2QQLH

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
227
structure length
222
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTISGYGIHWVRQAPGKGLEWVAYIYPDSGYTDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAREDFRNRRRLWYVMDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuropilin-2
publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 39
structure length 222
sequence length 227
ec nomenclature
pdb deposition date 2007-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qqlH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qqlH01
4X80H 4MA1C 3QHTC 1ZT7A 3T2QA 3HNTL 3GJFK 2YD4A 3UYRL 3R1GL 4JJ5A 3G9VA 3KYKH 4ZPTB 1IQWH 2UYLA 3RGVB 3RWHA 5FHBH 3UYPA 4ZS7H 1CDHA 4F15B 5KSUA 1H3TA 5F9JA 2FEEI 2B4CC 4HUXB 3HKFA 3HAEB 5L88L 1P4LB 5EB9A 1P84J 2A6JA 5IM7B 3SDYH 4K3EH 3UC0H 2GKIA 5B3JE 1WCBB 4ENED 3GSXA 1CGUA 3UDWA 3VCLB 1OCWL 5I1AB 4Z7UA 1A2YB 3J7HA 4OZGF 5IHUH 3VFRA 4OFPA 4MAYA 5E5MB 4EZMA 1NAML 2EH8H 1IBGH 3QZWB 4PTTB 4M43L 4WO4C 2K3TA 2XWJB 5IMOA 2I5YH 3IF1A 3JWDH 4WTZA 4BELD 3CUPB 1FE8H 1A6ZB 1C5BH 5I76B 1M71B 4Y5YB 2FHFA 4Z9KB 4WHTB 2HLAA 1U8JA 2E6JA 1Q94B 1RURL 1A21A 1F42A 3PP4L 2OTWB 3EIFA 2FR4B 1P7KB 3ISWA 2VC2L 2QR0B 3MBEB 4M1CD 5I8OH 4ZSOA 4I3SL 2YKLH 1FO0L 1GGUA 4HGWA 3P77B 4X7CC 3WEXA 1C08B 3E8UH 1C5DB 2HTLD 3KPSE 4UOW0 5EUKB 4Y4KD 5EA0H 5M95B 4KRNA 3U36B 5DJ6A 5IKCB 5BXFB 1BQLL 1J1PL 1UEYA 2QADC 5AD0A 4M7LT 3SDXE 2M8XA 1UFUA 2P8PB 4XNQB 5C0BE 1GSMA 2AP2A 5LG1A 1KG0B 4NQDA 3BW9B 2NYYD 3K2UH 3VD9A 1YEDB 2PO6A 3I6GB 2JB5H 3VXMD 4U7KA 3QEGL 2IAMA 3RZCB 1UH4A 5J1AB 3IJHA 1T0MA 4CN1A 1H8NA 1XGPB 2OCFD 4Q7DA 2MSPA 3HRZA 2DF3A 1T3FA 4OIIH 2GJZA 4XPAL 5FGCB 4HFWB 5EPMB 2NY3B 1Z9MA 4LRIA 1EO7A 3NABH 4X4ZA 5IROA 2ZUUA 4X98A 5LBSL 5C3TA 4IRZL 4JKLA 5I8KL 1VEMA 3O2WH 5I16A 4WENB 1KTRL 4EOWL 3MRIA 5FHAH 3AS3A 3L9RB 5ADPL 1G84A 4RRPG 4W6XB 4Y4FB 3S34L 5HI3D 4LVHC 5I1GL 1FYTD 3FB8B 4YQXL 3KWWA 4OSUH 1H5BB 4JRXB 3G08A 2Z35A 4MCYB 1KXTB 4UQ3B 4NKIH 5FA3B 3RTQC 2G9HB 4PS4H 5EUOB 4WFHE 2DJ4A 3VXOB 2AXHA 4YHOL 4GBXA 4I5BB 1JVKA 1UB6B 1Q9KA 2AS5M 1RK1B 1KGCD 3MA9L 1H8SA 3RBGA 5K59E 4R7DA 3HE7A 3QULB 5I71B 1MAML 5I1JH 1RHHA 3U0PA 1YEHH 3LEXA 4N5ED 3FQTA 3DO3A 1YMHA 4TUKH 1UVQA 4FXGB 4EBQH 4N0YH 2H1PL 5D7SL 2FJHA 3MJ9L 3ZHKA 4NQVB 3TVMD 3MYZA 5FYKU 4LRNH 2XI9A 5IP4A 5IW1B 1FVCA 1MRFH 2X89D 4Z76B 1WT5A 4HC1H 4WVRA 1Q0YH 3IJYB 3U82B 4RAHA 5C9JA 5TDPB 3U1SH 2Q76A 2GTWA 1NGWB 5GS2H 5EBWA 1AR2A 2OM5A 2UY7A 2BMKA 2R0KH 2V2WB 3FB5A 3TNNA 3NFPA 1JPST 3RJQB 2C1PA 3DUSB 5KVGL 3QHZH 3REVA 1D5MA 3D69A 3MRQA 3TT3L 3GMOB 3RNQB 2XN9B 5JHLL 3W81A 3C2SA 1B3JA 4AQOA 4LOUC 1EHAA 4M5ZL 3O6KH 4ORGA 4QYOA 2IALB 2NZ9D 3MRMB 3L3DB 3DGCR 4XP4L 4QOKE 5D2LF 5J57B 1AIFB 3AXLB 4HHAB 1QPPA 5HYSG 1X44A 4BQBA 3F58H 3HG1B 3ECBA 4I0PB 2BY2A 3N1GC 4QRRD 4FTVE 3MNWB 4U0RC 2ED9A 3TEUA 3CU1A 5LWYH 2JJTA 2R4SH 5ILTH 5C08A 2H8PA 1AJ7L 1U93A 1IGFH 2YUWA 3DXAD 1KUMA 1T7VA 1MF2H 2VDKL 1MJ8L 3HC0A 4MGXA 1U3JA 3HI5H 4P2QB 2V2XB 4Y1AB 2EDWA 1FRGL 3TO2B 4G6FD 2OXHA 2DLHA 2OJEA 4H26A 1M7IA 2FX9L 2ZCHL 3DX7B 4PIRF 3TGXA 3BXNB 4K7PH 2H45A 2NY1D 3E6FA 3P4OA 3B8SA 4XH2B 3GSQA 1RUPH 3VFGL 1R24A 3MACH 5FKAB 1FIGL 5HGDB 4NN5C 3TPUA 3FO9A 5HHOD 1OTTC 4FFZL 2DI9A 2F5BL 5TE4H 5C0CD 4DFHA 5LAXA 4DCQB 3BAEL 2P7TA 4ELKB 1OSPL 1VFBB 5CMAA 4M5YL 5DUPL 3V2AR 4GRLA 1RZIB 4XAWL 4H20L 3WHE1 1A7NH 3T3MF 4HUUB 5F7KC 3V52L 1T4KA 2X7LA 3SDAD 2VLKD 2I07A 4O2FA 1M6OA 2A9NH 1MHPH 3BESR 3FTGA 1T2QH 3AY4C 1MLCB 3KYMA 3SEPA 2VABA 2HJLB 3EGSB 3TBVB 4ZUUA 4NKOB 5M7QA 3MODL 1P1ZA 1XFPA 3B9EA 5EO0A 4JR9L 3UTQA 4IIQB 3RDTB 5E00A 4QTHB 4D0DA 4U1LB 3DHJA 3UJTH 4U6HA 1WQVT 3T4AA 4MB4A 5GPRA 3FO1B 3X13A 5I1KH 3E2HB 3EDFA 5CZVH 3O8XB 3OX8B 4R4NC 1HNGA 4G6MH 1GGTA 1CE1H 4YLQT 4DAGH 5GGTL 3VFVA 1WBXB 4KAQH 3NH7H 3O6LL 5TJWK 4UI2A 4CKVX 3GSRA 1T20A 4NQEA 1NCAL 4NUGL 4AEIH 2EDLA 2OTUA 1AFVL 2FBJH 1C16A 5A43C 2ATKA 2FHBA 2ZP0T 3S36X 2J88L 4PRIB 4J3VA 4ONGL 1QFWI 4OZFA 4M7JL 4OCRH 4NFCA 2MHAB 3NIFE 1MCQA 4XP1L 3QIBA 4NT6A 2Q8AL 4GS7B 3CFJA 3SGDH 3GM8A 1UKTA 2A74B 2F5AL 3ZT7A 4LQFL 1AI1L 2Q86B 4RAUB 3WIHH 1X5ZA 4OFYA 1HKLL 3I02A 3QCVL 4X9GA 3F7YB 3CFCL 3GFUA 4OLZH 1FGVH 1QQDA 4JO3L 3VGHA 5CIPH 3L7FB 4G9FE 4XWOD 1YA5A 5C0JB 1A7BA 1OGAA 3OXRA 5FYJE 1PAMA 1JGUL 4L3ED 1RZ7H 5GS2D 4LARH 4G7VL 3QDJE 4PJ8D 2E8YA 4HXAH 3F12B 4YXKH 1PKQA 3PGDB 3UTTE 1KENH 5FK9B 1IKNC 2RFXB 4JANB 4JRYB 1GGCL 4J4PD 1LDSA 4UDTA 4X6BA 5JXED 2AEIT 4Y2DB 4CMHC 3ARDD 3QI9D 2D7NA 4PJCA 3U2SA 1GHFH 2H2PC 2VZUA 3CXHJ 3LKPB 3MRCB 2BJMH 2M26A 4PJHE 3DJ9A 4KTYA 1N6QH 4G43B 4ZO8A 1QTYT 4UQ2B 4IRJA 5C0AB 3CH8A 3H9HB 4XTRC 4LSSL 3VWJD 1DZBA 3LN4B 5E2WH 5EIQA 5I1IL 4PLKC 1FFOB 4R2GD 1TNNA 3PWUA 5SWQB 4F2MB 3OKLB 1B2WH 1I7UA 3QO1B 2MTPA 5E1AA 2KZ1B 4U4BA 3EOTL 3Q6GL 5FGBC 4OQTA 4PJ5E 43C9B 5DMKB 1G7QB 4JDVA 3ZYZA 1TJGH 4G3YH 2DQHL 1HKFA 1MVUB 3DBXA 4PJFB 1F4XH 1JF6A 2JTDA 4GRMB 4Z7NF 4XZUB 4YHLH 5D70L 4I0KA 1ODAA 4E5XB 2QLVB 2FX7H 4O00A 1JNNL 4M7LL 3EYUL 2GJ6A 2MCG1 2Z4QB 4XMKL 4R90L 4I9WE 5H94A 4QF1A 4OM0L 3QUKB 5T3ZH 2NLJB 4NO5A 5BVPL 1H3XA 1G6VK 1T5XA 