2QQLH

Neuropilin-2 a1a2b1b2 domains in complex with a semaphorin-blocking fab
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
227
structure length
222
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTISGYGIHWVRQAPGKGLEWVAYIYPDSGYTDYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCAREDFRNRRRLWYVMDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuropilin-2
publication title Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 39
structure length 222
sequence length 227
ec nomenclature
pdb deposition date 2007-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qqlH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2qqlH01
2HFTA 1KLUA 5BV7C 2DD8H 2DQGL 1HEZB 4NO3B 2DKUA 3TN0C 5GZNC 1H15B 1LILA 3U0WL 3VXRE 4NWTH 3BZFB 3TA3B 5DF0A 4MQTB 1FJ1B 3DXAE 4XCNB 4M48L 4K7PX 1D9KC 1DQQA 1J0YA 5CBAA 4OF5A 3UTSB 1R5VB 3DUSB 3TBTB 3X12A 5I1JL 3W0WE 3SDYH 4OFDA 1DBJH 4JB9L 4MWFA 3VXOA 1ED3B 1SJEB 4ENED 3NVQA 4BQCA 4UNVA 3GSWA 3QQ9C 4NC1E 1B4JH 1ZGLB 2EDEA 3V0WL 2BNQE 4GXVH 4G6JL 4I9WE 3NABL 3NIGF 1W0WB 3B9KA 2W60A 1ZTXH 5I8KH 3KYKH 4FABL 5FYKD 4N5ED 5EU3B 2FEEL 1TCRB 2YUWA 1F8TH 1CYGA 2WP3T 3NMEA 1CXFA 2V5MA 2RGSA 3FRUB 5DWUH 1IT9H 3C6LB 3VRJA 4J23A 2ICES 1UXWB 3BMVA 4R96A 4J4PC 1Q72H 2ZOKA 2CK2A 1SYSB 4L4TB 2YPVL 5IMMB 2FLRT 3B8SA 3L3GA 3AREB 1CXEA 1OAXL 3DO3A 4UIKL 2JB6B 1G7HB 3MV11 1BX2B 4XCCL 1KYOJ 5DSCA 1SQ2N 5ERWA 3VRIB 1G7PB 4KJPD 2OQJA 4P49A 4J2XA 5L2JB 1CD1B 1XGTB 4APQB 4UINL 4Z5RA 4Z7WF 1OW0A 3FT3A 1WEJL 2IQ9H 3O45B 4LVEA 1NL0H 3QIBD 2DBJA 1LQSR 4H8WC 4DN4H 4K23H 2I60H 4ELMB 1YPZA 2DRUA 1NBYB 4PP1C 1DQML 2AEPH 5IW6A 5J6GB 3U79A 1YNKL 5BQ7A 2H8PA 3KJ4B 3QXUA 5TGBB 2H45A 4WHYG 4DKDC 3VJ6B 3G08B 4JFFE 1AHWB 1T1WB 4KGJA 1KNOA 5KVMC 4U1KB 4XRCA 2DJ4A 4LSVL 3VXNB 4DKFH 2IG2L 3EDDA 3WIHH 5HPOA 2EDLA 4U1JA 2R15A 2DL2A 3O9WD 3TCLB 4JM4L 2Y25A 2EEDA 2AJ3B 2V6HA 2MQCA 4OV6F 4PJDB 4NSKB 3HG1A 1MCWM 3MYJB 1CFBA 3SO3B 3MUZ1 5IB3B 2N7BA 1YNTA 4PJHE 3HI5L 5IG7A 2OR9H 5GGVH 2VXTL 4XP5L 4EQ3A 2DDQH 2XXCB 3UAJD 2QADD 4WI8A 2VDNL 3IDNB 1IAOA 1S9YA 4KZDH 4UNTA 3B9KC 3RWCB 4NKQB 4ZFOA 4W68A 1E4XH 2OXGA 4PRPD 3L6FB 1JFQH 5HDQH 2F54D 4LSUL 4WIQA 1HI6A 2CMRL 2CDFA 3KYAA 4X9HA 1F4YL 3VGBA 4W4NA 1CK0L 1QRND 3UBXG 2BFVH 1NMAL 4RGNE 3QCTL 5DJ0B 2E9IA 1KIRA 1JWUB 2YPKA 1MCJA 2MQ3A 1KEGH 3V4UL 4QRTB 2RAMA 1FNEB 4EBQL 3ELAT 3D6GA 1AGDA 2PYFB 2WNGA 2R4RL 5D1QD 3T65A 1L7TL 1RZIA 5IESH 4MXWH 2HKHL 1ZLVH 1JF1B 5J0BA 1W0VA 2E8ZA 4KK9D 2X6MA 2Z0BA 5DUML 5E4IA 2RFXB 1HWHB 5EIVA 2IH3A 5TFSH 2CR3A 4DGYL 4UUJB 4AG4L 5DK2A 1UM4L 4NNPH 5GGTL 2VXUH 2LE9A 1P7QD 2AV1A 3CK0H 3INUH 1A9EA 5CMAA 5IMKA 2EYSB 4CJ0A 4K9EL 4HBQA 4QT5B 1A14H 2Q7YA 4ZS7L 3RUGB 5MENE 4M7ZC 3TZVB 4OUOA 1FORL 1FIEA 1TQCC 3H7BA 3TO2A 5SWZB 3MGOA 2VDPL 3G9AB 2E3VA 1UCBL 3NPSC 1J1XL 4NN5C 5DXWA 5E4EC 1LEKB 2DM4A 3PQYB 1L9NA 3RWGA 3K4DA 1K8IA 3VFRB 3MNVA 3C09B 3MRMB 4QRSA 1P7HL 3VGAC 3QUZD 3BEVA 1WCQA 5E6IC 2R1XB 2IH1B 4TQEH 2F53D 4YHIA 1S8DB 2APXA 3FN3A 2C1PB 2HT2D 2X4NB 4QEGA 4IS6A 4L1HA 5TDOA 3ROOA 1GXEA 1DQDL 1K6QH 1MCLA 1IQWH 2PW2A 1J1OH 1HSAA 5DO2D 3I6LE 1OM3H 2CKNA 1I75A 4RMRA 3ULVD 1MEXL 4O4YH 1B2WH 2E7HA 5A2IH 5AWNL 1J18A 3WLWC 2Q1EA 4M6NL 3ZMRA 3CVHB 2FBJL 1V05A 3BWAA 4ODTH 1IAKA 1T0MA 2EZ0D 2P24A 2C4XA 4OI9A 4IRJD 4J8RB 1PJ9A 4OCNC 5E9DD 4N5UA 4MQ7B 1KB5L 3AROA 1WZKA 3MGAA 4ALAL 4GMTL 4H5SB 1FC1A 2NY0B 1RZJL 3TA3D 5T1LD 3IKKA 1MUJA 4O2CB 5DC0A 3AU1A 3CZFA 2ITDA 3MODH 4LLDA 1EHAA 2CGRH 5SWSB 1S5IH 4CMMA 1HE7A 1OWWA 4FRWA 4NCC2 2HFFB 2YD3A 3UC0L 4OFYA 3NPZB 4EJ1C 1ETZB 2JELL 4PIRF 5BJTA 1QVOA 3T2PA 2A6IB 1W72H 3VFVB 2V5TA 1V7NL 3L5WA 4BFBD 3MCKA 4CN1A 4H25B 2O61B 4C56A 3MRQB 1NC4A 5AZ2L 3QXVA 1A64A 3AUVA 1A4KB 4JZJA 1EIBA 4NC2B 2O5YL 2R9HD 4TTDD 5KSAA 4PJAB 1VCAA 5BOZG 5IW1A 4M9PA 3AS1A 3P9MB 3HFMH 1QUNA 1WAAE 3KLSA 1F3RB 4XVSH 5IFAL 4L4TD 5FA4B 1JPTH 2EDNA 4IMLB 2C5DC 1QKZH 4U4BA 4WU5A 4OZHA 5KS9F 4X6BB 3FMGH 5L2KA 4EKXA 4QHNA 2VDLL 5TDNA 1XGQA 4X98B 2JIXB 4CN4A 1RZ7L 2E8YA 2QSCL 4HS8L 3IDJB 4HV8B 5D4QA 3ZDYE 1U3YA 2R29H 3HPLA 4K3JL 5HDOA 5JW3L 4QOKB 1TVBB 2VDOH 3MOBL 3ZZ1A 1OP3H 2D7TH 2RCSL 5GS2D 3TBYA 3TV3H 1SEQL 3I50H 5EO1B 3SBWA 3GBMH 4BA8A 4DW2L 2BSTA 1C5DA 3A6CL 5EUKB 1FIGL 3D2UD 2Z92B 3MBEB 4HIEA 1T20A 4NC0B 1NCTA 1X5XA 4HMEA 4P3WA 5HDLA 1TQBC 2HJKB 5CKGA 4WCYH 2VR9A 4Z7QE 1KJ2B 4OAWA 5EBWB 2O5ZH 1JP5A 4KVNL 3T0EE 2AXFA 4PJGA 3WXWH 3WCYA 2DQDH 4V1DB 4PS4H 3NN8B 4XVUC 2FO1A 5CP3A 2VZ1A 2H6PA 2FDBP 2VDML 3RVVD 5C0NC 5FHAL 3MRCA 3O2VH 4JEGB 4X7TB 5K9JH 1G6RB 4K3GA 3GBLA 5A2JH 1Z3GH 2DI9A 3H2WA 5CS7A 1IFHH 1KIQA 5DFTA 5C0FA 1RUQH 4I2XA 1CE6B 3TYFA 1IE5A 4GMSH 3HE6A 3VA6A 4R3SB 4WRLA 5ITBH 2HTLD 5ESAB 5BRZE 5DUBB 5LGHL 3GNML 4BKLB 5IVNA 3TWCH 1KUMA 3QNZB 3WHXB 1QSZA 4NUJA 3DI3B 3MA9H 5M7QA 3QQ3B 3NFNA 1HNFA 4Z0BL 5J06A 2ICWJ 1LNUB 4MCZB 1KENL 1Z5LB 4HKJB 3NGBB 5EN2A 1JGUL 4JZJC 2AK4A 1PQZA 1YMMB 2G75A 3QO1A 1S9WB 3B6SB 3QHZH 5KSAC 2WANA 5DURD 5EIIA 2HH0L 3S4SB 4QHUA 1NEZG 3LV3B 2C3VA 2X9XA 4LEOB 3G6DL 3QJHB 5BV7B 1P4IH 3QEUA 2LFGA 4NRYA 4UT7H 3TN0B 3SO5A 2PF6A 3SDXB 1AXSA 1XT5A 5DJDB 2ESVB 