4MZRA

Crystal structure of a polypeptide p53 mutant bound to dna
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
234
structure length
234
Chain Sequence
SSSVPSQKTYQGSYGFRLGFLHSGTAKFGTCTYSPALNKMFVQLAKTVPVQLYVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERSSDSDGLAPPQHLIRVEGNLRAEYLDDPNTFRHSVVVPYEPPEVGSDYTTIYFKFMCNSSCMGGMNRRPILVIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENLRKKTMDGEYFTLQIRGRERFEQFRERNEALELKDAQAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Reversal of the DNA-Binding-Induced Loop L1 Conformational Switch in an Engineered Human p53 Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 49
structure length 234
sequence length 234
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4mzrA00
2X0VA 1LJMA 4MZIA 3IGKA 2J1ZA 1YCSA 2J6WA 5AOLA 3QYMA 1HU8A 1GZHC 2WGXA 2PCXA 3Q01A 3EXLA 3WTVA 3IGLA 2BINA 3D06A 3TS8A 1CO1A 3D09A 2BIQA 2BIMA 2XWCA 3WTSA 4G83A 1E50A 2VUKA 2J1WA 4IBVA 2IOIA 1H9DA 4IBUA 5AOMA 2AC0A 3EXJA 1EAOA 3WU1A 1HJBC 2J20A 4IBYA 4LOFA 2GEQA 2H1LM 2X0WA 5ABAA 5AOKA 3WTTA 5G4NA 5G4OA 3VD0A 2XWRA 3D07A 2P52A 3WTWA 1EAQA 5LAPA 5AOIA 2ATAA 4GUOA 4IBSA 4AGNA 5BUAA 3QYNA 1UOLA 5AOJA 3WTUA 3KZ8A 2J1YA 4L18A 4QO1B 4MZRA 2RMNA 4LO9A 4L0ZA 3WTYA 3VD2A 4A63A 1TSRA 2MEJB 5ECGA 1IO4C 3KMDA 5LGYA 3US1A 2J1XA 1EANA 1TUPA 1HJCA 1KZYA 4XR8C 4L0YA 4IBTA 3WTXA 3D08A 2ADYA 2X0UA 2FEJA 4AGMA 1CMOA 4IBWA 3VD1A 3D05A 2YBGA 5A7BA 5AB9A 2OCJA 1GZHA 3US0A 3Q06A 4IBQA 4IJTA 4LOEA 2IOMA 1T4WA 2BIPA 4KVPA 5G4MA 2BIOA 2IOOA 3Q05A 2AHIA 4GUQA 4G82A 4AGOA 4HJEA 4IBZA 4AGPA 3D0AA 5KBDA 3ZMEA 4AGQA 4AGLA 2J21A
chains in the Genus database with same CATH superfamily
4PJEF 4MJID 4FTVD 1UVQB 2Z8RA 3P9MB 3SDCA 2K6WA 1LJMA 2XN1A 5FA3B 3WFEH 5LXGL 2AZAA 4X4YB 4XRCB 5IB4B 1IILE 2MCPL 3IDGB 4OLVL 5B1JC 1NDMA 3TYFA 3ULVE 3VSVA 3D06A 1U8LB 2YAFA 3PGCA 3PG2A 2WXHA 3VO0A 4MJ6A 1QX1A 4JN1L 1NSNH 1LO5B 3BRDA 1EIBA 4WWKA 2E8ZA 2F8OA 1CIUA 4PI2A 1EGJH 5MEND 4ADGA 1YY9D 4M8QA 2OJZH 2WHVA 2IMNA 3MOBL 4JK0D 1I1FA 5I0VA 4X7CC 1K4DB 3ARYA 3S35H 5IHUL 2OMWA 1JSYA 1AZNA 1ZE3C 2EDMA 3VFRB 1A4JA 4JUSA 2QGCA 3LQMA 5CN3A 4M1CD 3MROA 3T0EE 2E27H 4NAQA 4UOZA 4A7VA 5CEZE 1E3FA 4WQOA 5I6XB 2XBTA 3GSWB 3WENA 3T6QC 4TSCH 4ZTOL 3IJHB 3CZNA 4MYWB 1KJ3H 4GBXD 4S1QH 4WNJA 3X1NA 3QIBC 4M5SA 4NDMB 2WQAA 3EYSH 5ANMB 2ZPKL 3FUMA 1A3ZA 1X5ZA 1MUJB 5DD5H 5LNDA 1XFPA 1G6VK 4J7RA 5CEYA 3MLPA 1AI1L 5AOIA 2BRQA 2OR9L 3MNWB 4OD2B 4KGJA 1FO0B 3LQZA 3OF6D 1UOLA 1BZ7A 4NN7B 5JPNA 1FGNH 8PAZA 2G5UA 1FHNA 2VXVH 4GI9A 5C0GB 4HISA 1ZHBB 2ZYRA 5EO0B 3TP4A 2VKXA 2OI9C 2XG4A 1S7XB 5IB1A 1RURH 2QELA 1IQWL 3I6GB 1U58A 1RSYA 3PAYA 2UX6A 5KS9E 1E4XH 2ADJB 3MBWA 1DFXA 4R2GD 1JMZA 5LGYA 4EOWL 1ZEAH 2APFA 4ANXA 4MNHB 1JNJA 4CVUA 2NY0D 1AP2B 4X7TB 4ZFFA 4HIXL 4QJ3B 3M1OA 4I48A 4H88H 3S3JA 3QHFL 2W9EL 5F7AA 2NY1D 2OMBA 2Z0BA 1ZT7A 1M7IA 3MREB 4F37K 2H1PL 1N6UA 4JDVA 4WDIA 3ZR6A 1UZ6E 4TVPH 5MP6H 3U82B 4D9RE 3US0A 3VXQA 2WINB 1E7VA 3R1GH 5TJWK 5TH2A 3OHXA 3TBVA 1VFAB 1PD6A 2FZ3A 3HG1E 2IQ9L 2QADD 1OOWA 3IKCB 5ADOL 4K9EC 2DLHA 1A4CA 3LIZH 3WNOA 2B08A 25C8H 3NZSA 2VLJE 3IMWA 3WEXA 2FR4B 2YAHA 5E2VL 3BSZH 5HGBA 4N0FA 5AW0B 1ZDQA 5LCVH 3NDZE 4HWBA 3DVFA 4XNZC 2H1XA 2OZNA 4YC2C 3W9DA 4PBWD 2AXFA 3UGXA 5AOLA 1X5YA 4JN2B 3B9KA 3O6ML 4Q9CA 2XWTA 3FH5A 2IFFL 1ANUA 1KELL 2ZKHL 1R47A 4MASA 4TNVK 2HZHA 4Y19E 5EUOB 2D2CC 4J23A 4ZSOB 4JKNA 2YFNA 3QO0B 1MELA 2K45A 3BPCB 2BIQA 3QDAA 4KOBA 3QORA 5I5RA 1C1EH 4O02B 5D7JC 1YJDC 2BO0A 1XGYH 1MXGA 3EJYD 3EFOB 3SZKC 3KJ4B 1QYGH 4JO1L 2VDMB 4H7VA 4FNPA 4HFWB 1XGRB 5I8KH 1QACA 5JXAL 1S7UA 3PGFL 3HUJA 3GPSA 1IJNA 5JIPA 2AQNA 3U4AA 3OR6B 1ZANL 4JAMB 1HINH 4UU9A 1GOHA 3DJZA 4KKLD 4UAHA 2BH0A 3ULUL 4P4KA 4GRWE 4P04A 1RZQA 3ZMRA 3KL0A 5EU4A 3FSOA 4LL9A 4RSYA 3TIDB 2R69H 3O6FB 3U1SH 3KLDA 1B0RA 2Z91A 2AXGA 4UV4H 3FQWB 3MRQA 4N9GA 1DBBL 4PWEA 5IG7A 5E9NA 2XTJD 2LR4A 1XF5B 4PJHE 3D1MC 4QF1B 1QQDA 1FFNA 3Q8CA 4HFUH 4NLAA 4EI5D 3QYCA 3LN9A 3V5HB 1R3JA 5B3NA 4KK5C 2YKLH 3U7WH 3U36A 2IALA 4L9LA 4PSRA 5KZCD 2C4FU 3FFCB 2DLEA 5BVJB 3BFOA 1YJDH 3ARBD 1XZ0B 5IGXH 1NGPH 3NESA 5AUMB 5LBGA 1Q9WA 2ERJB 3NP4A 4P9HH 1JPSH 1N5AB 4X5PA 2JQZA 4OR1A 3SY0A 2AJUL 2WXFA 3IF1B 4MQXD 3W2DH 1R3HA 2X6CA 4XP4L 1QFWL 2IOMA 3VXTA 5JXEC 5HHOA 1KV7A 2X70B 2AP2A 1E0OB 4XC3L 2HB0A 3UO1L 1J5OH 1U3JA 4Y16B 2OFQA 4Z0BL 1KXQA 1I3VA 2DS4A 3FFOA 1J1PH 3TO2A 2ENPA 4HUUB 4Y9GA 2HUHA 1SYVA 2VW4A 2I5YL 3CVHB 4LIQL 3U1PA 5JQHC 1G7HB 1CQYA 3MFFA 2GUYA 1RK0B 1TZIB 1IM9A 2GTQA 4HMDA 2V17H 5D1XA 5K9OA 4Q9RH 4ZNCD 5E8PA 2HTLC 3QQ3A 2W91A 2FEEI 3RZCB 1C5BL 4KJPC 4GAAA 4YE4H 4Q6YA 4FA6A 4BFBD 4I0KA 4NQQA 2BY1A 2VW7A 3U48A 3VI3F 4IRJC 4PD4J 2VSCA 1KTLA 3DO3A 1I3UA 5B1KA 1HHJA 5FOBB 2WVVB 3N55A 2EUXA 2DL2A 1BBDL 3MACH 3WKMH 3UBXI 5C09E 4AY0A 3PXLA 1J5CA 1OLZA 2CHXA 1IFGA 3NH7L 3QZWG 3QCVL 3Q3GA 4N8PA 4UQDA 5H4ZA 2VITA 3JXAA 3TO4A 1CICD 2E9JA 1SUHA 2DIAA 4PJ8A 3GLAA 4X6FA 4PJAA 1UACH 4YDIH 4IBUA 4QUOA 4F7EB 4G6FB 3GMQB 2F2HA 2RR3A 2FYYB 5F9JA 5HYSA 5KBMA 4Z5RB 3A4EA 2Y72A 5LG6A 1G5GA 2DM3A 4LLVB 1II4E 2OX5A 4FFYL 3VYOA 4JDTH 4H1LG 3DJSA 