4LSQH 4HJGA 4PGCB 4X6DA 5ID0A 3ZKXB 4GFTB 2D31B 4OLWL 4AEFA 4G5ZH 3D6GA 5MEOA 1FZMB 5D7IA 1J11A 4XB8A 4JDTL 3BKJH 5F1IB 3GRWL 3L7EA 2NY2D 5E0QA 2R9HD 3DX6A 1FL5A 3BKCH 5BZWA 2A83A 1QFHA 1SBSH 4X7TB 3KPMA 3PE9A 1NCWH 5IGXL 2DKSA 3TYGH 5IMMB 3GJFH 1NDGA 4E42B 4GRWH 3C5ZC 1PDKA 5MP6H 4XC1H 1KCUH 5FB8A 4HX1A 1FL3B 3MO1A 4AH2A 4XVUC 5BS0B 2D0FA 1WZLA 3D85B 4XCEB 2VIRA 3C5JA 3V5DB 4JAMA 4RMUA 5DD6A 1GGBL 4E41E 2FGWH 1T0NA 2LQRA 2IJ0C 4FFVC 1QRNB 3BE1H 1HSBA 1QBMH 3BPCA 3GKWL 1CR9L 5E9DD 4HULB 1H0DA 4ONHA 1DN0A 2QQQA 4EJ1C 3WHXB 1DVFC 1TTGA 5D1ZC 4LMQI 4KJWD 3WLBA 3TF7C 3KS0H 3K1DA 1MCOH 2EIZB 4YDIL 5E94B 1LO3L 3O0RH 5A2JH 3V6ZA 1SMAA 2J7LA 4J3OC 2YSSB 5D1QD 4RRPA 4P5TD 5DSCA 4ODTH 2QSCH 2HH0L 1U91B 2HLFD 1X7QB 3GBNL 2DBLL 4ALAL 1N59A 3VGFA 3WFHB 6FABL 4JY4B 3ULVC 5B8CA 5H37H 1I75A 2A6IA 4PJBB 3QIUA 1DQDH 3TBWB 1B0RA 1U3HD 1A9BB 1JPSL 1ZS8B 4KTDL 3H8NA 3ZKND 4AMKH 5IQ7L 4FQ1H 2XOTA 3UXFA 1NJ9A 3V6OA 4JM2B 2WIIB 4HUKB 3ULUH 4R7NA 2O61A 3S35H 4HUXA 4WFEE 2CO7B 3BSZH 2NW3B 3MUJA 1U8NA 1P7QB 4WTXA 3PWPE 2X6MA 3ZTJH 3OB0K 1EMTH 2OL3B 3BQUB 4ZUSB 4R4FH 5I1AA 4LLMB 3CC5A 5JA8B 5DURD 1A2YA 4EUPH 4F80A 4H0HB 4Z0BH 1HDMB 4HGKC 1S5IL 1MCSA 2D7QA 4NGHL 5I1DB 4YPJA 4Q9CA 3DURA 5HDQL 5MI0B 1N4XH 4ETYA 1NL0H 1F90L 1BQSA 1XF4B 4NJ9L 4KPHL 3FOLA 4BQ8A 2EDJA 4WWKB 3ZYJA 4LIQH 5I18H 5IEHA 1JPFA 3KJ4C 3S36L 4MDJA 5ESVB 5FKPA 2PXYA 1EAJA 3L3KB 4GAFB 1FZJB 5EOTB 1CFVH 4L3CA 1KIRB 5DEGB 2PNDA 4UTAH 2LTQB 4MXWL 4IHOB 2BVQB 4XAKE 4S0TD 3F7VB 1H15A 2YA1A 5HYSA 4OT1H 3U9PL 3FL7A 3RY6C 5I1LA 1G7JB 3GMLB 1HXYA 4YEFA 6CGTA 4MD0A 5T3ZD 3MV7E 2BOCB 4HKBB 1A6UH 1C8PA 4N8PA 3CNKA 3CFIC 4KJPD 3HMWH 3KPPB 1L7IH 1CLYH 1PX4A 4KTEL 4ZUTB 5HPMB 3MRFB 4KKBC 1ONQA 4HJ0D 1RJCA 4RSVA 2P5WD 3I6GA 3FAWA 5C0RH 1T0PB 2AJYH 4ZFZB 4MNQA 3UJIH 1CGVA 3U83A 2DQJH 4K94L 4NC1C 5FV2A 3FONA 3C60B 4I4WB 4MB5A 1AHWA 3EO9H 4MD4B 4P2RD 4HV8B 4QHKJ 4OAWA 3VMNA 5CCKH 5JORA 5C09D 3TA3C 1MJ7H 2P8MB 3PHQB 4PJDF 2Y6SD 4BSWB 5GRUH 2R1WA 3RZWA 4PJXF 2VN4A 4WFFE 2XNAA 3O41B 3M17B 5D71H 1DR9A 1EDQA 1FVEB 5H35A 2H6PB 3GK8L 5J9PB 3IFLL 1ZT1B 2R29L 4OCMC 5HYJD 1DLHA 5DO2C 2P5EB 5A16A 1WFUA 4L8SC 3ARGD 4JFDE 1JRHI 4JQVC 2C3HA 4QHLB 2YC1B 4NZTL 4PJCF 4S1QL 2YPLB 3JWNC 5TE6H 4AIZB 1E4KC 3LPFA 5DWUL 3BJ91 3QFJA 5CJQH 2V5YA 5DJ8A 5DT1L 2ED7A 3BH8A 4NQSA 5EUOA 3LDBB 1JHKH 1MI5D 5J1TC 3BP7B 4N9OB 3SCMA 1HEZB 1UG9A 2YUXA 5AZEL 4ZG1A 2OMNA 1XCQA 4HWUA 1QFPA 3C5SA 1OTSD 4CN6A 1E4XH 5ALBL 4JPKL 1P4IL 4PY7B 4OZIA 1MFEL 4HZLA 5DD1L 4KK9D 2R0ZH 4X9IA 1YDPB 5J13C 1DEEB 1AGDA 1N3NB 2P48B 4M6NL 1U8HB 4KDTA 5TPWH 1QSFE 2H2SC 4DUXA 5F96H 3WFDH 1BAFL 5JO5B 3VFOA 2OP4H 1NCCL 1A4JA 2GEEA 4NQVA 4YXLL 3KXFD 1OTUD 2EXWD 4ZDHB 2ZPKL 4WGWB 3MRBA 1LEGA 2ZOLA 4M61B 5H2BB 3RP1A 1I7TB 3J8F7 4BFGA 1DUYB 4XBPA 1MCJA 3UTZB 1WICA 2VB5A 2EICA 3MLVH 4L4TB 4HWBH 3RVUC 1NFIB 5KOMC 4LVNB 1UACH 4TVPL 4EN3D 1XGUB 4AT6A 1AR1D 1BQUA 1TENA 2WLYA 3ULUD 3HZMA 1S7QA 1EGJA 3CDGB 3DUSA 5J4MA 2DWDB 4YWGL 4TQEL 1CLOH 3Q5YA 4LSUH 4TULH 1UM6H 3MGAA 1AY1H 1L9NA 2ERJB 1LGVA 3M8OL 4QRPD 4X8XA 4Y5VB 5C0ND 3NA9L 4JY6B 3ULVE 2YMXH 4LKCA 4X6FB 3QNXA 2FYYB 5IV2A 3MBXL 4Y16B 5FIEA 1TVHA 5I6XC 2X4SB 4NBYB 4D0BA 1NAMA 1YMMD 3D87B 1QSEA 1YECH 2H32H 3R8QA 5E99H 1MJJB 1B4RA 2DQTH 1K4CB 4XP5H 2BHYA 3QWRD 4JFED 5CUSH 3MV9E 3QNZB 4HEPG 4ZXBA 1JI1A 4XVJH 1I7RB 4EDWH 1JPTL 1CXHA 4FS0A 4HPOH 1YUHA 2BDNL 1GZQB 4JN2A 2Z31C 3PXJA 3QWOA 2FZ3B 4J1UB 3MCLH 4HGMA 1T7XA 4X9HA 1DL7H 4XXDA 4LLYB 4BFEA 5KSAA 1FO0A 5GGSY 2ZUTA 1Y6NR 4NNPH 4OZGE 5BO1L 4Z7VA 5HJ3B 1H8OA 1Z0MA 4YBLC 4JFOA 4XHJC 1K8DA 4KZEL 2FX8L 4P23A 5DJ0A 2ZG1A 4L4VD 1BJ1J 3I2CH 2NCMA 1UM4H 4TTDC 4UB0H 2CJUL 1RZIA 5DEFB 3KYNA 1JZ3A 3MLXL 3A6BL 3HPJA 5CJXA 1G9NC 2IANB 4P2OD 1QA9A 5ERWA 5C0FA 3JV6A 4E0RB 5D6CB 4IRSB 1BOGB 5CSBA 5DJCB 4OM1H 3SQOL 1BZ7B 4QTIL 2VLRB 3HLAA 1RK0B 1IGYB 5IJKA 4NNYB 2G60H 4UILH 1XF3B 1JIBA 2YWYA 4KZDL 4QT5A 1L6ZA 3N50A 1C7TA 4POZD 2Q6WB 2HJFA 4U1LA 3BPOB 2LVEA 5ACZA 5L2KB 4JG0L 4HS6B 2ORBH 5GJSH 3RI5F 1EFXA 3V6BR 1KPUA 4KUZH 3IDNA 2R2BA 5CKGA 1HHJB 2W9EH 4PJAA 1CQKA 3RWCA 2UZIL 1DQML 4M8QA 5F7MC 4L1HA 5D7LD 3C6LA 1ZWIA 1I1AA 1D5BA 3O2DL 4CJ1A 2XKNB 1T04A 4NC1E 2R1YB 1T7WA 1NGQL 4N8CH 2MPAH 2IBZX 4RA3A 5IHBA 5SWSB 5ICZB 1OLZA 1YC7A 1K5NA 3DO7B 4XWGL 1U8MA 1IGIH 4QRQB 3PQYE 2VR9A 2XZQH 3UDWC 3ZSSA 1I3VA 1BJMA 2FB4H 3G5ZA 4OUUA 4HG4J 1A64A 1HINH 4MAYC 4RIRA 3M1BA 3D39B 1PEZA 2AV7B 3VXSD 4G6AD 1VADA 3ALXA 3N1FC 5JQ6H 2NX5B 2BSRA 4KKAD 4Y4HB 2X5PA 5EBLA 1A8JH 1XCTB 4GUPB 4JO4L 25C8L 1NLBH 1ZVHA 3MJ9A 2X1PA 1Z2KA 5D5MB 5EZOH 2B5IB 5F1NB 3P11L 5JW5B 2W9DL 5DDHA 4ODVL 1C1EH 1G6RA 1VFOA 1KJ2L 4EI5B 2X42A 1NEZG 1P6AB 2ZWLT 1OL0A 3FFDB 1I9EA 3B9VA 2FL5B 3K0WA 4NNXB 2VNCA 2EEBA 1F3JA 2J2ZA 4OD1H 3F12A 3EFDL 5CD5D 4R8WL 2F19H 5DUBB 2X9YA 2Y06L 3SE8H 3PGDA 1S7RA 1MCLA 4JRYA 2APBA 1KBGL 3SY0B 3H0TA 5IHZA 3OZ9L 2X44D 1R3HA 3FMGH 1CL7H 1OAZL 2YUVA 4P4KB 5A2FA 4KRPB 3S5LG 2OXGA 4Z77A 2PO6C 3WUWB 1N0XH 5IBUB 3V4UH 3GBMH 4WUUB 1JHLH 2IAMC 4KROD 4KVCL 4PP2A 4F7TA 1QHPA 4FABH 2VITA 3DRQA 3N06B 1BEYH 4S1SL 5TE7L 3MRJA 3FQWA 