4MZRA

Crystal structure of a polypeptide p53 mutant bound to dna
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
234
structure length
234
Chain Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTAKFGTCTYSPALNKMFVQLAKTVPVQLYVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSSDSDGLAPPQHLIRVEGNLRAEYLDDPNTFRHSVVVPYEPPEVGSDYTTIYFKFMCNSSCMGGMNRRPILVIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRKKTMDGEYFTLQIRGRERFEQFRERNEALELKDAQAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Cellular tumor antigen p53
publication title Reversal of the DNA-Binding-Induced Loop L1 Conformational Switch in an Engineered Human p53 Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 234
sequence length 234
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4mzrA00
2MEJB 2BINA 2VUKA 3Q01A 4QO1B 3KZ8A 1YCSA 5G4OA 3Q06A 4IBWA 4LOEA 3WTWA 4IJTA 1H9DA 1HU8A 2J1ZA 1TSRA 4GUQA 5AOKA 1GZHA 3D09A 4L18A 3WU1A 3WTYA 2IOOA 4IBZA 3VD1A 5LGYA 1CMOA 4IBSA 5A7BA 4AGNA 4AGMA 3D06A 4LO9A 5G4NA 4IBQA 3US1A 2GEQA 3D07A 4IBTA 5AOLA 3QYMA 4IBUA 3Q05A 4AGLA 2OCJA 2J1XA 3D08A 2WGXA 1E50A 3EXJA 2BIMA 2XWCA 1KZYA 2J1YA 4KVPA 3WTXA 4G82A 2IOMA 1IO4C 4A63A 3VD2A 4GUOA 3VD0A 5AOIA 1LJMA 2J21A 4AGOA 5BUAA 2XWRA 4L0ZA 1EAQA 3WTVA 5KBDA 1CO1A 2H1LM 3QYNA 3IGKA 5LAPA 2P52A 2J6WA 2PCXA 2ATAA 2X0VA 2YBGA 2X0WA 5AOJA 1EANA 3ZMEA 5AOMA 5AB9A 2X0UA 3TS8A 2RMNA 3D05A 3EXLA 1UOLA 1HJCA 2J1WA 1T4WA 3WTSA 2AC0A 4XR8C 1EAOA 3D0AA 3US0A 4AGPA 3WTUA 1GZHC 2J20A 4MZRA 5ABAA 4LOFA 2FEJA 4AGQA 2BIPA 2ADYA 1HJBC 2BIQA 4G83A 4IBVA 2IOIA 4HJEA 3WTTA 5ECGA 3KMDA 5G4MA 2BIOA 4IBYA 3IGLA 4L0YA 2AHIA 4MZIA 1TUPA
chains in the Genus database with same CATH superfamily
4NNXA 4OLUL 3O0RL 3OQRA 5F9OL 1ITBB 3DSFL 4MVBD 5DO2D 5FO8B 2O5XH 2BCMA 3BKJH 4N2AA 1RJCA 1NEZA 2JKXA 3N42F 5BS0A 5I0WA 5H4ZA 1W9XA 1MY5A 1T2JA 4HHWA 4L3EE 5CZVL 2DYPA 1IKNA 2HPTA 4LIQH 4GOSA 1DJHA 1VLXA 3PGDA 2XZQL 3EH4B 5AAPA 1MAMH 3GSWA 3FPYA 4WFHE 3ARUA 4AKQA 3BDYL 1MPAH 1E2WA 5CZKA 4P2YA 1P4BL 4XPGH 3NCYS 3VXRE 3KPSE 1ZLUH 4MS8D 3HI6H 2MPAH 5KEZA 2YRZA 2ADGB 2CMRH 1JZGA 2VCOA 1O6SA 1Q9OA 2EE9A 1HYSD 2W81C 4U6XB 1IQDA 1DYZA 5IHWA 2I9TB 1E4HA 3BPCA 5DLLA 1G43A 4AZ8B 4PS4H 3EKCA 1RLWA 2Y25A 3RFZC 3BCDA 1JJUA 3BGMB 4CBZA 2VW4A 2XWBB 4NP4L 4Y1SA 2VXTH 4BFIA 5E0FA 3W3BA 5KAQG 4N2FA 4OFDA 1RIHL 1WICA 3RGVC 5I1LA 4QT5B 4RZCA 2C4FT 4XVTH 4APXB 3QYNA 4G7RB 1KCUL 5LB1A 2F6AA 5HHXH 2F7RA 4GY4A 2VAAB 2H0PA 3B4NA 5ID0B 5IB3B 4DCQA 3D4GA 5LCVL 4Y19D 4A37A 1MJJB 3CZNA 1ZLEA 2I9LB 3K6SB 3RPKA 2WBJD 1CFQA 1CE6B 1OSEA 4PB0H 5I66B 2XI9A 4PLOB 2PO6A 3CNKA 2WMPB 3APFA 1U93B 1TF4A 1OGAE 1TCRA 3AGWA 1YJDH 3WNIA 3WNKA 3TYFA 5K1JA 3L3JB 3VDBA 1F3JB 3PHQA 4PJ9A 4JDEA 3DSFH 1T6BX 4XN2A 5AVWB 1BAGA 1V27A 2HLFD 1YEGH 2G3ZA 4PREB 1F13A 5C0DB 1U3HB 3UTQB 5DYOB 3A6OA 4UDUA 4XB3A 5DJZA 2F8OA 1T4KA 5CZVH 2J71A 2MFNA 3QR2A 2L7EA 4DK3A 1ZVSB 2KI6A 2XV0A 3HMXL 1QTYT 4WQOA 1NMBL 1OB1A 1KC5H 4XRCB 3VU2A 1ECYA 2XZQH 1WRFA 3CCHB 4PJ7E 3WIFB 5H35A 3IGLA 4EI5A 3ARDD 3MODL 4FFVD 1WF5A 2R29A 4GRMB 4UU9A 4J3OC 5A16B 2P24B 4AYFB 1FNLA 5KBNC 2J55A 1PLGH 2V6HA 3HRPA 5E99H 3KYOB 3WY2A 4C47A 1NGYB 1ROCA 2DIJA 1BEYL 4IBWA 1YVLA 4J6RH 3SPCA 3QDMB 3KPRE 1QACA 4Y2OB 4AM0B 3PY9A 2FT8A 1LEIA 4WJ5A 4NZ8A 4R5VA 5JDJA 4NKQB 1XXDC 1WIPA 3TZVA 2VN7A 4NQVB 4AL8L 3REWB 1GC1C 2BJML 1H5BB 2J4WH 4OJFL 5B8CA 1AD0B 4OLYH 2VISA 4QRUA 2HUEA 5C9JB 4O58L 4FZEL 2BERA 3KDPB 4GG6E 4DH2A 1JGEB 2PN5A 4PP1C 3WKML 4RDBA 4G7YL 2DMCA 3OJMB 4XODA 2DRUA 1PSKL 4F2FA 3I2CL 5F7LB 2J8HA 3MJ7B 3CLEL 4NRZA 2W65B 2UZPA 4M1GL 2EDNA 3WUZA 5ICZB 4XNYL 4PRIE 2HN7A 3S36H 3BPLB 2QVTA 3CGTA 5DK0A 1F45A 1LGVA 3CHXA 4NO0A 2UXTA 3ZW3A 2ZJSL 3WO4B 4OIIL 3UFIA 1AP2B 3W81A 4R7NB 1S5HA 4LSSL 3LPFA 4OZ4B 4IS6B 3WEOA 3K72A 3UAFA 3QJUB 4LNVA 2P52A 5EIIA 4UNTA 2EC9T 4JX0A 3CSTA 4KNTA 3W0WA 3TIDB 1WDAA 4FXGA 4HXBH 4OGYH 3N43F 4XO4A 4G8IA 3O11A 3EUDA 5CJBA 2P1YA 4WEMB 3BUIA 4NO5B 1TQSA 1QASA 1WA1X 4FEMA 3AB0C 3HAEH 4Z7WF 2QLYA 2LTQC 2OJEB 2B5IC 1BCIA 1OOAA 1FRGH 3V4PA 3H9SB 3TV3H 5J57B 1E9PB 5C0BD 5KYUB 2D03H 3VFUA 4N2DA 4FYSA 1RZKC 2VLLB 1YEKH 1IKNC 2P5WD 3QDGA 5ITFA 2RD0A 3MLUL 4TVPL 4Y1AD 5D7LD 3VCLB 2BLFA 1JXJA 3BQVA 4LLYB 1COBA 2ZUSA 5DD1L 5JR1L 3JVGA 4EZJA 1YO4A 5JQ6H 2GI7A 2V9UA 3WN5B 1YYLH 4QOKE 4DUVA 1QUNB 1J0YA 4MNHA 3JTSA 1BAFL 3IE4A 2ZUWA 3PXLA 1AGEB 1U8NB 4AL8H 3KMDA 3ATFA 4UZSA 2BJMH 4JUSA 1VCBC 3BH8B 3C5XA 4OJFH 1WFJA 1A6AA 2ZOKA 1NUGA 4O58H 4ZFOA 4TUKL 5TFSH 2YAPA 3QUZA 4WO4D 4HV8B 1E7UA 4PTUA 4U3CA 1ZANH 4KY2A 4P8QA 5JMOC 1F56A 4CVXA 1PSKH 3BP5B 2WQRA 3KE0A 4LLDB 3L3DB 2Z31C 4I0KA 3ZDWA 3PL6A 4BSVB 3MFFA 1DLFH 4HH9A 2XWZA 3L45A 4XNYH 1MCFA 2QVFB 3MC0A 3T3MB 3IXTA 4AEIL 2ZJSH 4KDTA 5K59F 5JHMA 4UQ3A 2RHEA 3HUJA 1D7BA 2UVEA 4AVIA 3ZE2B 1C8QA 5DWUL 4AGMA 3EYQC 3DLQR 4NQTA 5HYSG 43C9A 2CIIA 3L5XL 2NY4D 4PP2B 1GS6X 4UILL 3Q44A 4TNEA 5J7CC 4D2NA 4UIMA 1QO3B 3H3PL 3RJQB 2PO6C 3GMPA 3NIDB 4U6YB 3SYOA 2OXGB 3OAWA 2CHDA 1W80A 1WEJL 3QPQD 3RVVC 4YJZL 2H6UA 5KG9B 5IREA 4ELMF 3WFDL 4PJ9C 2H6PB 3NSCA 1BIHA 1SLVA 3D6GA 3ILPB 5BJTB 1C12B 2WXGA 1KJ2A 