2K3HA

Structural determinants for ca2+ and pip2 binding by the c2a domain of rabphilin-3a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
GALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWNETLQYHGITEEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKANQRKNFNICLERVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Rabphilin-3A
publication title Structural Determinants for Ca2+ and Phosphatidylinositol 4,5-Bisphosphate Binding by the C2A Domain of Rabphilin-3A.
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2k3hA00
3QAQA 2BWQA 4ANWA 2FK9A 4FJYA 4QJ4B 3SD5A 3APDA 4LDCA 1RH8A 2JQZA 4ANXA 3ZW3A 2Q0ZX 2K3HA 4L1BA 2WXFA 1CJYA 2QZQA 3F04A 3MJWA 4PS8A 3IBEA 3S2AA 1DJHA 3APCA 4J6IA 2CJTA 1W15A 1HE8A 1YRKA 2UZPA 3L16A 3NSJA 4DNLA 4F92B 4WAFA 5T8IA 1DJGA 1DSYA 2QZ5A 2WXGA 2ENQA 4IHBA 2RD0A 2B3RA 4WWNA 3TL5A 2DMGA 4OVUA 4WWPA 3DPDA 4JPSA 5G55A 2K4AA 2CJSA 2WXOA 2K8MA 3KWTA 3ENEA 2WXQA 3L4CA 5EDSA 2DMHA 3APFA 3ZIMA 3QK0A 4NP9A 4URKA 1E8ZA 3R7RA 3ML8A 1TJMA 2WXKA 3PYCA 4FHJA 4F93B 4LCVA 3JZYA 1GMIA 3HIZA 4KZCA 4Y1SA 2ISDA 3W56A 5CCGE 1BYNA 2D8KA 2NSQA 1E90A 3T8MA 2CM6A 4OVVA 4ANVA 4GB9A 3CSTA 3NZUA 4EZKA 1E7VA 3TJPA 2CHXA 2EP6A 3L13A 5H4YA 4NPJA 4QJ5B 3PREA 3GPEA 4TUUA 4TV3A 3FDWA 2A4ZA 4NPKA 2NQ3A 2WXRA 3LJ3A 4V11A 4EZLA 2YRBA 4KZ0A 3L9BA 1E7UA 2YOAA 2KI6A 2CM5A 3F05A 1W16A 1K5WA 1TJXA 4ICWA 2CHZA 2CHDA 4KITB 5CCHE 4FHKA 2ENPA 4BGDA 3R7QA 4XX5A 4A55A 1DJXA 3QJZA 1DJYA 3F01A 4PS7A 4XZ4A 2WXIA 2Q3XA 2WXLA 4HVBA 4FADA 3QR0A 4XE0A 1QATA 4F1SA 2CHWA 5KJ7E 4LT7A 2N1TE 4L23A 1E8XA 3PS6A 2WXJA 4AJWA 4L1LA 2A5UA 3B7YA 3F00A 1E8WA 4MJJA 2K45A 2WXHA 4L2YA 5G2NA 2Y3AA 4G11A 1WFMA 4EZJA 4WWOA 2ENJA 3FBKA 3HHMA 3RPBA 1BCIA 2ZKMX 3ML9A 4HLEA 3QR1A 4QAMB 4QJ3B 3ZVVA 3N5AA 4PS3A 2V4LA 5JHBA 2WXMA 4Y1TA 4DK5A 3L54A 3M7FB 4ANUA 3L08A 4F91B 1UGKA 2LHAA 3IM1A 4FJZA 4BFRA 3OHMB 3QARA 5H4ZA 2FJUB 2Z0UA 4FLHA 3P2BA 4AOFA 3RDJA 1A25A 3OAWA 4GNKB 3PFQA 4NS0A 3HN8A 1DJZA 3NZSA 4TS6A 2X38A 1RSYA 2WXPA 3W57A 4FA6A 1UOWA 1BDYA 2R83A 1QASA 3PRZA 3L17A 2NCEA 4FULA 3TWYA 5JHAA 4IQHA 1UOVA 3DBSA 1DJWA 4ICXA 1DQVA 1E8YA 2WXNA 3CSFA 4WEEA 1V27A 5CCJA 1DJIA 1RLWA 3KWUA 1WFJA
chains in the Genus database with same CATH superfamily
3N43B 1KCLA 4ZFFB 1U95A 3C5ZB 2LVEA 3PHAA 1F90L 4LQFH 3JYCA 4OJCA 1HQRB 3HMWL 4G71B 4M8RA 1QRKA 1HQ4A 3NJKA 2VN3A 4KVCH 3QJTB 4U1IB 1BVLB 2N59A 2WSDA 4OQTL 2YPVA 1XL4A 1CFQB 4W9FC 2RQEA 2NNAB 4X0KB 3SODB 4RQQB 5AOLA 4A38A 3IFPB 4PI2A 1ZDQA 2NUTA 3MHZA 4M61B 4WTZA 3AFLA 4QRQA 4WWPA 3K6NA 4EI6B 2FJGB 4H2CA 5FYKD 5BW7C 2A38A 5HVFB 3JWNH 2HLFD 4AQEA 3GRGA 2P8PB 4OTXH 4Z18A 3WD5L 3HKZA 3QNZB 4E36A 3O8XD 4KHXL 3SDXB 1DEDA 3H6JA 3TV3H 3RWCA 1KJ2L 1N3NB 3BPNB 2D0GA 3HI5H 1E7VA 4NCC1 5B38G 1JXJA 2V3FA 4X5WA 4FFZA 5F21B 4Y1AD 4HCRA 4ODSH 4BEIA 1T1YB 1MY5A 2HX7A 4TSAH 3BHBA 3U2IA 2KL6A 1KYAA 3MCLH 3C12A 3ZKNC 4PQXA 4TL5A 2F1EA 2YKLL 4N26A 5LJYH 2X87A 4N8CL 3UYRL 4I2XA 4XRCA 3LV3A 1OPGL 1KBBA 3NGBC 4MJ2A 4Q58C 3BIKA 4BJLA 35C8H 4OF6A 5JORA 1OQXA 2IWFA 2A74C 4XNQB 4Y89A 5GRYA 4CVXB 3BVNB 5INDB 2JKLA 1H6FA 5DRZA 1TU2B 3WTYA 1NBYB 4R83A 3SQBB 2Y3AA 3ESUF 4EZJA 1HK6A 2HZHA 4ZSOB 3A6CL 1RUPL 4GIAA 3BZ5A 4L8BA 1IO4C 1D5RA 1M2OA 1AXSB 4YHYC 2V4LA 3E6HB 5CILL 4PTUA 3RZWA 1ONQA 1QBBA 4WGWB 2P46B 4JY5H 4N22A 1J8HE 4MLIA 4W9ZA 3BUPA 3V0DA 1KOAA 4Y1AA 2FJUB 4MB1A 1XVSA 2ATAA 4UU9B 5E8OA 5DHVA 3VVVA 3TBWB 2VXTH 3KDMA 1K8IB 2Y3NA 4KPHH 3Q2CA 4UAOB 5IJVA 4IOIA 2YUZA 1PKQB 1OGAD 2E9BA 3RNQA 4EUPA 4L2LA 2WCPA 4P3DB 5F2FA 3ZZLA 4CUCA 1KN4H 2DQEH 1KXQE 5H4ZA 2CD0A 1AE6H 3MUZ1 5CUSL 1DN0A 3GXNA 4G7RB 3WTVA 1S4IA 3BGFB 4MCNA 4Y8AA 4HJ1A 4UQ2B 5HYQB 5D1QB 3AM8C 4XP4H 4JKLA 1D7BA 3K0YA 4NM4L 3QQDB 3AMLA 4IBUA 2CALA 1DTUA 1J9QA 4JO3L 3FZUD 1V3LA 1BHGA 3CFNA 4I7ZC 2IV9A 4AX3A 4HAKA 4ALAH 3EAKA 3HFFA 4AYFA 1YN6B 3MNZB 4BSVA 1M3JA 2FYVA 1ETB1 2D03H 2ADGA 3RZCC 1BJ1H 1TVBB 3KE0A 2H3NB 2FCBA 4N68A 3QBTB 1MJUL 3GEWB 3VI3E 3K46A 5AAPA 1UWGL 3IWVA 1EDHA 1NKOA 1MRDL 2AMGA 4PWGA 5IEKB 4ZW6A 3IJHB 3BZ4A 3NP4A 1Q1PA 5B1AB 1J0ZA 1HNYA 3EOBA 3U0PA 1JD7A 1X7QB 4FTVB 5AOIA 2YPVH 4OFIA 3EDDA 5DD0L 3EOAA 2FWLB 3QJQB 2L0DA 2KI6A 2CM5A 2R2EA 3KGUA 3OKLA 2RB8A 3TPUB 5IQ7L 2Y36H 3K71B 4YO0A 3GSXB 1F56A 4GMSL 3TN0C 2YD9A 2KZKA 1A6PA 1J0KA 3WHXB 3ZQXA 1UXSA 1AANA 1IKNC 2HFTA 4GRLB 2ODIA 2EE2A 1AGDA 4XWOD 3FRUA 1MRCL 4FFZH 1M7IB 1AH1A 2CBMA 2AQPA 1Z5LA 5LBGA 3PGCB 2EACA 1FGNL 3T9WA 2MCPH 5IVZA 3X1NA 4K3EL 5K9KA 3SYOA 3K4AA 4PLKC 4A68A 3CX2A 1GTNA 1ZSDA 4N0CC 3U9PH 2Q8AL 1NDGA 2YZ1A 3ZMRA 5CZVH 5A16B 1SFDA 3NG5A 2R0WH 4UTAA 3TURA 3BIBX 2YA1A 3SKMA 1XGPA 2N7SA 1TJIL 3TO4D 2HTKC 2FSDA 1YY9C 4PWHA 2OI9B 1EDQA 4HHWA 1BREA 1JPGB 3KH3A 4ICXA 1CI3M 4CDHA 3B37A 5FYKH 3ZX1A 5E7BA 5KYNA 3UTQA 2QKIA 2FAUA 5GJTH 1OGTA 3D1MC 1GPOL 1UB6B 4ZOAA 5FV1L 1K4DB 5KJ4A 3EFDL 3FSVA 3TFBA 2A9CA 4JFDE 4XP1L 2QEJA 3JV4B 2PXYB 4MB4A 3OMIB 4L29A 1G1YA 1RJCA 2WB7A 4LCWB 3G7TA 4LVOB 5IF0A 