3RA7H 3W0WD 1W0WB 1Y0LA 2ZKHL 4LSRL 3QO1A 4LRIC 1IAIL 4JFXB 1RSFA 5IROC 4LU5H 3LKSB 2W92A 43C9A 1G7QA 4LASH 1MCPH 4JG1L 4KHTL 4BH7A 1E6JH 4XZUA 5DJYB 1BFOA 3OF6D 1FG2B 4PD4K 4PG2A 5I75C 2QBWA 4OD2B 7FABL 1OSZB 5AZ2H 4MA3A 4HUVA 3D0LA 2MCPL 2K7PA 3IDGA 2PCPA 4G6JH 2HT2D 4WUKH 1GOFA 1IT9H 5EUOF 3CMOH 1ZLSL 1NBVL 4JPWH 4ZQKA 4M8VA 1YNTA 3DVNA 1B6DA 4FXKA 3UTSE 5IFJA 1RV6X 2PYEB 35C8L 4OZIF 1FVDA 1YEJH 5DD0H 3TJEH 3KPRD 4OCYH 4GBXC 3I3EA 1S9YA 3V4PL 3HUJB 4BSVB 1AGEB 5EC1B 2HFEA 1I85A 3HE7C 3CX5J 1AXSB 1QVOA 5IW6B 5BVJB 4NQTA 3MCKB 2F9BT 2HVKB 4M48L 5F8RC 2V2TB 4PTUB 3EDDA 2C5DC 1WBYB 1TQBC 1L7TH 2LU7A 2YRZA 4Q58C 3GMNA 3BP5B 2PW1A 2FATL 1G7IA 1YZZA 4YDKH 3IKCB 5F9WC 4ESKA 4MNHB 5T1KA 4JM4H 2GY7B 3MGOB 1F02I 1K3ZA 1RUML 3QUXD 5E08L 1OWRM 1WT5C 1NCDH 1OM3H 1LILA 1RULH 1A5FH 5BS0A 1U92B 3BT2H 4M7ZB 1JHTA 5KS9B 1LMKA 4XCEA 3V5DA 2DLFL 1CD8A 2FEDD 2O5YL 4TUJB 3U0TA 3LKNA 2VLJA 1SVCP 1MFAL 4X80L 4R96A 3VWKA 3VDAA 1DN2A 2NNAA 3OB0H 5C07B 3DYOA 3DVIA 3L3OB 2NTFA 3O6MH 1MCBA 3T3ME 1MREH 3BGFB 2GAZB 3TO4B 3MRKB 2AKRA 3KYKL 2O5ZH 2BC4B 2X4PB 1AGBA 1IQWL 5DMGD 3O4LA 5BV7B 3LQZA 4B7LA 5AAWA 1GGYA 4XX1G 5K9OB 1J0IA 1XGTA 4MQ7B 5E4EB 3SGJA 3RUGA 2R2HB 4MDIB 2ITDB 4WFHD 3UC0L 1HYSD 3PWLA 3ILPA 2ZSVA 1INEL 5EZLB 2AXGB 2JJTC 2YSSA 3MRRB 5IHUL 5FYLE 3HRPA 2X4OA 4LKXA 1QFUH 2WBJA 4WW2B 1IBGL 1V7NH 3TIDB 4PY8I 4XNYH 3AVEA 5LGJA 5SX4H 1WWWX 4NUJA 3UPRB 4GW1B 2I5YL 4JKKA 1IVLA 1KCSH 4K9EC 3JWDL 1BD2A 3FQRA 2JB6B 2C4XA 4PB9H 1FE8L 4Z7UE 3FJTA 3VXUB 4PV8B 5JW3L 4OI8A 2W60B 1FCCA 1B0GB 2HT3D 2NXZC 2Q7YA 2YS4A 1KJ2B 5IK3A 1KEGL 4WCYH 4MJIA 3HR5A 1ZLWK 4OLUH 4ORZC 3OL2A 4MMZC 5B3NA 1SYSB 2VISB 5I8OL 1KLFA 4IOIB 1DQQB 2YKLL 4FFYH 3O6FD 4YDLC 4PV9A 4Z7QE 3E8UL 2COQA 4N1CA 4GRLC 5DMIL 5EA0L 2NY6B 2P46B 4C54A 3I9GH 2IGFH 5GRZA 2UWEB 3MOBH 3CSBA 5C0GB 2HG5A 4ZSOE 2AVGA 3WV0A 4JFHE 1GRWA 1NC2D 4XP6H 1OQOA 5JDSB 1CXIA 4Y19A 1UCBH 4FTVD 1XGRA 2J8UB 2R23A 4PJAF 1KTDB 1C12A 2JB5L 4D9QD 4P3WA 3EBAA 2NY7L 4XP9H 1P2CA 2H9GB 3CK0H 4YK4C 5T1MB 3ZO0A 4HG4K 4YHIA 5DRWB 4OIIL 1H3VA 1ZVSA 3DRTA 3LRGA 4DVRH 3LZFH 1TZHA 3TCXA 4NQDE 3NABL 3KR3H 4WDIB 2G2RA 2FIKA 3BUTA 2E27H 3U7YH 5IBTL 4YR6A 2X70B 4LLQB 5FHAL 4LHQB 4YE4H 3L5IA 1RU9H 2F8XC 3ALWA 3TZVA 2BNRB 3GUTB 3KLHD 4R97B 3QIWB 3MNVB 2XWBB 4X4XB 2Y25A 4X5WB 4ZUTA 2XA8H 3PWVA 4QRUB 5ANMB 4NKIL 3QIBC 2FJGA 4PS4L 2VDNH 2VOTA 3G9AB 4L5FH 4OF5A 1CTNA 3GRWA 1JMZA 1CN4A 4GAYB 1IM3A 1X5YA 5E8NA 1G7MA 1U2CA 2CK0H 2Y9RT 5A40E 1RZKC 2J12B 1N5YH 3HNVH 3X3FH 3L3HA 1SJHA 5I1JL 1V3KA 4PR5B 1YEHL 3D3VD 1K4DB 4H5SB 4RZCB 5T1DL 1F97A 2GJJA 3MV8D 4TUKL 1QPXA 1V3JA 4BFBD 2GK0A 5E6ID 2Y23A 1I1FA 2DYPD 4JZOA 4G6KH 4Z5RB 4LRNL 3MPCA 2LV4A 1OAQH 2CXKA 2FWOA 3DV4B 5L2JA 1MRFL 4ZOAA 1U42A 3GEWB 4HC1L 1T1WA 1A7OH 3ARBA 5DVLA 1Q0YL 2MOVA 3ARPA 1AGCA 3SDDD 3SDCA 2PW2B 3GSNH 5IQ9A 3U1SL 5KVDH 3SPVB 3NZ8A 5HYEA 1DBJH 3RWDB 1JNLH 3T8XA 4J6RH 3O3BA 1T1YB 3ZDXE 4D0CA 3HE6D 3IDMB 4NO0B 3GBLA 1Q38A 4JFFB 1CD1A 4KJQD 4KXZH 4IRJC 4NOFA 1X5LA 2EDHA 4YHKH 2C1OB 3O6KL 1J8HB 3NPZB 3C87A 4PJFF 3S37H 5F9DC 3NCBB 5KVMC 1INQA 4AJ0A 3LKRA 1ZV5A 4M4PA 2AI0H 1A0QH 4C56A 2IFFL 4PJEA 5HGHB 3DUUA 5LWYL 2R4SL 4OFVA 4BUGA 4JVUA 5ILTL 2WWKO 1HQRB 2GW5A 4YNYB 3W9DA 4OLYH 4YHNA 4FQHB 3DXAB 1MJUL 4P3DA 3UTZA 4H0GA 2F8VA 4L4TA 3CCHA 1F2XK 4KI5D 4M6MH 4G6FB 4YDVB 5C0IA 1F3DH 1O7VA 1IZKA 4G9FD 4O2EA 5C08E 1TJHL 4K7PL 3GO1H 1LK2B 4ZAKB 3H9SA 1CXFA 4LCUB 4HUNB 1RUPL 4PREB 2ADGA 4TSAL 4U1IB 1L0YA 5D7JB 1JZ5A 5B22A 4M93B 3V0AC 5ETUA 1KJMA 5TE4L 4C83B 2DQUH 2VXUH 3QDGA 1KLUA 4X6FA 3IFOA 3MA7A 1K2DA 2FLRT 3QDMD 5C0CB 1A3LL 3E6HB 1IAII 1YEIH 3MJ7B 4HIEA 3RKDC 4LBEA 1DBBH 3FN0L 4EXPX 3SGKA 5D96B 5MEND 5JHDB 1A7NL 1ND0A 1NEZA 1TZIB 4RWHA 5HVWA 1AH1A 3B9KD 2A9NL 1MHPL 2OS7A 3SDAB 2AK4A 2G5RA 1T2QL 4TVSa 1IEBB 3TN0B 1IC4H 3WE6A 3WIFA 3UAJD 1UB5B 3LD8B 5FECB 4QHNA 3NVQA 3IU3A 3BVNA 5E2UH 4YHMH 3S5LA 3GMRB 5MERB 1GXEA 4OCWH 1T2JA 3K1KC 2F53D 4BQ9A 5CZVL 4GLRH 1BHGA 3ARYA 3RUGF 3BO8B 4G8GD 2D7PA 4P4RA 4LLWB 4G6ML 4S2SB 1U8OB 4LHJB 4DAGL 5BOZG 3IXTB 2OJZH 2NXYB 1QO3B 4KAQL 1RIUH 3NH7L 3OJDB 4S11A 1AC0A 1CFNB 2BVTA 4HWZB 5INDB 3NFNB 3U0WH 4AEIL 4IOSD 5KW9H 1U8IA 1PJ9A 4ZOBA 5HHMD 4N0UA 2FBJL 4JFPA 3UZEA 5CINL 4E0RA 4PRNA 4IRSA 5D6CA 4PLOB 1I4FA 3FHQA 4QHUB 1XGYH 1I1YA 3HI1A 5EC2A 4Q9RL 1BP3B 1IGYA 5HGBB 4OCRL 4MA8H 2DTML 1KIPA 4NQEE 4JDZA 1AD0B 4MMXC 3KYOB 2X4RA 5F7FA 2KZWA 1WWAX 1VGKB 5B8CC 1W72B 3WNNA 4LCWA 1S9VA 3QIUC 5KVFH 4JM2F 5HVHC 5FUZH 1I9IH 4LL9A 4WI2A 3RHWF 2F58H 3T4YB 1A1MA 3L1OL 3CFEB 1FV1B 4NO2B 4G9DA 4OLZL 4MHHG 1JV5A 2CLVB 3CAFA 3O9WB 4KQ3H 1FGVL 3V6OC 4QCIB 1D9KB 5DK0A 1BVKA 3QR2A 4PRBB 3DO7A 4LLDB 3I6KA 4X8JB 2NPLX 2ATPB 2FD6H 5F3BB 5C6PB 1RZ7L 4LARL 2ID5A 3VFTA 4MHHI 4ZO9A 3RHWK 5EU6D 2C7UA 4HXAL 1CVSC 4YXKL 1CXLA 5IVZB 2ZOKB 4Y2OA 4MVBC 1VPOL 3R8BB 4U6YB 3QEUA 2J5LB 3B3IA 5KN5A 2JIXD 4W70A 3PJSA 2NX5A 1XF2B 3MLYH 1OGAE 2P24B 4OGYH 4YHPB 1RJZB 4U1MB 1GHFL 3NAAL 2OYPA 4Q9QH 2SEBB 3CVHL 2ESVA 2BJML 1XCTA 3P9LB 4JPVL 3F6IA 1N6QL 1PKQE 1LD9B 2YN5A 4OLXL 3AREB 4BFIA 1TPXB 3GIVB 1ZGLM 3QEQA 