4MZRA

Crystal structure of a polypeptide p53 mutant bound to dna
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
234
structure length
234
Chain Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTAKFGTCTYSPALNKMFVQLAKTVPVQLYVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSSDSDGLAPPQHLIRVEGNLRAEYLDDPNTFRHSVVVPYEPPEVGSDYTTIYFKFMCNSSCMGGMNRRPILVIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRKKTMDGEYFTLQIRGRERFEQFRERNEALELKDAQAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversal of the DNA-Binding-Induced Loop L1 Conformational Switch in an Engineered Human p53 Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Cellular tumor antigen p53
total genus 49
structure length 234
sequence length 234
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4mzrA00
3WTVA 5ECGA 4XR8C 4AGOA 4AGLA 2AC0A 2IOIA 2J1YA 4KVPA 5AB9A 2XWRA 2YBGA 5AOKA 5AOJA 4L18A 4AGMA 1TSRA 2BIMA 2XWCA 5LAPA 4IBTA 3WTSA 3Q01A 1IO4C 1CMOA 3EXJA 5G4MA 2BIOA 3VD0A 3QYMA 4IBSA 4L0ZA 5AOIA 3IGKA 3ZMEA 4G83A 4MZRA 5A7BA 4IBYA 4QO1B 3VD2A 1EAQA 3TS8A 1HJCA 2IOOA 2RMNA 4GUOA 1HJBC 3D09A 3D08A 1GZHA 2BIQA 5BUAA 2J6WA 2H1LM 1KZYA 1LJMA 3VD1A 2BINA 2MEJB 5AOMA 5G4NA 3D06A 5ABAA 4IJTA 3WTXA 2P52A 4AGPA 1UOLA 4IBWA 4AGQA 3WTYA 2PCXA 3US0A 2J1XA 4L0YA 4LOFA 2J1WA 4AGNA 3WTWA 2X0WA 2OCJA 3D05A 2VUKA 3WTUA 1EANA 1EAOA 4MZIA 3KMDA 4GUQA 5LGYA 2FEJA 2IOMA 3QYNA 3D07A 1GZHC 5AOLA 2ATAA 2J20A 1E50A 3Q06A 3WU1A 3Q05A 2WGXA 3EXLA 2ADYA 4G82A 5KBDA 1H9DA 5G4OA 1TUPA 1T4WA 3IGLA 2X0UA 3D0AA 3WTTA 2J21A 4HJEA 3US1A 4IBZA 1YCSA 2X0VA 4IBUA 4A63A 4LO9A 2J1ZA 4IBQA 2BIPA 4IBVA 1HU8A 2AHIA 3KZ8A 1CO1A 4LOEA 2GEQA
chains in the Genus database with same CATH superfamily
2Y69B 4LF3A 3D18A 2QJDA 4KJQD 2OW7A 1WS8A 2VDQB 4I77H 2IADA 4QHLB 3L48A 3OJDB 4WUKL 4DP7X 2ZKMX 5IK3A 1OGTB 3K4ZA 5IMKB 1JGVL 4D0DA 4L4TB 3KWUA 5L4MA 1A6AA 2OYLA 1HKFA 5BRQA 5FO8B 1YC8A 3K3QA 4TTDD 4IU3B 3F58L 2DWXA 2YAEA 4NRXA 1RUMH 2TSBA 4Y9FA 3S36X 3OG6B 5J7CC 4DUXA 5HDQL 4TPRL 2VDMH 4YGAB 2HRHA 3T0EC 1Z3GL 3P4NA 3LKNB 2WWMD 1TJGL 4WFED 1S8DB 4HX1B 1NCDL 2LTQC 1LO0L 2NZ1A 3BKCH 3M86A 1J1OH 1TEFA 2HG0A 2QQKH 1UWEL 3IXAB 4ZPVA 1R17A 5KZCB 5F7DA 1KBGL 2YWZA 1T21B 2DJMA 3N43B 2X4NA 1UZ6F 3TONA 1LK2A 2XVBA 4PV9B 4GKOA 2KDGA 2WWMC 1CFVH 3HG1A 1D6VL 2Y4SA 3ASWA 3KM2A 3QZPA 3B2XA 3OB0K 3Q6GL 1HHJA 2FYVA 4U3SB 5SWQA 4ZMQA 4K2UL 4QXUH 4TRPH 1N6QL 2PO6C 3VTAA 2XA8L 4FQPA 4M3KB 3BIAX 3E8UL 2F8VA 3CHSA 3IDGA 1DBBL 2Y7SA 3CFTA 1N70A 1VESA 1M71A 4ZJ9A 2EDNA 4N0CD 4AG4L 2JH2A 1XZ0A 3J2PA 1GZHC 3SE3C 4JN1L 4KTGA 5HP5A 4ZW8A 1DBML 1AGBA 1NL0L 2BVPA 3VXNA 4TL4A 1NCHA 3KYMA 5DS8A 5KW9H 4UYPA 3LN9A 1OSZB 1E3XA 3KR3H 3V4PB 4JY5H 1ZT1B 2O72A 1LE5A 1DVYA 1OTTC 4PD4K 1J5DA 1OB1B 2F7PA 3SJVD 5C2UB 1AR1D 2ROYA 1H15B 1X5GA 1MCLA 4HJJH 1MRCH 4KZDH 3JYCA 4IKJA 3MRPB 4HFUH 4J3XA 3DIFB 4OB5L 1VKXB 3L3DB 3BW9A 4N86A 4JFWA 3HVDA 4E41B 1GC1L 1NGQH 2DYSB 5T1LD 1LK2B 4DUWA 3KCPB 5MENA 1XO8A 1UEMA 2AKRB 2NNFA 4OI7A 4BFIA 2EKJA 1BWMA 4U49A 3QA3B 4EXPX 2X4OB 4M5TA 3PXJA 3BE1H 2WXNA 5H2BB 1YAZA 2JCWA 3ARGA 3MRJA 1RPQA 2HT2C 5T3XL 1I3VA 1TLKA 1DL7H 3VFPB 1RUQH 4BYHA 4JR9H 3MLWH 5T1JA 2ZNXA 4F7EA 2VMFA 3FPXA 4HJGA 4PQXA 3QNZA 1FZKB 5BUGA 2AERT 4JY4B 1ED3A 3MTRA 3HMXL 1S78C 2A4EA 3GS4A 3WSQH 1U8HB 2OMWB 5HYSA 3LPPA 3U79A 4AV0A 4APXB 2PPFA 5LBSH 1PIGA 2CO3A 3DX9A 2WAHA 4DPAX 5C07E 2B1AL 1FRGH 3OKYA 1P2CB 3P1VA 4HLJA 1IJ9A 2FECI 2D7QA 1S3KL 3QIBB 3RWFB 1HN1A 3WS3A 3FQUB 5DD0L 1IAKB 5TH2A 3QQDA 3L1FA 3MA7B 1KC5L 3QORD 4LLWB 1NCWL 1KIUB 3L4VA 3AU1A 3G5WA 3U25A 4F9PC 1CLOL 2GTWB 1Q4NX 3GKWL 3B43A 1UADC 3P4NB 2JCCF 4P2AA 3HE6D 2QKIA 4OM1L 3ZDYF 2KPNA 2H2PD 2R0KL 3HIZA 4NFCA 3WOVA 3ARZA 1VENA 3NOIA 2Z1KA 4NRXB 3C5JA 2EC9T 2WQRA 4X4KA 4DEWA 5IQ9B 1XF3B 1J5OH 3C09B 5AD0A 1CGUA 5INDB 1L9RA 5KYYA 3VGDA 4KQ0A 3NRFA 1W72L 4XP9H 4OGAD 3K71B 3DGGB 4Y4KD 3MN8A 3TEYA 2W1NA 4J8RA 3OJDA 5JA9A 1FPTH 2MHAA 2ARWA 1V54B 4TV3A 1KJMB 1UJ3C 3FT1A 1AGFB 4UV7H 2GTQA 4XCCH 2BVYA 5FECA 5I6OA 1PD6A 3L3GB 3RIFF 4JO4L 1EUUA 2VJ0A 5TTRA 5LBVA 1ZVHA 1J86A 3DOHA 4KRPB 1T89A 2V5SA 1I9IH 3BFWA 4P4KD 3CDZB 4LCIH 4KJWC 1E5AA 1GYCA 1XGUB 4HLEA 5B39G 1WIUA 5C08A 4AOFA 4J3UA 1P7BA 4W9ZA 3ARFA 4NNYB 2PMZA 1YHPA 4JX0A 4NI3A 3W39B 1LYQA 4CKQA 1PDKB 2DQIL 1RZ7L 2WBWB 4M8RA 4MNQE 3EOTL 4KK6C 1JVKA 2L3BA 4LLVB 5EBLA 4ZXBC 3WHXA 4CNIB 3WFDL 1KEGL 2A5UA 2PCFB 3MCLL 1L9MA 3OHXA 3L3OB 3MRQA 2IV9A 4YHOH 1MLCA 3M6DA 1MWAH 4KVPA 4XNZB 3SKMA 3PAYA 1RIVL 1INDH 3QDGD 3SE9H 5IHZB 1RZIB 1UYWH 3CFUA 3SKJH 4PJBE 1U8PA 3LS5L 1FH5L 2WXJA 2CKBL 4Q6KA 2MOVA 1JV5A 4MYPA 3R7QA 1AIZA 1F41A 5IVOA 5T1LB 1XH0A 1W6LA 3EYUL 2YUVA 3HS0B 4X7SH 3UADA 3T0VA 5JIQA 4UT7L 2AK4A 2IBZY 1LO3H 3BPCB 3N43F 4NHUA 1Q9LB 3NCYS 4HCRL 1JZ5A 4FA6A 5HGHA 3ZDZB 3L5WA 3QRFM 2ITCB 5MEOB 1JGEB 1XIWA 2QQNL 2VDNB 5CMAB 1T83C 4HG4J 4PI0A 3BPOC 2JJSC 2F53A 3HAEB 4H1LH 1G9HA 1JZ3A 1BIIA 4OKVB 4JG9A 5LXGL 4FNUA 2QTVA 4ERSH 1NC2D 1TQCC 2WBJA 1DVFB 1S7SA 3H42L 4PS7A 4O00A 5GPRA 4RGOH 3LAFA 1ZLDA 1HTYA 3EYSL 1G9MC 2EDWA 4P57B 5KYWB 1OHZA 5TQ2H 1Q38A 4Q58C 2WKOF 5KSBE 1UVQA 5FFGA 