3NSJA 3RIKA 4UTBL 3OC5A 1TKWB 3WU1A 3NSCA 5DHVH 3FQYA 3S35H 1BOGA 4TXVB 1AHKA 2E86A 4IU2B 1KYFA 4YHKH 2CQVA 1UA3A 2LU3A 1F3RB 2XZZA 4ZOCA 1FH5L 3GSVB 4I3SH 1SNRA 1TJMA 1YEEL 1F0LA 5DC4B 3NDZE 3ZZSA 3NRFA 5HYJE 5EHFA 2WM0A 5HY9A 3ZE0F 3PPEA 5TE4L 2Y07H 3HB3B 3TO4A 5D6DC 3F7RA 1CUOA 5A40E 3PPSA 5HYEA 5EBWB 3P3UA 3CVIH 3GPEA 3LEXA 3FDWA 3K2IA 5F7FA 4AYBA 1QO3B 1ZOXA 1IBBA 4A6YB 2Y2YA 3CLEH 1X4ZA 4JY4A 5E4OA 3HG5A 1FZJA 3VUAA 4U6HA 2FHCA 2V0AA 4PBWD 1FFPA 2E4TA 3RA7H 3PDOA 1NH6A 3LZLA 3SDXE 3LZQA 2HMID 5ADOH 4H1LA 4XGZA 3VTMA 3SB3A 1U8CA 3X13A 4EN3B 1SXAA 1WT5C 3X14B 2Z34A 5KVGE 4HH9B 1CO1A 1EXUA 3L4YA 4YR6B 2F8IA 1IC7H 2C9XA 2XVLA 4RGMC 1XXFC 3TIDA 5T1LD 4NPYA 4YZFE 1AS6A 2AJ3A 5DS8A 3UACA 2NZ9C 4HXBL 1LDSA 2WLIA 4Z3JA 2UZYA 5CU5A 5AB2A 1EHLH 2DI7A 2EIMB 1UM5L 2Z6FA 2XIDA 4TL4A 4YOKA 1U8MA 1ADQA 1IC4H 3ETSA 3MJ8A 4JFFD 4JEGB 2XVKA 4RSVA 1P7QB 2R0ZL 1MHEB 2B2XL 4M7KH 4ZNEE 4HJEA 4NRYA 3V9FA 1UJ3A 4Z7UB 4CU7A 1IBHA 1AGBB 3HNSH 5IROC 3S5LA 1MVYA 1X5HA 2GEEA 4ZDHB 2CBQA 5CIPB 2CNYA 1J11A 4ZSOE 1QEXA 2D73A 4Y4KB 1ETA1 5I76A 4YHML 3BFOA 1E8YA 2XN1A 4G7SB 1NL0H 4Y5VA 4XI5C 5I1GH 2JCWA 3PWJA 2QGEA 3S34H 3L7FA 4YSPA 5I1JL 4NNXB 4GW4A 5FYJL 5GQBA 1HHIB 4L1BA 3T6WA 3FT3B 4D2NA 5IEHB 2XFXB 4MXQD 2EO1A 3WCYA 1ZS8B 1IM3D 5TTRA 3ZN6A 3FTXA 5DJXA 2YD7A 4DNLA 5EN2A 5T1LA 2BVPB 5E8PA 5LQBL 3BKYH 3ZDYF 2W38A 1W91A 4YX2L 3RVXC 5E8NB 3RWJA 5D7LB 4LFHD 1OEZW 3QNFA 4PREA 5SX4H 1T66C 1DR9A 2BHYA 1F11B 3GMOA 3L4CA 1ZDSA 4JFFA 3SGDI 1UA6H 2ZG1A 4HUVB 1DLFL 1AJ7L 2DH2A 5D1QE 4IBSA 1IVLA 4IS6A 3JV0A 5IWLA 3S4SB 2OMUA 3CFEB 3QPXL 4AV4A 1KY6A 4FMVA 2R4SH 4U1KA 4LNVA 5DFTA 1I8KA 4PG9B 1TTCA 1WZ1L 4LCUA 2D7OA 5JHDB 1LK3H 5DVNA 4DGYH 5E2VH 4C4KO 2VKXA 4DQAA 3IT8D 1MWOA 2X4UB 2J72A 3HVNA 3GBLA 5AYUH 3AU1B 1REIA 2PN5A 4NNYB 3QS2A 4LLMB 1Y0LB 4WHTA 4NKOB 4DERA 3ILDA 2FO1A 3U4EA 1HZHH 2CHDA 4JO5A 4FHKA 4XCEB 1FH2A 4U2YA 4M1DH 3T4AC 4PW4A 1IM3A 3GGWA 1E3ZA 1EEZA 4ZO8A 5DFVD 4LLAA 4M6AA 5GGSA 5CXPA 5HHNA 3MV11 3FULA 1QATA 2KUTA 2LGNA 3DO7B 5E6IC 1IM9B 1KLFA 2WBJA 1J18A 4FTVE 1K72A 4AGPA 3QP3A 1UACH 5D72H 3O6KL 2YXFA 5FGBC 1QNZL 1AQHA 4ZPTA 3G04B 3OXRB 3VWKB 2X6CA 3NCYP 4JFOA 4I9XA 1U3NA 1MFAH 2QR0A 2ZXEB 2MPAL 2V5MA 2FYYB 2OMXB 4HALA 5F93C 2NW3A 3T3MB 3EIFA 2KH2B 3MLXH 2YPLD 1MNNA 2JKSA 1XGRB 2OS7A 3DRTA 4H1LH 4RWHA 5AG9A 3GJEA 1KTDB 3P0GB 1Y6KR 3LH2L 4XBEH 1VA9A 3GSNL 1GMEA 4XCCL 1XF4A 3WY3A 5EN3A 3US0A 1J0YA 2V2WA 2VXSH 4M1GL 2IG2L 2F8VA 1IKFL 2E75C 2OMVA 5DO2C 3VXQB 2ENSA 1GS6X 4HJSA 1ETJA 2WHVA 3R8BB 2YUWA 5JZ7D 2XTSA 2BK8A 3T6ZA 1WICA 1VEPA 2ORBL 3N40P 1O6VA 2HVJB 3RWFA 4YDVB 1QI3A 4PVBA 1JXKA 3KGTA 2AW2A 4TLTA 2WIIB 1CJYA 2JCCE 4D0CB 5FHAH 3CFBA 5DEFA 1L0QA 1N4XL 1G7JB 5T1JA 1PY4A 1YC7A 2CJTA 4YDJA 1VCAA 1CS6A 2CPCA 1JD9A 1L5GB 4HSQA 3QCVH 2X4OB 1MHPL 4NQDB 4XNUH 3RTLA 4ZZKA 4F7TB 4GJTB 2NQCA 4FFVD 2BMKB 1LO2H 4R8WH 2F0CA 3DBXB 3P9LB 3NGBB 4UM8B 1YNLH 4ZFQA 5DUBB 4RLDA 2VXUH 2V2XA 2FEEI 4KKNA 1A4KA 4WU5B 2A6KB 2A74B 2YPLA 4XXWC 4IBVA 3CC1A 1SJHA 1RZIB 3U0TA 4ODVL 1DVQA 4LCWE 4PJAF 5MEPB 4AUYA 5ECGA 5CCKH 4NKMB 1HHKA 5H8DA 1AMXA 3J7HA 3DROB 3SDYH 5AB9A 1FFOA 1X5AA 2HP4A 4KXBA 5I18L 4UT7L 5EU6D 3VD9A 1MCHA 4YHYB 1BAFH 5DJCA 3ZO9A 3V7AE 4OLVH 3X2QB 1CDGA 1XFPA 2GIYA 2OLDA 3BP6B 4FNLL 2XV6B 4PGCA 3LQAL 3D51A 1WAEA 1S9VB 4AVJA 3HAEB 4PS4L 3UZEC 1I3GH 1MJ8L 5DSCA 3ZGHA 1TUPA 5T1KD 2OJEA 2O61A 1JPFB 2R7EA 2XIBA 3GS4A 3IMBA 5ICUA 5C3TA 1YY8A 4I1PA 4HK0B 5F1NB 2B3IA 3BKCH 5EZPA 2ZOUA 3P77A 5BOZG 1YQ2A 2YARA 3PABB 4OFPA 3QO0A 3QEGL 5CEXA 1TQVA 4CU8A 5JNYA 1ZLWK 4LHUB 5DURB 1KGJA 1KV3A 4H4NA 2EEFA 3ZHFA 4H88L 4MXWH 5DS2A 3T0AA 5E6SB 3S3CB 1HINL 1NMCC 3HBPA 4GQ9H 1BZ7B 1MHHA 1E27B 2CZNA 5EU6A 4ZMOA 1NBZA 1WZLA 2MRYA 1TTFA 2XFGB 4HP5A 3RZCB 1ZT4B 1QFUH 3L3GB 3H9ZA 5BQDA 3H0TA 3MBEC 4KBPA 4Z0BL 1DO6A 3MBXL 2MNWA 3EJPA 3PAUA 1W8EA 2Z92A 4PJHA 2JK5A 2VDQH 4LAJH 3BIAX 4U1JB 3ZHNA 1KNOA 2J1KA 4MVBC 2VISB 4Z7UE 5EDXA 5T1KA 2CDGA 4NCDA 5E99H 3DV4B 2P8LA 4TF4A 1YEIL 4LLVA 1A8JH 7FABH 2NX5D 2HFEB 1RHHB 4HK3N 2IBGA 5FV2A 3BUYA 3GLAA 3J8F7 4OCNC 4F92B 5J1SC 3IFOA 1C5DB 3IS0X 3QEHA 4G3YL 4FABH 3ETBJ 3D48R 5FYLL 4ZD3L 5SWQA 1PZ5A 3TN0B 4OCRH 1QPKA 3LZFL 1ZLEA 3RLSA 3WEXA 4FZ8H 3P1VA 3IAPA 1XR9B 3U4BH 4I48B 4X7CC 2YKKA 3W2DL 1U9KA 3VFWA 1L4IA 1IZKA 4CC4A 3TBSB 3RKDD 1UZ6F 1EGJL 3U83A 4G6ML 2ZSWB 3KYNA 2VDMH 2EDWA 4TTDC 1Z0MA 5LB1A 1SY6L 4FQQB 4IK7A 2LV4A 4NQCB 4P4RA 5D7LE 4PRDB 1G9HA 3FOMB 4XNBA 1KPRA 3PLYA 2ZWLT 3K7UA 2QQLL 1JBJA 3F7YA 5L8JB 4G1EA 3L9BA 2FB4L 3MRLA 4M7JH 1T4KA 3LRKA 2HSIA 4TVPH 3GB7A 1DJYA 3HE7D 3OKYA 4H25A 3OKKA 2WINB 3VCLB 3LPWA 1LILA 2J8UA 32C2B 2DRUA 2X4PA 2ZCLH 5E7FA 5LN4A 1RZKH 5JHDE 2VRKA 2FEEL 3PHOB 3UJJH 2OK0L 1QKZL 1KB5L 5I15H 4MMXC 2CJUL 4W70A 3U0WL 4PWEA 3NJXA 4A39A 1MWAA 4L05A 1JZ4A 3RVWD 4WHYH 5J7CC 2ZAIA 3NZ8B 4N8UA 5CEZE 1AHMA 4RAUB 2G0LA 2OMZB 3QIUC 4ODHL 4JFXA 1LP9B 4HUCA 3CCHA 3QFGA 5DRXA 2FWUA 5I16A 1XF5A 3P30H 1R5VA 