2QQLH

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
227
structure length
222
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTISGYGIHWVRQAPGKGLEWVAYIYPDSGYTDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAREDFRNRRRLWYVMDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Neuropilin-2
publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 222
sequence length 227
ec nomenclature
pdb deposition date 2007-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qqlH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qqlH01
1SJEA 2UWEF 4YHOH 1OAZL 4RFOL 4K23H 2OQJA 3QUML 3T4AA 3MBEB 3STBA 3SGEI 1JF5A 4BUGA 5FFLA 1UCBH 3L3KB 3VWJA 3MRMA 4OQ1A 5HI3C 3OG6B 3T04D 3QFJD 3EDJA 3EFFB 1A4KA 1EGJH 3UYRL 4AZ8A 2ZOLA 3E6HA 5KOVC 4PRHB 1FIGH 1ZLSH 4KK6C 3VCLB 2BNQE 4L5FH 4OFYD 1YYLH 1MHCA 5J4MA 3I84A 3CXHJ 4N0UB 43C9A 4LIQE 3BHBA 3QPQC 4IDLA 4C54A 4ODVH 1OAKH 4M7KL 1MCRA 1YEHL 3CCHB 4Q58C 4Y5VA 4X5WB 3B3IA 4XNZB 3BD4A 4U1HB 5EFIB 5MEPA 1T0MB 2JCCE 1GIGL 3G04B 3S5LA 3HZKA 2XTJD 4H5SB 3BIAX 2Y9RT 4TOYL 4YXKL 4PIRF 1Q0XH 4LL9A 5ESVA 2VSDA 4MS8D 1WSST 1I7ZA 3BZ4A 2W38A 5C9JA 4L8SA 3VGFA 5T3ZE 2NXYC 1XGQB 2NY7L 2BVQA 4FOMA 4HIHB 5KSVA 1CGSH 1NLBH 2J4WL 3P3YA 4L29B 5DJCB 2AV7B 2DQIL 1NGYB 5FYLD 4GBXC 1XEDA 3JWDL 3Q3GA 3MLVL 4OZIE 3C2SA 2PN5A 2Z92A 3VFWB 1OTSC 2QSTA 2WBJB 1MH5B 5HHMD 1BZ7A 3SDDB 1I8MB 1JGDA 1JPSL 3U0WH 2BSTB 2E9IA 5J57B 1MI5D 1S3KH 2XKNA 3WMSA 1CICB 1RUMH 4ZD3H 4FNLL 5DRZA 3WKML 1N5YL 1P7QA 3HE6D 3CSYB 3SDXA 1T6WA 2WBWB 3O2VL 5E2JA 2OK0L 2B4CC 5GHWL 4N8PA 2R2BB 1ZA3B 2DLFH 4YHIA 1IZJA 3CVHH 5E00B 1AGFB 2IBGA 5EZLB 1D5ZB 2Y1VA 5A2FA 4OLVL 3D69B 4M8VA 3SY0B 3MBEA 5EU6B 4F7MB 1F58L 1TJIL 3BX7C 3UDWA 1IM9D 3L3KA 1U2CA 4H0HB 5EG6C 4JPIB 3EFFA 4NM8L 3WN5B 1G1YA 4YJZL 4WI8A 4PRHA 4R8WH 2JJWA 3VCLA 4WW2F 4QRPD 1WZLA 4N0UA 2X1QA 1PEZA 2XYCA 1KG0B 3D9AL 3HPJB 5GRZA 4XGZB 1YEJH 3G6JF 4NQED 3CCHA 5HVWA 3S96B 2J6EA 4X5WA 4H88L 2Q7NA 3ZKNC 4U1HA 5GS2H 3F6IA 5EFIA 1T0MA 3HTLX 3G04A 4L4TE 2XV6B 3TV3H 2QQLH 2ZCLH 4H5SA 4OCNC 4WW1B 4OFIA 2BY1A 2O5XH 1MAML 4ZG1A 5K9QI 1G7MB 4UV4H 1JTTA 1MFBH 1XGQA 4HIHA 1RZKL 2YD1A 1INDL 2EKJA 4HGWB 5EU4B 1G7JB 3CSPA 4L29A 5DJCA 2AV7A 2E7HA 3U0PB 4EZMA 1NGYA 1AQKH 1MCNA 1Z3GL 2XA8L 3W5NA 2JJUA 1DBJH 1NDGB 3TCLB 2I9LB 3S35X 3AM8A 3VFWA 2XWJB 2WBJA 1MH5A 1EMTL 1G9NL 3SDDA 1I8MA 1SBSH 1NAMH 2BSTA 1CICA 3TIEB 3GHBH 1YC8A 4PS4H 3T0BA 2A6JB 1BEYH 2G75B 3CSYA 3ULUE 4N0YL 3S8WA 2DTMH 5C3LD 2R2BA 4F37K 1ZA3A 2ZUWA 5DQDH 5T1MB 3C6LD 1J8HE 5FB8B 2NY6B 5E00A 1AGFA 5EZLA 3VI4E 1D5ZA 1VGEL 3V6OA 3D69A 2GFBB 3SY0A 3PP4H 5BO1H 3ARYA 1U91B 5EU6A 3F62A 1A6UL 4ZO6A 5C0ND 1H3PL 1C5CL 5FHBL 4JPIA 3ZO0A 4IM8A 3WN5A 1HIMH 1IC4L 4MDIB 5E2WH 4HKJB 3FFCB 2BC4B 5DT1H 3L95B 3ZT7A 3C08H 3G6DH 5C0JB 1MIEL 1KG0A 3O11B 4JFXB 4XGZA 4HLZG 4JAMB 3S96A 1H3GA 4PG2A 1NANI 4F8TA 1EAJA 1IRAY 5FGBC 3UTSE 4GW5B 4FMKA 3S36X 4WW1A 1NFDB 2LTQB 3ARTA 1G7MA 2WWMC 3QIUD 4XRCB 2ADJB 4HGWA 5EU4A 1G7JA 4KUCD 2PO6C 3U0PA 1EEUA 1S7WB 5JOPE 4ODTL 2W9LA 1H8NA 1EJ6A 4NUGL 1NDGA 5SWZB 3TCLA 3EOAB 1HH9B 2I9LA 4IJ3B 4XCFH 2XWJA 3EYVB 1FNEB 2AK1L 2J8UE 1BM3H 2A1WL 1MLCB 4NQCD 4DTGH 3GB7B 3PXHA 4NQVB 1JZ2A 4F7PB 3TIEA 2LAAA 2A6JA 3SDCD 2G75A 5B8CC 2EYRB 1J0JA 5T1MA 5J3HD 3K4DA 5FB8A 4Q9RL 5CGYC 2ZG1A 4ZUTB 3AY4A 2GFBA 1FV1B 4LHUD 1JK8B 2ADGB 1U91A 4HMCA 4OF3A 3PJSB 3ARFD 4UU9B 1SEBB 4LPUA 3P11H 2CXGA 3P9MB 2QR0B 4J12A 5FHAH 4ODHL 4MDIA 4HKJA 3FFCA 2BC4A 4KV5E 3L95A 3JV6B 5T1LD 4KDVA 4TUKH 1QNZL 4Q74A 3MJGX 1SYVB 5C0JA 1OCWH 1DUYB 1X5GA 1JHLL 3O11A 1EA9C 4HC1A 4JFXA 4OT1L 2VL4A 4YDKL 4JFEE 4G6KL 4P3WA 5D71H 4JAMA 5IKCA 3DNKA 3FN3A 5H37G 1WT5C 4LIQL 4YHKH 4XMPH 5EOCL 4GW5A 1EX0A 3IB4A 1HHKB 1NFDA 5E1AB 4NGHL 1GGBH 1QHPA 1JN6B 4OLUH 4XRCA 2ADJA 5I75B 2OP4L 3ZYIA 1S7WA 4OTXL 5ID0B 2VDRL 5T3ZL 3QWOB 4RMTA 2X4NB 5SWZA 3EOAA 1HH9A 5E8OB 1IZKA 1QD0A 3U1SH 4E41E 2ADFH 1P5VA 3EYVA 1FNEA 2IGFH 5I1HH 4MJ4A 5CKAA 3BI9X 3DHJA 1TZHB 1MLCA 1LP9E 2GJ6E 3GB7A 4NQVA 4F7PA 3D18B 4IEFB 3TBVB 3I50H 4UDUB 4JO4H 4X7FC 4MNQD 2V7NB 4KJWD 1NCNA 2EYRA 5BMFH 3OF6A 3V8OA 4XNUL 4G6AC 4JFFE 4JFOB 5F9OH 4LAQH 1BMGA 4LU5L 4OCWL 5CZVH 1U3JA 3LDBB 4ZUTA 1KELL 1FV1A 4NM4L 1JK8A 2ADGA 3MOBL 1JZ6A 1E6JH 4LSPL 3PJSA 4UU9A 1SEBA 1WQVT 2YRPA 1OTUC 3WFDL 4YH6A 3P9MA 5TE6H 32C2B 4NNYB 4LARH 4TSBL 3WCYA 4DKAA 2QR0A 3MRDB 3UTZB 4XNYL 5FUOH 4XC1L 4FP8L 4Z7WB 5EB9A 3CFCH 3JV6A 1NSNL 4FQCL 2IQ9L 4YZFE 1HQ4B 1BQLH 4UINL 2OMBA 3UZQA 1SYVA 3HRZB 4JO1L 4DOHE 3ULVH 3UTPE 2CPCA 1TETL 3RKDD 3T0EE 1FC2D 3ILQC 3RNKB 2V5YA 1ZHBB 2EXYC 5C09E 4MB4A 1HHKA 1E4KA 5E1AA 1XMWA 5HYJD 1NC2D 1JN6A 4JB9L 3W0WD 5L8KB 1WTLA 2EDXA 5ID0A 1EEZB 2ZSVB 4DCQB 1VGKB 3NAAH 3QWOA 2Q8BH 2X4NA 4IOFC 4GJTB 3NGBB 5E8OA 3FB8B 3DI3B 4Z8FL 3WSQL 1E0OB 5I6XC 5E94B 3F5WB 4ZNEE 4XCEB 5FYKE 3LKNB 3FOLB 1JPTL 4H1LB 1TZHA 5GS0D 3JTSB 1YEFH 3D18A 3TBVA 4LKXB 4KUZH 4UDUA 2V7NA 1OHQA 1MRDL 1QRKA 2QADB 2VABB 3DRTB 3RU8H 4NN5B 4R26H 4NN6B 5J11B 4JFOA 2LU7A 5HHOD 2XICA 1YNKH 4JR9L 2K7QA 4PJ5D 1A02N 3ULUL 1FPTH 1NL0L 3C60B 4KJQC 2FX9H 4WFHD 3SDYH 2F8OA 5J0BA 