E9XA 4PFEA 2AXGB 2G2RB 2EDLA 4FQ1L 2V9RA 4ABQA 1OGTB 3RPIB 2GFBB 4DEWA 1VGEL 1YMMD 1T4WA 4V2BA 3NTCL 3DTDA 4HJ0C 1XAKA 2Z92A 2I24N 2IDCA 3SOTA 3AS1A 4LMQI 1LHZA 1AQMA 1A4JB 1MFEH 5KTEL 1E9QA 2K70A 3ZE1B 1IZJA 3QHFH 2Z7ZA 3IDUA 4V1DD 1AIFB 3QZWB 5D6DC 1PD6A 4N8VA 4ZMZA 2AJXL 3ZU8A 1A9VA 3ASOB 1SBBA 4KY1L 4OZ4A 4APQB 4K0OA 4P46A 1JI1A 3DUHA 2CCLA 5D2NC 2GBTA 5ICUA 1OM3L 5FDYA 3ARFC 1DLHB 1JPFA 4Z3JA 2WWMD 1GGUA 2SEBB 2FHFA 4Y9BA 1LO5B 2KZWA 2D3NA 3CQQA 2FUQA 3ROLB 3IM1A 3MQIA 1E4JA 1JGEB 1KGJA 2XG5A 1E27B 2WZAA 1HHKA 4RGNB 4U33A 3JV6B 1TQCB 5ID0B 3MLPA 3QG7L 5GGUA 1SLUA 5FECA 4YX2L 1YN7A 3FO1B 4G9DB 3HNVH 5FKPA 3WEBA 4L9LA 3HZ3A 4AE0A 2YAOA 3QEHB 1JZGA 4N0YL 4UQ3B 3GKWL 4UDTB 2NY4B 3X11B 2H1PL 3FFCD 3VTMA 2CUIA 2WWKO 5AW0B 4Y2DB 3WTWA 1JZ7A 3TEZA 3ARBC 4K07A 4KZEL 5IB3A 1XXFC 2C5DC 2DN7A 3C8KB 4RDQG 1ETB1 3WE6B 1JS4A 4Y9FA 4QF1B 4EZLA 4X7TA 5EOQH 3CE1A 3WEAA 1OAQH 3BKJH 3GHBH 4QJ4B 3TX4A 1GR7A 5MHSD 5C08B 1WZ1H 2B59B 4EUPB 1EFQA 5B38B 1LEIB 1AS8A 2BOCA 4DCQB 2NRDA 4IIQB 4QRRB 4UOJA 1G9NC 1CYXA 5E9AA 4LBEA 3OWEA 2FVNA 5DFWH 3B2VH 1FGNH 5KVEH 1DTUA 5AVUB 1VEPA 5B22A 2XCMC 2ZJSL 4LCCC 5DUML 2OR7A 4XPHH 5EU7C 1FO0A 5K39B 1YEWA 4CSSA 2A9ML 1UA6H 4Z7WE 4JHVA 3NJFA 4X42A 3MNMA 5F6IC 3OB0H 4Y16D 5GGVL 2HN7A 2AJZA 2DQUL 4YNYB 2BSTA 5GRUH 5GRXG 5DQ9B 4XXCC 1WUZA 3QIWB 3FT9A 3H6JA 3C5ZD 2EXWC 2OAAA 2R0KH 4DUXA 2V5YA 2EE6A 2WXOA 3X3FH 3W5NA 3TWYA 2F53E 5TDPB 4JG1H 4N2FA 1S7QB 2WGXA 4TYUA 1YJDH 5FOBA 5JDSA 4H0GA 4HKBB 4AGQA 5J11C 1D9KB 2BMKB 5FO2A 1L3NA 1BQHB 3CLFL 4BK4A 1E4HA 3D39E 5D2NE 5CHNA 2XA8H 1A3ZA 1QR1A 4ABWA 1S7WB 5JPMB 3V0DA 2W0KA 3L5WB 4P49A 4UUJA 2R8SH 2ZG1A 3WJJC 3FN0H 4HQQH 5E51A 1E4XH 4MQTB 3ARYA 3OKLB 4MXQC 2CBPA 2W0FA 3BPNB 1FFPA 4FZEL 5CSBA 1I85C 4MXVE 1H0DB 3RNQB 3LRSA 3ZKSD 3CSFA 3CU7A 2IAAC 1JK8B 4AE1A 5MERA 1ZJAA 3WTSA 1VFBB 3A22A 1XH3B 3QJVB 3QUMH 1L9NA 1OAJA 4Y9GA 4AWJC 4BGLA 1Z2KA 2R83A 3AREC 4UQAA 4UM8A 2P5WA 3MLUH 3VTTA 3N42B 4YQXH 4D0DA 3AGVA 1IGTB 3WIIH 4R3SB 5DC0A 3QEGH 2QQKH 2VDKB 4AGPA 2P7TB 3CK0L 3D25B 1K8DB 2A73B 4LXFA 4BSVA 3EIFA 3MUHL 5JO5B 4RX4D 1BJ1J 4KNSA 4NKOB 1I4FB 3WCYA 3UG4A 1DANT 4Q8BA 3MUGA 3EBIA 5KYWA 1ULVA 2NR6D 1UD4A 2OSLA 3NJNA 5K5YA 3D18B 1N5AB 5L2JB 4GT7A 3EBAA 3OLGA 2Q6WB 1XD0A 2JB6B 3PABB 1QACA 1LILA 1MCWW 3PHQB 4MMXC 4NXKA 5HI3D 2Z0BA 2AGJH 3B2PA 3IN0A 3S2AA 3VH8A 1G1CA 4N2HA 1DCEA 4ODVL 2PWEA 2NXZB 2D03L 3ZIMA 1MFMA 3J8F7 3UYOD 4CW1B 3L4CA 1RIUL 2IXQB 1TZGL 3DK0A 4DP7X 5BZDB 1P4LB 4N2LA 2ZUWA 1I8UA 3HC3L 4Z18A 5EDSA 5HVWA 4FTVD 2JJUA 3GI9H 5JW3H 2DAVA 2IMNA 3L7EB 1TQBC 3D30A 4PLKC 3JWOL 3D4YA 3GMRA 4DP8X 2PXYD 4JFWA 4KQ0A 4ZO9A 1KENH 4U1JB 1AGEB 3GSNL 5F0PB 3SDXE 2N56A 5D6DA 4GH7B 3VXRA 3IGAB 2FZ3B 2E4TA 3FBKA 2B3RA 4LF3A 4G9FD 4R2GD 1BIHA 3GSVB 4Y5XB 5D2NA 1OL0A 2RCSL 4YXLL 1EUUA 4QR7A 5DLLA 4DZ8B 2AEIT 3OVUB 4AYFB 2E6JA 2FD6H 2A1WH 3L45A 3Q1EA 3F65A 4FFZA 3SDYH 1OTSD 2CO6B 1CGTA 4QCIA 3EO0B 3KYAA 3CLFH 3E80A 2XZCH 4KGJA 2BSEA 2JKSA 3QCTL 4RMQA 2NXYC 1MY7A 5F9WB 4IRSA 4XMTA 3KH3A 3RLSA 3P2DA 4DUWA 4X9YA 1NANH 5I76B 4RGOL 5IJVB 3GIZH 4GMTL 1MPAL 3BQUC 2CM6A 4Z95H 3N0PB 2X4PA 1P4BH 5FXCH 1T03H 4A7TA 4FD0A 2DM2A 4FN0A 4K71B 1RIVL 5F2FA 3SPIA 4Y5YB 1CYWA 3UYRH 1LP9F 4FQXB 1J8HB 3VXME 5KYWB 3WJJA 1RZJH 4PRPB 2HLEB 2ZOWA 5FYJU 3QUML 2XLLA 1UH2A 3CPLB 5FYJE 3TWCL 4JFEB 4JZJC 2MKLC 2TSBA 2V3DA 3ARUA 3HS9A 2CKBA 4Z3GA 1DL7H 3Q01A 3DOSB 1GOHA 4UAHA 3BUBA 5EZJB 4OLXH 2APFA 4R90H 3P4MA 4TVPH 5AAPA 3LEXB 1RPUA 2OV0A 3WHXA 1B3IA 5CKAA 5IIEB 3OX8A 3UZVB 3RZCB 1XH3A 1CD1A 2XIBA 4IU2B 3HZKA 4QKTA 4M1CC 4PJCF 4Q9RH 3ECQA 2OM5A 4CBPA 3P73A 4WJ5B 4A38A 3PDDA 4HDIB 1TZAA 1BZ8A 2X12A 3UZEC 5I1CH 3MKGA 3CVIL 5GS1A 1FC2D 4JR9H 4OJFL 1T6VN 4PMFA 5EUOF 1ZAGA 4NERA 1BQ5A 2OTUA 1EJFA 4B9GA 3CUPB 4J27A 2DQMA 3N1QC 1R5IA 2Z7WA 4IDJL 3QUXA 2ATPB 5DJZA 3PAZA 4AUUA 2WQXA 5CMAA 1E90A 3PIQA 5AW4B 3V8OA 3PF2A 3PGDA 2NX5D 3DI3B 5D70L 3MRCB 4J4PC 3DGDA 3DECA 5I1LA 1UOLA 2ICES 1P7QD 4W1TA 4YWGH 1IV8A 3K0YA 1UASA 4APXB 4QHMB 2IFGA 3TBCA 4U0QB 