5AG8A 2IDTA 5F44A 1DQKA 4CGTA 3KYNB 4JRYB 2AGJL 1L9OA 1QSFB 3NCJL 1R33A 1JHTA 1RIUH 3QFJA 4MQTB 4YZFE 2GIXA 4FGMA 5JQ6L 4FJYA 1O9WA 4CN1A 1QHPA 4G3YH 5E5MA 3D85D 5GZOC 4MA8L 3X1GA 3INUH 3MJ8B 4UMSA 5FGBA 2RD0A 1I82A 2XSKA 5BXFA 3KXFD 3DV6A 4TLTA 4R4BA 4DIXA 1FNHA 3BAYA 1HFUA 1OK0A 4FN0A 2V9TA 3PWVB 4BQCA 4QRRD 1NEUA 2Q86B 4O2CA 5A3ID 1O7DE 4NBYB 5E9DE 3BZ4A 5DJYA 4UIKL 1DE4B 3M17A 3O3AA 1DSFH 2P9RA 4EDXB 1S9WB 4JANB 2XXCB 3SDDC 4HH8A 1BZ8A 1QR1A 3F7LA 1PLBA 5A7BA 5I73B 2WIIB 3Q2NA 3EO9L 4X5WB 1XIWC 3O2DA 2GKIA 4U1HB 4XXWA 5BS0A 3QCTH 4JMNA 4XO9A 3KVPA 4M7KL 4L1LA 4RBPH 4X4ME 4F3FB 5JMOC 1XXDC 3V8CA 1FL6B 1E2VA 4P2QE 4MJIA 4PIBA 1LWHA 1OTTD 1VGEL 1MIEL 3L2NA 4KI5D 4TPRH 5E8EB 3Q6FB 5J56B 1NBYB 2EZ0C 2QZQA 5FXCH 4UQEA 2IG2H 2V9RA 4DZ8A 1A0QH 2HTKD 3VU2A 5J3HD 4AEEA 2O5ZH 1E67A 4OCSH 5EMYA 4HZ1A 1ZGLA 2XWXA 3FHAA 2YLKA 1R24B 1KTDB 1U2YA 3PWPE 3Q8AA 5ID1B 3QIBB 4RQQB 5AZ2H 3RL2B 1JPTL 3TURA 5CCJA 1I3GL 3G6AA 4A2GA 1U93B 2AEPH 4OCWH 4MWFA 4KJQD 3NG5A 4N87A 5MENA 5CBEB 1QPXA 5JLZB 2R2HB 1XR8A 4FFWD 3CX5J 4CNIA 2ZTBA 2QHRL 3FTGB 4RDBA 1S7WA 3WTSA 2EECA 1XF4B 4G8GA 5IQLA 4I18A 3F84A 1DBKH 5I1GL 5CZKA 3WL9A 1BMGA 4JKPL 3FFDA 3PREA 1GS7A 3BP7B 1V05A 2R0ZL 2UZPA 2B2XL 2WNWA 4L1DA 3RWEB 5EPMA 5DUMH 5ISZE 4GBXA 2EICA 1G1YA 4NQXA 4WRLA 3IJ7A 1ZT1B 1GKOA 5FGCB 5A16A 1HQ4A 4RFEB 3DTDA 4D2NA 3OJDA 4PJ5D 5TE7L 4EN3B 2NRDA 2XWRA 5GGTA 2ZYSA 4G6MH 4QHMA 4F1SA 1WEJH 3PAVA 3FYEB 4Z8FL 3MFGB 1I7ZB 3KPSB 4YLCA 4J28A 1OAXH 2Z1PA 4NQDE 3WBDA 3PE9A 2BSRA 4JM4L 5E4AA 3JV0A 4BK5A 3PAZA 3QA3B 4H8WC 2B3IA 3QULB 2A4CA 5F89B 2AEQL 3SKJH 1GGIH 3DDGA 1NZRA 5I5JA 4AQ1A 3BGFC 3QIWB 3IXAB 4JY6B 4PJBB 3EH3B 4PB0L 5I74B 4RESB 2PXYC 4OLZH 4XNZB 4YC2B 5FYKH 1RUAH 2APVA 3T2NH 2H26B 3P3YA 4XNYH 4M43L 4IS6B 1MI5A 3V4PL 3L1EA 4H8VA 1G0YR 3VM5A 3LKPA 1ZGLP 4RAVB 3HKZA 3TZVC 1YNTA 3BX7C 2OXGB 2X4UA 4UNIA 5E8DH 1NCCL 1ZOXA 1CE6B 4GI8A 3U6RA 3KPMA 3ARUA 1BEXA 3GMRB 2UY7B 4MCMA 3HZYA 2HH0H 5JYMA 1AGFB 1DQDH 5EU6A 3T0XA 2PCPB 3FJTA 3IFLL 1KGXA 5D7JB 3RWCA 1NMBL 1O7SA 5HVGB 2A5UA 1YMME 1E6OH 4FLHA 2OL3B 3D50A 3QC5X 1VZGA 4LEEA 3WI9A 1HDMA 5DK2B 1DBJH 1S5IL 2CKBH 2XG5B 1ZVSB 2FWOB 5BS0E 4QRUB 1PSKH 2CA4A 3N85H 4AT6B 3DX9A 3KDMB 3B6SA 4XPAL 4FTVE 4NN6C 1IAIL 1TZ8A 4OI8A 1ZTXE 1XT5A 3Q2LA 3TOPA 3L3DB 4H8WH 4HVBA 5DK0B 1GS6X 2W07B 1BOGB 3FRUA 1OAJA 5DRXB 3HC3L 1RUKL 3RX8A 1UM6L 1D6EB 2H9GA 4GG8B 1LO4L 1J9QA 3KLKA 4TULL 2ZKYA 3MRFA 3QQ9C 4JQXC 4N6RB 3U2SB 1N5YL 1G6RB 1D5BB 5E6SB 3DMMB 3MRDB 4HKXB 1XGQA 5D8JL 2X40A 1LDPL 2FO1A 1OALA 3EDFA 1T21B 4XCNB 5IBTH 4ODTH 5DEFB 3ATEA 4P8QA 1O6TA 3PABA 5CCKH 4NM4H 4UTBA 3LY6A 4NM8L 2NTFB 3CFEB 3H56A 3ARWA 3GTNA 4YE0A 3CLEL 1F8TL 1N7ML 2ZG2A 2BOCA 1FH5H 3KVDD 4RNRA 3MLWH 4IOSA 1OCOB 2PP7A 4NUQA 3FQYA 2WZ0A 3TYGL 2IADB 4ODXB 2NY3D 5E6ZA 1DQLL 3QI9C 3EOAB 2FECL 5AOKA 4YEEA 5GS1C 3SGEI 4HGWB 4X6CA 1CFQA 1HTYA 4LLWA 1PQZB 2IPKA 3O0LA 2F5AH 4GRMB 1RJYB 4MMYB 5ESAA 3FQNB 4MAUH 4AG4H 4MJJA 4Q7DA 5LGKA 1OTSC 3I84A 3UYPB 3VE0A 1SQMA 2GBUA 1UD5A 3H7BA 4EI5A 1UUSA 1DBMH 5DXWA 3FB7B 1IC5H 1MCFA 2D0GA 1YEHL 2XZCL 3FBKA 2YMTA 4FNSA 4TNEA 2X7LA 3ZR5A 2ESVB 4N0CC 2CO7B 3X12B 2EDNA 3BLPX 3GZQA 5D5MA 3SO5A 1QFUL 1AD9A 1SDYA 5EU5B 4OLXH 4PRAB 1T03H 3D39A 1F4YL 2XWDA 3N06B 5CZRA 3MR9A 3TJEH 2YO3A 3KMDA 3LQAL 1NC2A 5HGAA 4M8RA 3L4VA 4QO1A 2H2PD 2GT9A 3DYPA 2IQAA 1TQUA 3S2CA 4B9GA 2BNRA 2VC2L 3HE7C 2Z35B 3VDCA 3PPEA 1M42A 2CDGA 2OSYA 1YN7A 1ND0B 2J5LC 2J5WA 5I0WA 1G7IA 4JFOA 1BWWA 1K8IB 1JGVL 4KJYB 5KYNA 2MMXA 4IRJB 4RMUA 1PEWA 1U8KA 1I53A 1L7IL 2K70A 4TSAL 3C09C 1CGSH 3H3PL 2DQUH 1J7VR 4G1MA 4R8WH 2JE8A 1V5JA 3O6FD 5DA4A 1NOLA 1JTOA 3IGAB 5F6HJ 1F11B 5GJTH 2P5EB 3V0JA 1XMEB 3MBXH 3O8XC 4TNWK 3PHAA 2IWFA 3RWGB 4WFGD 1F3JA 1BXAA 1HZKA 3GF8A 3D2TA 3VQ1C 4I3SL 4H0IA 2YPLD 4PRHD 2F0CA 1JNHB 3VU1A 2ADIB 3QZWA 1EZVX 4X80H 3STZA 2QQQA 3FFCD 5F9AC 3VGFA 1PY4A 4MLIA 2N7SA 3MGTB 1F4WL 4MAYC 1UQSA 4J4PD 2XBDA 4E9WA 1WC7A 2RH0A 3FUEA 1KLGB 1X6NA 2XDHA 1DJHA 3MODH 4MJHA 5DFWH 2WWOA 1FE8L 1GGTA 4ADJA 2CR0A 1CICA 1WA0X 4ZUUB 4I0PA 5I1KL 4GXVH 4BUGA 3LKSA 3FO2A 4KVNL 1H6UA 3EO0A 4HZAA 3NJIA 3RZWA 3TFBA 2GAZB 3ABLB 3VXPA 1QFHA 2AMGA 5D7LA 1A6UH 1U2HA 3UTZA 1EV2E 2X1WL 3ZE1F 1CFNA 1SYSB 1NL0H 2E7CA 3LB6D 3N40F 4HWZA 3KYOA 4Y16D 3ULUF 4A55A 1GYWA 1RZ8A 2QLVB 5D72L 2B16A 3E0GA 3V4VH 1W6WA 1I3RA 5KSBB 2HUEA 2WLIB 2UZIH 2DZEA 3P1VA 3CFNA 5E4EB 1F13A 3OJ2C 4PCSA 4JREC 4QYOA 1XIWB 1OF0A 2Y2TA 3B8YA 4N1EA 1EAPB 4XOBA 1BZ9B 3P9WB 2XTJE 3VFPB 2O6FA 4I88A 3ZY7A 2ADFH 5I76B 4XTRC 4GP8B 4OIAA 3NQKA 2CBPA 4QRRA 2Y5TA 2K3HA 4RGNC 1A9BB 1PF3A 3CLWA 2JB6B 1ZHNA 1FL5A 2B5IC 5FFOA 1EA9C 3V0HA 3B7RL 5IT2H 3V7AG 4DEUA 1A64A 2IGLA 4GUCA 2NCEA 3SJVB 3FUKA 4Z7VF 1MCBA 3MJ6A 2VXUL 4LQFL 3GBML 4ANVA 4KMTL 4GXFA 3SGJA 1JK9A 3IMTA 3NVQA 1CMOA 4G6FD 1NANH 3OKOB 3P9LB 3UTSB 3BT0A 3D0LA 5LN8A 1F3DH 1I7TB 4NNYA 2Y07H 4U33A 5GQBA 1S9YA 1J5DA 3H9ZA 4QEGA 3V0AC 4XO4A 1SJHB 3KCWA 4AENB 2E9GA 4AJYV 4GG6A 1QSFD 3OAZH 3VCLB 3KPTA 1YPZF 3ARZA 4DKEH 2I9TA 4TQPA 4HJJH 2H8PA 1YYCA 4F80A 1MZZA 1GW0A 2W65B 4N2OA 1MDTA 4TUOB 2GFBB 3BXNA 3LIUA 4B9ZA 3ZE0E 2FSDA 