3AC0A 5BQ7A 1NIDA 1VFMA 1A7RL 3FC8A 4XMPH 1E6OL 3RX9A 5JPNC 4N90D 2J7LA 4E9TA 5D2NE 4Q4EA 3H53A 3UTPE 2I60L 1FWXA 4FXKC 4J3OC 1KMGA 4K3DH 3FUJA 5ILTH 3SE9H 2AEWA 4K5PA 3R0MA 3GJFK 4PJFB 4XMXA 5JO5B 3MCKB 5JHLL 4PV9A 4YEEA 1AQKH 3I02A 4UNVA 2TRHA 4HS3B 4E9YA 2E76C 4JE0A 5JIMA 2XBDA 1EBPA 3N2JA 5E94B 5KUMA 4HGMA 3MOAL 5DHXB 3HE7A 5EUOA 3R1GL 4TSBL 3NJFA 3BD5A 3VGDA 4BFEA 5SV3A 3DGCR 4O2FB 3ARBD 2B16A 2CIIB 2X2IA 3QUKA 2VMEA 1DQLH 5GGQH 3F85A 1O0VA 2KZWA 3BVVA 3DX1A 5JQ6H 4OF5A 1N8ZB 3BP5B 4GKSA 1GGYA 3IGKA 3UAAA 1W8NA 4G43A 3KPOB 4L8CA 3GI8H 5JOPD 2ICEC 4J5VA 1BD2D 1YG9A 2VZVA 1JVKA 4CADB 1HYSC 1JK8B 2A73A 2XJLA 4KJPD 1MH5A 1AD9B 2X12A 3TA3D 2WXQA 3CPLB 4KOBA 1BMZA 3JWOL 1X7SA 4DEUA 4DQOH 3HMXH 2VSDA 5LGJB 3MMEB 5BXFA 3ATDA 3CMOH 4LHJB 1FAKT 3O11A 2BSCA 1S7TB 4F93B 3SKJL 4RGMB 1GZPA 3VTTA 1JJUA 4RFOL 1V8HA 1BQHA 3QH3B 1KZYA 1I8IB 2ZE0A 1NSNH 4NQDE 4ZO9A 3GMLB 4CVWA 3OAUH 4IMLB 1MW1A 2VJXA 4G7VH 4HWUA 2QLVB 1CBJA 4CBPA 1SPDA 1QABA 1TZ8A 2DI9A 1PL3A 3K6FA 4U0RC 3N85H 1DUYA 1OARL 5ANMB 5E23A 3LKSB 1ZLUK 1HILA 4QHMA 3ARBA 4PJHF 1AXIB 2VR4A 3U7YH 1M3IA 4ZUTB 5IB4A 4KX8A 1KIUA 3O3BA 3PGDA 2FHFA 3BUIA 4J4PD 2YHGA 2PW1A 4HKBA 4GY4A 5I1IH 2VLME 5DXWA 3DX7B 2QT6A 1FFTB 3ZT6A 2OP4H 1BD2A 1KJ2B 4F3FA 5AWNH 3Q9QA 6FABL 5KW9L 1F4WL 1VFAA 4P5MB 5DLML 1TEGA 4BRJA 4KZDL 2P1YA 3SE4A 4GXUN 3TA3A 5FWRA 3S8GB 4HLZH 5KSUB 3TF7C 2A1WH 2P8MA 5ESVA 1GOGA 3MV7B 3ZQWA 3QE5A 4YQXL 1KG0B 3C75A 3FU7A 5I1LB 3MJ7B 5D70H 1JZEA 1A7QH 3HG1E 3QT2A 3BN9D 25C8H 2XXFA 3MLRH 5KJRL 1HESA 2GK2A 4KVCL 4YXKL 4AZ8A 4Y2OA 1JGDB 1YEHH 3DARA 3M6DA 1BDYA 1P7BA 3OJVC 2G75B 4AGOA 4MD5A 3P0VH 1MWAH 1SYVB 1LMKA 2H8PB 2NLJB 2W9EH 4IDJL 1C16A 3BWAA 4LSRH 3WKYA 1JNLH 1XX9C 3SD2A 5HHQB 1CLCA 1QFHA 4J4PA 1WBYB 2OX5A 1G9MH 2JJUA 2ZKYA 2XQ0A 1NCBH 4PGDB 2R4RL 2XPGB 1G9NH 4JLRA 4LEOB 4HJIA 4PJ9C 3QB7C 2J8UF 4HZLB 4OTXL 5CLTA 2FJHB 5ACZB 5I19L 1J5HA 1ORQA 1T0MA 5C8JB 4ENED 3NPSC 4M3JA 3TV3L 2W65B 2K3TA 2WANA 4PV8A 3HI5L 1EA9C 4M5ZH 3GRBA 3VXUD 2F18A 1OF2B 4DZ8B 4XB7A 3T4AB 2DM7A 5EOCH 2JJSC 2CJSA 2WYHA 1BSIA 3X3GH 3RUGB 1NBQA 1GXEA 4DZBB 1NFDB 5E6IB 3A6BL 5FUCC 1I7TA 1AO7B 4H20H 4PB0H 4LL1A 4RBPK 2TSBA 1CFTB 1J9CT 1BJMA 5E95B 4KZCA 3TEWA 1INEH 5ANHA 5AVYB 5HGGS 5HD8C 2VXVH 4DKEH 5ENWB 2E56A 1UB5A 3L5IA 4Z3HA 3UXFA 1WGVA 4HUWA 5H4YA 4APXB 3EOYG 1ACCA 1JUFB 4Z3FA 2GSIA 2H2SC 1I1AC 2B4CC 1KLGA 2CO6A 2X0UA 4MYPA 4W9IC 4XVSH 4MQ7A 4PRBA 2K78A 5SWZB 4J23A 2F7RA 2JQAA 3ELAT 1CXFA 1DO5A 5IB1B 1QR1B 4KQ3H 1T89C 4RAVB 3SDDD 2MTAA 2F7PA 2VUKA 3V6FB 3RE0A 5J9PA 5LGHH 4K3HA 4F1SA 2ZYSA 2HLAB 2DY2A 3NYKA 3VXUA 4ELKA 1KGCD 5DHMC 1BXUA 3D3VB 4WNQA 4Y5YC 2VXTL 4IGBC 4KPHL 3OPZH 5C0EB 1HC1A 3QFDB 4XAWL 2OR9H 4XO3A 1TTRA 3Q2VA 5TE6H 3MLTA 2IQAA 3F83A 2IBBA 1AE6L 1DBJL 3CN1A 2JJWA 2RQ8A 1M71B 4MNGB 3KJ4C 2FWOA 3WNOA 1YJDH 5A2IH 2M2DA 3VMNA 2Y5TA 5B39G 4KRPD 3S37X 1RK1B 4X7EC 3SPCA 2AQTA 2FD6H 4XP4L 3WELA 1RD6A 5EC2A 3HUJA 3DSNB 1P6WA 3FSOA 2EUWA 4FULA 4D0DB 2IDTA 5JHAA 4IQHA 5JLZB 2IXQB 1A4JB 5KSAD 2Y6SD 1LGVA 1MQ8A 1FPTH 4ALAL 2P24A 3S98A 1FNLA 3SDDA 4O9HH 2WQWA 4P9HL 3N1GC 5FCUH 4BM7A 5E2JA 2O6EA 3DHJA 4RMVA 4WFGE 4UNTA 1ET7A 1O6SA 3QUMA 2FL5A 2C3XA 4J6IA 3N91A 5FGCE 3MRIA 1OK0A 5KANG 4Z23A 4A7QA 2GJZB 4N86A 1G0XA 3ULVH 3D30A 1SEQH 1N7MH 3RBGA 1E9OA 5FX3A 2XA8H 1GOHA 3VXOB 1LNUB 2CBPA 4F2ME 2YPVL 4OIFA 5JR1L 3CNKA 4IRSD 5GGRA 4KK5C 5MEQB 3QWNA 4IIQC 2MQGA 1A8ZA 1KXHA 3AUVA 5C9JB 1R4XA 1DEEA 5AYQA 4Z6AT 3V7AG 3AXLA 2QPFA 4ZAKC 3X17A 2CLVB 4PY8J 3T8MA 2Y2WA 3LHPL 2HFFA 5AAWC 5C6TL 4MNQB 4B0MM 1N6QH 3SQRA 3M8OL 4PJXB 3PREA 3HFML 5KSAA 3ZR5A 1XZ0B 5DZLA 3I9PA 3SKNB 1QSEB 4QHNA 4HS6A 1EXHA 4JJ5B 2BHUA 4DK6A 2P47B 2ZP8A 2G4GA 4FFZL 1WA1X 1NMCB 4PGZA 3HHRB 3CHPA 1EAJA 4KKAD 4IRJC 2MCPL 1TYEB 4XCNB 1GZHA 4DP0X 4DO4A 4FG2A 3QQ3A 4EO5A 1PF3A 1HNFA 1QHPA 3U9PL 3DOSA 5FGSA 7PCYA 3MBEB 5CZVL 3W39B 1QWNA 2WWMC 4NO0B 1E9QB 1GH7A 2R0WL 4GRMB 4AQAB 4DEWA 5ANME 4HDIB 4S1QH 3LKOB 1J10A 5L6YH 1YNTB 5F7MC 4IRSA 3OF6D 2B59B 3DKHA 3ARRA 2ENYA 4CU6A 2E59A 5F0JB 1CZ8L 3GF8A 1BFOA 5IM7B 4MDJA 4ZS7L 5FYKL 2XYBA 1DN2A 3BUQA 2XV0A 1NAMB 2C8NA 5GJTL 3UL4A 2MNUA 5GSVB 3PJSA 4Z77B 1QHQA 3JWOC 2J21A 5HGBB 5FA4B 2IAAC 1F00I 4G70B 4CSTA 1HEZA 2WQ8A 4MJ5A 1YN7A 2W0KA 3MV7E 3EYVA 1CG9B 4HW6A 4ORGB 3IMVA 4WJ5A 3UTTD 5B1BB 1E9PB 3TV8A 2ESVB 1Q9LB 3MOBH 4R26H 4WFHD 2G3XA 4MJ6A 3F84A 2BP3A 4Y4HD 5TPWL 5GS2D 1MEXH 1IU1A 4HQQH 4I3SL 4B3EA 4JFUA 5AW6B 4JFPA 1JV2A 4DH2A 5EO0A 1G84A 3UDWA 4W4NA 1B4JH 5JXAH 4PCKA 4LCYA 1N70A 3MRRB 2ADJA 4K7FB 2Y07L 3VRLE 4XN2A 4HF5H 2ROYA 3OF6A 1SN0A 5FB8B 1ZKAA 1DSYA 1J5OH 3L9EA 4P9MH 5C3IA 3CVIL 1F4XH 2BH0A 3BXNB 4LAQH 1UYWH 4OSUH 4OVUA 4JPSA 3W38A 1SDYA 5ETUA 5F9DC 5HYSA 1WFUA 2OCJA 3CLEL 3L95A 3WUWA 4QI3A 2HCZX 1PYWB 4MMXB 4TUJB 3RA7L 3C6LD 2DD8H 4XVUC 2ZYRA 4HEME 5DWPA 1IFHH 3ECWA 3QUGA 3QIUB 4G8GB 1HE7A 4ANVA 2XXMB 3AWGA 2DBLH 1KV7A 4Y9EA 3S4SG 1TQBC 1NDTA 2GFBB 1ZVYA 1UXMA 2BOCB 3PAVA 