3T65B 1P5VA 4MNGB 2CO7B 4NQVA 2TRYA 3QIWA 4PGCB 5KBKA 5F7YC 1KIQA 4RGND 2OMWA 5E6UB 3GF8A 2VDQL 2PNDA 3FONA 3UL4A 2EAEA 5A6LA 3CIAA 4EOWH 2X87A 4ZO6A 5T3XE 1YDPB 3O6FD 1VHPA 3LX9A 1I85A 4LCUA 2WXLA 2ED8A 2BCKA 4YEFA 4L4TD 1Q4NX 3SBQA 4TM9A 5KSBB 3GMPB 4AG4H 3OLIA 2AJXH 3EZ8A 1LM8V 2GHWB 4K7PX 1HEHC 5K9KB 2EO1A 1DLFL 2YRBA 2EYSB 2KC0A 2BJML 2FD6L 2IANA 2JTDA 3FSAA 4FFVC 4IU3B 3NIDB 2Z31B 3CBJB 4NO3A 3QULA 1NC4B 2N01B 5A43C 5IQOA 4XNUH 3UJIH 3QJHB 3O45A 2WTRB 7PCYA 4Z0BH 2FUTA 4LSUH 1EXUA 4NO0D 5A2JH 4N2BA 4UV7L 5EPMA 3MJ7B 5KG9A 1AC6A 3EGDB 5EO9B 3PPEA 3AGWA 1FH5H 4X5XA 1Q38A 3OB8A 4HK3J 2P47B 1R24A 2OQJB 3AVEA 5DEFA 1NM4A 1KN4L 4PJDE 3UAJC 1RJYB 3OR7A 3WMQA 1ET8A 1OGPA 3RVVD 4DESA 1U58A 3QDMD 3GB7B 3L1FA 2E9JA 1FL5A 3HMXL 2W07B 3WIHA 2CALA 4WHDA 3GMOB 5IMKA 3QEHA 1JV2B 2JMRA 4ZZKA 2VE6B 4U2YA 5CCJA 3WY3A 3DVNB 3LAFA 3WFCH 2NY1C 2I7OA 3VFSA 4JG9A 1QKZL 4Z7UB 4QCIB 2P5ED 2VXSL 1ASOA 4LPCA 1ED3B 3EYQD 1ZHKB 2BOBA 2R1WB 1OTSC 2NNXA 1HTYA 1R24B 3H3KA 4KX7A 3FRPA 1GRWA 1E50A 2X0WA 4L23A 2ZKYA 3NRQA 2Z4QA 3B56A 5LGKA 4TVPD 4AITA 4XVJL 1EWHA 4XC3H 3WELA 4R8WL 1VGKA 5EZOL 3QJFA 3Q5OA 4Q6IA 4APQA 3CV5A 1YRKA 2BVPA 4M3KB 4XXCA 1AQHA 1G0DA 4N6RB 1J5OL 4G5ZH 4KNTA 1S46A 2WXQA 3JWOC 1OF2A 1B2WL 1KCKA 5ICZA 3KYKH 3HC0B 4XNAA 1PX4A 1R19A 3QQ3B 4P3CL 4KTDH 5GS1C 3SYCA 2Y6TE 4H44C 2CD0A 1BBDH 3ECVA 3MNZA 3BCFA 1FE8L 3QIBD 2E59A 1TZHB 1OZUA 4TUKH 4XPTL 4PJXA 2LTQB 2NDGA 3IBOA 1SYVB 4L3CB 2DQGL 1TZGH 4IGBA 4W4NA 4PWKA 5E1AB 2MQGA 1R5VB 1NAML 5T3ZE 3REWB 4KKAC 1IFHH 1YHPA 1KJVB 4LOUC 2DWXA 3ZDXF 1AGCB 5E2UH 5I18L 5JR1H 3U25A 1IBBA 5ID1B 3KZ8A 5FIEA 3MRCA 4WGKA 1E67A 2H2PD 2J6WA 4AQ1C 2ENQA 4IKJA 2W9EH 4UTCA 3VI4E 1RSYA 3PWPA 1ZTXH 4TVSa 3PQYB 3D85D 1JHLL 4AEHH 3GO1L 4O9HL 5ICYB 5C08E 1FBIH 3IVKA 3IT8D 4KTYA 1RK7A 3LDBC 4FJ6A 1IC7L 4M8QA 3QUHA 4U6XA 3VFNA 1S7SA 2GJ6E 5GGSB 3DGGA 1IFGA 1JNNH 2YEQA 3HLAB 4U7KA 1V27A 3TIDA 3GEFA 4UYQA 3OSVA 5J57B 2E46A 3NIGB 1KIUA 1A0QL 3HE6B 2BIQA 1W72A 3D12B 1IZKA 1OM9A 3UTQA 3SGEI 1N2RA 1XDTT 2ZCHL 3NA4A 4HLZH 4TSAH 4PJ5A 4NM8L 5KANI 4HWBA 1JPST 1LWRA 4M6NH 4PVNA 3MOBL 4DFHA 3DX8B 5CNHA 2W92A 4WAFA 4AH2A 4JR9L 4KXBA 4OJFH 1YECH 5I17B 4NDMA 5LDUA 4X4MA 4ZO8A 3RQ3A 4HWZA 5CZVL 2LAAA 3DX0A 2XYCA 1IJNA 1TENA 5CUSH 4AIXA 2VDNB 3ILDA 3TPUB 2PYED 3JWNC 2J4WH 4ZMXA 1WSST 4IBVA 2HJLA 3MRQB 1TQTA 3TT1H 5JHLH 2QZQA 4I3SH 5AYUL 1UG9A 5JQ6L 1DBML 2Y24A 4IRSB 5JUEL 5KSVA 2K1MA 4KZEH 4P23B 4PJ8A 3NPSC 1ETZB 3ZE1E 4JAMA 1OALA 2VLJD 1WV7T 4NPYB 1Q0EA 1R3LB 3LRLA 3TTYA 1TU2A 2VDMB 5F3FA 5IM7A 2YGVA 2AQSA 1A5FL 4LP4A 2OS7A 1HINH 4IRJC 2MCPL 2COQA 5L7XL 2ZOOA 3BUIA 1FP5A 4U7MA 4JM2D 3BVNB 1UACL 5HD8D 5I8CA 3G6AB 5I0YA 3QSKB 3ETBJ 3KPPA 1Q9WB 3PWLB 4M7JH 3LNIA 5DZOA 4MKTA 4APQC 3A6BL 3B2VL 1NJ9A 2CLVA 4KOCA 4FQQB 3M1BB 2YAMA 3NFPB 2YD0A 3DX8A 1QFWI 1P7QA 4B9JA 3GXFA 4B0MB 4EDWL 1ECYA 4HKZA 4LLMB 5IGXL 1HEZA 3C2AL 4KX8A 5L6YH 2KZBA 1MCQA 2O5YH 2XPZA 3S4SG 4Z7QE 5DZ9A 1T89C 1ZD6A 1FCCA 1A6AB 4FCHA 3KJ6L 3BYTA 4XMKL 1MG3C 4LEBA 3ZVVA 4HC1H 2GBUA 2HRGA 2LLLA 1BXXA 2WCPA 2FR4B 3UTPE 1KB5L 3P54A 3Q3GA 1FWXA 5TFSL 3KPNA 2AABL 4OLZH 1V5JA 4Y4FA 3ABLB 1JMZA 3CZNA 4L1TA 5ALBH 3ZZ1A 1SVZA 5D93B 3O2WL 3V6FA 4U6HA 1C08A 1NIFA 4K73A 2DZEA 1B9ZA 4YHZH 4PTUA 1E4XL 4M03A 3DKHA 4LCWE 4KRPC 3V0IA 5L2JA 4A1RA 5F96H 3BT0A 3LRMA 3QRLA 4Q2ZB 2BP5M 3ECBA 4A7QA 4PVLA 1Z9LA 2NZ9C 4ZAKC 3F04A 3BQUD 3WN5A 3ILPA 1BREA 4WV1A 3SZKC 1MAKA 3AS2A 2XZAL 3TT3H 3X1GA 3D25A 3NAAH 5GZNA 2Y7LA 3QPXH 3UTTD 3MUUA 3TBVB 2BSRA 4OD2A 1KJ3H 3MXWH 1F45A 2EEFA 4UM8B 1EHKB 2BOBB 3VD0A 1MCWM 2NW2B 3OHXC 5DJ8B 3G6JF 3QEGL 4MHHG 1DE4B 5EA0H 1V3KA 3QUXC 4Y2OB 4H1LB 4LIQE 4K5PA 4P9HH 1XGUA 5BZXA 5KAQG 4YHML 3S88L 3NZ8B 1CI3M 3E8UL 3BAEH 5K1JA 4R6UA 4ZBJA 3WNNA 4OGAD 3VGAC 1A6ZA 4X4ZA 5JYLA 2F58L 2YQBA 2DQGH 1NL0L 4E5XA 2P45B 1MIEH 5AYQA 1KFAL 2F08A 3LB6C 5EPMB 4EAEA 1ZXQA 4BH8A 3JZYA 2BFGA 3WKNA 1IBYA 3H7BB 1KFGA 3LSOB 1AHWB 4B0MM 4RWYL 1MDTA 2N0MA 3CNKA 4AEIH 5FKAA 4BA8A 4B7LA 5LNEA 1GYVA 3IU4H 3RVVC 4H8WC 