4LPWA 2XACC 4JZOB 2DQTL 2CGRL 32C2A 4NNYA 4QHUB 3MRDA 3UTZA 1PZUB 1P4BL 2ICES 1AO7D 4Z7WA 4HJGB 4JHWH 1JZ5A 4L9LB 1HQ4A 3BD3A 3MXWH 5SV4A 3HRZA 1J11A 1F4YH 4U6VH 2R0WH 2OL3H 1OTTD 5FXCH 3AMLA 4NHCL 3VGBA 4G6JL 3UEZA 2UWEB 3RNKA 5TDOB 5EZOL 1ZHBA 2YD7A 4P46C 3MOAH 4KY1H 5DR5L 3UJTH 4OGXL 12E8H 2DIJA 4I3RL 3O4LD 3S4SG 3L5WB 3U48A 3LD8B 4M5YH 1MJ8L 3UTTB 1ZVYA 3QWRD 1UXWB 2DBLH 4OBSA 4Z7QF 4DKFH 5BW7A 1MJ7L 1EEZA 2ZSVA 3MV7D 4DCQA 4LQ1A 1VGKA 3O9WC 5I8EB 3HFMH 2M8XA 3KPSD 1IC1A 3FB8A 5EIVA 3DURB 4G7VL 5CSGA 4Z18A 5KTEH 4NFDA 1JNLL 4M6AA 4QWWC 3F5WA 4PJGF 4I5BB 4XCEA 1KXTB 3PGFL 5E94A 2QL1A 3FOLA 3A67H 3LKNA 4H1LA 2W9EH 4EDWH 3JTSA 5IMKB 1JGEB 4G6ML 5IEKB 4LKXA 5L0QB 4NCDA 5F1KC 5ENWB 4UBDC 2VABA 3T2NH 3DRTA 1GZQB 1OM3H 2UYLB 3DECA 1NAKL 3QDGD 3PQYB 3F7PC 5IP4A 4P9HH 1FGVH 2NY4C 3C60A 4OB5L 4MAYD 5F7UA 4JZOA 1JWUB 4YBQD 3NN8B 4JFYB 4QHUA 4JHAL 5D1XD 5KAQF 4HJGA 2VUOA 3P0VL 4L9LA 3D5OF 4HBCH 1OAUL 1WITA 2JE8A 1FNHA 2NYYC 5T1DH 2EDLA 1OOAA 3MJ6A 3BKJL 4F9PC 2ESVB 5M7QA 4P9MH 1QR4A 4IMKC 2E7MA 3ZDYF 1MQ8A 2FEDC 2UWEA 1NMAL 5TDOA 1E6OH 3SCMD 4A6YH 4N0CD 3SE8H 1AHWC 1Q72L 2GY5A 4B0MM 4ZTPH 1BLNB 1P7KB 4M7LL 2PTTB 4X8JB 3L5WA 1U3HB 4Y16B 3RDTD 3UTTA 2EZ0D 1UXWA 1MEXL 2WZPD 5GPRA 3RTQC 2OTWB 5I8EA 4PUBH 2FNBA 4YXHL 4DKEL 3DURA 5DHXB 2W07A 5ANME 1BFOB 3B8YA 5E6ZA 4I5BA 3MYJB 1UYWH 5F93C 1FH5H 4BZ1H 3ROLB 5KVGH 2FHCA 3NFNB 3MLYH 5IMKA 4OGYL 1JGEA 5IEKA 3T09A 3CDGB 1P9MC 1C1EL 5ENWA 5CHNB 4D0BB 4CU7A 1XIWC 3IDXL 1HWGB 5IG7B 4LEOB 1GZQA 4V1DB 4BZYA 3I02B 2UYLA 2OCFD 3ARGB 4QOKD 3PQYA 4IRJB 1SY6L 2IJ0C 4JKWA 5GGQL 2VMFA 2FIKB 3B5GA 1MCWM 2W0PA 1A6VL 1JWUA 3NN8A 5DFTA 4Q6YA 4D94A 4JFYA 4UT6H 3VXRD 5ADOH 3ARSA 4I0KA 1F3DJ 1XCQB 1HINL 4KQ4L 2LVEA 4DGIL 3OL2A 3H0TB 5I1GL 3ARED 4R4NC 4WDIB 2ESVA 1PKQB 4KROB 4PJIE 2AQ3A 2V17L 4LRNL 4U2YA 4IOIB 1H0DB 4X99B 3VXMD 2AJVL 4Y4FC 5FO9B 4LCWD 3MNVB 4EI6A 4KKLC 3LH2H 5F3HB 1BLNA 4Z9KB 3QEQD 4UDTA 1P7KA 2PTTA 4X8JA 1DVFB 1U3HA 1IAII 4Q7DA 4Y16A 1R5WB 3QB7C 1UKQA 5B39G 3RNQB 4JO2H 3LPWA 2EXWC 4U49A 5LBSH 5DMGC 4JFDD 2OTWA 2X89D 3HB3D 4PJ9B 1D9KB 1UJ3C 2HN7B 4UT9H 4ZPVB 5IW3A 2VAAB 3PL6D 2F53B 1BFOA 3MYJA 5ALCL 1JBJA 3WYRA 3ROLA 3NFNA 2OSLB 4U6XB 1LNUB 5FUCC 1MVUB 4WUKL 1B2WH 4MB5A 3CDGA 2B2XL 2AJYH 5CHNA 5K9JL 2QQKL 4JY6B 4LEOA 4B50A 4V1DA 1FFOB 5IG7A 4PJFF 3I02A 2MPAL 1P2CB 4ALAL 3ARGA 4NJ9L 4GMSL 4IRJA 1FO0B 2X1XR 5E8NB 4Z7NE 3C09B 2AEWA 3D0LB 4LSRH 4P5TC 2FIKA 1P4IL 4I4WB 5T3XH 5BOPA 4NN7C 3FN9A 2H2PC 4CKVX 3RVWD 1KEGL 5DVLA 4ZXBB 2CKBH 3TNNB 1XCQA 1GGTA 5DSCB 3KG5A 3IDGB 5DFVD 3MA9L 2JF1A 2FEEL 1NLDL 4WHYH 3H0TA 3CZFB 4WDIA 4HMDA 3TM6A 1TJGL 2MSPA 1T83C 1PKQA 2FD6L 4XC3H 4N8CH 4YHZH 1PYWB 4IOIA 1H0DA 4X99A 5FO9A 3BZFB 4ELME 3MNVA 2BX5A 5F3HA 4HZAA 4HFUL 2A2QT 3T0DA 1DVFA 4Y1AE 4K94H 2FH6A 5EULV 1R5WA 3CSBA 4NKIL 5JA9A 4O02H 1S8DB 2NY1B 3RNQA 4NZUL 4QGYA 1X5HA 5FYJH 2DI8A 4JQIL 2VZ3A 3IDNB 1C7SA 5A43C 5HI5C 1LDPL 4PJ9A 1D9KA 3RJDA 1OAXL 3Q1SH 2IPUG 5DURB 4PBXA 3PWJB 5IESH 2HN7A 2HFGL 4ZPVA 2VAAA 2F53A 3RZCD 1AQDB 1X5YA 3BISA 2OSLA 2P48B 4U6XA 1LNUA 1MVUA 4EJ1C 4KHTH 2JIXD 3HNTL 1MCPH 1W0VB 3C2AL 4JQVC 4JY6A 2J5LB 1C8PA 1FFOA 1QSFD 1U8PB 2P8LB 4S1RH 4ETYA 1BQHG 1P2CA 3EUUA 4MD0B 1FO0A 5E8NA 3WFCL 3T0WA 3D0LA 5B21A 5L8JB 3S4SB 3NACH 1YPZE 5C07B 4I4WA 5H2BB 4K3EH 3E2HC 4AIXA 5I1AB 3VWKB 2ERJB 3NIFF 5DD3H 4JO3L 4ZXBA 5ALBL 4ODSL 5EBMB 1KLFA 4UQ2B 5D1ZB 3TNNA 1KB9J 5DSCA 3IDGA 4PJCB 4W81A 3TYFB 3CZFA 4JFHD 4XAKD 2PXYB 1I3GH 4IDJL 4HULB 1JL8A 1PYWA 5KW9L 3TJHD 5L88L 5JIHA 1OSPH 2DD8H 3BZFA 1PX3A 1S7TB 2EIBA 1O7VA 3MUY1 5E08L 4GW1B 3OR6B 1YQVL 5GJTL 2I27N 1S8DA 5LVEA 5JZ7D 2H2SC 1KUMA 2O5ZH 4OIIH 1BOGB 3QFJE 2B0SH 3IDNA 4P2QB 2AJUL 3DETC 4E42B 2R0KH 2JJTC 4FQPA 3WIHA 3HG1E 1MREH 1WWAX 1A7QL 1T66C 1R3IH 3PWJA 3QG7H 4QXTB 4ZODA 3U0TB 1J18A 4TTGA 1AQDA 4JFZH 5JHLH 2AJXH 5I8KL 3V4PL 1IVLA 3N1PC 3DMMB 5KANG 4Y19D 3D39D 5JXAL 4HAFA 4FG6D 4LVHC 2VXQL 3PWPD 3IRPX 4JRYD 1W0VA 5F9WC 3LB6C 3HAEG 1U8PA 1YJDC 2P8LA 2XTJE 3FOMB 4CVWA 4HKXB 1I1FB 4MD0A 2H8PB 4OCYH 3S4SA 3EIFA 5C07A 5T1KB 1VERA 2R4RL 5BRZB 3N1QC 5H2BA 1DBBL 2BVUA 4I77L 5I1AA 3VWKA 3O2WL 3V6FB 4GRWH 1XGRB 3FCTB 4NIKB 3KLHC 1DCLA 1FE8H 2AVGA 5EBMA 3VGDA 4MMZC 4OBRA 2B1HL 1J05B 4UQ2A 5D1ZA 5TPWL 5L7XL 2NTFB 5HHME 4JRXE 1B4RA 2VXSL 4PJCA 5A3ID 1FRGL 3TYFA 4TPRH 1N3NB 3BEWB 5CJ8A 2ADIB 5I1KL 1RZJC 2PXYA 5H94B 1FLRH 5B38G 4O00A 1CF8L 1FBIH 4R9HA 3HN3A 5F89B 3HMXH 1S7TA 3GMPB 1L7IL 5C0BE 4GW1A 3OR6A 3MLSL 1V3JA 3RQ3A 1Y6KR 3FN0H 3S97C 2E5EA 5IV2B 5IFAH 5IB2B 5C3TA 4K71C 1IE5A 4KKCC 2DI7A 4KTYA 2XRAH 4G9DB 1BOGA 1CLCA 3ARUA 2FJFB 5JPNB 4P2QA 1ZHLB 3HNVL 4E42A 3BKCL 3EJYD 2O5YL 4Q9QH 4D9LL 2DS4A 4N9OB 3KS0J 4EN3C 5A2JH 4U1LB 4OZGF 4QXTA 3U0TA 3K81A 4QRPE 3DMMA 4HQQH 4NQEE 1E4XI 1P53A 3H6JA 3WFBH 5ESQB 1LO0L 3FOMA 5GJSL 4HKXA 3OKEB 2FATH 1I1FA 3OKNB 2H8PA 1MFEL 4LSSH 1AXSB 3CVIL 4PBWD 1VEPA 3V52H 3SKUD 5T1KA 2EC9U 5BRZA 2BP3A 4U6YB 3UC0H 4QRRD 5B39B 3EYFB 4WFGE 3V6FA 2HVJB 1XGRA 3FCTA 3DI2B 3MLZL 3BQUA 1J05A 5C0FB 4HF5H 3VWJD 3DVGB 2NTFA 4ONFL 3GKWL 4JN1H 3GSNL 1I1RA 