3OXRA 3Q9PA 2F19L 4KDTA 1EZSA 2VLMD 3BKYH 5KSVB 1WIUA 1Z2KA 2PO6D 3NPSC 4LQ1A 5IVXA 2OK0H 1PZ3A 1XF3B 2IIJA 2UWEA 3CVIH 3L2MA 3VFOB 3IU4L 3VFGH 1WA2X 2ZCHL 5HY9A 2V2TA 2J7LA 4M29A 1BP3B 1YECL 2GK0B 5EA0H 5I8EB 2OLDA 1Z5LB 2CKBB 3AU1B 3MLZL 4FNTA 1UXLA 5E8NA 2C4FT 3WD5H 2M1KA 1WAEA 2J25A 4FI8A 1I7RB 4UQCA 2AABL 1YEDB 2W1NA 4U2YA 3VXOA 1AY1H 1VEMA 4JR9H 3QS3A 3MJ9A 4KY1H 4QY8A 5IFAH 4MCZB 4DOHE 1UB6B 4NX0A 1SDAB 4X6DB 4ANUA 4W4OC 2ZUSA 2E75C 2OMYA 2A6IB 1KCKA 2VDPH 3BUYA 5L7XL 1EHNA 3GKWH 3HRPA 4LP4A 4FERA 1EHLH 2R56H 3FOLA 5AOZA 4N86A 5B38B 2HMIC 1S9XA 2CLVB 5CS7A 3OKNB 4RRPA 4L1BA 4EKXA 5T1MA 4PJ5A 3DUHA 2HX8A 2EACA 3MLXL 1KGIA 1MQKL 3G6DH 2FH6A 3P9MA 1SOSA 2DWEA 2FDBP 3RUGA 4OJEH 2WO2B 3QRBA 5AW5B 1Z3GL 3TZVB 3ARGC 5HDOA 2C9UA 1AXSB 1K6QH 4LCWB 5KVEL 2XN0A 3JTTA 3QIBD 1JJUA 4G9FD 5ABDE 4JE0A 3HNVL 4YSQA 4FJZA 1E6JL 3GMNB 1PIGA 4F8NA 2UY6A 3T6XA 2R23A 4GAYA 2KUTA 3G6JE 3KXFE 1GH7A 4AMXA 5AW8B 1F1AA 4XP1H 4F7PA 4ODSH 3DWTA 5ENWB 3VXRB 2VDKB 4FNUA 2CJUL 3GD1C 1SNRA 3KHOA 4NN6B 1W0WA 1XH0A 4BWTA 5KYWA 3H53A 3IJHA 3LRSB 4I1PA 4ENEC 3VFWB 5EOTB 2XV6B 5IHBA 1DCEA 2F53B 4NDMA 1UWGH 3CC5A 4L05A 1Z6JT 5CKGA 4E9VA 3C5SA 3Q0HA 4FXKB 5JNYA 3VD4A 2RFXB 1IE5A 3FO0L 1VESA 3VWJB 2J4WH 2R29L 3T0BA 3NN8B 3FTZA 3ULSA 5IESH 1A22B 1G87A 5SWZA 1ACYL 4HF5L 4A7QA 4KI5E 4R96B 1ILSA 5JW4M 1GJWA 1I9EA 3T3PB 1ROWA 4X8JB 2GJZB 3EFDL 2F7QA 6PCYA 1CVSC 5BPPA 2YAOA 5J8OA 3KH4A 3QI9B 3IJ9A 5GS1B 3FC8A 5IVXE 1HCZA 4LLYA 3MNVB 4G72B 3RILA 4YZWA 4ZFOB 4AWJC 3UPRA 2ZOOA 3PNWB 4NKIL 1MJUL 1OGPA 4KJWC 2XVKA 2X4OA 3TS8A 2WLLA 1U3ZA 3LEXA 4NNXA 3UEQA 2W9DH 4PRPB 1N59A 4ODHH 3OKDB 2XZAH 4GO9A 3UXFA 4KRLB 4L1TA 2MKLC 4JFQA 2M26A 4Z7OE 1EEQA 3JWOL 4WTWA 2VN7A 2LVEA 3WS6A 5GGVH 4XNXL 1U91B 1D7BA 2KC0A 4PRNB 3SN6N 2JJWA 1H9DA 5D7JD 5BJTB 5I1JH 1F2QA 1WIOA 1RMFH 3OLEA 3SQOL 4LVOC 4U0RB 5J9PA 2CLRA 3HE7B 3FUFA 5F96H 4M6NL 1UWXH 2J5LB 4KV5E 3UFIA 2OSWA 1RU9L 3ISRA 2AQ1A 2WBKA 1RHHB 2HVJB 1AS6A 4YSRA 3WN6A 2ORBH 2R0LL 3KBEA 2UXVA 3LZFL 1UXMA 2CQVA 3CNKA 4IKIA 4X98B 2IDUA 4PGCB 4P3CL 3SKNA 4GIPD 3QO0A 3LNHA 1N6QH 2KQNA 3BPCA 4PJEA 1KENH 3C09B 3CWGA 3P77A 4J1UA 1QO3B 5AVZB 1FCGA 1YRKA 4CKQA 1YNLH 3V4VB 3KWUA 3FTYA 3E2HC 4Y4KA 5FLUA 3O8XB 2C9XA 4NFCA 4LCCA 4YHKH 1BAGA 1E90A 3BAIA 3LH2L 2WKLA 4KK5D 5EBMA 2X4NB 1YYLH 4N2DA 1KTRL 3OR6A 4LB8A 1KGCD 2NY7L 3HZVB 1CCZA 5AYTA 3WO3B 1MPAH 1DQVA 2NDFA 4TMPA 4PY8I 5KSUA 3LZQA 4MLSA 1BECA 4MAYB 3KAAA 2YQGA 4WW2C 4JCLA 4P23C 3BWUC 2F5BH 4JS7A 1CE1H 4PIRF 1LP9B 4QHNB 5EOQL 3VSTA 2YGNA 5ANME 2ZXGA 4DFHA 4LF3A 4OF6A 5JYLA 3CDCA 3TBYA 2YLHA 3B2VH 4PJGB 3TBBA 5C0JA 3KWVA 1CD0A 4CUCA 3N44B 1AOHA 4HD9A 4QF1A 1MLCA 1ZK9A 2VZSA 3MA7B 3E3QE 2IANA 3DI3B 1H3PL 4U3XA 2EIDA 3ZIYA 2MKWA 3V5HA 5JXED 5ICZB 3CQQA 4MAZA 4PRHA 2YPLA 4YDKH 2ESVD 4Q52A 3FFCA 1BQRA 4M5ZH 1ETZA 5KYXA 5DDHA 3WS3B 4G7VL 2CIKB 3EH5B 2NSQA 1DQQA 1FZOB 1G94A 1BVLB 3CPLA 4U1MA 1F00I 1YEIH 3N91A 1XZ0A 4J4PA 2YPVA 3TGXA 1I8IA 3MUGB 5K33A 1MCHA 3CSPA 1EVUA 5F8RC 5AUMA 4LK4A 3IGFA 1E9OA 4JREB 2VM9A 4FQLH 4YR6B 5J12C 2PTTB 2OYLA 2MOQA 4AQ8C 1KBGH 2YGPA 2Z4QA 2HTLD 1RZJL 5JIMA 4D0DB 3IDMA 4KJPD 2QEJA 4MMZB 5HYFA 1H15A 1BIHA 4XBPA 1YQ2A 4PLJC 4N2GA 3BFWA 4ZUSA 2JI1A 4DVRL 5D1ZC 1MVYA 3NAAH 4LE8A 1E7UA 1TYEB 2WBJD 4Y16A 1KGWA 2B5IB 3JTSB 1LQSR 2RCSH 5CFAA 5DJ6A 5GGVY 2DN7A 3S6CA 3QR2A 1BXXA 2ODIA 2XA8H 3T6VA 1CLCA 3CXHJ 2H1LM 3RNQB 2YD9A 5CJ8A 2WTOA 2F8IA 2XWBA 4LVHC 4ATWA 3V95A 1MOEA 2IFGA 2OKMA 1BQKA 1TKWA 2E3VA 4I2XA 1NMAL 2VDPB 1SJEA 4MCYA 5AB2A 3X3FL 4PPTA 3K0WA 1ZLUH 3THMH 1IC7L 1ZA6A 2ICES 1KIRA 3OAZK 5EO1B 5EUOE 1X9LA 5JPMC 3KWXA 3R8QA 1NGQH 2QGBA 1MNNA 4G8FB 1WA1X 2CIIA 1F41A 4LLUB 1DFBH 1B0WA 4PJ9C 4QTFA 5AAWC 4Q6IA 2J8UF 2QVKA 3N1QC 4QLWA 4C55A 1R3LB 4JFTA 1U8NB 2YAEA 1F45A 4FQHB 1AHWA 3PWJB 3FQ2A 4XCFH 5HHVH 5C0IA 1B0GA 3T77B 1H5BC 3ME0B 3WFDL 2FHCA 3TNNB 2ADYA 3K72B 4J8RB 2ICWA 1S8DB 3D5OF 4YIQA 3VMNA 2ZD0A 1YEGH 2LW3A 5E08H 1S7RA 2PW2B 3T0DA 2VMEA 4QCIB 1INDH 2R8SH 1UD4A 3P4MA 3H4HA 5AVQB 3I3BA 3SDDD 3DROB 3SPCA 5A2JH 1NAMH 5GSRA 2AEOA 4UNTA 3RWIB 4FABL 4ZTPL 1KBKA 4E0RA 3KGTA 3T4AC 3ISYA 4MBRA 3QXUA 1N8ZA 2PO6A 1C08A 5K1VA 2AEWA 2MSPA 4KRNA 2NLJB 1KY6A 1CLZH 3UBFA 3FH7A 4ZX4A 1A3LL 1J5IA 4WFGE 4Y4HB 4A67A 1I9RL 2Q8BL 1NCWL 5I17B 1EZUA 4NOBA 5H94A 2OA9A 4HK0B 3FFCE 2EZ0D 3ZYJA 2JKTM 3DECA 3WKYA 5K5YA 1TQTA 1GRWA 2WWNA 1I1AC 4GB9A 1SXSA 4BYHA 3RIFF 4UDUB 5E6IC 4X5WA 2DWXA 2FJUB 1NLDL 1J11A 4HJTA 4PG9A 1AXIB 2ALWA 1TZOA 1G0DA 1FAKT 2G60L 5MEQB 5D7SL 1M2OA 1WD8A 1OAKL 2SEBB 4U6YB 5C7XL 4ONGH 5IJDC 5SWQA 1TZHA 2C1PA 4CJ0A 1O7VA 2QVIA 2YD6A 3C5JA 2P45B 3IFOA 4G6KL 1Y6KR 3OAUH 5F88A 2OTWB 2XIBA 4L1SA 1KB3A 1D7FA 2A38A 3HHSB 1JZ4A 3K46A 1SRDA 2HLAB 5EZLB 4G9FA 2RHEA 1GMEA 3NFSL 4PJIF 1OP9A 3FT3B 3QO1A 4FD0A 4ZW5A 4UQ3B 2DQIL 5CMAB 2FJGA 4I2XE 4ZPTA 4HT1L 1Y18B 1DCLA 4G6JH 2VW6A 3V7AE 4PP2B 4WJ5A 2HCZX 5E8OB 1GYAA 5I9QB 1A1MA 1SN5A 1T6WA 5JIQA 3UYRL 2H32H 4AXWA 2ZAGA 4XNDA 1AO7B 4G43A 1TYRA 1UENA 4HU2A 4PW9A 1BAFH 1ADQH 2VDNL 2APSA 1IO4C 2CKNA 1FFQA 4P2CG 5GGUA 4OBRA 4NO2B 4JG1L 3S98A 4NUPA 3AM8A 1JZIA 1JHLH 2ZCLH 