3QUMH 4M1CD 1MFNA 3EH5B 2VITA 4QYOA 3UTTA 1HIMH 1OM9A 1RJLB 5EF3A 3LIUA 5DEGB 3RUGE 1IC7L 5JPNB 5I0VA 5E8EB 1NFDE 5JXEC 4KZ0A 4FQXD 4Y4HA 1AO7E 4UQ3A 3OD3A 5ABAA 4FXKB 1K6QH 3ZE1F 4MX7A 1IQWL 2RJMA 4X2UA 3SDAC 3IDJA 3QJHA 4RDQF 1YUHA 2A77L 2Y7SA 3IGAA 5GJSH 1IC4L 2VZSA 1K4CA 2NY4C 2FH8A 3WNPA 1N12A 2N1TE 1KIQB 4M7KL 3PL6C 1KYOK 4HJGB 2F54D 4G9FB 4KFMA 5EC1B 5IY5B 5SWZE 5C0BA 3H8NA 3FCBA 4P2QD 3VGHA 4IW4C 2YUXA 4EIZC 3O4LD 1F02I 1ES0A 3C6LA 3DDFA 3QJRB 3DIFA 1NL0L 4YHPB 4AH2A 2DQTH 1ZHLA 3U7WH 3VFRB 5L8KB 4PP1D 5D1XC 4WEMB 2DIJA 3S34L 3F6LA 4PJGB 3RFRA 2ICEB 3FN3A 3IDNA 2DWDA 1P5VA 2FUQA 3D3VE 3L5HA 4XN9A 1KTRL 3FXIC 3CVCA 1ZA6B 1A25A 3VQMA 2AXFB 2NSXA 3CE1A 4JANA 3CDGA 1CIDA 1SDDB 4U1NB 2M26A 4FQXA 3IKCA 4UTAL 3BMWA 3CVBA 4X50A 2IMMA 1NINA 1M4KA 3GSWB 4OCSH 4R2GD 1DQQA 3GLEA 4MNGE 2XZQH 4H8UA 1T03L 4LKXA 2MOGA 3FF8A 2EYSA 4JO1H 1G7LB 1KBWA 1SLUA 2WLZA 3EO0B 3PGFH 1UA6L 5F1IA 1M1XB 3FQRA 2AVGA 5DI8B 2EYRB 1ZVSA 3REWA 4OLYH 1SVCP 1GGCH 4U0RB 3C2AH 2F54A 5GISH 3K1DA 4L4TB 4DVRH 1DQDL 2R4SL 3RGVC 1IMHC 1JXGA 4P2QA 4AQ8C 4ZMNA 2RFXB 5H35A 2HJKB 1KBPA 3D50A 4HJ0D 1YMHA 1BAGA 1K8DB 2RD0A 1LK3L 3UP6A 4DGYL 2EIEA 5E2VL 4EDWH 3DPDA 5A2LH 43CAB 4U31A 4M56A 5DC0A 5FF6A 3BQVA 5AYUL 3ECQA 5AL0A 4XPHH 4X7SH 4PGEA 2J5WA 2FJSA 3AREA 3CFIC 2IDUA 3MCG1 3ML8A 3VFNA 3ZR6A 2G2RB 4LCVA 1OB1B 1RURH 4XAKE 3E6FB 4M1DL 1DDTA 1IAOA 2A7BA 3R18A 3W0WD 3GXUB 2V6HA 3T5WA 3IU3A 4O02H 4ADIA 2GSMB 4YPGA 1YYCA 4JHBA 2PYFB 1FFQA 1QTPA 2MOQA 4YNYB 4AGNA 3H9SD 3BUDA 3OTTA 4FG4A 2WLLB 4Z7VA 1DQKA 1MFAL 4GFXA 2FEDC 1URIA 2PW2A 3OSVA 2ZX8A 3QXDB 4IBQA 1S7WB 4MNQE 1HSAB 1QUPA 2AV7B 4PJXE 4ALAC 1OTUC 1A2YB 1ASOA 3HAEG 2HYMA 3Q0HA 1QSEE 1BLNA 1TLMA 4P9HC 4IHOA 4XMTA 5KVEE 3FUKA 2L04A 3CK0L 3VFOB 1HN1A 4XBEL 4BE6A 3D87B 4PTTA 5AZ2L 4YHNB 5TDOA 4LEBA 1UENA 1CE1H 4XVJH 4WI6A 1XCXA 2VXSL 4PJ9B 4FQJH 3SCMD 1OAYH 4K55A 3THML 5F6HI 1HXYB 1IQDA 2KPNA 3V0JA 2ATPA 2YAEA 3A3YB 4NRXA 3NPSB 5GS2H 5CBAA 5IMMB 3BCDA 4LDEB 4LIQH 2D0FA 3QQ4A 3W0WA 4OCXH 4LHUG 4NJ9L 1B0RA 3TFKC 2OXHB 2EVGA 5FHAL 2XLLA 4HGWB 3MLYH 2JH2A 1LXMA 4NUMA 2NY5H 1LE9B 4OIBA 3CFMA 4A1RA 2CLRB 4AXWA 2J1WA 1UD2A 1MVFA 4HIEB 3T3PF 3TWYA 1M6OA 5HI5C 3H9SA 3FUIA 2XG4B 4HUKB 3FB5A 2WOBA 2F53B 3RWDA 3JSSA 1OW0A 3DTDA 4R8WL 1BVKA 4XCYB 3ILEA 4POZC 1YNLL 1TG8A 1XGTA 3AWFA 2VDPL 5L2KB 4QJ4B 1JIBA 3ZKXC 4RVBA 2CUAA 3GK8H 4MDIA 2BERA 1INQA 3W9EA 1I1AB 3NRPA 1GAFH 4N2MA 1QZNA 4EAEA 1BQ5A 3BGMA 3QSKB 3IU4H 5FM4A 5KBDA 4P23C 5CCKL 1XSOA 3SCMA 2ESVE 4JG1H 4WWKD 5EZLB 1UTDA 4KKCC 4AIZB 3M46A 3GMMA 4M48H 2DL2A 2YEZA 3H56A 3U9WA 5I1CH 5IHZB 1VEOA 2AFNA 3IFNL 1D5ZA 2R59A 3HNTH 1THAA 4Y5YB 1U91B 2VE6B 2XNAA 2YMOA 4IGBB 4JY6B 4ZTPH 2AJSL 3MPCA 4ONFH 4EI5D 1SDAB 4ISVA 4QRRB 3MKKA 5ICXA 1XGUA 2HLFC 4QXUH 1RIHL 3ZHDA 4BKLA 1IFGA 4JMXA 3N40F 4OZFG 4TQIA 3BKCL 3LQZB 2WKLA 3C6EA 3KJ4B 4OAWA 3NQIA 1I75A 1AXTL 3KPSD 4WW2A 4B9IA 4MBOA 5FYJE 3TBCA 4NB7A 2I7SA 2WZ0A 2YD5A 3KPNB 4G8GE 3PWNB 4JM2D 3GMQB 5F97E 4JL2A 1JTTA 5DVOA 5KJ7E 1J9TA 3D9AH 4MXWL 5ISZD 1B9ZA 4GQ9L 4WWKA 1KFGA 3FCTB 2BVYA 4IK6A 4NGHH 4FQ2H 1PMYA 5D96C 3RBSA 1FZMA 4PLJD 4ZOEA 1FJ1B 4ELMA 2SEBA 1QFUL 3RURA 3QJUB 3TBVA 4DPBX 3V55A 5CZXD 3UIZA 2MOVA 5IR1A 4LB8A 3QGVA 3WDIA 5D4JA 5HVHC 4FQHA 2EDMA 5J8OA 4QT5B 1CDBA 4FDWA 5E2UH 4V1DD 3EXLA 1T80A 2FX9L 5DJ6B 1N5AB 4N2GA 2WWKT 4EI5A 3T1WA 3C8HA 1MQKH 3MRNA 4J3UA 3SJVD 4G9FE 5E99L 2RBLA 3I84A 3MNWA 4X9FA 4NKIH 5GSRB 5ERWB 1L0PA 2BW4A 1Z9LA 3GHBL 1BVZA 3FQTB 4IIQB 4AK2A 3KPSA 5E5UB 2C1OA 4OZ4B 4FABL 2ICES 5IREA 4A7TA 2YQ2A 1YEJH 1II4E 1D5MA 1U21A 3FO0H 4QWWD 3F12A 2ICCA 4ZAKB 4JM2A 2B1HH 4FZ8L 2P5PA 3CDCA 4X6BA 2YQGA 4PJDA 3U4BL 4Y2DD 5I6NA 4N2FA 5ISZA 1A1MB 2F15A 2GY5A 4J1UB 5HGDB 1N0XH 5EPMA 1NPNA 3FSAA 4D9RD 3SY0A 2VDML 1V05A 4YS4A 4H8HA 3MRKA 3DJ9A 4IRJB 3W9DB 4EI0A 4DGUA 1UT9A 2YAQA 3IJEA 3TL5A 5DQ9A 4B41A 2HKHL 4V1DA 4G6FD 2FRGP 2GUYA 2I24N 2PKDA 4MKMA 3BW9A 5JIDA 5E9AA 3VW3H 4M7JL 2E47A 2XSKA 4G80A 3SJVA 2X3AA 5DUMH 2K70A 3SKOB 3FZUC 1HDMA 4L4TE 4RFNC 2H45A 2VMFA 1LO5A 3QA3B 5M95B 1FAIH 2C3GA 2COVD 3EHBD 1AGEA 4ZUWA 2ZCLL 1CURA 1RZ7H 3VGGA 1RZKL 2DLFH 5E5MB 4NDMB 3UJJL 4KXCA 4RZCA 1MW0A 3UAFA 1YUKB 4JCMA 2CLZA 3FSZA 1XXDC 5AVSB 2OSYA 1MHCA 2X1WL 3OHXA 1Z3GH 1F6LL 3I74A 2FBRA 3HZKB 4NKQB 5DWUH 4Y2DA 3WEAA 2O6PA 3WE1A 4X4XB 5IW1A 1LD9B 1SBSL 5AUMA 3QJZA 2XWEA 3OB8A 4XZ4A 2ZD0A 2APSA 2BVQB 3EZJB 3MRBA 3NA4A 1WC7A 4PU2A 3ROLA 4I0KA 2XG5B 3KPRB 4AUUA 1ZXKA 5E51A 4PUBH 1Q72H 2Z65C 1EJ6A 1HOCB 3OGCA 3CQQA 4K3DL 4KI1A 4GG8A 5ILTL 3QHZL 3SE9L 4PJBE 5ITBH 4TUOB 2QQKH 2C9PA 2JXMA 2QKIC 4BH7A 2A6DB 4ZODA 1NANH 5I8OH 1TFHA 5E4IA 2BNRD 3OMZA 4NWUH 1O7DC 1CGWA 3LVEA 5ESQB 4KJWD 3GRWA 4GSRA 4BWTA 5J5EA 1VPOH 3L54A 3BP4B 2YBRB 3NSYA 4XWOC 4GRWE 1L9MA 5ABDE 2UXFA 4OJAA 5E9DD 1DBMH 4N9OB 2FTAA 5EZIL 2Z1KA 4XX1E 4LE8A 1DQLL 1S9YA 4YDLC 1ITCA 3LAFA 5GGQL 3V5DB 2DM3A 4U6TA 1GW6A 2W81C 1XZWA 1A6VH 5DD1L 3GI8L 3O81A 3VE0A 5CSGA 