4X6DE 1PG7W 3LY6A 2K7PA 1AD0B 2WQ8A 4LMQI 4LDOB 3BXNB 5B4MC 1N3NA 3BEWA 3MUZ1 4F37F 2ADIA 3C5ZC 2HTKC 3RVVD 4MDJB 5H94A 1N4XL 4V2CB 5IQ9B 4IHOB 5F89A 5KVFL 4GMTL 2BRRH 3GMPA 4D8PB 3EDDA 1AE6L 4Y4KB 5C0CB 5IV2A 1KCKA 2FBOJ 4X5LA 1FQ9C 4G5ZL 1QSEB 4QTIH 3RIFK 1DQJB 4WI7A 4M93C 1NGQL 4G9DA 1EBPA 4YHYC 2FJFA 5JPNA 1VHPA 2Q86B 1ZHLA 2GAZB 4U3HA 4AJ0A 1RZGB 4U1LA 1RZFH 4KKNA 5MERB 1T0PB 1AY1H 2VKXA 3QUZD 1BF8A 5EC1B 1F6FB 4PRIB 4BSJA 3WO4B 1GL4B 1TQCB 5EA0H 4X4ME 3D87B 3P4LA 1BWWA 2VB5A 4I9WD 2ITCB 1W0WB 5ESQA 4KVCH 4KTEH 4Q9CA 2EDKA 4L1HA 2X1PA 3CMOH 3OKEA 5HHVH 2KQMA 4MSWB 3OKNA 4YAQB 5ECJE 2AEPH 1AXSA 4JREB 4X98B 5BCAA 4LVOC 4LK4A 3BAEH 4L8BB 4U6YA 3LS5H 5B39A 2PETA 2CLZB 3EYFA 1K3ZA 1JPFB 4S2SB 1DEDA 2HVJA 5ID1B 4GLRH 3S36L 2MJWA 3TH3T 5C0FA 3OKOB 3DVGA 4BK5A 1AD0A 3BXNA 3LAFA 5IB4B 4NQCE 4FZ8H 3RWDB 2CQVA 3FJTA 1KCSH 3TN0D 1IT9L 3SE4A 3QNZB 1OAQL 4KRNA 4MDJA 5EOCJ 2D0GA 4ZS6D 4ZFZB 1HYSC 2Z91B 5IQ9A 4IHOA 1CE1L 1ACYL 1J1PL 3C6SB 1MPAL 2NZIA 4D8PA 3GI9L 4UV7H 2GJZB 4YFLI 4X4ZA 2J6EH 3JVGA 1BQHB 4Y4KA 4CVXB 5C0CA 3GK8H 3H3PL 2ZKHH 3OJVC 5JUEL 1YDPB 1KLUB 3G5VB 4XCCH 1QSEA 4YHOL 1DQJA 1YEKH 1JZ4A 1T22B 2Q86A 2E8ZA 5FM5M 4OF0A 2GAZA 4P2YA 1RZGA 4X6CE 3V95A 2P5WB 3BKYH 3TZVB 4LFHD 5MERA 1BFVH 4X4XB 1F13A 1EGJL 1U42A 3QDMD 1EHAA 4POUB 1EV2E 5EC1A 4PRIA 2MQ3A 1ZLSL 4LGRB 2QHLA 3ZDXE 2WBJD 1YYLL 4M6ML 5A16B 2ITCA 1W0WA 4HPYH 5C0IB 1OP5K 5E9DB 2H32B 3WL9B 4PGBB 1OAKL 1BGXL 4M4RA 1II4E 4HIJB 1CICD 4MSWA 4G9FE 4KXZI 4YAQA 4I18C 4WI5A 4X98A 1GZPB 4ZSOB 3EBAA 2COQA 2EIEA 4PY8J 4L8BA 2R29L 4HIXL 5E2VH 3GI8H 2CLZA 1JPFA 1HKLL 4S2SA 1KYOK 5ID1A 4TTDD 3EOBB 5HDQH 2IAMB 1CGSL 1NGPH 4U1MB 3ZKXB 5D1QD 3OKOA 2E9JA 2O61B 5HVFB 3KXFD 1OGAB 3H9HB 3KPRE 3G6AB 5IB4A 3BWUC 3RWDA 1G7QB 1M1SA 3V7MA 4FN0A 5LGKA 1I85A 4YEFA 3QNZA 5D72L 5GGVY 3WNPA 4MNQE 2FIRT 1AJ7L 2P24B 4ZFZA 4GAGL 2Z91A 4HCRH 3P4NB 5D2LA 2XN9B 1IFHH 1S3KL 1EZVX 3C6SA 4DUWA 4EIZC 2GJZA 4EXKA 1KULA 5E6YA 4JVUA 4ZD3L 1CFTB 3CNKA 1BQHA 4CVXA 3DV4B 4KI5D 1J1OH 2LE9A 4KMTH 1YDPA 1KLUA 1CFSB 1RULH 2DLFL 3SEPA 3G5VA 3VFGL 2NX5D 2VDML 3MV11 1T22A 1AXTH 3WHXB 5C08E 2Z8SA 4N5EC 5E95B 4ZOCA 2NZ9C 4PBVC 2P5WA 4JDVB 3TZVA 1NMBL 3ZHLA 2BY3A 3CXDH 4X4XA 4JJ5B 3ULVE 2DIBA 5EU3B 2KQNA 2OR9H 2GKIA 2E9WA 4LASH 4TVPH 3PWVB 2X4OB 4RISL 5A16A 4XP1L 3TA3B 4DN3H 5C0IA 5KSBB 4G8GD 5E9DA 4JGMA 4DFHA 2H32A 3WL9A 4AEIH 3O6FB 1UENA 4P48A 4HSQA 1YEJL 5B38B 1QUNA 4HIJA 1M7IB 1E27B 5HYJE 3PHOB 4HAGA 3L1OH 2NY5H 2YEZB 3QDHA 3QNXB 4MJIB 1GZPA 3W0WE 2VL5B 2QQLL 2ZCLL 4ZSOA 1D5IH 4GOSA 2O5XL 5FGCE 4RGNB 4UV4L 1MFBL 1TENA 4XB8A 3BH9B 1V5JA 3JWNC 1EHLH 4LRIC 5JLZB 3EOBA 2G5RA 2IAMA 3NCBB 1CZ8H 2A74B 4U1MA 1AQKL 2O61A 4GG8B 1JIBA 3OBAA 2BZDA 4X83A 2WIMA 4P49A 3KHOA 5ABDE 1DBJL 1OGAA 3H9HA 3G6AA 5IVOA 1A7PH 1BQUA 1G7QA 1KCUH 4WWKB 3FFCD 1OF2B 4UNTA 4GW4B 1QBMH 3GMQB 1KGCD 4Z7OF 2P24A 2Y23A 3P4NA 3CMGA 2XN9A 1A14L 4HC1H 5ICYB 3EZ8A 3CLFL 5HI4C 1ZGLA 5F8RC 3GHBL 1K85A 3HAEA 5HHOE 2X5PA 4PS4L 1CFTA 4NQDD 3DV4A 2JKXA 2DBJA 3L5HA 3UX9B 2DTML 4WFHE 2VDOH 1CFSA 4DVBB 1FYTB 5C7XH 1BECA 2FSEB 3RIAK 4GBXB 4RFEB 1I9RL 1NC4B 1TVBB 3WHXA 2FGWH 2DM7A 2RQ8A 3RVTD 4JDVA 3VFOB 3WKNA 3O6KL 4XXDB 2A73B 5DK0B 1HIML 4JJ5A 5J12C 2I60H 5SWZD 3L3GB 4Z7VF 4ENEC 5EU3A 5DT1L 5FM4A 4PRPE 3KDMB 1ND0B 3PWVA 2X4OA 1PX4A 2A9NL 3G6DL 3TA3A 5KSBA 4DK6A 3O6FA 5TJWK 1F6LL 5B38A 1C5DB 3QT2A 1M7IA 5JOEA 1J7VR 1WZMA 1T5XB 4JPKH 3PHOA 3MRFA 3RHWF 2YEZA 4PY7B 2JLLA 3QNXA 4MJIA 3OF6D 3IJSB 1JFQL 2VL5A 2EC9T 2XI9A 3NPSC 3D85D 3KHQA 3BH9A 4GQ9H 1YEEH 5JLZA 3OB0H 5F1SA 5IR1B 2A74A 3ISWA 1IGYB 4OLZH 4M1CD 1ES0B 3E6FB 2J8HA 4GG8A 4JZJB 5CSZB 1JHKL 3RWHB 3UCRA 1G0YR 4PJ7A 3VXUB 1B88A 1D5BB 2HA1A 1I7UB 4WWKA 3MJ9L 4XP9L 4JPWH 4XCFL 4Q2ZB 1OF2A 3O3AB 2IALB 3QAZC 3VA6A 4GW4A 3GMQA 3VRLE 3BMVA 3I6KB 3GHEL 4DTGL 5I1JL 4TSAH 5ICYA 1A22B 1NCWH 1GJIA 4NCC2 5HPMB 1F42A 1KJ2H 5I17B 1RMFH 4FQ2H 4YX2L 4DVBA 3IFPA 5D7JC 4Q0XH 1FYTA 3RI5F 2FSEA 3B2UD 3ROOB 5FEBA 4GBXA 4RFEA 5I1CL 1NC4A 1TVBA 2QBWA 1UWEH 4ZTOL 4U31A 4PGDB 1LDSA 1T1ZB 4PTTB 3HMWL 4M6OH 4KJYB 2W91A 2P1YA 1KCRH 3VFOA 4EOWH 4OQTL 3TT3L 4XXDA 2A73A 5DK0A 4L8SC 4BQCA 3L3GA 5JW3H 3QIWC 5FV2A 1NGWB 4F33B 4TUKL 5HHXH 4GXUN 3KDMA 1ND0A 1CIUA 1DBKH 5EORH 2PUQT 2FEEI 1F2QA 3SGDI 2YPKB 4I3SH 4U0RB 1C5DA 2L7UA 1T5XA 5EUOE 4J4PC 2IPKB 3MLPA 4PY7A 4YHKL 3IJSA 3RGVB 2BMKB 2DN7A 5KN5B 1G7PB 3M8OH 4UTAL 1GGBL 3CFBB 1A9EB 4FQXC 1G1CA 1NCAL 4Y4HB 2YPVL 4G80B 4GKSB 4CRPA 5IR1A 3FMGL 3VXPB 1MHPH 2Q6WB 1IGYA 1GC1C 3CX5J 4YDIL 1ES0A 3E6FA 3ZL4H 1NBZB 3ZKQD 4JZJA 5CSZA 4XNMB 1DJSA 3RWHA 3VXUA 3O3EB 1D5BA 1I7UA 3B2VH 5D7LE 3U1SL 2ADFL 2X1WL 5GXBB 4Q2ZA 2X9WA 3O3AA 2IALA 2XY1A 1QKZH 4NKDB 5I1HL 4YPJA 2IAND 4KK5C 3I6KA 1U8OB 5IMMB 1F97A 3I50L 4QOKE 4HWEL 3V9FA 4JO4L 1P1ZB 4UOJA 5I17A 2R4SL 5BMFL 3CDCA 2G9HB 3K1KC 3D6GA 4JHBA 4XPTH 5F9OL 4LAQL 1XF2B 5CZVL 1YN7B 5EIQA 2D9CA 1X5IA 5TF1L 1BHGA 3RWJB 1UB5B 1WZKA 4WV1C 1CL7H 4RIRB 4XNZC 1E6JL 3VXRE 4NT6B 2DQDH 1CXEA 2OZ4A 1M7DB 5BZWB 4PGDA 1T1ZA 4PTTA 4KJYA 5TE6L 4K8RH 4LARL 3S98A 4L4JA 2YA2A 5FUOL 4J6RH 3AFLA 