3UTSB 3K91A 3QUYD 3CMOL 1YZZA 3DBSA 4PRNA 4FGMA 3N06B 4AZ8A 3WL9B 1QLEL 1UM4H 3WEMA 3EH1A 2V7HB 4DGYH 3LH8A 3QJXA 4PRIA 1QMUA 3KXFD 4L1DA 1KLUB 4GYBA 3QJRB 3EJTA 4NN6B 4K5PA 5FWRA 1XDTT 3K2IA 4WGVB 2ZP8A 3HUJA 4QCIA 5IOKA 4MGXA 3UTTA 3ZHFA 3I6LD 1E4KA 1IQDB 3WIFA 2ITDA 4HZLA 4D3CH 4FQCL 1MCKA 3VDCA 2KMWA 3BEWB 3CVIH 3OAWA 4PJCE 3Q05A 1NBQA 4IOIB 5JORB 2CJTA 4G42A 2QKIC 1N19A 4IU2A 4L1SA 4NO0B 4NNXA 3HNSL 2P5WD 3PL6A 3VM5A 1TYJA 1OAKL 4PRAB 5CUSH 4GLRI 4ERSL 4LBAA 1MJ7H 3WUZA 4Y5VB 5IR1A 3Q2VA 4K9JA 1J8HB 3I2CL 4A63A 1GGUA 2EE9A 4JZNA 2AW2A 1RZJC 5DRXA 4MZ2A 3WFHA 4OV5B 4O2CB 4AMWA 5HYEA 4UTAH 1YN6A 2VLRD 2MOGA 3V6OC 2BNQB 3SE8H 3U46B 1TNMA 1J9RA 5GZOA 3NACH 2O5YL 4OCYL 4M43H 1M7DB 1V10A 5H4ZA 4JZJC 4F92B 4HLZH 3OGOE 4GAGL 3QDJA 4GQZA 1ZVSA 5DA0B 4X8JB 2VL5B 4PBWD 1IEAB 3WKYA 1W2KT 1QSVA 5EIIG 1WIOA 2JK5A 3QFJE 4HUCA 1YVLA 5BQDA 4Y1AE 3LVEA 4ZFFA 1WPCA 2DKMA 4BM7A 4E41D 1JZ8A 3SE9L 3IDXH 3LPGA 1MG2C 4UUJA 1BA9A 2VDQL 4JCLA 5GS1C 3JWNH 3BEWA 2YOAA 2Y3AA 4XBGB 3UTZA 2VMCA 1EHNA 3DX9B 5FGBA 5JIIA 4X6EB 1FUNA 3OMAB 5LGJA 2O1AA 1EGJA 5HPMB 5D93C 4F7CB 1RZ7H 2ZUSA 5FK9A 4FQIH 1GIGL 4ZSOE 3UAAA 1ZY9A 3U6XS 1WFMA 1NUGA 4JO8A 1TU2A 3V4VH 1J18A 4AE1A 4DEPB 2EKSA 3RB5A 4HWEL 3W81A 4M62L 2JKTM 5D5ME 1JGUH 2NQCA 2LU3A 1SJHB 4H26A 5IJKA 5TE6L 3MJ9A 2DAVA 4IBWA 1W72B 3IRZA 5LQBL 4PRNB 4W9DC 3MBED 5JW4N 7TAAA 3CCHB 4CSTA 3KYNA 4XNQB 4PN6A 5IJVB 4XC1L 3Q0HA 4WFGD 4QIRA 4WY7H 3MYJB 4NNPL 2AQ3A 1OE1A 2GJRA 2JIXA 3K8MA 3Q2NA 4LCUA 5HDOA 5TD4A 3WJJA 5I76A 3BT2L 1BPLB 3ECWA 3SY6A 3O8XD 2AFNA 3MFFB 1FZJB 4CAGA 4E41A 1DCLA 3ATEA 4ZUVB 3QJHA 1TCRB 5CS7A 5I15H 3SOTA 3TO2B 5CP7B 4KOBA 3QYNA 3MRPA 4MS6A 1UWYA 3W11C 2G3NA 1SDYA 4KVNL 3ZRCC 5EOTB 1FFPB 2QLYA 3NIDB 4KHTH 1DEEA 3G6JE 1EDYA 1CLOH 1TDQA 2B2XH 2CMRL 3NP3A 3GZOA 3OC5A 3ATFA 2YAPA 1IZKA 1E9PA 1NCWH 3SDAD 1RUKL 2JJUA 4DJMA 4HD5A 5HHPB 4YC2C 3IJYA 2G0LA 2YD1A 5IHWA 5B3JE 1KFGA 4F8OA 4URTB 1IV8A 3NDYE 5D5MF 5K9OB 1WTGT 1QNZL 2A9AA 4OF0A 1KIQB 3QUYB 5AW6B 4HHAB 5BNXD 2IMNA 3ECBB 1MQKL 5EU5A 4MXQC 3MO1A 3LTVA 1LEIB 1MFBH 2DIAA 3BFQG 2X4SA 4KROD 4ZBJA 1ZLVH 3RE0A 1DN0A 1VACA 5DSCB 3WN6A 3O2WH 3L3HB 1UACH 3A6BH 4XBPA 3BZEA 1SJEA 4RWHA 1U3ZA 4APQA 4NLHA 5GRVL 5IKCA 2MNUA 5D1QA 4LCWA 2FIKA 1TJMA 4JFZH 2A3TA 3MUZ1 1INEL 4ADGA 3DOSB 3U7AA 4JZOB 5A2FA 1PYWA 5F7DB 5DLLA 2YC1B 2W0LA 5I1CL 2JI2A 3BE1L 3I75A 3UH8A 4UQIM 5AW9B 1T1XA 2F53E 3QJZA 4I13B 4NWTH 3ZUNC 1I9RH 1H8NA 3QO0A 3D9AH 1QBAA 2Q6WA 1ZLUK 3REVB 4OLWH 2K8MA 1CICB 4I18A 3ZKNC 3OKNA 1Y0LA 2FWOA 3D12B 4GLRH 4NZRL 3SCMC 3FQ4A 3HE6C 2X4RA 3H85A 3ECQA 1FF5A 3E3QC 4QHMB 4X8XA 5HGBB 3IETA 2DLHA 5JW4M 3TH3T 5M94B 4JMXA 2FDBP 2BM3A 4N26A 3JTTA 1M9SA 4F3FB 3WFBL 5CAYB 1SXSA 5EF2A 4Q74A 4WHTA 5D8JH 1Y7VA 2IPKB 3ATDA 5IEKA 3SKNA 3OKDA 2P52A 3UYPB 4N90D 2XVKA 2NW3A 2X7LB 4I5BB 2YO3A 1NKRA 4ZOCA 3WFEL 1BZ8A 4EBQH 1QRNE 2YPKB 5CGYD 4X4ZA 1J48A 4B6ZA 4JPQA 2J1XA 4JPVL 4Z7NE 3MJ9H 2ERJB 2YUXA 3SGEH 3BGFB 4WTZA 3CC1A 3PJNA 5TQ0H 2XXFA 1G1YA 2GJZB 2N3JA 2X0WA 4OJDH 4X0KA 5HGAB 3VFUA 2RBLA 1DQLH 1UUNA 1ZTXL 2CAKA 1ODAA 3WTUA 3QXWA 4OCNC 4YDMA 4MMYA 5C08E 5JMRA 4NBXB 2BHUA 3KJ4B 1KXHA 3CZFA 1MFEH 2CALA 4TRPL 3STLB 3BVWA 1N6QH 2CPCA 3CU7A 4DCQB 5I6LA 1M7IA 2K3TA 2EH7L 5KVGH 4NKOA 3G6DH 2BIHA 1Q9WA 1NDMB 2R2BA 5JORA 1LNUB 4IMLA 3ZL4L 1U3HD 1YNTF 2EIZB 2QSQA 4G6AC 5EN2A 5HYJE 2AQTA 2X4RB 5HGBA 4BINA 4Z7VE 2BSED 4FXTA 5I5MA 5DQDL 5JW5A 3ME0A 4OT1H 4GRWH 3WLWD 3QO0B 4FQJH 3X1NA 3GLZA 4F2ME 5FOBB 3M1CA 1LO0H 3BKCL 4ZUSB 1TXKA 4M48H 3DK2A 3GF8A 4TOYH 4OT1L 1FGVH 5C0IB 4NPYB 1VGEH 3ZY7A 1NANI 1K9TA 2LU7A 1U2HA 1RCYA 3O3BA 5IHLB 3DMMD 1IT9H 2Z4TA 1MI5A 4YDIL 4M7LT 5C6PB 1FL3A 2UY6B 4GKSB 4R0LA 5A6IA 1T2QL 3IYLW 4QRRA 3F58H 3KJ6H 2RIKA 3ALXA 3IDMA 4FZ8L 3F12B 3QC5X 1KZQA 3A6OA 1SOKA 2EH7H 2AAVA 1CF8H 1E27A 1RP8A 2VXVH 1RUPL 4Y19A 3GHPA 2C4FT 4ZAKC 1E5ZA 2MQGA 4OKVA 3ECBA 1DCEA 4HJGB 4PVMA 4PG2C 2P46B 4XO3A 4BK5A 1E4JA 2KH2B 2WGNB 2WXLA 3LIUA 2FHBA 4YMPA 3B9KA 3MTXA 4L29B 4WW2C 4HS3B 1C12B 4P3WA 2E27L 2IC2A 4L9LC 2C34A 3PWLB 5CXPA 5ESAB 1KACB 5T3XD 2C9AA 4YDKH 2CKBB 2EILB 2ESVD 4WNQB 1WAEA 2F19H 4TVPH 4JPVH 2VQ1B 1GOGA 2XXMB 4WI8A 3FAWA 1KCSL 5C70A 4JRWA 1ZWIB 1A6PA 43CAA 3NZ8A 4BV1A 4XN4A 1IBFA 3DWTA 4NUGH 1JV5B 2Y7QA 2IEPA 3FZUD 5CHNA 4AY0A 1OHQA 2X09A 2AJ3B 5D2LF 4CDGC 4UOZA 5AAWA 4TSCL 4F8QA 3DX7A 3S96A 1IJNA 5E4AA 4TULL 2V3EA 1R47A 3R06A 4A68A 2ADFL 4G1MA 4EI0A 1TLMA 5B7MA 1PFCA 1UD6A 1BXVA 2VDPL 3W2DH 3WTWA 1JUFA 2A9DA 2UYLB 3QUGA 1A6WL 4HUNB 5FKAB 3HR6A 4IRZL 4N0UE 4NN5B 1EANA 1ETZB 3KLDA 5SWZD 1GYUA 2Z91A 4M29A 1HHKB 4JFOA 4FABH 2G3MA 2A6IB 2IBZX 3GSXA 1SY6L 2FEJA 2PTUA 4GG6E 1S7XA 3GJEA 4IGBA 2NR6C 2R51A 5H37G 3BQUA 3QH3B 3QXUA 4QXWA 4NIKB 4JFZL 2O30A 2XV3A 4NOBA 1TKWB 3QE5A 2RQ8A 4G11A 4JHZA 1NFIA 4JRLA 1OZUA 2W5PA 3U30C 4DP2X 5CD3B 3JQOB 1BQKA 5IVZB 3WIHL 2BNRB 4TQHA 3QIWC 3EJYD 1T3FA 1LDSA 5C9KA 3FH7A 1G1OA 2BZ7A 4MS8D 4HG4K 3KHOA 5TDPB 4DKDC 5FR3A 5ISZD 3D7PA 1MQKH 2C4XA 3V0HA 3Q9PA 4M1DL 4FRWA 3STLA 3CNKA 3U1SL 1ZTXE 4ELKA 4TQEH 5ACZA 3DBXA 4FXLA 4JFDA 1I8UA 4KOCA 4UT6L 3IDJB 5C0BB 4DETA 5KSBF 5JIKA 