2ADIB 2PXYC 4APQD 1HHGA 3LPGA 4PJCE 3DMMB 3FFCB 3B2VH 1JTOA 3O3DB 3PV6B 2KUTA 3PHSA 1TJGL 5IB2A 2HFGH 3EJJX 1F4XL 1X5XA 2QQNH 5INCB 4YHLL 3F6LA 3V7AE 3C6SA 3D48R 1KC5L 5IEKA 3HMXH 1PG7H 3NIGF 4NRZA 2FX7L 1AO7A 2C9AA 2BNQB 3QUMB 3BGMA 1DE4B 4KK5C 4XCFH 4WFED 3NCCB 4OCSH 2EYSB 5T3ZL 1XF5B 5FYJU 4LSQL 1OAUH 4Q6IA 4QKXB 2E6PA 2DL2A 1J18A 5IMKA 4YZFF 2F74B 2GJ6E 4NN7C 4AL8H 4OI9A 1AHWC 1HQ4B 1ZK9A 1ZGLP 4L8BB 5L9DH 5DRZA 4MJ6A 1M05B 4HS3B 4Q97A 4NKMB 4X6DE 3T0EB 3TBTA 5SWZB 3BKCL 4PY8J 4NKDA 3ZT5A 1Q9OA 4WV1B 1E27B 1SBSL 2X4QA 4I18A 2GTZA 4X6CE 3VE0B 3T2OA 5D7IE 3TCLB 3IYLW 4U6XB 1ZT4B 4OD2A 3TYGL 3IDJA 1IM9A 3SJVB 5MP6L 3R1GH 5GGVY 3VXRB 1T03H 4M03A 1B4JH 3RGVD 4XC1L 1KCUL 4MCZB 4RFOH 5ICXB 4RFNC 3EOBB 3QAZB 4V1DD 1S5HB 3BP4B 1CIDA 4X6EB 1LP9A 4X5LA 5HI4D 3SKUD 3NGBC 2LFGA 1WWCA 5EU5A 2E7MA 2FGWL 4YBQC 5GS0H 3MV7D 2BOBB 1AD9A 3C8KA 3BE1L 2Y36H 3NIDF 1OCWH 4OKDA 2WSKA 4PRHB 3SCMC 4NQCB 3HUJA 2GI7A 4BSVA 5DJAA 4PJEF 3KAAA 5EZJB 1BJ1H 1S7UB 3BWAA 4XVTH 4PJ7B 4HJJH 2D9QB 4KDTC 1MCOL 1KB9J 4DTGL 4GKNA 3K8MA 3DETD 1WBYA 4HXBH 5DVKA 2CKBB 1L4IA 5D1QB 1FFNB 5GGRA 3VFNB 4ODTL 1DBAH 4BJLA 3ARFA 1XR8B 5DRNB 1ZLWH 4M00A 1HH9A 1GC1L 1YEKH 4AIOA 3MBED 4GKSA 2YD5A 3LN5A 3EOAA 4MXQD 1R5VA 5DJXA 5B39B 2HA1A 4I3SH 1FZOB 4OZHA 5DYOB 5F7NC 1CFTA 3RFZC 3O2DA 2Y5TB 4GO6B 3GSVB 4LK4A 5CZXC 5CEZE 2AJZB 5E7BA 2OR8A 5C0DA 3IFPB 4AMKL 4FQ1L 3OQ3B 4C4KT 3B6SB 3HC4H 3G5XB 1QBLL 1D5ZA 3ULUL 5GZOD 3S35L 5K9OA 4WHCA 3BSZL 1IAKB 2Z91B 4F37F 1EMTL 3QXAA 4R4FL 1CGSL 4NIKB 5GSVB 4HIHA 3RZCD 2HT4D 4QEGA 2F54B 5DRXB 4Z0BL 1UGNA 3ELAT 3MRHA 5DURB 2LAAA 3V6OE 1XIWB 3U4BH 4KKCC 3GSWB 1LNUA 2OI9C 5D1XB 1BVLB 4ZXBC 2NY3D 4HUMB 5DHYA 3CVHB 2VLMD 1KOAA 3RL1A 3SO3C 1N4XL 5GIRA 3DVFA 3QT2A 5T1LB 1KCVH 1KFAH 4F37K 2EZ0D 3EO1B 4LIQL 4EOWH 3BZFB 5EU4A 4S10A 1JP5A 4Y4FD 5BW7A 3FHAA 3RPKA 5IB3B 3LQMA 5KSAC 1T5WB 3HB3D 1CFVL 3PHOA 5I1GH 5IR1A 3S96A 5CP7A 2KBGA 4M62H 4F3FB 1SYSA 1SVZA 1WEJL 5D7KD 4JRXD 4QHMB 4YQXH 4JPIA 4P23C 4F8TA 4N0FB 4HCRH 4OT1L 3S3JA 3OKDB 4ZUVB 3LVEA 3EYOA 3ARRA 1DDHB 1PLGH 2IH1B 4MLIA 3N1MC 1A6UL 1V8HA 3MQIA 4Y4KA 5CJXC 2CDEA 3HMWL 5BRZB 4WFGE 2XPGA 4RDQG 2BCKA 3CZFA 1CLYL 3MA9H 4GG6A 3KLAA 5IJKC 4DFIA 1A9EB 4FG6D 4KQ4L 4HKJB 5ENWB 3UTOA 3DUHA 3B2UC 4WTWA 1LWRA 5C0RL 1E28B 2P5WB 5KG9A 2AJYL 3VXMA 1NFDB 1DUZA 2VKWA 5IB5A 3OG4B 5LJYH 1UWXK 3EO9L 5DQJA 4ZNCD 3V5KB 5CCKL 1S9WA 1MJ7L 3V6FB 5I8EB 4RX4D 1MEXH 2BRRH 1BJ8A 3QP3A 5GRUL 4PFEA 1N6UA 3C6LC 1JN6A 1I1AC 4MNQE 3OB8A 5MEPA 3WNMA 1E4WH 4XI5C 2I9TB 5D71L 1A6VH 3LPWA 4JVWA 5J6HB 4HBQA 1W2KT 5KVGH 2XN9D 2WWMD 3MNVA 5HYJB 5JHLH 5GS0D 4KMQA 5T3XE 5FOJA 2DM4A 4Q9BA 1FYTA 2R0WH 3NCYP 4HKXB 4QRTB 4RGNB 1CFQA 3CFDB 2BSSB 2VL5A 4QRUA 5DHVA 4GW4B 5HI5D 3HG1D 4I0PD 5FO8B 4KY1H 1JK8A 4ZUWB 5I30H 1JHKL 3QNYB 4KJYB 5D5MF 3IGAA 4F7MB 3NCFB 1T66C 2DQGH 4X4YA 5K9KA 1WC7B 1NMCB 1BQHG 4P2QD 4Y1AD 4JHZA 1NBYB 3QFJE 1GIGH 1T2XA 5TPWL 4X9FA 1J5OH 4Z7WB 5F96L 1U41A 5I9QB 3WFDL 3X14B 4URTB 3Q6FB 4L9DA 2OP4L 1JF1A 2L0DA 3L95A 1NGYB 1YQ2A 2FX9H 2GSIA 2ZCHH 4KI1A 4NCDA 1PEWA 1AXTL 1CFBA 5E2TL 3WN5B 3TVMA 4OZIE 4U05A 3WSQH 1G9NH 1J86A 2DMKA 1NH6A 2PW2A 2VUOA 3VH8G 3ZTNH 3BEVA 3MLVL 3FQNB 4HWBL 5F7DA 3G6JA 2MKWA 2VLLB 2EE6A 1CGYA 4EVNA 2ENSA 3CH1A 5HTSA 3MRPA 4GMTH 3WS3B 3ZDZE 4P2CG 3W39A 5BZDA 1LE9A 2X9XA 1CLOL 3B4NA 4LSUL 4TULL 4QXTB 4YDJB 1FFPB 2J6EH 1AY1L 2NQCA 3QHFH 2OX5A 3ZKMD 2CDGB 3QQ4A 4FP8H 4LEOB 4M1DH 4QRPB 4TUOB 5EIIB 1CICB 2YMXL 2OR9H 5IVOA 3VRLE 5IBLD 3CDFA 4PRPB 5AEAA 4P59L 1DQJA 4QRRA 3RDTD 1DJSA 5J3HC 1T21B 5F7EH 1YECL 4F33A 5E99L 3OHXA 4LPUA 4PGEB 2DQTL 4PJGB 3V0WH 3WS6A 4XPGL 3VU2A 1HN1A 3QA3A 2W38A 4XVJL 4EDWL 5IMLA 2UUDK 3O8XD 5ISZB 4PG2C 2CPCA 2XV6B 4IMLA 2QTEA 4HIJB 1V3LA 4Q0XH 2Z92A 4HBCH 4NRYB 3Q48A 4I1NB 5D9SB 2YEZB 2VZ1A 3MXWH 1QSEE 4PG9A 5GZND 5HHVH 1I8LA 5GGTH 4G8EA 3WUZA 1DL7L 3HUJF 1IGMH 5GXBB 4L29B 1NCAH 1HHHA 2GCYA 2X10A 3WFZA 1YEGH 5C7XH 4CU8A 5A1AA 4PRID 5HHOA 2H26B 1ZANH 3Q5TA 5C0CA 4CVZB 1CDIA 4UDUA 3OXSA 4EIZC 1SY6H 5L7XH 1YN7A 3GMMA 2D03H 3WKNA 1I85C 3ROLA 3I2CL 4QY8B 3P4NA 5EH1A 3NCMA 4UB0L 4L4VB 4BZ1L 3I50H 4YX2H 2P4AB 1MH5B 2AEPL 1PSKH 1VACB 2BZDA 5FFLA 1HXMB 3QCTH 4Z7VE 3AGVA 3P9MB 2W1NA 3SDAA 2VLKA 3X11B 4OM1L 1IKFH 4FFWC 3T3PF 1OY3B 2G60L 4X7SH 3PL6B 1FL6B 1UJ3A 2XTJB 3RWJB 3MLUH 3WBDA 1YY8B 5IJVB 5EBMA 1RUKH 2ORBL 3ARVA 3Q3GA 5GJSL 2FJFB 3GMRA 4KUZL 3OKKA 2J8HA 1MFNA 4YH6A 3VWKC 2W9EL 1Z5LB 3OTTA 4OF8A 3EZ8A 3BO8A 1A7PH 1S78C 2YR3A 1F6AB 2APWA 5D7LB 1KJVB 1QO3A 2OL3H 5JW4R 1Q1JH 3UTSD 2MPAL 4Y2DD 3SGJC 4PJAE 3L3JB 1K9TA 2A77L 2GITA 4P5KA 1IGIL 5H37G 2XZQL 1EAPA 3V95A 2D7MA 1EXUA 4NYLB 5C0AD 4XRCA 1KT2A 2IPTH 1A6AA 4MS8C 2FB4L 1JZ4A 1S7VA 1HINL 2G75B 2WBJC 3C08H 4R4BB 4MSWB 3FOMB 5FO7A 1UXSB 2APXA 5JIKA 5JQ6L 5EG6C 5EULV 4YFLI 1QKZH 4ELMA 4EDXB 3NFSH 4O9HH 1WFOA 3BKMH 3ZTJG 1YPZB 2ARWA 3R06A 4ODWA 1NLBL 3UJJH 5CILH 4NO2A 4EUPG 2N7BA 5DFWH 5EZOL 3STLA 1HHKA 4P9HC 4XMLH 4BYHA 5KSBB 4LDLB 1C1EL 1ZA3A 2JF1A 1QLFA 1R3LA 2VAAB 4RGMB 4LNRA 4R90H 3BKYH 1U3ZA 4G42A 4PRBA 5F21B 2RJMA 4LMQE 2UWEF 1LEKB 3U7AA 