3U79A 3CFCL 1NCCH 1S5IL 2ICWI 1NGWA 4F33A 4KHXL 3Q2CA 4XPGL 1BQLL 4ZO7A 4YFLF 1UACH 5ADPH 3DX7B 4H1LH 4XPBH 3VXME 1IGTB 4LCWE 3ULVL 2YPKA 4KK8C 1L6ZA 1QFHA 3QEQE 3L9RB 5LGHL 2C3HA 2R56L 1IQWH 1INEL 2IPKA 1FJ1B 3ULUF 1OL0A 3RGVA 2BMKA 4TQEH 2VZUA 3SDDC 3TBYB 5KN5A 3KYMB 3EOYG 1G7PA 1L9NA 2NY0D 3VI4F 3CFBA 4MAUL 1A9EA 4Y4HA 2VXUL 5GGUB 1Z0NA 4G80A 4GKSA 5E4EB 4TRPH 1NFKA 3NFSH 3VXPA 1MCJA 2Q6WA 5ETUB 1NBZA 2BNRB 3NAAL 4XNMA 4D9RD 1KB5L 1UWGH 3NABL 1U58B 3AS1A 3O3EA 4OGZA 4XXCA 3ZKSD 4QHLB 5EO0B 3BZDA 3WDHA 3MRIB 2CDGB 2R15A 4NKDA 3X3GH 3TO4D 1U8OA 5AEAA 5GS0L 1PLGH 5IMMA 4Y2DD 1P1ZA 1V7ML 2G9HA 4P3CH 3RU8L 4APQD 3QEGH 2MWCA 4OZFG 1BD2A 2AI0H 1XF2A 2QHRH 5T3XE 1YN7A 3PIQB 1LWRA 1YNKL 3QH3B 3V0WH 1KSRA 1ZLVH 1UB5A 1VDGA 4Y5XB 4LHQB 1FPTL 1WCQA 4PG2C 4RIRA 2FX9L 5AZ2H 3SDYL 1FL5B 4FTVD 1M7DA 5BZWA 1JWSB 1M71B 5DVOA 3VD7A 3KR3H 3LKOB 3TNMB 3MRBB 2DMCA 5HYSG 1X5JA 1T20B 2BVPB 4XP6H 2EICA 5INDB 3GBML 3BD5A 1HHJB 1WAAE 3MXWL 3UZVB 2P45B 2R2EB 3DX7A 3K0WA 1IGTA 1KPRB 4FQ1H 4JKPL 5HVGB 3ZSSA 3QR2A 4U6VL 3MNZB 2R0WL 2CMRH 3L9RA 4HLZH 4NDMB 1FJ1A 1ODAA 2VR5A 2IMMA 3RAJL 3EZJB 3MOAL 1JPST 4KY1L 3UJTL 3TBYA 5GZND 2J2ZA 4L3ED 3KYMA 3DHMA 4ZOBA 2M2DA 3PQYD 2D9QB 5FYJE 3P9LB 4M5YL 5GGUA 2DQHH 1Q38A 5C0NC 3ARDD 4LGPB 2NY5C 2ICWJ 1G6RL 3K2UH 3QXVA 4DKFL 4YDVB 5ETUA 2BNRA 1NBVL 1ZMYA 4QT5B 5J9PB 4PJDB 2HT2D 1U58A 3HFML 4HPOH 3T1WA 4EI5D 3BVNB 4QHLA 5DD1L 5EO0A 3MRIA 2CDGA 4F7TB 1WT5A 1U41A 3WD5L 3KPNB 2HT4D 1IKFL 1PG7H 2W9EL 4Z5RB 4HJJH 2YZ8A 2ESVD 3OXRB 1J0KA 1KEML 5DJ8B 5I30H 3VA2C 3T2NL 4XTRD 5T33L 2IBZY 3AC0A 3LEYL 2NW2B 3PIQA 2YUVA 4XMKH 3QIUC 3QH3A 4WO4D 4Y16D 4P9HL 1FGVL 4Y5XA 1FL5A 4HWBL 5GIRB 1BAFL 1JWSA 1M71A 5I6XB 3HE7B 1F11B 2GT9B 4XCYB 3LKOA 3TNMA 3MRBA 1S9VB 1WVZA 1T20A 2BVPA 3HKFA 4F57H 1PY9A 3IETB 4FFYH 4JFHE 4U33A 1MFAH 1JNNL 1HHJA 4HBCL 4LCCB 2R2EA 5T1DL 1KPRA 1LP9F 4ODXB 3GJEB 4P9ML 3MNZA 3SDCC 5DUBB 2YWYA 2XT1B 4QCIB 1E6OL 1QBAA 4KFZC 4NDMA 4XAWH 4A6YL 1Q9KB 2YOCA 4FXLA 3SE8L 4ZTPL 5H37H 1GOGA 1UEMA 4WY7H 1FL6B 1EO8L 1IC7H 3P9LA 4AY0A 5IOPB 3V4VH 4QGTA 3TJEH 3C87A 4YDVA 5D2NC 4QT5A 4PUBL 1ZVSB 1IBGH 4PJDA 5IVXE 4WNQB 1PW3A 4OIAA 5BVPH 5J9PA 2FL5B 4OM0H 3BVNA 4Y19E 3D39E 3GMMB 4YZFF 4F7TA 4IRSB 4MJ5B 1UYWL 2MOVA 4G8EB 4BZ1L 3KPNA 3QCTH 4Z5RA 3MLYL 2CDFB 3O41B 3OXRA 2VLRB 3H3KA 5HYEA 1FCCA 5DJ8A 1F00I 4ORGB 2YD2A 2YPLD 4POZC 4NO3B 1E4WL 4OF5A 2NW2A 4MZ3A 3P77B 3ZHDA 4GRWE 5GIRA 1IGFL 5CJOH 3V2AR 3HE7A 1F11A 2GT9A 4XCYA 1CD9B 1S9VA 2DF3A 2DLGA 4UT6L 4PV8B 2VDKH 1IGCL 4O4YH 3HUJE 3IETA 2VH5L 3THMH 3GSOB 3RPKA 4KZEH 4JGUA 3QCVL 4LCCA 5BV7C 5HHQB 3BN9D 1B6DA 1KTLB 4EUPG 3WNKA 1CLOH 4ODXA 5K59E 3GJEA 1NAMB 4U0QB 2BHYA 1S7SB 3QIBB 5DUBA 3VMNA 4QCIA 1W72B 2CKNA 4EVNB 3WFHA 5JMOC 2NY4B 3INUH 1Q9KA 4MVBD 3LH2L 5CMAB 4IRZH 4UOW1 4TNWF 5HD8D 1FO0H 3UMTA 1FL6A 3LHPH 5IOPA 3QDJB 5AAWA 3B9KD 1QFWM 2BNUB 3ZTNL 4MQXC 5LBSL 4JRWA 1M7XA 1ZVSA 4WNQA 1X5AA 2FL5A 3RL1B 3GMMA 3L3OB 4UT9L 2J8OA 1DZBA 4WI6A 1RUQH 4IRSA 4MJ5A 4G8EA 1MFNA 1AHWB 2XQBH 4Z0BH 4EXPX 3UPAA 5FM8A 2CDFA 3O41A 4U1IB 4ESKA 2VLRA 1E28B 1MJJB 2UUDH 2UY6A 3CK0L 4NWUH 4RA0C 2FHFA 4ORGA 4PRNB 3HS0B 3QHFH 5DRXB 3PP3H 4NO3A 2Z31B 3DWTA 3LOWA 4NYLB 3BE1H 4JKLA 4OI7A 3WDJA 3RTQB 3P77A 3FO9B 2HRLA 2EYSB 4LSRL 1XR9B 4XHQA 1MLBB 1UM4H 4U2ZA 2L0DA 5T3XL 3FT3B 3ESVF 2FX8L 4NKMB 2AGJH 3C9NB 4PV8A 3MLWL 1F4HA 4TSCH 3WIHH 2CKBL 4ZNCD 3GSOA 4NKQB 3GGWB 4PB9H 5B22A 1ULVA 1XIWB 5HHQA 1N6QL 1D5MB 1KTLA 4PJHB 4K8RC 4MXQC 1NAMA 4NNPL 1S7SA 3QIBA 3NGBC 5E7BA 4XC3L 1A6PA 1B0RB 1W72A 4EVNA 5IW1B 3WEXB 1J1XH 2QQNL 2WIIB 3EOTH 5ISZB 5CMAA 3SO5A 4HXAL 1RV6X 2VLJB 2ZUTA 4K94L 4OZFB 1RSFA 4OD3H 3RL2B 1QVOB 5C07D 3QDJA 1YEIH 4TVSa 4AG4H 3P9WB 2WNGA 5KSAB 3HZVB 4NN5C 2BNUA 5J11C 4F9PA 1RIHH 1OP3H 1CGWA 1PG7X 3RL1A 3C60C 4IMKA 4R90L 3L3OA 3IFOB 4I9WE 4Y4FB 1AHWA 4QEGA 5EBGA 4U1IA 3AAZB 1E28A 1MJJA 3VI3E 4RQQB 1TNNA 4BQ8A 1MFDH 1VEMA 5D7SH 1MCPL 1RD6A 4PRNA 3SDXE 3HS0A 3S7GA 4G6FD 5DRXA 4S1RL 2Z31A 4TN9A 4NYLA 3N9GH 1BJ1H 3PWUB 1U36A 4DQOH 3RTQA 2VZOA 3FO9A 3CLEH 3HA0A 3QCUL 2EYSA 1XR9A 2HYMA 1MLBA 2NY3D 3W2DH 4HG4J 3BUYB 3FT3A 4K3EL 3RWFB 1D6VH 4NKMA 3MV8B 3C9NA 1QFUH 5IBLC 5DD3L 5DHVB 3S9DB 1YY9C 3LD8C 4F80A 5DHYB 1LO4L 2AK4D 4PRHE 1CGUA 4HFWB 3GGWA 5C70A 2ZUQC 5LAXB 1XIWA 2BK8A 3I9GH 1D5MA 4PJHA 3VFTB 1AI1H 1N8ZB 5E2UL 3F58L 2L7JA 1J5OH 2DQGH 1B0RA 1WTGT 5IW1A 1UKTA 3WEXA 1KTRL 2DD8L 2ID5A 2WIIA 2ZJSH 5ISZA 2XIDA 2Y36H 3OAZH 3SBWA 5CEZD 2FZ3B 4NN7B 2VLJA 2XZQL 4YXLH 4OFKA 3U7WH 2P8MB 1X5LA 4OZFA 1A7OH 1YECH 3E8UL 3RL2A 1QVOA 2C3WA 4L4TD 3BP7B 5J7CC 1L0YA 5KSAA 3HZVA 2QSQA 5A40E 4R97C 1P69B 3U4AA 1CDGA 4KZDH 4OCXH 2HT3C 2R0KL 5F96L 3BQUD 2YN5A 5I2IB 4DEPC 1R3IL 3LQAC 3QG7L 4JKKA 3U2SB 2D0FA 3IFOA 3H7LA 4X0KB 1WISA 3WBDA 4Y4FA 2YXFA 4JFZL 5GGTA 2AJXL 4U1KB 2FR4B 4HX1B 1I4FB 4PG9B 3AAZA 4K2UL 4RQQA 4PJIF 1FNFA 4ZUSB 4QYOB 2A9ML 1I9IH 5E6ID 4M4PA 2WK2A 4XWOC 3ARVA 3H8NA 5IFJB 1D5XB 3MRNB 3V6OE 4OCYL 4YFEA 3GDBA 4OV6F 1BIHA 3BUYA 1J8HD 4L4VB 3RWFA 5J13B 3MV8A 3BIKB 3IAPA 2OXHA 3FAXA 4OF8A 1U3HC 4PR5B 1FE8L 3SQBA 