3I3EA 2MPAL 5KANG 5JHLA 3U36A 3HBQA 5A3ID 2BP5M 5C8JB 2N7SA 1D6EA 4S11A 4TUUA 1T5KA 3GQFA 2CJUL 3EOAB 4IKIA 3NJVA 2NX5E 2Z4QB 1BJ1H 1MFAH 5DJAA 5JW5B 2C9XA 4XH2B 4XWGH 4D9LL 2NX5A 4W93A 1RZPA 3FT2B 1KV3A 5TH2B 2BNQA 4HH9A 1UFGA 2CGZA 3E2HB 3ZHLA 2NYYC 1MAKA 4ABVA 1JTOA 2A9ML 2W07A 4ODTH 3M17A 1P6FA 1HEJC 4DO6A 5KBNC 4XE5B 3VSTA 1CI5A 5T33H 3AAZA 2V2TA 2B59A 3HB3D 3TBVA 3DJRA 5HDWA 4KI5D 4F37K 5T1MB 2YGVA 3D08A 2X4PA 4G8IA 4WGWB 3TL5A 5JQ6H 1UWFA 1BIHA 4PJXE 3OXSB 2VO8A 1JVLA 2Z35A 1GAFL 4B7IA 4H20H 1CU4L 1NAMH 3LD8C 1BXXA 1WA2X 5CD5C 2EEFA 3BKYL 5JR1H 1MW1A 5KYUB 5F1SA 1UOLA 1HILA 4M62H 4QTIL 1EBPA 4ZS7H 3UJIL 4GPVA 3QSKB 4PJDF 5EBWA 4XMZA 3C8KB 1F8TL 3B6SB 1XL4A 5HJ3A 2D2CC 3OR7B 4YBQD 1BZ7A 1ETZA 3FU0A 1F56A 1XGPB 3FFDA 2QGCA 1OTSC 2ZONA 5IROC 5BZWA 2EEXA 5G2NA 4U1KB 2K4AA 1MHHB 4Y0GA 4AYFA 4ENEC 3ILPA 3A0OA 2X4UA 4LGSB 5MI0C 2V8LA 2O93L 2BDNH 5E24E 4AJYV 3BAXA 1NBVL 3O6LL 2Z31A 1BZ9A 1J10A 2ESVB 4LSUL 4WO0A 3IDXL 1ONQB 3BJ91 1V3JA 4XC3L 5C3IA 1NLBH 2HKHH 4MHHG 3UCQA 5AW8B 1S7QB 1SXNA 4UM9B 3PGCB 2B4CC 1XMWA 5D7JD 5IROD 4ZTOL 1FAIH 1QUNA 2Y1VA 2X6BA 2YLHA 4HLZG 3RWJB 4JN2B 1EEZB 1ACZA 1HH9A 3CFEB 1CJYA 4FXKC 4YSDA 2A6JA 3GBEA 3TYGH 5SX4H 4J6RL 4ODVH 3VFTB 4Y7OC 5EO9B 1U30A 3JTBA 3D69B 1MUJB 1AZBA 2CIKA 4LIQH 2EKSB 2H0FA 4JM4H 4KUZL 4HOWA 3I2CH 4R83A 1K4DB 4KH9A 4ZAKD 4GT0A 4PJHB 3BQUC 3CZJA 5F7LB 5GZND 1NIFA 3BGMA 4FG2A 1NICA 1YEKL 4F9LA 3SKOB 4LARL 2WB7A 4HQQL 5JPNC 2OMXB 5DD1L 1TZHA 4RMRA 4ZX4A 4JB9H 5FWQA 3H54A 1JYWA 3KM1A 2VR5A 1LWHA 5EO1B 3J07A 2DEYX 4WZ9A 2K0RA 3IE4A 4ODWB 2JKRM 4PW9A 1NSNL 4CSPA 1XD0A 4NJAL 3HS0C 4OD3H 1LE9B 3DPDA 4E9XA 1HQRA 2FEEI 3UTQA 1CMOA 2I85A 5HHXL 1KNOA 4PRHD 3N5AA 4YO0A 4JRXA 3GBNH 2ENSA 3HMWL 4FQ2L 1PQZA 2F1AA 2P24A 4Y2DA 3SYCA 3T0EE 1IGJB 1TF4A 1F18A 2J72A 4YXHH 2Q3AA 1TMCB 1OAUH 1SN5A 2FJHB 3HBPA 3SDDA 5E99H 3DTUB 1EXHA 1SMOA 1UM4L 2M83A 4RFNC 5EZPA 2NRDA 4WU5A 4ZSOB 4F7CA 3CDZA 3VFOA 3QO1B 1JCVA 3A5VA 4HUVB 4FEMA 1HSBA 1EFXA 4FFWD 4S2SA 2FR4A 1OAQH 3MFFA 1DBKL 2QKSA 1YN7B 1NDTA 2FATH 1KN2H 4O02L 2PYFA 3AITA 3NCBB 1M7IB 1RZKC 3GSNA 2VZVA 4NQSB 1IL1B 4U33A 4U4BA 4M1GH 3BZ4A 3QCVH 4M1CD 2FJGB 4KRPC 5E8PB 4I9WD 1B4TA 2DQUH 3FT4A 2WO3B 5HHMB 3QIUB 1WQVT 1QD0A 4TKWA 4DW2L 1BEYL 4C4KO 3CFBA 3QCTL 1RAMA 2P5WE 5I6XB 2HWZH 4Z7VF 4ZRGA 3FRPG 4HCRH 1E90A 4WHYH 5LGHH 1HKLL 3AY4C 1DE4B 2W0PA 4TSBH 3B7YA 3C6LA 3OPZH 2X9ZA 3KDPB 2IDUA 2HJLB 2FJUB 3OZ9H 4JRXB 5F7KC 2CKBH 4X7DC 2YAHA 4OTXH 3G6AA 3SKJL 1N2RA 3KLAB 3EXLA 4HPYL 5GSVB 3FRPB 4TUKL 1INDL 4F8TA 1M6UA 4FL4B 5TK2A 3MCLH 4QT5B 1KEGH 3ETSA 3K2UL 4ZO9A 4JO3H 1K8IB 4ZD3H 1DVFA 2GB2A 2WBJB 3MXWL 5B21A 3BGMB 5C7XH 3KNBA 3BCDA 1CLCA 3FF8A 4HC1H 4GI6A 4NQCA 1AS8A 4U1IA 3F04A 1D7BA 4K23H 1I8KA 2A4CA 3BH8B 5B1KA 4OW6A 5DC4B 3UZVB 1I3GH 3NG5A 4Z7WB 4EDXA 1QASA 1X5FA 3VG0H 4AZ8B 3ULVC 1RPUA 1R3HA 5D6CA 2NMSA 5BZXA 1J8HA 3BH9A 2Y0SA 1ET8A 1MJ8H 3MACH 1RULH 3KVDD 3LKPA 2RACA 5J9PA 2OZ4A 1I1YA 2H7WA 2DMBA 3MNVA 1A1MA 3OKOB 3U0PA 4HKJB 5EUKB 3PQYA 4LCCA 3FTXA 1E8YA 1U8OA 2VTFA 2EDHA 4NC1C 4ZOBA 3ZE1E 1RJYB 3G5YA 5DYFA 4B50A 4ACPA 4XCNA 2AJYH 4K7FA 4MJ5B 4NYLB 1HL8A 2ITDB 3CHQA 1GW0A 1ZT7B 1AZVA 3V52L 1HJCA 3QAQA 4ZW6A 4IS6A 2VC2L 1FV1A 3MLSL 4LSSL 4E9LA 4Z77A 3MRNA 3IWVA 4DNLA 3TBWA 1GZQA 1U8NA 2B5IC 1F3JA 2QADD 3VD1A 1WWWX 2YUWA 1YEJH 4GEJA 1JPFA 2NUPB 2VM9A 5G4NA 1AR1B 1DQDH 2AQNA 1OAXH 3HS0A 3LQZA 4Z0BH 3WE1A 1NMAL 4YHLL 5CZVH 4HV8B 2A0LC 3S35H 3AG3B 1BAWA 4YBHA 5D7IE 4WIQA 1OCRB 3T1WA 4J2XA 4G2AA 4MVBC 1S3KH 4XMXA 3D39A 4FMVA 2YAOA 1FRGL 4X2UA 2B1AH 1ADQH 5EA0L 1JHTA 1FFOA 5D4JA 5AL0A 1KCVH 2KPWA 4HIEA 1HXMA 3QQ4A 4Y5VC 4DP4X 3MYJA 4OAWB 4HETA 4DKFH 5I17A 3OKOA 3AWGA 2QHLA 4MA1B 4AC2A 1BZ9B 3DGGA 1BVNP 3LXUX 4XNQA 2V9TA 3ATBA 5FM5O 1UM6H 5INDA 1DBJH 4GBXA 4EI5B 3FSZA 2XX0A 1ZTMA 3LV3A 5I82A 4XNXL 4FQHB 1AGEB 4XWOD 2R59A 1KG0A 2W88A 2P3YA 3PP3K 1DL7L 4BQCA 5I24A 1A6VL 2HT4C 3SDXB 5B7FA 3UO8B 3BWUC 3H2WA 4H8WH 3QR2A 3TN0D 5IT2L 3H2PA 1KYOK 5KYUA 2AVFA 5C8JA 1WH0A 5EOQL 1HI6A 1G0DA 2R4RH 1T0MB 1WS7A 3NAAL 3DUSB 1DSYA 4YNYB 3UO1H 1NGQL 1HAWA 3GSVB 3S8FB 3GINA 5AYUH 2H26B 3OLEA 2E59A 2YK1L 4WEEA 4BZ1L 1ZJAA 1SXBA 3LVTA 4J28A 5C09D 2VXTH 5BS0D 3LRSB 1IGML 1HYRC 4HOXA 3QDMD 4AGLA 2AC0A 5EZLA 1WGOA 3JWDH 4XPHH 5DJ8A 1CB4A 2CSPA 1TTFA 3WIAA 1T89C 4HS6A 4JO1L 5CD3A 3KCWA 4P4RA 2OKMA 5KW9L 1EJOL 4EOWL 2OSYA 4NQDA 3HPJA 3QZLA 2GBAA 3GBMH 5D7LE 1IO4C 4WW2F 2VYRE 3UZEC 3PJSB 5DJZA 3GMRA 3HC2A 1DFBH 4PJEB 4Z7WF 4F1SA 2MHAB 5CJXC 4GG6F 5ADOH 2EQDA 2BXYA 1HIMH 4AQZA 5AOZA 4H0GA 3QA3A 4U6XA 4QXUL 4HBQA 1LO2H 4HIXL 3K74B 4M1CC 1FN4A 4J6IA 1EMTH 4BK4A 1I7ZA 4YHIB 5E95B 1TETH 1J5HA 5BXFA 5DWUL 4G5AA 1U95B 4QKXB 1D6VH 1F6FB 2Y7OA 4LLDB 4Y2OA 3SIKA 2VXUL 2P28B 4Y9CA 3DJZA 4QHMA 1Z0NA 3GSVA 4ATTA 3LNDA 4HKZA 1JNNL 4BZ2L 5KVEH 3VX1A 3DIFA 3IAPA 1VKXA 1MFUA 2X87A 3MGOB 3OKNB 3QDMA 1NCUA 4K3DL 2R9HD 5DRWA 5AVYB 3MGTB 1URIA 1Z5HA 3RKDD 3W0WD 3X11B 4PRBA 5IJCC 1ORSA 2WC7A 1GS8A 3RUGE 4HGWB 3L6FA 4GAYA 1TEYA 3BUQA 3ETBJ 3STZB 3TBTB 4S1SH 1G6RL 1GYAA 1U8QA 3TWCL 2GYSA 3KPPB 4L8SA 2XOTA 2ZXAA 2F8OA 3FPYA 1HVXA 1HHGA 2NNAA 