1BOGA 1FL6A 4YDZA 4DAGL 4MB1A 2UZXA 4XOAA 5DGQA 5E9DE 2PXYA 3K2UL 2AJZB 4P46C 2IJ0C 4ICWA 3BLBA 3TBVA 4MDIB 1T0MB 5E24E 2MFNA 4L8DB 5HI3C 4BK5A 3QB7C 4TLSA 1QFWH 4YDVB 5H35B 3CN3A 4WV1B 4OFPA 4B60A 1BZ7B 1NMAH 3RWIA 1DLFH 2YMXL 2E7CA 2BVQB 3JQOB 1BZ9A 1GS7A 5DJ6A 2O5YL 3K6NA 4F7CB 3N85H 2K78A 2HG5B 2NY3B 4YSTA 1PSKH 1OP3K 4HG4K 5L4IA 2HPOA 2DYPD 3CXFA 3QO1A 2FX7H 3MRHB 1MCFA 5I15L 4TNEA 4U6HB 5EHFA 4NFDA 3BAJA 2GAZB 2YD5A 3CLEL 4ADJA 2EKSA 4MZ3A 3PGDB 3QDAA 4JZJB 6CGTA 4GRLB 4NNYB 2AXWA 4QKXB 2J5LC 2PTTB 3MOQA 3G6DL 4JL2A 1ZY9A 4ODXB 3HAEB 3GMPA 1DUZA 2VRQA 1K8IB 4AYMC 2C7UA 3NABH 4PV9A 1HE7A 5T3XH 4AM0Q 5A2FA 2F7PA 3CC5A 1KJ2L 4KVNH 5CD3A 5ITFA 4UQ2A 1TTUA 3BQVA 3LY6A 3MXVL 2VAAB 3QCVL 3QYMA 3DX1A 3I3EA 4BZ1A 5E5UB 1KT2B 3RB5A 4QTHB 2H6PA 1A1NA 2BY1A 2NQ3A 4MASA 3NSCA 3D50A 1WFNA 4G8GD 2AERT 3ARDD 4N87A 3K2IA 3PXJA 1NEPA 1T1YB 3VA2C 5JW4Q 1YY9C 2V8MA 2VQTA 1OPGL 4GBXA 4Y1AD 4I85A 1MHEA 4JKWA 3LMJH 1YEIL 1UWFA 5GRVL 1RAMA 3PWLA 5MI0C 2VH5H 3EADA 5EOTB 4EDXA 2D31B 1X5JA 2A6IA 2BSDA 3V0WL 3MBEC 2VXVL 5AD0B 2WBJB 3IN2A 2X70A 4F8OA 2NY5H 2V5TA 3TH3T 2D2CC 1TNNA 1RQ5A 3HE7D 4HW6A 3VWKA 5I1JH 1L7TH 2RHEA 3HZYA 3ZZLA 1NCCL 2B16A 3B9KA 2HJKA 3D69A 5AVYB 5IJKA 2QPSA 3UH8A 1JXKA 2QVTA 3FQRB 4EN2A 2Y1YA 3SE3A 4AVKA 1U6AL 3P73B 4WJ5A 2P24B 5E8DL 1A4JA 2WWOA 3EOAB 2ZKHL 1KN2H 3H55A 3B83A 1JD9A 2DKSA 1DZBA 3CDCA 5FO8A 1A3QA 5CZKA 5DD0L 5DFVC 3W9EB 4U05A 2ARJQ 1CS6A 2ZONA 4Z3HA 5CFHA 3B9KB 3D69B 4ZQKB 4F8LA 3S36X 3NZUA 4XWGH 2WOYA 5DJAA 4D8PA 1QBBA 5E99L 1DQLL 2X9ZA 4PJ5D 1VLXA 2OYPA 1T0PB 3GDBA 1U21A 1G7IB 1GW6A 2YUZA 1AO7D 4Y5XA 1B4TA 2XY2A 3DMMD 4C56D 4DP4X 4N2CA 3P2BA 3QIUC 3FTUA 4KDWA 3A4EA 4N9GA 4XHJC 4Y5YA 5HHPA 4HCFA 5AW6B 5JPMC 1ACYH 3OKOB 1IRAY 2E6QA 3BVTA 3PP4H 3NQKA 3H9YA 2NTSP 5GJTL 4HV8B 4U6VH 2O1AA 3VGEA 1F6LL 1KLFB 4QOKD 3L9YA 2DLGA 2OZNA 4DUVA 2A0LD 2OL3H 2CIIB 1KXHA 3IRZA 1DCLA 3ETSA 4NKMB 1U3HC 4XNQA 4IRSD 5F1NA 3ARSA 4I48A 1G43A 2NXZD 5DI8B 4HJEA 2P5PA 3S37H 1JNJA 3DLQR 4N0YH 5ERWB 2WVSA 1Y0LB 1VKXB 3EO0A 4ODXA 3S0PA 1GC1C 5FUZH 2J72A 2A99A 3ABMB 3IETA 4UBDC 3KJ6H 1OB0A 3OHXA 1SN2A 3DRTB 4WNJA 3TJPA 4BHUI 3VWKB 4O2CB 3MC0A 2IPUG 3TIEA 4JGNA 4UU9B 5ISZA 4BCZA 1INQB 2FL5B 2EIZA 4N2OA 1TQWA 4BSWA 1CXLA 2FQGA 5AOKA 1FRGL 2WYZA 2X9XA 3HRZC 1SPDA 4KKLD 1J9TA 1AGCA 4LRNH 1OAYL 2WXRA 3SQBB 2HX9A 3MRNA 2IG2H 5IQNA 3I3BA 1ZVHA 4Y19D 1AXTL 4HIIB 4ZOBA 2KL6A 1J12A 1O6SA 1QABA 2OMUB 3OAYH 4L8BB 4J2XA 4BXSV 1G9MC 3FFOA 3BMWA 1MIML 1S7RA 2R69H 3KBHE 1A9EA 1JGIA 4ETQA 4JJ5B 3V9FA 2TAAA 1O9ZA 5CEZE 4IBYA 3AZUA 2ADIA 3LXBA 5ES4B 3ISYA 3KWUA 2LVEA 3QISA 4Y9CA 43C9A 4M3JA 4P2QD 4DQOH 5J5EA 2EVHA 3MRFA 2BRRH 5A16B 3RIKA 4I89A 3L9EA 4XPHL 1ZLUK 4BFIB 5BZDA 5C0AA 2X4QA 5IFAL 3D48R 5CWSA 4AIEA 2WOBA 2XWJA 2AJYH 5BOPA 3IDIB 3PDOA 4B5ZA 1FVEA 3VQ2C 1J8KA 5E00A 1L9OA 3K2UH 5CZXC 4WSGA 1LWJA 1I9JL 2DEXX 4NQSB 5HGGS 3TL5A 1XF2A 3V5DB 4HD5A 4LL9A 1C5BH 2BNUB 2QQKL 1BVOA 3VH8B 3GI8H 2PABA 3GZOA 4BZ2A 1TIUA 3B9AA 4XNXH 4BK5C 1FZMA 4K9EH 3K7UA 2FJFB 1DEDA 3UAFA 1TQCC 3MCLH 2UY6A 4UTBA 4UT9H 4H20H 3VSTA 1KBKA 2P48B 4X6BA 2DQJL 4OV5A 4DP5X 4Z78A 3ES6A 4QRPA 1WWBX 3ME0B 4HS6B 4WO4A 5ITBH 4HUXA 3APNA 3FO9A 2HA1A 3MRKA 5IV2B 3DSNB 4UTBL 1SQ2N 4YLBA 3F5WA 4P5KB 4UT7L 3VB8A 2CHXA 1N3NA 4PJGA 5AW2B 2ZOKB 1JP5A 3KWWB 3X1EA 3DX7A 3LKQB 5LJYH 2A6DB 3H4HA 4XMKH 4H7VA 5FA3B 1GKEA 4I3RL 2QPFA 3PY9A 4L8SC 1NEZB 3C8HA 1OE1A 3QWOA 1XF5B 3W39A 1CFTB 1UD5A 1PLGL 1F58H 4G70B 1FG2A 1ODAA 2Y7QA 3MLRL 4HLJA 2OLDA 1I3GL 2HTKC 4FC3E 2Y1VA 4M5YH 4KKLC 5HHXH 5IESH 2IPKB 2Y6SC 3QJTB 4OGXL 3RL1A 2XWEA 4FA6A 1M7XA 3GMLA 2GTWA 3K6OA 4JDEA 1OQXA 2BRQA 4KUCD 4JFFB 2DWEA 2GQHA 4E41B 2E7LC 3QZWG 2OJZH 1Z9MA 3DK2A 5I23A 4KH9A 4RGNC 4IBUA 4ZTEA 4OGZA 2IANB 5CHNB 2OMYB 4M1GL 3X12B 3CSBA 4YMPA 2R0WL 2CBMA 4D0CA 5AKVA 4GW1B 1A4BA 5FX3A 5E8NA 3H85A 5HVHC 2VDOL 5CLZA 4BJLA 4JW3A 4ZD3H 2GJJA 5FYLH 3KWTA 3N44F 5EMYA 1ORSA 5C0BE 1M3IA 4ERSH 3NCJH 4GSDL 4PP2B 2GK2A 1ACZA 1SEBB 1OAYH 1U8LA 4L5FE 1WDAA 2ZUSA 4XHJD 