5DHYA 2HRPL 4GKZB 2UZYB 4HFWA 3U4BL 4KRMB 4LAJH 4WHYG 5LAXA 1EBAA 2ICEB 4ZAKD 2CH8A 3VFNB 1KJ3L 5L8LB 2D31B 4TPRL 1EHNA 5EZIH 1N8ZA 1QHOA 3VFSB 4WW2C 5E99H 2HFFB 2FDBP 1FLRL 4KI5E 1BX2B 4P5TA 1JZ8A 1FBIL 1JZ7A 2FH8A 3HMXL 2FZ3A 2DQUH 3IYLW 2NR6D 3E2HB 4PJ8B 2P8MA 2Q3AA 3P0YH 4GKOA 1DR9A 5IFAL 3UTSD 3BP7A 3D3VB 3A6CH 2IG2L 3ARGC 3C8DA 1CFNB 4QXUH 2XWTB 4IRJC 3WXVH 3ARXA 4U7MA 1T83A 4XPAH 1WLHA 1QOKA 5I2IA 5D70H 5DZOA 3U2SA 3CU7A 4TVPE 3V5KB 4X0KA 1UM6H 4B7IA 4U1KA 5HGGS 2R0LL 2FR4A 2P44B 2DWEA 2DDQH 3IF1B 4HQQL 4HX1A 4EUPB 1I4FA 2X44D 4PG9A 1T2QH 5EWIH 3LIZH 2OL3B 2EDOA 4OUOA 4ZYKB 1NCTA 2F54B 3WFBL 3OKMB 4QYOA 4ZUSA 4ELMF 4UT7L 1OPGL 3R1GH 4RBPH 5J6GB 4LSSL 5IFJA 5C0CD 4Y4KD 1D5XA 1U0QA 3MRNA 4KROC 5L2KB 3V52L 3SE9H 5IFHL 1KC5H 4L4VA 4L9DA 4M7LT 1MRFL 3BIKA 1EO5A 1TIUA 2BERA 1DVFC 4PR5A 3ZTJG 3EHBC 4GKZA 5I76B 3FFCE 1F4WL 3I6LE 3D2UB 4N0RA 4JN1L 2ICEA 2IWGA 4OLXH 5F9WB 3PP3K 4JQVA 4MXWH 3VFNA 2D31A 3VG0L 4KTDL 5DLML 5GZOD 2WM0A 3VFSA 4U1SB 3W39B 2QJDA 2HFFA 4PJ9C 3DRQB 1D9KC 3RIAF 4NQDE 4NBXB 1BX2A 1WGOA 4OIBA 4GS7C 1XFPA 4PJ8A 4JCMA 3KYKH 1NFDE 1MCLA 3H9ZA 3VJ6B 2VIRB 3LKRB 4ODUB 4ZFGL 3VE0B 4QRQB 4N5UA 5LKNA 3D3VA 2IPTL 3LRHA 4J3TA 4NO0B 25C8H 5DZLA 3CXHK 4LSVL 4JG1L 3GO1H 1WEJL 3MRRB 1CFNA 4WU7B 2YKLH 2XWTA 5E5UB 1OT1A 4XP4L 3C09C 5SWZE 5TE4H 2D7TH 1NANH 1JMZA 5GRYA 3BUTA 2GJ6B 5IBTL 5KVEL 1KENH 3PUCA 3V5KA 1AY1L 4K3HA 1DLFH 1T7YA 4H8WL 4HH9B 2IMNA 4EUPA 4JE4B 4ZXBC 5CFHA 4P59H 4E41D 4ZYKA 2OL3A 3QQ9D 1PZ5B 2F54A 3LRSB 1TCMA 3BPOB 3OKMA 4KTEL 4K71B 3RX5A 1KT2B 3CMOL 5HHVL 1PEWA 2JJVA 3H3BC 5J6GA 1L6XA 4Q6IB 1BFTA 4XX1G 4ERSH 1OP3K 5L2KA 2JJTA 3BOVA 3NIDF 3ZE1E 4JFFD 2OR7A 5ELIA 3LS5L 3WO3B 4KKAD 1EJOH 2IH1B 3EYUH 4I48B 1LO2H 1AR1D 3TT1L 2RIKA 5I76A 1CBVH 3BDYH 2NY1C 4M3JA 2P5WD 3TZVD 3D2UA 1I1AD 2Q1EA 4GUPB 4AM0B 3FONB 1MNUL 3KYOB 5L6YH 4U1SA 5CGTA 3W39A 1CN4A 3B5HA 2MMXA 4L8CB 3BDBA 1H9VA 2H32H 5CILL 1LGVA 5I1EH 4KDTA 1VENA 2EKSB 3VJ6A 2VIRA 3LKRA 4ODUA 3VE0A 1L7TL 2ZKHL 1UCTA 4QRQA 2BDNL 4ZOAA 1A6AB 5TFSH 5JOFB 2VN4A 3BWAB 1DDHB 4NO0A 4XCCL 5C09D 2J5LC 1QSZA 2FJGB 4YUEL 3MBXH 3MRRA 1P6FA 5K93A 4WU7A 3OAUH 5F7EH 1EEYB 1YA5A 4YGAB 1UM5H 4M7ZB 4AIOA 2IAMD 2CSPA 3C5ZB 1V7NH 3ETBF 4O9HL 3N0PB 5SX4I 2GJ6A 2ED9A 3LEVL 3A6OA 4S1DD 1AIFB 3VWKC 4FQJH 3O6MH 4HH9A 1N0LA 1FZKB 5DQ9B 2H1PL 1PZ5A 4HPYL 3LRSA 5GRVL 4GAJL 5FYKD 6FABH 1KT2A 4RX4A 2XN9D 3P73B 5KVMC 3T0VA 4M93B 4Q6IA 1F6AB 3L3IB 4YHPB 3TIDB 3BT2L 5E2VL 5DJXB 2YD6A 4S1SH 4PJXB 3MUHL 1AGBB 2IH1A 1ED3B 4I48A 4YNYB 5CBAB 4MMXC 4Z7WE 4K3DH 1YEGL 2Q8AH 1H8SA 5FKPB 5I19L 1NMCB 3G08B 2X1OA 4GUPA 4MHHG 4UZGA 3U83A 4AM0A 3FONA 3KYOA 1HXYB 3VGGA 4PLKD 4RAVB 2WLYA 5LWYH 2YMXH 2GJJA 4L8CA 2H45A 1NH6A 4YBHA 1XGYL 2A0LD 3TPKA 1FORH 4MWFB 5FF6B 1IAOB 3DMMC 1U9KA 1CI5A 1FYHB 2EKSA 2I5YH 5JOFA 1A6AA 4G7YH 3BWAA 1DDHA 1RULL 1AC6A 1CDCA 1C16B 5DEFB 3RBSA 5HI3D 2M1KA 2FJGA 3TBTB 3VGAC 3EFDH 1EEYA 3C5ZA 5GGVH 2E6JA 4XPFL 2QLVB 3CXDL 4X6DF 1JZ3A 2ZCKL 4H0GA 3GRWA 2VERN 4LASL 4TVPL 1FZKA 4WUUB 5DQ9A 4F58H 4LSQH 4N0FB 4RWYL 1D6EB 1UH2A 5HY9B 4CN1A 4AEIL 2VISB 5I1IH 3P73A 1F6AA 3L3IA 2NXYD 4PJBF 4YHPA 4G8FB 2CRYA 3QI9B 2ICWB 3TIDA 5C92A 3R8QA 2B1AH 3UJIH 5DUPL 1F45A 2O26U 4NRXB 5DJXA 1IKNC 4EIGB 4PJXA 1EHLL 1AGBA 1NC4D 1ED3A 4XBGB 4OCSL 5CUSH 1S5HB 4YNYA 4D9RE 5CBAA 3TWCL 3NIGE 1DEEB 5DO2C 5T5NF 5FKPA 1OTSD 4NPYB 1SMAA 4LLWB 3G08A 3LMJL 3T2OA 1HXYA 4RAVA 3MC0A 5D7IF 4ZDHB 1ORSB 4I18B 2LABA 1JNJA 1QBML 2UWEE 5C6TH 4JDTH 4Y5YB 4HC1L 4MWFA 1ZANH 5FF6A 1RZIB 5BS0B 1IAOA 4Z6AT 3NH7L 4RMSA 4WHDA 4BQBA 3HI6L 1DQLH 2X42A 2AEQH 2HLAB 1JRHL 2DQEL 4MNHB 5TH2B 4FTVE 1M4KA 4AL8H 1C16A 5DEFA 4KUCF 4GRLC 4YHLL 2FECL 1B90A 3TBTA 3EDKA 3B5TA 5ANMB 2PNDA 2HJLB 3GM0A 4DGVH 3BP6B 2VC2H 4FXGB 5MI0B 5DMJB 1RJZB 2FGZA 3VXUD 1OT2A 3D25B 3P4OB 4WUUA 2W65B 3K80A 4N0FA 4ZFOL 5I0DA 5FAAA 2VDPH 1D6EA 5HY9A 5AWNL 4AT6B 2APTA 2VISA 5ACMA 3WIFB 1B0WA 4GSDL 1LILA 4NC1C 3PQYE 4LOUC 2VDQH 4KMQA 2ZPKL 4G8FA 2LU3A 3QI9A 2ICWA 5GRUH 1CDBA 4M7JH 4OGAC 5I18L 4KU1A 3PF2A 4MGXA 4XBEH 2YUXA 4NRXA 4BSWB 5C0RL 2D3VA 2B7DT 4XBGA 1S5HA 5C8JB 4NP4H 3GSQB 1DEEA 2VQUA 4X6CF 4OFVA 4OLZL 5E56A 3QPXL 4NPYA 2J3SA 4LLWA 5IF0B 1ZVHA 2VNCA 3IJHB 3LKPB 4ZDHA 2ESVE 1ORSA 4JPWL 4OLYH 1FG2B 1CD8A 4I18A 1VB9A 3ZDXF 3SJVB 2R2HB 1RJLB 3RX8A 2X9YA 4Y5YA 4YC2C 4K9EL 1U6AH 3X3FH 2CIIB 1BOYA 1RZIA 5HVHC 5BS0A 4O58L 2FJHB 3AB0C 2BXZA 1DQQB 1G7HB 5DD5H 3MRQB 4FQ2L 3IFLL 2HLAA 5TH2A 4MNHA 2YA0A 3FAWA 1SJHB 2QSVA 1WFTA 4NZRL 1V3KA 5ANMA 5ITBH 3VRIB 4FZEH 2HJLA 4EEEA 3RP1A 4M6OL 3BP6A 3SOBL 4FXGA 4EOWL 4Z0XB 1AFVH 1RJZA 2N7AA 4M5ZL 1VKXB 3WFEH 6CGTA 4M1GH 5JW3L 4JHZA 4NFCA 4P2OD 3ZDZE 5IMLB 2FB4H 4CMMB 3D25A 2E3VA 3P4OA 2V7HB 2ATKB 2W65A 5EORL 3O8XC 1JHTB 4AT6A 1OAYH 1U8MB 4V1DE 3WIFA 4I3SL 4OM1L 1RIUH 2MKWA 3HR6A 3EJZC 1XGUB 1I85C 2Z4QB 2WWMD 1KLGB 3DX6B 3MTRA 2XTLA 3SKJH 3ME0A 5KS9E 2YD5A 2PO6D 1BD2D 5EU5B 3MJ8B 4BSWA 1N26A 1FC1A 3DVNB 5C8JA 3QHZH 3PHSA 3GSQA 4JY4B 3ARBC 5JHDB 5IF0A 1KV3A 4NZDA 5FO8B 3VFPB 3DOSA 3IJHA 1EIBA 3LKPA 3ULVF 3B2VL 2XKSA 1FG2A 4RSVA 1JGLL 4LNVA 