5TE6L 2HVBA 3MYJB 5IVNA 5I1CL 1GCYA 2PXYD 5DVNA 1H8SA 3LJ3A 4YHPB 1E4WL 2P8PA 4CGUB 1X5JA 5IW1B 3VI4B 3ESMA 1JNNL 2IV9A 4ES9A 5B38G 3V0IA 3S37X 4UV7H 3VRIB 3DJTA 3OKKA 1I7ZA 5SX4H 2EVFA 3TZVD 2L7JA 1BV8A 4AQZA 4Z77B 4JRYE 1ZWIB 1M71B 1QSFE 2YSSB 3REVB 4LCWD 4LPWA 1YY8B 2DKSA 4LP5A 2WQVA 3RFZA 3MPCA 1E8XA 1EQWA 1LILA 2CD0A 3D0AA 2NW3B 1I9JH 4FI7A 3BLBA 3QJZA 5BZDB 2VLME 4LVOB 5B3JE 4PJBA 3RPIB 5FGSA 5B22A 3K8MA 1UWXK 2YPVH 1FG9C 3CVCA 4LEXL 5DQ9B 3VXRD 4M7ZC 2BIIA 3ORJA 1GZHC 2H26A 3QNYB 1GXEA 4H25B 1ASPA 2ZX9A 2ZAHA 4Q14A 2BVPB 4KTEH 4NKOB 1UWEH 2R2BB 4PY7A 1MAKA 3ZN6A 5C97A 2NXYC 1J0JA 2EYSB 1OHQA 4LKCA 4PV9B 3EKCA 3G5ZA 2VQ1B 3D6GA 3BZEA 3FH8A 1D2PA 2F53D 2J6EL 3QQ9D 2PCPA 5H4YA 1IGCL 4AQEB 1T1YA 2EADA 3CZJA 3CN0A 5D96C 2OL3A 5T1DH 5TDNB 4B9YA 5DK2A 4CW1A 1OPOA 3E2HB 5GS0C 3V0VA 4FQPA 4HJUA 4WTZA 3UIZA 3HS9A 2WW8A 4HWEH 2OS7A 5F7MC 5HJDA 1PY9A 2R1YB 3L3DA 2YWYA 3B2DC 3ABKB 2CA3A 4IKKA 5AW3B 3TU6A 4TVPE 4BINA 5I71C 4WW2B 3LS5L 3GSXB 1A7QH 4N6RA 3D3VB 3QI9D 4B97A 3HC0B 1RUQL 3RTLA 4I3RL 2N59A 3U4EB 3L1GA 3VQ2C 1IJ9A 2V8MA 4M7LT 2IAAC 1B4JH 3RHWK 3GIVA 5L88H 2C9RA 4G1EB 3QDJB 3QNXA 1OTSD 3P0GB 2OM5A 2WYIA 1Z9NA 2JSFA 3ZSTA 5EBLA 4PGJA 4QXUH 2NTFA 5GGQL 4N0CD 1QZNA 2H45A 2XQYA 4NO3B 5C0CD 1TVBA 3ILPB 1SEQH 3NSDA 3ZU8A 5IV2A 2A9NL 4POYA 4OCNC 4MMXC 2CU9A 2WVSA 4XC1H 5SWSB 1J8RA 3U9UB 2Y7OA 2NDGA 2JELH 2Z7UA 4RAUA 5FGCE 2ITCA 5J12B 4J3UA 3GT6A 2BCKB 3HE7D 1C5CH 2FEEL 2FUQA 4LHQB 4ZOEA 2Z7ZA 1K4CA 3FQNA 4LL1A 1KWKA 2I7SA 4H0HB 4Y5YC 4HKJA 1OXYA 5GJSH 4NRXA 5JXEA 4WEBL 5TDOB 2ED6A 3LPWA 3KPSE 2ESVA 4MSWB 1CBVH 1UD3A 5D1ZB 1OAQH 1UM4L 5FYLH 4A2DA 3C8KA 4LSUH 5DHYB 4JLRA 4Q0XH 5EU5A 1HHIB 3EO1A 3MLTB 2R7EB 3TN0B 4F2MB 5BCAA 3BP5A 2Z8WC 3P4LA 3ZZLA 3UZQB 2W38A 4TN9A 5DWUH 4LVHB 1NAMB 2D7TH 3TESA 3GSVA 4PJBE 3O8XD 4RLDA 1SVZA 5BRZA 3H6AA 1BA9A 2BP5M 4WY7L 2YMXL 4QOKB 1RXLA 1WBYA 1ZLUK 2FQGA 5JHLL 2QTVA 3VFNA 4BDVA 3KLAB 4LP8A 1K8IA 5EZIH 1SHSA 2NNCA 4J2XA 5JQIB 4RMSA 1JPST 2GC4C 3LKNA 1PKOA 4XCCH 5JPMB 3G7TA 1MRDL 2PABA 4MAYD 2TSBA 5D7KD 1M05B 2WBJA 2DICA 3G9AB 1TPXC 5IOKA 3BRGC 3W0WA 4PJ9B 1KG0B 5EEVA 2GW5A 1RJCA 4QR7A 1NPJA 2PPCA 4IU3A 2FNBA 4XXDB 1Q90A 3A4AA 3NK3A 5BV7C 3M6DA 3V9CA 5C08B 2F74B 5C8JB 3VQLA 1H5BB 3NIGB 1MFAH 4I77H 4BD4A 4M5TA 3WG7B 4PLKC 1JXGA 2WXPA 2VO8A 4UYPA 3BESR 2V2XB 3Q1SL 2BSED 4PU2A 5D4HA 1G7JA 5JOPE 4P2OB 1KFGA 2ATPB 1UCBH 7PAZA 3EYVA 1AQDB 4GUOA 2J72A 4EVNA 1A25A 1KLGA 4GS7C 2DRUA 2OR8A 3BO8A 1F56A 2MCMA 3O4OC 5AYUL 4CMMB 2H6PA 1KBBA 5L2KD 3T4AB 1WBXB 1T22B 2R0KH 2HYMA 3DUSB 3EYQC 4HIHA 5KJRL 4M7JH 4PJCB 3U0TB 2D0FA 1A7OL 4LAJH 1RZ7H 1U6AL 4BSWB 5CEXA 3WY3A 2O6EA 2JCCB 3ARTA 1CC3A 4XTRD 5FF6B 1U8QB 3B1UA 4M02A 2BVQB 3K2IA 4CL7A 4RGND 1PJ9A 4YUEH 1E9PB 5DR5H 3W39A 4UB0L 2ED8A 1GPOH 4H5SA 3BI9X 4IMKC 3FN0H 4KNUA 3IFPB 4CBPA 2WV3A 1NEZA 4EF3A 4GT7A 1FWXA 4XNQA 1I1AB 4DKFL 3SDDA 4XPFL 4Z3TA 3GRGA 1URIA 5BV7H 2H32B 2MCAA 1B4RA 3QQDB 4GAJL 5E6IB 3ZTJH 1H9VA 2VXQA 4LSVL 3WIFB 1RP9A 1T4WA 4X7FC 1IFHL 3M45A 3GSOA 3VFUB 3E9UA 4F7MB 1GGBH 4N3UA 1KCSL 3QH3A 4D9QD 1W2KT 4NP4L 4U6TA 5BVPL 1JP5A 8CGTA 3IDJB 3QIUC 1BMZA 1N3NB 4W81A 3NJKA 3STLA 5MEPA 5K9KB 5C07D 4D8PB 2ESVE 1ES0B 2YRZA 3WEAA 5ICYA 3BP4B 3NYKA 2FJSA 1HXMB 2R1WA 2DMBA 3NCMA 1GC1L 2VM3A 3CDFA 4K73A 5T5FH 4OFIA 3SOBL 3P73A 3SCMD 4X0KB 2CO1A 1G9EA 2VYRE 5I15L 3RX7A 3KPOB 3P11L 4HLJA 1R5VA 4DN3L 3LMJH 4TQIA 1XXFC 1QSED 2VERN 4HBCL 2HT2C 1W0VA 5F9OL 3BVUA 1WH0A 3BH9B 3QEQB 4ALAC 3D0VB 1FLRH 2VSMB 2W0FB 2EDQA 1WRFA 4JHBA 5DJ2B 3UERA 4KKNA 5JOFA 3SDYL 1AZZC 1F3DJ 5LQBL 2XOTA 3L5WA 2FQFA 1TFHA 4UINL 4UM9A 3GI8L 4YHIB 2BW4A 4FFZH 2VZ1A 3VXUB 4A6YL 3UGUA 1U3HC 5TQ2H 3LV3B 1FFPA 2P5EE 2HMID 3PQYB 1J9CT 1XF3A 2AK1L 4FQQB 3MNZB 2WKOF 4JDZB 5J1SC 2BSSB 4P05A 3RWDB 3T3MB 3KPRB 2GCYB 3GO1H 3LCYA 4ZG1A 3OZLA 2JI2A 1M1XB 5I8EA 1N4XL 1T1WA 5E7BA 1NBCA 5F3BB 5D6CB 5CAYB 2XACC 1A4BA 3ARGD 1KGJA 1AGBB 1A6WH 2EKJA 1AGDA 3NK4A 2AV1A 4FP8H 1HQRB 3NJLA 1DJWA 1UXSB 3C8HA 4KMQA 1NCOA 1U3NA 2E5EA 1MCOL 2AJSH 3EBAA 2XWEA 2IXQA 3K1DA 1RLWA 5LXVA 1IGML 1P9MC 4WIQA 5DHDA 4W4NA 4F9LC 5EWIH 1MAMH 3EGDB 1F3RB 2PXYA 2XVGA 2DYPB 2GUOB 1YEKL 2VDLL 4GQQA 2V2WB 4ZZFA 5LDSA 4M7ZB 3VFMB 1HCFX 1M56B 3EW3B 1T3FB 3QJXA 5E03A 2PNDA 4N6QA 4P5MA 3WCYA 4WKZB 2ED9A 4X9GA 5DZPA 2H0JA 4E68A 4ZMAT 4BFIB 2NXYB 3CFDA 3G5XB 3W5MA 4ENED 3GUTB 1BBJA 3FONA 4HJIA 1KJMA 5KSBE 2W80C 4YHML 1XCTA 5DQDH 4DP7X 1NEPA 1MCPL 1QFPA 3TBSB 1U8CB 2EDTA 4B0MM 4A39A 1P6WA 2K6YA 3UP6A 2VABB 3PJSA 2UYLB 3VXRA 4XCEA 4S1RH 5DJAB 2ZSWB 3A6BH 5E1QA 4BGLA 1M3JA 5FA4A 4LSSL 4ZNEE 5LGHL 2V3FA 2ZP8A 4Z7WF 3M86A 5A2CA 1AO7D 2ADGA 2XHNA 2X9WA 5DS8B 3ZZ1A 2X4QB 3LRSA 4X2UA 1BF2A 3RA7L 3SJVE 1H19A 2F53A 2O5XL 5LBSA 1JPGB 2OR7A 4JPVL 2PYFB 4O4YH 4PREA 1XV8A 4LLAA 2XKNA 1JYNA 3L17A 3RWFA 1KCWA 3SEPA 1JIBA 4MZ2A 5DGQA 4KJWD 3TCLB 2WYHA 5ETUB 4QRQB 3UTSE 4DGWC 2KLRA 4PV8A 3L81A 5CLYA 4Z7VA 3FCGA 4U1LB 4Z95L 1HHHB 4CU7A 2F7IA 4IIQC 1JN6A 5FYKE 2KKQA 3ZBMA 1OSZA 5ES4B 3BEVB 4PJ7F 2IAMC 2V33A 4P5TC 1AOZA 1BFOA 3I9GL 2J2ZB 4E42B 3R19A 1R75A 4GYBA 2GJZA 1WT5A 3U0WL 3EJJX 3LNFA 4MMXB 