2B5IC 3BP5A 2WWMC 4JFEA 1ROWA 5IVXB 4L8CB 1N4XH 1YUHA 1OAKH 5AG9A 4PBWD 1XCTB 4NBXB 2ZG3A 1OTTD 5BXFB 1F3JB 4M62H 2OTWA 4HGWA 3SBWC 1OSZB 3QUML 3BW9B 3MLXL 5INCA 3DMMA 3ZHKA 5FYKU 1T0PB 3EO0A 3MNZA 4M7KL 3ZDXE 2YKLH 3T8XA 3WUZA 1U8PA 3RWDB 5C0AD 4NRXB 2X70B 4JO1H 4JFDA 4PJGE 5DHVB 2A9ML 5IB4A 1FYTA 1N3NB 1WV7T 2EIEA 4JFZH 4M3KB 3LZFL 2BX5A 4PR5A 3KPQA 3S37X 1TNMA 1FV1A 3KVQA 4MJ6B 5EOTA 4RAVB 2YUVA 3HE7A 3PWUA 1UH3A 4K2UH 2IALA 4GLRI 5FM5O 4HJJH 3HE6C 1PYWA 1MI5D 2V9TA 1EDQA 4NKIL 5CD3B 4PRAB 2F58L 4JN2B 1JRHI 3V7AG 4M7JL 3RJDA 3H9YA 1L7IL 2COQA 1Q1JH 1LO2L 4XVJH 5K9OA 5B8CB 5J89A 5JORB 4RX4A 2FGWH 1NBZB 4ZQKA 4QXUH 3TVMB 3MRDB 2ZUYA 3IJYB 4HCRA 2R0WH 1I1RA 3EHBC 3VFTB 4DJMA 5J4MA 5IB5B 2AJZA 3Q48A 3BFOA 5C0EA 3RU8H 1ONQB 3MJ6A 4I0PA 4RNRA 5IHBA 4PJBF 2Q6WA 3RL2A 2XRAH 3TBWA 2VLLA 5HY9A 4FQJH 4JKLA 3ZKMC 3EJZD 3UZEA 1ORSB 5CFHA 3RDTA 2RJMA 1HQRA 2WQRA 1JUFA 1DQQB 5FYJD 3KAAA 3BDBA 5CBAB 5E8DH 3QWOA 4J7RA 4HWEH 4QRQA 3X12B 5I17A 4PD4K 1I9RH 3TJEH 4MHHI 5JW5A 3GKWL 4MWFB 3RVXC 3VXOB 1S7RA 3BKCH 5D96C 2CD0A 5I18H 2EDXA 3GSWB 4ZXBA 2B4CL 5KTEH 4L8DB 5GS2H 1LO0L 1CLZL 1Z2KA 3B9KB 1A2YB 5JQ6L 2W60B 4POZC 2DF3A 3QDMA 5D93B 1JHLL 2Q76A 4TNWK 2BVYA 4UBDD 1DBAL 4XWGH 3VRJB 1BQLL 1YDPA 2KKQA 1XR8B 1QSFD 2FO4A 2RB8A 3OXSA 4OCLC 1AQDA 4R96B 3A0OA 2ZOKB 3UTTE 1TTUA 1NCBL 2V9RA 3HE7C 3L3GB 3FQRA 5E00A 1DBML 3TF7C 2VN7A 4GKZB 1ITCA 1M05B 2A73A 1CFVL 1KGCD 3SKJH 4AT6A 4Q2ZB 3S96A 3U4BH 5DSCB 5H35A 2DN7A 2OQJB 3MROA 1PBYA 4Z5RB 4RMTA 4QRPB 1CR9L 3RX8A 3FT3B 1OAYL 4QHMA 4BZ1H 1T5WA 1WICA 4ONFH 2BRQA 4HWBH 4YR6A 2XG5A 1J0HA 4L1DA 1YPZB 1ZLSH 1DQJA 4JO2H 1CVRA 3MLYH 4M5ZH 1CZ8H 5F96H 3LKRA 4XPBL 5AAMA 5IW6B 2VQUA 3ULUH 1DBKH 5BQ7B 5ADPH 4I0PC 1XF2A 2FB4H 4YHKH 3GMRA 1CGVA 1HXYA 2MPAL 4KK6D 3NCJL 1QR1A 4HWBA 3ARQA 2NY5H 2NCMA 3SE8H 4XRCB 1S9KC 1BPVA 4M7ZB 1IARB 4C55A 2Y36H 3RDTC 1NBQA 4U1JB 4UT9L 5FO9A 1TQCB 2EH7L 3BESR 4LVNC 4NN5B 3HG1B 3NPSB 1A1NA 2WV3A 3V52H 2OJZL 4U6HA 1IGFL 2A0LC 4MJ2A 1OSPH 3MV9B 3SE4A 4WFEE 5IG7B 3RPIB 4LCWD 1DE4A 4WFFD 3VXQA 1S7QA 3OQ3B 5C09E 1LDPH 4OJFH 3W9DA 4ZXBC 3VGAB 3C60D 5A3IC 4GG6A 1S78D 4LCUA 2PO6B 5C7XL 5E6IB 1WZMA 3S88H 2QEJA 4NIKB 1OAZL 4JRXD 4ZFOB 4FN0A 3QDME 4XX1G 1NAKL 4K8RD 5FGSA 5H37H 1G9NH 5DHYA 3I9GH 2I5YH 3PP3K 3S35X 1NLBL 3BO8A 2CDFB 1XCQA 1KCSH 3MOAL 2X89A 1LO4L 4GKSB 1YMMD 4J1UB 4IBLT 1S7UB 4OD3H 3IAQA 5ESQA 5HHOE 4GJTB 4RRPG 2NPLX 4G3YL 4NO0A 4AEHH 1KIRB 2YPKB 2EYTA 3UYOD 1UWXK 3JWOL 2Y1VA 1NGXA 3BGFB 4F9LA 1AGDB 2D0GA 2YN5A 4P2QE 5C0BB 5LQBL 3ZHLA 2DQEH 3WNLA 1MRCL 3T65B 2HT3C 1RZIB 2ESVD 1ZHNA 2QQKL 3BRDA 3VXRD 2HFGL 1A3RH 1RUKH 4HUNB 3MRJA 1W0VB 3E0GA 1D9KD 1EH9A 1I9JL 5TPWH 3O3EA 5TE4L 3SGDI 3EYOA 4O5LL 3RGVA 5D6DA 2IH3B 3W0WD 2E9BA 5AD0A 3WNNA 3GIZH 4U3HA 4MJIB 5DK2B 4TRPH 1IBGH 4LGRB 5DMJB 2AV1B 3CSYA 1UZ6F 4NRZA 5B38G 1MFDH 1A9EB 5CMAB 5ENWA 5IMKB 2BNQD 1EGJH 3AMKA 1YJDH 4NJAL 3HI6L 4XHJC 2E5EA 2Q7YB 3K2MC 3P30H 4EXKA 4MSWA 2YA1A 5I8EA 5I1KH 1CN4A 2Y07H 3TO2B 5BCAA 3MGOB 3MV01 4OLXL 3ULUC 1URLA 1M7IA 4PG9B 3SE4C 4WI9A 3MNVB 5FYLL 3E6HA 1FNFA 1AO7B 3QBTB 1FH5H 4ODSH 4X80L 5AYQA 3E1F1 3T2OA 4GG6E 4ZFGH 2NY5C 5DGRA 5KVDL 3O2DL 3OHXA 4YHIB 2VH5H 3D5OF 3C2AH 2GTWA 2XKUA 1FO0L 4BQBA 4KMTH 5FUCE 4E41A 1E0OB 1Z6JT 1G0YR 1QR4A 2IF7A 1X9QA 4PJIE 4ZS6C 5TDOB 3ZL4H 4NBZB 1A3QA 3ZHDA 1HSAB 4N8CH 1N2RA 1QSVA 4PP1D 1BFVL 1MY7A 3KXFE 3QUKA 1BAFH 5C3TA 2YUXA 3RI5K 1D5MA 4UB0L 3BWAB 3MRRA 3BRGC 1TQBB 4R26H 5E2UH 2P24B 1SM3L 5ID0A 1RMFH 5DZNA 1G9NC 2VLRA 1I3VA 3LQAH 3C5JA 3JV0A 4JFFD 1BD2A 1ZV5A 4Y16A 3RIAK 5ACMA 1AP2B 4JVWA 4PJFF 2RHEA 3CZFB 3WO3B 1JBJA 2CRIA 2ITDB 1A7PL 3RVUD 1IEHA 4LLDB 3RGVC 5D6DC 2PNDA 1FP5A 1DFBL 4MDIA 4CMMB 4YXHL 1RV6X 2DKMA 3S3SA 2AABH 5F88A 5I1DA 4F58H 5BJTB 1QVOB 1FNGA 3QRFM 2DMCA 2EDJA 4P59H 2QKIA 2J4WH 5BS0E 5C6TH 2PYEE 4OFPA 2MKLC 3SQBA 5I75B 1MHHA 3RWJA 4C56B 2K7QA 5HHNB 2I25N 1CXKA 2QLVB 4XMKH 1SBSL 4LASL 4PB9H 3UTZA 5MEPA 1U8LA 3LKNB 4JZJB 4OQTL 3X3GH 3NZHL 3RNQA 2UWEF 3CU7A 3HKFA 4L9DA 5KSAB 2NX5B 2JJVA 4ODXA 1OCWH 5IW1B 4XC3H 4PTTA 3PJSB 2DTML 5JOEA 4FFYL 1JN6A 5LG1A 1JNNL 1X5FA 4WU5B 4OZHB 1E6JL 5K59E 1Q0XL 1YEIL 3LEVH 1J8KA 5L2KB 3WNOA 4QHNB 1JGVL 4KAQL 5TDNB 4OM0L 2B5IB 4IDJL 1UC6A 1RU9L 4Q9BA 4NGHL 3HPLB 1NFDF 3H3BC 2CRZA 1N0LA 3UTPD 5DJCA 1FFNA 2B1HH 3TBYB 3C08H 3VXSB 1ADQH 3CFDA 4WV1B 3LKSB 1I4FB 4FZEL 4HH8A 3VDAA 3AY4A 4PRIE 4IM8A 5I71C 1RFDH 3N1GC 2A1WH 2J6EA 3FAXA 4HIEB 1T20B 2G9HA 4RGOH 4JJHA 3EKCA 5FYLE 2G60L 4G42A 4LCYA 4JZNA 1F4XL 1MPAH 4OAWB 4FFVC 4A6YH 3STLB 3FO0L 1I3GH 5E2VL 5F7EL 5EZIL 3GO1H 2YPLE 2Z8SA 4Y16C 3MO1A 2H6PB 3OB0K 3O2WL 4MA3B 4YDLC 3HS0B 3MRCB 1QG3A 3SOBH 3VXMB 3O3BB 1FPTH 1T6WA 1DLFL 3EDEA 1KIQB 4E9LA 1INDH 4I2XB 3V5DB 3OTTA 3TYFB 5ADOH 1KFAH 5ALBL 5E2WL 2IBGA 1BIHA 4XBPA 1A7BA 1C1EH 4A6YA 1GOHA 3GI8H 2VIRA 4M6AA 3EYUL 1G7MA 3QDAA 5FO7A 1H8NA 1F97A 3G6JA 2F5BH 3GIVA 3NFNB 1FGVL 3MYZA 5EN2B 1YEKL 2AK4B 4JHZA 2G75B 3QO1B 3CX5J 4WI2A 5ANMA 2IAMA 4JFPA 4HWUA 4FQIL 4DZBB 5EIIB 5I1GH 3U4AA 3I6LD 3D9AL 4JKKA 3I6GA 4FNLL 1CD9B 3GJEA 3P2TA 5F7DA 2BSRA 2IANB 3RX7A 1PSKH 