2VM3A 4NBYB 4EZKA 3GJFK 1WO2A 3LIZH 2CO7A 2QQQA 1CK0L 3DYPA 1UD8A 4F7MB 1HEZB 1ML0A 3TN0D 1UEYA 3HN5A 4TLUA 5I1LB 3GWJA 3GI9L 2E56A 2RBLA 1G1OA 4X2UA 5C0FA 1FPTL 1T7VA 5E6YA 3PIQB 4FYTA 4U1KB 2ZAIA 4APQD 5I0WA 4ODTL 5EG6C 3T0VA 4DO6A 1J88A 2Z31D 1J1XL 1G7LB 3BAKA 1RCYA 4XP9H 4D0BB 4X4YA 5J6HB 3TWCH 2DRUA 2SEBA 4KK5C 4M8VA 3UYPA 4DO5A 1WT5C 2QLVB 2BVOB 3NBNA 1AHKA 1M6UA 25C8H 3PWJA 5J13C 2OXHB 4P46B 1JTTA 3OAUL 4WW2B 1JNHA 3U79A 5E8OB 4KJPD 4JRFA 4B53A 4WENB 3WS6A 2WSDA 4LSDA 5C2UB 3P4MB 4L1BA 2XRAH 4IKNA 4NQCE 4JM4H 3KLAB 1J5IA 1ZVSB 1KZQA 3B3IA 3NCBB 4NCC2 1RU9L 3MRQA 5H4YA 2PO6A 2KHAA 4S2SB 3CWGA 4Y0GA 1HJBC 1ZT7B 5CJQL 5INDB 1MY5A 4TXVB 4FFYA 4XP4H 5DA0B 2G5BB 3V4VA 3RFZA 3VXNA 3DJSA 4PM1A 3NK4A 2HRLA 1D5XA 3JYBA 3L4TA 2C34A 3FRUB 4NT6B 4BQBA 5EIIG 4EEEA 3V95A 1IEHA 2GT9A 1AGBA 4XNMB 3OKKA 4UYPA 1J1PH 4AYID 2BHUA 4LEOA 5D1XD 1A2YA 3BZFB 4DK3A 5I6XC 3L4ZA 1O6TA 3GTTA 5KBMA 4BH7A 2X05A 3WNJA 4BFJA 2MHAA 4MQ7B 3FO0L 3PWNB 5ESAA 5FGSA 4WFGE 1U8QA 5JIMA 2ZD0A 4Y4HD 5I9QB 1SHMA 1NC2A 2VISA 3GMNB 5JW3L 2H2SC 4LSPL 3E3QE 3FXIC 3O6FA 5E6SB 3QDMA 4BDVB 3MBEA 5CBAB 2ESVA 4QTIH 4UILL 2BDNL 1O75A 1MSPA 3D3VA 5IFAH 3UFIA 5IOPB 1KGIA 5HHOA 4WDIA 2Y2YA 3PL6B 4XX5A 5EU6D 2YD8A 2MHAB 2VLRA 3QRGL 4MQ7A 3ULVF 4TSBL 4AH2B 1P6AB 4S1DD 3HMWH 4U1IA 3KLDA 5AVXB 1KCRH 3BIKA 4MAUH 4CKVX 4NQQA 1L0QA 3I84A 5HVHB 4G7YH 3MKKA 1XTMA 4S10A 2DJ4A 3NESA 1UOKA 3FQYA 1IFHL 3B7YA 1A6UL 3GSWA 3KXFD 2XTJB 5C6TL 4F2MA 2IDFA 2EZ0D 1SJHB 2OK0L 5HHOB 1A6TA 1VF5C 4NRZB 3X3GH 4HFUL 4W9KC 3EJSA 1G1KA 2PO6D 1EVTC 2VM9A 3PHAA 4O2EB 3HIZA 2Q3XA 5E9DB 3MOAL 1QWNA 2WUBH 1XZWA 2YSTA 3WJMB 3F12B 2B7DT 2ITCA 1YAZA 5IQ7H 3IFLL 3QR0A 4RIRA 3GSXA 1D5RA 4O2FA 4M7KH 3SOBL 5EU5A 2PP7A 1KFAH 2EE3A 1P53A 2F7QA 5C7XH 3B7UX 3V0VB 4GP4B 5BV7H 5SX5K 4FQJH 1IBHA 1VCAA 4HUUB 4LEXH 4MMYA 3V5KB 4ZXBD 1DQQA 1TMCB 4NUQA 3IDXL 1U3HA 3SE8L 1BXVA 3VSVA 4DAGH 1U8IB 1BM3L 3F05A 2EDKA 3QG7H 5D1QC 1CGWA 2J8HA 3QQNA 1AFVL 3FUKA 5I1DB 1Y1DA 3FUMA 5E56A 1JE6A 4ENZA 4MS8C 3L9RB 2UY7A 4HS3B 1UOWA 3OJ2C 4XN9A 2NNCA 1I8IB 1W0VB 3UG5A 2X53A 4KPHL 1TYRA 5IB5B 1SDYA 4P4RB 2VE6A 1ROCA 1X9UA 1ZVSA 4BQ8A 3IAGC 3EDFA 5CSZA 4FNLH 1XGRA 4DP1X 3TA3D 1H0DA 5LCVA 2WKOF 1TFPA 4G8IA 5SWZE 1KXTB 1CUOA 2VQ4A 4PJAE 3PGFH 4NBXB 2JELH 5EF3A 2ALAA 5DEFB 4KRPD 2PYFA 1CD0A 2PN5A 1QPKA 2D3VA 2ARJA 2N59A 3O3AB 4PJ9A 4L3FA 5D70H 1VESA 3EFDL 2Z4QB 4AIZB 3P30L 4UQIM 5KOMC 1TJXA 1FJ1A 3QJHA 2FJHA 4MBOA 2WLJA 1CXHA 3JVFC 4LDEB 2F5AL 4G7SB 4R7XA 3K74B 4WEMB 1HL4A 5EC2B 3WLBA 2CH8A 2ZSVB 2XG4B 3DUUA 3I6KB 4Q97A 1KTCA 4OFVA 2JB5H 5I75C 2E9IA 4F2FA 4OFYD 1P9MA 1WITA 1T3FB 4NCC1 3ZY7A 2WMPB 1G9NH 1DQKA 2KLTA 7FABH 5KSBA 3JWOH 3FUFA 2ETWA 3HLKA 5K9QI 1E4XI 3AQXA 3WUWB 2YLKA 5IQ9A 3TN0C 1ORQB 3GB7A 3ZOAA 1H5BB 3BVDB 4GG6B 4JN2A 3WNMA 3N1GC 2J1KA 1FG2B 3B1TA 3I6LD 3NCJL 4PP2A 3PLYA 1OT1A 4GG6A 2Y9RT 2HRPL 3VWJC 1JZ3A 1AHMA 1CE1H 5KG9B 3MNWA 4IMLA 2CKNA 5SWSD 2VL5A 2A6DA 1X9QA 4HZ1A 5BO1L 3L2LA 4PLOB 1AMXA 5E8NB 1HDMA 4X98A 4WWID 3FSZA 3SDXB 1W15A 1RKRA 2A74C 2IOIA 2D73A 2IAMD 4NENB 4YPJA 4RMRA 5D4HA 3W56A 4JO1L 4TF4A 3VXRD 3NDYE 4DN3L 1H8OA 5DC2A 1RVFL 4DZBA 2H8PB 4FFZL 1KACB 1VDGA 3C60D 2Y2WA 1KGYE 5GS1B 4OB5L 2OTWA 1RY7B 3GMLB 2WXMA 3GNML 5CLXA 1SY6H 1N59B 5IEKB 4GO8A 1NAKL 1N8ZB 4QHPA 2OXGA 4M1CD 1A7QL 1DBMH 3PXHA 2VQUA 3QUYC 4NGHH 2AK1H 3V52H 2JJSA 4K8RL 5GGUB 9PCYA 1V3MA 1T1WB 2ATKA 2R1YA 1KXTA 1YZZA 2QTEA 1BLNA 2HT4D 1I3VA 2J44A 4NQCB 4Y1TA 4XC1L 2E27H 1ROWA 1UM4H 1XL6A 1XGRB 4DP9X 1NKRA 5H37H 4QDGA 3SDDB 4R0LA 1GGIL 2OKMA 4R90L 4H88H 4YDJA 1S5IH 4OU3A 1LTXA 2VIRA 1GA2A 4HUXB 1IKOP 3RY5A 5C2BH 2R39A 3ME0A 2W0PA 1YEKH 4HS6A 1T1XA 5F6HI 2XWBA 3PV6A 2GC4C 4LKXA 5BZWB 2XXFA 3PHOB 5TE6H 1JVOA 3SN6N 3H9SB 1S7RB 4G71B 1X44A 4L37B 5I5IA 4WI2A 1PG7L 1TPXB 4NO5B 4PJFA 4JVUA 2DLIA 2Q1EA 5LBSA 1UM6L 2ICEA 1P0SE 2YXMA 1NL0H 3RGVB 1S9KC 2EVIA 2WUCH 4ONGH 4GSDH 4E68A 5DEZA 1OK8A 3ESOA 2ADGB 5AVRB 1ZLDA 4JGUA 5C0NC 1CGSL 1FVEB 3Q8CA 4HH9B 4K3JL 3T0ED 2NUTA 3B2DC 2DMGA 2CGRL 