2FX8H 3FQ1A 1Q94A 4X4ME 2EXTA 3FTSA 1DCLA 1RJYA 4WW2F 5EU7C 3CLFH 4KY1H 2RH0A 1TO5A 4PEEA 3B9DA 4KXZI 1SQ2N 3HI6L 3L9YA 4LLDA 2PWFA 4BRVA 1KDJA 4DQOL 1TQBB 3TEYA 3TO4C 2V5SA 3CMOL 1XMEB 2EDBA 3KBEA 1PQZA 3NFSH 1SHSA 3RP1A 4LPWA 4DP5X 5BVJB 5FUCE 1OHQA 1RZGA 4KGJA 1NSNL 2F53E 1SOSA 3OAUL 4M5YL 4WEBL 3SDAB 3JTBA 4ELMF 2BNRA 4QRUA 2X9XA 1OSZA 1UH4A 5G55A 2ZYIA 3QNXB 5L2KE 3DC0A 3N85L 2NY4B 1ZMYA 1OAUH 4XMKL 4ACPA 4A2DA 4R7DA 5H2BB 3U7YL 2OTUB 5E9DA 3PL6B 4MNHB 4ZFGL 3IMUA 3OR7A 3BH9A 2IDQA 1SXZA 2Z4QA 2ODHA 1NICA 4NUJB 4UDTA 2NZIA 1TZAA 1ECYA 3E80A 1HH9A 3MA9H 5I1IL 4H8PA 5I1KH 1JF1A 2OP4L 1UXWB 3LRGA 4QTHB 3VFTB 5LCVA 3CTTA 3N9GH 5I2IB 1P53A 2VQ1A 4CBZA 4X4ZA 3RL2A 4JGUA 5D1XB 1NGZB 4N28A 3LN5A 4IU3A 1NFAA 4JM2F 2XWTB 1N2RA 3BRFA 2A1WL 4XMUA 2FHBA 2Y1ZA 4X6FB 4PJDF 3KPPB 4QRTB 1UJ3C 2QMJA 1QFWI 2WXLA 3L2NA 5EU4B 2GW5A 3G6AA 2AEQH 3FFCD 4QRRE 4LLQB 5AAMA 1A7QL 2JIXA 2PCPA 9CGTA 4HK3J 5EO1B 1IEAB 25C8L 3MLRL 4Y19D 5FYLE 5MI0B 4MJHA 4Q9RH 2HMIC 3G5WA 1A0QH 2F8XC 2XQYK 4F7EB 4Y5VC 4NBXB 5DHDA 2Z35B 3P0VL 1MWAL 4XBPA 1AG6A 4LSRL 2W9EL 3H2QA 3KCPB 1QQDA 4QAMB 4WCYH 1JNLL 2I07A 5D9SB 4F9PA 1L6ZA 1X5JA 4W6XB 4Z3GA 1GGIL 3S37L 1G9ML 1HX0A 2O5NA 3D0LA 3RGVB 5C0DA 2OSLA 5IK3B 3RNKB 3EYOB 4L4VD 2DQHH 1NCBL 1YQVH 3QXAA 4CNIB 1G9NL 1RERA 1NKRA 3U1SH 3BJLA 1QBLH 2J5LC 5BJTB 2YC1B 2XN0A 3QPQD 3V6ZB 1QASA 5DRNA 3EYFA 3BEWB 4M5ZL 3BH8A 1NPJA 2QL1A 3QDMB 4R4BB 1EV2E 2YWYA 3OBAA 4TUKH 3MCYA 1OAKH 4QO1A 5ECJE 4KKLD 5EOCL 4Z3EA 5IWLC 1T3FA 1PD1A 5CJBA 1AQDB 3HC0B 5T3XD 3X3GL 4R3SA 4NUQA 3FFCA 1IT9H 4KK8D 4HPOH 4KZEH 1MFCH 5HXMA 1HL5A 4PB0L 5BO1L 4IBWA 1VERA 4DCQB 1HH6B 1WIUA 3O2DA 4FMKA 1WHPA 4Y19A 3MRCB 5JOFA 3S2AA 2VXVL 2P5WE 4WAFA 3HZVA 1U8KA 2BNQA 2O5YL 3MNVA 4XTRD 3QIBD 4YWGH 4CVUA 2QVKA 1NOLA 2P52A 1EMTL 3BD4A 4OD2B 3UGXA 5C0FA 4PPTA 4ZXBD 4MXQC 4X8CA 4TTGA 5CP7A 1NEZG 3H3PH 4L4VA 5MP6L 2G5UA 2VQUA 2CMRH 4DP9X 1UOLA 5HGAA 2GSGA 2NW2A 5IOPA 2WBJC 4WJG3 1GJIA 1X5IA 3I6KB 2WW8A 3LKQA 2D8KA 3KVDD 5FUZL 5LGHL 3MRHA 2WTOA 1U95B 4WKXA 5TGBB 5JIHA 3ZDXE 1NGWA 5D7IA 2Z64C 3FTGA 4C59B 1HQ4B 1ZTMA 2GIMA 2P5ED 2WXRA 2AXWA 1BJ1J 4JFHE 4TN9A 4ABWA 2EDJA 2H1XA 2OR9L 2RCSL 1IGTA 4EOWH 5TE6L 2NUTB 1EH9A 1JHKH 3FFDA 3QZOA 5FHBH 4QRQB 4YSCA 4QIRA 4HWEH 1CGSH 2DI8A 1CDIA 2FQDA 4TVUA 1G87A 1YJDL 5E00A 3TP4A 2V7NA 2ADIA 3QIBA 4AQEB 2CO7A 2YAFA 1F1DA 2FD6L 4DGVH 1OP5K 1EO8H 1BQSA 3TH3T 3ISRA 4EEEA 1P1VA 5CSZA 1ZLSH 3ZKXB 4IBYA 5DFVC 3RWCB 3JT0A 2EC8A 5F7EH 4AW4A 1FPTL 3J2PA 4FCAA 4KU1A 3KPRE 1E42A 3MLSL 1CL7I 3BHBB 4O9HL 4P23B 5JQHC 1T7XA 5FCUL 1YAIA 4PJCF 2W91A 5E5LA 4E9WA 4MBRA 4FJZA 2PPFA 3IF1A 3V52L 5AENA 3NEXA 1QFWL 2P5EA 2Q5BA 2XQYG 2WXPA 3TBTA 4PRPA 2J2ZA 3CHXA 3Q5YA 4I2XB 4XRCB 2CR0A 3QCTL 5CMAB 1SEQL 1XIWC 2ZWYA 3BIKB 5HDOA 1FBIH 1HHGA 2XA8L 1H3PH 1RZKC 1NZRA 3TONA 5DRZB 1T0OA 2DQDH 5KSVB 1BMWA 4HLJA 4GW5B 4Q97A 2WO3B 4IRZH 4AWJC 4L8BB 4NQVA 1I7ZA 2NXYC 2UWEA 1F2XK 1TQWA 1EJOL 5JZ7C 5CLZA 1PX8A 2D31A 1DQML 4PTUB 1ONQB 1D7FA 4P2RD 1N6QL 2X2UA 4WFEE 3FUMA 3UH8A 4M29A 3L81A 1P5UA 3D05A 3WI9A 4M8VA 5HDQH 4Y1AB 2PR4H 2CDFA 3ZE0B 4P2OD 1KZQA 4UT9H 5E8OB 5DHVB 5HPOA 1HWGB 3F5WA 4HWNA 3HBGA 4MFHA 4WFFE 4IOIB 5IJVB 2DS4A 3RNQB 2CO3A 3P2TA 4K23L 4EUPB 2VUOA 4LGSB 1FA4A 5D96B 3KD4A 3C09C 3SN6N 3ETTA 2J6EA 1HEHC 5DJDA 2GIXA 1EHNA 5E6RB 3DK0A 1T83A 3TNMA 5HVHB 5EIIA 5A7EA 3DECA 3WJJA 4TMPA 5F7DA 4S1QL 5JUEH 3TBYA 1KYOJ 4C54A 2VMJA 4OZHA 3LZNA 4EXPX 5F7AA 3IJYA 1TDQA 4AW7A 4ZMLA 2X53A 4AYFB 4BSVB 5LAXA 4J3OG 5L0QC 2ADGB 1B0GA 2VB5A 4P2RA 2BIIA 3HRZA 3LPFA 3HPJA 4RWYL 3CFCL 3PWPD 4NZUH 4FD0A 2YD8A 5E9NA 5D1XE 5CJQH 4P2OA 4XNAA 1GW0A 1KDIA 3BE1H 5AW8B 1U2YA 1QW8A 3MNMA 2E9WA 3P0YH 1OAXH 2YEQA 2WZAA 3BZ4B 3Q8CA 4NIKB 4R26L 2R69A 4HFWB 5T3XH 5F0MB 1TJGH 3EOAB 1MEXL 4LPYA 2IGFH 3QZBA 3AJ7A 2R2EB 3OKLB 3BAEH 3VG9C 1IBDA 1U8PA 4YO0B 3PFQA 5JXAL 5D7IF 3V4UH 4O5LH 4A7VA 4DJMA 2JFCA 4UOW1 1U2HA 4HF5L 3H7BA 4E42A 1I1YA 3EJZC 1UXSB 5C6WH 4BKSC 1F4XL 4ZMWA 3QRGH 4LAQL 4OSUL 3VXMD 4RFNB 4NSKA 2DPKA 4CC4C 5C07A 2WZ6A 3Q1SH 4OGAD 1AGDB 1LWRA 5CEYA 1P2CA 3GNMH 4AGLA 3FRUB 3NEEA 3ZDYB 2JQZA 4QLWA 2WBXA 1Z5LB 3PWPA 4ERSL 5IVZB 4CSZA 2DD8L 5K9KB 4S0TD 1E50A 1FL3A 2HRLA 2ZYHA 3DHMA 1CL7L 1NGQL 5FWQA 1E4JA 3QDME 1ZSDB 2DBLL 1NDGB 2QZ5A 4JK0D 4AM0Q 1IC5H 3ZUNC 2GJ6B 2N7BA 2Z7WA 1ZHBA 1SF5A 3QUML 3WO4C 2ZTBA 1HIML 1A6TA 3Q6GH 4UF7C 2ATKA 3SKMB 1FVEA 1XGPB 1BXVA 1RK0A 4URTB 2CO2A 2NOYA 3H54A 1SMOA 4WJKB 3RL1A 3IMSA 1DBAH 4NQED 1G1CA 2J43A 4JR9L 4R90H 2QQQA 2D2OA 3SPVA 5F9OH 5BUPA 5LO7A 5FR3A 4NZRH 4X7FC 3UTQB 1CE6A 2QKIB 5LWYH 1LO0H 1OGTB 3ABLB 3ME0A 3D34A 4MCZA 4OLWH 2EIZB 4NC1E 1X9RA 2E6JA 2P3YA 4WRLA 1K5NA 4Q6IA 1G9MC 2Z8VC 1RAMA 3VXMA 3D25A 4YDKL 4LLYA 3Q1EA 2WLMA 3Q44A 5TQ0L 3HJEA 3RKDC 4L29B 7PAZA 2JQMA 2I69A 5IF0B 5HPMB 1OZTG 4G8FA 3VX0A 4N20A 3HR6A 3QXUA 4YDLB 3H4HA 4E5XG 2YQ3A 2DTMH 3E8UH 1BOGB 3U7WL 3BQUD 1F86A 5GHWL 2W1NA 2CHWA 4L8SA 4PD4K 3NIDF 2UWEF 2H6PA 