2IF7A 1PKQE 1DANU 1LK3H 3SJVA 2R2HA 1RJLA 2YPLE 5DEGB 3NPSB 4NOFA 2CIIA 4LEXH 1OSZB 4P2RD 2FJHA 5CGYD 1DQQA 2HKFL 1C08B 1G7HA 4LRIA 1UXSB 3DBXB 3MRQA 4MA7H 4NQXB 3SHSA 4XPTL 5CCKL 3CDFA 1SJHA 1CR9L 4UMGA 1S7XB 3BSZL 4YHNB 3VRIA 3FRUB 2YRLA 3QAZB 4L3AA 1RUPH 1QYGH 2F53E 4Z0XA 1VKXA 3WUWB 4R0LB 1NBQA 2F19H 1B6UA 3U30B 3HC3H 1IAIH 5IMLA 5C9KA 4CMMA 2V7HA 1DBAH 5EBWB 2ATKA 1A6TB 1REIA 3B43A 5F7KC 5ADPL 1JHTA 4LHUG 1OAZH 1U8MA 3QUMH 1A3LL 5D7JB 1IQDB 4ONOA 5LJYH 2WUCL 3QXAB 1IQWL 1XGUA 2Z4QA 4KPHL 5C2UB 2EO1A 1KLGA 3DX6A 4NBYB 5LG1A 1TZGL 4J23A 3B9VA 2DKSA 5EZJB 1CFVL 1TTFA 1UZ6E 5EU5A 3JSSA 3MJ8A 2Y06H 1WIOA 3DYMA 3DVNA 2PTUA 3ALXA 3QIWB 2A6KB 4H25B 3NFSL 5E1HB 5F7LB 2H3NB 4JY4A 2X4QB 4JDZB 5JHDA 3BDXA 1YEHH 3EO9H 4HXBH 5FO8A 3VFPA 2YD8A 5FO7B 4XPHH 1GIGH 2H26B 1PSKH 4YXKH 3T3PE 3VXTB 4QNPF 1IC5H 5DK2B 5DEGA 4G6AD 4X9GA 1OSZA 3S88L 1PLGL 2NY7H 5INCB 3V7AG 3VXSB 4FQXB 1HNFA 1C08A 1UXSA 3DBXA 5E8DL 4QY8B 4P3CL 3TA3C 4NQXA 2QHRL 3O6FC 1OTUD 4H26A 3JWDH 4C55A 4S10A 3IRZA 4X6EB 1GOHA 2WWKO 4XZUB 1S7XA 1FNGB 4YHNA 5AZ2L 2N56A 2K3TA 3FRUA 4ZOEA 3NCYS 1R24B 2VZTA 1G7IB 4RGNC 3IXTB 4XP6L 3WUWA 5ACLA 4R0LA 3FQNB 3BRGC 2BXYA 1N5YH 3D0VB 3O2VH 4JY5L 5JW5A 3HG1D 5GHWH 5EBWA 3V0VB 3IDYC 1A6TA 5D93B 3VRLF 4LHJB 2EXYD 5FCSH 5D7JA 1IQDA 4KGJA 4Y2OA 3JV5A 1ORQB 2CMRL 3QXAA 4WWKC 4QLRA 1F58H 1TJIH 2JB6B 2ZG2A 4WV1B 3SQOL 3NZHL 5C07E 3PNWB 5EZJA 8FABB 3F65A 1QFOA 3RVTC 3QIWA 3WIIH 2A6KA 4H25A 3K2UL 3L3HB 4WFEE 4HWZB 2H3NA 4K07A 3D9AH 2EE3A 2X4QA 1MI5B 4JDZA 4PJCE 3GMOB 4HPOL 2YK1H 4H88H 3HE6B 5FO7A 1JCKA 3SGKA 5EO1B 2H26A 4D3CL 4J4PA 1PBYA 2OXGA 3VXTA 4JRXD 5A2LH 5DK2A 1PG7L 4WEUD 1QLFB 5INCA 3VXSA 4FQXA 4CVUA 1JI2A 1RZKH 1BJMA 5EUOF 1IM9B 3MQIA 1CGVA 4KJQD 5TF0A 3CDYA 4MZ2A 4QY8A 4ZMAT 1I9JH 2P5EB 1Z3GH 2XA8H 5JW4N 5M94B 4MA8L 5C0BD 4GFTB 2IH3B 4X6EA 4XZUA 1V3LA 1K8DB 2ILLA 1FNGA 3L7EB 5JR1L 4OFYA 2AK4E 1R24A 4KRLB 3MRJB 1G7IA 5IQ7H 2OJZH 4NQEB 3IXTA 4F57L 4JM2F 3FQNA 2AP2A 3D0VA 4Y0GA 4PLJC 2YUZA 3V0VA 4H1LG 5D96C 5JIPA 4PYHA 4P46D 4JZJC 5CEZE 1N7MH 3TO2B 1MY7A 1HWHB 1ORQA 1QRNB 1YMHB 2BVOB 2M26A 2JB6A 4WV1A 1ZGLM 1A6UH 3NA9L 4RMWA 4XAWL 5GS2D 3HLAB 5J1SC 3PNWA 8FABA 1IC4H 1RIVL 4WY7L 3GMLB 3O9WD 1IC7L 3F7YB 2VDNL 4GAFB 5L9DL 5F70A 3V4VL 1S7UB 2BOCB 4FFWC 3L3HA 3TJEL 4HWZA 1MIEH 4QWWD 1G9MC 2ZP0T 1MI5A 2UZXB 3O2DA 3EW3B 2WLZA 4ZFFB 5BVPL 3GMOA 4WFGD 2AV1B 3E3QC 3HE6A 2VQTA 5K9KB 5EO1A 5I15L 1JYNA 4M9PA 3QUXC 3C6LB 4UBDD 4KDWA 3QCTL 1U92B 2JELL 5EO9B 4PJBB 3TYGL 4I8DA 4KVNL 1UQSB 1QLFA 1MAJA 2A38A 4HS6B 4U4BA 5IGXL 1IM9A 1W72H 2XFXB 2P5EA 5FM5O 4U0RC 2IH3A 3RKPA 3L5XH 1K8DA 2C26A 3OQ3B 3ALPA 3L7EA 2AK1H 4X80L 4F7MA 5D5MB 3QDJD 3RGVC 1GPOH 3CC5B 2CK0L 3MRJA 3MRPB 5D7IB 2Q87A 2X70B 4W4OC 3K46A 4NQEA 2NYYD 2IQAB 4Y4HC 3SDAC 4CDHA 1OP9A 3QEHB 2PKDA 3THML 2BRQA 2FEDD 1I3RB 3VH8G 5MHSD 3WHE1 1MCBA 1UH4A 4HCRA 4R7DB 3TO2A 3HPJA 4FHBD 4L3CB 1QRNA 1YMHA 1L4IA 3QIUB 5F7MC 4BQ6A 4XXCC 2BVOA 2APWA 3INUL 2P43B 3HLAA 2F8VA 5IB1B 4IRZL 1K9TA 4XP5L 5CJXA 1J0HA 1NPUA 1S9KC 2C3VB 3GMLA 2VZSA 1FO0L 2KBGA 1CLZL 2MQCA 3F7YA 5I8OL 1E4XH 3HI5L 1S7UA 2J12B 2BOCA 1JHLH 4OT1H 4Y7MA 5M95B 1WCBB 4YDKH 3WE6B 1IGJB 4ZFFA 2AV1A 3U4EB 1C5BH 3SDCB 4HK3N 4NC1E 5K9KA 1DBML 2LU4A 3MFGB 1WAAF 1DANT 1RUQL 2BY2A 3C6LA 2W59A 3FO0L 4PLOB 1GCFA 4Z0BL 4NGHH 1U92A 5EO9A 4PJBA 4LHUB 1UQSA 1X44A 4HS6A 3ARFB 1LO3L 4NWUL 1Z9LA 5C0CE 2OP4H 3VDCA 1KB9K 4XH2B 4OTXH 3QHFL 2XFXA 2NY0C 5ISZD 2VDRH 3BE1L 4I13B 4WTWA 4WI9A 2VLJD 1U8LB 4OZFH 5D2NB 4K7PY 4FXKB 2PTVA 4HIEB 5D5MA 1P7HL 2Z35B 3CC5A 3MRPA 1MWAB 2AGJL 1O7SA 2X70A 4GXUM 5D7IA 3R0MA 3MXVH 2IQAA 2EDRA 4R4ND 3BJLA 3ZLQC 2WUBH 4TSCL 3WIHL 3QEHA 4JM4H 2V5TA 5E4EC 4I0PD 1YQ2A 4XNUH 4PB9L 3K7UA 1XF5B 1I3RA 4UI2A 1CDUA 5GGTH 4Y4FD 4OCWH 5TE7H 3UJJH 4BFIB 4KKLD 2EDWA 2ORBL 4MJ2A 4Y2DC 4MNGB 4R7DA 4O2EB 5HBBA 1OWRM 4L3CA 3QIUA 4XNXH 1CU4H 5CJ5A 4LSPH 1ETZB 3RJQB 4APQC 2C4FU 1KJ2B 3EOTL 5IB1A 1BREA 2XZAH 4Q9BA 2VQ1B 4TSBH 4RDQF 1MIMH 2C3VA 2WP3T 1JYXA 4XNYH 2EXWD 2NXZC 2Y72A 3IFNH 4XC1H 4FP8H 4G9FD 4Y89A 5DMGD 2YD9A 3L6FB 1G0DA 3MJ9A 5GS1C 1E4JA 4FQCH 2CK2A 1MOEA 2EH8L 3MCLL 1YEIL 2EEBA 5BV7B 3MV8D 3UXFA 1WCBA 1TETH 2D2OA 5DHVH 3MZTA 3WE6A 1IARB 1IGJA 1QR1B 1RIHL 4MNQB 4Y5XC 3S3JA 3U4EA 3SDCA 1VACB 2ZUVA 4F3FB 3HHRB 4XWGL 1XH3B 4KK9C 3GM8A 1KCVL 3KPRD 5D2LE 4LHUA 3SKMB 3RX7A 3ARFA 1MFDL 2GEEA 2Y7QB 1RUAL 3A0OA 4P23C 5GZNC 4P5TD 3ARQA 4PJAB 4XH2A 2F9BT 4OQTA 4C83B 4U1NB 4U05A 5HGBB 1B4JH 1M6OB 3N9GL 2H2PD 4QHKJ 1U8LA 4MXVF 1CDIA 4P5KB 3CLEL 5D2NA 5H8DA 4Z8FH 4FXKA 1CD0A 3GJFK 2QEJA 4HIEA 3VD4A 4O5LH 2VWEE 1RJCA 2C1PB 1H15B 2Z35A 3ZYOA 2P5WE 1MWAA 3QFDB 5EIIB 5IHUL 1QFUL 1TJHH 1A9BB 2YXMA 3JWDC 5DS8B 5IK3B 4EI5C 3NOIA 2ARWA 2IBZX 4ZUVB 1QFWI 5C08D 3GZKA 4S1QL 4JG0L 2EDEA 5EU7E 4FFVC 1LEKB 1XF5A 3DUUB 3I9GL 5BVJB 4HMEA 4OFDA 3G5YB 4H20L 4BFIA 5E9DE 3QQ3B 1DUYA 2VUYA 4MNGA 4O2EA 3ULUH 4BJLA 2WWKT 3ULVD 1ADQA 1UC6A 1NL0H 5DD0L 2AAVA 1ETZA 2FCBA 1KJ2A 2D4FA 2DQTH 5CEZL 4QXGH 1MFCL 4ZSOE 2VQ1A 4WO4C 3U7WL 4YXLL 1KB5B 1LMKA 2QQQA 4G3YL 3L6FA 1YECL 4GRWF 5HI5D 1JRHI 