5CEXA 2XN9E 1A6VL 5FUOL 3EYQD 1YZZA 3QEUB 4JJ5A 5T1MA 4NRYB 1Z0NA 3WKNA 3TC9A 2EE9A 5FYJU 1RVFL 1AXSB 3BDXA 1LE5A 3BP5B 4JFEB 1YUHB 1RZGA 3ZTJG 3KNBA 4WHCA 3LN4A 3I6KA 1E28A 1H0DA 4P46A 5FO8A 1R3LA 4PJEA 1NMBL 1UJ3A 1J8HB 5GRUL 4ZG1A 1T22A 4FQQB 2OP4H 4KUCD 4OB5H 4OCSH 4ODHH 1A6WL 5GJTL 1Z9OA 3FB6A 3UP1A 5INCB 5D96B 3AY4C 2EDTA 4WI6A 4XAKE 2PXYA 4EVNA 2Z31D 1HCFX 4S1RL 1E4JA 4OLEA 5J8OA 3MNZB 1JPSL 5GS1C 1MELA 4M7LL 3T8XB 3TYGL 2HFEA 3P0VL 1U8PB 5KSBA 1VDGA 5EBGA 3WIIL 2R2CA 4JFDB 1T3FA 5JHDE 5IB4B 3H0TA 1FYTB 1CDHA 5DRWA 4URTB 4PR5B 3KPQB 3V0AC 2EE6A 4NP4L 5I30L 4FG6C 1FV1B 3MRKA 2QHLA 2H2SC 2P8LA 4L8SA 4LSQL 4MXVE 4WGVB 5DR5H 1W2KT 3GMPA 3HE7B 3CZJA 1FVDB 3PWUB 5SX4I 3NCYP 2IALB 3CFCH 4MDJB 1PYWB 5DMKA 2N4IA 1N7MH 3MLSH 1AE6L 1T2JA 2KDGA 4JPKH 3GSNH 4NHCH 4R9HA 3T1WA 1NCWH 4P23A 2QQLL 4G9FA 4KKCC 4ZQKB 5EIQA 4JKPL 4PY8I 1GSMA 5ANME 4DK6A 3QIUA 4DUXA 2IAMC 4N0UA 2EDKA 5FKAB 3UDWA 2NW3B 2AJZB 3QXTA 4J12A 3JTTA 4NZUH 3W2DL 5ACZB 4I0PB 4AEIL 4RNRB 5HHXL 5E8EA 4QGYA 2Q6WB 3RL2B 3K74B 4UQ3A 2VLLB 3TBWB 5HY9B 5CEZL 3IAGC 1QO3A 2B0SL 5ESVA 3LKPA 3HMXL 3T0ED 4AIZA 4Z7WE 1MY5A 3QFJE 4RBPK 3ARDA 3L3DA 3RDTB 5TQ0L 3TH4T 4PGBB 1FZJB 5I1JH 1JUFB 4LVNB 4P46C 1MVUA 5I0DA 4JB9H 5C0ND 3QWOB 2QL1A 3PDOA 1ZKAA 1UJ3C 5I17B 4YWGH 5EFIA 1ZANL 5T3XD 1S7RB 3PV7A 2PETA 2PXYC 3V0WH 2BVOA 2XYCA 2N56A 4OFYD 4G6JH 4ZXBB 5E7BA 1RHHA 4Q58C 4HXBL 3Q6GL 1OARL 5C2UB 4XMPL 5BRZD 5F93C 4PJ9A 2W65A 3W9EA 5JZ7D 3QFDB 1NC4D 3FHQA 4R6UA 4JCLA 3VFPB 1WBZA 2Q76B 4BZYA 5HPMA 5E08L 2MOVA 4Z76A 4PUBL 2FO4B 4L8SC 1AQDB 1NGPL 1OAXH 5CGTA 5F1SA 3S97C 4UIKH 1FL6A 4XCCH 5E00B 2A73B 3NA9L 1V3LA 4AT6B 2BP3A 3S96B 5C6WH 5FECB 5H35B 1WEJH 3B5GA 4JREC 1CQKA 3MROB 4RFOL 1DL7L 1U95A 3FRPG 1NANH 1NMCC 2Y06H 4QHMB 1T5WB 3M07A 1KTKE 3UO1L 1AD9A 1UEMA 5B21A 4YZFF 1H3WM 1AKJA 5BZWA 2GSIA 4WWID 4P23C 4YR6B 3MLVL 3WDIA 3BHBA 4TNWF 3QCUL 1DQMH 1DQJB 4JHBA 3D25B 3QIUC 3P40A 3WO4B 1YNKH 3LKRB 1K2DA 1XGYL 3D18B 3UDWC 3TESA 1AFVL 3GSXB 3LHPL 4YFLI 1X5ZA 35C8L 2GITA 5CLWA 4DAGL 4LSVH 2ZCHH 1QR1B 1LO5A 2IG2H 3LCYA 1CS6A 3X17A 4JM4H 3PHQA 4KV5E 2VXVL 4OTXH 3ARDC 4MB4A 1AC6A 1AI1H 3HI5H 1A1NB 2Q20A 1OLLA 2Z4QA 2VXTH 1T83A 1CFNB 4W4OA 4CVXA 3QWQB 4DEPC 4EEEA 2VDNH 4X7CC 3VXQB 1S7QB 3HE6D 3W9DB 4GXUN 4P57A 1TMCB 3SDCA 2NY7L 3PV6A 4PY8J 4LCUB 3ZSSA 4U1IB 4XPTH 3HNVL 4KROD 25C8H 2JF1A 3NFSH 2CR6A 5HJ3A 3ULVF 3LEXA 5C9KA 3PWPE 4LSUH 1RPQA 3VGGA 5IV2A 5D7SL 3RWEA 3S5LG 2CMRH 5CEZE 4PJ9C 5SWQA 5DHYB 1F4YH 2CSPA 5L8LB 3WDJA 1JMZA 1CK0H 3IETA 3BO8B 2VWEE 5GRJH 1NMAH 2AK4D 4X6FA 2VWEC 3QCTH 3U4EA 5ESQB 4Z6AT 4MNHA 2NR6C 3V4UH 1EFXD 4NO0B 2D31A 1PFCA 2BK8A 2EYTB 5D7LA 4LVHC 1X5AA 4O9HH 1NGXB 1C16A 2BMKA 1L7TH 1J86A 3T3PF 2H32H 3FJTA 3EFDL 3QEQA 2HKHH 5DJ6A 3HAEG 1UADC 1HINL 4JFOA 1N6QL 5IT2L 5DHXB 1ZHNB 1MFBL 1VHPA 3BIKB 3QHFH 5DUMH 3S7GA 1ZT7A 3CVIL 4Z7OF 2R56L 1R24A 7FABH 4W6XB 1YY8A 2ICEA 3O3EB 4DGYH 3EYOB 4DKEH 5TH2A 3G6AA 1CFSA 5C0GA 5FOBA 3RGVB 1LHZA 1UM4H 4MHHG 3RVXD 5DD5L 5GGTH 3QSKB 5AD0B 3ZTNL 4HZLB 3V6OE 3VWKC 3DMMD 1C08A 2X4UA 4X4ME 2Q86A 4K9EH 1K3ZA 3IDGB 1JPFB 9CGTA 1Q9OA 5ENWB 5CD5C 1YNLH 2VXQH 5J11C 4LHUA 5K33A 5KVEL 1CDYA 5B22A 4GRWH 4WUKL 1FYTD 5C0RL 1H3PL 4MSWB 3D39A 4F2MB 2VDPH 5I8EB 1J1PL 1UCBH 1J0JA 5JMOC 1DDHB 3VH8A 3QPQD 2X1QA 3DIFA 1P4LB 4NQEE 1M7IB 1T83C 2VDRL 1ZHKB 4W4OC 1VPOH 4K07A 3S34H 4IMKC 4J3TA 3UTTD 5TF1L 1B4RA 1QFHA 2VL5A 1P69B 3L5IA 2X2YA 3SDCC 3BE1H 2VDKH 3OHXB 4NZRL 2GTWB 1EAJA 1XF3A 1DQDH 3HZKB 5I1AA 4E41B 1WJ3A 5E03A 4XVTL 4PRHA 4RX4D 3L5XH 4OLWL 5CCKH 2B2XL 5HVFB 3OAZK 1N2RB 5AWNH 4ZAKA 3MLWL 5I71B 4L29A 4WJ5A 3T08A 3H9ZA 5GSVB 1ZAGA 2FBJH 2UYLA 4GW4A 4ERSH 2H9GA 1TTGA 1IAIL 3CDFA 4I0PD 1D5MB 4L4VB 1HYRC 3MRRB 4IRSA 1KB5H 1CBVL 1KC5H 4ALAH 5ID0B 4S10A 4U1LA 5DFVD 1J10A 2VLRB 3C5JB 3OAUH 1BD2B 4RAHA 2WUCL 4Y16B 4DFIA 3SE9L 4MLIA 1EBAA 4L3EE 4YDLB 4LOUC 2YRZA 2FJFB 2YEZA 3S3PA 3DX7A 1OP9A 3ILPA 1IM9A 4MDIB 2Z8WC 5GS0L 3QDJE 2JELH 4I0CC 4L9LA 4WFED 4ZSOE 5F88B 2GYSA 5I1DB 4F7CA 1V7NH 3ARXA 4ZXBD 5F9AC 1I1AB 3GMMB 5GZOD 3B83A 3RI5F 1NAML 5A3ID 4Z7UF 3O6ML 1MHHB 1I85A 3RWJB 4PP2A 2LTQC 4OKDA 3D39E 4XTRC 4JHWL 5MEQA 4EOWL 3QDMD 2O5YH 5GRVL 3NIFE 1U58B 3MQIA 4Z0XA 4BSJA 4P5KB 4PJXA 5FK9B 1JF5A 3RIAF 1PEWA 1U8LB 5MEPB 3RTQD 3UTZB 3QXDA 4JQVA 3RNQB 5EA0L 4P9HH 5F89A 5IFAH 1JJUA 5JMRA 1F45A 4ODXB 1PKOA 1ORQA 3MV7A 2FCBA 1GPOH 4K9EC 2R39A 1JN6B 4AH2B 2QTEA 2CDEB 2VDLH 1IGML 1TLKA 1KOAA 5DQJA 1RZ7H 1K5NA 3B5TA 2QSCH 4HS8H 4U6TA 4WU7A 4J3VA 4P2QD 2HT3D 2QSQA 3MOBH 2Y5TB 3F62A 2RCSH 4IJ3C 3LAFA 3WL9B 1SEQH 4MQXC 1CXIA 3C9NA 3RHWF 4ONHA 3AAZA 2NZ9C 4CGTA 3A6CH 1FIGH 4ZAKC 4K94L 1D5ZA 3RUGF 3UEZA 1N5YL 5F8QC 4U1MA 4R4NC 1VFAA 2P45B 4ZPTB 5GS1B 2J2ZA 2G9HB 1Y6NR 2X4RA 5FEBA 4IRSC 4G42B 4LCYB 5DS8A 4OCYL 3F5WA 3P4MA 5JW4N 2VDMH 5FHAH 1WIOA 1FNLA 1HILB 3MO1B 5FCSH 5B39A 1G7QB 3F7PC 1JNJA 2IJ0C 4TPRL 1GOFA 4P48A 3MFFB 4NNXA 1FAIL 3X13A 5HHQB 5D1XA 4U1HB 2NMSA 1KXTB 1S7VA 4L9LC 4PGCA 2HMID 4XBPB 3TCXA 4A6YB 2R2HA 4LCIL 2X42A 5DD3L 1RZJC 3MJ7B 1GHFL 2DLIA 2VIRB 1DP0A 5D2NA 4PJ5E 2GQHA 4Z0BH 2CO7B 1G7MB 