3WGUB 3INOA 1SHXA 2VKWA 2W88A 2J6EH 5MEND 5LN8A 4AGQA 5IMKA 3HE7C 3LPGA 1GC1C 4JFED 4MQXD 5HY9B 3TO4B 1ZE3C 4EKJA 1EVUA 4NQEA 4Z7QF 3WN5A 4XX1G 1FV1A 2CUIA 4LL4A 1N67A 2C4XA 2GC4C 4AYID 4BFNA 3LEXB 2XZQL 5AOKA 2BW5A 2XN2A 3WFDH 4JY4B 2QDVA 4JO1L 3B2UD 3RVWC 5FUOH 3PGFL 1FZJB 1KPVA 2BRQA 4U6HB 3TM6A 5HBBA 4JDTH 2OQJA 1FFPB 2WJ7A 1EZVX 1GGCL 3PDOB 3K81A 3GIZH 4WF7A 3C2AL 2VDKH 1UM4H 4NOBA 4H1LB 4X42A 1EZUA 4XGZB 4G1MA 4HIPA 1UOWA 2Z7UA 1J0JA 2VN7A 2J20A 4R7XA 3NK3A 3IDXH 3DVIA 3X13B 1FP5A 4J6RH 1FO0H 3FK3A 1TITA 3JT2A 3VQLA 1MLCA 4EDWL 1F41A 4OZHF 4XBGA 3LEYH 4ODTH 1EXUB 1YLBB 3BQUA 2X4TA 3DDGA 3TIDB 2PTTA 4XPHL 4X7SL 4NPYB 2CA3A 1WGOA 1OCCB 2R69H 5DS8B 3H1ZA 1RURL 2DICA 2GITA 2WLIB 2UZYB 1GL4B 4I2XE 5MENA 1B4LA 1N6VA 1UASA 1U8MB 4DTGL 1V10A 4JFEA 1J7VR 3MJ8B 5MERA 1L3WA 3NIFF 2BXZA 3KLSA 2G30A 3O3AB 1RMFL 2VM9A 3ARBC 1WJ3A 3WIAA 4C56D 4NRYB 1CD8A 1UJ3B 3HOGA 5B38A 4M4PA 3WO3B 3CFJA 1W0VA 1WWCA 1L7TH 3S5LB 2ZAGA 4X8GA 1A1OA 3BAKA 3U6XA 4RGND 4F8TA 4JPKL 5C70A 1OVZA 3W5MA 5HHOD 2VDPB 4OKVA 1NCAH 4Z7OF 3NK4A 3FB6A 5I76B 2FLMA 4KAQH 3MGAA 5L88H 2YD0A 5DQJA 2OPCA 4Y5VB 1FN4A 4XC1H 1HCZA 4JHVA 4KJPC 4OD1H 3SE4C 3WFBH 3PWJB 3TA3C 2JMRA 1RSFA 3L7FB 3ZE0E 4GW4B 1L0YA 1MCFA 4XC3H 2X6BA 2CBTA 4DW2H 4DFHA 1CE1L 4NYLA 4XVJL 3E9TA 4FQJL 4MJIE 1OAYL 5EN2B 5T1LB 1WAPA 1JZHA 1TR7A 2J5LB 1NMBL 3VM5A 3ZL4H 3IJ9A 1FNGB 2EDLA 3CVHH 5E1HB 3RWJB 5GS3A 4LARH 3II2A 4LIQL 4PREB 2W94A 1J1PH 1QLFB 4X5QA 3GMOB 1WD8A 4JFFB 1AZRA 2BHZA 3B2VL 4OCXL 3BRDA 1HCVA 3ZKQD 4NUPA 3BVXA 4A2GA 4XNXH 3PE9A 5ICYA 2D9CA 4UILH 4Y16A 1QPXA 3GSRA 4IS6B 3TCXA 3MLYL 1LDPH 5IHLB 2OMUB 4FQCH 2NY5L 1D6EA 4J4PC 3T6VA 4NHUA 3B9KD 3ILQD 4JPVH 3KWXA 1I8KB 2ZCHH 4R96A 4LCUB 4NQXA 2ZG2A 5HHOA 2ZPKH 3FUDA 1OAJA 3L45A 4N0YL 2J6WA 4LCIH 3SOTA 4PCTA 4XPFH 4H8VA 5DC9B 3K2UH 5TE7H 1NEUA 3GK8L 4WHTB 4ATWA 2V3DA 2WGNB 3U2SA 3U4EB 4F5CA 5EEWA 2HH0H 1GAFL 1DFBL 1CDCA 3UG4A 1DVFD 1EEZB 5GGSB 4YE4L 4DP6X 2PABA 3VG0L 4GH7B 4JG1L 3VFUA 4PSRA 1KLFB 2BP8A 2WBJB 3PWUA 4NFCA 3FT2B 5CD5D 4JGJA 4ZPTB 5I1CL 2HUHA 1JS4A 1I1RA 3ASWA 3TNNA 3HS8A 2O6DA 5I82A 4JFOB 3G5ZA 4G82A 3AQXA 3FFOA 3HNTL 2QR0B 4N2IA 3N41F 4ZTOL 2DB8A 2FZ3A 2NW3B 5CLYA 5HHPA 4W9GC 4I88A 4ONFL 5I0YA 1Q0YH 5EO9A 3B9KA 3EADA 2VZ1A 2CK0H 4N5UA 4IBZA 2GTQA 4RIRA 2XWRA 3DRTB 5FFGA 5HTSA 5KSBA 1RPQA 4QXUL 1XHHA 1ZT1A 3GJEB 5J57B 4WI7A 4L3CA 4BZYA 3H42H 4ZW5A 2WQUA 5GS1C 3ZDYE 4JDZA 1GR7A 2BIHA 3MKGA 1UJTA 1XF4B 3GTVA 3LZOA 3IMWA 4ENEC 2V2WB 4Y5XA 1BPVA 3QCUH 1T04A 3FW6A 4R4FL 2OMVB 5JMOC 5HHXL 1CGUA 2W07A 1FNFA 3TYGH 43C9A 3FMGL 4BK5A 1AYRA 2B8OT 5EEZA 2QJDA 1DVFA 3T2NL 4L3ED 3D9AL 2GJ6E 2OR8A 2QDWA 3RWFB 5CJ8A 1YPZA 2VDMB 1NBVH 4NGHL 1S7QA 4OM0H 4RMRA 4B5EA 4FQ2L 2M83A 2XX0A 3FQWA 3CFBB 3MC0A 5E4EC 1BVNP 5IHUH 4AKPA 1RV6X 3GZOA 2FGWL 5CO1A 3N1FC 5EBLB 1CBVL 3QJSB 4YDJB 5D1ZD 1CLZL 4O2EA 1AHWA 4XPGL 5HI3D 1QA9A 3V95A 3TO2B 3EBHA 2WXIA 2XX1A 3V7MA 5E2UL 4KXAA 2XXCB 1MVUA 5CGYD 3CZEA 4NRZA 1S9KC 1XIWB 1NWPA 2AEIT 2EZ0D 3G6JA 5FXCH 2V2XB 3U25A 1A4KB 2YPLB 3BFQG 3C8DA 4DUXA 1SJHB 4NKIL 5CINL 3U0TB 4W6WB 4D8PA 4G11A 3SDDC 4TRPL 3ZK0A 5B22A 4RMBA 2Y7LA 4LEXH 3UEQA 1T2JA 2ITFA 1KEML 4A67A 1D7DA 3T0XA 1OB0A 1BIHA 2GTWA 1SHMA 4X5PA 4Q9QH 2NXYB 1YEJL 4E41D 2X41A 1H6UA 2RACA 1XEDA 2B1HL 1I9IL 1KBKA 3TCTA 4L3EA 4MAYD 2BY1A 5EU7E 4S10A 4W9JC 1JDDA 3ETBF 5KN5A 4JPWL 5AW9B 1N0XL 1BZ8A 3WIIH 1BQKA 3VXTA 4XMWA 2AJZA 5DSCB 3Q48A 5D1ZA 3PUCA 1XGZA 2OJEB 2O61B 2R7EB 4PG2A 3C09B 1GIGH 1IGJA 4JKPH 3EYSH 2DJUA 3SPJA 1YY8B 4YBHA 2FR4A 1FNAA 3GS0A 4RGOH 4F8LA 2B15A 2DW5A 4XVTH 4NAQA 3P77B 5AVRB 4NO5A 4Q14A 1BBDH 3VW3L 2R0LH 2XN9E 1IJ9A 2V8LA 2YMTA 1RIUH 3D85D 3QO0B 4MA7H 5DUML 3MV9D 5D71H 1A5FH 5JNYB 5KSAC 2Y6SC 2VRAA 4XCFL 1OAZH 2IC2A 4M8QA 1F4AA 3DOHA 1FAIL 1WD9A 4WO0A 3UGEA 4BQCA 3G5XB 1RZ7L 3DYOA 2DLFL 4DAGL 2DF3A 2ENQA 4KRMB 4X6CF 1EX0A 1VFBA 5IBLD 3WAKA 4YUEH 5L8LB 5EU6B 1E5YA 1NBZB 4E41A 1FNSH 2YA0A 3DX9A 5L0QB 1GZHC 4A2HA 4NP9A 1Z3GL 5KG9A 4E2OA 1A6ZA 3GUFA 5EEVA 3NBNA 1ZAGA 4MAYA 5DWUL 3DXAD 3MLUH 3T4YB 3H0TB 2BM3A 2W60A 2C3WA 1D9KA 1NGYA 4KWUA 2F19H 1DFXA 2Z92B 2BP0A 2CM6A 4PJHB 2JK5B 2JKIS 2X9YA 1XL6A 1UKSA 1KNOB 1A65A 3AT9A 3Q9PA 5KYUA 4PUBL 1Q72L 1ZA3B 2GJPA 1KJMA 2ICWI 4RMSA 5T1KB 4PRID 2CDGB 2XC8A 4DP1X 2H9GA 4IKIA 2P8LB 4LLVB 2DLEA 2PPAA 3EGXA 5ITBL 3IETA 4FYSA 3RHWF 2QQKL 3HZMA 3RWEA 3BUYB 1MFVA 2VR9A 3DGGA 3VG9B 3IFOB 3D85A 5FYJU 1WF5A 5T5FA 3HPLA 5PCYA 2MH4A 3MV9A 1F45A 1HNGA 5TJWK 1HVXA 1PZ5B 1VZGA 5F6IC 1VPOL 5SWQB 1KCSL 1ZT7A 3WEXB 1ZTXL 1ADWA 3QEUA 5M94B 5L4FA 1QUNA 3VFWB 3GKZA 4KKAC 3F7PC 5BMFH 4XPBH 5KYWA 3VFMB 1N26A 1TQCC 1P4LA 5KSBF 2K9FB 5D7JA 3KYNB 4AT6A 1A6VL 1XAKA 2XV2A 4H8WH 4WWOA 1G7MA 4FGMA 4GP8B 2X09A 2AQ1A 1BFTA 3DXAA 3ML9A 4HU8A 2FX8L 2VABA 2X42A 4B53A 4P4RB 1MAJA 3E9UA 3UDWC 1KPRB 2WXMA 1QR4A 4KY1L 2K0RA 4K94H 4KO5A 1A64A 3I9IA 4M9PA 4R5TA 3F7YB 3CU7A 4G1EB 3C60D 2ZP0T 3WO4B 3TEZA 3MRLB 1T4KB 1TZOA 