3AREA 4ELMF 4N5ED 2MQCA 3GZKA 1KYAA 2QHRH 2ITCB 1FV1B 3OPZL 5D1QD 4DSYA 1L0PA 1G0YR 3GGWA 3UP6A 2HLFD 2VUOA 5C6PB 4Q56A 1AGDB 1JXGA 2F19H 3FB8B 3S4SA 3MRPB 3T3PB 5AZUA 4PRDA 1F02I 4DZ8A 2ADIB 1U30A 3PQYE 1HINL 4GQRA 1FGNL 4L8CA 2Q3ZA 4V1DB 1I1RA 1NFDA 4KO6A 3RIFK 4NRZA 4FKEA 1XR8A 4KK8D 1ZLSL 1A14L 1MVYA 4RA0C 5BV7L 4KROD 2CMRL 3CMOH 5F6HJ 2ZUXA 3MRRB 1HHGA 2I9TB 4N2NA 2FATH 5CGTA 2X2JA 3IPEA 4ZUTB 2GITA 3LN4A 5GRJL 5A2AA 1SLVA 4J28A 1DDTA 2HKFH 2EIZB 3LXAA 2XSKA 3DOIA 3BZ4B 4JFFE 2LHAA 2PO6C 2QL1A 3MBWB 2VWEC 2BM3A 5HHQA 5I5MA 2Q86A 3KNBA 1NCUA 3SDCC 1YJDL 2NZ9D 2RIKA 4ZAKD 4LKCA 1TJMA 2IXQA 3QPQD 3ARQA 3D3VB 1HWHB 2Y7OA 1OAKH 3BUTA 2PPDA 3KPLA 3HG1E 4I2XB 2XZQL 1V3JA 2AMGA 3PP3H 3QDMB 3VA6A 3JWDH 2HVJA 4MYWB 4UAOC 4ORZC 4JFOB 2V8LA 4YAQB 2ZWLT 5FCSH 4OLZL 4HQQL 1TCRA 2YXWA 4U31A 3WXVH 4PBWD 5DHDA 4D9RD 3SD2A 1FGVL 1ZT4B 4XP4L 1CIUA 5I1HH 4HLZG 4F91B 4N1HB 5ADOH 1MREL 3BPOB 4XP1L 1XCTB 5C09A 1SF5A 4L37A 3X1FA 4X7CC 3DJ9A 4P9ML 3WD5H 3ZE2B 2KT6A 5C0BA 1UXLA 3FFDA 1J9CT 2ICWI 2VIRB 1JMXA 5E2TL 2FBJH 1N7ML 1AXSB 5TE4L 4G7RB 1VFAA 2GEQA 1SQMA 4X6DB 3TT3L 4YBQC 4R3SA 3V6OC 3V0WH 4FG6C 1W9XA 4CU8A 5F3BA 3RGBA 3BDYH 3SDCB 2NUTB 3BO8A 4S2SA 1T1WA 2ATKB 5E03A 1IE5A 2PO6B 3DX2A 1VFBA 5F71A 4KVCL 3GXPA 1KT2A 1CD8A 3C87A 4OLYL 4L4TA 4QT5B 3KLAA 1BQHG 3L3OA 3MX0B 5L4FA 1EANA 5JMOC 2YPLD 2AEQL 3C8DA 3LRSB 2P5WE 4YHLH 4IDJH 5ICXA 3T6WA 4FLHA 5D1ZC 3SODB 3CH1B 2R15A 4KXCA 3QQXA 3TO2B 2Q6WA 3TVMC 5DVNA 5E8OA 1W80A 5DD3L 5IMLB 4FQXC 4EPSA 4WO0A 3EYFB 2ORBH 4IOIB 3P9WB 4P59L 3M17B 4U1MA 2KERA 2XQBH 3SDXF 1OAUL 2YPVL 1K8DA 2A73A 1YYLH 2KBGA 1MEXH 4NZJA 1V7ML 2Y7SA 5L6YL 5HSFA 3IF1A 2ZWYA 2DS4A 2E7HA 3WFEH 1DQLH 3ULVE 3NGBB 1WBZA 4OCXH 1D5BB 2DMCA 3E7JA 5EC1B 3X3GL 3QNXB 2ZUTA 1JWUB 2ZUYA 4R7LA 4PIRF 5AG9A 3KPSE 4TS6A 1U33A 3ZK0A 1OY3B 1Y18B 5J9PB 4PJ8D 5IVZA 2FEEI 2HJFA 4JDTH 3OXRA 4YDKL 4PRHB 5E6ID 5T3XL 2O5ZL 2K6WA 1NDTA 2AEWA 3GHEL 5ESQA 4XTRC 5KYUB 4CAGA 3FJTA 1CN4A 1H6EA 3MRMB 2ZWSA 4LOEA 4Y8AA 2G4EA 2WQSA 3IDMB 3K4DA 2A83A 2VYRE 3QDJB 3QWRA 3GSRB 3OLDA 1H6TA 1GJWA 5HHNB 2XG4A 2M26A 3ZDXB 5HYJE 1F4WH 5E2WL 4JO3H 4FA7B 4Z23A 1NQBA 2XZAH 4O02B 3DRQB 1XF1A 5BQ7B 4JL1A 2OI9C 2O6EA 5F7UA 3I6SA 3GSOA 3GK8L 1OXYA 2ARJB 1UYWH 4IYKA 4EIBA 1G7PB 4FQIL 3NH7H 4AGMA 1WAAA 4OFDA 2EQDA 5KW9L 5FUOL 4HFWB 1NTDA 1G7JA 2WXKA 4ODSH 1BQSA 2GTWB 5FWRA 4L4VA 3TO4A 2GB2A 3RGHA 1H5BA 3BPCA 4XX1G 3LPOA 1I82A 1T66D 4M61A 1PLAA 1Q1JH 2EXTA 1FFOA 1ZRUA 4AEEA 2NYYD 3KCPB 4OKVA 5CLTA 1JPGB 1KJ2H 4KVNL 3T8XB 2D03H 1IM9A 1HHHA 1ZWIA 1D2OA 4Y2OA 3V0GA 1CFTA 2Y07H 4TNFA 3WENA 1JVLA 2YN5A 3AQYA 3QZLA 2VLJB 3KPQB 2FT7A 2APVA 3N9GL 4WU7A 2OW6A 2G30A 2DMKA 1LEKB 1A64A 5IWLC 4AT6A 1WBYA 4DCQA 2A74B 5GIRB 3GHBL 4Y7MA 2ZOKA 3KWWA 1K9TA 4OCWH 4P3WA 4F57H 1AKJD 2ITFA 2X28A 3QRBA 2BIPA 4Q74A 1F3DJ 2J57A 2XTLA 3MV7A 3BH8B 1MRDL 2QTVA 4E5XB 3O9WD 5EEWA 1CLOH 4IOIA 4CVWA 4AK2A 4HVBA 2EC8A 1ZE3H 2VDLH 1ETA1 2IWGA 3LRKA 5KJ7E 1E8YA 2QSTA 4J8QA 5J56B 1YO4A 4X6CE 4NQEB 5HGAA 5E5MA 3WSQL 1WISA 2F74B 4P05A 5IHUL 5I19L 1A65A 1U6AH 3DX6A 3SE6A 3FO1A 2EE0A 4G9DA 5FECB 1EFXD 1FCGA 2HLFC 1ND0B 4Q4IA 1MCRA 2UXFA 2WVVA 3QNZA 5K9JH 3RYMA 3TNNA 3DROA 1OAKL 1AD0B 3U36B 1WIPA 2QADC 4OCXL 3KXFA 5D7KD 5TDOA 4LGPB 2D4FA 3PJNA 3RWGB 2ZYIA 1EFXA 2WM0A 3B8YA 4NBZB 3MZTA 2O30A 4KKCD 4P0DA 1QATA 2EIKB 2LU3A 3L5HA 3RX5A 4G6MH 4IHOB 4IJ3C 4Z5RA 3CCHB 2F8VA 5CZXD 1EHLL 1NDMB 2PCFB 3Q7JA 3FTGB 1TYEB 1IAIM 1U4EA 4HT1H 3HNTH 4KV5E 1HEJC 1NJ9B 2CLVB 3MRNB 3PL6A 1A14H 1ZSDB 5J6GB 4DF9A 5F9JB 3IJHB 5F6IB 4JFED 4MJJA 4IJ3B 3QQDB 2ISDA 1TCRB 1RJZB 3GSNA 5IW3A 3UG3A 5B21A 3SY6A 3T8MA 2V9UA 1HXYB 1F00I 2BRRL 1T66C 3AMLA 4LCCB 1NFIB 4GMSH 2WINA 2QFPA 3F2LA 1MCJA 4ODHL 4PN6A 4A2DA 4L1HA 2GTQA 4JRLA 1MDAA 5LGJB 5JHMA 5CM1A 3K8KA 5HHQB 3D51A 5DHYA 4KO9A 2DQDL 1I9JH 4I5BB 1X7TA 2FJGA 4O5LH 3TBTB 3DV6A 4JANB 4NO0A 2FO4A 1WZKA 1TEFA 4JRXA 4NM4H 5L0QC 4MNGE 1QLFB 5EBMB 2W81C 1FRGH 1U3JA 4RZCB 1XMEB 3HMXH 1ZS8A 4RMTA 5CJXC 4A7VA 3ABGA 4CRPA 3LPPA 3DGCR 