3MGTA 4I8DA 5FO7B 5HI5C 1I85C 2BVTA 3G6JB 3WD5L 5CINL 3OX8A 3GIVB 1JGUH 3BDYH 3QI9D 1KPUA 4M00A 4ZS6D 4JANA 1BP3B 3BPNC 4GRLA 2HH0H 4W6WB 4JQVC 3T77A 1HSBB 1ZLWK 1CI5A 2X89D 1B6UA 4JFPB 4U0RC 4PLKC 5ICXA 4YHML 5DRZB 3G6DH 4X5XA 1YY9C 3GJEB 1NGQL 2BSRB 1IC5H 3DX8B 4Z8FL 1Q0YH 5CEXB 3VDBA 1OY3B 5T1MB 1PW3A 2DJUA 4LHJB 1JPGB 4XXDA 2MWCA 4PJ7F 3BPOB 3VFOB 5J13C 5IB2A 4J6RL 3QG7L 5HDBE 4FZ8L 1GIGL 1WT5A 2JCCF 3GJFH 2FEDC 3GB7A 3KNBB 4KRPC 3LN4B 3I6KB 3HC0A 1E28B 1H0DB 4P46B 1YEFL 5FO8B 1R3LB 1I8IA 4PJEB 3Q0HA 4ONOA 2GJZA 1UJ3B 4RCAA 1T22B 1DVFA 4OZFH 4GQPH 4Y1AA 4GAJL 4RMQA 4M7KH 5HYJA 3KPPA 3KPTA 1P4BL 4EVNB 3G5XB 4XAWL 4KKLC 1N8ZA 3DV6A 3KPRA 4O51B 3SGEI 4OKVA 2WW8A 2YA0A 2HFEB 4MD5A 4U6XA 3GJFA 4PJAF 5KSBB 5SX5K 3VFWA 2P47B 3LZFH 4YH6A 1T3FB 3H0TB 3QUMA 2WP3O 5LBSL 1E27A 1KJVA 1OT1A 2QSVA 3BQUA 5FKPA 1T7ZA 4OZFA 1LDSA 3NBNA 1DEEA 3MRKB 2P8LB 4YBHA 4L8SB 4U2ZA 4X6DE 3V4VL 2J8UA 2FYYA 4KHTL 3GMPB 1OF2A 3DNKA 5D1XC 3SDAB 2YHGA 1TITA 2BVUA 3I75B 1FG2A 3RZCB 4W70A 5DMKB 4G7VL 1L7IH 5J3HC 2WWKT 4WTZG 3CPLA 5D2NC 2IWGA 3LRHA 1NMCB 4JRYE 3PGFL 5CSZA 2XQBL 3DHJA 3U0PA 4P23B 2H41A 2NY1C 3K80A 4G9FB 4E41D 1XMWA 3E2HB 1NUNB 4GRLC 2VSDA 3QIUB 3L3HB 4N0UB 1OQXA 2YK1L 5DMYA 4JPIB 5E6ZA 4M1GH 4HJ0C 1JPST 3JTTB 2DWEA 1UM6L 4PRID 2VAAB 1N6UA 4M7LT 4WVRA 2D4DA 5E8EB 5A1AA 4UQ3B 4NWTL 3TIDB 5HD8D 3U82B 3QQNA 4M9OA 1QO3B 1FLRH 4UILH 4FFVD 4XNZC 5ESVB 1EO7A 2VLRD 5MI0C 3TNNA 3LKPB 2OL3L 4FS0A 1WT5C 5D2LA 4AIZB 4QKXB 4MA7H 1BD2D 3ARDB 3L3DB 3SN6N 3VGHA 1DBJL 2YRPA 2CKBL 1MVUB 4AEFA 1HDMA 3GKWH 4KI1A 3PDOB 2F19L 3BI9X 2GCYA 2ADFL 2ED8A 1A4JA 2ZUUA 1DVFC 5EFIB 5BOPA 4X6CF 2B4CH 4YIQA 3FO2B 5IVZA 4DEPB 3UZVB 1KN4H 3WNKA 1LO0H 1ZTXL 2J7LA 1MLBA 3KYKL 1CLZH 4EI6A 1RHHB 5JQ6H 3O0RH 4KXZH 1F8TL 4XP9H 3T0BA 1CL7L 5DWUL 1IT9L 1HK6A 4M5YL 1DBAH 3EDJA 5JDSA 4PJ9B 2W65B 3W9EB 1XGPB 5EUOA 4ZO8A 2CPCA 4I1NB 1WBZB 2DQCL 3BQUC 1P9MA 1ZVYA 2EO9A 4OUUA 2P1YA 2NY2D 5HPMB 5KG9A 3SDXF 4NN6B 4C54A 4Z76B 4D2NA 1CDUA 1NCBH 4YBQD 4XZUB 1I7TA 5J1AB 1BF2A 1CFVH 1B88A 4LVHB 4N1HB 4JQIH 3IU4H 4XP1H 2XN9D 5GQBA 3TNMA 1RUMH 1CR9H 4D0DA 2WBKA 4TUKL 2Y23A 2AGJL 4HKZA 2W0FA 3SKUD 1AD9B 1X4XA 4WEUD 1AKJB 1JI1A 5IHZA 3BHBB 4LKCA 2QSTA 4AIOA 4YGVA 2F8XC 3RKPA 1TVHA 1K2DB 3VWKB 2VZOA 4HD9A 3JVGA 3JWNC 2MPAH 3NCJH 4EN3A 3VD3A 2GITB 1X5KA 5J11B 3WIHL 4AQOA 1JYXA 2DYPA 1LO5B 3PP4H 2BC4A 2MQ0A 4UT9H 4HT1H 4OZIA 2EH7H 4XX1E 3PHQB 5JHDD 2FBOJ 3BVNA 1IGFH 3GSVA 1IC7H 5E6YA 2OR9L 3TLRA 3IDYB 1LP9B 2DDQL 2Z4QB 1SY6L 4J3UA 4O2FA 2JJTA 5DTFA 4CVXB 2NY3C 2OR7A 3BEWA 4KZDL 4BFEA 4WFHD 4H1LH 3OR6A 4P57B 4Y19A 5CJOL 3SDCB 12E8L 1FG9C 3PV6B 1E4XL 1OAZH 1QFWM 4XNMA 4JDTL 4LEXH 3W39A 1NAKH 3LEXB 4YHNA 5F97E 2HJLA 3RWEB 1NLBH 4LLYA 5SWQB 3MOAH 1ZHLA 4HWZA 1LO4H 3MREB 4KKCD 4D3CL 3IETB 4BQ9A 1BOGA 5KSVA 1N5AB 2B4CC 4X6FB 2CXGA 1SYVA 5H94B 1KEGL 5HYFA 1Q9LA 2IAMD 1CT8A 3JWOH 1JYWA 4EIZC 2V17H 2D31B 4NM8L 5KVGH 5D7LB 1GCFA 5LQBH 1C16B 1MRCH 4XI5C 2E6PA 3JBG7 4MXWL 2V2TA 1PDKA 2NYYC 2QQKH 3QEQB 3RIFK 4JFOB 2DQJL 2HFGH 3GM0A 4CVZA 1U2HA 4PJHF 3RA7L 3HRZA 3GMLA 4N0CD 1ZT7B 1KCRL 5E0QA 5TE4H 4WEMB 3SCMA 2C9AA 3K46A 3QFJD 4BQ6A 3M45A 5TFSL 1R24B 4O5LH 1OVZA 3VMPA 2DOCA 3THML 3HCVB 1YY8B 2KQNA 1QFPA 3AVEA 4ZMAT 1CIUA 5TH2B 3G6AB 1CFSB 5C0GB 5FOBB 2VXUL 1OWRM 1J0ZA 4ZYKA 1LGVA 3GMQA 1C08B 1F42A 2H32B 5LAXA 2CIIB 2PXYD 2WMPA 2X4UB 3JVGC 2Q86B 1A14L 1LO3L 5K9KA 3D87B 3HI6H 2EICA 1QQDA 1Y6KR 3Q3GA 4LHUB 4FTVE 4LFHD 4OZIE 2LTQB 3TBSA 4WENB 4TTGA 1Q9WB 4OLXH 5DC9B 4LLWB 5L0QC 4P3DB 3P11H 3OAYH 3M1BB 4PJFE 3VH8B 3L3OA 2PN5A 3DIFB 5FYLH 3H6JA 2M26A 2JJTC 4OZGE 1S5HA 4RIRA 3VXUE 1X5HA 4KJWC 2VL5B 3FT2A 4XNQA 1R5WA 5KVDH 2OM5A 2X4PA 4UTBL 1IVLA 3KJ6L 4GRWB 3GHEH 4DGVH 1CU4H 1XF3B 4RZCA 4IJ3B 1J1OL 4OFVA 5EU7C 5FF6A 5I1AB 5JOFA 2BHUA 4P23D 4HEME 4PRHB 5F9WC 1PKQA 3CDCA 5IBTL 5FYKL 4MNQA 3BAEL 3EOTL 4HLJA 2UWEE 2FX7H 4GBXA 4ZAKB 4HGMA 4L29B 4L5FL 4ODTL 3KPOB 3O2DA 3LPGA 4LDOB 4UB0H 4GW4B 2P5WA 2H9GB 2DBLL 4TVPD 4U1SA 5C0CE 1FO0A 3DETC 4YDVA 1O7SA 4LSTL 3OXRB 4HX1A 2A83A 5IJVB 4U1LB 2EIZA 5CAYB 1P1ZA 3OGCA 3ARYA 1KG0B 4I13B 6CGTA 4HIIA 4ORZC 3QDGA 1PX4A 5GGSA 1NFDE 3SCMC 3ZE1F 3H9SE 4ZFZB 3JWOC 1H5BA 1I1YB 1CDBA 4FQXA 1DFBH 2DIJA 2YEZB 3VXPA 3DX7B 4HK3J 3ILPB 5EH1A 1IM9B 2X05A 4L9LB 1W72L 1KB5B 1MCFA 5ISZA 4UDUA 1CG9A 3SPVA 4F7CB 2ICWA 3ARWA 4YFLF 4L8BB 3LQZA 5FB8A 4DFHA 2QQNL 4JRWA 4ELKB 2MSPA 1SBSH 1LK2A 4LASH 2XKNB 3PGCA 4PP2B 3PWPD 4OQTH 1XGRB 2IBZY 1WK0A 3NZHH 4PJCE 4Z0XB 2WM0A 4PJXB 3BPNB 2VXSH 3HFML 4XVSL 4F7MA 2G2RA 4C4KT 3OB8A 4AZ8A 4YC2B 4S1DD 5F89B 4LLQA 4U0RB 3SE3A 1GGCH 1QKZL 1S7WB 2DTMH 4FFYH 1ORQB 1JNNH 1QBBA 3MV7B 4RAUA 1E6JH 1EEZA 4K71C 1A9BB 3LS5H 4WUUA 4KAQH 4OM0H 3PE9A 4M02A 1MREH 5E56A 4IDJH 1K5NB 4WU7B 5JXEC 4KUCF 4OQTA 4NGHH 1P53A 3B3IA 3K2UL 4KGLA 4QXTB 1NGZA 3P9WB 4D94A 3F58H 3NTCH 4KRPB 4FXLA 3I50L 3MRBA 3GBML 1AKJD 2FL5A 3O41A 2M2DA 5DEFB 4MNQE 3IGAA 2E6QA 3IFOA 1QSEA 4ONHB 3RAJL 1YMHA 4NKMA 3AAZB 5C08A 1MNUL 2P8PA 2DLFL 1D5ZB 4U1MB 1VFAB 4WCYL 2G60H 2NNAA 3BIBX 4CNIA 2O5ZL 4NQSA 3VWJA 2M8XA 2X1WL 4OBRA 3FO0H 5CD5D 