5JW3L 4NGHH 3RKDC 5F3HB 4OCSH 1RZ8A 3SDXA 2JJWA 2K70A 2NYZA 4LL1A 3KVPA 4N0UB 2J21A 2YRLA 3FT0A 1QFWI 4S0SD 2APSA 4U1HB 4ZUWA 5G55A 3IDUA 1GGIL 1Q9KB 4TVPH 1DVTA 2GIMA 4AW4A 3MCYA 1ZLSL 4EI5C 3OKLA 4PJCA 5JR1H 2HVKB 1U30A 3UAEA 3LRSA 5SX4H 1AQKH 2GJ6B 2P8LA 4AYSA 3AXIA 3TVMA 3THML 3MZTA 4CSZA 3EXLA 3R8QA 1O75A 4TYUA 2V0AA 5D8JL 3Q13A 2JELL 1K6QH 3F7RA 3GEFA 3OF6D 1I1FA 1NCNA 4JRXA 1IFRA 1UENA 3HMWH 5D2NA 2NNXA 1I9JH 3EGDA 5CJOL 5JLZB 1RVFH 1VB9A 2CIKA 4FTVA 2DF3A 3TZVC 5HHVL 1T5WB 1FZOB 1Z2KA 5AB2A 5B8CC 2A0LD 4XBPB 1YEIH 2BNRD 3CSPA 4ZFQA 3TO2B 1M71B 3ERXA 3A67H 3GI9L 1J5OL 3BQUB 3ENEA 1ROWA 1AQDA 3DX0A 4AEIH 5JORA 2IPKA 4AUUA 3U6RB 1VPOH 1THCA 2DMGA 3O4OC 1CZ8L 5DWUH 2V3FA 4R7VA 4Z95L 4F20A 1KXQE 3NRQA 1JMZA 2VQUA 4TTDD 5E0QA 5JPNB 5INDA 1U8MA 1X5IA 5KVFL 2ZKMX 4LCYA 4JM0A 4F8PA 5E8PB 1U3NA 3Q9QA 2VGLM 3QEGH 3X3FL 5F7HA 5T33H 1PW3A 3O2DL 1R3IH 4EUPB 1N68A 3GBNH 1NUNB 3QIUB 4FQCH 4KOCA 3PWJB 2X6BA 2FE0A 1UFUA 3QT2A 5EEXA 4LU5L 4K15A 2HG0A 4PJFE 4X8GA 5H94B 2BVPA 2ZPKH 3AACA 2YFOA 2WLHA 3V5HB 1INQA 4RCAA 4IOFD 3TA3A 4WHCA 4NQUA 1GGIH 3QDME 4RFEA 4URTB 5GJSL 5E23A 1G5AA 4IBQA 3O45A 2J6EL 1E67A 1WO2A 3G5XA 4AGLA 3MNWB 1B9ZA 4BKTC 4G9FA 4YGVA 5DS1A 2IF7A 1MHCB 3B2XA 4QHMA 1DBKL 5MP6L 1SMDA 3BXNB 2W0FA 4KRPB 3HC2A 4P5KB 2A6JA 1BZDA 1BM7A 2JELH 5I1DB 5E6YA 3NFPB 1AGBA 2LAAA 3GS0A 3EUUA 3KHQA 3RWFB 2R0LH 5DRWA 5CJOH 1XF2A 1BXXA 3SJVD 3K8KA 3HE6B 3V9CA 1RCYA 5DK2B 2XG5B 3OKDA 2HVJB 2MTPA 3ILDA 3SDAD 2O1AA 1KG0A 5LLIC 1AHKA 1XF3A 2KBGA 4B9YA 5JHDD 2BRQA 4LSQH 4JFEB 2W92A 3FB5A 5DSCA 5EPMB 1OK8A 3U48A 3QUZC 3ZUCA 4FQ2H 2CDEB 4GXUM 2PNDA 4B95C 5DS8B 1XIWD 1EK3A 1RKRA 4ZPVB 2EVJA 2RAMA 2YEQA 3P4NA 3FTGA 3BZ4A 4I1RA 3PL6C 2BSBA 2GAZA 4R4BB 4WU5B 1RY7B 2R2BA 2OMUB 3STZA 1SHXA 3FH7A 2R0WL 4H25B 4PSRA 3K0YA 4HLJA 3ESPA 3X3FH 2QGDA 4I3RH 1IBGL 2WM0A 4KDTC 1Z6JT 5L8LB 1OGAA 2BK8A 4AUJA 3WOVA 1QYGL 4P5MB 4M5YL 3IFLH 3QVAA 2VDPH 3DPDA 3H9SE 4XAWH 1XF5B 1CFSB 4HIJB 4E9VA 2V17H 4G8EB 3UBXB 2LGNA 4QTIH 5E5MA 4MA3B 1I3GH 3F84A 1HH9A 3UZEA 2C3WA 3PJLA 1O5DT 3U4BL 4L1LA 4HVBA 5KVDE 1ET5A 2IAMD 2XWDA 5D93B 5E2JA 3GSVA 1EMTL 2XWJB 2PR4L 4NPYB 5ES4B 3FUDA 2B4CH 4PJ7A 4ZQTA 3MV7E 4C83B 5KW9H 2VZUA 2V2WA 4FLRA 4PV8A 1JWSA 2WCGA 5C0IB 1DBKH 3EJYD 5T1KB 4BH7B 5LGKA 1WWAX 1XGQB 1KEMH 5SX4I 2NXYB 4LASL 1OANA 3IAPA 3WTYA 4A2MA 5JXEC 3SD5A 2AVGA 4P57A 3O4LA 4XWGL 2YAEA 3ATDA 4AYID 3UX9B 1ASPA 1ZSHA 1HWHB 4AQ8A 3L1FA 3TLRA 4ZMYA 1QSZA 1IKFH 3TVMC 4MGXA 3VSVA 5JW4R 3UAJD 5J56B 3CX5J 1ZT7A 3TONA 3ZTJG 3ZKND 5IB4A 3IJYA 1C5BL 1MCBA 1VHPA 1HQRB 2YQ3A 5DJ0A 1MFAH 4FTDA 4P59L 4X98B 4CMHC 3T3ME 2HX7A 1XAUA 5D2NC 2QQQA 5HHMB 4GG6A 2V7HB 5FO9B 1D9KC 3ZE2E 3DWTA 1NC4A 4E5XB 4X6CB 4KXZH 4XHJC 4YK4B 1QR1B 2FLMA 3WTVA 5MI0B 4HX1B 3JWNC 4KVNL 3B7YA 4QJ3B 1F58L 4QXTB 5E6IA 1ZGLP 2QPSA 5EBLB 2AJZB 3LD8C 1IBGH 1A4BA 1QSEE 3QQ3A 5T1MB 1T2XA 5GGTA 1MIEL 3OLGA 4MAZA 4ELKB 2R1YB 5IT2L 3OKKA 3RB5A 3APNA 2AQNA 1JV5A 3LEXB 3FOMB 2AJYL 1DQJB 1MVFA 2Q6WB 3V4VH 2BVOB 3HBGA 4JY6A 5ESAA 2VMCA 4Y4FD 2YKLL 1LE5A 3MX0B 4WNQB 3TEYA 3SZKC 3VD3A 4JM2D 5DMYA 5L6YH 1EMTH 1KCVH 5FDYA 5AVYB 3PV7A 3RE0A 4OAWA 1ZJBA 2GJ6E 3D50A 3KM2A 3WFZA 1P7QD 3ZKQD 4YNYA 1WAAA 2GSMB 1HILB 2OMWB 3APCA 1RUQL 4WW2A 3TA3C 4FYQA 9CGTA 4G83A 4H4NA 3TF7C 1DQTA 1FVDA 1C08B 4BUQA 5EA0H 2WO2B 4LAQL 1NC2A 1M7IB 3TBSB 3UL4A 4AI7A 4XWGH 3SQOH 2D3LA 3Q1SH 4W9DC 1V3JA 1VKXB 3VWKA 5KSAA 3DURB 2MPVA 4P4KD 2CA3A 43CAB 5FB8B 3SE3A 3G5YB 4PGEB 3TNMB 4ACPA 2CU9A 4QOKA 5IMKB 1WITA 3JZ7A 2I26N 2NUPB 1NCAL 1KYOK 1T6WA 2YJLA 3QNZA 4CJ0A 4Z77B 3FXIC 4P59H 2NQ3A 4RISL 4TLSA 5KVGH 4K5LA 3I9AA 3EF7A 1JYNA 5EU5B 3QEHB 4MD5A 2ORBL 1MZYA 4U1NB 4Y1TA 3RI5K 3LPOA 3N85L 1FHGA 1R17A 2CJUL 2H2SD 4ZUTB 4KO5A 5JOPD 2I5YH 3S8GB 2EC8A 3DX4A 1F58H 2Q8AL 5T3ZL 5DRZA 1N26A 4PTTB 4LSPH 5CD3A 4BZ1H 1DVFA 2DD8H 3HG0A 4PJDA 3UO8B 2I69A 4U0QB 2VN3A 2G5BA 1L7TH 3K3QA 5B38B 2AJYH 5MEOA 2ZTBA 3QZWA 2G30A 4NKMA 1GZQB 4HZAA 2HFEB 4WU7A 1F97A 3AC0A 1GYVA 4RNRB 3MTXA 5HGHA 3MRDB 5C07B 2I7OA 4K3HA 2OS7A 2DWEB 2G0LA 3KAAA 1Q9LA 3IEAA 2X4TA 3R7QA 1USQA 1SHSA 4DF9A 4WWPA 1N6VA 2XV2A 1SEBA 4K7PY 5BQDA 4LAQH 4AIEA 1NLDH 3N1GC 3UTZA 5I17B 5K9JH 3SDDA 4WWKD 1D6VH 3BDBA 1OAZL 3V79C 1UA3A 2DEYX 2VW7A 3WN6A 1Z3GL 4UANA 1KLUA 3QFDB 1NCAH 1GY1A 2UZYB 4OTXH 5ABAA 3B2DC 5C3LD 4JFEE 3KEHA 3MLYL 4L4TB 1UT2A 1LWRA 1NDGA 2NSMA 2PTTA 2R23A 3FU8A 2CBMA 1HN1A 3G5ZB 3LKQA 3TCLA 2R1WB 3FRPG 3KR3H 4APXA 4AQ8C 1OAYL 4J27A 4C58B 4PS3A 3DHJA 2Z3FA 3ESVF 4KROC 2WSDA 5LVEA 2UY7A 4JHWH 2R7EA 3GEWB 3MV9B 4LVNB 4LHQB 5ID0A 1A1OA 3QUML 3WG7B 3L17A 4JRYB 2NTFB 1PZUB 1OTSC 1LO3H 3SPVA 2P8PA 4MWFA 1QSVA 1BZEA 3PWUB 4JZNA 4KXZI 1I8KB 4RAVA 1CE6A 3K2UL 4X7DC 1U58B 2X2HA 5T3ZH 5SWSB 1JD7A 3BW9A 4MBOA 3BKCL 3SGKA 4Y5XB 2AQQA 3RGVD 3FCSB 1XF4B 4WENB 3L3JA 4KKRA 3VM7A 2JKIS 3N9GH 2QSTA 3W11C 4R0LB 1XR8B 1A8ZA 5DFVC 3ABZA 3QISA 2WVVA 1G6RL 1JPSL 4YDVB 2B2XL 2VWEE 3P2BA 5F3FA 4HUKB 4CVUA 5CN3A 5I1CL 5E6IC 4B9KC 5AW8B 3VRJB 4EQ2A 4OI7A 4V1DB 3K6IA 4MMZA 4U1GC 2V2TA 2W80C 4DN3H 4KBPA 1E0OB 5CHNA 2IMNA 4G1EA 3FQRB 2NNRA 3QR0A 1XQ4A 3DK0A 4S0HA 1RUAH 