5MENE 2QJDA 2G3NA 3VXNB 1QSED 2YKLL 1Z9OA 2FJUB 5CIPA 1WC7B 1KPUB 1FVDB 2E4FA 2EADA 3GMQB 3LNGA 3QHFL 4XMUA 1HXMB 1YNLH 1JZFA 3U4BL 3QEQA 2H0PA 4ANUA 3S4SB 5DQJA 1OV8A 4JFHE 5F7LB 2CBTA 3VXTB 4WHCA 1N2RB 1CGSH 2VISB 1OE3A 4HIQA 1ZEAL 1MRCL 4Y16B 3U7YH 3BWAA 5BO0D 5CEYB 3HE6A 3BSZA 4GIPD 2ZUVA 3PXLA 3S34H 2MQ3A 3V4UL 1SOQA 3D1MC 1ILUA 1D7BA 3QWRD 3BVUA 1BSIA 5EEZA 4YSAA 4Y16A 4BZ1L 1H8SA 3HLAA 4AEIL 4XPBL 3OLEA 5DFAA 4OQTH 1B0GB 4JQXC 1KXQA 3OWRA 4RLDA 1GZQA 5DYOB 5KZCD 2Y5TB 3U9WA 3TPUA 1ZGLM 3VFNB 3NSXA 2VC2L 3HC4H 1A4KB 4UTAH 4YGAB 4GJTB 1DVUA 3ZDZE 5I16B 4MJHA 2AMUA 2BNRD 3BLPX 1HESA 3H9SA 1I1FA 4XP6L 5F7AA 1QRNA 1FL3B 3MV7E 2NY2C 2RB8A 2F53B 2DIJA 1HNFA 4JN1H 2FTAA 2YSSA 4KU1A 1KBVA 5G4OA 4JFDD 3MLYL 4Z3EA 4N0UA 2NZ1A 3WXWH 3ZT5A 2XV2A 2FEEL 4RQQA 1V3LA 4ZMLA 1EBAA 1IC1A 2H47C 3RX7A 4N22A 2Z31C 2V6HA 3D08A 4NQCA 5JXEA 5JR1L 3FB6B 3VUAA 1DVFA 2E3VA 3MRLB 5EDXA 2P28B 5GSRA 5DJXB 1E4KA 4XH2A 3OKMB 2VN7A 1UVQA 3DA0A 3SYQA 2XJLA 3HS8A 4LCCA 1HXYA 1XX9C 3SYAA 2YPLA 5F7DB 1WAPA 4DEUA 4S1SL 1R3KB 2FQEA 4HHAB 3NYKA 4UMGA 2BWQA 4XB8A 3KJ4C 4H40A 4F8NA 1QRND 4HOXA 4HSAC 2BZDA 2EIMB 2DMHA 4GMSL 4MJ5A 1BYPA 4XRCA 1JZDC 2EYTA 4PUBL 3S3BB 3RX9A 4F8QA 4I9WE 4Q6IB 5EOCH 1I8KA 3VX1A 3PPSA 3ZDXE 5HYJB 5EZIL 2CLRA 1KJVA 1D6EA 1ZOXA 3QDJE 2VL5B 1B4RA 1TZIA 5A6MA 5IHZB 1IQWL 3SGJC 3VQMA 1FNAA 1RIHL 2JIXA 4LFHD 5JXAH 1SBSL 5C09D 2BIOA 3CZGA 3LS4H 1DN0A 3Q2LA 3T2OA 4Z76B 1P5UA 5J13B 3MGAA 3DBXB 4FQIH 4IS6A 4YXKL 4XN2A 4OJAA 3L1GA 3BPLB 2A9AA 3N1FC 4YDVA 5H35A 1UD6A 1GZPB 2R29A 2VXUH 3AITA 5DK2B 5D1ZB 1IC0A 5HHOE 2AJUH 3KVDD 4MDIA 1U91B 3FSVA 5FYLE 3STZA 1XGPA 1UFGA 5C0GA 2NCEA 4ZW3A 4FEMA 5GGQH 1QSEA 4LASH 4WO4B 2YA1A 1Z9SB 4ZNCD 2Z8WC 2ZCLL 2ITDB 4HZLA 2PTVA 4KJQD 3PNRB 3MODL 5CJOL 3N43B 3EBGA 3ZHKA 2ZXBA 3BZEB 4I9WD 5BS0D 1IIKA 3PREA 3ZQWA 2YWZA 3JWDC 3H0TA 1AI1H 1C5DA 2I5YH 1LK2B 1NMCB 2OMVA 5LBGA 4FABH 3P3UA 3KPRD 5BUGA 3LN5A 1A5FH 4UOQA 1B0WA 4TRPL 2Z1PA 3QULB 4AMWA 4UANA 4F1ZA 4HJIA 4LLUB 2ITDA 5LAPA 4U1SA 1MXDA 1MCOH 3I6GB 1QR1B 3SKJL 4A2GA 3NCCB 2VDRL 1WG3A 1UWXH 3V10A 4NQDE 5C0AD 3W1ZA 1IM3B 4M7LL 1UXWA 1VACA 2NY1D 1TJIL 3NZHL 1YNKH 5TQ0H 3R8BB 1LQSR 4IBSA 1D2PA 3N85L 2WTOA 2XFGB 3TA3B 3F00A 4LDLB 5GZOA 3VO0A 1FG9C 1RU9H 3GD1C 4HFWA 4UQDA 5EIQA 1KTJA 1KIQB 3P69A 4LSRL 3D85A 2HB0A 3VYOA 1BHGA 1F4WL 1EO7A 1RPQA 3CVHA 2H1PH 3MAWA 2XPGA 4OD3L 5HDBF 1P5VB 1J9RA 3RURA 4G82A 5HHMB 2EVJA 5FYLL 3DRQA 1EGJL 5DMGC 1KB5H 3OJDA 5TFSH 3VI4B 2FYYA 5MEOA 4G7YL 4I18B 3QUXD 4OUUB 4P5TD 3SCMD 3NH7L 4B41A 3S35H 2EYTB 5T1DL 3EYSL 1URIA 3C6EA 5BRZD 1Z1WA 4NRXB 1Y6NR 1MJ7L 1PYWA 4XBPA 3TBYB 4NQED 2GJRA 1T5XB 3QFJE 4Z77B 2H3XC 1FF5A 1DP0A 1QRKA 1YPZA 3AU0A 3FB5A 1RZIB 4DW2L 2HFGL 4POZC 1KOAA 3Q3GB 5M95B 5JYMA 4TQHA 3NP3A 1UATA 5DSCB 3EJQA 3VFTA 4W9CC 4Q9BA 1V54B 1NUNB 3FB6A 3CDZA 2C4FU 1XIWC 2R2EA 3SEPA 2MJWA 4JM2F 4Q14A 1L9TA 2DH2A 4HUMB 2H32B 2G3XA 1UZ6E 5DJ0A 2HRPH 5K9JL 1XBRA 1CE1L 4ZW8A 2BIMA 1QD0A 1P7QB 5KSUA 1D9KD 5FW6A 2MPVA 1AS6A 2IAMB 1G4RA 3CJJA 3QP3A 5HHVH 4ZODA 3QXDA 3E3QC 1UOVA 4DHLA 1KGCD 1TETL 2VLRD 5GQBA 1Q9WA 3QUZD 3S8WA 4N8UA 4JY6B 1ZHNA 1HCYA 2X6AA 3GBNL 3LQMA 1RIVH 1K5WA 1S5HB 3RAJH 3QDGE 3C2AH 4ILDA 3ZYZA 4CDHA 1LE5A 1EDYA 5MP6L 5IK3B 4LCYA 4QRFA 4QXVA 1VFMA 3QJOA 4ZFZA 5DRZB 4RMWA 1OKEA 1JGVH 3UC2A 3VD9A 1B4LA 1FC1A 3PCYA 4I4WA 5T3ZL 3HRZB 3CU1A 1M53A 1OTUC 3RA7L 5DLMH 4PGBB 4N2IA 2AC0A 4MCNA 3A23A 1R3HB 1WAAE 2CO4A 1ZV2A 4I3RH 5I1KL 1N6QH 4G42B 3VWKC 4AQZA 4NWUH 1J8HA 1CE6B 1CXIA 4JREB 3ULUF 1MHPH 4YDKH 2IAND 1N70A 4ODWA 4RMSA 3D9AH 2KLRA 3P9MA 2NY6B 1RPKA 1YNTF 4WTQA 5IUCA 4AUYA 2IFFL 3EYOB 4MJ6A 5LDSA 2VW4A 2FRGP 3B3IB 2D7QA 4MNQD 1GXEA 2NLJB 4XN7A 1IJ9A 4LCVA 2FK9A 3ILEA 2VDPL 3LEYL 4DWHA 1QI3A 3MGTB 2IVFC 3ZLQC 1FYTA 2NY6C 2JE8A 2OR9H 2V9TA 3QIWC 4GKLA 4JHAH 1FNSH 1HH6B 4XZ4A 4PJDF 2F2HA 3HZYB 1P5UC 3PWJB 4Z7QF 4JY5H 2X1QA 5CCKH 2OMXB 4CGUB 4HPHA 1KIRA 2QBWA 3O2DL 2CXGA 1N64H 4JZJA 4XMLL 5A2KH 1EEYA 1N18A 2R2BA 4GUPA 3GRBA 3P0GB 2WPGA 4ICXA 1NEUA 