4LHQB 2DQDL 1DUYA 5DS8B 4PS4L 5F7EH 4YQXL 4G80A 1I3RA 4XP6L 1MVFA 5F3HA 3P4MB 3O2WH 3FL7A 4UV7H 5K9JL 5B39B 4WI7A 3IJSA 2P5EE 4KK5C 1H5BC 3O3AA 1I8KA 4NNXB 3E8UH 4GMSL 4YHOL 1PAMA 2DLTA 5ALBH 5D1XB 3FO9A 5E2WH 4NQED 1S7VB 1YEGL 4PGCB 3MOQA 2CUHA 4HFUL 1IAMA 1HH6B 4WNQA 5D2NB 1MSPA 1GJIA 2E6JA 4JM2B 2CLZB 1X4YA 3OX8B 3DO7A 2A6JB 3ARFA 1K4DA 2NY1B 3ILQC 1KPUB 2VERN 4FQIH 4NDMA 4GRLB 3D9AH 1BGXL 2NLJA 3VI3E 4FNLH 4GW1B 3SE3C 4WDIA 3DYOA 1NGYA 1P4IL 3WIFA 2RIKA 5HI4D 4JLRA 4UT7L 4X5XB 5FUOH 4G8EA 4XH2B 5D7LD 2E7LA 4XXDB 2XPGA 3V7MA 4XNZB 5MI0B 1FQ9C 3L3KA 5DA0B 3MRNA 5D70L 3GB7B 5A16A 3F7YA 3LRGA 4Q9QH 1NMBH 3HC0B 2GAZA 2QBWA 3KLAB 1I8IB 4LOUD 2GJZB 1Z9SA 2R69L 5AYUL 1KPVA 4S1RH 2SEBA 4Y1AB 2YKLL 4WHYH 4NKDA 1JPSH 5HYJB 3KPPB 4M7LH 1RQ5A 3TYGH 3QDJD 1HHJA 3P0VH 1N8ZB 1OQOA 2I24N 4OF8A 3WUWA 3DV6B 3KPRB 5IEHA 4OKVB 3VWJC 3WIIH 3ULVL 4K3HA 4NYLA 4DVRH 4JFZL 4MD5B 3GJFB 3VFWB 4ZNEA 1D5BA 3REWA 4LHUD 4TSAL 5HYQA 1R3KB 2CDGB 4HUWA 4LPUA 3QUMB 5J9PA 4BSWA 4XTRD 1CTNA 1EJOH 1KJVB 3ARPA 4XPGL 5I30H 4OZHF 3EYVB 3D39D 3BQUB 4HIXL 3OJVC 4LSQH 5FKPB 4OI7A 4OZFB 3DHMA 1GC1L 1DEEB 2J8UB 2YN3A 2FYYB 4HJJL 4OGXL 4KH2A 1XZ0B 1OF2B 3EYSH 3GSOA 4MMZC 5CGYC 1W8NA 3W11C 1YECL 2YMXL 1B0RB 3TIEA 1KCKA 1CQYA 1FG2B 2VL4A 1GZPA 2HWZL 1JRHL 4XVJL 5T3ZE 2ZG1A 4YPJA 1KXVC 2BRRL 5GXBB 3CPLB 4MA1C 4PFEA 4CMHC 1QRNE 3NCFB 1FCGA 4LCCA 4UIMA 4JKPH 3DVFA 2R0WL 3U0PB 3ARFC 4F37F 2FD6L 1BLNA 4GKOA 1RY7B 3HPJB 1CLOH 2VRAA 3BD3A 5IW3A 1FAKT 2A6DA 4PJGF 4AEIH 2DWEB 3BZFA 5CEZH 3RVWC 3FFCA 4WW2A 2B0SH 2VABA 4FQJL 5IR1A 2E7LC 4IRSD 2P8MA 3UBXA 3TBTA 5TQ0H 1P5UA 5D2LB 1DR9A 4X9BA 4HWEL 3H3PL 1ED3A 1FVCA 1NPUA 1MCOL 1VFOA 1HDMB 1QFOA 5I18L 1ZGLA 2VE6A 2GCYB 4WWKA 3IVKB 1W0WA 3RKDC 2NY3B 5KTEL 5IVZB 1L0XA 2X41A 3HMXA 3Q6GH 1OARH 4HXBH 1IRAY 3U9UA 4KRLB 1PEZA 3PHSA 4ZNEE 1EEUA 1UXWA 1YYLL 4XWGL 4PJ5D 5FDWB 3T0WA 5JDSB 5IVOA 3V6FA 4QXWA 4OUUB 1AXIB 1NGPH 5KG9B 1G7HA 1BX2A 2I9TA 2XIDA 1I7TB 1CICC 1FZMB 3MV7D 4P5MA 4X4YB 4P4KC 4APQA 3NA9H 1YY9D 1RJCA 3R8QA 4RFOH 4Y4KA 1DL7H 3TNMB 3QIWB 4HH9A 1SEBA 3I02B 1UM5H 2CIKA 3WKML 5D5MB 4ELMA 5FAAA 3UO1H 4RMSA 1RHFA 4ORGB 2H2PC 2X9WA 3MLVH 4LCCC 4XXCA 5D1ZA 5I8CA 2FEDD 2ZUXA 3QCUH 4M5ZL 3WJLA 5IHZB 4RMUA 4LKCB 2AJYL 1J88A 4PJ8A 1DBKL 1XGYH 1YEHH 4YGVB 2VLJB 3EW3B 1BQHB 3VJ6A 1AFVH 3LHPH 5BO1H 4BUGA 4U1KA 1U8QA 4KKLD 1U3HA 4DAGH 3TPKA 4G6AD 3SE8L 4WW2C 3TCLA 3UTSE 5CILH 3BN9D 8FABA 1RZKL 3BKYL 3FO1A 5DJ8B 4NOBA 5F7YC 2BC4B 4NWUL 2GI7A 1KTLA 4PREA 5KJRL 4XT1C 5HHMB 3BVNB 4M1CC 1CGWA 4M1DL 3GSVB 3EJYD 3GDBA 4D9RE 1ACZA 1AIFA 3T2QA 3HHRB 4H20H 4WI4A 4WWKC 1C12A 4O2FB 3LKQB 5DTFB 2AJUH 3SGKA 5D1XD 4ZNCD 3JUYA 4RA0C 3RWCA 3BEWB 3HC3H 4E5XB 3L6FA 3S88L 3HNVH 3OR6B 4Y19B 4LIQE 1VEPA 4XNMB 3W39B 5D7SH 3I9GL 4YHNB 5T1DH 3REVB 2HJLB 4L4TE 2H26A 5KS9A 4MAYD 1MQKL 1ZHLB 1JWUA 2NY1D 3ZYOA 3KHQA 1BOGB 4AEHL 4GRLD 3OKKA 3VMNA 3ZT5A 1R0AL 2PYFA 1SYVB 2HT4D 1CT8B 1Y0LB 4H1LB 3CXHK 3JWDL 4APQC 4HJ0D 4JCMA 4U6VL 1GL4B 1MWAL 5DLMH 5IBUB 3EFDH 4JY4A 4XB7A 5F72S 1N6QH 3O6FD 3B5HA 4Y4KC 5IT2H 2D7PA 4ELME 2V2TB 1MFBH 4ETYA 3ARGB 1A3RL 3MUY1 1JVKA 4CVZB 3CVIH 1UH2A 2R56H 4KDTA 3HRZB 4BSVA 3GMLB 5D1ZC 3MCG1 2XOTA 4XXCC 3PWJA 3SCMB 3CDGB 3TO4D 1ZOXA 4MS8C 5ITFB 3D3VA 2HJFA 4WO4A 5DD5H 2IQAA 3LQMA 4PJ8C 5GGRB 3R1GL 1DVFD 1F3DJ 3GMQB 5HYJD 2L4OA 5LAXB 1EGJL 1YJDL 1V7ML 1PX3A 1U3HC 3B9AA 5K9KB 3C8HA 3P30L 4CAGA 1QQDB 5FA3A 2VQ1B 5B3NA 4PJDE 5KVEH 3Q3GB 4EDWL 5C0RH 3AGVA 1LK3L 1NEUA 3TBSB 1J1PH 3PQYA 3I85A 1T7YA 3VFRA 3BQUD 2C3WA 2BNRB 5FDYA 2VDRH 3L3OB 5FM8A 4Q74A 3RBSA 5GRZA 4ODSL 5MERA 3FZUC 2VMFA 5FYJL 1S5HB 4K71B 4RIRB 3SGKC 1S9VA 2R1XA 1R6VA 2IH1A 2VITA 4P5TA 1YEJL 1CF8L 3FT2B 1G9MC 4XNQB 2X4NA 5KVFL 3G9VA 3VD5A 3C2AL 2X4PB 4Y2DB 4NZRH 1G1CA 2HTKC 1X5JA 3DX9A 4XVTH 3ZL4L 4RZCB 4OLWH 4FQLH 5FF6B 4MD0B 4GUPA 2B2XH 3CFJA 4CW1A 3HNSL 3OJ2C 4PGZA 1EK3A 3MLWH 4TUOB 4DGIL 1DJSA 3GK8L 3MJ9L 4MZ3A 1YC7A 1IAIH 1L0YA 4MQ7A 1U8KA 4GFTB 2DIBA 2P5WB 1CBVH 4U1SB 2B39A 4Z7NF 1FO0B 4YDVB 1NCDL 3LQAL 1OP5H 3QUYA 1GGYA 4HX1B 2V5RA 1J5OL 4GRMB 2EIZB 4I77L 2WUCH 1P1ZB 4PLJC 3SE9H 4OGAD 4NZTL 1T04B 2Z35A 1VKXA 4KDTC 4HIIB 1J11A 3QDGB 2C3XA 5GGSB 3CDYA 4GXUM 4LPYA 1H5BB 4GG6F 2FWOA 4WO4C 3HZVA 5GIRA 5E5UB 3U30C 2NXYC 3CNKA 4F58L 2IMMA 2X4SA 3DUHA 3P0YL 5DZLA 3RUGE 3WNPA 1T66C 3MRQA 1F2XK 1NAMH 4UDUB 5ISZB 3SPVB 2PTTA 4PJIF 5FB8B 5SWZE 4K3DH 4JHWH 5I9QC 4EOWH 2FH8A 1LK2B 2VZVA 2Z9TA 1UQSB 3PQYE 3VDCA 3UMTA 3UJTL 5EA0H 3BZEA 1I9EA 4XC3L 3MLZL 2UVEA 5F7UA 1P2CA 1FE8L 4S1QL 4RAUB 1V3JA 3QULB 2Y6SD 5LWYH 1MCCA 1KJMA 1BQUA 1EEZB 1OHQA 1IGMH 4HV8A 3O3DA 4WUUB 3O4LB 2E7CA 2AEIT 4P5TC 4QOKA 5ECJE 1JZ5A 4XI5D 1YQ2A 5BZDA 4ODWA 2IEPA 5FV1L 4F7EA 3B3IB 2XZCH 1NGZB 4H0HB 1EPFA 2WIIA 3C08L 5DT1L 5C1MB 1UYWL 2EKSB 1IEAA 3MRBB 1D3CA 5EUKA 2FL5B 3O41B 2G5BA 3GBNH 3IGAB 3IFOB 1QSEB 4XB8A 2C7UA 4CVUA 3ET9F 5C08B 2P8PB 1NDMA 3GHBL 4XWOC 1N5YH 2HJKA 3E3QC 4MQSB 5EBWA 4R8WH 2XG4A 2NNAB 3WS6A 4EUPA 4CNIB 3VWJB 1MCNA 5BW7A 4YDIL 5EO9A 1Z9LA 3QUYC 1F4WL 4EN3D 4HBCL 3KGRA 1DUYB 1ZGLM 1I9IH 1ZVSB 2DYPD 3BKJL 1PG7L 5SWSE 