1YMMD 5FYLE 1S46A 2L0DA 4PJFA 1M1SA 1UEMA 4B3VA 1JXDA 1K4DA 4UDTB 2E7CA 1P1ZB 4OBRA 1J86A 1P5UA 3CC5B 5F7DB 3VGAC 3WBDA 5BRPA 1I9IL 2A74A 4ZO9A 2CLZB 3AUWB 4EF3A 4DUWA 2ZNWA 5D71H 3G6AB 4NDMA 1OAZH 1D5IL 1Z66A 3TC9A 5DZPA 2CKBL 3OKYA 5GGRA 3TO4A 5D4QA 1RPUA 2R4SL 1S9XA 3EH1A 2Q3XA 4WW2C 2KDGA 3IDIB 1WCQA 5C3TA 3WYRA 4XNDA 3FF7A 1FL6A 1OCOB 1A0QL 3FT3B 4NQVA 4Y7OC 4G3YH 4E2OA 1MCSA 1R0AL 1BVOA 1H8NA 3QK0A 3V6BR 4WWNA 3D4YA 4MAYC 2MH4A 3QORC 1XX9C 5AW5B 2VDRH 1TZHA 3CHQA 5CIPB 1UD3A 5HHME 3VWKC 5HGDB 4QRTA 5KSAC 4N8CL 4X6CE 1TXKA 3SE3C 3C87A 2GT9A 2LVEA 4GS7B 1AGFB 4YHLH 1JZEA 1LP9B 3DMMB 5KYWA 3QUMH 1HTYA 1KGCD 3EYOA 3O6KL 2ZUVA 3OZ9H 4XOAA 5T3XD 4U1SA 3OSVA 4QJ4B 1FORH 5E5RB 4JAMA 2BM3A 2XRAH 3MJ8B 4X7TB 5IESL 4MA1B 1AP2A 3L6FB 5DS2A 1H6FA 4QRSA 3DRQB 4AE0A 3ULUE 2AEQL 3DJSA 4D94A 5AZEL 3PRZA 1KCWA 2LV4A 2WYHA 4HBCL 4EDXB 4TQPA 1FFPA 5I1CH 1KYOJ 1MRCH 4ZYKA 2GBVA 2QKSA 3J2PA 3LKRA 4WAFA 1DVFC 1X6LA 3KCWA 5L8KB 2FB4L 3CLFL 1YUKB 2Z93A 2FYVA 4HGWA 4JFHE 3KDMA 1TOXA 4AT6A 2DJUA 4XNMB 2E3VA 4F58L 1A4KB 2FLRT 3DV6A 3ZDXB 4ADIA 4X7SL 3MUGB 4ZS7L 3IMUA 2M83A 4X8JA 2A6DB 3WDJA 3P9LB 2HG5B 2H41A 2DS4A 4GO6B 2IG2H 4HS3B 4LMQI 3U36B 5LQBL 3HG1A 3QAQA 3QC5X 3GJFK 3FUEA 2GW5A 3OL2A 1SLXA 4HDIB 5HI4D 3D09A 3GK8L 3UBGA 4LLYA 3AABA 4ADGA 5I9QC 2DW5A 2XKNB 4RMWA 4H44C 1MW3A 3MV7A 1IGIH 1P9MA 4GRWH 3RIFK 4PCKA 3EFDL 4HOWA 3LNDA 3WSQL 4Q6IC 2C9VA 2V33A 3LY6A 1QWUA 2NOYA 3BWUC 5IVXF 1EHLL 1BEXA 4BELD 2BSSB 2DYPD 4PJ8B 4P9HL 4EVNA 1IEAB 4YL4A 3SDDC 1HEHC 2ZYIA 4N9OB 4YFDB 4ELMB 3SHSA 2H47C 1EZSA 1G7PA 2IPTL 3FO1B 4BFKA 3BPNB 2P45B 2ZYRA 3QNYB 1ZSDB 3QQ4B 3HW7A 1G87A 4C4UA 4DESA 1UYWL 1PLBA 1E6OH 2CD0A 2FCBA 3MHZA 1KIPA 1AMYA 3IMSA 3OKOA 1ETZA 2XNAB 5HVWA 5JXAH 5HI5C 2A9NL 3NCJL 1P6WA 2WWKT 1KCSL 1ZWIA 2NY3B 1BPVA 1BVKA 5J5EA 2CDFA 3R06A 3ZMEA 5F3BB 2Z31D 1QO3A 1CLCA 2BY3A 4U6YA 3SGKC 1J8HA 1AS6A 5LDUA 5KG9A 3PDOA 5GSRB 2NY5H 5C07E 2TSAA 2Y7NA 4YXLH 1Z0MA 1OARH 5LG6A 1QSEA 4OD3H 4A7UA 5J6GA 3ARBD 4F58H 1TCMA 3F58H 2CRMA 2QQKH 3OLDA 3K1DA 5HI3D 4JJOA 2WNKA 2X3CA 4Z7NB 4CGUB 3S8FB 3EYQD 1KXTB 2VZOA 4FQIL 4XN4A 1CC3A 2O6FA 3BH9B 2N1TE 4MMZC 1DJXA 4LPTA 3P4LA 5LQBH 1RUML 4KHXL 1CICD 2PO6D 2ERJC 3PCYA 3PF2A 2J8UA 2A9MH 2R69L 3LEVH 2EABA 3RVVD 4HIHB 3UXFA 4TQEL 4KKZA 5LWYH 2Z35B 5D7SH 1G7QB 3LZFL 4PJ9D 3MXWL 3OGOE 4PI2A 1U3JA 5ERWB 4A2GA 4Z6AT 2AGJL 4YSSA 2D3JA 5EU7C 2EIMB 5MHSD 4HWUA 3RKDD 2AHIA 3N1PC 2QSVA 3I9PA 1HHGA 1GOHA 2JIXA 1KDIA 2VMJA 3OXRA 4OKVA 1NUFA 1P5UC 2PABA 4NUGH 1KIQA 1FNSL 2KL6A 4P9HH 2A74C 3OHXA 4HUMB 3KG5A 4X80H 2ZOLB 4QYOA 1ZHBA 1X5KA 4ZO7A 4G43B 3TO4C 4DNLA 5C09B 5JLZA 4KUZH 1AKPA 2EC9U 1TQCB 4JRYE 1OAKL 5EU3B 4HCRL 4Y89A 4GRWF 2DQCL 3AG2B 1IGYB 5SWSE 1X4ZA 1YEEL 1UYWH 2Q7AA 5I74C 4PJIF 2WXOA 1F6AB 4OGAC 2AXWA 3E6FA 1E3FA 3V7AG 3FH5A 5JIIA 4HWBL 3ZE1B 1JGUH 3CQPA 3BHBA 3NCJH 5C0AE 3P30H 3TZVD 1X5XA 4KTGA 3ASNB 4HIQA 5T5NG 1OHZA 4RAUA 3SKMA 3T4AB 4UTAH 2QHRL 4V1DE 4F7PA 2EUXA 3W82A 2J73A 1MCKA 2OI9B 3DK2A 1CIDA 3RI5F 5DI8B 4UT6L 4FD0A 2XX0A 3WE6A 2R1XB 4JG9A 2E6PA 3QIUA 1I7UB 3PWJA 4K71C 2KLTA 4L9LB 2PWHA 3IS1X 1LM8V 4DKFL 2DQHH 5F6IC 4XNUH 5KSVA 2VDLL 4CDHA 5CD5C 1TTUA 1JHLL 5TH2A 2FWSA 3HNSL 1FZKB 2Z92B 1KYUA 4ALAL 5E6UB 2R69H 2WKGA 4FQQB 2YFNA 2ZOWA 4NO0D 2I07B 3M7FB 4H20L 4TQEH 1DFBL 1JXGA 3MXWH 5B1AB 3T77B 5DHMC 3MNWA 4KMTH 4K3JL 2C3GA 1PD0A 1QMUA 4NOBA 4QRFA 1I8UA 4JFSA 1AAJA 3VI3B 3BXNA 3W0WD 3MYZA 3P0VL 2ICWJ 2QSCL 2OMYB 3G6DL 3IFNH 5E4EB 4MKMA 3MOBL 5I0DA 1BQHG 2O72A 5EZOL 3DX9A 4JY4B 1I3VA 5ALBH 1QOKA 2ALWA 3LB6D 5SWZD 4JG1H 4KQ0A 1BF5A 3UTTA 3C08H 3VGFA 1LP9E 2XICA 1P9MC 4AENA 3WUWA 3L54A 1INDL 1URLA 2X7LB 3MA7B 1HJBC 2C4XA 3D5OF 5DK2A 4AQEB 1EJOL 4O02H 2X4SB 4YPGB 3MBWB 4BZYA 2KDYA 3TT1L 3TP4A 3VG0L 1OTUC 1G94A 4MZIA 1T5XB 2A4EA 4A2LA 1JVKA 4NWTL 4HZ1A 1MNUL 5I23A 4JFDB 3D9AH 4KRMB 3S96B 4RMUA 2JI3A 5DS8A 1F86A 4BIKA 4JPVL 4E9RA 2R27A 1F18A 3BKYH 3CMOH 3P40A 1JPGB 4UB0L 1FBIL 2RCSH 3UPRA 3RAJL 4FS0A 5HHOA 5I76A 3QRGH 5DZLA 3KJ6H 3U1SL 1BFOB 2XY1A 1QI4A 1VSCA 1GMIA 1JGIA 3DTUB 3VFMB 3RWDB 3BO8B 3QUZD 3ZDXE 2Y7SA 4Q0XH 5A7EA 4FP8L 2ZP9A 1LLAA 2HPOA 5ICXB 3WLBA 5E08L 1ZKAA 3U9UA 4DKFH 3MCKB 1RK7A 4HIJA 5ACZA 2EDJA 3H9HB 4OZGB 4FFYA 2EIZA 2AITA 1YC7A 3REVB 5J9PA 3GJFH 5GSVA 4B7LA 1F1AA 4MNGB 3HRZB 4K3JH 2X9YA 2BNQD 4BXVA 3BVDB 4M9PA 5T1KA 3SKJH 4CC1A 5A2CA 1JZ7A 5LXGH 1PY0A 2YN5A 3D48R 3P0VH 1GHFL 5FW8A 1V3KA 1R3KB 1J5HA 1A7PH 5C0CE 4XP9H 5EZOH 5IMMA 4HJTA 3WKYA 3OKEB 4WI0A 5GGUA 4QXWA 5MENB 1FVCB 1S7WB 2HJKA 3LIZA 1N4XH 3A23A 2J12B 3IJSB 4JFFE 1INDH 3QZPA 5F9JA 4BYHA 4PJXF 3BVWA 5EZIL 5IW6B 2FVNA 3KLSA 2F8VA 3FOLA 2W07A 1OV8A 1CPUA 2R59A 5TQ0L 1S9VB 3OHXC 1MDTA 3U25A 5D6CA 5K69A 5CILH 1V3LA 1YN7B 3R18A 1XD1A 4X98A 3SGJC 5L2KA 3ARYA 3QFJE 4JY5L 1AXTL 2VLJB 4NWTH 5ANMB 5JXED 1MNUH 1WYJA 2XN2A 5HHNA 1HQ4A 1KBGH 3S3CB 3OZKA 3ZQXA 4HIPA 2NSXA 5CBAB 5CM1A 1XEDA 4ABQA 4FA6A 3F6JA 4UQDA 1DQDL 1S7QB 2K8MA 2IWKA 3TVMD 5E8OA 3ECVA 4K23L 2G2RA 1CE1H 1MFCL 3B2VL 3F6LA 4LSRL 2JSFA 1U8JB 1YYMH 3NQKA 1GRWA 4PBDA 3QIBA 3V8CA 2BC4A 4XXCA 1PAZA 3RB7A 5A6IA 1FE8H 1D9KD 