2BNQB 1QLRB 5AVTB 2PETA 2JKWA 3TONA 4GBXB 3P9LB 3D7PA 4ODSL 4R2GC 2R2EB 3NN8B 2IWFA 2IGTA 2VZ1A 4FG6D 4OZIE 1AGEA 4KROB 3BVVA 1RUKH 1F4AA 4AG4L 1SMOA 4L1SA 1PFOA 4XWOC 1REIA 5F93C 1T2JA 2H45A 3UBXB 2CMRH 3CMOL 4XT1C 2CK2A 3O4OC 2I9LB 3ESUF 4ADGA 2ZNWA 4PJXB 5G5DA 4YSPA 1QFOA 2P80D 4UIMB 1U8LB 1AYRA 1YMHB 4GXUN 4LLQA 1RUQH 1E7VA 2FIKA 5GGVY 2X44D 2QV2A 1OLLA 2F5BH 2K3HA 4FQPA 2P42B 1WWAX 3N0AA 5HYEA 3V4PA 3HN8A 3U7WL 1U8MA 4PWFA 3L6FA 2V37A 4EIGB 5C2BL 4DGIL 1UKQA 4N25A 3QA3A 3EF7A 4PW9A 4DKTA 4L4JA 4D3CL 4HWEH 2YGOA 5MP6H 2Q87A 2MPAL 4WFEE 1WYJA 1T1XB 4YVUA 2G9HA 3T0AA 2DD8H 4XCEA 2HAZA 1UKSA 3O6ML 4RISL 2R59A 1AS7A 4NAQA 4F15C 5L2KB 2J6EL 4OFKA 1JCKA 5DGRA 5T1MA 5IR1A 3HKFA 5LGHH 2YZ8A 4QXGH 3LH2H 3VW3H 3MSPA 1U0QA 1N10A 4MYPA 4E36A 4JRXE 4RWHA 2BSTB 4LLUA 4MJIA 3TBBA 3RZCD 1GMIA 4HWUA 2ZCKL 1HYRC 4XBGB 2VDRH 4HIJA 5E8PB 3HBPA 1FYTE 1JV2A 1MRFL 1XGZA 3ZRCC 3KPSD 1KPVB 1W0YT 4WTZG 1PDKA 5L2KA 2GTZA 4ESKA 5GJTH 4R5TA 3H0TB 1SNRA 4KVCH 4BIKA 1GPOH 4PGZA 4N0FB 2R0WH 4NQTA 2J2ZB 1N26A 1G7JB 4MAZA 1BZDA 5DO8A 2D4DA 5ISZE 4OV5B 2VCOA 4X6BB 2XKSA 1CLCA 3ECBB 2YFOA 2F68X 3N04A 4HBCL 2CWRA 4M8UA 5D1XA 3WLWC 3H2PA 4IIQA 2ZXCA 3TV8A 4QRRA 4BKLA 1KYUA 4AKQA 4OGYL 4GP8B 1BQLL 4WU5A 4FQCH 2XN9E 1HS6A 1SXAA 5INCB 2BDNH 5JW4N 1J0ZA 2C4FT 1XO8A 3AG1B 4HIPA 1XF2B 2WBJD 2F1EA 2FWUA 5D5MB 3EGXA 5DRWB 2GC7C 3KMDA 2EYSA 1CF1A 2M2DA 4MDJB 2EXWD 5D2LE 3ARBA 5FGBA 3MV01 4YWGL 5IB2A 4HK0A 2UV3A 3CXHJ 5FM5M 4ZNEA 3LZOA 2E8ZA 2EP6A 2WB7A 3ULUC 1A6WL 1AE6L 1HHJA 1NMCC 1QPPA 4YHIB 5FF6B 4W6WB 1J0YA 1SUHA 4RA3A 4ODTH 4BWUA 4R5VA 3QFGA 5FKPB 1E5UI 2H0JA 1A9EB 2JJTA 4FFVD 4XN4A 1Y18A 4EF3A 5BXFA 2CO1A 3LHPL 1F4XH 3UAEA 4NOBA 4CU6A 1I1AA 2XN9B 3PFUA 1G94A 4NLAA 4HUVB 3ERXA 2Z93B 3ZJAA 4X5WA 1E28A 1UB6B 3VH8G 2BXZA 4LCWA 3BP7B 4PB9H 2Q0ZX 1UQSB 3NIFE 4UT6A 3D07A 1R3KA 4GEJA 4QYAA 4UTAA 5KSAA 3LS5L 3W38A 2HVBA 3DMMB 3O3AA 4PJ9B 1N8OE 3MFGB 4UNTA 1OSPH 1J9SA 1DJIA 2XRAL 3ABZA 2FR4A 1HL5A 2DMBA 2IADA 3MRLA 1A7PL 1UHVA 4TVPL 4E42B 5AG8A 4W4OA 4Z7WA 5BRZB 4G83A 3GZQA 5L8KB 3NJLA 2X4RA 4U6VL 5D55A 1L0YA 4A2MA 5DK3A 43CAA 3RVUD 4OLYH 3IGLA 5KW9H 1FNEA 3QJRB 1GGCL 3KPSA 4X8JB 5DVOA 5E6IC 5I6LA 2XWTA 4KK6C 2DQTL 1IC4L 4RFNC 4PJ8C 2CR0A 3JV6A 3WXVL 1KJ2B 1KF9B 3LKPB 4G6AC 2E5EA 4ODWB 4FQ2H 4JN1L 4JQIA 3KDPB 5AQ0A 3UDWC 3O2VH 3UO1H 3VGAB 4WFED 1CG9B 1IC5L 5I15H 2F7OA 1YEGH 1W8OA 1ZA6A 2I07A 3SIKA 5KVGE 5KVDL 5CP3H 3UTSB 2EH8H 2VN4A 2KPNA 1DQQB 1V7MH 4LPTA 2VSKB 3JYCA 3ZYJA 2HTKD 3INUH 3UTQB 3EYSH 2YQ3A 4ZMVA 2C9RA 4MXWH 2H3NB 1I7RB 4OF5A 4ZFGH 1OOAA 1S9XB 1J86A 2QMJA 2ZSWA 4TL5A 1Q9OA 1N4XH 1Q0YL 1IAII 5KAQF 4B3VA 1I7ZB 3C5JA 4HMDA 3HPJA 2GK0B 4P2OA 4D9QD 5DVLA 3ULUD 3AB0C 1U8OB 2ZXEB 4MB5A 4NN7C 5F70A 4YZFF 4JY6A 3GSNH 5EOCL 1E4WL 5B1KA 1M71A 2UZPA 4KI5E 3V7AE 1P84J 2F6AA 3TS8A 4ZT1A 3QXDB 4YO0A 1P7KA 1QG3A 3P4LA 3LQZB 3RKDC 5CGYD 3BZ4A 1NSNL 4JDVB 1WEJL 2IH1A 4YBHA 1PU0A 5EBMA 4PJ5B 4WRLA 1N19A 1IBGH 5FB8A 3Q06A 2YQ2A 5IJCC 2C9AA 2VLKE 5AB0A 2A3TA 4KHXL 4K7PH 4UT6L 4S1RH 3KH4A 5AL0A 2O5XL 2EC9U 1MQKL 4JO4L 1KIUB 2JWYA 1DQDL 3C5ZA 2OTPA 4JGJA 4MFHA 4XPGH 3BP4A 4QTHA 4R96A 4ORGB 5ABDE 3T0EA 3N06B 4XCNB 4QOKB 2WXHA 3QQ3A 1MFCL 1KN2L 4A04A 3V5HA 3HZMA 4JPWH 1X5IA 4U6XB 4AC4A 5KBLA 4Z77A 2C7UB 5CINH 1BQKA 3QQDA 4FFTA 3EH5B 3X14A 4WHYG 4AKOA 2X38A 4MNQE 3VDAA 1UA3A 2VXSH 4PLJC 3HI6H 3MCKB 4R7NA 2BNRA 3H56A 4QNPE 1SJXA 4U3CA 3CXHK 4DKEL 3X1NA 1MHCA 3NJMA 1JWMB 1YC8A 2IH8A 3MLRH 2KMWA 4M5TA 3EGSA 3BDXA 4Z5RB 3OJDB 3VI4A 5MEOB 2AEPH 2UZYB 1TEGA 4ACTA 1XGQB 2AK1L 3UMTA 3V52L 3K8MA 5KS9F 1M7IA 4PRID 4IRJB 3ALPA 1C12A 1O5DT 5DK0B 4JFXA 2HFEA 3WNLA 4AGOA 1K6QH 3EOBA 1RZKL 2IDQA 1IVLA 1UWYA 3OG6B 4HWEL 2AI0H 5JO5A 2L04A 1UXSA 2PYEB 2V9QA 1M42A 5AAWA 5K1NA 4IRSC 3HC0A 2WIMA 1HKLL 5AB2A 5ICZB 4ZD3L 3ZMEA 2VERA 3SO3B 2J8UA 5I1EL 1NLBL 2GY7B 1URZA 1FFQA 4PS4H 4HGWA 2LOEA 4PRNB 3KD4A 4P3CH 3AWFA 4LPUA 3UXFA 2XBDA 2BS9A 4ZMQA 3SZ6A 1JXJA 2P8LA 2ZICA 1OGAB 5D96B 1INDL 2BO0A 5IMMA 1MF2H 3S5LB 4JKMA 3OKLA 5J6HA 