4G80B 4FTVD 5F3HB 4HK3N 3ZSTA 5HHMD 5J12C 2ED9A 5K59F 1FAIH 2I9LA 1INDL 2D03H 4G8FA 5DRXA 5EOQH 3O3AB 1A21A 1I8KB 1KFAL 5DUBA 2GKIA 4BKLA 1EEYA 1UFUA 3DGCR 3QUXA 1C1EL 1RIVL 3FO9B 3QNZA 3WHXA 3FAWA 2VLKA 2WUBL 3GI8L 3Q6FA 5DD3H 3QQ3A 4KJWD 3CLEH 1GHFH 1H9VA 4Y19D 4KI5C 2BXZA 5I1EL 3C87A 3OZ9H 3MMEA 4WNQB 4MA1B 3WD5H 2YWYA 3NACL 4HXAL 4CMHB 2XZAL 4PJAE 4F3FA 3T04D 2D9QB 2AXHA 1F6FB 4HKXA 3V6ZA 5IROA 3DO7B 3S4SA 1U3JA 3ARFB 2JKXA 3AS3A 5GS0C 3ESUF 4LEOA 5I1GL 1KB9J 5EU6B 4NDMB 3QJHA 5LXGL 4YHMH 2NLJB 3T1FA 3W5NA 1NGQH 4WDIB 4Z8FH 1NGYB 4Z7WB 3WIFB 4JLRB 1HHHA 4YEFA 5JOPE 2VR5A 3KS0H 5HVGB 4L8CA 3BJLA 2Y5EA 4G8EB 4QOKE 5HXMA 2APWA 5C0CD 4J6RH 3QG7H 2XPGB 1II4E 1GIGH 4FZ8H 4GSDL 2FECL 1XIWD 2IPUK 5KOMC 1OSZA 4J3WA 3L3KB 2CUMA 3MRNB 1YEFH 5A16B 3F7YB 2OP4L 4P2RB 4OB5L 4OCSL 2GAZB 3EFFA 3UPCA 1X6NA 4CL7A 1IGYA 1NCNA 4GAJH 4ACPA 1P4BH 1KPVB 2FX9L 4XAWH 2SEBB 4R7NB 4NKDB 1WZLA 2VJXA 1HHJB 3WUWB 4V1DE 3WS6C 1GGTA 5IEHB 5HI3D 5BW7C 4NYLB 1KBGL 1W8OA 5LBSH 4QCIA 3DRTB 1D5BB 3REWB 5HYQB 4HUWB 4X6EA 5J9PB 4BSWB 1NSNL 2XWBA 1MCSA 4OF7A 4WFFE 2AV7B 4RMVA 4AJ0A 4K94C 1RJYA 5T5FL 4MAUL 4UOW1 4KHTH 3IF1B 4Y89A 3VA2C 3GSQA 1CICB 5FHBL 4P4KB 2BY2A 3QUXC 4JN2A 1KPRA 3VFMA 3GSOB 2ERJB 4JFYA 4G7VH 4NQDA 3RVTC 3TIEB 3MV8B 4KK8D 3GSNL 4NHCL 5B8CA 4YLQT 2CO6B 1NBZA 3TVMA 1YMME 3PGFH 4BFIA 3S9DB 2XQBH 2V7NB 4LSPH 3HNTH 4LCCB 4UIMB 1EXUA 5IROC 3EIFA 5MHSE 4HMDA 1BLNB 1RUAL 2YK1H 4MNQD 5CZKA 1MJ8L 4NZUL 3SDXE 1T21A 2XT1B 3GI9L 3RFZC 1FDLL 1UM6H 5F6IC 2ESVE 1SJVA 3QPXL 4GBXD 2A6DB 3HC4L 5IVXE 4M61B 1IC1A 3SDDA 5JW4M 2P5WD 4BH7B 4ODVL 1ORSA 3CFBA 3D85B 3FFCB 3MBXL 4WW2B 2VABB 5IR1B 1NLDL 2OL3H 2P8MB 5DVLA 3UBXB 5I66A 4MXVF 3MSPA 2CKBH 3RY5A 5DEGA 3ORJA 1FVCB 3OV6A 2F19H 4JDZB 4JVPA 1I1FB 5E99L 4YWGL 2ADFH 1CGYA 5A43C 1HHIA 2P5ED 2QR0A 2VE6B 4FQXD 4L8DA 4WWKB 3TP4A 3ARSA 1A2YA 3G6JF 3ALPA 3P9LA 4KWUA 2OL3A 4FMKA 1CL7H 3U9UB 2FX8H 4M5YH 3U7YL 3TJHD 2EDOA 4E42A 1XR8A 3ZKNC 2DQCH 1BFOA 3GEWB 4Q9CA 3V6FB 3ALXA 4G8GB 3LN5A 1VGEL 4GKZA 1M05A 3GJFK 2DQHL 3LDBB 3STZB 4U49A 4Q2ZA 4R97B 2I9TB 4LFHG 1OTUC 1UENA 4P5MB 5GSRB 1MH5B 4QRPA 2LU4A 4ZDHA 1YN7B 1EUUA 4WUUD 1A8JH 3ARRA 4TUKH 4Y4KB 2Y06L 5B8CC 1KYOK 4HH9B 2AGJH 1SEBB 4GOSA 4AY0A 2CIKB 3TVMC 2ATPA 3U83A 5D1ZB 5I8CB 3I3EA 1JCKA 4ZFOL 43CAA 1U93A 4PJ8B 4XCFL 5KSBF 4JPVL 5I74C 2W9EH 3BIAX 4RFEA 1INEL 2F5AL 5MEOA 1U8QB 1ZVHA 1JGDA 3SDDC 2NY4C 1NC2A 1WCBA 2ZCHL 1U3HB 7CGTA 2EDFA 1G0DA 3LN9A 5CZXD 3RZWA 4OTXL 8FABB 3OMZA 1Y18B 3FO1B 1HKLL 4JGUA 1AI1L 3MCLL 5I1IL 1UGNA 3MV9A 3HZYA 1KTLB 4PREB 1QBLL 3G5ZB 5EZJA 3L95A 1VACB 3RPIA 2XACC 5F70A 1EERB 1SY6H 5F1KC 1AIFB 3IU3A 1BVZA 1ZS8B 2PO6A 4KVCL 1C12B 1X44A 5E6IA 3WIHA 4QHLA 4YO0A 5CGYD 1MIEH 1OGAA 5CJOH 4KHXL 4XPTL 12E8H 25C8L 3NFSL 4JDTH 1MCEA 5D93C 4AM0A 1HYSD 3FKUS 4HG4J 4GKSA 5T3ZD 4J1UA 1RULL 1S7UA 5GRJL 4D3CH 2H26B 3LSOA 5KS9B 3H3KA 4QRRA 3ARFD 2FZ3A 1P7KB 3CFKA 5F9OL 3OKKB 1F58L 4XMLH 1TDQA 4NM8H 4O9HL 5C0BA 1IZKA 1MCBA 2XTJC 4QRPE 1WISA 3ZDZE 1JMXA 4KV5F 1IKFL 1U8JA 3ZE2E 4JY4B 3UTPE 3RVWD 4P4RB 3U46A 2DQJH 3JUZA 3P73B 1YPZE 1UKTA 3QHFL 3RA7H 5DMGC 1KCRH 3Q2CA 7FABL 4W6YB 3CLFL 4BSVB 3THMH 3PWJB 4DKEL 1YN6A 2LAAA 5DD0H 3T0XA 4MJIA 5L6YL 1WWCA 4LGSB 3UYRL 3J7HA 2DICA 3D3VB 2HJFB 2ZPKL 3DVIA 4WO4B 5DJAB 4B53A 2IQAB 4IOFC 3MRHA 3U30B 2NXYB 3U48A 3BXNA 5C07A 3RKDD 1LO3H 4G7YH 4LLMA 1YNLL 2GJ6A 2VXQL 1X3DA 1GVIA 3EYFA 5HVHC 5FA3B 2BZDA 1QACA 3EOBA 2X09A 3E6FA 3HG1E 5I9QB 4N0FA 1A7RH 1BWWA 1XGUA 3MV9E 2JJWA 4KUZH 3AS0A 4OCRL 5BVJB 5I76A 4PG9A 5K93A 3FN9A 4OLVH 1AO7A 1O5DT 3NAAH 3ZE1E 1VPOL 3S34L 5MERB 1FLTX 4JZOA 2PO6C 1AR1C 1XEDA 1S9VB 4XCEA 4BUHA 2KPNA 2VITB 5IHUL 3BE1L 4CU8A 3UJIL 4P5TB 2VDKL 4UTBH 5JTWA 3KJ6H 2UZIH 4FQHB 5D7JD 1RUPL 1LD9A 1J12A 2ED7A 3DX9B 3L5XL 3K8LA 4V2BA 1IGIH 5CCKL 3KR3H 5IBTH 5F1NA 5FYKH 1NCCH 1MRFL 2ICWI 4GUPB 5E8NB 3CFJB 3BAEH 3SEPA 4CW1B 1MCRA 2WSKA 3EOTH 4Y2DD 1XFPA 3BGFC 4L5FH 4ERSL 5C0BE 3T0DA 4P9ML 2DBLH 4NKOA 3MLRH 4D8PA 5T1KA 4EDXA 4LAJH 1U8KB 2AS5M 1KC5L 3GGWA 4LSTH 3ZTJH 4Y4FC 1RSFA 1QNZL 2YXFA 3QUYB 3OAUL 1JWMB 1AP2A 3H8NA 5DQDL 3UTSD 2APTA 3QWRA 1NKOA 3EDKA 2Z35B 1VKXB 3NZ8B 1L4IA 4MJIE 5J12B 2BVEA 2KUTA 2JK5A 5CKAA 4M1CD 5IKCA 4JFHD 1O0VA 5L8KB 2FWOB 3FQWB 3HZVB 5GIRB 4D9RD 3O3UN 5LVEA 2ORBL 2X4SB 5C8JB 4L3AA 1L6ZA 5HHNA 1FFPA 2R0ZH 2QQNH 5DQ9A 3RJQB 3S8WA 4ZO9A 3TFKC 2PTTB 5J56B 1DQLL 3LKNA 3C6LD 4HW6A 4FFWC 2AJSL 5LGJB 2NX5A 5TDPA 3QIBA 4P9HL 3PJSA 1AO7E 3BZEB 1W72A 4R90H 3VXTB 3ARED 4J3SA 1D5XA 1PY4A 1GPOL 1P2CB 3UTQA 1KTDA 2UY6A 4LHUG 1NAMB 4RQQA 2VLMD 4BZ2L 1KJMB 4APQD 1YC8A 5ETUA 3O3DB 3ZKXC 3X11B 4HUUA 5BZDB 2YWZA 4ODWB 3VH8G 3FT4A 3K2UH 4MMXC 4F7EB 3VXSA 4WV1A 3LKSA 1I4FA 1FZKA 2WIIB 3O9WA 5D1ZD 3RAJH 1IEAB 5IFHH 1IILE 1MNUH 3S3JA 4PJBB 3NA4A 2G5BB 2DLFH 3IFLL 2C7UB 4KQ3L 1NDMB 5I1LA 4ISVB 4MA8H 4ENEC 3EJJX 3GMOA 3STLA 2EXYD 3NIFF 4EUPB 2DMBA 2Q8BL 4YQXH 5EO9B 5F71A 1FFQA 2UUDH 4XP6H 4MA3A 3HS0A 4N5EC 4P2OB 1E6OL 4PRPA 3VXMA 2DQIL 3O3BA 5T3XE 2F54A 3CIQA 5IMLA 4LDEB 3BRFA 3V5DA 3N9GH 2I9LB 4QXGL 4YHOH 5DRXB 4G8FB 4GRWF 4BM7A 5E5RB 4D9LL 