1YDPA 4PRIA 1V3KA 4KMLB 3F3HA 2VR6A 4NS0A 3ZY7A 3GB7B 5E56A 1G1OA 3KWVA 1KXVA 1WISA 3OKKB 4H25B 4ES8A 1UQSA 3L9RB 4OFDA 3GDCA 4W9LC 2J8UB 2X4PB 2HAZA 3JXAA 4GI6A 3T65A 2VC2B 2NT1A 1JGIA 4ECNA 4CSPA 1BG9A 4N0FA 4I85A 1OAUL 3LKPA 2PCFB 5EG6C 4DWHA 2VDOH 4BK4A 1WWWX 4DGIL 1BV8A 3K6DA 5B3JE 4JFXB 5DRXB 3CCHB 4OCWH 1KELH 3FU6A 3NA9H 5I16B 1XF5B 2VDLL 1R5VB 4HEPG 4JRXD 2DIEA 3L4WA 1QPPA 5FCSH 5BQ7B 5DJ0A 3FHEA 3L16A 5B8CA 4HIIA 1NCJA 4LO9A 3MA9L 4G59C 5HDRA 4Y4HC 3P4LA 5I1KL 4GEJA 3QQ9D 5FECA 3KXFD 4AYGA 3N9GL 5LNEA 4JVUA 2GAZA 2KZBA 4OH2A 4N8PA 4P5RA 4BZ1A 4J27A 5EEXA 2ZICA 4PV9B 4WI8A 1XB3A 3C60A 3I02B 3DPBA 1V55B 2NY5C 4AEIH 3S3PA 3MLVH 1IVTA 4NQQA 4WHCA 4KX9A 3HE7B 5DT1H 5EUOB 4LMQI 3CSTA 1WLHA 4ZMXA 3P4NB 2AEQL 3L13A 3ZDZF 4P2AA 3WV0A 1KFAL 4S1RL 5FEBA 2H3XC 3VGFA 4Q2ZA 2H0JA 5DD3H 1ECZA 3QUKB 4H5SA 3C6LC 4ILDA 1ZLVH 4Q9RL 2R9HC 2BVOA 3DJRA 3INUH 5F71A 3NCEB 3QNYA 4NENB 4W4OA 4GKSB 4G43B 4PJ7B 4L8CB 3GEFA 3DSFH 2HG0A 4OJYA 3H3BC 4XNMA 3X1GA 4M1CC 4JRXA 1EUUA 2A73B 2Q3XA 1B2WH 4Q6KA 1SEBA 3D0AA 3RWHA 2E7LA 2DQHL 1YQVL 1C9SA 4JX0A 4WTZG 4FQXC 5BXFB 3U1SL 2ZP9A 5I30H 2QSVA 4F7CA 1QBLL 3O11B 3KXFA 3HS0A 2VTFA 4HWBA 1GZPB 2V37A 3VB8A 3II3A 2AJYH 3EFOA 5CJOL 1PZBA 3ZBMA 2IAND 3B7TA 1R5IA 4NQSA 3WDJA 1BQHB 3ABKB 4TQEH 2ZKMX 1AOZA 4TUKL 4CN1A 1OAKL 1FYTD 1WZAA 3Q7JA 4OM1L 1N18A 1CD9B 4B60A 1W72A 2G60H 1CXIA 2WMPA 1A4BA 1CPUA 2UZXA 1I9RH 3MSPA 4QHMB 5T5FH 3ARBB 3GRWL 1BEYH 4HPOL 4KZEL 1AI1L 3V0IA 2OYPA 5IB4B 2ARWA 3NZSA 1KIUB 5IB3A 3O3BB 3PGDB 3BKJL 3KVPA 2HVKA 3ZIYA 3WS3A 3VAEA 4W9KC 2PW1B 1MPAH 3NT0A 4HKBB 3TXAA 3EZ8A 2OMYA 3Q6FA 4FEMA 4PP1C 3MI6A 4YWGL 1MFUA 4X5XA 1AYOA 5TF0A 4FFTA 1P69B 3AREC 1BD2B 4F3FB 1KYUA 1GYWA 1VFAB 4YHIA 3TA3B 5I5MA 3V79C 1QW9A 3E0GA 5J6GA 3CFQA 1J8HD 4Y9FA 4HG4K 3ESPA 2P8MB 5ESVB 2BINA 2AP2A 3APCA 4GAGH 2K1MA 2YXVA 3CFDA 3FU7B 4NZDA 3HG3A 1PSKH 2XKUA 1F3DJ 2IANA 5EIVA 4BSJA 1G7IA 5FK9A 3UZQA 1A9VA 4HPHA 1FYTA 1H8SA 1QSZA 4WI3A 1K9TA 4AZ8B 2X6VA 1PZ2A 1P4IH 4HBQA 4Y2OB 4DO5A 4PYGA 5HDLA 3VYOA 2NNRA 2PP9A 4MD5B 1UXLA 2EDXA 4EOWL 3AMKA 4HJ0C 1JHKL 5FHBL 1C16B 4HZ1A 2EJ1A 4HWEL 4HPYH 5IB5B 3VRJB 2OX5B 4EUPG 3D6GA 4Z0XA 5EU6E 5IJKA 2Y5EA 3KL5A 4JLRB 3ZE2B 4ABVA 2C7FA 1R5WA 1EO8L 3FH8A 4U1SA 1ORQB 1NGPH 2FVNA 3CJJA 2HT3D 5C7XH 3WNIA 4JKKA 5K59E 4PV8B 1XSJA 2PCYA 4W9DC 1J8HA 3CFKA 5F7EL 5HI4D 5A2CA 4BZ1H 3P3RA 1I8LA 4PJHE 1Z9OA 1CGXA 1ACZA 1P9MA 3U6RA 4B96A 4BHUA 2WTPA 5AKVA 4FKHA 5BZWA 3FCUB 1Q90A 2H1LM 3F7VA 1V54B 2HLEB 1I7TB 1CFSA 1BXAA 1SBBA 1ZV2A 3QJFA 4JPIA 3DWTA 1FNEB 2P44B 4NXSA 3U4KA 2L8AA 1KXQA 1OW0C 4Z7AA 1I7UA 5KVDL 2V5RA 4HUWB 1FBIL 1J86A 2ZWKA 1WCQA 4HULB 1F1GA 2DDQH 2GSIB 4KNUA 1KLGB 3WGVB 1TTUA 3OL2A 4JAMA 3ZKMD 3L1EA 1CLYL 4PGBA 2DQDL 4AK1A 4PRBB 3CZKA 4DP8X 4Z95L 4YMPA 4H0HB 3PNWA 1BGXH 2BZ7A 2WTRB 3SCMC 4KQ4H 5CLXA 4EIBA 4P48A 5GS1B 3TT3H 2C9SA 5D7HA 3NJGA 3EH2A 1JGLH 3ZKSD 4PJEF 5J9PB 4WSGA 3RVVD 1NMAH 2KERA 1BIIA 3Q01A 3FQXA 2J88H 3VD1A 3VXUB 4ELKB 5DUPH 4HWBH 1XD1A 2JI2A 5HDQL 1IGIH 1AR1D 2FBJL 2IPTH 4UT9L 4WNQB 3WXWH 1HL8A 1SHWA 1G6RA 4DT2A 2P4AB 2YAOA 3M86A 5KVMC 5DMKA 2JKWA 3KNBA 2J25A 2ZONA 3OVUB 5E4EB 1OHZA 4AY0A 1W72H 3MLTB 5IFJA 1VADA 2IQAB 2KQNA 4F7MA 5AW4B 2J8UE 4XO9A 1JCKA 2M8XA 1ED3A 3VH8A 2FWOB 4LNRA 3O2DL 3EDEA 3RVUD 2Y5TB 2VJ8A 4WW2C 3V5HA 5IG7B 1BM7A 1HWHB 4YHLH 2Y7NA 4MMYA 2C9VA 5EC2B 3HUJB 5AVWB 4WKZA 3UX9B 2H0PA 3IEAA 4N0RA 3SOBH 1CD1A 2B0SL 1YHPA 4MRBA 4FXGA 2X28A 1QOKA 4JFDD 4X99A 3ZSSA 2P24B 3SDDB 3BKML 1ORSA 3ZE1B 2UY6A 3GMPA 3S3SA 4UMSA 2EXWD 4NPJA 4TUUA 3UC0H 2HWZH 4HJJH 3NJNA 4PW9A 2J55A 5CJQL 4C83A 1Q9OB 4PD4J 1O6SB 3QUMB 1MW3A 5AB1A 1BZOA 1D5BA 2FL5B 2IIJA 3BE1L 4HYTB 3C08H 5D5ME 2GHWB 2QGDA 3MRIB 4FNQA 2ZXDA 3I3DA 5DVMA 5DTFA 3P0YL 2ZX9A 4MS8D 4NHCH 1E9OB 3ALXA 3DMMA 4EI5C 3GSNA 5EUOE 5T3XL 1VAHA 3L3HB 1TJGL 5HYJD 5F9AC 3VGEA 3OMAB 4LT7A 2DKMA 5GGRB 3R4DA 4L23A 4YAQA 4D9LH 4J8QA 5DFAA 5AOZA 3AG2B 3K8MA 4L8DA 1DEEB 3V4UL 1EEUA 4O5LL 3AXLB 4U4IA 5D55A 3RRQA 4PJ7E 4JM2C 4KI5D 4Y7MA 1WYJA 2HFFB 1MCLA 3KEHA 5HDBF 1FL6A 2UYLA 2AERT 4ONHA 1PG7X 4Q4IA 4P0DA 4CMHC 5KSAB 4JFDA 4GINA 4QHNB 1JZDC 3Q1SL 1O6TA 4HS6B 4N90E 5I0WA 3GNML 3BH4A 1XR8A 3L3OA 4LSTH 4WEUD 3QG7H 1BM3H 4I87A 1SMDA 3WNKA 3AADB 2V8MA 3QQ3B 4ZFFA 4RDBA 3PUUA 5A6LA 3OJDB 3RWGA 3DOSB 2CXKA 1IC5L 2JI3A 1H15A 1U3HD 1PEWA 3WS6A 3RDTD 5D8JH 1U6AH 5I6OA 3Q6GL 1J8KA 1KN2H 5HYJA 1JDAA 4NI6A 1CLOH 5EZJA 1FVCA 3EO9H 3ZW3A 3SE6A 4HCFA 4I5BA 4R90L 5IGXH 2LAAA 5F9OL 5DK2A 2XWCA 1BFOB 4MDJB 3ZU8A 1WH0A 3PDGA 4OFYD 1I9JH 4QWWC 5LWYL 4OLWL 3OHXC 1PTZA 3ZO0A 1P4BH 1BD2E 3PJSB 4BFIA 2D9QB 1JN6A 4Y2DC 1Z66A 3NN8A 5TDNB 1RZ8A 4PAZA 3SO3C 5F6IB 5D7KE 1TQSA 5HVGB 4MJ5B 1YN7B 3DX0A 4I3RH 3EYVB 2B1AH 3S5LG 4U1GC 4WJ5B 2NYKA 2E27H 3BWUF 2DTML 5JW5A 1G6RH 1TFPA 1TQCB 1ACYH 4MJ6B 3M17A 4QDGA 3HS9A 2VERN 2J3SA 4LK4A 2UY7A 1FRGH 2C34A 3DIDA 1E40A 4M6NH 1JV2B 4NO2A 4PRHD 1U3HA 2ED7A 4XO4A 5EO0B 5GRZA 1XO8A 3RDTA 