2C9VA 3HB3B 3P77B 1JPTL 2Y06H 4LOVA 3AFLA 4PP1C 4QRRD 3SBRA 4X5WB 3BH9A 2ID5A 2CDEB 1LEKA 3HE6C 1RUKL 1R3JA 4J3OG 1UA6L 2VERN 3VFOA 4G9FB 4R2GB 4U4IA 1F1AA 4JPVL 3DVNA 4JDZB 3SGKC 2WLLB 3B2XA 2ZP9A 2ZP8A 5HDRA 5C0CA 1OZTG 5E0QA 4ONOA 1LDPH 3Q5TA 3WFDL 2UYLB 4MXQD 1DVZA 2NUPA 4HF5L 3IWVA 1RZ7L 1CICC 1NBZA 3IE4A 2YR3A 4U3SA 1CU4L 1ZMYA 2NW2A 4HMCA 1BAFH 1UWGL 3U9UB 5BNXD 2AV7B 1HSAB 3LKSA 4G1MB 2QGCA 4PH8A 3GSQA 3QUYD 1IKNC 1T6BX 1PJ9A 1ZT1B 3RDJA 3QS2A 2Z8VC 4B9FA 4L3ED 5LNGA 2WLKA 1G5GA 2WYTA 4H0IA 3UABA 3B5GA 2BP0A 4HCRA 1AOHA 4AL8C 1O9WA 1TETH 2JJVA 3FQTA 1UGNA 2V2TA 2Z31A 4PRIE 2L8AA 2RTTA 3TFKC 3OKYA 3LPWA 1NUGA 2ZX8A 3OKNB 1R5IB 5DJZB 3FT2A 2NW3A 4GKZA 5FUCC 3OZ9L 2VLKA 3Q9PA 3VTAA 2CZNA 3UO1L 3ARDC 4KDTA 5HHME 5DEJA 3EAKA 2FJHB 2EECA 2J2ZA 3TVMD 1AZZC 2H1XA 2DI8A 2CR3A 3S3CB 1FZOB 1BZQK 5KYUA 5GHWL 3HVDA 2PP9A 3DX9A 1RZPA 4QF1A 3F6JA 1YY8B 1E2ZA 4D9LL 3ZDWA 5GSRB 4MA8L 3TH4T 1FNLA 1S9VA 1J05B 4UNUA 3VFUA 2OMWB 1W0WB 2C9UA 1VIWA 1CGVA 3B9KC 5IJKC 4Y2DA 4V33A 3FU3A 1I9IH 3MLSH 3VACA 2NUPB 1EV2E 3US0A 1WBZB 4AC2A 3UBXG 3ZKMD 5IESL 5I1JL 5DVPA 4ES9A 2DQDH 2QGDA 1P7HL 1MI5D 3MTRA 2ADFH 2R9HD 1O7VA 3NCFB 1D5IL 4G5AA 4E9SA 1JUFA 2VLKD 1T21B 2E9BA 4P57B 1NCTA 3KDMB 1SYSA 1OHZA 4AQOA 1XB8A 3BH9B 4JFXB 4PS4L 5HJDA 4R83A 4K23L 2FNWA 4XHQA 3KHQA 5E0FA 1OP3H 4JKLA 3I2CH 1A4KA 4HXBL 5JQHC 4N28A 4K94H 4EI5B 4PYHA 3W0WA 3EKCA 1F6AA 4FNPA 5A6IA 4XGZA 3OXSB 2UZYA 5HDWA 1DSFL 1JPSH 1OB1A 3QUYA 4J6RH 4P46D 5E00B 5HHOD 3OX8B 1GIGH 3QPQC 3UZVA 4OQ1A 3WHXB 2XA8L 2YPVH 3SHSA 2VZUA 2Z7UA 3T8VA 1A1MB 4FAAB 1Z0NA 5K9OA 1JHTB 1Z5LA 1KXVC 3IKCB 3P2TA 1HH9B 4MD4B 43C9B 4EIUA 1L9QA 1LO4H 5IW1B 2WIIB 4GAAA 4J3WA 3NFNB 2SODB 3T0XA 3ILQD 3UZEA 4ZFFB 3QORB 3QDJD 1OP5K 4KQ3H 4XCFH 4AGLA 2Q7YA 2J55A 4Z0XB 2V17L 2VDKH 1DYZA 2ZUQC 3QJUB 3Q9QA 2B9BA 2VXQA 3KPTA 2EABA 3MRIB 1MZZA 3G9VA 5DO2D 2VN3A 3BIKB 2EDHA 3LZQA 5C3LD 2V7NB 4MTMA 4UU9A 1U8JA 2YBGA 5ISZB 2ZUQB 3ZL4L 4R7NB 2Y4SA 5DD1H 1P4LA 5DS8A 5J4MA 4MAYC 4G6FB 3FTVA 1UA7A 2R1XB 3M46A 2XFXA 2D7TL 1HU8A 1P4IH 4FXGA 1LWHA 5IJBC 2WCGA 4PTTA 3U4EB 1IO4C 4YDNA 1UT1A 3HEIB 4A6YA 1PKQE 3ZDYF 4V11A 4ZPTB 4XMPH 2GSIA 1HT6A 2NY4D 3NA9L 1U8QB 3T3MB 3PABA 2J88L 5IB1A 4YHOL 1KTLB 3GTNA 2DD8L 4JFDE 5CZVH 5DRXB 3D06A 5DS1A 3N42F 4YXHH 2AQPA 5J89A 1CMOA 1NWPA 1ZIAA 2HTLD 1WCQA 3ASWA 3HI6L 1SJMA 2IQAA 4PRIA 2ZX9A 3KVPA 3MV7D 4OLXL 5B3SB 5ID1A 1PZUB 1QNIA 3IMRA 4JLRA 5TF1H 3DYMA 1WT5A 3DTXB 5T5NG 2QHLA 5DR5L 3ARWA 4XVSH 4N0CC 3IJYB 4E9LA 1NIAA 2MQ0A 3V4VB 1RZGB 2K7QA 3ZE0B 1D5IH 4K9EC 3FQUB 1IGCL 3OMZA 3UBHA 3FT3A 3BP5A 1BD2D 3PWVB 4RRPG 4IOSD 5IK3A 2NZIA 1ICTA 3L5JA 2DPKA 2Q8BL 3W9DA 1RHFA 3CHQA 2A4ZA 1S3KH 1XGTB 4GUQA 4XOCA 2WAQA 4PJIE 3EJYD 2EICA 2YFNA 2W94A 2JB6A 2E74C 4N6RA 4G72B 4IOSA 4PD4K 1PLCA 5AFAA 1UEMA 3Q8BA 4TNWK 3LPGA 2DDQL 1VGKB 4JKNA 1SYSB 2EO7A 1KTRL 5AZEL 5BZWA 1L9MA 1SDDB 2X70B 4BKTC 4KK6D 4FLOA 3BEVA 2QELA 3IJEB 1JERA 3KG5A 4CA4A 3NUKA 5MEND 1M1SA 4Y5VB 1AQDB 2YZ1A 3UBXI 5LQBL 8CGTA 4G8EA 3VXUD 2RACA 1F11A 4NXSA 4PJIB 3UADA 5ACZB 1EJOL 2NY6D 3MCYA 3QDGA 2AQ3A 1KYDA 3I9AA 1VFOA 3CFDB 3M1CA 2VR4A 3PAUA 2PPAA 4FHBD 1KENL 2DQCH 2WKGA 3W11D 3WN5C 3FCSB 1ADWA 2LT9A 3M45A 4UQ2B 1QBAA 2MCMA 4M61B 3HHSA 4LVOC 4AENB 4L4VD 3TO4D 1YNKL 2FATL 4XMWA 1A7QH 3HG1A 1T5XA 4J3SA 1NC2D 4JO3L 1TPXC 5HGDA 1QEWA 1T7YA 1SFHA 3OKDB 4HEME 4JFEE 4PRPD 1MCBA 1GGTA 4NNYA 2B77A 4PV8B 4XCCH 4HOWA 1UM4L 2YPKA 4ATWA 3LH9A 5JHDB 5JOFB 4U4BA 4NZFA 5EN2A 2JKLA 2XTSA 4LHUD 2XXCB 4R4ND 4F33A 4NO3B 2Q9OA 5C9JA 3QAZC 3R0NA 2OMYA 2DL2A 2XPYA 1C8PA 4HJGA 4MAYA 5DQ9A 3VNYA 3OKDA 4O02L 2IDTA 1WD8A 1LDSA 1F6FB 1XEUA 2R23A 3OZ9H 4TUJB 1SLWA 4DKAA 3APDA 5LCVH 1FO0B 3WD5L 2A7BA 2AZAA 3R19A 3W11C 1T0NA 2VUKA 4UINH 4P23D 1M4KA 5IVZB 4G9FA 4HWBL 1XF5A 3BIBX 2WNGA 2WKOA 3LJ3A 4JRYA 3L8QA 4XVSL 1BOGB 3QNXA 4A6YL 2X9YA 1IFRA 3ETBF 1D5BA 1TOXA 4LL4A 5FAAA 5LHDA 2BOCB 4KHTL 1J5DA 4Z7VE 2D7NA 3LKOB 2VN5A 1FJ1B 3CFIC 4MX7B 4OCYL 5DUBB 2FGZA 1FAIL 3F58H 1A6VH 2V0AA 1KB5A 2WQRA 4PW4A