1MVUB 1MCEA 2ZCKL 3X13A 3WNPA 4Z7NE 4KC3B 4HUXB 3EH5B 4FG4A 1KPUA 3OB8A 4XHJD 5FUZL 3S37L 3P3UA 2L7QA 2MQCA 4YZFF 3C5JA 3CZFA 3AMKA 1IQWH 2WP3T 1JK9B 2BP3A 3V6ZB 3L4UA 4JO3L 3U0PA 4IJTA 3MRNA 3GRWA 1HU8A 5B4MC 5B1KA 2JQZA 3WS3A 4PRDA 3KS0J 3VFSB 3CVCA 3JBG7 1GHFH 1PJWA 4NC1E 1VADA 3Q7JA 1C16A 3MUY1 4ZMZA 4FKKA 4ZFZA 2YQGA 5C09E 1EA9C 4ZX6A 5EUOE 4H88L 4ZSOA 1I8IB 2J5LB 2NYKA 1JZ4A 2BSDA 3CQFA 2HWZL 4LLVB 3O2VL 4O2FA 1CD1A 3GRBA 3TA3D 3WFEL 1UVQA 4AMKL 3PQYB 1BBDL 2AJ3A 4XPBL 5I15L 4ODUA 1F3DH 3RIFF 3SO5A 4D9QD 1ETA1 1IO4C 2ZYHA 4JNXA 5I71B 1HESA 4NJAL 2XFXB 1E3ZA 2GSGB 4G9FD 2NY1C 3DO4A 2A6IB 4KXCA 4FQHA 3U0WL 5HJGA 4XE5B 2VR5A 12E8H 4N8VA 2OTPA 5JTWA 3B2VH 5D1XA 3C2AH 1ZE3C 2XX1A 3KS0H 2ZXAA 5KANI 3SBQA 5KOVC 5AALA 3RL2A 4PTTA 5IKCA 3FMGL 4LZKA 1WFUA 3L4VA 4CSPA 4RMTA 1CDCA 1BWWA 2GKIA 2LU4A 2FHFA 5IFJB 3OJDB 4M8QA 2VDKL 1CB4A 3ZHKA 2WKOF 4AZUA 3L9RA 3O41A 4XXDA 3US0A 2W60A 4KV5F 1SXNA 4WUKL 6FABH 3VWJD 2EH7L 1UB5A 2CHWA 1IAKA 5HHPB 4JO3H 3CHSA 1A1NA 1ZPLA 2R15A 3GMLA 5CZRA 2Y2WA 3DBSA 1VRSA 4X4YB 3NDYE 3O6FD 3VI3E 1EVTC 2VWEC 3QFGA 4I89A 4XZUA 3GB7B 3MLZH 3FNKA 2CM6A 3WEXB 1Z9PA 3EDEA 3AS3A 1W8NA 5HSFA 3QCVH 1N6UA 4XCCL 2VLMD 1WHPA 2CUAA 1G1OA 1SF3A 2G60L 3LS5L 5EBMA 8CGTA 1PFCA 4XOBA 1L9TA 1C9SA 4NP9A 5JMRA 1Q9WB 3LEYH 1IM3A 2VDOL 1B0RA 1JZ2A 5ADOL 3I6GA 4M1DH 2ARJQ 2JMRA 2X4OB 4RA0C 5I1EH 2F8IA 5AVXB 3QFDA 5IROA 5HYQA 4LPCA 1HDMB 1SN2A 2A1WH 1ETB1 1SOSA 5TTRA 3G5ZA 3VM5A 1TJXA 4JFDE 4AQAA 3HAEG 4WFFD 3MLTB 1PZ2A 1M57B 3MXVH 4ZOBA 3AY2A 3UYPA 1JG9A 1EX0A 1T0PB 2D4DA 3MCG1 4L9DA 2E9IA 3EFOB 5CCKH 1DE4B 1JCVA 1NJ9B 1BQLL 4PBXA 5T1LB 4W9FC 3Q2WA 2QQNL 5FYJE 3Q5TA 3O4LD 3KPNA 1WWCA 5F9WC 1T04B 4AKPA 2NW3B 2PETA 2VXQA 1G9NC 1MAKA 3D85B 4P2OA 5C0AA 3DGGA 3VD2A 2NY6C 3WFCH 1X5MA 3MUUA 3K6DA 1OTSD 2B20A 4K9EH 4CJ1A 3VXSE 1CTMA 1WZLA 4DAGH 2AK4D 3QJFB 4UTBA 1MCWW 5A1AA 2EH7H 4L37B 2BXYA 2ED7A 3QIBC 3VI4F 1XGPB 1IBDA 1QWNA 1UZ6F 4XXCC 4JQIA 1P4IL 5E6RB 4TLUA 1RUKL 4MNGE 1H3GA 1NC4D 3ZKXC 1S7SB 2PW2B 4FQJL 3W11D 1QHOA 3JYBA 5BW7A 1KGUA 2F53B 4ZX5A 3DV4B 1LO0L 3SODB 1IKOP 3UYRH 4DP7X 1MIMH 4YHYB 2XTSA 4M7LL 4JGUA 1IM9D 5E6ID 4ZUSB 2X5PA 1E2ZA 5MENE 1M2OA 3LS5H 1HFUA 3Q5OA 4JO1L 2QTVA 2EDFA 2IFFL 4JG0L 4QKXB 1I7ZA 3G6AA 2ZKYA 1JV2A 5LNEA 4ZG1A 2VDOH 5IW3A 1A25A 2OK0L 5ADOH 3EAKA 3EJUA 1QG3A 1ZV5A 4AMWA 1I8MB 4L8SB 1CWVA 2FO4B 4I4WB 1J1OH 4ELDA 4Z7QB 4MJIA 1YNKH 2WWOA 3NIFF 4PJEA 3AAZA 1E3XA 4OQTA 1NKOA 1FJ1B 4RGMC 5EZLB 5KVFE 2VLJE 5ANME 4ERSL 4HJEA 4X7CC 1N8OE 4HALA 4Q7DA 3RDTB 4FQXB 2VMFA 5B39A 2CDGB 1YC8A 2GTZA 2DLHA 2GY7B 3ULVH 2NNCA 4HU2A 1NAKL 2WLJA 1TQUA 2RFXA 1D5XB 1TO5A 2HP4A 2HT4C 2NRDA 4DEPB 3AXHA 4YBLB 4P23B 4B7IA 3UTPD 1UT9A 3IKCB 3VTTA 4PGJA 2DWTA 1IGTB 3BAEL 4G6KH 1CLZH 1NC2D 2HB0A 4PEEA 4Q9BA 2WBXA 3LAFA 4MAYD 5C7XL 3QORD 3CN0A 1BG9A 1G7HB 4U3SA 3VWKD 1ORQB 5KSAD 3B8YA 3I9GL 1BD2B 3SN6N 4DGWC 3CZUB 4HIXL 3DO7A 5HGAA 5D1XC 1OEZW 1MHPH 4R5TA 1Q72H 2M8XA 1UA6H 1YY8A 3FBQA 2OQJA 3EBAA 1GPOH 2WBWB 3HZ3A 2VN4A 3G5VA 4I9WE 8PAZA 5ID1B 5JDSB 4MMXB 4ZUVA 1YAZA 2B1AL 2DQUH 4I18A 5FYKL 3BJLA 3FULA 4DQAA 3OWRA 3VG9C 1PZSA 3CSFA 4H8WL 4LDLB 1UOWA 2FBJL 1TVBA 3WD5H 2A6DA 4EO5A 1HEZB 4M7LH 1UB6A 3O3UN 3WIIH 3FFCD 2D2OA 1KPRB 4ZI8A 2CLRB 3KLQA 5JHAA 2BSRB 5I19L 1IIKA 1DVFD 3OX8B 4KOBA 1X7SA 1GR7A 1DN0A 3HG2A 4PJAF 3RZCB 3W9DA 2HKAA 1MQKL 4L1SA 3E2HC 3KGTA 4X6DF 3QARA 1YUHB 1AACA 4J4PA 3RG1C 2CO6A 2DY2A 2NZIA 5HYEA 3KLDA 4H0HB 3PQYE 3S37X 3UG3A 4X9FA 2EUZA 1EANA 5GS0C 5C0CA 3TCXA 2G9HA 1FPTL 3UP6A 3SGEH 5IIEB 5E1HB 1TQWA 3EH2A 4UF7C 1HI6B 5EEUA 1IFHH 1JGLH 1JCKA 1PZCA 1ZK5A 1GOFA 4JFFA 3FTVA 3D39E 4FG6C 2E7LA 5FK9A 5IROC 1D5RA 3F04A 4PRHA 1G6RB 4K3EL 3MUZ1 2Y4SA 1MCOL 5C7XH 4OF7A 2BP8B 3P3TA 2EXSA 3QFJA 1BX2A 1F0LA 3SDDD 3OAUL 3CUPB 4A1RA 5J11C 1KZQA 5EOQH 4M61A 3S88L 1KFAH 1KBVA 5DTFB 2EH8L 4ZMAT 3IPBA 2IV9A 4XP4L 1JTPA 5DUPH 3V0JA 3FDWA 1KENL 2FL5A 3QWRA 1S7TB 3QHTC 2MCMA 1N8ZA 2OL3H 4QO1B 5CZXC 2QVIA 1MSPA 4D8PB 5C0JB 3FN3A 1L9PA 2EDRA 4OUOA 4P2OC 5CMAA 5HI5D 3IMWA 4EJ1C 3C60A 4DPCX 4NQDD 3CU1A 5DFAA 4PJGA 4GFTB 5IG7B 2CKBB 1F6LL 2ATPA 3Q43A 4IMKC 5FW6A 2X4RB 5HYJA 4I77L 3FT2A 1MY7A 4ONGH 2XZCH 3WL9A 1T0NB 3DGCR 3DKHA 1LL1A 3PPSA 1JXKA 3VXPB 3BGAA 5K9OB 5IVOA 2ZWKA 2Z35A 2VJ8A 5BW7C 5ERWA 1DCEA 3VFNA 1CFNB 5EO9B 4D0DB 3FQYA 2OA9A 1EHKB 1QBLL 3EGXB 3FCGA 3UAAA 4F15B 1AYRA 3ZTEA 1XSIA 1UD4A 4Y5YB 4JLRA 4DKEH 2IQ9L 5I1HH 4FEIA 5EF0A 2OZ4A 3QYMA 3U7AA 5IK3A 1AC6A 1CDGA 1VZGA 2WN2A 4GFXA 5C08D 1BIIB 3N50A 3GXFA 5I5JA 3AY4A 3AADB 1YHPA 5EUOA 3OC8A 3GHBL 4POUB 4HAFA 3DJZA 2VDML 4W68A 5JNYB 1KGJA 2H32H 1WD9A 1IEBA 4YX2H 3MMEA 1X5LA 1YN6A 2YOAA 3E9TA 3NCWA 3CBJB 3B9KA 1MCOH 3PWNA 4MB5A 4OUUB 2E86A 4AYMC 1MJ8L 2BP0A 4PJHE 4BFOA 1FG2B 1MEXH 5DHYB 2X0VA 2WJ7A 2ZP8A 2ITEA 5JIKA 3K6FA 2PYED 1VFAA 5I8KH 1G9MH 1YG9A 3ZGIA 5E94B 3D25A 3UZVA 2WXMA 3QQDB 4LVOB 4JEGB 3AWEA 2DYSB 3IN0A 3ESOA 1CF8H 3BWZA 3Q0HA 4F27A 1RL1A 5F0PB 5F88A 3GSNL 4XMTA 4AGPA 1V3MA 4HC1H 3MV11 3VUAA 4NBXB 1BPLB 3QAZC 1AI1H 4XNAA 5FGBA 1AO7A 2EQDA 3U30B 3J7HA 3HB3C 1A6ZA 1MFUA 1CFBA 1ICTA 4HP5A 2XBDA 4I77H 5I73B 