5FHAH 3GHPA 2A74B 3PDOB 5GS1A 3U30C 1PD1A 1YPZA 2X1XR 1YUHB 3RP1A 2DBJA 4ZFOA 3HC4L 1JGUH 5CIPH 4R7VA 4FHKA 2EDEA 4AGNA 5LXGH 4QI3A 2TAAA 4CVXB 1JUFB 2EUVA 4OLVH 4Y5YB 5ERWB 3I74A 5TPWH 1FJ1A 3DOIA 5E51A 5I18H 4ZX3A 5DRZB 3WNKA 3PGDB 1ETA1 4M1DH 5C0CA 1Q0EA 3N40P 4JJ5B 3VD2A 2DQFB 1OM9A 2DAVA 2CHNA 2NW2A 4X6DE 4BA0A 3T0AA 1E43A 3QS2A 2I7OA 3U4BL 4BCXA 2W5PA 5IHUH 4PJDF 4MXVF 4XAWL 5C6TL 2WQRA 5E1AB 3KJ6L 3NSFA 5DHVH 1T0PB 4NPYA 4ZTOH 3WIHL 3CZGA 5EZOH 1TU2A 3S4SB 4C4BA 4LDCA 4LSRL 1ZRUA 2NZIA 1FLTX 4PGCA 3C6SB 2ZPKH 1J86A 5GRUL 1T89A 4P23D 1TPXB 4LCWE 4XO5A 4NQTA 3D3VD 4R4FL 3WE6B 3W56A 3FT4A 1AI1H 1HH6A 3V6FB 4KY2A 2V3DA 3EGSA 3O11A 1S7TB 4FDWA 5IW6A 2WTPA 5BV7B 2ARWA 1A1NA 2MFNA 4UT6L 4NJAL 2XQ0A 3L6FA 4GH7B 3ZDXB 7CGTA 1A3QA 3QDJD 1WGVA 3O6LL 3VXRE 3BUPA 3UTTB 3IJEA 1AE6L 4DUWA 2X4NA 3CK0L 1Y7VA 3APCA 3OKLB 4H8HA 5E5LA 1H8OA 2VQUA 4PCKA 3VXMD 4EOWH 3MLYL 1T80A 3MKKA 4JG0L 4HIXH 3CZEA 2JIXB 2F53E 2QQLL 4GS7B 4PHXA 4LRNH 2VAAB 3GJFH 2W9EH 3QHFH 1U8OB 1EZVY 4WENB 4YSEA 3CIQA 1ODUA 4PJGA 2H1PH 4LSDA 4NKMB 5IQ9A 3ZOAA 2R2CA 3FCTB 5LDUA 5FIEA 1R5WB 2F54B 3ETBF 3MA7A 2Z3FA 1CLYL 3HRZC 3R18A 4PLJD 5JO5B 4ZMVA 2E7LC 1AIFB 2IQ9H 3BCDA 3K5RA 5TK4A 2GY7B 1BF5A 5L4MA 1GR7A 5ADOH 5CP3H 2BSEA 5D1ZD 1NMCC 4PP1C 2MOGA 1I1YB 1BVLA 3N6YA 5E2VH 3CFTA 3T3PE 5JHDB 3QRGL 2B1HL 2EKSB 2KZKA 3WGVB 4L8DB 3R7QA 3TIEA 4GSDL 1JK8B 2XUWA 5L2KA 1NKOA 4YR6A 5HYJD 3O6MH 4NHCL 4ELMB 1P6FA 2IFFH 2ZKHH 3PXHA 1HX0A 4QOKD 4UQAA 5EV7A 4GO6B 4ZODA 5DUJA 4HMCA 4Q4IA 1CXKA 3QIUB 4PRPE 2QPDB 5TDPA 4OZHA 2G3XA 2PP8A 2PWGA 4GLRH 4M5YL 1PZ5A 3CFJA 3ILDA 3D30A 4JO1H 2VKWA 1HJCA 1BM7A 3ZIMA 1AGEA 1G9ML 3RNQA 1ASOA 4BELD 5JXAH 3VG0H 4IGBD 1OTUC 5C08D 3K6DA 3H9SA 3W11D 1G7PB 4AC2A 2XICA 1KPUB 2B0SL 1F58L 3MCYA 4JFHE 5EIVA 1NCTA 3LN5A 4K7PL 3WO4C 5FW6A 4F8LA 4G6AC 4AM0B 3UC0L 3ULUH 1PKQB 4NO0B 2ZKMX 5EO1A 3WSQL 4P59L 5C07A 4WNSA 2NOYA 1S7SB 3A3YB 2X28A 4OAWB 5FYJD 4N5EC 3ALWA 1DBBH 4NWUL 2DMKA 5TE4L 3SCMA 1ECYA 1U8NA 1KYOK 4JHZA 4R97C 4OV5B 4N5UA 5FDWB 1LNUA 2MHAB 1QSEA 4YBLC 3LKRB 4LOUC 5KAQG 1M2VA 1DZBA 3IYLW 1G0XA 4MB4A 4GW1B 4TUJA 3P4NB 4FNRA 4DVBA 4EQ3A 1B2YA 3AG1B 3P0YL 1E28A 3OG6B 4ODWB 4AYFA 3EHBB 3SPJA 3ATBA 5FFGA 3V4PA 1CD1B 1I1AD 5D7KE 3MLRL 1ZLSH 1XGPA 5DD6B 4W4OA 1LP9E 3DJRA 4WGWB 2DTML 4GUPB 2AJUH 5E6ID 4YGVB 1EO8L 2CMRL 4LU5L 2XQYK 1G43A 2EO7A 4XP4H 1JGLH 3QWQB 4HH9A 4PJGE 4ZOBA 1PZCA 1WTLA 5F1NB 5HGDA 1VA9A 4MA3A 2I85A 4LSQL 2DDQL 4XC3H 3UO1H 4HCRL 3HG3A 3PIQB 3TTSA 1W91A 4Z0BH 4YFEA 4JFFB 1QA9B 1MQ8A 1TYJA 5E2TL 4MS8C 2VRQA 4MD0A 3O81A 4OZGF 2DI7A 2PPFA 5HHMB 2I5YH 3ARGA 1C8QA 3CVBA 5DMYA 2LHAA 4P3WA 4FZEL 35C8L 4PLNC 1RJLB 4UDUA 3L95B 5IHHA 5IY5B 4FNQA 1C5BH 3NZ8B 1M53A 1P4BL 3R4RA 3SE3C 2WNGA 4QHLB 1YAIA 3EUDA 4LARL 5I8CB 1JV5A 5F1IB 3QDGA 4XP5L 3QEQD 2VUOA 1BBDH 5CIPB 3TNMB 1LYQA 3F01A 2IGFL 3IDNB 4JVPA 3NH7H 3NIFF 3QCVH 3GSNH 1G9NL 1FHGA 3BD4A 3OB8A 4F9PA 5BOPA 2OTWA 1UEMA 3RE0A 4IBTA 5EU3B 1E4XI 1MJJB 1DANU 1DN0A 5CGBA 3EJCA 4HHGA 1CT8B 2HLAA 5EZLA 1JI1A 5T1KA 4WCYH 1CFTA 2XV0A 3FT3A 1IAIM 2GABA 3CVDA 3PQYD 1N19A 1SLWA 3ALXA 5J1TC 2O6PA 4FFYH 3L1OL 2YR3A 2QT6A 3KPRD 4JM2C 5K59F 3A5VA 4PQXA 2AGJH 1E27A 5IQ7L 3FB8B 2BVOB 4ZJ9A 3EIFA 4NJ9L 4FKHA 5JQ6H 2YJLA 4X6EB 1MWAH 3OB0H 4XE0A 4OGQC 4RWYL 4MA8H 4IDJL 1AO7A 2L3BA 2V5SA 2IAMB 1DVFC 4MS6A 3ARDC 4P5TB 5B1AB 5K9JL 1ZLEA 4AJ0A 2CSPA 4IQHA 1UXWB 4OFYD 5CJ5A 4NO2A 3ES6A 1T5XB 5H37A 3N41F 2MQGA 5DQJB 5DK3A 3U30B 1RIHL 3ZHFA 2DQ6A 2HLFC 2HN7B 1FC1A 2MNUA 3BYYA 1MN4A 4XPBH 2BPBA 5FK9A 2DYPD 4WGVB 4UIKH 2J8UA 5DD1L 5EO9B 4XVSL 5IW1A 3EYOB 7FABH 2G75A 2VUKA 3D9AH 5B7FA 3E6HB 3VRIA 3VFVB 2VISA 4PWHA 4DP2X 1G7LB 1P69B 1K3IA 1HWWA 2C7UA 2GIMA 4BFEA 4ANWA 4HWBL 2R4SH 1JWSA 1W9XA 2XKUA 2OZ4A 4N24A 4HZLA 1MFCH 4CADB 4J3OC 1KCUL 5DJZA 4DO5A 2Y25A 2Z65C 2NY6C 4O5LL 4M7KH 1P53A 3BZFA 3DTXB 1X4YA 3ZKSD 1ZD6A 3L3HA 3TVMC 3WUWB 3PWUB 3RNKA 3KPLA 5GS0D 1KIUB 1MIEH 1IGJB 2KERA 4N0YL 4JZOA 1Q1JL 3G5YA 3PHQB 4H25A 5I23A 2X6MA 2V37A 2E59A 3T65B 3V5KA 2Z92A 2F1BA 3FKUS 5BQ7B 2DMCA 4B6ZA 1OQXA 1JPTH 4FMKA 2WNKA 1I3GH 2FK9A 2LV4A 3GBEA 4YSDA 2JFCA 3TWCL 5E6YA 5EBWA 4NQEB 3JSSA 3KHQA 3SD2A 1XBRA 1SUJA 2WTRA 1L6ZA 2V8LA 1ZLDA 2QHRH 4HKZA 1NC4B 2YXWA 4M61A 3LRMA 4CC1A 3GJEB 1G7MB 5I1GH 3MRRB 1LO3L 1PYWA 3BISA 4JKPH 1MVUB 3CZFA 1MHEB 4BSVA 4AUYA 2R0ZH 2B2XH 5CSZA 1SHMA 3I3EA 1F97A 4AVKA 3ULVC 2R1YA 1OGTA 3UG3A 4NQCB 1UZ8A 4MD5A 1KT2A 4JFXB 4P23A 4M3HA 2OCJA 2DBLL 2XZQL 4YL9A 5JR1L 3GJFK 5I1IL 3FB5A 3WKPA 4UQIM 5TE7H 3U4EA 2VLRA 4PYHA 1QEXA 5IB2A 5FWRA 2BM3A 4AGOA 3TF7C 3X13B 1E9QA 1PG7X 4DP5X 4Z8FH 3T0EC 4WHTA 2CPCA 3LRGA 4JG9A 1BG9A 1KCVH 1ORSB 1QUPA 3HRZB 1XVSA 5D55A 3JV6A 1OKEA 5I0XA 4ZO6A 1LE5B 5D9SA 2CGYA 4XAKE 1NMCB 1YCSA 1AO7E 2AEQH 3LZPA 3VXMA 1MCNA 1AYOA 2E0PA 2VE6B 4N2KA 3KE0A 5A2AA 4D9LL 1IBGL 4ECNA 1C9SA 1RVFL 1A8ZA 2YBRB 3JT2A 2YD2A 3CHOA 1P1VA 5KYUB 1WS7A 1IGTA 2YGOA 5FO2A 3V4PH 4AQ8A 4A2LA 4OGXL 4F33B 1YMHB 5L9DL 2ICWJ 3HLKA 4TQHA 3QISA 3RVXC 2X6BA 3UACA 4G80A 3RB5A 3VI4E 1NCCH 4X4XB 3APNA 1W8EA 4BE5A 3K3QA 3SY6A 3DK0A 4OIBA 5AKVA 3IFLH 1ONQA 1KLFA 