2OMNA 2YD1A 1EEYB 1YEGH 3FZUD 3QUXB 1EAPA 2BJML 4C56E 5I75C 3LEYL 4HFUH 2VLKB 3Q6FB 3CCHA 1AXTL 3KPSB 5CIPH 2WWKO 3MMEB 2XY2A 2YD6A 3BDYL 2HTKD 1HNGA 5ALCH 2NX5E 4Z9KB 3TPUA 3OF6A 4F3FB 4NHUA 5JLZA 4LL9A 3LVEA 4HKXB 4DZBA 3V6ZB 4HUXA 1KCVH 3QIBC 1BGXH 4OZHE 2IANA 5HGDA 4D9QD 5E1HB 1BBDL 3T1FB 5L2KE 1IC5L 1KCUL 1Q0YL 2NZIA 5F6IB 5F7LB 1HHHB 5CIPA 1KIPA 1P7QA 4B50A 3P4NB 4DWHA 2X10A 2GK0B 3TT3H 2VB5A 3VXSE 5D70H 1J8HA 2A2QT 4FQQA 4WV1C 2IPUG 3B2VL 3O9WC 3QZWG 3NH7H 5A2LH 2R69H 3EFFB 5AYUH 1IGYB 3RL1B 5ICYA 5ABDE 5DRNA 3FRPA 4MXQD 2GJJA 4NFDA 2L0DA 3UAJC 1SHMA 3ULVH 1XAUA 1V8HA 3HUJA 4LVOB 1QZ1A 2QADC 4HCRL 4PJXF 2ZUTA 1MAML 3TZVD 2J88L 4TSAH 4U7KA 3SJVB 2F53A 4QCIB 3VXME 5FGCB 5SWZD 1KXQE 4XPGH 4CRPA 4NQUA 4X6EB 4HIXH 5IM7B 1RJZA 1MFCL 2XWBB 4I2XE 3PQYD 2WZPD 1GC1H 4N9GA 1FVDA 5DDHA 1RJYB 1MHCA 3MRFB 4OGXH 4MDJA 1Q94A 3UBXI 3GSQB 2GHWB 5FGBA 1YECH 1OTSD 2YMXH 5CSGA 5HDBF 3VFMB 1KPRB 1UB5A 4G6FB 2HWZH 3DYMA 2R8SH 1RI8A 2IMNA 4JFYB 1JRHH 4NQDB 5B39G 2BRRH 4IRJA 2EYRB 5KOVC 2AK4E 1K9TA 5C9JB 4BFIB 1ULVA 3PP3H 4IRZL 3QP3A 4KJQD 4WTXA 4Z77A 4U6YA 4X7EC 4UOJA 5D6CB 5T1LA 2FD6H 5F21B 5FKAA 1EXUB 2NW3A 5CHNB 2HVKB 5E94A 2IANE 3OKLA 5IB1A 5ACZA 4M1GL 4HPYL 1UWXH 1T21B 5I74B 15C8L 2VOTA 1VGKA 4UAOC 3FB8A 3I3BA 3K8MA 3FQUA 4JFEE 3HAEH 2UZYB 3SDDB 1J0IA 2NY4B 4JDVB 1FLRL 4UILL 3CFBB 2NY0D 4PGBA 1FZJA 2YR3A 4M93C 4MA7L 1J8HE 4X6DF 3H3PH 5I66B 4F15B 1OAUL 3ECBA 1HIMH 1MCOH 4NQCA 5DEGB 5SWSD 3CFIC 2IFFL 3EOAB 4UZGA 1BEYH 1HHIB 3GUTA 2W1NA 3HAEA 2QR0B 3RNKA 1KN4L 2W9LA 2UV3A 4JFDE 3O0RL 1X5GA 1FYTE 1SJHB 3P9LB 1EEQA 4WFGD 4XP9L 2OL3B 1T7VA 4F7TA 3QFDA 3VFPA 3HZMB 3MLPA 4KI5D 1YYLH 1LVEA 1M6OA 2CKBB 4AIXA 2AEQH 4E42B 2APVA 4AENA 4NFCA 4LRNH 5JO5A 3JSSA 5LJYH 3RY4A 2K3TA 1BFOB 1MLCB 5GS0D 5B38B 3LN5B 4KMLB 4M43H 5FECA 2ZKHL 3ULVC 3QXAA 4JQIL 2XTJB 3IU4L 4OLZL 5FGBC 4XP1L 2JIXD 3D2UA 1RUML 4HIJB 4ZDHB 5JOPD 3DWTA 3C8KB 5HGBA 3VFGH 3WKMH 4QOKD 1M71A 4IRJC 1BBJA 1UH4A 3OWEA 5IP4A 4TSCL 6FABL 2EDWA 1FL5A 3D25A 2ATPB 1EZVX 1RJLA 1CD8A 1OGTA 3D18A 2AJYH 3FONA 1NCAH 3ZYZA 3GSXA 3S36L 3MBED 43CAB 5I8OL 1U93B 4B5EA 4HQQL 5HTSA 4RFEB 2KZWA 3KYNA 5MEOB 1RK1A 1JGDB 5D7IA 1NC2B 1WCBB 3WYRA 5CBEA 3PP4L 4QY8A 1RZKH 5A40E 5HVHB 4V1DD 2AEWA 3BKYH 3PL6A 4HT1L 3R06A 4NWUH 2D7OA 4WW1A 5KZCB 1K4CA 2X7LA 4MZ2A 2J8UF 5KJRH 1IC7L 1CFNA 3HZYB 5EZJB 4OV5A 2BY3A 4M1DH 3L95B 1CFQA 1TJGL 2IPTL 4P2YA 4TTDC 1J7VR 5L9DL 2BOCA 4BH8A 3IU3B 4U1IA 1VEMA 3QUXD 1TENA 1UZ8A 2IPKA 2M1KA 4QHLB 4YO0B 1OGAB 4LEXL 4XGZA 3O8XB 4AM0B 4Z7VA 1UWGL 1HXMA 4FFZH 4I4WA 5EB9A 1EMTL 4FQ1H 1MQKH 4QNPF 3LSOB 4QRRB 2FZ3B 1R0AH 1S7SA 5MHSD 3CFKB 2V17L 4Q0XL 3WFDL 3JWDH 5KVGL 1V3MA 4U6VH 1MWAH 3TN0D 5DGQA 2NQCA 2EDYA 5D2LF 3CH1A 5GZND 3QEHB 2FSEA 2VC2L 4CDGC 1A47A 3V8OA 1U8JB 4PV8A 4Y4FB 3BIKA 3CFEA 5C0AA 2MJWA 3U46B 3P4OA 2P48B 2F74A 32C2A 2KL6A 3WLBB 3MNWB 3SGDH 3WO4C 3ARTA 4UNUA 4WTWA 1YN6B 4LNRB 4HZLA 5C86A 3RVVC 1MWAA 5IQ7L 2ITCA 3QQ9D 3R1GH 2I26N 3C5SA 3NCEB 3MRHB 3IDGA 1JPFA 1O7VA 3U36A 3MC0A 3BXNB 2R23A 5C07B 4HPOL 2BDNL 5F6HI 5L7XL 1V7MH 1QOKA 1MJUL 4LLMB 4N8VG 5EUOF 2GJ6B 3OJDA 2HTLC 4R2GC 4EDWH 4F2MA 3EYFB 4Z7NE 5DD6B 1LK3H 3VD4A 4ONGL 2EDHA 4GO6B 3PL6C 3ALWA 3CVHH 3EOBB 3E6FB 4NM4L 1DDHA 3ULUE 4N0FB 4CADA 4YFDB 1CLYH 1XGUB 3OB0H 4KKBC 3ZKND 3P11L 1P4LA 3ULSA 4J4PD 4Y7MA 1ZHKA 3GZKA 5I76B 4C4KO 1EGJA 5FYJH 1X7QA 3OGOE 4HMCA 4S1SL 1C5CL 1OTUD 1J9CT 4JZOB 1U2CA 1YEJH 3ARVA 1CF8H 1H3VA 3KYMA 4XCEB 5KVFH 2H3NB 3ISWA 3GHEL 2AK1H 4DGVL 3ZKXB 4NQDD 2XQYK 3HZKA 1IAII 4D0CA 1OAQL 1CU4L 4R4FL 1T7XA 1LD9B 2FATL 3TVMD 3MR9A 4RWYL 4ZO7A 3HNSH 5F1NB 5GSVA 2FX7L 4DGIH 3SKNA 1BF8A 3GK8H 5C71A 2DLGA 4A2MA 3MJ9H 3DGGA 4L4VA 5IJKA 4NKOB 2JJUA 2JCCA 4D8PB 3VRLE 2EE3A 3EO9L 4HDIB 5T1KB 4EDXB 4OZIF 1NCDH 3GGWB 1J5OH 4XPHL 4I77H 2R0LL 1D6EA 1NUGA 3U2SA 4NZTH 4JPWH 2OK0L 4H0IA 4YDJB 3IJHA 4QGTA 2FJFA 5EOCL 4R7DB 1JZ6A 4OZGF 4AK1A 2JK5B 5IBUG 3JWDC 4PG2C 1NUFA 1JF6A 5IKCB 4GAFB 4JY6A 4RSVA 1I1AA 3GMMA 2P43B 3P0YH 5H2BB 4M3JA 1UEYA 1TJIL 3B9KD 4LPWA 1R5IB 1U0QA 1FFPB 1HQ4A 1C7SA 5GHWH 1UACL 5D8JH 5DQ9B 3H42L 5FM4A 1CCZA 1U58A 4P5KA 3T09A 5FK9A 3S98A 3UJTH 2J6EL 2V9QA 4DOHB 2VXSL 3HA0A 3PNWA 4FQCL 5TDPB 1KJ2H 1QYGL 3HLAA 3MLZH 2E27L 4N9OB 3FOMA 5SV3A 3QIBB 1WSST 1GGCL 5FGRA 1FE8H 1QPPA 1W72B 4AH2A 4X7FC 4S1QH 1D5XB 2CDEA 3BYYA 1YJDC 3UTQB 1KTDB 1MJ7H 3LS5L 1U8MA 4RQQB 1MREL 2P49B 2ZCLL 1G6RH 5EC2A 3U1SH 3R0MA 2Y5TA 4QRPD 5ETUB 5F7MC 2VSCA 4E41E 1QEWA 3LPFA 5DVKA 3GMNB 3WL9A 4HUUB 3F58L 3FT4B 3NTCL 5FCUH 1BECA 5DT1H 2CLVB 5DMGD 1UYWH 2VO5A 3EJZC 1FZKB 4M6ML 5F6HJ 3RWIA 3O9WB 4HK0A 1BJ8A 4K8RH 3GHBH 4ZPTA 5GS1A 4L4VE 5JPNA 3DUUB 3WEXA 5I1LB 5IJKC 4OT1L 2VLRE 4LCWA 3BP6A 3GMOB 4CN6A 4YDIH 1BD2E 2QADB 1GAFL 1F4WH 4HBCH 4PJCF 1ADQA 1NC2D 1EFQA 1WFOA 1HILA 1TZHA 1ITBB 3BKJH 1G7QA 1PG7H 4MJ5A 4RBPH 4F8TA 5IWLA 4UV7L 3QHTC 3MFFA 4PRPB 4X6CA 1BZQK 3HG1D 5HHQA 3M8OL 1UKSA 2F54B 1QTYT 4U1HA 5IMLB 3MV9D 3FQXB 2APFA 3E8UL 4OSUL 4JN1L 2IC2A 4KY1L 1RIVH 1I1AC 2VKXA 3LQAC 3BP7B 3MJ7A 2XZQL 2WUBH 2PO6D 5F9DC 5E6ID 1U6AH 1EAPB 1UG9A 4X8JA 2KBGA 1YEDA 