1P4LB 1UGNA 2UY7A 2FECI 2C1OB 1ZHKB 5CP7B 4OCXL 3LS4L 1QR1A 4WI4A 1BFSA 4MNQA 4KXZH 4G6JH 4NHCH 1FVCB 3HUJF 7FABL 1VACA 4HUKB 4NO2B 2VR9A 4F3FA 1HZHL 5CKGA 4OGXH 5HDLA 1XH3A 3HE7C 4HJ0D 5TQ2L 4PJ5B 5CWSB 5K59F 2XN9E 2JJSA 3SKMA 2B5IB 4QRUB 2PYEB 4PLNC 1EO7A 1MJ8H 2Y7QA 4LCCC 4OZ4B 4PJEB 4PJAA 1MJ7H 1UH3A 5I74C 2RGSA 4LLQB 4C83A 4U1NA 5HGBA 1M6OA 1AO7B 3K3QA 4P5KA 2VZ1A 4BH8B 2YZ1A 2W0LA 3OZ9H 1RZKC 1JNLH 2C1PA 1H15A 4EQ2A 3QFDA 5EIIA 1A9BA 1O5DT 5IK3A 5DS8A 4DN4L 1WWBX 4ZUVA 2D0HA 1R3KB 1QQDB 3WHE0 1YMMB 2FLRT 4N1CA 4XT1C 1GYAA 1G9NC 4Z7UF 1LEKA 3DUUA 4FMFA 4GG6F 1RZ8B 5BVJA 3O4LB 4RGMC 1NAKH 3G5YA 5KSBE 3QQ3A 3LSOB 5EZIL 1UJTA 4EUPH 5E99L 4LVEA 4PRPD 2F54D 1G6RB 4PGJA 4WHCA 2HTLC 2X09A 4IRSC 4MJIE 3MV7B 4R4FH 4MA1C 4JHAH 1KB5A 2H2SD 3KPSB 4RGNE 4HK3J 3P0YL 4HUNB 2HKHL 4LLMB 1WBYB 1P4LA 4EBQH 1T66D 3DSFL 5F6HJ 2ZUQB 3FO2B 3NCJL 43CAB 2C1OA 1ZHKA 5CP7A 4QXUL 3RHWK 1INQB 4PJ7E 1FVCA 1PD6A 3FB6B 1MF2L 1RI8A 2DIAA 4NO2A 1W2KT 1MCIA 3L5IA 4HS3B 4NZTH 3D2UD 3QDGB 5HGDB 1QA9B 3LB6D 1YJDH 1EFXB 4PJ5A 5CWSA 5MP6H 3VH8B 2DDQL 4QRUA 2PYEA 4MAYB 4MVBC 3BPNB 5JXEC 2JB5L 4OZ4A 1MEXH 4PJEA 1NJ9B 3UAJC 2NY2C 2EEAA 5AZEL 3HNSH 4LLQA 3OJDB 3RPIB 4R97B 1FYTE 2I24N 3T4YB 1AO7A 3KPLB 3QIBC 4BH8A 4PGCB 4YXHH 5C0AD 3KLHD 2X40A 2FO1A 3SE9L 4DEPB 4C57C 3PGCB 1KC5L 2Y07L 4D9QD 1DQTA 1DQML 4DAGL 4NBZB 4OGYH 3RUGF 3U82B 5ICZB 1R3KA 1QQDA 1YMMA 1UA6L 5JDSB 3SCMB 1C1EH 1RZJH 5C6WH 2DL9A 3O4OB 3KPQB 3RI5K 4K3GA 1RVFL 1MQKL 1JV5B 1RZ8A 2VLME 3O4LA 3V6BR 5LXGH 5EC2B 2CJUH 3LSOA 2X4TB 2L4OA 5GGQH 1RUKL 4LQFL 5KJRH 3TVMC 3FQRB 3QWRA 1S7VB 1CFQB 1A6VH 1G6RA 3BEVB 1QBLL 3MV7A 4PRAB 2EDBA 4KKCD 1EVUA 5E8PB 3KPSA 4AENB 1QLEH 1Y0LB 3KYNB 3PG2A 5DK3A 3WNNA 1EXUB 3FQWB 4LLMA 3WLBB 1WBYA 4MQTB 1HINH 3QZWG 4EN3D 2Z31C 3FO2A 43CAA 3N85L 5J1TC 1INQA 3VXUE 3FB6A 5TE4L 4WW2B 3SPVB 1Q8MA 1VFMA 4LRNH 4M43L 4LVNB 1JMXA 1MJUL 2YR3A 4HS3A 1CT8B 4OKVB 2R23B 3G6JB 4IS6B 3QDGA 5HGDA 1QA9A 4G42B 1EFXA 4JM2D 4OF7A 3VH8A 3UBXI 4P59L 5D7LD 4MAYA 4LSTH 4KJPC 3G5ZB 4HWBA 1NJ9A 5DA4A 3OJDA 3RPIA 3IKKA 3T4YA 3KPLA 4AMKH 2RCSL 3Q6GL 4PGCA 4ERSL 5F9JB 1FHGA 3BGFC 2EDYA 3PGCA 5ALCH 4OZHF 3ZYZA 3WJJC 3SBWC 3AREB 2ZZUT 1EJOL 3EYUL 5HYFA 4WUKH 2RBLA 1F8TH 5B4MD 5ICZA 2P46B 4R2GD 2B2XH 5JDSA 3SCMA 2HTKD 3BDYL 3MRGB 2QQKH 3KPQA 3UTOA 4LCIH 5KSAC 5IM7B 1JV5A 4ALAH 4XVUC 4NJ9H 5EC2A 2X4TA 3JWOH 3GRWH 5CD5C 3FQRA 1P4IH 1S7VA 5CZXC 1CFQA 2C4FT 3BEVA 2Y5EA 4PRAA 1RU9L 2EIZB 4JFDB 1HCVA 1YN6B 5E8PA 4JQXA 4KRPC 3ET9F 5I1EL 1IEBB 4AENA 1Y0LA 1MVFA 1CD1B 1Y6MR 2NY3C 3KYNA 1EXUA 4JKMA 3FQWA 3FFDB 3PL6B 3DROB 3ZKMC 3WLBA 5D6CB 1K2DB 1NLDH 4XVTH 5CINL 2YBRB 3TBSB 3EYOB 3JBG7 3SGDH 3N06B 3OAUL 1X5FA 1CGYA 4JANB 1UM5L 2HLFC 1CIDA 4WW2A 3SPVA 1RHHB 4YHMH 1HCFX 1CT8A 1A6WH 1WK0A 3I85A 2R23A 1XZ0B 4OKVA 1IGIL 1MCDA 1MCKA 3G6JA 3BPLB 4IS6A 4HFUH 5K9QG 3VFVB 1S9WB 4G42A 4FQJL 4GS7B 3F8UB 3NTCH 4NNXB 5DTFB 3V5DB 4H0IA 3G5ZA 5F7FA 5JTWA 1DQDL 5FYKL 4NZUH 4KI5F 6FABL 3NBNA 4N90E 3WLWD 4D0BA 5FGRA 1BD2E 4PV9B 2W9DH 3GBNH 5F9JA 2HFGH 1YY8B 4NC2B 3QULB 5KAQG 3SO3C 3AREA 5F1NB 5T3XD 4ZS7H 3JXAA 4AQ1B 2VYRE 3T0XA 3H2WA 3HNTH 1GAFH 4M00A 5LCVL 3MRGA 1LO5B 4DW2H 5IM7A 2F15A 3R4DA 1WWWX 4LCUB 2RAMA 1A47A 3MNWB 5LWYL 4P3DB 4P2RE 2YMXL 3MR9B 4RMRA 3MODH 2JK5B 3TPUB 1FORL 2ZUYA 4JFDA 1VEOA 4M62L 1YN6A 1Z0MA 1VSCA 1IEBA 4JO3H 3ULUC 1NUGA 1CD1A 3AROA 3O6LH 2I5YL 3FFDA 3PL6A 3DROA 1I1CA 5D6CA 3ECBB 3GSUB 1K2DA 5EUKB 3KVQA 4UIKH 2YBRA 3TBSA 3EYOA 2BNRE 2AABL 3EFDL 5FYJD 4BFEA 5HTSA 4JANA 3BYTA 2JIXB 4XVSL 2CRMA 4ZAKC 3LZFH 5GGSY 1RHHA 5L88H 4NHUB 1QSFB 3RY6C 4BH7B 5J13C 1XZ0A 2Z8WC 1S9WA 3MJ7B 3VFVA 4NNXA 5DTFA 3V5DA 4F9LA 2VO5A 1P6AB 3HC0B 4F58L 4N9GB 3DYOA 2NR6C 2IADB 3QXTA 5I1IL 4PV9A 5BS0D 3H9YA 1NFDF 4YO0B 2YUWA 3GMNB 4NQUA 1I75A 1YY8A 3FT4B 2B1AL 3QULA 4OCRL 5F1NA 1QLRB 5L2JB 3V4PH 3GMRB 4TNVF 4PJ8C 4LGSB 2QTEA 5CUSL 1RPQA 2VXQH 3N1GC 2Z0BA 2RB8A 1IAKB 3ZTJH 1SQ2N 1LO5A 1AKJD 1Z9SA 1OY3B 3WFZA 3EDFA 4LCUA 3PV6B 3MNWA 4B41A 4P3DA 1MSPA 2R4RH 3MR9A 5DUML 2C7UB 2B4CL 2DRUA 3EAKA 3OR7B 5C6TL 2CIKB 4JDTL 1DBBH 2JK5A 3TPUA 4I77H 2DYPD 3O2WH 3ZHKA 2KL6A 1NGXB 3I3BA 1FNSH 4AH2B 1OW0A 4N5ED 1J0IA 5TPWH 2AEQL 5F7YC 3LVEA 1WBZB 2NZ9D 3ECBA 3GSUA 5EUKA 5GGSB 1RAMA 1OP5H 4FQHB 4AL8L 1FRGH 5I1KH 3PWPB 4PJDE 2JIXA 5I8CB 4JRYB 3M1BB 3TH2T 4LLVB 5E24E 1UZ8B 3QUYC 4NHUA 1KOAA 1QSFA 5IBUG 4BH7A 2IBBA 5GZOC 3EO1B 1GGUA 3C8HA 1IGMH 3MJ7A 5J56B 2DM2A 4YGVB 3EYSH 5DJ2B 3HC0A 2J7LA 4N9GA 2D03H 2IADA 3CX5K 2SEBB 3PDGA 3BMWA 1BZ9B 3VGAB 3HNVH 4YO0A 3GMNA 2VDQL 3FT4A 5SX5K 1HILB 2R0ZH 5KG9B 1HQRB 1GGIH 1QLRA 4XBEL 3HUJB 5L2JA 3GMRA 5IJKA 3QZWB 1WF5A 4HHAB 1RFDL 4KDTC 3REWB 2F5AH 2EDFA 4X9IA 2ZWLT 2OZ4L 1FGNH 1IAKA 2OS7A 4U3XA 4UTBH 2WW8A 4ZO9A 3PV6A 3QQ9C 1H3VA 5HI4D 3DIFB 2A6IB 1AP2B 4F8QA 2C7UA 3OR7A 1NUDA 2CIKA 2DQJL 1A8JH 1WFUA 4YWGH 1U6AL 3X3FL 3SE3A 3ZE0E 3BKMH 5KZCD 2GCYB 3MOQA 1NGXA 5DD5L 4AH2A 4LCYB 4ONFH 5JPMB 1U2HA 5GGSA 1WBZA 4LSUL 3BPOC 3VW3H 2VE6B 4KKAC 4FQHA 1NDMB 5JIIA 1CWVA 1Z9OA 5IT2H 1GRWA 2WBKA 4XB7A 4Q6IC 1QO3B 3PWPA 4Z7UB 5DMIL 