4DGIL 2Y23A 4YSSA 2A73B 2DWSA 3B8SA 1QABA 2N56A 3MLTA 4ZOCA 1S5IH 1BZOA 3S4SG 2KBGA 1NFIB 4JFEB 2BSDA 4OFQA 5B3SB 3K4DA 1F4HA 5AZEL 4LEOA 3CG8A 5HYJA 5GGRY 4XPAH 4G9DB 3C60C 1IAIH 1IE4A 4AE0A 4QOKA 2CE6A 3UTTD 1PLGL 3BUTA 4WW1A 3WO4B 3HC3H 3FCSA 3DVIA 5IWLC 5I1LA 1UM6H 2GJJA 1LO4H 4TULH 3KG5A 4KXZH 1VADB 1N5YH 4GKSB 1WG3A 1FNGB 3FU3A 1VRSA 3OAYH 4M56A 2JTYA 4MRBA 2Y1YA 5AAWA 2Z93A 2JIXD 3IDIB 4PRDB 5PCYA 1CR9L 2DWTA 4GNKB 1R4XA 5D8JH 2VL5B 1W72H 5ACZB 1LDPH 2FIRT 4X5QA 3T2OA 5BO0D 4PEEA 1KTKE 4IGBA 5MEOA 3NIDB 3EYQD 1P4LA 1WAAA 4NM8H 4NZJA 4R97B 4QXTB 1H5BA 3ABMB 2F54D 2ZUQC 1SJMA 3O0RL 4YBLB 1LEGB 1PS3A 2XVBA 1N7MH 2EXWC 2WYTA 5AAMC 4ZI8A 3T4YA 3G04B 2YBGA 3KPPA 1V3LA 3QUYA 3TYGH 2G5BB 1I31A 2WCGA 3F7KA 1AQDA 5JHDD 4IKNA 4NC1C 3GSNB 3AADB 3GB7A 3D3VE 3H9HB 5GPRA 2VLLB 1J1OL 3O45B 4PMFA 1Q9KB 5CJXC 2FWLB 4IBZA 1KJ2L 3VXNB 3CDGA 5FO9B 3RB7A 3U0TA 4NP9A 4W9EC 1YEHH 2H0FA 3QDJE 3FQXA 4BSWA 3QIUD 4LBEA 3QYMA 2G4EA 3D4YA 2W0KA 4P46C 4ADIA 1QFUH 3CSYB 3BE1L 5DFVC 1E9PA 3JVGA 1F4YH 3O2DL 4HDIB 2F8XC 3N42B 4FXGC 5AW7B 3LQAH 3AGVA 4AV4A 1MWAB 1ZPLA 3IKKA 4L48A 1GZPB 2PF6A 2VC2H 3LSOB 4EDWL 4JY5L 3K6SB 4ZUWA 2VOTA 3DX0A 3QQDA 5SWSE 3GSRA 4OCXL 2AV7A 3BHBB 1KN4L 3MLUL 1ZTXL 1JV2A 1M4KA 2HT2D 3HG2A 4TL4A 3VFUA 5DI8A 2BMKB 5L4JA 5J6GA 1UYWL 2H3NA 3LH8A 4HXBL 3IDJA 3V5DA 1L7IH 4TSAH 4HGKC 1MSPA 1WWAX 3H3PH 2IBZX 5J7CC 1JZHA 4OLUL 4XPTL 5FUOL 3QJHB 1WZKA 3HZMB 4X5XB 4N0UB 3BP4A 3HHRB 1IIIA 4V1DD 1HEJC 1T83A 5DVLA 4F2ME 2WOYA 3FRPB 2XT1B 1ED3B 1U3HD 4RETB 3KPOA 3OSVA 5HPMB 1WISA 4E41A 2PWEA 1XSJA 4APXB 4HUXA 2PTUA 2F7OA 2VDQL 4ORGB 4QOKE 1E4KC 3DX7B 4JM2B 5GGRB 3T04D 1F4WH 3OB0K 2J8OA 3EBHA 3ECBB 3ZRCC 3KWWB 1FE8H 4PGDB 2XPYA 2C34A 4IU2A 2OMXA 4UOJA 4OIIL 5I1KH 1YLBB 3IVKA 4KVNH 2X1PA 4H26A 4QRPB 2Q76B 5JMRA 5DZNA 2JKSA 1WAPA 3H85A 3MLSL 5C08E 1WAAE 2PKDA 1FPTL 2IH3B 3K8KA 1OB1B 3O4LB 5F7BA 3TBCA 3NIGE 4HUMB 1GJIA 1H6FA 5KS9F 2OYPA 4E9YA 4UI2A 1JWMB 3QUXC 3U0PA 1IC4L 1TITA 1SF3A 1M1XA 5D72H 4P5KA 3HAEB 1HHGB 2GSIA 1N12A 4DPCX 5F3BA 2JKIS 2ICEC 5HHMD 5IMKB 4R26L 1AGBA 2VJ0A 3DIFB 43C9B 3LZLA 4NHUB 1BYPA 3WJJA 2QPEB 4I89A 2VXSL 3S35X 3AT9A 1SY6H 1UOKA 1FV1B 4HJEA 3LKQA 4KK6C 5FYJE 4RIRA 4OFYA 1XF2A 1A66A 3UAFA 4O51A 2Z31A 3BN9C 4ZPVA 4RMTA 2X1OA 4Y2OB 2QDWA 5D7IA 3RPKA 2ZWNA 2HFTA 4NNPL 3DX8B 5T1LB 2P43B 4WV1A 4PJCE 5K9QG 4MNQB 3LHPL 3KLSA 3ZT7A 3ERXA 2NYZA 1A3RL 1BWMA 2JCCE 3IGLA 4KX8A 1VZHA 3X11A 1I8MA 2F18A 2F58L 1CO1A 4JFYA 1NGZA 1NJ9B 3DOSA 1LEIA 2ZKXA 4L29B 5I2IB 2VXUH 3GBMH 3L3IA 4KMTH 4CVZA 1IL1B 3FOMA 1BXUA 4ABUA 2VWEE 3S34L 3LVEA 3MV9D 1VSCA 4LCUA 4W9GC 4BXSV 1Z9OA 3BUQA 2HFEB 2GTWA 2QKIC 4NWTL 1O5PA 1T4KB 4X7SL 2QR0B 2X2YA 1P5UC 1O7DC 1HKLL 4KQ4L 4L9DA 4Y5XA 5IQOA 2EC8A 4ZAKB 3D8MA 3GBNH 4YSUA 2Q6WA 2I60L 2IAMD 4ZQKB 3ILEA 4P5TD 4LNRB 2F19H 4NYLB 1GL4B 3PP3H 4G8EB 4G11A 5C86A 4UTBL 3QCUL 4OH2A 5BUAA 1YECH 1UWFA 2XWJB 4MDRA 2OMVA 2AJZB 3B37A 5D2NB 3UROR 1I8AA 3MLZH 3EFFB 1XGTB 4GMSL 4GRWF 2MCG1 1P5VA 3FQTA 2AABH 3V8OA 5MERA 1JDDA 1GHFL 2DQGL 4U1LA 3QEQE 5HI5C 3U9PL 5FKAB 3IMVA 3DTUB 1A6TB 4R7NB 2FX8L 4M4RA 2DIJA 2WUCL 3F7PC 3HS0A 1FFOB 3CDZB 3LXCA 3MV8B 4NERA 4U1NA 4CC4C 4PJHF 5L7XH 4BE6A 4HD5A 3RDTC 3GMOB 4PG2C 4K7FB 4N1CA 3O2VL 4XPGL 4PW3A 1SOKA 4EUPH 3W57A 4N25A 3B7TA 2DQDL 3A6OA 3C2AH 3BIAX 1UKQA 2PWHA 3P02A 1YUHA 3RRQA 3PQYE 1ESOA 5FO7B 2C9AA 1W72B 1XD1A 2XNAB 3L9RB 3NZUA 4QRAA 1T0NA 3T3ME 1Z3GH 3KPRE 5TD4A 4Y4FA 3WUWG 5KVEH 3IEAA 1D5XA 2V7NB 3VGGA 4ZDHA 2WKOA 1MFDL 1FP5A 3I6LD 1E6JH 3N5AA 1JTPA 2X5PA 1RZFH 4JDEB 4ZYKB 1LEKB 1RHFA 5IJVA 1ECZA 2DQFA 1BJ1J 4NQED 3REWA 3M1BA 4DERA 2AJXL 4JX0A 1NC4D 3FK3A 5IJBC 2HT4C 2CJUH 2CRIA 3C60B 2MNJB 1TTCA 3UZVB 3ZO0A 2IH1B 1HNGA 1VFBB 3BAKA 4A7TA 1WFIA 3JWOC 3APFA 4K3DL 3UZEC 4YOKA 3OAYK 1EEUA 1HEZA 1UJTA 1DANT 3SQBB 3QG7H 4BWUA 1E8ZA 3CN2A 1FBIL 3W9EB 1G7QA 1SDDA 3FO0H 1U4EA 4FQ1L 4FQIL 4X7DC 1FI8C 2R29H 3J07A 4JPWL 3HPJA 1N0LB 2VC2B 5AVSB 4PTUB 3RTQC 4EEEA 1EEZB 2BOLA 2ZUQB 1ACYH 3GSQA 4HF5H 3IJSB 2YZ8A 4PVNA 4AL8L 5K39A 2FGWL 2ZWKA 1FAIL 3GMMB 1D6VL 3OKLA 3EYFA 2BFGA 2WVTA 4V33A 3U1QA 3EFDH 4LPXA 3MCKA 2CUHA 5IQNA 3SBQA 4PP1D 3VGDA 3RJOA 1XSKA 1FNEA 3NA9L 3STBA 4U6HA 5C2BL 1EHXA 3K0YA 5FKPA 3H54A 4NKIH 1OARH 1MJUH 4BA8A 4U3CA 1AAJA 3FB6B 3IS0X 3UCQA 1A2YB 2WC7A 3WNJA 4KH2A 2EC9U 3JBG7 4YZFF 3WFBH 2I9LB 5L6YL 1MCWM 3CCHB 1J87A 1XBDA 4YO0B 1R5WA 2OXHB 1WHPA 3D33A 4WI7A 3JWOH 2FB4H 1IC1A 3QUKA 1WHOA 4XNXH 4ISVB 2ATKB 2CCLA 2EVIA 5IFHH 4P46B 4U4IA 5I1HL 2EDKA 3BQUC 5JW5A 5HJ3B 1X5GA 3U79A 1C16A 4IMKA 3S96B 3T2PA 3ZKNC 1PDKB 2OV0A 1HK6A 1SHXA 2EE3A 2X12A 4YWGL 3SQOH 1AHKA 1XTMA 1OK8A 1NGWB 2YXFA 4P4RA 4WFHD 2YN3A 4NIYE 2R59A 4PUBL 4NN5C 1QLRA 4JFED 4QT5A 1YO4A 2D9CA 2FHFA 3GHEL 3MUUA 1A5FH 1OTUD 2QSCL 1TJHL 3P3RA 4M6NH 1NANI 1DVXA 1RU9H 1UT9A 3DI2B 3V55A 1G1KA 4OY9A 3WHXA 5C0AB 4KRMB 2R0LH 3LZFH 4YHLH 5IIEA 2DYRB 2VH5L 3QIUA 4G6AD 1UM5L 2CO2A 3GQFA 1CJYA 4WSJA 2P8LA 5D6DC 2FJFB 4HUVB 3LN4A 4LLDB 1WTGT 2Q3XA 4K4KA 1IAOB 4FQ2L 1ET7A 1KLUA 3BKJH 3G08B 4ONFH 3PWNB 3AABA 4OVVA 1EJ8A 4N5ED 4FS0A 4FQCL 1RD6A 1YEJL 3F12A 4G70B 