3E6HA 4NHCH 1XF1A 1C08A 1ADQA 4B5EA 1A6ZA 5CP3H 1BX2B 4OJFL 4JHWH 1EHKB 4RMBA 1A7RL 4PJ5E 4PEEA 4YBQC 1I8LA 1K2DA 5T3XE 5EZOL 5TF1L 3TP4A 1CK0L 4EIGB 2CRIA 1AIFB 5DCCA 3VXUE 3H6JA 3NVQA 1OB1A 1O5DT 1JZDC 3CLEH 2X2YA 1IAIH 2YPVH 4PP2B 1QFUL 2EUWA 1DQQA 2BOCA 4QRRB 5E1IA 3RDTD 2J21A 5EN3A 1MCNA 1AKPA 2XBZA 3V55A 1UM5H 1I7TB 3ORJA 3NESA 3P4MA 1PVHA 4I0PD 4IBUA 1LEGB 1N7ML 4GQ9H 3UEZA 4Z23A 4K7PY 4JKLA 4ZDHA 3IAQA 3L7FB 3WGVB 3CDCA 4IW4C 4LFHD 4LOEA 2VH5L 4E42B 4BFOA 1DEEB 2AKRA 1AP2B 2YMTA 2BNUA 4EMZA 1F3JB 3O6KL 1C12A 3EJQA 1S8DA 1I3RB 3ME0B 2AAAA 2UY7B 5E56A 5DZLA 5TGBB 1MEXH 1QSFE 2QVKA 3MLRH 4H5SB 3TEWA 2AXFA 4I7ZC 3MOBL 2FD6H 4F33A 5HYIA 5CWSA 5C0RH 4FULA 5K59E 2R23B 1TTAA 2XDHA 4OLXH 1IM3D 4BFEA 3F12A 3SB3A 1S4IA 3KXFE 2AEPL 4LRNH 1RK0B 4XNUL 3F65A 5TE4L 5LHDA 3PIQB 3LS4H 4GEIA 4P05A 1D9KC 1PKOA 3UGXA 5HHMD 4QHNA 1R5VA 5MP6H 4Z7QB 2YEZA 5KS9E 2BNQD 4R8WL 4XN1A 2A2QT 3BUBA 1JD7A 2R56H 3K2MC 4PGEB 3HI1B 2E9IA 1GZPA 1QLEB 3AM8A 3D39E 3MRKB 2ED6A 2MQCA 4OBRA 3X11A 1FG2B 2NY1B 3BZDA 4D8PA 3EG9B 1SYVB 3LH2L 3L2LA 3GNMH 3LX9A 2BJMH 4GRLC 4G9DA 4NQCD 4QRTB 3PV7A 2XFXB 2CUIA 4M6AA 2E7LC 3IETB 2V5MA 4BH8A 2RGSA 1N2RB 2WXGA 3KLAA 4FFYL 3VGHA 2FB4H 5CN3A 4KO6A 5JIHA 3GB7A 1KY7A 3S5LG 4BEIA 1EHLH 2WYZA 4PJ8A 4DVBB 1DVSA 1ITBB 3C6LB 1CT8A 4ZXBA 1JF1A 1XGTA 5BV7C 3U4EB 2EYSB 4HWUA 2HFEB 4Y1AD 4YL4A 2YPVA 2XWDA 1AY1L 2OSLA 3CZLA 1WC7A 3NYKA 1NAKH 1Z7JA 2EE2A 3CFBB 3RIAF 3H7LA 2NY7H 1P4BH 2WYIA 3C60D 5MEPA 3FFCA 3Q3GB 4X4XB 1K6QL 1AD9A 4AH2B 4AEIH 5IMLB 5LCVH 1W0VA 3GI8L 4DAGL 1QKZH 4ZNEA 2DQGL 3KS0J 1FNAA 4GB9A 2J12B 5EU7C 3GTTA 1UB5A 1NM4A 1JDAA 2Q8BL 1J8RA 2L7QA 5IVZA 3RWIA 4D8PB 3ARUA 1A25A 1RZGB 2J8HA 5DVOA 1UT9A 4DZ8B 4CVWA 4E9TA 5HI5D 1JHTB 1CE6B 1O7SA 1U93A 4YUEL 5J12B 3C5SA 4PGEA 4HMDA 5CLZA 5JDSA 4ABUA 2AK1L 3GT6A 4PRDB 4GG6B 5IZ7A 1XH2A 2ZT9C 1EK3A 2R27A 5FO7B 2YR3A 4NIYE 1U8IA 2DQCL 1MH5A 1T22B 4L4VE 2W0FA 4KI5E 2XIDA 4AQ1B 4B3EA 4G9FE 3T0BA 2E7CA 4HK3N 2NW2A 1HHKA 4JFOB 3WJLC 3BISA 2YC1A 1BVNT 1NC4B 1C1EL 2EADA 3D2UB 3G6JF 2Q5BA 2J7LA 2NSMA 1DBAH 2P9RA 3ROLA 3VQ1C 4IRSD 5I16A 3CVHB 3L9YA 3DMMC 5E5RB 3SDYH 4HEME 1T5XA 4IHOA 1E4XH 1W0WB 1JK8A 4FN0A 1NINA 1WA1X 3A4AA 4JPIB 4LOVA 1J12A 3MNZA 1W8NA 3IJHB 4N87A 4S0SD 2RALA 3D09A 1UXLA 4KV5E 4KJYA 4P59L 4U0QB 3VWKB 2OCCB 5SWSE 4ONOA 1OD9A 4H8PA 1A8JH 1MAML 2O6DA 4XN2A 1I1YB 4N9GA 5TDOB 3OMNB 4ENED 1AO7D 1RVFL 3RWHB 3L3JA 5ITBL 4MLIA 1Q9OB 5DTFB 5EZIL 5AFAA 1V3MA 1J0IA 1R3IH 4WJKB 4R84A 3AGVA 2WP3T 5CNHA 3RL1B 3PPSA 3ZTJG 3RPKA 2IGLA 3FTVA 3L5XH 1Q9OA 4JJOA 5E00A 2XZCH 4WK0B 1EEZA 4AGNA 2KYIA 3RWJA 2HX7A 4HT1L 1CFTB 1PLBA 3KPSD 1BQHG 1MPAH 1ZHNB 1JERA 2IWFA 5AW0B 5ESVB 3RWEB 2FX7H 2IFFH 1GCFA 4AVHA 1E9QB 1ROCA 2IQ9L 1GKOA 3ZHNA 1D7FA 1BX2A 1WBXA 1JZ2A 1GYWA 1BBJA 3PYCA 1CD0A 5IHUL 1J1XH 1GOFA 2E4FA 4PWGA 5A6LA 2CK0H 2LE9A 1I7RB 4LEXL 2OYKA 2X44D 4ZMOA 4FNRA 3K5RA 2R8SL 3BDXA 1OD7A 2OR9H 3VXME 5L88H 5FA4A 2VM4A 3F7RA 4KMTL 2YKLH 1TUPA 1C5BL 1YEDB 3G5XA 4RISL 5B3SB 2E7LA 2MQ0A 5CN2A 3JWOL 4FYRA 3C6LD 3MRBA 5CFHA 5DC2A 4O51B 2OX5A 4B9FA 4RIRA 4B9IA 2I07A 3WKMH 2O6PA 2NUTB 1XGYH 2QHRH 2NLJB 4LL9A 1A3RH 3D85A 1AZZC 4JFQA 5E1HB 4I9XA 4HF5H 2VITB 4Q2ZB 5ITFA 3A22A 2K45A 1VFAB 1H19A 1G9NL 4G6FB 4AUYA 1H3VA 4IMKA 3B2VH 5GRYA 5JPNB 5E2VH 1WK0A 1GSMA 2XWJB 3QC6X 2VWEC 1KCUL 4JJ5B 5K9JL 5FCSH 3CSFA 1UJTA 4ZS6C 3LHPL 4DEUA 1OM9A 5H35A 2XN9D 1MDAA 4A6YA 1IGFL 1CVRA 3SGDI 4MD0A 4MMYB 5D2LB 1YN7A 3FO0H 1KN4L 1F6LL 2L7UA 3F62A 3FN9A 3WLBB 5G4MA 4LEOA 1QFPA 3K6SA 4XOCA 4FTVD 3IRPX 2JKLA 1M1XA 3OKMB 3K72A 3CBJB 1QATA 3BVDB 4B95C 3ULUH 1IAII 5EIIB 4YHNB 4OUOA 1RQ5A 3BUIA 4N2HA 3WY2A 3GB7B 4I9WE 1T80A 1G7QB 4PYHA 4J4PA 1MW3A 1USQA 2CCLA 5SV4A 4JRYD 3QWRD 1HE8A 4OCRL 1DO6A 5IVXA 2XV6B 1U8JB 1T20A 2YMOA 1MIEL 2O61B 3AFLA 4QRRE 1CDYA 2ZKXA 5E08L 3O3UN 1TO4A 2Z9TA 2GK2A 3DMMA 3B9KC 3Q2LA 4OU3A 3LQAC 3CN4A 5A40E 4F5CE 4QHUA 2ZQKA 4QAWA 3SCMD 3QZBA 2BNRA 4G42B 1CBVL 1WEJL 1JL8A 5KSAB 2WXHA 4XP4H 5GGSA 1OAJA 1M6OB 4RAVB 3LH9A 1P4LB 3MLPA 3D05A 3D85B 3O6FD 5B3NA 5FYLL 3VWJD 4AKPA 2DM4A 3Q13A 3MRIA 3MUUA 4S0TD 4JG0L 2RAMA 1S9KC 2HJFB 5IB2B 1WO2A 4OJYA 5DHVA 1UGNA 3GJEB 4Y1SA 3T4AA 2UZYA 1XEUA 4YO0B 3SQOH 1HEZB 3BPCA 4NHUB 1JPGA 4H88L 1E7UA 3HAEH 3AS0A 5I30L 1QA9B 3WL9A 1WAPA 2P48B 4CN1A 1I1RA 3CQPA 43C9B 3DECA 1A7PH 5DJCA 3P3TA 2CLZB 1YQVL 5L2JB 1MJUL 2JXMA 2ZNWA 3R0NA 1VADA 3WXVL 5C0GA 4LQFH 5KJRH 2AXGA 1OSPH 3LSOB 1T5WB 3QNYA 4PR5B 4E36A 4HWZB 3IGLA 5IMMB 3ZZSA 5I75B 5IOPA 2BOBB 2QR0B 4FHJA 2OMZB 1BVKA 4KPHH 5JUEL 1AI1L 4FQXA 3RVWD 1JP5A 4YXKH 4GRWE 4QYOA 3NIDF 3IDIB 1FL6A 3O2DH 4GIOA 2BCKB 2XVLA 3ARDA 3DHPA 3PHQA 4NGHL 5EU6B 3WTVA 4E42A 3BT0A 4I18C 4CADA 3X12B 3NCJH 1N8ZA 2VDRH 2FX9L 4MKMA 4PJAB 5EOTA 4OZGE 2YIHA 1PLGL 5C92A 1U8IB 3NFSH 3HAEG 4YWGL 2WMPB 3RNQA 4OZHA 3MR9A 1BZQK 1JYXA 4WSJA 1QHPA 3MLUH 4GAYB 3OC8A 5ERWB 1IMHC 2QADC 3EJCA 4KO7A 2GC7C 2NTSP 1EV2E 1CF1A 4L48A 5IVNA 1P1ZB 1HWWA 4YDVB 2PW1A 1AD0B 1PX8A 3ILDA 2XSKA 4HKJA 4TLUA 1QEWA 2HA1A 3EBAA 2B59B 4IMKC 2BW4A 3RI5K 3QZWG 2XTSA 1U6AH 5CSZB 1MCRA 1USZA 2NSXA 3V9CA 2D3JA 5HY9A 2TAAA 