3UYOD 4FQIH 3OKMB 2ADFH 4JE4B 2GT9A 1CLZL 4L3EA 4TYUA 5DZNA 4M9OA 3D2UB 4OLWH 1T1ZA 4ONFH 4TPRL 4OD1L 4U7SA 2OR7A 5JIHA 4PJ8A 2J8UF 1NBZA 5CBAB 3SE8L 3HZYA 4PLJD 1UZ8B 3I3DA 3PDOA 4YEEA 5GISL 3O2VL 4J4PA 5FDYA 1ZTXH 1CL7L 5JXEA 3ARDA 4DGVH 3QI9A 4DK6A 1BLNA 5IW3A 5J56B 1V7ML 3FB6A 3V4UL 2OQJA 4D9LL 2YN3A 3GBML 2YBRB 4FZEH 4BZYA 5F88B 1JHLL 5K33A 2DQIH 2EKSB 4YJZL 1BIHA 4FABL 4RQQA 5IGXH 3VWJA 1J0JA 3P73A 1BEYL 3BZ4B 3RA7L 4LAQH 4WGVB 3W9EA 2XWTA 2B4CL 4LU5L 3D85D 1FP5A 1VGEH 4FQXB 1CXEA 1MCPL 3TBYB 1G7PB 1E6JL 5EFIB 1GGBH 3G5YB 5D93C 2E7LA 1QRND 5AZ2L 3MYJB 3TZVC 4M3KB 3T1WA 4G6JL 2EDEA 2R56H 3MRDA 4WUKL 3CU7A 1MHHA 4MXVF 1MVFA 1XGQA 3CMOL 4OF3A 4JPWL 2A73B 4P57B 5E2VH 4PRDB 3FT2B 2GUOB 4U7MA 5TFSL 4K9EH 3MROB 3MOQA 1NBQA 3T65A 4X9BA 3RNKA 4H25B 1YEJL 4YDIH 3T1FB 3KPSB 4OCYL 2PUQT 2CK2A 4PBXA 4N1EA 2WZPD 5GGVH 1HQ4A 3SDXB 4XBGB 4L9LB 5DC0A 1DQTA 3T0BA 5C0BB 4ZD3H 3L3GB 3UO1H 2A0LC 6FABH 4J3XA 5F6IB 2JCCA 4Z0XA 2VMFA 3E0GA 1L7TL 4LCIH 5C70A 1A02N 1U8KB 3QUZB 4YDKL 4B41A 4JM4L 1UC6A 1IC7H 1HOCB 1OGTB 1DSFH 1KPRA 5EO1B 1HH6A 1N8ZB 4FXLA 2WUCH 3QXDA 4JM2D 2PO6D 3ARBC 1OM3L 1RULL 1UCTA 1A5FL 1VFAB 3SDCC 3BT2L 4RMQA 1P7QD 4AM0A 3EW3B 3LKOB 4F7CA 4RA0C 3JZ7A 5C6TH 4J7RA 2IH3A 3BQUD 4I48A 4NSKA 3O45B 3L5JA 1BX2A 2PN5A 3O6ML 4DOHE 1MY5A 5IOPA 3F7QA 1ZHNB 5E9DA 1E4XI 3QUYB 2C3GA 1CGWA 5ALCL 2FSEB 2X4NA 3FQXB 1Q9WB 5ESQB 3LCYA 2VLJE 3L6FA 5JPMA 4ETQB 4NPYB 5HHQA 5DMJB 3QQ3B 3RVTD 1A1OA 1QP1A 4KK8D 4WWKD 3MRNB 4KPHH 4UOJA 3L3IB 3QH3A 4BM7A 3O4LE 2A9ML 1QFUL 1XF1A 1KCLA 1V7NL 3GJEB 4P5TA 1U9KA 5HBBA 1RZGB 3RUGE 3MJ8B 3QJFB 5C9KA 4HQQH 5B38G 1KCSL 3WIHA 1MCWM 3JSSA 2IPKB 5FGRA 5JZ7D 1GZPA 1BREA 1V5JA 1YY9C 3MREA 1U3HA 5A2KH 1JWSB 5DHXB 5D2NA 4WCYL 5ESAB 5CIPA 5HHNA 1J1XH 2C3VB 4OLUL 4K71B 1BQHA 1RZKH 5I2IA 1XR9B 2N1KA 1BD2E 4NM8L 1J05B 2QV2A 5FYJL 4KTEH 4FFYL 4R6UA 4UV7H 1OP5H 4OZ4A 4KDVA 4DGIH 4HUWB 3FCTA 1MAJA 4QNPE 3SGKC 1EVUA 4MJIE 1EEUA 4RFEA 1MAKA 2QSTA 3C60D 3LV3A 1UWXH 3I9GL 2IGFL 3MOBL 3ZE1F 1U8LB 1I9JH 3VDBA 1G7HA 4NKQB 4MA1B 5ITFA 1X4XA 2B1HL 4QOKB 3VH8A 1B88A 5GS1B 1UCBL 2AJSL 2AJVL 4ISVA 1KTLA 4FTVB 4RMRA 5AYQA 3N1QC 2P45B 3EO1A 4JQIH 4X7DC 5HYQB 2CLRA 4XP9L 3BZFA 3CK0L 3WFCH 4ZFFA 3TFKC 2ARJB 3DPBA 2DIJA 4CADA 3FQUA 4DVRL 2P5ED 2R29H 3LZFL 4OCNC 4K7FB 4NWTH 5E6YA 4Y19E 2X4TA 4LVEA 3RVXC 1FNEA 2BHZA 2YPLD 2E27L 1MLBA 2VZSA 5KTEH 3U7YL 3M45A 1U95A 1ORSA 1HZHL 1LK3H 3OKDA 4MA7L 4YE4L 4JJHA 1RU9L 4WO4B 4G80B 4Q2ZB 1NCTA 1CS6A 1ORQB 3O11B 3H3PH 4IRSC 4I3RH 5ALBH 4JPKH 1P4IH 5L0QC 4UBDD 3ESUF 2CR6A 2XA8L 4NCC1 4NHUB 4K94C 1OAYH 2P49B 1R3JA 5DR5H 2VDNL 4L5FL 2WP3T 3X12A 3DSFH 2R4RL 2CK0L 1U58A 1KTKE 3LB6C 2ZPKH 1UWGH 2PKDA 5F9AC 3WDHA 5C0EA 1N5YL 3HNVL 1MCRA 4P2RA 3X3FL 4EEEA 4WEUD 1PG7X 1DTUA 1N7ML 5C09A 5TGBA 2WINB 3MFFB 4LHUB 1OOAA 3C2AH 4NN6C 1FBIH 3GJFA 3CSYB 5FA4B 4I2XA 1MCNA 5GHWH 4TVPH 1HYRC 1NGPH 4G6KL 2QADB 3H3KA 3K81A 5I74B 2DYPB 3U4EB 5ACLA 5IVNA 1VKXA 5DJ2B 1OAQL 3AROA 4DZBB 3BIKB 5HYJA 1A7OL 2D4FA 3ARGA 4Y5XA 3GSNL 3RU8H 1MUJA 5KVDL 1OF2A 3DX9B 4Y16D 5DA4A 1BM3L 3CIQA 1DBJL 2WUBH 4JZJA 3U46B 1TTFA 3MBXH 3C9NA 1KLGA 5FDWA 3QJHB 1JNLL 4LGRB 3TNMA 4J6RL 3MRGB 1WJ3A 1KYOJ 1ZA6A 3VFMB 3HS0A 1MI5A 5EO9A 4PGJA 5FF6A 5I66B 4AIXA 4N8VB 3EJZD 4PGZA 4N0CC 1MHEA 3S4SG 4YGVA 3SKOB 2UUDH 1JZ6A 1EH9A 4YHKL 4JHWH 1A3RH 4HH9A 3S37L 2NW2B 5DQDH 2B5IC 3U9UB 4Z7WA 3G04B 1ZVYA 1EBPA 2AI0L 3D0VA 4LVHB 4N68A 3WN5A 4Z18A 3KXFA 1CG9A 5F1OB 3LRHA 3EFFA 3IXAA 1A4KA 3RWFB 1G1YA 3F65A 3NIDE 3RPIA 4F9PA 3RTQB 3V4VH 4MYWB 4M6ML 4C56E 3GMPB 4PJEE 2IADB 5FXCH 4MJ2A 2QKIA 4EN3A 1CL7I 4G9FB 1N5AA 2R69H 3GO1L 3B8YA 4P5MB 2CJUH 3FO2B 4JO2H 1J0YA 4IOFC 4Q6IC 5HDBF 3MLXH 3JVGA 3KS0J 3V5HB 1Q9LB 2IAND 1ZHKB 4W68A 3QDJB 2Q1EA 3RWIA 2DQUL 4S1DD 2I9LA 2VLRD 2P8LA 2JCCF 4EUPA 2FH6A 3SOBL 4KFZC 1YEIL 3UTTB 3DTXB 5F7HA 1ZGLB 5LQBH 5JXAH 5JMRA 1HCFX 4HK3J 2X09A 3QQ9D 3H9SE 5ECJE 4HIIA 1YMMA 4NZUH 4YBHA 3ES6A 3F7PC 1DLFH 5L2KD 3RIFF 5EN2A 5FYKH 3EO0B 1SJEB 2EO9A 4PJHB 3QDGE 4I18C 3T2NH 3QWRA 4JFEA 2V7HB 3UTPD 3I85A 3SHSA 2EYTB 3IU4H 1IC4L 4U1JB 2FO4B 3ZL4H 1BZQK 1TQCC 3RL2B 3JV4B 1EVTC 1YEFH 4B5EA 2Y5EA 1CF8H 2DLIA 3UCRA 3NN8B 1AE6L 1NGQH 4PJ5B 5TF0A 5SWSD 5E2UL 43CAA 4YHML 1AP2A 3RVWC 1S9XB 2AK4E 2CSPA 5DJZB 5BV7H 1NCUA 1FJ1A 3EOYG 2BSTB 3JV0A 1ES0A 4PJ7F 1FQ9C 1D7FA 4U0RB 1BBJB 4X99B 4CVZA 5IIEA 3D39D 1G0YR 5EZIL 4FN0A 5EOQH 2W0KA 4UT9H 1RIUL 1B0WA 2Z0BA 5CEYA 2ZSWB 1RZ8B 3ROOA 3U0WL 1ZHBA 4Y4HD 5KW9L 1LO5A 5H8DA 3REWB 4CW1B 1UQSB 4XCNB 1G7LA 4IDLA 4L8DB 2X9WA 3EYSH 3VI4E 4W4NA 4P2OA 5DTFA 5B4MC 1XGYL 4G7YH 3MUHL 1XH3B 4ZYKA 5E8OA 3K3QA 3ARFC 2DAVA 1EFQA 2W9DH 2BK8A 3JTTA 4ODVH 3KNBB 4EI5D 1FLRL 4N0UE 4U1NA 3B5TA 2XFXB 3CFKB 5FUZL 1I7ZB 3RKDD 1IEAA 4JFYA 2V5MA 2F58L 2EIDA 3O3EB 2N56A 5CSZA 4TVPD 3P4MB 1ZE3C 4XPHL 3LEVH 4G8IB 5I17A 2W65A 4XPTH 2XQYK 2HN7B 4R8WH 2EDYA 1JI2A 4KQ3L 3OR7B 5DUMH 1CDGA 4CNIA 4LCWE 3OZ9H 4P4KD 3A0OA 3L3JA 4KRPD 5ID1A 5GRYA 4E41B 4ZTOL 1HNFA 2CDFB 3CLFH 1KB5A 1I8IB 4ENEC 2ZG2A 4MJ5B 3V7MA 1X4YA 2V7NA 2CLZA 2Z8WC 5SX4I 4JGJA 4R4BA 3O3AB 3FRUA 