3CCHB 1ZWIA 5I1EH 5HGGS 4UV4L 3NACH 4HXAH 2XZAH 1T4KA 2OMBA 1IGTA 5D1QB 1QFUL 3VG0L 3TPUB 1HSBA 1ZSDA 4NHUB 1ZT4A 5JLZB 5AAWA 5DI8A 4HUXB 5DRZA 5LXGH 3DXAA 3DX8A 2B20A 5HGDB 3WLWD 4EIGB 4EQ2A 4NJ9L 3CX5K 4UAOB 2XFXA 1JPGA 1GYAA 5C0BD 3VFOA 3VFNA 3F6LA 2E7BA 1QD0A 5CIPB 1RZFL 1KV3A 1KIPB 1P7QB 5B3JF 5HYSG 1JK8A 4JGJA 4GSDH 5JW4Q 2BNQA 4M93B 5INDA 4X7SL 4Q9QL 4FMFA 4MJ4A 4WI3A 3MTRA 5F7FA 2OTUA 2YD2A 4ZUWB 1FFRA 2E9JA 2OJEB 3G5XA 4U3XA 4MJID 5EZLA 2FX9H 1JNLL 2YXMA 4O51A 1EJ6A 4JY5L 4OFIA 5ICYB 5DRNB 4OLUH 2ADIA 3DV4A 1IEBA 4DVRL 2EC9U 3WFHA 3HUJB 3EGSA 1HN1A 1KBGH 1FRGL 1ZGLP 3QUZB 1DUZA 1S78C 3TFKD 4IHOA 1EJOL 1NJ9A 3IAPA 4PPTA 3VI3F 2F53B 5IWLC 1NSNH 3LPWA 1MF2H 3FB5A 3RX5A 1RJZB 4KZEH 5T5FH 1P5VA 4MAUH 5ICZA 4N9GB 4WFHE 5DDHB 3WN5A 5IEKA 3SDAA 1MHCB 1AO7D 3OG6B 3EYSL 3I75A 5FHBH 5SX4H 1Q94B 5GGVY 1NFIA 5JXAL 3RZCA 1AGEA 3FQNA 2AJXL 4CU6A 1YQVH 1KEMH 1F11A 4ZUUB 1UB5B 4ZOBA 3G6JE 5HYEA 5EC1B 4Y2OA 2CK0L 4IRJB 2WLYA 5E9DB 2ZWLT 4NQXB 2PR4L 4K3EL 4JFFA 1EHNA 1BZ9A 2WBWB 3L3HA 4Z77B 5C0IA 5C2BL 4U6YB 5T1LB 4HS3B 1CLOL 1FC2D 1RUAH 4JPIA 1IQDA 5E94B 1S9XB 3OKLB 1SVCP 1MJ8H 3GI9H 5IB1B 2VAAA 1FDLH 4PYHA 5I15L 2A77L 3QPXH 1CFTA 5D72L 3GSNA 3HC4H 1VGKB 3TIDA 3FB8B 5LCVL 4PJHA 3BPOC 3FQUB 4ODVH 3S5LB 1KF9B 2C3HA 5T1KD 4ZODA 3MBXH 1N6VA 1CGUA 1NLDH 1T5XB 4NC1C 4OCXH 4XVUD 1DTUA 5F3BA 4PJEE 2FR4A 2LQRA 4DZ8A 2RR3A 3ECBB 1CL7I 1QLFA 3QWRD 4NQCB 5E99H 1IL1B 1WITA 5EU5A 3FO2A 1I8MA 1GGBL 4OIIH 3GUTB 3HAEB 3KS0J 3RNKB 5KSBE 1RK0A 1UXSA 2ZSWA 4KPHL 5J1SC 4C56D 3LMJL 1AD0A 3BP4B 1XGPA 3U7YH 4F7TB 3PXHA 3SKMA 1M6OB 4AENB 4XZUA 5JO5B 5KSAD 2NX5D 1VGEH 4N0YH 1KN2L 5J1AA 1MCDA 2DQHH 2EDRA 5GISL 3WUWG 4ESKA 2X4TA 3WN5C 3SDAC 3OG4B 3WFCL 3VFUA 4X5LA 3OPZL 3RZCC 3QXAB 5L2KD 3MACH 2ZUWA 1B3JA 3KYOB 3D2UB 2PUQT 2WWMD 2XY1A 1UM5L 5IFJA 1CE1L 5HGBB 4G9FE 4XPAH 3TT1L 1M71B 1U8IA 5KANI 1BBJB 1FNHA 4D0BA 1FFOA 3E2HC 1FL5B 5CJQL 1ZXQA 1D6VH 3VXSD 5KN5A 1RJLB 1TNNA 2GTZA 4N0UE 1QHOA 2A6KA 1OGTB 2EH8H 3L1OH 3OAZH 3S37L 5MENA 3EZJB 3EZ8A 3WHE0 1YEHL 2Z93A 3VWKA 4TVPE 1RZ8A 4XCFH 3FONB 1ZLUK 4JPVH 3RVUC 5BO1L 4PGDA 3EUUA 4ZFFA 3VMOA 3IDXH 1INEH 4JG1L 2F5AH 2ZSVA 4H0GA 3OR7A 3KYNB 5CILL 5I6XC 1RK1B 1J87A 5D7IB 4R2GB 5CBEB 4QY8B 5GRWA 5F7HA 1NGWA 3PL6B 1HKLH 4OCWH 3R06B 5BVPL 3MCLH 4WW1B 4X4XA 5I1IH 1E4XI 1K4CB 2X7LB 1FN4A 1QBLH 4Y8DC 5DUPL 1LP9A 3VXMD 3V2AR 3VI4F 4OV5B 1AY1L 4L3CA 3OKNA 1QBML 1CFQB 1UB6A 4H20L 4IMKA 4JQXA 3LS4L 4PB0H 5DK3A 2AJUL 2C4FU 4KVCH 5GS3A 2BOCB 4Z7UB 3T3ME 4BH8B 4G43A 1TZGL 1XF4B 5DURB 3SY0A 3HC3L 4KHXH 3OKOA 1UZ8B 2IPKB 2VDQL 4RGNC 3DI2B 4GH7B 2Y7QB 4XGZB 3VCLA 4F57L 4PV9A 3F6IA 4DN3L 5T1DL 1F90L 4Z7VB 5JR1L 3UJJH 4DK3A 1HXMB 3MREA 1RULH 4I4WB 4JKMA 1N5AA 4UT6H 2AVGA 2DM3A 4NN6C 4X99A 1OW0C 3EHBD 4LDLB 3OF6D 5H94A 1MCPL 2IGFL 2QV2A 3FCTB 5F9OH 1F58H 1S7SB 3BX7C 4JVUA 4WW2F 4JO3L 4XNUL 2IAND 5DLML 3IFPA 4WHTB 5L88H 2Z31A 1IKFH 2W59A 3CH1B 1NKRA 2FSEB 5I1CH 4JFED 2MCPL 2O93L 1JV5A 3ZKMD 1NUDA 2ZCKH 4PV8B 5IMOB 1HZHL 3CFEB 1UT9A 5C0AB 3P4OB 5JNYA 3CLFH 3HCVA 2BY0A 3RRQA 2F74B 32C2B 1UJTA 2Y4SA 1J8HD 3JV5A 3QG6A 5L6YH 3X3FL 2V5YA 3UYRH 1H8SA 5I73B 2ZPKH 2H32A 2CIIA 1MWAB 2ITCB 5GGUA 3C5SB 2E9WA 1FL3A 3D0VA 4X8XA 3U36B 2YD8A 2R23B 1WAAA 4POZD 2VZTA 4JFDD 3NCCB 1MI5B 1C7TA 3OJDB 4FQ2L 2D3VA 1Q9WA 4LLWA 3BN3B 3RBGA 3UPRA 4LAQL 1MCHA 2ZOLB 4P3DA 4C57C 3M1BA 4OCRH 5GGTA 1JL8A 4CADB 1LP9E 3IDYC 3ULSB 1CD0A 3HE7D 1GH7A 4JQXC 4FP8H 1WBXB 1DN2A 4OIBA 1X7QB 4ELMF 4N68A 1YYMH 4WGWB 1H3XA 5IHUH 2GSGA 4GQ9H 4P0DA 4Q9RH 3UJIH 5JIKA 2Q3ZA 3DOSA 4JKWA 1TXKA 4OD1L 1V5JA 3T4AA 3KYMB 1RUPH 1XF5A 3IKCB 3PWVA 4MB3A 5T3XH 3EYQC 4HLZG 3IXAA 3QO0A 4D0CB 1MHEA 2XQYG 4FQLL 3T0EA 1ACYL 3MR9B 4YHPA 1MRFH 5D71H 3NCBB 1ZLWH 2DMKA 3KPOA 5D7LE 3SKNB 1XH3A 1D5IL 3DGGB 4P9MH 5DD1L 4CBPA 4PJ7B 4PJDF 1MCIA 2EE2A 3OXRA 3QEQE 5IJVA 2NTFA 2JCCB 3BZDA 1F02I 2Z31C 5TE7H 5F44A 1QFWL 3B2UC 1QNZH 1KG0A 3L3IA 1DANU 2FRGP 5DQDH 3K8KA 1G7IB 5BRZA 3RDTD 2DQTL 1D6EB 2B8OT 3U2SB 4ZFZA 2FIKA 1I1YA 1UCTA 3IJHB 2A0LD 1LEIA 2IBZX 4I5BA 3T4YA 5HHPB 4WY7L 4NQCD 3S35L 4NO2A 3VFSA 1KB5A 2VNCA 1QSFB 4HWNA 3VE0B 4JY6B 2ORBH 5JDJA 4L8BA 4ZTOH 2YZ1A 2JE8A 1WLHA 4ELKA 1DEDA 2XKNA 5SX5H 4K3DL 4Q6IA 1DQLH 1HQ4B 1GGIL 1XGRA 2EDQA 4LMQI 3DROA 2AJSH 1CXHA 3BOVA 1ZLVK 5IQ9A 3T0VA 3CUPA 1PGRB 4MNGB 1S7WA 3PNWB 3HLAB 3FOMB 4YDKL 1A9BA 2R4SH 3QEGL 1JNHA 4XC1H 5LWYL 3A6OA 2YOCA 5CP3H 4BZ2H 2AERT 1NQBA 1Q8MA 4GRWE 1U8MB 1F6LL 3A6BL 5EC2B 3BD5A 5ELIA 3QR2A 4QXTA 2VISB 1QEWB 3A67L 4PRHE 2XZCL 1A6PA 4CU7A 5DEFA 2VR4A 4U0QB 3BSZL 1WWWX 5ID1B 3T0EC 3GBNL 3UYPA 3NFPA 2XA3A 3RWIB 3IFLH 4HK0B 5DJXB 4IEFB 4KQ3H 2FLBT 5DJYA 5JPNB 2EO1A 4F80A 3QAZC 4R8WL 1QLRA 4UQ2A 5LGKA 3WEXB 5FV2A 2FJHA 3RPKA 3G5YA 3QCVH 4LCWB 3BP6B 4XHJD 5F1OB 2Q8BH 3C60B 2WQ8A 1KT2B 1I9IL 2AJVH 4R2GD 3MUHL 1TZHB 1E6OH 2Y72A 3PL6D 1MAKA 2DQIH 4MJ5B 5JHLH 4JRXB 4HIHA 4I18A 4X6CB 3ULUD 4KKBD 4ZTPL 5JZ7C 2N7AA 2R0KL 2D03L 5EOQL 5KAQG 4QXGH 1WWBX 3CGTA 2NY6C 2HG5A 3QH3B 4D9LH 4LLVA 3UPAA 4CVWA 3U9PH 5KW9H 5JIHA 4HKBA 3NCMA 2R1WA 3DTXA 2BJMH 2P4AB 3UXFA 1EFXA 3CLEL 3D1MC