1NFIA 1HKLL 4IRZA 3I6LE 1LNUA 3SE8L 3U7WL 1OF2B 4EN2A 4I18C 2QJDA 4LK4A 2PXYA 4MDIB 1I3RA 4FFTA 4PLNC 1FFQA 5F97E 5IBTL 2V5TA 2ZKHL 1W72H 4KTEH 1JN6B 4Z0BH 4Z7QE 4Z0XA 2C9QA 3DJTA 4IJ3C 1NINA 1DBAH 2PMZA 4ZMQA 5CD5D 2R0KH 1G9EA 4JDVA 5TF0A 2COVD 1DEEA 1K3ZA 4NN7C 4Z7AA 5D96B 2GUOB 3Q6GH 1ZHKA 5KYXA 1LDPL 1ZIAA 2BSEA 5CBEA 3ULVD 1XR9A 3O3BA 4H0LC 3AZUA 4J4PC 3SGEI 5HVHC 4B27A 3MA7A 4WUUB 2VDMH 4ZTOH 4XGZA 4X7EC 2CCLA 2X4SA 4FI6A 1GJWA 3FQXA 2OSLB 3HG1D 2WIIB 4ODVL 1CXEA 3GSOB 2WUBL 2DPKA 1RIVH 2CHNA 4OCWH 5AYQA 1T5XA 2KT6A 1BD2E 3S96A 5CCHE 5GGVL 2E7LC 1E27B 3SYQA 5F7YC 1YDPB 2ZKWA 4OKDA 3OMZA 4N26A 4N3TA 3MRQA 2K4WA 4ZTPH 2BFVL 3S2CA 3L3IB 1LK2B 4BSWB 3L4WA 1BFOA 4KZEH 2X2JA 2Z8RA 4FFWD 2M26A 3CBRA 1U8IA 4HUVA 3LPWA 1PZBA 5DD3L 5DJ8A 2ZD0A 1EGJA 3EOBA 3KPMA 1OM9A 2YMXL 4R96B 3W57A 1ZPUA 2GITB 3RWCA 3MJ6A 4K2UL 3Q9PA 4CADB 1EAPB 5IF0A 2H8PB 3DSNB 4HLZH 3K1KC 3EYUL 1EXUB 3OGCB 2BY2A 1HKLH 2VXSL 3VXSA 2KZ1B 4AVHA 1CDHA 5DJ2A 4MMYA 2WJ5A 3VFPA 5IB5B 4L3FA 1HVXA 3BEWA 4I0PA 3HKZA 1BAWA 4JPQA 1A7BA 2FBRA 1HL5A 4A6YH 3L2NA 4MNGA 3C60C 4X8CA 1IU1A 3S7GA 3N40P 4BHUI 2YD4A 3NTCH 5CO1A 4CUCA 2HJLA 2KC0A 3JXAA 3CVBA 5FKPA 5BOPA 4FI8A 2ARJB 4BZ2A 2QPFA 4Y9EA 1YPZB 4XVSL 1J8HD 4E9WA 2OKMA 2NZ9C 5DFWH 1V7MH 2QSQA 1CL7H 2YAHA 1RJLA 4ENZA 3ZYOA 1IVLA 2QTEA 5TGBB 2Y06L 5C70A 1RJZA 3FU3A 4R2GC 5GRZA 3G6JF 1AR1B 1RZKL 3FQUB 4HGKC 1A2YA 2MMXA 3CXDL 4Y19B 2XXCB 2KUTA 2Y5QA 2WBJB 1CTOA 3CFEB 5DMJB 3EGSA 3QNXB 2LFGA 4GUPA 4NC1C 3QXDA 4ANKA 3HHSA 5EEVA 2WINB 4HG4K 2PYFA 1YN7A 2WUBH 4G7QB 1MFNA 4X6BB 3VMNA 5IHZB 1CT8A 4N0CD 4JK0D 2VLJA 3AY4C 1YEDB 4G42A 5HGGS 1DJIA 2BOLA 5HVFB 5D1ZI 3KXFE 1T1YB 2ZAHA 3ARED 4ADJA 1MCRA 2ICWB 1SXBA 2AXHA 3A6CL 2XG4B 4AQ1A 3QUGA 5DMGC 1BREA 1TSRA 2JIXD 4DVBA 1XVSA 2BFVH 4O4YL 5LGHL 3B9KC 1UQSB 1QX1A 3I3DA 5LGYA 2YD8A 3P73A 5CINH 2DM4A 2VDLB 2P48B 4IU2B 5HHQB 3ARDB 1X5GA 4AEEA 2VC2L 4DVRH 3IGFA 4U1MB 4GH7B 2FEEI 3GSUB 3LX9A 5B7FA 5BNXD 2ATKA 4APQA 3WY1A 2XQBL 2KHAA 4OLWH 5IVZB 5HDQL 3LDBC 3F5WA 4OZFB 4OD2B 1EO7A 3QXUA 1HOCB 1ZTXL 1K8DB 3FUKA 2BVUA 2WGXA 1AZZC 2GIXA 4R9HA 4PW9A 1U9KA 5AAMA 3MREA 1W6LA 1RZQA 5D5MF 5FGBC 4PRNA 2NUTB 3K2MC 1ZVNA 4CVZA 5F2FA 3JTBA 4JDTL 2IGFL 2QPUA 2VUOA 5DUJA 2ED8A 4IRSB 3NRPA 2AQ1A 2IXQB 3ATBA 4XVSH 2F8XC 1EEYB 2OXHB 4K3GA 2XTJB 3U7YL 2PXYC 3CFQA 3ELQA 2DQTL 4OZHF 1NGWB 3FO9B 3IJEB 5I1GL 4ENED 3L1OL 4C56A 4S1RL 5B4MD 5D7IE 2A83A 3IMRA 1RMFL 5GRYA 5FKAB 4JFXB 4TPRL 1Y6NR 3P4OA 2OMZB 1YEJH 1FL5A 4NNYA 1SGKA 4FMFA 5JIDA 1M3IA 1U8KA 2R29L 5D1ZD 4AIZA 3HEIB 2UUDH 4B9CA 4KO9A 3WTSA 2YPLD 1IAMA 5DEFA 4CA4A 1SMAA 3ESNA 3NA9L 3JT0A 3B9VA 2XFXA 1JUFA 4YHIB 3LN5B 4HOXA 3TPKA 1DZ0A 2HVBA 5LG1A 3D39A 1CU4L 4H8QA 3CFKB 2JFCA 1WCBB 2ZX7A 4O4YH 4YEEA 5BVPH 3RVXC 1B4TA 4Y8AA 2AVFA 3D0VA 4RETB 3X1BA 2WZ5A 3L2LA 2HA1A 2ICEB 3UTTD 5C0FA 3SZ6A 2DL9A 3BP6A 4FNSA 1K85A 4F9LA 3LV3B 4LBAA 5CFAA 3EO9H 1FLRH 5FO2A 4O9HL 4GG8B 1ZTXH 1QSFA 4WKZB 4YE0A 1QBBA 1PNCA 5JO5B 1VACA 5KJ7E 3DYMA 1R5IB 1FSKC 4Y1AB 5D7LB 5DJAB 5HPMB 5HJ3B 1QRKA 1FZJB 3UP1A 1MH5B 3A4EA 3F83A 4ZT1A 4OV6F 2KZBA 3V4LA 2DLFL 1XZ0B 3LKNB 4PGBB 4XCFH 4TQIA 4JVWA 2VXUH 4MYWB 5BZZA 1WAEA 1V54B 1ZGLB 2OMVA 2H3KA 2IGFH 4BJLA 5JHBA 3KJ4B 5HHOD 3HOGA 2MSPA 5DHEA 4S2SA 1R6VA 2FWLB 4AV0A 4EXPX 4WO4B 3MLVL 4I0PC 1XDTT 2RTTA 4HJSA 1XMWA 4HJUA 3QHFH 1CL7I 3T3PF 4WUUE 3DJRA 2XZAL 4JO4L 3DBXA 2YXVA 3FUMA 4MA8L 1UT1A 3IDNA 1OSZB 4JREB 2F7IA 1FC1A 1A6VL 2W9LA 1HDMA 2FIKA 1GIGH 3S97C 2W0PA 2MRYA 3KLLA 4NQEB 4WK0B 3UJTH 5E9DA 3VI4B 2LQRA 3RWHB 4TN9A 3CTTA 1ID5I 5A6MA 2B1HH 1T03H 4YFLF 1CO1A 2APWA 1CIUA 4JN2A 4XNQA 5F1IB 3SBPA 3GXUB 3V9EA 4ZW7A 2X2YA 4N2NA 3EFOA 1SFHA 4N0FB 1NJ9A 4PPTA 3LRHA 2EUVA 2E9GA 4Z23A 1T7WA 1PIFA 4WWOA 2GK2A 2XN9D 1UD2A 5C86A 5DHXB 4HWEL 2ZWLT 4YBQC 2AAAA 4PJHA 3NZUA 4NN6B 3R1GL 4AQ1C 3D85A 3IJ7A 4KI1A 2C1OB 3DVIA 3HR5B 4PD4K 3WFBL 4TVSa 4ZFOL 5BVJB 4BE5A 4JGJA 3KPQB 2R0ZH 2R2EB 3V4UH 4HG4J 4EE2A 4IRJA 3L3GB 4C57C 5L2KD 2BY1A 4UQAA 5T1DL 2OM5A 1LQBC 4JFYA 5DRNA 3GZQA 3VXUD 4APQC 4Y4HA 4RFOH 4IBYA 1JZHA 3DV4A 4ZS6C 4OCRH 2VERN 2NY6D 4F1SA 1YPZE 3NEEA 5AAWA 1CVRA 2ZCHL 4FXTA 1SRDA 4B96A 4FZ8H 1YNTB 2FATH 1TU2B 5EZJA 2K7QA 4X6EA 3C09C 3CHRA 5SV4A 5I16B 3Q2NA 4MD4B 4UT7L 4Y19E 4YFLI 3BSZA 4X0NA 3Q3GB 1UD6A 5EOTB 2EO1A 1DP0A 3PAYA 3FTUA 3SCMB 2BNRB 3BDXA 1O0VA 1P1VA 4X5LA 2DIBA 3RWIA 3TN0A 5C0RL 4UM9A 2PTUA 1KJ2L 4CW1B 3HLAA 4FNLL 5EBWB 1NBCA 1WH0A 4L4VD 3RFRA 2WSPA 1ZLVK 4HKZB 4WKXA 3GJEA 2FX7H 2CDGA 2WOYA 4KQ4H 3V55A 1JZJA 5IY5B 4GAJL 1KTLA 3T6XA 2C3HA 2F19L 2IDFA 3L3OB 1VGEL 1IGTA 1TTGA 1VGKA 3EDDA 4XPTL 2VDKB 4XMWA 1CF1A 4G8FB 1O7DE 4GBXB 5TE4L 1EUUA 1G7HA 4ETQA 1UXSA 3BFQG 1WE5A 2FWOB 4WK4B 4CNIA 4HD5A 1M6UA 3R1GH 1NCCH 1RP8A 4DKDC 1BSIA 3KNBA 3WFBH 3FQTB 2IH3B 3NN8A 4ZFGH 2CO2A 2UWEB 1IT9L 2HT4D 1B90A 1MLBB 3CU7A 4PJBB 1S5IH 4YE4L 5J13B 2GTWA 1N2RB 2HFGL 5JOFA 3U6XS 3KBEA 2ZUQB 2MIZA 3PNWB 1NDMA 4DP0X 4Q9QH 3MRJA 3LYRA 3HHMA 3FCTB 2UYLB 4F9LC 1MJUL 1RK1B 2QQLH 3MYJB 1NUDA 1TQBB 4KKLD 4QLRA 2V3EA 5LAXB 3DI2B 3TU6A 1P6AB 4NFDA 4D0BA 5AW0B 1VESA 5D1XD 1JSYA 4Z7UB 2ZCHH 4BK5A 2AC0A 