4U1SB 4LSRH 3VXSA 3MLYL 2IEPA 4NBXB 5TH2B 4Q9QL 2EE3A 2NR6D 1HILB 3LSOB 5D2LA 1YJDC 2O5XL 2BXYA 1JUFA 3BDBA 3WFEH 3DROB 1JNHB 3BI9X 4LLUB 2CH8A 3MR9B 5BW7C 4U1HA 1NDMB 1A7RH 2YZ8A 1NGXA 1MCHA 3IJSA 3KPLA 3UZQA 3B2VL 5F7YC 1EV2E 2BY3A 2NY5H 2E9JA 2OSLA 2Q8BL 2ESVE 3WHE0 2YHGA 4M1CC 3ZKSD 5IB1B 2HFGL 2PYED 1OARH 4AENB 2OZ4A 1QSVA 4QGTA 4O2CB 1NUFA 3VFUA 4HWBA 3QEQE 4OLVH 4PGDB 1DANT 3HMXL 3NBNA 2HTLC 1PG7L 3Q1SH 3LOWA 4Y4KC 1M7DB 3V4PH 1GCFA 4XX1E 3QDHA 4XCFL 1S8DA 4OCSL 1NFDF 4L3AA 1SYVB 3JWOH 2MNUA 5B38A 4UUJA 1OAUL 3AU1A 1FCGA 3PWPB 1PZ5B 1UXWB 3WKMH 2NYYC 2OMBA 3ILQD 3L5XH 1AO7E 3GB7A 2H32A 3RVVC 2FATH 4X5XB 4AL8L 4J8RB 4GRWF 5FYKD 5CEXA 1HHIB 1J0HA 4JLRA 5E8PB 5GRXG 5L9DL 3W0WA 1ITBB 2XZCH 1Y18A 3BH9A 4LGPB 5HHPA 1MCWW 5JIPA 1K8IA 2Y7QA 5CD3B 2JJWA 1BZ9B 3U48A 3LH2L 1PQZA 1PVHA 5B21A 5C07D 1MWAB 3ESVF 1MFAH 5CHNA 4X0KA 1TCRB 3OF6A 2AQ2A 4NDMA 5IHLB 3TO4D 1NEUA 1Q0XH 2VQ1B 1T03L 4CMHB 1B4JL 4RFOL 5HI3C 1RQ5A 3EYVA 5J0BA 1A1NB 1AQDA 3QQNA 3TYFB 5F1SA 4RMTA 1U8PB 4V1DB 3H7BB 4MD5B 2KQNA 4IS6B 1J9CT 2QQLH 1YNKH 5GS0L 3T0VA 1I8MB 1HIMH 4GKOA 3MV7B 1INEH 2Y36L 3CXDH 3KPRA 4XCYB 3WIIL 1F13A 4Z7WF 2ICEA 1BIIB 1LP9E 3BN9D 4OGXH 3FZUD 1JWUA 4P46D 2BY0A 4XVTL 5CGYD 4HJJL 4JGMA 5KVEH 1JFQL 4KV5F 5E8EA 4MWFB 1NGZB 3VXUD 4N5EC 4YFLF 4U1GC 4FQCH 5JW3H 3ETBF 4HXBL 3HUJE 2L7UA 3BX7C 1KN2H 3G5VB 3TVMC 2WQRA 2M2DA 4F7PA 1DBAL 2APVA 1S7SB 1KEGH 3GSUA 1E4JA 3QUXA 5IVXA 3AC0A 1WZ1L 3ULUF 1YEKL 2BVOA 3VMPA 2PYFB 4HH8A 8FABA 1HK6A 5F3HB 3TIEB 3LKOA 1RIVH 1JGDA 5FO9A 1PKOA 1S7XA 1FIEA 1RD6A 2NY6D 2VE6B 5DMIH 4NO3A 4KXZI 3BHBB 4JFDB 4YHYC 3HC4L 2D7OA 1OB1B 1QZ1A 3W5MA 2EDTA 4N90D 4LCCA 1TNMA 5LGHH 3T3PE 4UINH 3RWEB 2NZ9C 4OZHE 1IGTB 1RJLA 1RIHH 5AUMA 1SEBA 3S98A 3PIQA 4HDIA 5HD8D 2DQFA 3SKMB 3C5ZB 4GKZB 3EDKA 4PJ9D 3SKNA 5CWSB 2NY7H 4PGBA 1QR1B 1AXIB 4WU5B 3VXPA 3U4BL 3ABZA 4X7EC 3WS6C 3JWDC 4WW1A 3MLSL 1I3RB 2WIMA 1ED3A 3MJ8A 2B1AH 4HK0B 2CD0A 1GAFH 1QSFB 5IG7B 1KCVL 2EC9T 1ZLVK 2IPKA 1N2RA 2R2EA 1KFAL 2CXGA 5GRVK 1I8LC 5IBTH 1BOYA 1CGTA 4PRAA 1DVFB 2BNRD 2NY1C 5D1ZB 1XZ0A 1F11B 3D18B 5E2JA 3QIWD 5MEQB 5EBGA 3S4SA 1F4YH 4M62L 2CRZA 1FNGB 2YD9A 3MUGB 4BZ2H 3BGAA 1JNJA 1HI6B 4DKAA 4HCRL 1AKJB 4KRMB 1G6RH 3VRJA 4DVBA 5CP3A 3GGWA 1CYGA 1PW3A 2X4UA 3O6FA 5MHSE 4G8FB 2VXTH 5DS8B 1PLGL 4JKMA 1JWMA 3QG6B 4U3XA 1CU4H 5EU3B 4BK5A 1IAMA 2VDMH 2IQAB 3TH3T 1WZKA 2X1XR 3MNZB 3SDAC 3W11C 1BPVA 3PF2A 4RAVB 4R3SB 1NC2A 5GS1A 4ZFOA 1W72H 5DJDB 3BN3B 4WIQA 3HAEG 3DI2B 4FTVA 1HWGB 5T1DH 1UJ3C 4FZ8H 3G6AB 4K3GA 2V6HA 1NC4B 3MV9B 4DJMA 1CDYA 2ICCA 5BJTB 2XG4A 4GLRI 3BUYB 5ELIA 3X3GH 4GG6E 2CRYA 3QZWG 2IWGA 1QSED 4ZS6D 1CE6B 4LEXH 5DQ9B 5E4IA 1MEXL 2BRRL 4DK3A 3VXME 1FZKA 1E4WL 4S0SD 1MCDA 1A6VL 1D6EB 1H9VA 3VXTB 4NRXA 1OP3K 4F7EA 3S3SA 4Q2ZA 4NO0D 4XNUH 5DGQA 3MC0A 4I13B 4JFFD 1GJIA 3KPNB 1JCKA 4H1LB 1UH3A 4OZGB 5ICYB 4QXWA 3C8DA 4DN3H 4F57H 4JCMA 4XNMA 1J8HD 1OWWA 2AXFB 1I3GL 4NZDA 2R0WL 5HY9B 1TCMA 1U0QA 3VD7A 2JK5A 2FECL 3TM6A 5KJRH 3KJ4B 2Z93B 4KY1L 5GGUB 1YPZF 1T89A 5I30L 2X40A 1QEWB 2IFFH 3WMSA 2CIKB 3PGCB 2DQGL 1LEIB 5KSBF 3BP6A 4QHKI 4L1DA 2R15A 3ZMRA 4HKZA 1FYTE 5HGAB 4OUOA 5C8JB 4O51A 4L8CA 3HZVA 1SQ2N 1JYNA 1MJUH 3EYQD 3STZA 1GIGL 3D3VA 3GMQB 1J5OL 3Q0HA 1WBZA 3WNKA 1MIEH 3MV8A 1VHPA 5E24E 1EEZB 1IGJA 2AV1A 1TJHH 5E6IA 3U7WH 4ZAKD 2HMIC 3WLWD 4NFBA 4N9GB 4XWOC 3MCG1 1KACB 1KGCE 3QUMH 2ENYA 3WSQL 4IJ3C 5KSVA 5D7JD 1G9NL 3VG0H 4TSAH 3VXQB 1M1SA 2LVCA 1KF9B 4PJ8C 3ZTNL 3SDDA 3IVKA 3GSOA 5IB4A 4OF0A 1P9MA 1A3LH 3AAZB 3ZZ1A 4Q74A 3QEHB 4GMTL 3FN0H 5DFTA 1KPVA 3AFLA 4J4PC 3VFMA 3HZKA 2HRLA 4J3WA 5JHDD 1ZSDB 3TA3B 5JXEC 3ARDC 3BRFA 3QI9C 2J6EL 3PQYB 3I6LD 3HE6A 3QHFL 1PGRB 4FP8L 4M1DL 1DFBH 1S7WB 8CGTA 1QYGH 3LKQA 4MQXD 3UBXB 1FFRA 2OR9L 3TN0D 3G6JE 3VGAC 2DWEB 3VWJC 4QWWD 2R1XA 4R2GC 3JUZA 1R5WA 4JFQB 5F7EL 3VFPB 3MRLA 5BQ7A 3OSKA 1CBVH 4C58B 4L8SB 3MSPA 4ODUA 1RUAH 3LRSB 3V0WL 3RQ3A 1QR4A 1JRHH 1KELH 5I0DA 1FDLH 4JREB 3QO0B 3GI8H 2E7LC 1A7QH 4Q0XL 4HBCL 4RBPK 4QRRE 3DIFA 2Y4SA 2XACC 3MXWL 4HLZH 4B53A 5HHVL 2NXYD 5FM4A 2ADJB 2A6KA 5J8OA 1IGML 5F9OH 5EOCH 1GL4B 1T80A 2GSGA 1LVEA 1KV3A 1T22B 1YEGL 4IMKA 5J13B 5C7XL 4YAQA 5CINH 3OKNA 5DK2B 4JHAL 5TDNA 1ZANL 3BDYH 4Q9RH 1RMFH 1S7TB 1D5XA 3QDMA 4P9HH 2EDNA 1SY6L 1QLRB 3WJJA 5L7XL 2GFBA 2D03L 2DTMH 2HVJB 2IG2H 3KHQA 2BSED 2YD7A 2VXVH 4YX2L 3I50L 2CKBH 3OBAA 2NY2C 3RJDA 1IL1B 1PSKL 2R9HC 4YIQA 1R0AL 3DVGA 5MENA 3QCTL 5JOFA 3CDCA 3DV6B 5HHOE 4RMVA 5IVXF 4RNRA 3EHBD 1TVBA 2V7HA 3IDIB 3B9KA 1IKFL 3N9GH 1MRDH 3VXNB 2VQTA 3VRIA 3L1OH 3KPOB 3N85H 4X7SL 3KDMA 3ZDYF 1T1XA 3O9WD 1N6VA 3FT4B 1D9KD 4A6YB 3MLUL 3ORJA 2HFFB 3HNSH 3NN8A 5JPNB 1VERA 1RUKL 3OKOA 3TESA 1CT8A 2PTTA 3L5WB 5I8CB 2VLKE 4WEMB 4DKFH 2XZAL 4PJDA 2AJ3A 1YN6A 2F53A 4PJXA 3TWCL 5I6XB 3MLPA 4GXVH 5I1EH 1A7PL 1I8KB 2MQ3A 4X99A 3B43A 4G8GA 4OIAA 3ZE1E 4BQCA 2EYRB 2OL3L 1J0ZA 1VPOH 2H3NA 3U6RA 1KIQB 1HSAB 2FDBP 3TBSA 1Q1JL 5I73C 3IETA 1RZ8A 2VDQH 3CFBB 4MNGA 3VJ6B 5GSRB 3UTSB 3DGGB 3SE9L 5K59F 5IF0B 4KJWC 3NAAH 1DQLH 3D25B 3CVHH 4TOYL 3T2PA 1JGEB 4JPVH 5JR1H 2IPTL 3ARED 