1UB5B 3LH2H 5I1DA 2ZE0A 2DH2A 4Y2DA 3FMGL 2DQEL 1L6PA 1LK2B 1MCIA 4Q2ZB 7FABL 2NY7H 4LOUD 4OUUB 4P49A 1VZIA 5HGHA 4I9WE 4BFOA 2AITA 5E2UH 3MYZA 4PJDA 4OZIA 1N8OE 1TTFA 1TO5A 5EOQH 4NAJA 4XB3A 3CZUB 3OPZH 3D2UB 3QWOB 3H3BC 5TQ0H 4JPSA 3RIFK 4EIZC 2VQTA 4YSPA 4IBYA 4GY4A 3BIKB 2X3AA 2Q2EB 4KAQL 4V1DA 5LNEA 2M83A 3TONA 5B7MA 3K71A 1YN6B 3L3JB 2ZUTA 1KB5A 3NBNA 2LABA 1QTSA 1H3PH 1U3HA 3I02B 4LZKA 1PX4A 3BGAA 3ZT5A 3VD0A 2FCBA 3ZDXE 2R2EB 2LGNA 3MJ9L 4R83A 3RAJL 1Y07A 4HIJA 4G7VH 3UTTE 2YJQA 2BC4B 4CSPA 4MS8D 4PJAF 1JFQL 4Y2LA 3HBZA 5I16A 1LGVA 2DB8A 2ICEB 3I9PA 4DQOL 3QARA 4WHYH 3RJQB 3US9A 1CD1A 1RJZA 4F7CA 3TTYA 3P2DA 5I1EL 5J1AB 5G55A 3SE9L 2CO3A 2HVKA 2VAJA 2ITDA 3IPBA 1RZIA 3L7EB 4GXUN 4L4TB 4JFPB 2WXMA 2XRAL 3NUKA 5DWPA 3DX6A 1P9MA 4F9LA 5KJ7E 1KJVB 3BVWA 3ZE2B 3L9YA 1DJXA 3QJSB 4DVRH 2F54E 2J1KA 1WQVT 2WZ6A 3PL6A 2OMUB 2L04A 2N0MA 3DBXB 3I50L 4G8AC 4L4VA 4MXQC 2NQCA 2DWDB 5ICUA 4F27A 5FV2A 2FIKB 4K2UL 4U3SA 4ZFZA 3E6FA 2VMJA 4ODUB 4WEUD 1U36A 5JHDE 1MFBL 2B4CL 1NMAH 1RJLA 2NNAA 4OCRL 3L95A 1TTAA 1F6AA 3X3FH 3NRQA 5H2BB 4RZCB 1IC7H 4EUPB 4ELME 2ZWSA 1QPPA 4KXCA 2CDEA 5F1SA 2QKIB 2VSDA 4GP5B 4HSAC 2UV3A 4JM2D 1C7TA 1P5UB 3FRPG 1J0ZA 3X14A 4NUGL 4ONOA 1KNOA 2J6WA 2Y1VA 3TT1L 2Q7AA 2WLHA 4JZJA 3S5LA 1VEOA 4PFEA 4EIUA 1DVFD 3ARDD 4AZUA 1TMCB 2ZOWA 2XIIA 3MMEB 3MUHL 3PP3K 2E9IA 3GMLB 5EU3A 4EI6B 1MJJA 2EYRA 3UTQA 3UAEA 1FO0L 1ZS8A 3FPXA 3L4XA 3NCEB 2NNRA 5D1QD 3WFDH 4MNGA 2MPAL 1K5WA 4G83A 2HLFD 3MV9A 2WXKA 4AIOA 3JT0A 3O4LD 3PJNA 3GXPA 4P3DB 3ZQ9A 1BREA 2VR9A 2BOBA 1DBAH 1TFPA 2X4PB 5DMGC 1JD7A 5F93C 2C5DC 4GP4B 1OL0A 4IIQA 5GIRB 2VR5A 1OWWA 1KIPB 3Q6GL 1PKQE 1BFVH 1ZA3B 4N2EA 3QC6X 4BZYA 3RBGA 4FABH 1HSBB 4ZTPH 2C8NA 4JFVA 4UZSA 3RDTB 4J3OD 1T1ZB 3DO4A 4YHYC 2NY6D 4GINA 4D3CL 4X9HA 1I8KB 2HRPL 3Q8EA 1A3LH 2OYMA 3TVMD 1I9RH 3Q2VA 5T1LD 2AJ3B 3MNMA 1NCWH 1O9ZA 3DV4B 3N43F 1N70A 4MNQD 2FLBT 4JMXA 3KYKH 4UTCA 1LMKA 5J89A 1PGRB 3LOWA 5EO9A 1LK3L 3VWKC 4ENZA 1CN4A 2EDRA 3MXVL 1T20A 1D5ZA 5IVOA 3K81A 5AVRB 4Z23A 1NCUA 1F90L 4LLQB 3K91A 2WIMA 2NUTA 4ES8A 4PB9H 1R5IB 5IW3A 1XH1A 3P2BA 1CGVA 3U2JA 1HHKB 5BNXD 1NLDH 3RI5F 3L9BA 2ZQKA 1NIEA 1TZGL 1C5DA 1RZKL 5IM7B 2CM5A 2EEBA 4J27A 2C3VB 1DVUA 2G60H 1PTZA 2E46A 5D7SH 5IFJB 5C7XH 1OAKH 3QR1A 4GJTB 4GRLC 1ZVNA 5T5NG 1T04B 3MRMB 1IV8A 2WLKA 3KS0J 2L0DA 3UH8A 4G6KH 1NIDA 1DVQA 1JCVA 4QXGL 2ZXBA 4JFFE 3EH2A 1XL6A 2WVUA 5C6WH 4YVUA 4C56A 4ESKA 3KYAA 2GJ6A 3ULVD 2YWZA 2VDML 5HHME 3NFSH 4PCTA 5EDSA 3WKNA 5FUCC 1DLHB 1FUNA 1KYFA 2DQIH 4POUB 4HT1H 3FO9B 2GTZB 3N9GL 1R46A 1D7DA 2FSEA 5IROC 3RGVA 3DGGB 4OZFB 1U8IB 4OZGA 4HJGB 5EB9A 4PJFB 2FEDC 5IR1B 2JVUA 2YXMA 1V3MA 1NC4A 4Q8BA 3DK2A 1XB8A 5CJQL 3RTQB 4TVSa 3T0ED 5CEZD 5H35B 3UYRH 1A7RL 4GKZB 4XX1G 1MHEA 4FF9A 1S3RA 2VDNH 4UOW0 3ZXAC 3EXLA 4JGJA 3VMOA 4X9YA 1JZ8A 3MV7B 3NDYE 4PLOB 4JG1H 4XNUL 4QHUA 5AKRA 1GSKA 2HJLA 4RFNC 5TE6H 2EEAA 5I1CH 1EEYA 3BVNB 3VSUA 1LLAA 5IHZA 5JORB 2Q7YA 4IKJA 1TQWA 1E4WH 2N4IA 3BVXA 1MCJA 4KBPA 1WJ3A 4F57L 3PS6A 1EBPA 1JNNH 1YDPA 5K69A 2EP6A 5B7EA 3V9FA 4EPSA 3LKOB 3Q13A 3RVXD 3K2KA 1AQ8A 4LOFA 4HUWA 1ORSA 3KPNB 2E7LA 4HEMA 2UX7A 4PCYA 2P80D 3VFSB 3DBSA 2YPKA 3KR3L 3IK2A 2NX5B 5I66A 5GRJL 1P7QB 2NY5C 1Y1UA 2GB2A 2NYYC 1CI3M 4LHUA 3V0GA 1USZA 4NN5B 3GZKA 4LEXH 1WZAA 2DOCA 4RX4D 4MDJB 5CCHE 4BK8A 5LVEA 5EC1B 5KYUA 3FN3A 5LG1A 3WN5C 3C60D 4LSTL 4NRYA 4HIEA 2K4AA 4AYGA 2FWSA 1YHPA 4JRXB 4D9RD 1WPCA 2PTVA 3QNZB 3OGCB 3ABGA 1F1DA 3HHMA 4X6CF 3ALPA 4L3EB 1NBZB 2J6EH 3RVTC 2XN9D 4FLRA 3LNGA 4BFKA 3KPQA 1WYJA 1IGCH 3FT2B 1FVEA 4MKTA 4S2SB 2FAUA 2R83A 4FXLA 1KGUA 2A7BA 1SM3L 2A73A 5CJOL 3QBTB 2GY5A 4HPYH 2Y3AA 5F3HB 2WWMC 2W94A 3CMOL 1IQDB 3SKMB 4G9DA 5D5MF 2FJHA 3TA4D 5D1ZI 2HAZA 2EXWD 4CU8A 2B7DT 1S78C 2G2RB 1EFXB 3QEUB 2IBBA 5F7LB 4Z7QB 1QEWB 4Y1AB 3OKEA 3LS5H 3PFQA 4NO5A 1DYZA 3II1A 3UEZA 4Z78B 1R3KA 1RUQH 2OBGA 1X5KA 3I6LE 1NSNL 4I3RH 2XY2A 1PFOA 1JZFA 3WHE0 1EGJL 1ML0A 4J8QA 4NQEE 3MRGB 2QMJA 1CDYA 4AQAA 3BT2L 3QDMB 3QEHB 4FJ6A 2X2UA 5GGQH 3WTVA 2C3GA 1WDAA 2E27L 4DWHA 1FL3A 4P46D 4DFIA 3JTBA 1MCDA 4H8QA 4AYID 2A9NH 2VLKB 5DFVD 3WXWL 4NQCE 3EYSL 3ZDZB 3D69A 5ALBL 1KDIA 1FYTB 3EGXA 2WBXA 4B9FA 3ZKMC 4RA3A 3H9HA 2VN6A 1IT9H 1OPGH 3HKFA 2WB1A 1EFQA 2X4SB 2VGLM 2ZOLA 2CG9X 3V10A 2X9XA 2YRLA 1KTCA 3MX0B 5C0AD 2V0AA 3NFPA 5FO9A 5IMLB 1RH8A 4WEBH 3FQRB 4KQ3L 1PNDA 3SPVB 3BGMB 5IOPB 4NRZB 2YKKA 1UM4H 3X1BA 5JW4Q 1OAUL 1QVOA 4LCIL 4L37B 3MRIA 1AKJB 3V4UL 5HDWA 4X99A 3H4FA 3U46A 4M48L 3WFCL 1QLFA 1KPVB 2WAQA 3RVWC 2P8MA 3ULUE 1VPOH 3NACH 1RZGA 1A4KA 2LU4A 4TLKA 3C5ZA 4WY7H 2YMXH 1CXIA 5F0MB 1MCKA 3KZ8A 5JHLH 4NKQB 3E3QC 3AWFA 5C0FA 2PUQT 1VGKB 5L0QC 2RMNA 3IJYB 5AVXB 5HGGS 3MJ7B 4QRSA 1JDAA 1BVKA 1IKNA 1JS4A 1MW3A 4O58L 1HEHC 4KUCD 6FABL 5MP6L 2V7HB 1JTTA 3KYMB 1MRDH 4F7TB 5KEZA 1S9KC 2PPDA 4OKVB 1KIQB 1TVHB 4JHAL 4LLMA 4L8CB 3Q5YA 5BMFL 1WZ1L 3G6JF 3R06A 3MO1B 4I4WA 1A1OB 4Z7WB 3CV5A 3OBAA 4X5XA 1E5BA 2A77L 1H0DA 3F3HA 5FYJU 4DQAA 2V9UA 4DZBB 4K8RC 4JFEE 1ED3A 1MG2C 4P5RA 5HPMA 4BGDA 2EABA 4YDVB 3A47A 1B9KA 4HHAB 3IS1X 2IOOA 1GJUA 3QUXD 4KXBA 1KN2L 3DYOA 4WK0B 