2H2PC 3RY6A 3J27A 1CDIA 4PJ5D 3V5DB 4HH8A 4YHZH 2NXZC 1FFRA 1X9LA 2VR6A 1TZOA 3QI9D 4TULL 4EN3B 2O61B 3AG4B 1SVBA 2AQPA 3KYMB 2VR8A 2FX9L 3CLWA 4MDJA 3LHPH 3RU8H 5FUCE 1UWGH 1P6FA 1IJ9A 2N0MA 1K5NA 2CBQA 4LPWA 4RIRA 4KO7A 3MV01 5JHDB 3FB8A 3ME0B 2Y7OA 2ZKXA 3T0ED 4LOUC 1YQVL 4D9LH 1NFDF 3VD9A 3VD4A 1OSYA 1YNLL 4U4IA 1CFVL 3IBEA 4QGTA 3MFGB 7CGTA 3VGHA 2LFEA 5HVGB 4MASA 3H0TA 1FO0H 1KSRA 2QEJA 4XCNA 4N8PA 4PGDA 1JGVL 1B0GA 1XH3B 2OMTB 3LVEA 1QVOB 4NHUB 1F4WH 3ZY7A 1TJHL 1ZVHA 3FRPA 4LCIL 3RNKB 1KTDB 2Y5TA 2XQYK 3ATAA 5A2IH 4W70A 5GS0D 2FQDA 3MACL 4FRWA 5MEPB 3A5VA 3C6LA 3OLEA 1Z1WA 4R8WL 2W0LA 4XNZB 5C0BE 3RNQB 1F4XL 3KXFA 5GPRA 5H37H 1I4FA 5GZOA 2L3BA 5DTFA 4P5TA 2P5WE 1S9WA 4KJPD 4XP5L 1IB5A 1C5DB 3OBAA 4AXWA 1ZA3A 4Y1AE 5D7LE 5E1AA 3B9EA 3DOIA 2IAMB 4WJG3 32C2B 3P4MA 1KY7A 1I7RA 1KYAA 1Z5LB 5AENA 3LZPA 4BQ9A 5I6MA 3A4FA 3BAYA 4D8PA 3C5SB 4G7VH 5DD6B 1J9RA 2DM7A 4DN4H 2KERA 1ZK9A 3HZKA 4IIZA 1BLNA 5D9SB 4ANWA 4PLJD 4YVNA 5HYFA 3EOYG 2X1XR 3MI6A 3QH3A 4MSWB 1GW0A 1QRND 2MQ3A 5J4MA 1HS6A 4GIPD 4IRJC 4P4RA 3ZL2A 3F7VB 4K7FB 4HPHA 5I82A 1ODAA 2ZUYA 1DBMH 2G3MA 2PR9A 3F65A 35C8L 4XOCA 3BWAA 4Y4HC 3FO2A 5LXVA 1TITA 1SZNA 2J6WA 4LCVA 1E30A 5INCA 2NY0C 4P2OD 4PD4J 5KANG 3GINA 3EGXA 3TT3L 1JNHA 3GRGA 2WB7A 2DWDB 4G8AC 1ACCA 4I48B 2A99A 5I0VA 4Y5YA 4ZD3H 5AAWC 4DJMA 2H6OA 3DIVA 4Q8BA 1B4JL 1LO4H 3HUJF 3RJDA 2ZF8A 5KTEH 5F9DC 1MG2C 1MF2L 5JW5A 3O2WH 1H3VA 1CFVH 5CP3A 2VDNL 1Y18B 2RH0A 3DO3A 5ILTL 4YQXL 4J12A 3VFOB 1R3LA 3TN0C 2X42A 2B77A 5D7IA 4JO2L 3PAZA 2XKSA 3PJNA 5BZWB 5DJCA 1QEWB 3AWGA 1TJHH 3N04A 3EOAA 4OB5L 5I18L 1TPXC 4YSAA 3O6LH 4R8WH 1OM3L 5L0QB 4LVHB 1F4XH 2VQ1B 1OPGL 3SY0A 4K73A 1EPFA 2ROYA 1EO5A 1IBHA 2F7OA 3GZKA 3QEQD 4MJID 4OM0H 1EZVY 4ILDA 1OWWA 3DC0A 1OCWL 1ZA6A 1S8DB 4FE9A 4HWZA 3EYVB 2AEPH 1XO8A 4GKLA 2ADFL 5BV7L 4PWIA 4PG9A 4OGQC 1UCBH 5EC1B 4HUWB 3EBIA 1G7IB 4AH2B 5GHWH 2HMIC 3FJTA 4FI7A 4K94C 2VE6B 2X12A 1FN4A 2XVKA 3INOA 5JHLH 4DZ8B 4IU3B 1MWAA 4N9GA 2CO7A 5BMFL 4GPVA 4UOZA 3B5TA 4F33B 4BUGA 1HE7A 5CP7B 5FHAL 1UJTA 3BI9X 5FDWA 4MJ5B 2HKHL 5B7EA 1B2WL 35C8H 5IQ9A 4P4KB 4RWYL 5DHVH 3Q6FA 4MDIA 3UJIH 4LO9A 3VW3H 1KTKE 1XT5A 3JWDC 4NM4H 1O9VA 4YDJB 4Q4IA 3ZL4H 4Z7VF 3IDMA 3TT3H 2BNRE 3Q05A 1GKEA 2ID5A 3HB3D 5GGTL 1PZ5B 2FJHA 4BK5C 3CDCA 5E6SB 1D5BB 3RY6C 1MCLA 1B4JH 3MNZB 3PXJA 1MF2H 1J1PH 4A63A 4DPRA 3GM0A 1CG9A 1NLBL 1RZIA 1L6ZA 5EBGA 4EOWH 1VZIA 2G5UA 5JIHA 4ZMOA 3ZRSA 4WHYH 4JS7A 1ZLVH 3BLKA 4DP6X 5FM4A 3RHWK 2CM5A 1X9QA 2EACA 3FO0H 2CG9X 2ZWYA 3C9NB 2GSIA 4G1MB 4ODSL 1SQMA 5TDOB 4N0YH 2GJRA 1I1AD 5IQ7H 2HT3C 1TDQA 3DYPA 4WY7L 2WIIA 3RL1B 1WA0X 3KWVA 4M3HA 3H4FA 4OB5H 1G5GA 1PQZB 1MJ7H 1KB5A 5E1IA 4Q14A 1OM3H 4JDZB 2B3IA 3MRFB 4J4PD 3ZXAC 2WTRB 2UWEE 1E28A 1I8MA 2BNUA 3TBVB 1YEHH 5EN2B 1CFMA 3VFRA 4PJBE 1HNFA 2NX5A 1OCWH 3KYAA 1QBMH 4ABWA 4F8LA 2MNWA 4GW1A 3RRQA 4BKSC 1A14L 2BRRL 2ICES 5BV7H 3ML8A 1RZ7L 5EFIB 3C6LC 3LXBA 4F3FA 5B21A 2R56L 4S0TD 5L88L 4MRCA 2FO1A 3S5LB 1GKOA 1NBYA 4P5TC 2WUCH 2EEDA 1MREH 3UC0L 1LK3L 5FUOL 3WEBA 1DUZA 1PPIA 5FS5A 4CADA 5C0NC 5K59E 1VAHA 2ZX6A 3OKMA 4PRHD 3GMRA 2F7PA 2NY2C 1EXUA 2ZXDA 1B2WH 1V05A 2Y2TA 5IP4A 5EDXA 4O51B 3FH8A 3GHEH 2VUKA 1EIBA 5IQOA 3O3EB 1NA8A 1X9RA 1XTMA 1SHMA 3KBFA 4X99A 5JHDE 3JTTB 3SQBB 1OAUH 2JB6B 5F7AA 3V0WL 3ZLQC 4BFBD 1M3JA 2E56A 3S4SG 1WS7A 4MNQD 5IBLC 3QWRD 4LP8A 4NC2B 3BUYB 3NPZB 3NZ8A 5HXMA 3WLWC 2AZAA 1GZHA 1KOAA 4JKPH 4NOFA 4DW2H 3TF4A 1SYVB 1A66A 1HL9A 2D0GA 2ZXBA 3O3AB 4DP8X 4F7EB 5IM7A 1KIUB 1Q94B 1DQVA 1ZT1B 3RFZB 4PR5A 4U3XA 1NPNA 4N2OA 1SXCA 1RZJH 2K6ZA 2ZWZA 4Y19A 5DR5L 2DI9A 3VTAA 4B5ZA 1E2VA 2Q20A 2D7TH 3FONA 1PYWA 1M05B 2WXFA 3QNXA 4KI5C 2CSPA 4J1UB 1E5YA 3LNFA 2WINA 4WY7H 3RGVB 1D3CA 1MRDL 4AWJC 2NZ9D 2MHAA 5IHZA 1LILA 3RUGF 3CHOA 4LHUG 4Q97A 3C6SB 3GBMH 2GJZA 4JFQA 1KZYA 4R2GD 4NERA 3TPUB 1JK8B 1WBZB 3GSNB 1ES0A 3VDCA 4WK2B 3AS1A 3VXQA 2FECL 2LLLA 3QWOB 1CXKA 4FF9A 1QLRB 3BC9A 4NCC2 1UFGA 4E9XA 4IK7A 4KFZC 1A14H 4NFCA 2PP8A 2Y1VA 3PP3K 5F7BA 1BDYA 4UM8A 3ARDA 1KCBA 1HHJA 1GAFL 4N22A 2F74A 4G8GD 1OPOA 4PG2A 1YMMB 3HPJA 3QDHA 2FGWL 1LK3H 3Q5YA 4I2XB 5AOJA 5ENWA 2PCFA 4XNXL 4A2FA 3UIYA 3BZEB 5E2UH 4OD2A 2BCKA 1U8HA 1HOCA 4RMSA 3GGWA 1T1WB 3HC4H 1W0WB 2BOCA 2DEXX 4KY1L 5DMGD 6PCYA 4EDWL 3WKNA 1KN4L 3MDJA 3BEVB 4Y2DA 4I13B 4WTZG 5KSBF 2KPWA 3QDJB 1HK6A 2EYRB 3NFSH 4HCGA 2B59B 5CEZL 4NRXA 2NY7H 2NUTA 1XGUA 3U4EA 1A7OH 2A5UA 4GKZB 1R5WA 4B50A 3G08A 3HZYA 4HFWB 1WFMA 4TMPA 3AU1A 3CVHA 3TBTB 2A77H 1FAIL 1PX8A 4G70B 4HMDA 4RMQA 4Y9FA 5M95B 3M17B 2AV1A 4BE6A 5AKSA 3P0GB 1SPDA 1TETL 4M6ML 3D8MA 4IQHA 3PWLA 3LS4L 3SY6A 3OD3A 3FO9A 3KLHC 1R3HB 3ES6B 3HZVB 1U3YA 4NHCH 1AO7D 3V0EA 1N0LA 5DR5H 4F57H 1CGSL 3GPEA 2P28B 4O5LH 4LDOB 1U8LA 1XGTB 3VXMD 1PLAA 4JN1H 3UMTA 2ZOTA 4G6FB 1SUJA 4PJ6A 4ZRGA 4HKBB 5J1AA 2DKMA 2Z8WC 1M2VA 4GMSL 1SVCP 2V4LA 3V8OA 5BZDA 4QCIA 1WUNT 1JL8A 4CU6A 3PUCA 3LN5A 4JFOB 4YUEL 1X7QA 4YHPB 1D7FA 4PHZA 2YD0A 4G80A 3LSOB 5KBMA 3F00A 5AKRA 4A7GA 3HC3H 15C8L 1A65A 1WCBA 2N1KA 2VSMB 3L3KA 3L7EB 3F7QA 5IOPB 3I6KB 3ETSA 4U6VH 3BH4A 4HHAB 3FF8A 4JR9L 2CPUA 5IV2A 4WI3A 3RDJA 