4OLXH 3IB4A 3V0VA 3VFWB 4HWEH 1JPGA 3C08L 4YO0B 2JLLA 4P5TC 4FQLH 3OJ2C 3DMMD 3FFCD 4LCYA 2HLFC 1EEYA 3RY5A 1KEMH 1JE6A 1BF8A 1QKZL 3E3QC 2D4DA 3P0VH 2G5BB 2ITCA 3HPLA 5LXGH 4YBLB 1FORH 3NFSL 1R3KB 4O9HL 1BECA 4D9RD 32C2A 3BKML 1U3HC 3UJJL 5CILL 4YPGB 1G9MH 1TJIH 5D2NC 1KC5H 4UIMA 4ODSL 3KPQA 2BNUB 4XMLL 2BNQD 3ZKNC 1T83A 4D8PB 3LMJH 2ZUVA 3BEWB 3V8OA 4ELME 3PNWB 3BKYL 3T04D 4BKLA 1ZHLB 3GSNA 4FQIL 4WU7A 2ADFL 3RIAK 1EBAA 5JLZA 4ONFL 3JTSA 4LF3A 1RJYB 2A6DB 1MCIA 3OR6A 3PABA 5EU6A 4FQQB 3MZTA 3VFSB 4OV5A 5ADOH 3RX7A 3T0ED 5SWZD 3NTCH 4NQXA 1ZT7B 2JIXA 1ZTXL 4MQSB 3O81A 4L3EE 4DGVL 3IDUA 4JJ5B 4WNQA 4FZEL 1VA9A 2UYLB 2DQIL 2VR5A 3RWHB 3SE3A 4Z78A 4KKLD 3MOAH 1AQKH 4GW5A 3I75A 1BWWA 5KSUB 4LSPL 3SJVD 5F9JB 3VXRD 2YK1L 1OW0A 1ZEAH 4LAQL 2RGSA 4APQA 2A6JB 1W0VA 3P30H 5F89A 3GSXB 5KOVC 3TJHD 2X41A 3RKPA 1VGEL 4Z7UB 3VFRB 1LE5A 4U1KA 3MFGB 3STBA 3MMEA 4MAYB 2EXYD 2HJKB 5HVGB 3HCVA 5D72H 4O58H 4A2LA 4H8WH 3R4DA 4PRHD 4NQCD 4DZ8A 2R56L 1R5IB 3MGTA 5IMOB 3IF1B 2DQDL 1EO8L 3EJYD 4KJPC 4NP4H 2VTFA 5D8JH 4Z95H 5E2VL 4F8QA 4K9EL 2GYSA 2HLAB 3C09C 1U8JB 3QWQB 2CMRH 4DGYH 3X17A 4HJ0C 2BRQA 4DTGH 1FN4A 4LLVA 4XT1C 2NY0D 2MWCA 4XC3L 2CIIA 4XNZC 5FOBA 5GGVL 4ZSOB 1U36A 3P4LA 1CFSA 4GG8A 4ZD3L 4CVXA 4HGWB 1KIUA 5GGSA 3WL9A 4OKVA 1UM5H 3WEXB 2BVPA 3UO1L 1GC1H 4I8DA 3WFBH 2Y6SC 1ETZA 1F3DJ 5DJ6B 4LCIL 4OQ1A 3EUUA 5DLMH 3VA6A 1IC7L 1DSFL 4ZPTA 4NQDB 4J23A 2WUCL 3RGVA 3TYFA 3MLTB 3ARGC 2PO6B 1QBLH 2FECI 1L9MA 2JCCE 4KGJA 4Y5XC 4V1DA 1EHLH 5C1MB 3IJHB 1T0MB 3HAEA 4JZJC 2VN7A 1P4LA 5IM7A 3SE4A 5C6TL 3HRZB 1WCBA 1T3FB 4FRWA 2GJZB 3MV7A 3VCLA 2F54D 1CGSH 1IFHL 3NIFF 4XCYA 3GIZH 1PY9A 1XIWD 1T7ZA 1SHMA 5E5MA 4X98B 5D1XD 3WDJA 3QZWA 1OTSC 2R39A 4PTTA 3WJLA 5I16B 4Z8FH 4KK9C 5T1LD 2XWJA 3MRIB 1YNLL 5I75B 4QO1A 1X6LA 3MTRA 1ZLVH 3CUPA 4WI9A 3VW3H 1A6ZA 5I76A 3WO4C 1M71A 5HDOA 4WRLA 4Y5YA 5E9DE 1EERB 4WHTA 3WN5C 3G5VA 3SBWA 2EKJA 2DDQH 5F72S 4KI5F 1I9RH 1EX0A 1OTUC 2EXWC 1Q94A 3KWWB 4QRSB 3G08B 2Z35B 4PJIE 2OTWA 4HQQL 4F9PC 1P7KA 2FR4A 1FNAA 5SV4A 3OAUH 1EIBA 1WEJH 1MQKH 2QR0A 3ARQA 3MBEA 4GBXB 5FV1L 5LVEA 1Q9KB 2XRAH 3P77A 4EN3C 1C08A 1VESA 1AR1C 4HAGA 4P3CH 3ULUC 1YYMH 1C5DA 4R7DB 3HE7B 4ZOEA 3CVIH 5EUKA 1NUGA 1RHHB 3JVGC 3U0PB 1J1XL 3U36A 5BRZD 5IKCA 2BHUA 1RZKL 3LEXB 5BXFA 3E3QE 3FQTB 5C0NC 1IRAY 1MHCB 1YMHB 1UVQB 3N0PB 1QD0A 2P8PA 4XNQA 4PJHF 3RRQA 2FJHB 1TQBB 4UV7L 1KG0A 3CLEH 4JB9H 3BW9A 4KQ4H 5F9WB 3UEZA 1YEDA 4DGIL 5D2NE 3VMOA 1FVCB 4O4YH 3RZCA 3CMGA 5J1AA 1XGPA 5C9JB 2Q76B 3QPQD 4HFWA 3CD4A 2GTWB 1I9JL 5EPMA 5JNYB 5EBWB 5CKAA 2BMKB 3FB5B 3TNNB 3NFPB 2C1PB 3UPAA 3REVB 2MKLC 2HWZH 1D5MB 3D69B 3MRQB 1NUDA 4UNUA 1O7SA 4JQIL 3S6CA 1WV7T 3L9RA 3WFCL 1OP3H 4ORGB 4QYOB 2KDGA 4Y4FA 2VZ3A 1Q72H 1B90A 2D7TL 4NWTL 3ECBB 2BERA 3RAJH 4RGND 3FB8A 2AEWA 2UZXB 5KTEL 2IBGA 5JW4N 3HMXA 1H5BA 1H3PH 4JRXA 4MCYA 3WXVH 5C08B 9CGTA 2H8PB 1LK3L 1U93B 4UQ3A 5FA3A 2G9HA 3HC0B 3PG2A 4OQTL 4ODHH 3VXOA 2Z9TA 4I5BA 3DNKA 1QFOA 1UB6A 4YXHL 1OAKH 2FIRT 1EPFA 3H3PL 4HIXH 4M7KH 2OJEB 4I3RL 1RK1A 4H26B 4P2OC 1M7IB 4PD4J 3QULA 5D4QA 2NXZB 2X2YA 3E6FB 3P4OB 3QRGH 1OAYL 3GSQB 4PPTA 2AAVA 5DR5L 4FXGA 1R24B 2CRIA 1YQVH 4MJ4A 5T3ZE 4FQJH 3DSFL 3TPUB 3FO9B 4POZC 2APFA 3U30C 1AXTH 5E2TH 5LAXB 2P7TB 1UWGL 5IW1A 2PTVA 1N0LA 4Z76A 3DYMA 5CMAB 3ZLQC 3IJYA 4YDLB 4NWUH 3C2AL 2YA2A 4RX4A 1FBIL 5TDPA 2EIEA 4GRLB 1TETL 5DA0B 1NGWA 5GHWL 3PDDA 1OD7A 1NGPL 2V2WA 3MJGX 2I07B 4O2FB 1M6OB 1MY7A 1NANH 3FTGB 3KYMB 2ARJQ 4P2RE 3VGGA 2VABB 3GMOA 3RNQA 5C09E 2XN9A 4ZUUB 1NKOA 2XY1A 1CICD 4JY5L 1P1ZB 4I2XE 4GRWE 2EDFA 5EO0B 3RU8L 2IALA 3MRMA 2Q7NA 1M7XA 5E00B 3L3DA 4D0DB 4PRPD 2WUBL 1AIFA 3AXLA 3MJ6A 4HHAA 4LPXA 4YK4B 5C6WH 3HG1A 4I0PA 4U6HB 3T4AB 3BYTA 2EDDA 4P59H 3MNWA 4G6AC 3X13B 4WI5A 3NPSC 4KKAC 2ED8A 3PWNB 4XPGH 1HWHB 3RGHA 2HP4A 5ISZD 3VFVB 4JHWL 4P2QA 1A3RL 2V2XA 1EEQA 4Y1AA 4KDWA 4U2ZA 5DQDL 3TO2A 4RBPH 3GSRB 1T20B 4R26L 3TV3H 4NQEB 1ACZA 3DX8B 3T0AA 2OTUB 1MI5E 4NCC2 3DX7A 1KXVC 1C16B 2HKHL 15C8L 3BXNA 1FSKC 2ATKB 4XH2A 1IGCH 1NSNH 1AC6A 4OZFB 5TQ0H 1P53A 5FKAA 5HGDA 3O4OC 4J2XA 1R6VA 1BWMA 3QIBB 4NT6B 3V4VL 4XVSL 4DCQA 3CFJB 4IEFB 1SMOA 5CD5C 4OFDA 3H2WA 5J7CC 5IFHL 4WHYH 3NCJH 5CEZL 3EAKA 4ELKA 1VFBA 3KXFE 2DKUA 3T77B 3LQAH 2R69L 4BZ1H 4JO2L 2AEPH 1P4BH 4HUUA 5LCVH 4UIKH 4OTXH 2BXZA 1QQDB 4KROC 1MLCA 5JQHC 2YD1A 4CBPA 2HJLA 3EGSA 3TBVA 4D3CH 3PL6D 5LQBL 5JXAL 2N4IA 1UT9A 4NKOA 3ULUE 2NTSP 4KH2A 2XTJD 1O5DT 1OGAB 3OXRB 4C59B 4NZUL 4IIQA 3RDTA 1DLFL 1IE5A 4QTHA 5FYKL 3T2NL 1PKQB 3WDIA 3FO1A 1Z9OA 1EZVY 2DICA 3O8XA 1IC5H 3IU4L 3OX8A 1RZJH 3ZL4L 4UDTB 5I1HL 4X6BB 1YEFL 2HT2C 1YMME 4PJCB 3U2SB 1CF8L 3Q2CA 1WBXA 2VKXA 4JFEE 4OCXL 2CKNA 4IRJB 5DFVD 2BX5A 2ZCLH 5BV7L 4HS8H 1MNUH 2A77H 3H6JA 1YJDH 3PWUB 1I7UB 4PRIA 5E1AB 5EOQL 4UT9L 2HVJA 4BA8A 4JDVB 2MHAA 1UEMA 3DBXB 4KUCF 2QL1A 5A2LH 4DW2H 5AYUH 3D5OF 2A74A 1QSZA 3VD5A 5A3ID 3EYSL 4G7YL 2GJ6B 2Q86A 4RAUA 5H94B 2C26A 4QF1B 4KK6D 5BOPA 3F7YA 4NO5B 1Z9SA 3BPLC 1T5XB 4HJGB 1KULA 4X6DB 3QUXC 5ID0B 3OAYK 1W0YT 3I84A 5KAQG 3L7FA 1ACYL 4X6CB 1Q8MA 5C0JA 5MEOB 4RMWA 