4HX1A 5LAXB 5SX4I 1QBLL 3GDBA 2ZG3A 3QQXA 1PAMA 4K5PA 1MF2L 1PG7H 1ZTMA 5AYUH 1DVFA 2CH8A 3ARDA 2BP8A 4IHOA 1GC1C 1OCWL 3CH1B 4KK6D 3VQMA 1QYGL 4YQXL 4YHYB 3A24A 4PD4K 5DJXA 1KGYE 1A7OH 3Q01A 4KI5F 2EC9T 5D1QA 3BN9D 1SQ2N 2HJKA 4DH2A 4GG6F 3NJGA 2B39A 3NIDE 2D03H 1Q9OB 2IH3A 1CFVL 3AREA 4AVJA 4XMLL 4LPUA 4UB0H 1JWMA 3VWKB 1RPQA 2VZVA 5DT1L 1E50A 4K9EL 5IVXF 5IEKB 3HAEA 4XPFH 1XEDA 3CSFA 3HR5B 43C9A 4GAJH 1QRNB 5C7ZA 1F42A 4K8RH 1CYWA 5EN3A 4LSVH 4JY4B 4EIBA 1HZLA 4BKLA 1HJBC 3T8XB 1IFHH 1ACCA 4ZMOA 3LH9A 5LBVA 3AXLA 3F58L 4RGOH 4Z7OF 1J18A 4NP4H 3LS4L 5BUGA 2X0WA 3SDAC 5BVPH 2OYKA 3V9EA 3TVMA 4O2EA 1FZMA 1P1ZB 4GRLB 5T1LA 3HI1B 2K7PA 4X6BA 3BMVA 5JIIA 5E9DD 3D07A 2BP0B 3MGAA 2VZOA 1T7VA 4UT6A 1Z9SB 4ZTEA 4EUPG 4QWWC 1BQHB 4IK6A 2A6DA 1GC1H 3SOBH 2ARJB 2OL3L 2OMZB 1IC0A 4MA1C 2YGQA 1VDGA 2CLZB 4WWID 2WP3O 5I15H 1XL4A 3P11H 4KV5F 5DUPL 2NCMA 4U1KB 1J0KA 4DN3H 1IL1A 3B9DA 3B3BA 3D25A 4HBCH 4PGBB 3GRWA 3DRTB 5F9OH 3W3BA 1TIUA 1Y6MR 3HN8A 1GY1A 3QHZL 5B21A 1EH9A 3BH8B 4L4JA 2Z8VC 1RULL 4P2QD 1NFDB 2DW5A 3V2AR 3OXSB 5CD3A 2ZP0T 4HLZH 5HI5D 4BXVA 5AYQA 5LQBH 1G6RL 1NKGA 1QWHA 3PHSA 1FZKA 1SFDA 2E9BA 3VRLE 2WGNB 2Y7QA 4LNRA 2UZYB 3RDTD 4A6YH 4N0UE 2VDRB 1VFUA 2ZOKB 1XCQB 4RFNB 4B7IA 2BVEA 3CFCL 4W9IC 2AK1H 1IEBB 3MTXA 3K6OA 3HIZA 5DZAA 3L3GB 3ARFC 5IZ7A 5JHMA 2EUZA 4JQIH 4L23A 1CPUA 4DK6A 1N4XH 4HEPA 1U8HA 4U1SB 4B9JA 4KPHL 3WNLA 3TEUA 4B27A 5ILTL 3T0EA 4LCYB 4NLHA 1I85C 1CG9B 3F7VA 2ILLA 2UXGA 5ISZD 1HAWA 1MCOH 3CX5K 5I0YA 3II2A 1IGMH 5DLLA 1A9EB 3F04A 2KPWA 2YEZA 1HL4A 1GVIA 4LVEA 4OF0A 4R0LA 4XGZA 4ELKA 1UACL 4QRPE 1MCRA 1RUPL 1C12A 4JHWL 1YEKH 2VDLH 4IMLB 3IMRA 2JTDA 2KYIA 3IDUA 3RZCC 2CHZA 4D7BA 4R7DA 5BZWB 4Y5VC 3HN5A 5I6NA 3L9RA 4IEFA 3WN5B 1OD7A 3O4LE 4Z7AA 4TNVF 4BH8A 1CDJA 1DJGA 3L8QA 4NQDD 4DP6X 3FTUA 5HJBA 2P80A 2EQDA 3IPFA 2IWKA 4YHMH 2C3HA 5KS9A 3INUL 5A2KH 1U92A 5KN5B 43CAA 3QUMB 3QFDB 1MCPH 2W95A 3IWVA 3W38A 4AIXA 3ETTA 1Q94A 3UBHA 2IH8A 2HT3D 5HSFA 3NCWA 4RX4A 2X6VA 1IAKA 3EF4A 2R1XA 4TLSA 1L9SA 1GW6A 4LSSH 4OCYL 5LGHH 4MNQE 5E9AA 1H3UA 3ATFA 5DHMC 2IH1A 3B3IB 4OI9A 4OZFG 2VDOL 3DVNA 3MGOB 3MV7D 5E5RB 4WU5A 4MB3A 1X7QB 3RA7H 1XGZA 2O5XH 4P0DA 1XH3B 1MCEA 2XN9A 2DEWX 4F91B 3KGUA 4JPVH 4TYUA 1NGXB 4YXLL 3CFKA 1QFOA 2WNXA 1YMMD 2X3BA 3T1FB 2QSQA 5C6PB 3FQ1A 4OV6F 1ORQB 5AEAA 2O5YL 3BCFA 5EUOF 5K93A 3T8VA 3OMZA 1U8JA 3SGDH 4R5VA 4DNLA 1CUOA 4Z95H 1EO7A 3L45A 1PLCA 2VIRA 2NY4B 1EEZA 3C9NA 4AGMA 4TPRL 4Y19A 3BLKA 1AD0B 3I9GH 2EIZA 1NGYA 5FW8A 2Z7WA 2D9QB 3FF8A 3FU9A 2ZAIA 2IWGA 3BQUD 1NAKH 4KO6A 4OCSL 1R0AL 2NX5D 5IMOA 4HCRA 4QTHB 4K15A 3U0WH 3CFMA 3WDJA 4XBGA 2NNXA 3T71A 5I73C 7PCYA 5IBLC 4KKAC 5HHPB 3U25A 4G7RB 2AEPL 4D0CB 4N26A 4OCWL 5F7EL 4N68A 4D8OA 3HC4H 5CILL 1TCRB 1TEYA 32C2A 3C6LD 1CXLA 3U7YH 4KKPA 5EZJA 3TM6A 2DLFH 1HAUA 4XX1E 3RY4A 1EUUA 5D2NE 3WEBA 2ENYA 3CN1A 4KQ0A 3BIBX 4JRLA 4URTB 4FFVC 4FYRA 4F8OA 4GO8A 4WEMB 1M7DB 4YPGA 5C0DB 5DZJA 3EADA 4M3KB 5HJGA 5CGMA 3IJ8A 3ECQA 5EIIB 2KHAA 5A2BA 5M94B 2WGXA 4P46A 2G4GA 2A83A 5AALA 2VXQL 5JIKA 4MX7A 1M6OB 1T0MB 4FXGA 5DSCA 2EDOA 3I2CL 2R39A 2XV3A 5I24A 4LPCA 4XAWH 4J6IA 1OP5K 1BG1A 4HXAL 3QB7C 4XX5A 3VFTA 3KJ6H 5SX5H 2NT0A 4ZUVA 5C0BB 2ENQA 4P2RB 3SPIA 4PJHA 3LEVH 3WGUB 4G71B 3WIHH 1I8UA 4GIOA 1I7UB 3M88A 5L0QB 5DJ8A 3F62A 1Z5HA 3TEXA 4LSRH 1EFXD 4KDVA 5TGBB 4HHWA 2OW6A 5GRUH 2J20A 3MRKB 4R4FH 5DZVA 4NI3A 1JGDB 1S7VB 1K2DB 2RIKA 1ZVHA 3G08A 3QJQB 3PWNA 3JYBA 2W60A 1Q9LB 4UT6H 4LL4A 4NJAH 1SF5A 3PWLB 4BHUI 4OGZA 3L4UA 3LVTA 4ONHB 4ZFQA 4AQOA 2HG5A 1O6VA 1PJWA 2IBZY 2PCYA 3CBJB 3O6LH 1XX9C 3EOYG 4EN3C 1AE6H 3O3EB 3FU7B 5ESVB 3T2NL 3CK0H 4FMFA 1H8NA 4XNYL 1P7KB 3QEGL 4N20A 1G1CA 4Z18A 4L18A 1UD2A 3MLYH 1OOAA 4F15C 5CBAB 4Z7NB 3QG6B 3QRLA 4JG0H 1FG2B 5F71A 5F72S 3TA3C 3IETA 1WO2A 2MEJB 1B88A 2QQLH 1FRGL 2HH0L 4FYQA 2UZXA 2XN9E 1RPUA 5ITFA 3VH8B 5AVWB 5DYOA 3BW9B 1EANA 1LD9A 1MCLA 2MJWA 1G9MC 1E6OL 3Q8FA 2ZCKL 3P3SA 4K07A 5HHQB 3QIWC 1DJYA 3MRCA 5I74C 1YN6A 2CKBL 2EH7L 4BH7B 4W9DC 4MD4B 1PSKL 2HKHL 3I02A 1A6ZB 1CLYH 3N41B 5C0RL 5AKTA 7TAAA 1AZVA 4HAGA 3F5WA 3Q2WA 4GKNB 4XMVA 2LT9A 5HHXL 1I8LA 2D7NA 1DUYA 3GI9L 1EX0A 3I6SA 4W6WB 3QUXA 1JHKH 2NXZB 3BWAB 3B43A 3FO1B 6CGTA 3GXDA 5IKCB 1INQA 4M7LH 1TENA 4MXQD 2WLJA 5INDA 3U7AA 4NZDA 1W80A 2TSAA 3QRGH 5C09A 1JZ7A 1AGCB 1HI6A 2B1HH 4HOWA 4ZO8A 4GSDH 3EF7A 2LTQC 1AYRA 5L2JB 2AJVL 4NHCH 3WJLA 3G5VA 4NC1E 5L4FA 4A6YB 1QD0A 2CR6A 1EDHA 3M07A 4MZIA 3SDAB 4FC3E 4P9HC 1HVXA 3JV4A 4F20A 3UAJA 4HU8A 2DL9A 2XXMB 4A2FA 2OJEB 4PGEA 3N0PB 3WIIL 4M5YH 1XR9A 3JWNH 4OKDA 1N26A 1OM3L 3DARA 3DBXA 4NUJB 5E94A 5JOEA 1FH5L 4ZXBC 2A6JB 3P69A 5IB5B 1JF1A 1XD0A 4U4BA 5B3JF 3SDXB 1G9MH 2C3XA 3O3BB 4MA1B 3TBTB 2CXGA 2Y24A 1FORL 3GC3A 4ODUA 5KSAA 4M6ML 2JJSA 2WCSA 3DMMC 4PWIA 5DJCB 3HG5A 1CF8H 2VDKL 4QXWA 3MRBA 1HH9A 3OKMB 4MAUL 1F58H 5H2BA 4ZT1A 1C7SA 3RWHA 3QQ4B 2MTAA 4RZCA 3KCPA 4LNVA 1D5RA 3UC0H 3AACA 2YUXA 4EIGB 5C0AE 3WSQH 1AR1C 1FVDB 4P59H 1P5UA 5CINL 1UT1A 3HNTL 5E9DA 5DMGD 2PPEA 4QHKI 5J6SA 1UJ3A 3S7GA 5K9QI 2MPVA 4WWKC 2FO4B 5LBSL 1IGYA 2F9BT 1Q0XL 4NWUH 1FVCB 4XCYA 1BZQK <