1M4KA 1IC7L 1V8HA 2EIKB 4QHPA 1IV8A 2UY6B 5K39A 5I6NA 2O5YL 2DQEL 1NOAA 5C0BA 4M03A 1DR9A 4GAGH 3ZKSD 5D55A 5EH1A 3QXAA 1KT2A 1IC1A 3VFWB 2IALA 2B9BA 2P5WA 1II4E 2J1KA 4EEEA 3FCBA 4Y1AA 1MCDA 2DDQH 4HLEA 1JHKH 1NICA 3AT9A 1IMHC 3NZHL 4XC3L 2D4FA 3RX8A 3AB0B 1MCIA 1TJMA 1R24B 2LTQB 3LKNA 2XWRA 5DJYB 4ES8A 2B5IB 3K81A 5BS0B 1JNLL 1OAXH 2H1LM 1EFXD 3GS7A 3CDZB 4JPWH 2PWGA 2DYPB 3D30A 5J12C 2LLGA 1PEZA 1JPTL 2E7HA 3GNMH 4N1HB 3PGDB 2P42B 1U91A 3GSWB 4KNSA 4N4YB 2IO5A 4QHUA 1JWUA 3S3JA 5JOPE 1UOLA 1UATA 1ESOA 1UWEH 3BKML 3ZTNH 2IPUK 5IW1A 1J88A 2AQTA 1PFOA 4FG0A 5JW4Q 4HKJA 1L7IH 2R51A 1Q9OB 2BY0A 3S3DB 3T09A 5C9JA 1GZHC 4Q6YA 1E8XA 1IQDB 2CJ3A 1NCWH 4DO4A 3NP3A 4XMVA 2QZ5A 3H3BC 1IGCL 1J1XH 3I02A 3MGOA 3BRFA 2C7FA 4AGQA 3TIEA 2VH5L 2VC2B 3NG5A 2OULB 3HCVA 3BZDA 2Z31B 3J07A 5DA4A 4G5AA 1T20A 2EDHA 2FJUB 3B9AA 5KVDL 1U8QA 2ESVA 2FUTA 4N0FA 1W0VA 1CFTA 5I1LB 4RZCB 2XPGB 1FA4A 2E76C 3LMJL 4TNFA 5AWNL 3VYPA 1Y0LA 3MR9B 2IGTA 5GGRY 1WC7A 3LRKA 2CGRH 1BFVL 3HNVH 3NCYP 4DCQB 4XVJL 2Q2LA 5DLMH 4RMBA 3JWOL 3QUYA 1I8AA 2C1OA 3HR5A 4XMZA 1XWVA 4OW6A 2OLDA 3BWUF 4QJ5B 1XZWA 2PO6B 4ZW8A 4PBWD 2UXFA 1TCRB 3FUJA 2R2EA 1RFDL 5AOKA 3TYFB 1CBVH 1O7DC 2P80D 4YS4A 3PHQB 4H40A 4FFVC 5I8EA 1FNGA 2CJTA 4JDEB 4PJ9B 4GB9A 5CJXA 2HKFH 5IFHL 4PG2C 3W2DL 2XV3A 4YBQD 4YHNB 2K8QA 4N28A 4IBSA 1GS7A 4UDUB 3UTSA 3ZMRA 3BYTA 3AW5A 3HS9A 5DJZB 5IJCC 5FF6A 1T4KB 3QA3A 3FKUS 1C5CH 3K8MA 3OF6A 1YECL 1JPTH 4WEBL 2Y7MA 1A64A 1OB1B 4Y2DC 4RRPA 2GBAA 5H35B 4EI5B 2YA0A 4U33A 4UYQA 1TKWA 2RIKA 3K80A 4G5ZL 4UU9B 5GS1A 4EIGB 1NBZA 5F6HJ 3RTLA 1IJNA 4NS0A 2AKRA 4NLHA 4APQD 1IRAY 3CH8A 5J06A 5IEKA 2MOQA 3HFMH 3O3DA 4NQQA 5DVOA 2YO3A 4XO3A 2YXWA 3I50L 3EG9A 5DD0L 3KCPA 3FZUD 1LEIB 4WJ5B 1JS4A 5E4OA 5EBWA 1SOKA 2E27L 5AVVB 1ACZA 1IGCH 4X0KA 4AKOA 2E46A 5BQ7A 4HKZA 4A38A 1KPVA 4U1IA 5GISL 1ACYL 2VQTA 4HFUL 1NL0H 3TZVB 2X0WA 2C9RA 2X6MA 5FUCC 1HIML 5B8CB 2BHUA 1RHHB 2VISB 4QRUB 3GXDA 4UV7L 5ISZA 2B8OT 3V9FA 3VAEA 5ALCH 3LMJH 1N5AA 5CLWA 4G8FA 2B1OA 4YR6A 3NIGB 1D5ZA 1F8TH 2NNFA 3RHWF 3MJ9L 2EE3A 1QNIA 2GB2A 1YMME 3O4OB 3PP3H 4C56D 1E4KA 1PAMA 2X3BA 1AKJD 3PWPA 4I2XE 2AJUH 4JPIA 4JFUA 4NRZB 3JWOH 3ZJAA 3AITA 3SPJA 5TPWH 4ATWA 2YD1A 1JZ3A 2HN7B 2B3RA 4Y16D 5DK0B 3ZDYB 3BT0A 4NO0B 2D7QA 3HPLA 3X2QB 3QDJE 1WK0A 1IBBA 4U1LA 2VLRA 1TJGL 3K72B 3QCTL 2AJXL 2SEBA 1B4RA 1FWXA 2FD6H 5EIIB 4V2BA 4ES9A 2WLZA 3W0WB 1Q1JH 5I6OA 4P3CH 4G8IB 1FNEB 1SJHA 3O11B 1YECH 3I6SA 1E90A 4UT9A 4R97C 2OJZL 1G6VK 4W9HC 3AG1B 4BFJA 3CDFA 3B56A 4MXQD 3WHE1 1A7RL 1A8JH 4ZUUA 3MRBB 1YLBB 1KGCE 3SJVA 1E5UI 3V4PB 2O61A 3PUUA 2JI1A 5C1MB 5T3XE 3VFUB 4YIQB 3HVNA 4UZUA 1I1RA 3SDAA 1XGZA 2F5BL 4LPYA 4S1QL 3QDGB 2Z0UA 3LQAC 6PAZA 3NH7H 1QSFD 5ITFB 4ZTEA 5IR1A 3BUQA 1CI3M 3RWGA 2EDKA 1F4AA 1XIWA 2H2PD 3QYCA 2HZHA 4JFZH 2O30A 1ASOA 2J72A 3MBXH 1AGDB 3US9A 3ZDZB 4DQOL 2EIJB 4MNHB 3JTSB 2NXZD 1MUJA 2WWKO 4IYKA 4MJHA 4WDIA 2OCCB 4BXSV 3BESR 4U1JA 4HMEA 2FJFA 5F1NA 4MBRA 1A6AB 2ZOKB 3MBEA 4UV7H 1KCRH 5J1TC 4ZFOB 1NCDL 5I5MA 1SOXA 1JP5A 3ZZSA 3QUZB 4GUOA 3HAEA 3F8UB 4PTUB 3MJ9H 4M6OL 2DYRB 5A2LH 4CVXB 2NY4C 3LN4A 3U46A 5MEPA 2VKWA 3PL6B 3POHA 3X12A 4FL4C 3IGKA 1MCPH 3MFFB 3AWFA 4U7SA 1WZ1H 1TYRA 3QPQC 2DTSA 2HLEB 4HKXA 1C5DA 4OFYA 4PY7A 4RSVA 1XFPA 5F70A 2IAMA 2F1EA 3IXTB 5F96L 2TSBA 3B3BA 1K4CA 4ICXA 1CCZA 1NDTA 3LHAA 5E9DD 5IOKA 4UQ3B 3SDCA 2BS8A 3UGXA 2AJXH 43C9B 2CIIB 3TH4T 5BS0E 3QJOA 3QUYC 4UIMB 3S5ZA 3H42L 4LE8A 1BBJA 4PUBL 4BDVA 3GMPB 3PP4H 5CEXA 2PW1A 3B1UA 4NKIH 3TNNA 4WF7A 4KHTL 2OP4L 3F7VA 4K7FA 5CJXC 5IEHA 2A73A 1JD9A 1NCJA 3IPFA 3GTNA 3M88A 4XCYA 1KJ2B 4KJQC 2OTWA 3U9PH 3VFVA 4NZUL 3SDXB 3LH2L 3K0WA 1PG7H 2QR0A 2XY2A 4Z8FL 1WIOA 2R8SH 3OPZL 4ZUWB 4S1QH 4JKKA 4QGYA 3O0LA 4EUPH 5IHUL 5AYUH 2O5NA 3MRPA 5D7JC 3T3MF 3RA7H 4Z3HA 3CPUA 2Y69B 1SHWA 4JVPA 5FV1L 3OKLB 4PJCB 4AG4H 5GS1C 5F1SA 1L3NA 3ZE2F 5DT1L 1UH3A 5JIQA 5AKVA 3GMQA 2P8LB 2IANA 1Y18A 5D7EA 4Y4HD 4NSKA 3TVMB 1JZ5A 2LABA 2OFQA 1KMGA 3NIDF 2NY0D 4FFYL 5HDBB 4HLZG 5GQBA 4PVLA 4UI2A 1YJDC 1LMIA 1PCSA 4K8RH 1NCDH 4XCEA 4CMHB 4JFPA 1J8RA 2LR4A 3GLEA 5D2NB 3EGDB 2VIRA 4PY8J 5FOBA 4FTVB 4OVUA 5B1CA 1D9KB 2ROXA 4TTDC 1DBJH 3ZQWA 3VB9A 1JIBA 2JI2A 2QGCA 4YAQB 3LVTA 3QQ9D 5ACLA 4I5BA 4J3XA 1EXGA 3QHZH 1S6NA 1YRKA 2JB5H 3LIZL 3NCFB 1GW6A 3GMOB 4OM1H 4UM9D 4Y4FA 4K5NA 5I5IA 4UAHA 4YZWA 4F7CA 1AQDB 5F96H 2ED9A 4K9JA 4JM2A 3LD8B 2IPKB 2J88L 1PX3A 1MFBH 2E7MA 4JE4B 4LARH 4LLMA 5MHSE 1JXFA 4PSPA 1E4KC 4HJGA 3U2IA 1P7QA 3MQIA 5EO0A 4HS6B 5INDB 1KELL 1U8MB 4FG2A 3Q2LA 4XAKD 4LCYB 4AGOA 5GGSY 3EFFA 1EAJA 3DPBA 3FT1A 1G9NL 1A3ZA 3MKKA 1WFOA 4P4KA 3MLRL 1X44A 4UIKL 1JI2A 2VUYA 3R8BB 3ECBA 2BVPB 2ENPA 4GSXA 5D7KD 3G3LA 2CALA 3K4ZA 2WQUA 2HMID 3TA3B 3VH8G 4BA0A 1OSPL 1G7MA 3P3RA 2C34A 3QNFA 3OG4B 1LEGA 1QHPA 3N1FC 4BQ6A 1JBJA 1A7QL 3O45B 1U21A 5ITBL 2YRPA 2FX8H 2PP7A 3G5XB 1AR2A 5EB9A 4G9FB 5ESQA 4AK1A 4QHMB 1QFUH 4U2ZA 3SDAC 1H0DB 2BFGA 3II1A 2W0FB 3H7BA 4QRAA 3ZO0A 2K9UA 4FOMA 2A6JB 3E7JA 5I1JH 2A6KB 2DBLL 5E7FA 1AGBB 5LBSH 3CZLA 5FAAA 3GRWL 3W5MA 4UQ2A 2IOIA 5KVEH 2QVKA 1XIWC 3M7OA 3NIGE 5DRWB 2ITCA 1A9BA 3AQZA 