4FZEL 4ENED 1MCOL 3K1DA 1CXFA 3M1BA 4JRYA 4Z7WF 4LLVA 1NEUA 5I8CA 4GG6B 1N4XH 1UZ8A 3X11B 4F15C 2YRZA 4TNWK 5KVFH 3EO1A 3KNBB 5JHDD 4FQLL 1KJVB 4YGVA 5F7NC 4R4BB 2HMIC 5DJ2A 2PF6A 4ORZC 4G5ZH 5JMRA 3DJ9A 5DF0A 1OAYL 4QRRB 4YDLC 3T0EC 1ZTXL 4GRLB 4AEFA 3BESR 1HHHB 1BZ9A 1A0QH 3AS0A 1L0QA 5DRNB 4DZ8B 3SKJL 1HILA 2E27L 5KG9A 1HQRA 1U8JB 1FDLL 3LPGA 2DLTA 3GSXB 1L0XA 1CXLA 3QZWA 4HHAA 5FUZH 3TGXA 5F71A 1TTGA 3REWA 2VTFA 3QHZL 2EE6A 4PJGB 3X12B 3X14B 5F8QC 3NCMA 4Y5VB 5D8JL 3W9DB 2G60H 1S78C 4LLDB 4M7ZC 2A6IA 1DFBL 1AP2A 3PGDB 3RVXD 1HHGB 3BPCB 5JQ6L 5D7JD 4ODWB 3S35L 1IKNA 3JWOC 2GCYA 2EDJA 2R69L 3LKSB 2HFTA 3NCCB 4KI1A 4MA7L 4LCYA 5JPMA 5IB2A 3J8F7 4JPVL 2VE6A 3TFKC 3QDJE 3QUZB 3WS6C 1NDMA 4N8VG 3RUGB 1F90H 2FX7L 1X5ZA 1T03L 3VXNB 4CVZB 3H9SB 1QO3A 4Z7UA 4GG6A 1EPFA 3X11A 5CJQH 1FVDB 3MRHB 4PY8I 2J88L 3KAAA 1RUPL 1CE1H 1ACYH 1J1PH 4QTHB 4DZBB 1MPAH 3KNBA 3GI9H 4YC2B 2F19L 5MHSE 1KJVA 4B7LA 5HVHB 2VSCA 1KBGH 3H3PH 3AB0B 4R4BA 3HRPA 1AD9B 1UWXH 2A0LC 4J4PD 2XOTA 5HDOA 2OR8A 1X9QA 2DQCH 1NMCC 3I2CH 4XCNB 4QRRA 3GKZA 5C6PB 4GRLA 1A3RH 1HHHA 5CLWA 3VXSD 4FQXD 4RAHA 4O2CB 5DRNA 4L8DB 4DZ8A 4HWNA 1P7QD 3EDEA 3ZT5A 3OWEA 1U8JA 3UZEA 1GC1H 5BZDB 3GSXA 2RR3A 3B6SB 1EH9A 2Y06L 3TN0B 5GSRB 2B8OT 3MBED 1A5FH 5CZKA 4M6MH 4PJGA 3X12A 1LVEA 3O8XB 3X14A 2G2RB 4KK5D 1BGXH 4PJHE 3EO9L 4HXBL 3UO1L 4XPHL 2HP4A 3W9DA 5F1IB 4KKBC 4PRHD 3CH1B 4LLDA 1PSKL 2X4UB 3PGDA 1IC5L 5IWLC 2R29H 2VN7A 1IAMA 4HIXH 1HHGA 5DJ6B 3BPCA 1JTPA 5ERWB 5ISZE 4ODWA 1HKLH 3UTQB 1RZ7L 2VLJE 1CDJA 4LMQE 5F1OB 3CH8A 4OZHB 3LKSA 1UADC 4JVPA 3MLXH 5FYLH 3QUZA 4NUJB 3QDMB 3RUGA 3BRFA 3ARBB 1J10A 4K23L 3VXNA 4CVZA 3H9SA 5D72H 3UP1A 3AXLB 3QI9C 1Q1JH 1AJ7H 1FVDA 4GAGH 1UCBL 3MRHA 2R9HC 3OKDB 4QTHA 3O2DH 4DZBA 3MYZA 4HW6A 3VFRB 3CFJB 4WHTB 4KK8D 5CLTA 5F9DC 1FIGL 5IHBA 1AD9A 1NUFA 2QKIB 4L5FL 3VFGH 3ZYJA 2XZZA 2VDMH 1BJ1J 4XCNA 3SDDD 5LGJB 4ODVL 2IEPA 2Z8RA 4C58B 4O2CA 4I0CC 4L8DA 5D1QB 1NMBH 3ORJA 2P5ED 3KXFB 4Y5YC 3UBXG 5BZDA 1Q0XL 3B6SA 3QJFB 1KNOB 3MV8E 3TN0A 1LD9B 1NCDH 4GAYB 5GSRA 4IMLB 1Y6NR 3WIIL 4RISH 5EU6D 5C71A 4TULH 5FUCE 4XP1H 1NLBL 3O8XA 1OGTB 2G2RA 1IM3B 4NKOB 5IBUB 2YK1L 1BVZA 3ZDZF 5F1IA 3CH1A 1PVHA 4MD5B 1BWMA 2X4UA 4PJFB 3LN5B 4P4KC 2NX5B 1SJVA 5MI0C 5DJ6A 1J88A 1VFBB 4LPCA 5ERWA 3U0WL 4NRYB 3UTQA 4YFDB 1ZV5A 5IIEB 4PD4J 1QRND 5FOBB 1RUML 2CLRB 4OZHA 4XI5D 1A7RH 3IKCB 1I9JL 5KS9F 2Y6SD 3QDMA 4NUJA 5HGAB 3X17A 1BQSA 1QFPA 2D7OA 3ARBA 3CVHL 1BVKB 4I3GA 3CUPB 2X10A 5DA0B 2NMSA 3AXLA 5D9SB 5AG8A 4M48H 4G8GB 1TVHB 1JTOA 1MRCH 2XKUA 3OKDA 1A14H 2VXTH 5IQ7L 2OJZL 3BGMB 3CLFH 3MSPA 3VFRA 3CFJA 1CVSC 4WHTA 1A4JB 2E7CA 4R8WL 2AJSH 5JW4R 1DSFH 1X7QB 2QKIA 4TVPD 4OI8A 4LDLB 2Z8VC 1B9ZA 3GSWB 1I9RH 1N7ML 5LGJA 4PGBA 1I8LC 5D1QA 3STZB 3TV3L 3O6KH 3KXFA 1RURH 4L4VE 3QJFA 3IU4H 2NY6D 3O3BB 1KNOA 1CLYH 4WFFD 1LD9A 4GAYA 4IMLA 4YIQB 1A6ZB 4MA3B 2A9NH 2EC8A 3WNMA 1T1YB 3IDYB 1HSBB 1OGTA 1Q0YH 1IM3A 2AJZB 4P2OC 4NKOA 1CGTA 5IKCB 3HC4H 4NQDB 3CZJA 3OAYH 4HUMB 3RGHA 5SWSB 3GEWB 1JFQH 5IJVB 4MD5A 1NUNB 4PJFA 3LN5A 2PW1B 3I6LD 2NX5A 3MGOB 1VFBA 1SBSL 3RVUC 1NAML 2CUHA 4NRYA 4ODBD 2LFGA 5IIEA 5FOBA 4BFGA 1W72L 2CLRA 1J9CT 1BEYL 3IKCA 3D3VE 1JHKH 5HGAA 5DQDL 1UZ6F 2ENYA 1D3CA 2QSCH 3MFFB 1BVKA 2VXVH 3CUPA 3L5XL 1F5WA 1HXMB 3MJ9H 1TZIB 4XP9H 1P84J 5TDPB 5BO1L 3PP4L 1U8NB 4ZFOB 1CE6B 5D9SA 4CU8A 4JFQB 4ZO8A 1U3ZA 1TVHA 3LV3B 3GHEH 4G8GA 1GPOL 2N1KA 5I1JH 4PRBB 3BGMA 3LCYA 3SKOB 4DVRH 1A4JA 4OAWB 4MD4B 5E2WL 4KAQH 1QG3A 5IROC 1V8HA 4RMQA 4K3JH 4YX2H 3C5JB 3U9UB 1X7QA 3T3PF 3D85B 1IEHA 2F54E 4S11A 3C08L 4FFZH 4JEGB 3GSWA 5I1CH 2I25N 5MENB 1OD9A 1OQXA 4ZTOH 5FKAB 2EDHA 4M6NH 1E27A 5HDBE 1A7NH 5L2KE 3HMWH 5KOMC 2ZNXA 4D0CB 2WANA 4OQTH 3STZA 3Q6FB 3TT3H 1U95B 3O3BA 1MCCA 4N8VB 4YIQA 2I07B 1A6ZA 4MA3A 1E4XL 3MCG1 4LLAA 1BVLB 1UWXK 1T1YA 1HSBA 1MWAH 5D96B 2AQ2A 2AJZA 3HR5B 4NQDA 2ZCHH 1C5BL 3T8XB 2BVTA 5SWSA 3PE9A 2R1XB 3Q5YA 3P2TA 5IJVA 1RK0B 2PW1A 4HG4K 2YS4A 4AEEA 4POZD 5C2BH 1W8OA 1BM3L 3MGOA 4UTAH 3L7FB 4V2BA 1NCAH 4R0LC 3I75B 1KXVC 1ADQH 3ELAT 3U30C 2YPVH 3WNLA 5KANI 2OI9B 1ZT1B 3U36B 5EN2B 3FMGH 5C0AE 4QXWA 1H5BB 1T4KB 2JCCF 4YDIH 5GSVB 2VKWA 4I2XB 4R3SB 1TQBB 4MJ6B 1UG9A 3MFFA 3FQTB 4D9QE 1HXMA 1TZIA 5TDPA 4PTUB 5ESAB 3VD5A 1U8NA 1T80A 4ZFOA 1CE6A 4JFQA 3LV3A 5BV7H 5MEQB 3QUXB 3P11L 4PRBA 3MXVL 4PJCF 5FHAL 3SKOA 4HWEH 2WUBL 3FZUD 4OAWA 2F5BH 4MD4A 5CS7A 2R4SH 4JM4L 1K4CB 4OZIF 4RGOH 1I7RB 3C5JA 3U9UA 3S37H 3OKKB 3D85A 3RFZC 1IMHC 4GQPH 5GGTL 5TE7L 3UJJL 1OCWL 5TF1H 5MENA 3RA7H 4XNXL 1ERNA 1CU4L 1TCRB 5D71L 4K7PH 5FKAA 3SGKC 3KLSA 1GGYA 4D0CA 4XMPL 2XZAL 3Q6FA 4TUOB 1MIML 1U95A 3IFNL 4MQXD 1VCAA 3MRCB 5D6DA 4N8VA 3SDAB 1S5IH 5HYQB 4OLUL 4OZGB 4KHXH 2I07A 4XPGH 3BO8B 5GQBA 2IANB 1BVLA 1S7QB 3BN3B 1T3FB 5AG9A 3HR5A 5F97E 5LGHH 4D2NA 2R56H 3T8XA 1INEH 2IFFH 2R1XA 1A21A 1MUJB 1RK0A 1CTNA 3K8MA 2IGFL 3PDDA 4CMHC 2YD3A 1JGUH 2AXHA 2ARJB 3L7FA 4J7RA 4MAUH 1ACZA 5A2IH 2VXUH 3I75A 5C86A 4X6BB 1ZT1A 2A77H 3U36A 4X4YB 5EN2A 5HPMA 2XTJC 4EKXA 1H5BA 1T4KA 2RHEA 5GSVA 5D93C 2AW2A 4I2XA 4R3SA 4MS8C 2I26N 3BP4B