2VDPB 1SQMA 1I31A 3V6OE 2VZOA 3V7AG 5C0AE 5J6SA 1HL4A 5IFHL 2C9RA 2VW7A 4YL9A 2IAND 4N22A 5JPMA 1EAPA 12E8H 3DO7B 5J1AA 2P47B 4XN8A 3RUGB 4ANUA 3M7OA 2X1XR 1YEEH 4OZIE 1KB5L 1NGXA 5KSBA 4BD4A 1KCRH 4C4KT 3OVUB 5JW3H 5I8EA 4WDIA 2WLYA 4W9EC 2GABA 4WI3A 1KT2A 1VDGA 2QQLH 2KLTA 3WXWH 3TC9A 4A7TA 3WI9A 2IG2L 1WJ3A 3D87B 5IESH 1NCAL 3T8VA 1FVCB 4JDZA 4X6DF 3T3MB 3N41F 1ED3B 3EUUA 3JWNC 3W5NA 1JK9A 2HVJB 5DQ9A 5C2BH 1ZANH 4Q52A 4P4KA 5EWIH 3GBLA 5D1XC 4I3SL 4PWHA 3IAGC 2OSLB 3U7YL 4KAQH 3D1MC 3LKQA 1CDBA 1M05B 2I9LB 5ILTH 2ZJSL 4R0LC 3MLZH 2R1WA 1A3LL 2XN0A 1LD9A 4GSDH 5F89B 2X0UA 3IDYC 3EJJX 5BS0B 1JHKL 2WVVA 3GO1L 3QORA 3Q7JA 4A2DA 4EUPH 5F9DC 4E5XG 5JHLH 2ZWSA 1B4LA 3MA7A 3FO9B 5KSVB 1CR9L 1TZIB 5IMOB 3BHBB 1GH7A 2VDLH 5JOFA 4M9OA 4MB5A 3S4SA 2CRZA 3BUDA 4J7RA 3QDGA 4U1HB 4LOUD 1KIPB 4M03A 2YSSA 1GPOL 1UXWB 3CXFA 2ICCA 4JFSA 4XVSL 4QWWD 2B1OA 4N9OB 1U4EA 4N4YB 1XXFC 4NM8L 3S96B 4V1DD 1Y0LB 3SE4A 4CILA 4Z7VA 1HXMB 3QQ4B 3GDCA 4XBEH 2ZPKH 2ZUYA 1INQA 4P2QA 1IKNA 1NUFA 2C9QA 3I9IA 1S7RB 4PREB 5FEBA 2A74A 3QFJA 1KNOB 1UA7A 4XVTL 3BP6B 2W9LA 3T2NL 4DFHA 1FIGH 5FYJH 4WUUA 3QDHA 4GXUM 4HZAA 5F7NC 1IGCH 5CEYA 1A4CA 1S7VB 3IPBA 1T0PB 3O3EA 4P2OD 4U6VL 1BP3B 1M2VA 4YE4H 1ZA6B 1A0QH 1RU9L 3RLSA 2NUPA 1JPFB 5L2KA 1EX0A 1IEBA 3FU7B 1SBSL 5ESQA 4K73A 4F58H 2DLGA 4LLMA 2XWZA 3QWOB 4EVNB 3VXRA 1DDHB 2VQ4A 3ARVA 5CINH 1ACYL 1HWHB 3ZE0F 4KVCH 3U9PH 1SJVA 4J3WA 3D69A 2X89D 2UVFA 1O6TA 4OZFH 3TT1H 4JFED 1KPVB 5SX4I 3K6FA 2DIBA 5C0GB 1YNTA 3L5WB 5BOZG 4DGUA 5L9DL 4KX8A 5DZNA 4N1EA 4JPKL 2VOTA 2YD8A 3UGEA 5F1NB 1HE7A 2DF3A 2ZKHL 1OKEA 3ABMB 2IAMC 5A16A 1OGPA 1FYTD 4OGXL 2EIBA 1NC2B 3BUYA 1RZFL 3PWNA 3Q6FB 4PY7A 5C7ZA 4A04A 1FFPA 2MNWA 1NUDA 1CXIA 1M71B 2LLLA 1T83A 3MGTA 3T08A 3BVUA 4WK4B 1I8KB 3DO4A 2A6DB 4UIKL 5GSRB 5CLXA 4TNWK 4KZ0A 3LZQA 1UB6B 4KRLB 4R7DB 5BV7H 1DVZA 3CN2A 3GMNB 5LG6A 2OFQA 4GIPD 4XMKH 1RMFH 3CVHA 3WV0A 3ZTCC 5C3LD 3FU6A 5EBLB 1JZ6A 4G6ML 2IDSA 3HZVB 2CCWA 4E9VA 5IUSA 1TZIA 3FU9A 1PZSA 2XBTA 1AC6A 4WW1B 1QWHA 3GTNA 3U6RA 3O9WD 2FQEA 5CEYB 6CGTA 5E6IB 1E2VA 2HT4D 4Q9RL 1DLHA 3ZKXC 2ICES 1YYLH 3MV9B 5F7HA 3FSOA 1UTDA 4TLTA 2AXJA 1RIHH 4P4KC 2ZCHH 1TU2B 3TWYA 4ATWA 1BJ8A 1OP5K 1HDMB 1MHCB 3IFLL 3K4AA 2OL3L 1EGJL 4MXWH 4YSEA 1B4RA 25C8H 5E1GA 3VQ2C 5A7EA 4ZUTA 1WHPA 1PBYA 4I4WA 4MX7A 4K7PL 1WV7T 1RUAH 4L8CB 1EDHA 4WHTB 5GGRA 3TJPA 4OUUB 3R0MA 5D2LA 4Z7AA 2E4TA 4Y4HA 2DS4A 5EFIA 3VH8B 3PL6C 5KBMA 4M93B 3S4SB 4DGIH 5GZOD 4EN3C 3HFMH 4XVJL 1R3JB 4XXWC 1NZRA 2UXTA 1FBIL 1WZ1L 3DVNA 5HHOE 5C0CB 1L6XA 2E9BA 1EHAA 4G7VH 1YEHH 3GJFB 4UTAA 3L7EB 2XNAA 1UWGH 3KPMB 3WIHA 1HXKA 2X2IA 4NZTH 4WI2A 3FSAA 3DHJA 1UURA 4PVLA 4ZT1A 1WWAX 3GJFA 3NGBB 4NWUL 5CZKA 4DN4H 4OJAA 1A14L 4YHML 5DD6B 1YQ2A 4IM8A 4JFDB 4N8PA 5LWYL 3OF6A 4R3SB 3IMRA 4LSQL 2CH8A 3QG6A 1TR7A 3QEGH 1ZHKB 4RESB 4FFZH 4CDHA 1CG9A 1QRNA 3PV6A 1NKOA 1JFQH 1FG9C 2D0HA 1VPOH 4LOFA 4UOW0 4P46C 3T6WA 2NTFB 2P80D 5I8EB 4NN5C 5CZRA 5ALBH 4UQ2B 3B2DC 4OCSL 3VXOA 4YNYA 1N4XH 2VUKA 3H3KA 2OJEA 4Y8DC 1U0QA 1QWUA 2O5NA 1FGNL 4RBPH 3MBEA 4RZCA 1NCCH 3O0RH 4I87A 3UPAA 4WWKA 3RNKB 1I8MB 1JCKA 1OQXA 2YXMA 4L2YA 4YGVA 4OCMC 3IGFA 2YAFA 2D9QB 5CGYC 1L0YA 1JN6A 1W0YT 2BZDA 3RVXD 1JDDA 3UBGA 1FCCA 5AW1B 2ORBL 2ENYA 3QXVA 4KNUA 2FWLB 3GSWA 5DQJB 2V5TA 4KJQC 3UBXA 3ARGC 1FE8L 3MRNB 5DUJA 4EZJA 5IKCB 2WLKA 3OF6D 1NMCC 2X0VA 3HC4H 5HVHC 2EYRA 1G7PA 2ZUQB 2ZX8A 4N85A 3SQBB 4C56A 1HU8A 1FORL 4QNPF 2QTEA 3HZMB 4K5NA 4Y4FB 3BDBA 2B4CH 4KTEL 4PWFA 3TV8A 1TZ8A 4HEPA 2P80A 3FU8A 3SDDC 4X4YB 4KZCA 3QXAB 1ZCRA 4QRPE 4XOEA 3GHBL 5AVVB 4H0LC 3FTGB 1OP3H 4OCLC 5FA3A 2ITCA 4Y4FD 2PPAA 7FABH 4N3UA 5CJBA 5E9DD 3ARDB 1X4ZA 1PL3A 1MWAA 5F9OL 4XOAA 4XODA 1OLLA 1GOHA 4XNMB 3RFZB 4MCZB 1YO4A 4WV1C 5D7EA 5EIVA 5C0DB 3HB3B 4OZIA 5LGJB 5MI0B 1E8XA 4UINL 3PHOB 3NK3A 1I7UA 4MA3B 2CGRL 3MXVL 2DQJL 2XFGB 5DEJA 3GUTA 4ZMYA 2MTAA 2R1YA 1GCYA 3FRPA 3WEOA 3D85D 3JWDC 3RU8H 4QXGH 3IMTA 2E86A 3FONB 4ZUWB 4EKXA 4AGPA 4Y4HC 2V5YA 2N01B 1U3YA 5C08B 4U2YA 4JRXE 4XXWA 4PRBB 4JAMB 2BSSA 4F8LA 1PKQA 3W11D 4ODUB 5CJXA 3A24A 4M3HA 3BYYA 4ODHL 3MGOA 5BZDB 4NQCB 2QPUA 1BV8A 1L7TH 3EFDH 2WNKA 3U82B 3II2A 1QTYT 5DJAB 5CR1A 1F6AA 2E8YA 3UBXI 2G60H 1CQYA 3H7BB 3CC5A 5AKRA 4JL1A 3TN0C 2YD5A 1CFMA 1CDCA 4OF7A 3HE6A 3CZGA 4L0PB 3ROOB 4LMQI 4UM9D 2P49B 3TTYA 4UUJB 2DKUA 5E8EB 4R9HA 1RFDH 3H3PH 5JHDD 2M2DA 2PYFB 4ZFFB 4RMVA 3BC9A 1PG7L 5I1IL 3MOQA 4Y4KB 2OBGA 2B1HL 3QK0A 1NGXB 5KSBB 1YG9A 1MREH 4LHUB 4P46A 2X28A 3C5ZC 3RY4A 5IUCA 3RBSA 1K85A 3TO4B 1A7OH 4U1MA 4PJGB 5B8CB 2X1PA 3PGDB 3EDJA 1YYCA 1DHKA 2GJPA 2HRPL 3H4FA 2BSEA 4HKXB 1I1AA 2H3NA 4UQ3A 4HS6B 1LEKA 4N0YL 2JKNA 2DYPB 5EEYA 1DSFL 2DL9A 4DPRA 1EJFA 1RSFA 4G6KL 3WNMA 3WLBA 3BQUB 5LBSA 4O2CA 5DD3H 1MI5D 4H8UA 4JM2A 5FYKU 1A7BA 2APVA 3TEUA 1MHPH 4XPBH 4FTVE 3C6SB 3ZDZE 3MV11 3R1GL 4MRCA 3O3DA 4HJTA 1G0YR 1HC1A 1Q1JH 3HRPA 3FHEA 4JCMA 5BMFH 2X1QA 4CU7A 1L9NA 3QEQD 4V2CB 1CICA 4I18B 2ZWKA 4HS8H 4OVVA 2BIMA 4ZMPA 2WBJC 4QTHA 4HAFA 4YHKH 1RURH 3ZRFC 3FOLB 3LKOA 3O9WB 4FFYA 4LOUC 5ADPH 5CJQH 1EVTC 3RL2A 5IIEB 1IC7L 3V4VA 3DTDA 1WZKA 1CE1L 3MJ8A 1U3HA 