4HOZA 4I3SL 5AZ2H 1XF2B 2COQA 5FYLH 1CGTA 4FFZL 2I27N 3CBKB 4XP6H 3IFOA 2MCPL 4WI2A 3NACL 4Y4KC 3L9YA 4QF1A 1KG0B 2A2QT 3RX5A 3DARA 1XF3B 3CSGA 3MBEC 5AW9B 3POCA 3Q06A 3L5WA 1ZVYA 2M2DA 1HHHA 4GKNA 3ZDYE 5DSCB 3IU4L 2FQEA 2X4NA 4LOEA 1NEZG 2HT3D 1JDDA 4QXVA 1ZGLM 1U8OA 1NCOA 3P4NB 3B1TA 4YXKL 3BZ4B 1WISA 4QRBA 3W0WE 2GAZB 2VXVH 2DAVA 2P8MA 3QW9A 2AK1H 3STZB 4DP9X 1UD5A 3UDWA 4N2CA 5HJBA 2OSYA 1REIA 2EIDA 1KULA 4R90H 5EC2A 1DSFL 1NOFA 2M1KA 5SWZE 2E8ZA 1UXLA 3KYNA 3E3QC 3SDCC 4GKSA 5CLTA 1RPKA 3FHQA 4WWKA 4KZ0A 1R3JA 4QXUH 4ATTA 3C6LD 3GO1L 4O51A 1DQIA 4AL8C 4Z78A 3X17A 2HT2C 5IVNA 4HPOL 4YLQT 3QDGE 2HFTA 1BXUA 2VDNB 4JCWA 3SQBA 1G9HA 3R4RA 4QTHA 4TUJA 4CN6A 5C0ND 4M5ZL 3B6SA 3BUYA 1BXAA 5ITBH 4RWHA 3CK0L 3ULUH 1Z7JA 4JKLA 4PJ7B 5AB0A 2YQ2A 2V2WB 4DTGL 4PV8B 1JWSB 4IDJL 5ESVA 4ABUA 4X5WA 4RGOL 3P2DA 3HNTH 1S2EA 2A9AA 1XXFC 2N4IA 5ICYA 3OPUA 4LP5A 2JTDA 1N19A 3NGBC 4LLQA 4J3SA 1A3RH 3O4LB 4P57B 5IBLD 2IBZX 3PHAA 2YZ8A 4Z1PA 2DTMH 5CUSH 2IIJA 1E5AA 5KBPA 4FFZH 4ODHL 3RLSA 4KROB 5GRUH 3C6SA 1HJCA 1UXWB 1YY9C 3TPUA 4RQQA 1J9QA 1ZT7B 5IB4B 5DUML 3IJYB 5DQJA 5TDPA 4AEFA 5GS0L 2YOCA 4MLSA 5DJ0B 2NPLX 2AK4B 4EMZA 1HH6B 4KI5D 4FMKA 4HJJL 4TNGA 2VLKD 4GG6B 4XX1E 3NZSA 1NC4B 1NMCC 4U1KB 1MRFL 4KKAC 4YXKH 2ENJA 3CMGA 3SYAA 1DFXA 3TASA 3BQUD 4MX7A 2XN0A 1J87A 2FNBA 1FNFA 1FIGL 4TUOB 4Y4FC 4LB8A 3OB0K 1IM9B 5E6IB 4AJVA 4LL9A 4JM2C 4NO2A 3NJJA 3QQ3B 4U1GB 2I32A 1J5IA 2W9EL 1A6TA 1TEGA 3OKKB 4LSTH 3X1NA 3GO1H 1JV5B 3M07A 5FYJU 4H5SA 4OF6A 4B9JA 2OR9L 3FS9A 2XVBA 1S3KL 4CL7A 2YPVH 4JY6B 5ESAB 3NSYA 4HFWA 4AJ0A 3LRLA 5E5UB 4PY8I 1LE5B 3N5AA 2VMEA 5EU6A 2VXQL 2LU7A 4M5ZH 3VGAB 3MLSH 4PJCE 3VXNA 1DJGA 2CO1A 2WN3A 4FYRA 4X6CF 4OAWB 3H4HA 3B43A 4W4NA 4IDJH 1R3HA 1UOKA 3ES6A 4M7JH 2J8OA 1I9EA 2ZX8A 4UTBL 4WW2B 3CE1A 3BCFA 3UBXI 3JV4A 2Y5EA 1A6WL 3TBWB 1FVDB 4JQIL 1A3QA 4K8RD 3L5HA 3WEMA 4AMXA 3VGBA 1NC2B 4AJWA 4MAYB 5D2NE 3QORB 4PI0A 4W6YB 3VWKB 5KSAB 4ODHH 2ICCA 1IVTA 5C6TH 3ULUF 3DUHA 3KLHD 2DQFA 4QOKB 3B9DA 1BOGA 3V4VA 3FSAA 3MCLL 1G4RA 5IB2B 3JWNE 3QNZB 1KBPA 4M56A 4NBYB 2Z64C 3L7EA 2IDSA 4L8DB 4MD5B 3VE0B 3BRGC 4MQ7A 4ONFL 3FT4A 5IMOA 4HXAH 4OQTL 1PZ3A 4HIEA 2VITA 3BSHA 1KXVA 3E8UH 3MV8D 4CVWA 2B14A 4LEOA 5DRZB 1NM9A 4F9PA 1UADC 3F05A 1EJ6A 5CD3B 2XXGA 1DVFB 4PJDB 1IC4L 4A55A 2LU5A 4P48A 2G5BB 4NO3A 1N6QL 2DQJL 5EEYA 4UNVA 2I7SA 1GVIA 1R24A 3K6NA 4LQFL 5DJYA 5MEOB 2KPNA 3QZWB 5FHBL 1YEFH 4NKMB 3UDWC 3WXVH 2WANA 1E4WH 4WU7B 4XN8A 2N0KA 4X4XA 3T4YA 3CDZA 3Q8AA 5TE7L 2NX5D 4D9QE 4FLHA 5HGHB 3DTXA 1ZIBA 2ZZUT 1PY4A 4WWKC 4Y0GA 3FN0L 3SPGA 1Q9LB 4G9FE 3VO0A 2X4TB 1OZTG 2E8YA 2WHVA 4NM8L 5I9QB 2AJVH 4XN5A 1FV1A 2HRHA 3RKPA 4D7PA 2ZIDA 1N64L 4KAQL 3X14A 5EU4A 1ZMYA 4OZIE 4JQIH 4Q6IB 4PN6A 1FL3A 1SEBB 2YXMA 3VX1A 3WNJA 1CQYA 2VERA 3II2A 4BZ1A 4LEEA 3UTZB 4B97A 2VR7A 3SDDB 2J5WA 3B5HA 3CDYA 4ZPTA 5DQDH 2R4RL 1GZPA 2XT1B 1A3LH 1A4JA 4LLWA 2EO7A 1RURH 4YBHA 5AVZB 1KLUB 2Z31A 4YWGH 2VMDA 3B7UX 2BZCA 4WLCA 4EBQL 3NESA 1NDGB 1WGOA 1URZA 2PTTB 2R23B 3G9AB 3LKQB 4GXUN 3TCLB 2XPGA 4QUOA 1WBXA 2UX6A 4N2HA 3VSTA 3KWWA 1KJMA 1NSNH 4G59C 3MR9A 1PDKA 4YVUA 3ARBA 3RGBA 4Y9CA 4JL1A 2UY7B 2R7EB 3CC1A 2OCJA 4ONFH 1A1OB 3L9BA 1GGCH 1NFAA 1MI5A 3SPVB 3JSSA 1XTLA 2BIMA 2P8PB 3E8VA 4JZNB 4MWFB 2J1YA 5CIPH 5I6PA 4RAVB 1CICA 5CU9A 2VLME 3BW9B 4OLZL 5BXFA 3MGTA 4P9ML 1T83A 2A9CA 3H1ZA 1BMGA 4HUUA 4ODBD 2OCFD 1KBBA 2B4CC 4OLUH 3O0RH 4GEJA 5F9OH 4F2MA 3S35L 3SE4A 3DX6A 2BVQA 2WVVB 4YHNA 2HUHA 5ACMA 4LPVA 3S34L 3D69A 1U4EA 3ZL1A 4TKWA 4M4PA 3ORJA 4MMZB 5TE7H 3V52L 2V2TB 2EDTA 1UUNA 2ERJB 5CHNB 4WFFE 4G1EB 3FQ2A 4K3DL 4NNPL 4JQXA 5AW7B 3UZQA 1HYRC 3BDYH 4NM8H 4OFKA 1QKZL 3SE9L 1ZS8A 2FYYA 1P4BH 5H37G 4PJFB 2N59A 4QEGA 4V33A 4CU7A 2AANA 4KAQH 2DQIL 1K4DB 5J1AB 4YDNA 1P5UB 3DJ9A 3O4LE 4KK8C 2A74B 4J23A 3A0OA 4W4OA 3VFTA 4KXAA 4Y2DD 5IJBC 4NDMB 1TTRA 2ZWNA 4NZTL 4W93A 1JFQL 2BIQA 1QAWA 5GGRB 4TSAL 3TO4B 5J6HA 1S9XB 3Q8EA 1NAMB 3M1BB 4A7VA 4NP4H 4BSJA 1DO5A 1LHZA 1FL6B 3D3VA 3AUVA 3ULAB 4L0YA 1BZOA 2AK4E 4BA8A 1I8LA 1T1XA 1RHHA 4PVMA 1RIHH 1WA2X 1TZHB 5I74B 3U1QA 5KN5A 1L0YA 1KCUH 4QRTB 5G4OA 2X4PA 2YGQA 4H1LB 4M1CC 3VYNA 2Y07L 4ZZFA 2UX7A 2GT9B 1E42A 3D2UA 4OT1L 4W9CC 4WFGD 2OZ4L 5KYWB 3ARQA 1F11A 3EYOB 5IVXA 5LCVH 4NQSA 1E40A 2D9QB 4U1SB 1MN4A 1BQRA 3QXTA 4JAMB 1IL1A 4TF4A 5BCAA 3OB0H 2DQGL 3BZFA 4LF3A 3DX8A 2Q1EA 1MCWM 4QRSB 3TESA 1RERA 4K71B 1KXVC 1K3IA 3JYCA 4FABL 1FYTA 5E8DL 5TD4A 3S34H 3WHXA 5I1IL 1FFPB 5F6IB 2GEQA 4ZYKB 4F9PC 5GRVK 3LKRB 5E03A 1EZLA 1P5VA 1FNEA 1LE9A 2GC4C 5HI4C 3HMXH 1NMBH 4KNQA 2Z93B 4HGWB 3KDMB 4AT6B 5SWZA 1KGIA 3MODH 4XH2B 2XWEA 1LP9F 3DV6B 1AD9A 3MRBA 1QKZH 4DEWA 1WAAE 3MNDA 1QNZL 4KV5E 5F0JB 4X8JB 1VA9A 4NIKB 1LJMA 3UTPE 2DQIH 4YIQA 4Z3EA 2FJSA 1BEYH 3HG1B 1TIUA 1DBBL 4BGDA 1B88A 3QDAA 1JTTA 1C1EL 4IIQA 3QJTB 1E9QA 5EMYA 1AGDA 3MV7B 1GGYA 5BRQA 4BFRA 1GGBL 5EEWA 4IRZL 4M7LT 2FHCA 4LCUA 2X3AA 3WY3A 1LO2L 3CFMA 2F58L 3CN3A 4R7XA 4ZMXA 3NAAL 2WXPA 2IBGA 1RHFA 3OC5A 4EVNB 4GIOA 1T4WA 4FZEH 3IRCA 4Z5RA 4C55A 1EAOA 2FLBT 2Y9RT 4N6RA 3IDGA 3WKMH 3ZDXF 5CF3A 4P2QA 4XPHL 4G7YH 4MZRA 4P46A 1G7PB