2FEDC 1E0OB 5D7IB 1CDBA 3DI3B 3SKJL 3D2UD 3QPXH 3LEVL 1CLZH 4TPRH 4XPTL 3BZEB 3L7EB 5J11C 4ZTPL 3DX6B 5BZWB 1ROWA 2A83B 2VXSH 1UZ6F 3ARXA 5DMGC 5FK9A 2RFXA 4JANA 5DUML 3KPMB 4LCCC 3UTSA 1WUNT 5GISH 3O2VH 4Y2DA 4GQ9H 3CLFL 3LKPA 3MRCA 1NDGB 1HYSC 1V7MH 2QSQA 4J3SA 4G43A 4D9LH 4UQ2A 5FB8B 5C0AA 3H9HA 3TLRA 3C8HA 1A14H 3LN4A 3MO1B 4AH2B 5BMFH 1FFOA 1F8TL 1MIML 2VIRB 3C5JB 5SWQA 3A6OA 4JAMB 3WYRA 3NCEB 5DD6B 3OKLA 4F2MA 2FRGP 1T0NB 5E6ZA 3QXVA 2B4CH 4UAOB 4FQXD 1HSBB 1IJ9A 3BPCB 5DMKA 4M3JA 4PJFA 1H0DB 1MVUA 4RWYL 4GRMA 4ONHB 1DN0B 3WFEL 3S3PA 4U6VL 2HT3C 1S3KH 4E5XA 3H42L 1LO0H 3VXSE 1A7RL 2IC2A 4D8PA 3WLBB 2Z4QA 2NY5L 1F00I 3V6ZB 3QUKA 2R0LH 2NLJA 3AS2A 5D2LE 1JZ2A 1OARL 4PGCA 5TFSH 1D6VL 3PP3K 1NFKA 5DSCB 2D31A 3O6FC 3KPSD 4HSQA 4JCLA 2DMBA 1RJYA 4GAJH 4OLVL 3ZE0F 5TDOB 4KHXL 3Q1SL 1FZMA 4QXUH 1LO2L 1N59B 2RR3A 5B8CB 2J6EA 5C0BD 5F1IA 2A6IB 1WLHA 3QIUB 5HVHB 1SBBA 3JWOL 1B0RB 5DVOA 5GS1C 3DOSA 1EUUA 3WKML 4X7TA 4E9LA 3V7AG 4GMSH 4K7PX 2OBGA 2NY4C 3L5XL 3QUZD 1NJ9B 1EGJL 5IMMA 4R7NB 2O61B 4E42A 7CGTA 1VFUA 2UVFA 1U8NB 2XZCL 4ACPA 1FL3A 4HMCA 3CC5B 3D85A 2DM7A 3ALPA 3K8KA 3DYPA 2HJKA 1QNZH 3LHPH 5CLTA 1DBMH 4AEEA 4HMEA 3OAZK 5GGTA 2A2QT 1QRNA 2W0PA 3DURB 4U49A 3QUYD 3W0WE 1Q0XL 1R5IA 4LSVL 3CSPA 5ALCH 3KLHC 3WHXA 1G9EA 1FAKT 3MX0A 3FOLB 3BPNC 2QQLL 5IEHB 5MHSD 1JPFB 1REIA 1YNKL 1TZGH 2EIZA 5E5UB 4MDJB 1T89C 5E94A 5FKPB 1SY6A 1HIML 2PXYB 3CXDL 5T33L 4L3CB 1EJOH 2I25N 4N1HB 2A9MH 4PP1D 1U91A 4PUBH 5JW4M 4OGXL 1H15B 4OGAC 5HYSB 1X7QA 4P46B 5I1LB 5KVEL 1HXYB 5CJBA 3WFHA 4JY4A 4MD0B 3BISA 4PJBA 4FQCL 2ZUWA 3KPRE 4X83A 3WUWG 2VDOH 3TBWA 5IBUG 1A9BA 5E6IC 5I74C 1KN2L 4PYHA 1ZS8A 3F5WB 4XCCH 1ONQB 3JUYA 2FGZA 3MLTA 4JM2A 2WIIA 4KVNH 4NM8H 1WTGT 3ARWA 3SDDC 5FYJH 4MNQB 3RVVD 2NW3A 1P9MC 1P7QA 1RIVL 4YC2C 5J6GB 3FONB 4NN7B 1AHWB 5IESH 2OL3A 3BQUA 4ZUSA 4PYGA 4LLMA 1GOHA 4OAWB 5FCSH 1MFDL 3P9WB 5JORB 2AERT 1HDMA 4JQXA 4MB3A 5IVXE 3HE6C 3MXVH 5I1DA 2R1WB 2QJDA 4KJQC 2XNAB 3MLWL 5LGHL 4QOKD 5EDXA 4UINL 3ZDYE 2B1HH 1RIHL 3GDBA 5H35B 2AJSH 2AJVH 1XF4A 1DLHB 4WWKA 4AYFA 4ODBD 4RFNB 5A16B 4HT1H 4PJ9B 4LVOC 5L6YH 4OCLC 1MFCH 2MQCA 1OQXA 1MRCL 2RB8A 5ESVA 3U79A 4QRSA 3NGBB 3L3KA 5T5FH 2IMMA 1FZJA 1RAMA 5EOTA 2AQ3A 3QFJB 2B1AL 1KIRA 5DEGA 5DJ8B 3BH8B 4NQSB 1KN4L 1GAFL 1V3MA 4IHOA 2BVQA 4KI5C 3F7VA 4FOMA 3SCMB 1A6TB 3V79C 1XCQB 3C5SB 1HZHH 1DBKH 1G7JA 3GMLA 4MA7H 4POYA 4OZIB 4WO4D 1KJ3H 4HZLB 5I1CH 2BOCA 4HKBA 2B0SH 1QACA 4IMKC 1AGDB 3MLZH 3NOIA 5JDJA 1F4YL 1MHCA 3QG7L 3KPPA 1RVFL 4AZ8A 4UT7H 3VFOB 4BZ2L 4D2NA 5HPMA 1A4JB 3MRFA 1A3QA 3WJJC 1F2QA 1G6RL 3MRBB 1LEGB 2ZOLB 2VXTL 4OJFH 4NM4H 4ZFZA 3VG9C 1CU4L 4K8RC 4MAUH 3THMH 4XBPB 2R4RH 2VDML 3C60A 4I4WA 4MD4A 4Z7NE 1SEQH 4HV8A 5AAMA 3ZYIA 3B9KC 2YA0A 5JNYA 2RIKA 4AT6B 4LHUD 1W72L 4RGOH 1N7MH 2CGRH 1PX3A 2P8MA 3PHQA 2EDOA 3HZMB 4BSWA 1S7QB 2ZUQC 3GKZA 1TLKA 1FNSH 2XT1B 4FZ8L 1PYWB 3O41A 2QADD 1OPGH 3M17A 4N0RA 5C3LD 1C5CH 3UAJC 1FVEA 2H6PA 1P6FA 4LKCB 5J9PA 4M6OH 2XG5A 5KZCB 2DN7A 3QNXB 1ZT1A 3X3GL 5A2IH 5IV2B 2P5EA 1TVHB 4QHLA 5GJTH 4D0BB 1NAMB 2YC1A 4LEXL 2YPLA 1QSEB 4AIZA 1FNFA 1NCNA 4D9QE 1BM3H 2OI9B 4ZXBB 1MELA 2XIDA 3BP7A 3SO3B 4XNUL 1HEZA 1UKQA 1YUHB 4JN2B 4DN3L 4F57L 2DQCH 4PY7A 5E8DH 1BGXH 3QWOB 1UH2A 2WBWB 2XQBH 1IAIM 1YDPA 4XXDB 1DEEA 1N3NA 5HSFA 5KJRL 1U8HA 1ADQH 4NQUA 2NMSA 3LIZH 4MLSA 5JO5A 5KSAB 1FO0B 5CBEB 1FC2D 3AB0B 4Z7VB 3QSKB 3HI6H 4ZDHA 3CPLB 4ZO6A 4JZNB 4JFOB 4M61A 1NMAH 1JGLH 1K8DB 5H2BA 4P23B 1GVIA 1I7TA 5DJ0B 3RTQD 1DUYA 3KYNB 1T83C 1MIEL 2VQUA 1NFIA 1MSPA 3HPJB 1XGUA 2YD6A 3W11D 3U7WL 2J4WH 1QA9B 5ERWB 5C0FB 3JV6B 3CDGA 2DWDA 2YD8A 5FYJD 1EJ6A 3DWTA 3QUML 2ZUXA 3HLAB 5CGTA 3VG0L 3QDJD 1P84K 4Y5VA 3D3VE 4JY6A 4QT5B 2YRPA 3MV8E 3SN6N 3UTTD 2HJFB 2FYYA 5ACZB 3SOBH 4Y16A 1EFXB 1KPUB 2X4SA 3IDNB 2B2XH 5DEZA 2R2BB 1TITA 4PJAB 3RWCB 1CDUA 1MJJA 2J3SA 4M8QB 1K4CA 1F4WH 3PWNA 4WWID 3QNZA 3NZHH 3C6LB 1DFBL 1ZWIB 1I1AB 1QYGL 3SE3C 1D5BB 1I7RA 4Z7UF 1T04B 3OJMB 1WZMA 1SM3H 1CXKA 1OW0C 1EK3A 1GZQA 3DX8A 1MWAH 1K5NB 2QHRL 4APQC 5J12C 3S35X 1U8MB 2FZ3A 4J1UA 4PJ5D 1CBVL 5IWLA 4OB5L 1AE6H 2Q20A 4LOUD 1RUAL 5JTWA 3G5ZB 4OUUB 1JRHL 1KELL 4LLYA 2B7DT 4PBVC 3MUZ1 4RIRB 1FDLL 4K3JL 2EO1A 3M1BB 2J1KA 3GI8L 5JOPE 1A7QL 5HJ3A 1R3IH 4Y8DC 1VADB 4N5UA 2BSRB 4Z7QF 5EBLB 4I9WD 1RFDH 5EZIH 5K93A 2OK0L 4ZFGL 3T77A 4D94A 4CMMB 5F9OL 5EOCL 1LO4H 5DEFA 3LEYH 3IDYC 1P5UA 1XEDA 2IANA 3T0XA 4DEPC 3IDXH 5DDHB 1BOGA 1G6RB 1KNOB 5DJCA 3OKYA 4KI5E 5DZLA 3BDYL 1BZ7A 1RMFL 2VLRA 1RK0A 2HMID 4PJBF 4P9HL 4NNYA 2IG2L 1XF3A 2FO1A 3OAYH 2VXVL 2CKBL 1OTTD 2AEQH 1FLRH 2Q6WA 3GNML 5E7FA 5L2KA 1F3JB 4HS6A 5E5RB 3E1F1 1HHJA 1UWEH 3QDME 3N9GL 1MRDL 1S7RB 4XPHH 1J88A 3H0TB 5IHZB 3TC9A 3LY6A 1Z9LA 3N85L 1R3HB 4WI6A 3RGVC 1F58H 2XKNA 4F15C 4Z77B 5MENE 2R1YA 3HNSL 3NACH 2FCBA 2WWKT 5SWSA 4F7TB 4PP2B 4E41D 5ICZA 4DKFL 5HI4C 1QBBA 2FLBT 2VITB 4ZTOH 3SE4C 3BWUC 3DRQB 3JV5A 4QRQA 4UOW1 1YC8A 3MRJB 1TTUA 4GT7A 3FQWB 4UZGA 4GXVL 5I1EL 1Y0LB 2RBLA 1BFVL 4I0CC 1QLEH 2DS4A 5DI8B 3D39A 3PUCA 2AV7A 4HLJA 3WJLC 4BH7B 2VDQL 4PJDE 1BFOB 3K4AA 1FH5H