1J11A 1SVCP 3OX8B 2XIBA 1UJ3B 2ZSVA 2XG4B 4PJDB 2CRMA 3GZKA 3BDYL 2HH0H 1UD5A 3V6BR 2EIMB 2AEIT 3CFEA 1UKQA 3MOAL 4J3OD 3O45A 3Q8FA 1TEGA 1Y6KR 2XWBB 5JW4Q 1G6RB 1U33A 5E5MA 5I75C 1SUJA 5AOMA 4D7PA 3WNPA 3O6FC 3WMPA 5KUMA 1CDJA 3ZTNH 4RMSA 4MLSA 4KJPD 2WXMA 3SD2A 1B90A 3B9KB 2DQTH 4Z7UF 4OZIB 2IJ0C 1X5HA 2WIIB 2NY0C 1R9FA 1J88A 3V6FA 2JXMB 4ZAKA 2ZCLH 5ANME 5J1SC 3QWOA 4EVNA 2F5AH 1MFNA 2J1WA 5D7JC 4ZMAT 2AJXH 3P3RA 1K2DB 2LT9A 1G7MA 4AIZA 3DUHA 1T03H 1SFDA 3QRGH 1UH2A 3NEEA 1MRDH 5LJYH 5TFSL 3CWGA 3VFRA 1GZQB 5I0ZA 1T0NB 3HCVA 2YPLB 4MDRA 3L9RB 3MRFB 2H41A 2QLVB 2H6OA 3LNHA 5D5MB 3V4VB 5EUOE 1D5MA 4GG6A 4JN2A 3QHFH 4DP0X 3MNMA 4NN6C 1NMBH 2VDOH 1MKFA 3EIFA 3HNVH 5FFOA 3BOVA 3KPLB 3WNNA 1VSCA 4G5ZH 4LNRB 4UCFA 1T4WA 5SWZB 1IGIH 2OXGA 3ASOB 5DJCB 1H8LA 4UILL 5J9PB 4U7SA 4P5MB 1PZ2A 1MCHA 1NPUA 2BP8A 3IJSA 4OSUL 4CSSA 4TUOB 4F1ZA 1JZ4A 2V37A 3UZEA 3QBTB 5CEZD 5IB5A 5JO5A 1DQJA 4OZ4A 3IDYB 1R19A 4OY9A 4IIZA 1P5VA 3OB0H 2EO7A 4RAUB 3EO0A 2DBLH 3A6CL 3CDFA 1MVUB 2UX6A 4AGOA 3H9YA 4NT6B 5EEVA 1UC6A 4MD5A 3CLWA 4OI9A 4OIBA 1QX1A 2NZ9D 4LMQE 1HCVA 2CBTA 1CYWA 3DETC 3BAEH 1CIUA 3KPMA 3NJHA 4NQCE 4LEOB 3DURA 3FO1B 3OWRA 2WNWA 1ETB1 1FNLA 3DX6B 1QLRA 4K3EL 5DURB 2J5LB 4NQDB 3J8F7 1DQTA 2FSEB 1I1AC 3BIKA 4F2EA 5A2CA 3MMEB 5JQIB 1JYNA 3S3BB 3F64A 3G04A 1KBVA 1TG8A 3ARBC 4YSPA 1HT6A 3EDKA 1XBRA 4LPVA 4JM2C 1WHOA 1PNDA 2PXYA 3IFNL 3KPOA 2WYTA 4HOMA 4ZX6A 4DCQA 1JNLL 4M7ZC 2ETWA 3IE9A 3MAWA 2B20A 4PJXA 3W82A 4AH2A 2LABA 2OS7A 4RVBA 3PDOB 4AYID 5I8KH 3UC0H 2ODIA 2A4ZA 2KERA 1DYZA 1OB0A 3BSGA 3PHSA 1IC5H 1BF2A 1F97A 2LR4A 1ASOA 2XPGB 2ZWZA 3ISYA 4KRNA 4DUVA 2PCPA 5D71H 3ZW3A 1HZHL 2P1YA 4M7ZB 5DRZB 5J6GB 5IQOA 4M7LL 4XP1L 5E8PA 4AGQA 1MZZA 2ZCKH 5F6IB 3WE6A 3VI3F 3GSXB 1AJ7L 2PWDA 3SDXA 3RVXC 4DF9A 5ICYA 5FKAA 1E67A 3IGAB 2C1OB 4OZGB 2WLJA 4WEBL 3H56A 6TAAA 2K8QA 1AYRA 5CILL 4ACTA 3H4HA 4HIJB 3WIFB 3EFOB 5AG8A 2MJWA 2GI7A 5GS0D 3D2UD 4JQXC 3WY4A 1F4XH 3B5GA 1XGQA 5BW7A 5ALCH 4WFGE 2AGJL 4A67A 2UXVA 3CIAA 2Y5TB 3OGCB 4PB0L 4OFIA 3IDNB 4QRPA 4BFGA 4F2MA 1AH1A 4DO4A 4GAJL 3MLYL 4X99A 5D1QC 5D2NE 5D7JA 5CBEA 3TOPA 5FA3B 4Z78B 1KWGA 1OPGH 1I7RA 3TPKA 1A6UH 2JFCA 4G8GB 5F7EL 1UATA 4CU8A 3M7FB 4YJZL 5IFAL 1MCDA 4UB0L 4ZX3A 1RZJH 5CCKL 3ESUF 2HLAB 3ILQD 3QJUB 4K3JL 3HE7A 3HN5A 5SWSD 6FABH 3UPRB 2YGQA 3V2AR 1NEZG 1QPXA 3BAYA 3QRBA 3UZQB 2TSAA 4RCAA 3CVHL 1AO7B 3RWDB 4W1TA 3VXUA 3P3SA 5I1HH 3FU7A 2HFFA 2Q9OA 1IM9D 1PMYA 1BVZA 2OYPA 2NCEA 2Z34A 4IHOB 3UBXG 4GKSA 4R0LB 5SX5K 1KEMH 1F0LA 4YIQA 4D7BA 3OR6A 3EADA 1OAYH 2FZ3A 3JUYA 1GXEA 3VXMA 4GAAA 2DMHA 2ICEA 4JG1L 4LPWA 1R75A 4QYAA 3SDCA 4P5TC 3RGVB 3T3PE 1CLYH 5CD5D 1S5IL 4P2QB 4PREA 3F7KA 1LEGA 1X6NA 2FBJH 2Y5TA 4MQ7A 4KZEL 1KLGA 1MCWW 3PGCA 1YUHA 2GTZA 2Z1PA 1EAQA 4HS3A 4JFEE 3TV3L 5I74C 3NMEA 4NO3A 4FQQA 3KJ4C 2GW5A 3LIZH 5DK2B 3MCKB 2R0WH 3UTTE 1WZAA 1I9JH 4JFPA 1KULA 3W9DA 1HZKA 5I2IA 4FMFA 2FGWL 4MMXC 4P2RE 2F5BL 1C16A 1I85C 2F6AA 4FHBD 4IRSC 2F53D 3BEVA 1TQTA 3CN1A 2GJ6D 4X98A 5ANMA 2BIIA 2WSDA 1XCTA 2XWTB 4U4IA 3UPRA 1LWJA 1OV8A 1IKFH 2BVOB 2Y7LA 4PB9H 4XP5H 1A6ZB 2Y1ZA 2ZOLA 3DRTB 3QG7L 4WFHE 4ILDA 4F7PB 2XYCA 3C8KA 4FQLH 4LAJH 5E2UL 1R46A 4NJ9L 3UDWA 1BFOA 4BZYA 5KANI 4X7TA 4WJG3 1ZSDB 4UDTA 4JO5A 5HI4D 3HI5L 1PPIA 2KQMA 1GGCL 3IXAA 5GS0L 5IWLA 2ZYRA 4IOFD 4ALAL 5DS1A 4LQ1A 1G7LA 3BWAB 4XPAL 3C5ZD 1WAAE 3DX2A 5GISH 2BZCA 2IH8A 2CLVA 2D7NA 2H3KA 1M3IA 3OKMA 5GGUB 4XP6H 2XN9B 3TO4A 5AKSA 2OMBA 3HRZA 3B5HA 2Q86A 2EIEA 1ZS2A 4PJAF 3ZDYB 4GUCA 2J88H 3KL3A 1JWSB 1YEWA 5E6IC 2C1PA 5FO9A 4OD1H 1UQSB 5ICYB 4NAJA 3ZT5A 5TPWH 2CBQA 2AANA 1KFAH 5CF3A 1SQ2N 1SRDA 1BREA 4ZS6D 1GGBH 5I74B 1MDTA 3JV0A 1WA0X 4KQ3L 4ZFZB 4AW7A 5DJ6B 4NBZB 3VW3H 2D4FA 4BK5C 5EF0A 3ZO9A 4JRYE 1AE6L 1TMQA 3GI9H 3NQKA 4AYSA 5HD8C 1E4WL 1QSEE 5DMIH 5FW6A 4XPGH 2AJVL 7PCYA 4QRRD 3VTTA 2B0SL 2ZOTA 4BH8B 2DWYA 1F45A 4L9LA 5LN4A 2VSKB 3IMSA 1BDYA 2V3FA 9CGTA 1FZMB 2PYED 1PQZB 4Y2DB 1N5YH 3GMOA 4LSPL 5INCA 5HDRA 3DTXA 3DXAA 1VCAA 1MCJA 3X3GH 4X9YA 1QVOB 3MZTA 4ZMXA 1O6SA 2AV7B 3PL6B 4PJ7E 5K1VA 1ZGLB 3DNKA 5HDBE 1CFBA 1VFOA 1X7QB 3EJUA 4BSWA 4ZMLA 1C8PA 4X50A 2VXQA 3ZIMA 2NNRA 4P57A 5DK2A 1NIEA 2PR4L 4UM8B 5JLZA 3ARDC 4HPOH 4YR6B 3BKJH 2EIJB 4LVNB 1R6VA 2W9DH 4MXVE 3R8QA 3LMJH 4XVUD 5HHPA 4KQ4L 5CEZL 1MCBA 1IAIM 1NM9A 1NBYA 3FO2B 5DJXB 3O2VL 5B1JC 3PUUA 3ULUD 1WG3A 3EDFA 3LZOA 4PPTA 3VG9B 3SSGA 3VXMB 1RK0A 4XI5C 2IPUG 1QR1A 3V95A 1TYEB 4FQHA 4HBCH 4AIZB 2P8MA 3T3MF 4RZKA 2J4WL 4CSZA 1KCBA 4NX0A 2NR6A 5ICUA 4JJHA 5J11B 1L9PA 3MRMA 4PHZA 5D4HA 5DTFA 1XB3A 5FYKH 3O41B 2VDOB 2HFFB 2WWNA 4PGJA 1T7YA 3R06B 3N85L 4D2NA 2XN1A 3IKCB 3BPNB 5EDSA 4NKMA 4G6JL 1NCOA 2ESVE 3H6AA 1DJSA 4MQXD 5I1GL 4LCCC 4H44C 2YD9A 3FL7A 3EGSA 3LZLA 4LNRA 4UT9L 4BQBA 4XGZB 5GGQH 4KKCC 1HQ4A 4N2GA 5F88A 1OPOA 4PJXF 4BHUA 1SLXA 1VJSA 3DV4B 4A6YH 2QFPA 4LVHC 1YUKB 1G7PB 5F21B 1YDPB 4FZEH 4MMXA 2VRKA 3FQRB 1OARH 4WFFE 3RZWA 2VMDA 4P5KA 4AL8L 3B3IB 4AEHL 1CFNA 4Z8FL 5CU9A 3AQXA 1AQ8A 3BGAA 4KRPD 1O5PA 3NZHH 2GPZA 3UDWC 2WLZA 3UJJL 5MEND 3G08A 3BD5A 3IJ9A 4Z77B 4HD9A 2RB8A 3IPEA 3FK3A 4GG8A 3QZWA 1U8CB 4I0PB 3T0AA 1TTBA 3VGEA 3P0YL 1H0DA 4RSVA 1UXSB 5IHZA 2WTPA 4RWYL 4EN3B 5GHWH 4Y4FC 3V5HA 3VCLB 2EDDA 2P8PB 3NTCL 3TO4C 1F1GA 1MCWM 1TQSA 3UMNA 15C8H 1HCFX 3BZ5A 4J8RB 5C0AD 2OMVB 3MQIA 3AG2B 3KPRD 5EOCJ 4EZLA 4YSQA 5IMOA 2W60A 4C83A 3G6AB 2Y1AA 5D1XA 2DLFL 1CD8A 2W65B 4R5VA 3UYRL 4JGUA 4DN3L 3BH9B 3RY6C 2IIJA 3LXAA 2XQYG 5I1AB 5C0BD 5I19H 2EXWD 5D4QA 5FCUH 3NJXA 4P9HL 4MJIB 2C3WA 2XACC 3GXMA 3INUH 2EDRA 4FJYA 2XIIA 1AHWA 5DR5H 1A3QA 3P0VH 5IREA 3FOLA 1AZCA 3ZT6A 3E0GA 3V0WH 2FO1A 2DI8A 4N90E 4G9FA 1NDMA 4O5LL 4WHDA 2OTUA 3UROR 4DVRH 4L4TA 2PXYB 3KPOB 4NQSA 1WISA 1YECH 3DX3A 3F85A 3EF4A 3VFWA 2PWEA 3P30H 5GSVA 3CFNA 1LP9B 4U6HA 2IGTA 4PG9A 4XNYH 1I8AA 2PO6D 3K81A 3TU6A 2ZXDA 2YPLD 2X2JA 3DX6A 3F7VA 5E2TL 1DJXA 1F11B 1N59A 1UFUA 2ED8A 2ITEA 3RIAK 1JBJA 2WWKT 3ZVVA 4RFOH 5DXWA 1ZK9A 3ESNA 2ZAIA 4CVUA 3PWUB 1WZMA 5CJOL 4JKNA 3DGCR 5D1ZA 3PREA 1DUYA 1I9EA 2KC0A 4F7EB 1YEDA 3G5XB 5BO0D 3EH2A 4K8RL 5FA4B 5LBGA 5EC1A 5DC0A 3TNNA 2DTMH 3JTTB 4P2CG 4HUUB 4ONHB 4RX4A 5I5JA 5FLVA 5CZXD 4RA0C 2NZIA 3IJSB 4OM0H 2FL5B 1GS7A 3EH4B 1LGVA 5EO1A 1U42A 4J3OG 3TH4T 1JZHA 4OAWA 5I17B 3ULAB 2HB0A 3BP7A 4HYTB 1FNSL 5J06A 4OFPA 2VIRA 5BZZA 4MCZA 5C0DA 4F9LC 3HZYB 2Q7YB 3QPXL 1ZHNA 2F54B 4MJHA 4XTRC 2N56A 3K8KA 3V4LA 1QYGL 5BQ7A 4N2IA 5TE7H 2J56A 2J71A 1UD2A 4KMQA 1ZV9A 5GRVK 3ISWA 1ESOA 1OP5H 2LAAA 4E68A 1EO8L 3FU3A 1OGAA 3QEQE 1RLWA 4N8UA 5LCVA 4CMMA 1H6EA 2X9XA 5CJOH 2WZ6A 4GO8A 3WJJC 5EV7A 3RGVA 1Z32X 3FONA 4ZUWA 5C6TL 4K3HA 4YVUA 4ADJA 4PRIE 4W6WB 5F1NA 5GGSY 3BPLC 2DDQL 3NQIA 4WHCA 5L0QC 3GSUA 4H2AA 2VSCA 5EU5B 3C2SA 5T3ZH 3EO9H 1SY6A 5F9WC 1RZIA 4MJ5A 3RWGB 4FOMA 2NDFA 5AVWB 4KI5C 3PWPB 4KHXL 4ZODA 4W9LC 5LAPA 3FB7B 1HL9A 3ZDXE 2XG5B 3EYFB 1U92A 43C9A 1GC1C 2NY4B 1E28B 4HDIB 5ANHA 3ETBF 2F58H 1DJWA 2D7TL 4CBPA 2CLRB 2FO4B 4TXVB 5DO2D 4Q6IA 5CBAB 1X9RA 4R26L 5A7BA 1OSEA 3O6FB 2EDYA 5DR5L 5HJ3B 3UAJD 4RQQB 4NZJA 5T5FH 4YDZA 3RVVD 4AQ1A 3DLQR 3INUL 2R9HC 3FTGA 1TIUA 1COBA 2XA3A 5FO7A 4BQ8A 3I3DA 2EEBA 5FCUL 4UTBH 3ZE2E 3FQRA 3ZUCA 5I19L 1BYNA 1HESA 4JLRA 4OGZA 1Z9LA 3RY6A 1AXSB 1SZNA 1FL5A 2NNCA 3LKOB 3IDNA 3L3KB 3CIQA 1YEGL 2UZIH 2JJVA 3O9WA 3M1OA 4XAWH 5I1DA 1XL6A 2IH3A 4JQIA 2XX1A 4GMSL 4PI2A 2IFGA 4ABWA 5D70H 3TBYA 4GKNB 1RZGA 4DZ8A 3PQYB 5JOPD 4N68A 3T0ED 1RIUL 5KVDE 2AJUL 2GIMA 3T09A 4PGBB 15C8L 1YY9C 1BLNB 3AROA 3GK8L 3FYEB 1M9WA 4AQ8A 2B9AA 5H37A 2C1PB 2LOEA 4V33A 2JELL 5FO9B 3ULVH 1R34A 2R29H 1TJXA 3MV8B 1SM3H 2W9EH 3FFCB 2ZUVA 3LEVL 1XR8B 4X5XA 2G5BB 3X1EA 1O0VA 1RJLB 3D25A 4W6YB 5E5LA 1F42A 4M6OL 3KDMA 2IH1B 2O5ZH 4X9GA 5K1NA 1QZ1A 4MVBD 1YJDL 1ZLSH 5LDUA 3BP5A 3HBZA 4PJGE 3VH8G 3S8GB 5E23A 1JMZA 3FUIA 2A6KB 2ZAGA 4WWKB 4HWBL 3VSUA 5HD8D 1CLZH 1LP9A 4U6HB 2X70B 3BLKA 2CO4A 4JPSA 4JFDD 4HP5A 5DUML 4G80A 4A2HA 5KYXA 1HEHC 2Y06H 1IBHA 2NQDA 3DXAB 4KKPA 3Q9QA 3GSNB 2OQJB 1O7DC 1IIKA 4GSQA 1D5BA 1AXIB 5CCGE 3MREB 5JZ7C 3O6MH 3P2TA 4B9GA 3S5ZA 1DQMH 1FFNA 2BIPA 5FUZH 3NSYA 3QNXB 1I82A 3MMEA 5KAQF 2Q86B 4UTCA 1U58A 1KXVC 2DQHL 1WC7B 1LO5B 3L9EA 4NQUA 4RRPA 4UTBA 2QKIB 3LEYL 4HALA 1EAJA 1FQ9C 4FKKA 1PW3A 3I9AA 4XH2A 4KJWD 3HG3A 2GTWA 3C08H 3CFDB 3KWTA 5K33A 4J8QA 4PM1A 5J6HA 5H2BA 3O2VH 4X9IA 3L7EA 5MHSD 1R4XA 1ETJA 3WN5A 1YEFL 3LMJL 1Z9OA 1CFQA 1A2YA 3GJFK 4IBTA 5FHAH 2K78A 2OP4H 3V0VA 4A7GF 4LHUD 5K9KB 1SHWA 1XCTB 2XWTA 3S36H 3SEPA 3VA2C 4PCYA 3S98A 1J8HE 2FRGP 1V05A 3MA9L 2WJ7A 4HK3J 4YDJB 1ZHBB 2ZOLB 3DRTA 1N10A 3GRBA 3CZUB 3LZNA 1PCXA 4RDQG 2CO7A 4U1SB 1WBYA 2DN7A 4ZUUA 5BVJB 5IEHB 2NY3C 1BM7A 4LSDA 3TS8A 1A1OB 5GSRA 3HLAA 3RWEA 4WWPA 4B0MM 4NKIL 4WK2B 1HJBC 4NRYA 1OLZA 1J1PH 2IGFH 4HXBH 2YOCA 4LSPH 4HJ0D 4PJCB 4HU8A 4MMZA 3ARFD 1SHSA 2DI7A 3M1BB 5F97E 4NBYB 4HK0B 1EXGA 4N8CH 5EO9A 1Q0YH 1T4KB 5IQ7L 1HSAA 1C5CL 4LCYB 5CIPB 4D9RD 4A7GA 1G9NC 1E4WH 1S7XB 3VXRD 3LQMA 4KTDL 3RPIA 3PS6A 4OLZH 2G2PA 2C9VA 32C2A 4PGCA 4KQ3H 2XTJE 1ZS8B 4KNTA 3FB5A 1B2YA 4PRHB 4JREC 4HEPG 1F4WL 1ILSA 1X7SA 3V6ZB 4KJYB 4TM9A 4NCDA 1KFAL 4G6AD 4PRPD 2WNGA 2OZNA 2GG1A 4IS6B 1NCNA 4MA8H 4AVKA 4ONGH 5ES4B 1TCRA 3ZE2F 4C56E 4NYLA 3ZTJH 5LAXA 3TZVD 1G7JA 2J88L 1P1VA 2HLAA 2ZD0A 3SO3B 1WVZA 3EJZC 5I26A 5GRJL 1WUNT 3IN0A 1VADB 4QOKE 3U4BH 1FHNA 5ID0A 4K8RC 2H6UA 1MWOA 1T21A 3WDHA 2VDNH 4M6MH 3CFKA 4K7PX 1DANT 1HK6A 2PPEA 3SDDD 3MCYA 3GRWL 2CXGA 2GJ6E 1CL7L 4ZMWA 3EOBA 3NCYP 4RGNC 1FLRL 2NQ3A 4NLAA 2GKIA 2D3LA 1T4KA 2PCPB 3MODH 3MJ8B 3CH8A 1YSOA 4H8HA 5CLTA 4P2OB 4OLYL 1XTLA 3IF1B 2OSWA 1X7QA 2JTDA 2FLBT 4Y19B 1QQDB 4E5XB 1WBZA 3NA9H 3QVAA 4IMLB 4PRHE 3ARGD 2X6AA 1MCEA 4G3YL 4F37F 3C8DA 2ILLA 3I6KA 3IU3A 1W8OA 4G3YH 5T1KB 2V2TB 3DRQB 4WENB 5DO2C 5K93A 3NA9L 1E5UI 1IEBB 4JRXD 3TCLB 4M7JL 5L2KB 2D03H 4HJIA 3VGBA 1I9JL 4L1HA 4OZGA 4P9HC 5KSVA 1EXUB 3C5ZA 4X5QA 4P04A 3WLWC 4J5VA 3V0GA 4OLYH 3MBWB 1F4YL 3GIVA 4ZTPH 4QAMB 3M07A 1JD9A 2AI0L 4MBRA 1FC1A 2NY6B 4F24A 2C3VB 4ZPVB 4KXCA 1FLRH 4ZUSA 3U0TB 2NX5B 5DGQA 3D3VA 1CLYL 3GRWH 3H9SE 5BRZE 2P8LB 5DUPH 5DJ6A 2C5DC 1KB9K 3QQ9C 3U0WH 4DPBX 4OFYD 4U1MB 5B8CA 4JGMA 2OYMA 1ZXKA 4FC3E 1XCXA 3RDJA 4KXDA 3BWSA 3OAYK 4PJ5B 4ZW5A 4Q9QL 4YXLH 2BVEA 2EIZA 3MC0A 4U0RB 3W5MA 1CDHA 4GKZA 4JFHE 4AVJA 4LP8A 2XVGA 2FEDD 3WJMB 2HMID 4MJID 1QSED 4NC2B 1FNFA 4PCSA 1LK3H 2YQ2A 1BQSA 1BF8A 1TJIL 2RCSL 1I8LC 2IPTL 5F3HB 1AHMA 4UBDC 2DQEH 4MNHA 3GMQA 2ADJA 4JM2F 2A1WL 3QDJD 3WY1A 3CSYB 4W9JC 3WYRA 3JVFC 2WZPD 1RZKL 2CDGB 2G9HB 1KBKA 3CG8A 5LG1A 5EU4A 1E6OL 4HUVA 2XZZA 1A6UL 5AUMA 3BD4A 3SN6N 2HG5B 1GSKA 5HDBF 2KT6A 4PB0H 5I1AA 4ONFL 3O6FA 5IVXF 3MRBB 1MVUA 4EPSA 2PP7A 5KN5B 2QPEB 2G75A 5DJDA 2G3ZA 3GZQA 3FCTB 3PLYA 2WVTA 1XSJA 2CKNA 1AYOA 4LPUA 4POZD 3VXTB 2I27N 2I25N 4KNQA 1QHQA 3SGJC 1F1DA 1JWMB 1U3JA 4K9EL 4ODWA 3N9GL 5C07B 1QBMH 3QUMB 3VI4B 3DUSA 4NEHB 3ARXA 3W9EA 1SNRA 3QCUH 1L6PA 4M6NH 4OLUL 1BF5A 5FYKE 1UOWA 3GRGA 4D0BA 4UDUA 2OTPA 4UNVA 4YQXL 4LO9A 4NXKA 3WO4C 4QNPE 5JIPA 5FDWA 2C3XA 4HSCX 2H5UA 2HUEA 4MSWB 4OF6A 3PNWB 5F1IA 4JGNA 4MJ6B 2CKBA 2NYYD 1WE5A 4TSAH 5HY9B 3WFCL 2FZ3B 1QBLH 1PEZA 2H32B 2WUBL 3H0TB 4Q6IB 1LP9F 3PAVA 1JZIA 5LAXB 3PDDA 3O4LB 4HCRA 2VXQH 4LEEA 2NYKA 1J9TA 3QJHB 4PAZA 1FNGB 5KAQG 2FLMA 4YSOA 2R39A 4XCNB 3S3JA 2BOLA 2D31B 5K39B 4G43A 1N12A 4PJBB 2GAZA 1NGPL 2LTQB 3C12A 3P73A 4JNXA 5E5MB 3FB5B 1AGDB 3NH7H 5DEFB 3EHBC 4NKMB 4N5EC 3AVEA 3T8MA 2BSDA 1GGIL 4AMXA 2MIZA 3KS0H 1JK8B 3SDAA 1JDCA 2HN7B 3ZSSA 3C6SA 2W38A 3L95B 1N67A 5IB4B 4PV8B 2VR9A 3O81A 3AS1A 2VLJB 4L8SB 3BAKA 1B6UA 2NY5H 2XRAL 5BRPA 5F9JA 7PAZA 4GXVH 3BD3A 3TN0A 1IAOB 3CHRA 4L5FH 4WI0A 1X4XA 2Q1EA 1NBYB 1S78D 3FO2A 4KK8D 4O58H 5DJXA 4X0NA 4L2LA 2YFOA 3KGTA 4S1QH 1CQKA 2HTKC 1B9KA 1VLXA 5HSFA 1ZDQA 2OMTB 4IOSA 4WW2B 3VFMA 4WJ5A 2F68X 2R29L 2APBA 5AQ0A 2Q7YA 4YDNA 2R2CA 1U95A 3PWVB 4Y2OB 3NIFE 4LAQH 1NWPA 5FB8B 4G8IB 4I1PA 4ZFGH 5K5YA 4BFFA 2ZXGA 3NT0A 2YA2A 2UWEE 2DD8H 3NABL 2ADGA 5CR8A 1KXTB 2HRLA 2IALB 3TIEA 1I1FA 3D0LB 1PJWA 2KS0A 4CJ1A 4NI6A 2X5PA 3HUJE 3L17A 1P0SE 2DWDB 5C07D 3NIFB 4UTBL 3HR5B 5EF3A 4HGKC 2GJZA 2HPOA 4HH9B 4LESA 1PD0A 1M1XB 4BK8A 1PKQE 2PW2B 4ZW7A 5DD5L 5D7KE 3ULSA 2VMJA 1S2EA 3JV6A 3HR5A 2DQDH 4JAMA 5HGDB 3RGHA 1WWBX 1MRDL 2D7TH 2DYPD 3P9MB 1AAJA 1P84K 3FAXA 3QRGL 3FFOA 5EHFA 1IVLA 5FO8A 1T1WA 4UU9A 2IPKA 1Z5LA 1R5IA 1KXQA 3MRDB 2FK9A 5IW6B 1X3DA 1CFSB 3CXHK 1SGKA 1SOQA 2V17L 4JQXA 5B22A 4B9CA 3QIUD 1CXFA 4F57L 1U3HC 5IVXB 2Z7ZA 1XMEB 4HA1A 1H6UA 1L7IL 3MRDA 4NXSA 4Y88A 3ZPDA 3LIZA 2OTUB 5AVRB 3SGJA 1AC0A 2GFBB 5GJSH 2I5YL 4OD2A 4AGMA 2ROXA 4C57C 5I1EH 2VJ8A 2HH0L 3MRKA 3VWKC 1S9WA 3W57A 4EO5A 2E7BA 1XR8A 1EDQA 4PD4J 4QF1A 4B53A 2WHVA 4L3AA 4ZTEA 1CE1H 1BGXH 5AOIA 2X40A 3BPNC 3I9GL 5AALA 3ZDWA 1RI8A 2ZOKB 5FGRA 2X6VA 1D5IH 3FQXB 4WUUE 2A0LD 3MUGB 4L3CA 3SPGA 4W9FC 1XR9A 4Y5YB 3QPXH 1BQHB 3W56A 2F1EA 3HZVA 4KKBD 3DJTA 1LLAA 1A1NA 1VF5C 1FC2D 3BWZA 1FFOB 1A6TB 4GW5B 4W9KC 4ZX5A 4QOKB 3RDTA 4OM0L 3NBNA 5FO2A 2G2RB 1UZ8B 1UB6A 1H0DB 3OSVA 4FP8H 5IBLC 7CGTA 1BOYA 5I1JH 4X5RA 3IKCA 4JE0A 4EUPG 4XPBL 3T3PB 5IFJA 2YGOA 3CSTA 3QEUA 2I60L 1H3PH 4LL1A 5DD3L 4P5TA 5L2KD 3C9NB 2W0KA 3PGFL 3QI9D 3VTMA 4FXGB 4I89A 3QPQC 4P2QE 2KDYA 5JIMA 3DC0A 4UQAA 2A6JB 2CLRA 4ZO7A 3ZKMD 2G5RA 4FD0A 4GMTL 5LUMA 3V7MA 3WCYA 3X14B 1MFMA 1U41A 1CFNB 3UTSE 5AVQB 3NZUA 4X7CC 3QUML 5H8DA 3HHMA 3U6XA 4WV1B 3GSOA 3QUKA 4Z76B 5E4IA 3GS0A 1SMAA 2DLEA 4GMTH 4XNYL 3QI9C 3DYPA 1FZJA 2B77A 5I8CB 3V9EA 2NY4C 1E7VA 2WW8A 1WSST 3RBGA 3KGRA 3QUKB 3RZCC 1HXYB 3DSFH 1QSFA 2YZ1A 3Q06A 4O2EA 2JSFA 3AT8A 1UH3A 3Q8AA 4JHVA 3VRIA 4QLWA 4XNDA 2JKXA 1N5AA 2B8OT 2ARJQ 4LDLB 3V0WL 1RZ8A 5B1BB 3VYOA 5KUKA 4K15A 3NZSA 4JPWL 4KY1L 5GS3A 2R69L 1JIBA 4N0UA 3P0VL 1SN0A 5CN1A 2VAAA 4PYGA 4ODHH 1MNUH 1HHHB 1NANH 2HFGH 3HC3L 4WWOA 3ZL2A 2WZ0A 4CN4A 2WWOA 4ZUVA 3OPUA 3OHMB 3CJJA 3UC2A 2PXYC 5FECB 5ECGA 5IP4A 2DLFH 4P3DB 3GGWA 1J9SA 2VLKD 4MFHA 2XNAB 4R7VA 2X4PB 3MUJA 2DJUA 4XBGA 2WM0A 3UTZB 2XQYK 3PG2A 4HC1A 3GSQB 2ED9A 3HPLA 5FAAA 5GHWL 1RLBA 4HUUA 1DJIA 3HUJF 4LLDA 4BZ1A 2W59A 4JS7A 4N28A 2VERN 3IM1A 1R3LB 3OLGA 5GJSL 5CGBA 1CURA 5JOFB 1JGLL 2J1KA 5JOPE 4JFDE 2NY5C 3B6SA 3ULVD 5DVMA 1NCIA 5DMGC 5J3HD 3UJJH 3ZKQD 4B27A 2W0FB 4ICWA 3OG4B 1NKGA 2K3HA 4AYDC 5KSUB 3OKKA 5FHBH 2H9GA 1HYSC 2GBVA 3BH4A 1BD2D 5HGAA 1B2WH 4JDEB 2YARA 3AJ7A 2P5PA 4LU5H 2CDGA 2OJEB 2WK2A 3QQDB 3GHBH 1T6WA 2H1PH 3ABZA 3MJ7B 4I0KA 4OCWL 4NENA 4P0DA 4XT1C 3SGEI 2G0KA 2WQUA 4A6YB 3L1GA 3ARBB 2Z7YA 1PZ5B 3BWUF 4QRTA 2IH9A 1CYGA 1GY1A 3D4YA 3N41B 4G6JH 3TYFB 5F72S 1E9OB 1O9VA 3G04B 5I0WA 3HC4L 1XTMA 3CBRA 2BWQA 3GSQA 1HOEA 2WCPA 3KBEA 5KVGE 4EI5D 4K94H 2EYTB 2ZTBA 1KTLB 1KGIA 4Y4HD 4UV4H 5HXMA 1TCMA 2YSTA 3LRMA 4E9SA 1QOKA 1QHOA 2UUDH 2BNRD 5HHVL 3CDYA 4XXDA 1T1XB 2W65A 2ZSWB 3CK0L 2Y72A 3DVNB 2JB5L 1NJ9A 4PLJC 3LRHA 2LLGA 3QIBA 4KROC 2W94A 3GLAA 3OL2A 5I28A 2R1XA 2DB8A 3WMSA 1OGSA 4DSYA 3V5KB 3D0AA 4MB1A 5ALBL 1WBXB 3Q8EA 5A2KH 3IT8D 2J6EL 4XBPB 3BZEB 2ZCZA 4GXVL 1T3FB 3L3DA 4L4VD 3BXNA 3ZT7A 4GG8B 2OTWB 1JV2B 4JFPB 3S34H 3AY2A 2N7AA 3EGDA 4N2NA 3U1PA 3IF1A 4H0IA 1GHFH 4G7YH 3VJ6A 2FNWA 4P3CL 2JIXD 2Z7UA 4QRUA 2HMIC 2W92A 4WWKC 5E00B 5MEOA 2HSIA 3L7FA 1V7ML 1OSYA 4R7LA 5KVFL 3PWLA 1M7XA 3GI9L 4YHMH 4OLVH 3VFSA 4C56D 1JNHB 5A16B 2HN7A 1AQMA 3OMZA 1B6DA 4LSTL 3DX1A 2ZOOA 3KPSA 2VXQL 5KYWA 1NFDB 1IFGA 1AVAA 3Q01A 1INQB 1A9VA 4FI8A 4Y4FA