4CN4A 4FNUA 2J6EL 3L3KA 4JQIA 3RPIA 2N0MA 1S78D 3VU1A 2YRBA 4LCYB 2ADJB 5LGYA 4O2CA 3EHBC 1HCYA 5DD6A 3VI3F 8FABA 3OLDA 5GZOD 4BFGA 2VW4A 5D1QD 4NZJA 5IIEB 1JWSA 3D2UD 5ETUB 4N2DA 3VI4A 5HYSB 4OFYA 3WFDL 2X1QA 1E2VA 2J8HA 3L95B 5FUOL 2JE8A 1X4XA 1JZJA 2P45B 4LRNL 3WUWB 3ZE2E 4BQ8A 4YSQA 1ML0A 3CPUA 3LNHA 4JDTL 3VDCA 5I5IA 3S5YA 2KS0A 1SZNA 3GIZL 2VDKL 1UM4L 2X1PA 1DYZA 2NTFA 3B8YA 4HUUA 3UJTH 3IDXL 2FSEA 2VDRL 2WNKA 4J6RL 3UTTB 4LSVH 2IBZX 2VITB 2YD6A 3LEYL 4ODTL 3UBXG 1IILE 5JW3H 4GP5B 4MD4A 4Y4HB 4WK2B 3ARXA 5BVPL 4UQ3B 2R69L 2AQ2A 4PRHA 4MX7B 4WTWA 4MDRA 4YSTA 1XF1A 3CN0A 3IDJB 2NCMA 5HHVH 1R75A 3QJHB 4KJWC 1YUHB 1DUZA 3IGAB 2BSRA 2DQUH 3LXAA 4DPCX 1PX4A 3GJFA 3WENA 1K4CB 3MX0A 1A22B 3QW9A 2EEDA 5GZOA 1DBKH 3RX8A 2AJVL 3CUPA 2WKOA 4UQ2A 1EGJA 4F2FA 5DQDH 1S5HA 3D2UA 4KO7A 3UADA 5IT2H 1L7TL 4TQPA 2QSQA 5AZUA 1OM3L 1SY6A 3JVGA 5C0BB 3G08A 1V7NL 3QQNA 5A2FA 3BGAA 4MA3B 4L3FA 2R2BA 4GRLD 2V9UA 4LFHG 1ZLWH 3BVTA 1ES0B 3C6LB 4KAQL 1WFTA 1JAEA 2GCYA 3DIFB 3HLAA 5L88L 5TFSL 4WY7L 3TJEL 4AH2B 5FFLA 1QLRA 1ZHLB 4B9JA 4XC1L 3WFBL 2IOOA 4OD1L 3HHSA 4G6JL 4UAHA 1QVOA 4LLUA 2H3NA 1FUNA 2Q8BH 3IDNB 3PXJA 2DWDB 5C0AB 3HN5A 1P5VB 5ITFA 3HTLX 4YGAB 3KMDA 4UB0H 4DW2L 4JANB 1GY2A 3CDGB 4OT1H 1EUTA 2HX9A 1KB5A 2WUCL 2PYEE 3IKCB 4HJTA 4DK3A 1U8NA 4W68A 4KKZA 5AAMC 3LNEA 4HISA 4BIKA 4E0RA 4JFYA 4K73A 2X70A 4PBVC 1AD0A 1ZHNA 4LARL 1J1PL 4LKXB 1MCBA 2D7PA 2EYSB 1I3VA 1Q8MA 5F1IB 3FQRB 2NUPA 3DI3B 4FNRA 5DJZA 1SUJA 2YGNA 2QQNL 4XNXL 3K71A 1CQYA 1ZVSB 4UILL 3REWB 3HUJE 1JZ8A 1FFRA 2DYPD 1LDPL 3C8KA 4FQCL 2F54B 4F9PC 3QWRD 1QBAA 3LNFA 3FOLA 4P2QB 5H35B 3BLPX 4JPVL 4APQD 4AE0A 1UM6L 4WQOA 2ZCHL 3QORD 4KROC 1JZ7A 1YMHB 2X4QA 2CKBA 4G6KH 2ZPKL 3EUDA 5KS9A 3ZE1E 5FF6B 2YAMA 1IAIH 4LCIL 3D39D 4XPFL 1M7IA 1ICTA 4F58L 4BA0A 2DKSA 4R0LA 3K2UL 4PGEB 5TE7L 1KGCE 3AREB 3VFNB 4KI5F 5KVGH 1MCQA 2CG9X 4FA8A 1PG7W 2HH0L 5B39A 2A6JA 1IAOB 2CGRH 3VU2A 4K2UH 1MFBH 2XACC 4JKMA 2NMSA 5F89A 2W9LA 3D06A 5FIEA 2NXZD 5AD0B 3LZRA 3IU3B 5DDHB 4JQIH 5GGVH 4YPGB 4GT7A 3E1ZA 3OZLA 2EDHA 2JCCA 4LDOB 2WK2A 4RNRB 3HB3D 1CDHA 3UZVA 1BLIA 4OZGA 1PU0A 5E1QA 4MCYA 1Q0XH 1G7HA 4Z7VB 4OJFH 2EDKA 5BRPA 1NWOA 4G42A 2WWNA 4PHZA 2DYPA 4BQ9A 4N0UA 2PW2B 1NCWH 3QWRA 4X7TA 1Q0YL 3A21A 4N3UA 3BMVA 3GXMA 3QZWA 3VXPA 3SDCD 4APQA 3QORA 1BLNB 1HKLH 3EKCA 4IHOB 1R3HB 3H42L 3MACH 1IIIA 3CSYA 4PTTB 4L5FE 5TDOB 1NDMA 3D39A 2F5AL 4N25A 3ZRSA 2WXFA 2Z1PA 3ERXA 3QPQC 3VI4F 4KK9D 1IQDB 4MAUH 3TYGL 2ATPB 4R97C 1NM4A 4NRXB 4KKLC 4QXGH 5CBAB 3MRDA 3WSQH 1TPXC 3QQ4B 3W0WB 4WWNA 2B3RA 2XKSA 4KK8C 4X5LA 3AS3A 1B0RB 1NBVL 4OM0L 1I3RA 1AKJA 3ZOAA 1YEGL 1OOWA 3GJFH 4IJTA 3IMTA 2QGBA 4JG9A 1ODAA 1N64L 3KBFA 3SZKC 5KBLA 1WHOA 1P7QD 2AXHA 3L4ZA 5SWSD 4AXWB 1FGVH 4YL4A 5C0RH 5GRXG 3G9VA 3H9SB 4XTRC 3FB5B 3QIBC 4MSWA 3R0NA 3RY6A 3W3BA 1VFOA 3F7KA 1BVKB 1NIEA 1J0HA 1CTOA 5IBUB 1XGTB 2VXQH 1LMIA 4N5ED 3OKNA 5FO7B 5DMYA 1I1CA 1H9DA 3SDCA 1S5IL 1TZIA 4ODUA 4P8QA 5BZXA 3WEMA 2AITA 2E9JA 4MDIB 1INQB 3V9CA 3RJDA 1WITA 2WKOF 3VQ2C 3BGMB 1ZJBA 1HU8A 5JHMA 1IE5A 3ATAA 2HT2D 2ZT9C 4LEXL 3SCMB 2Q76B 4P2YA 2VZ3A 3P69A 4M7LT 4I9WD 4QKTA 3UABA 1T5XA 3GMMB 1Z1WA 1YYLH 2YEZB 4NNPH 3RIFF 1TCRA 3GT6A 2YAHA 2XIIA 1D5ZB 3ALPA 1M6UA 3FO2A 1CCZA 5I5JA 2BFGA 1ZRUA 1I3UA 2DH3A 1DVXA 2DIAA 3QFJD 2EDYA 5D7LD 2LFEA 2DKUA 3T0WA 3BESR 2XNAB 3WEBA 4XE5B 3WIIL 1SOQA 3QVAA 4BDVA 1JL8A 2C4FT 5SWSA 3T2PA 5FO8A 2HJFB 4U3HA 2YOCA 1NFKA 4ISVB 1NCDH 1M53A 2AJUH 1GIGL 5ICXB 1XGUB 2PTUA 3EYSL 4JKPL 1BZDA 4BKLB 2ZWZA 5CIPA 3ULUD 4RGOL 5G4MA 2EEAA 4OAWB 3WNNA 5BOPA 2CO1A 4HS8H 1BBDL 2CKBH 3W1ZA 4MA7L 4WW2B 5JHDD 3GWJA 2ZAHA 5D71L 1A5FL 4GO8A 4UQAA 3UMNA 3PP4H 2WBWB 4WTXA 4W9EC 1OAZL 5C08D 4J39A 1A4AA 1DZBA 1G43A 4PHXA 5IEHA 1URZA 2XFXA 4KUCD 4WFHE 4YUEL 3RTQD 1C8PA 1ZS8A 1YVLA 1MW2A 3T8VA 3VJ6A 1FZMB 3V4VB 2ZUWA 5IZ7A 3NCWA 4JFZH 4LIQE 3LKRA 2SEBB 1KCVL 1ZSHA 4ELMB 3MLUL 2OYKA 1MKFA 1MRFH 5T33H 5I75C 5IR1B 1NCGA 3OXSA 3QFJA 3FBQA 3IBEA 3VWKD 1T83C 5D7LA 4YXHH 3NCYS 1NAKH 2X0VA 4FQHB 2F19L 1HE8A 3NZHH 2UZPA 4LSQH 3WJJC 1DQJA 1F11A 1ID5I 1LQBC 1AACA 1OT4A 1GSMA 4QYAA 4S11A 3KWWA 1G1KA 3GS7A 2ITCA 2YMXH 4EI5B 2DMGA 4TKWA 4A04A 4BXVA 5HDWA 1KBGH 3MNWB 2K8MA 2AABL 2BIPA 4AYSA 3I3BA 5LBVA 5C0BE 3PQYD 3B3BA 5EOQH 1MZYA 4HT1H 4IEFA 5T1DH 1MFMA 3WAJA 2JCCF 1F4YL 2IPKA 3FQNB 3KPSB 1C5BH 5JHDA 2C1OB 5I66A 3HRZC 4OZGF 2AJXH 4JFVA 5ESAA 4F8OA 2X4SA 1KF9B 3ZXAC 1D5MB 4BFFA 2VDLB 2HPOA 3F12B 4JM2B 1TOXA 4P2OC 4NNYA 5C08A 2XOTA 4X6BB 5C0AE 3EDKA 2ITEA 4PJDB 1JZIA 1JVOA 5ISZB 4CMHB 3RTQA 2D3LA 1UT1A 3MRJB 3GD1C 1ET5A 5BMFL 4BINA 3ZTEA 4XPBL 4CILA 1T1WA 5EPMB 2WV3A 3TJHD 3SY0B 4AEFA 3FB8B 4H8WL 3CDZA 1RU9H 2MPVA 3EJQA 5D2NA 4XX5A 2ZCKH 2VR8A 3MODH 3IJEB 4P5SA 5DQ9B 3VWKA 4FA7B 4PWIA 4K94L 1MCNA 3L1FA 4V1DB 3ZKND 3QUYD 4ZUSA 3BW9B 5K1NA 4NQDD 3LX9A 4WU7A 4G80B 3SJVB 1L9QA 2IADA 4L1LA 2FYYA 4JUTA 2V7HB 1HDMB 3TZVD 2EDQA 3PQYA 1LO5B 2BFVL 3DYPA 4O58H 1AGEB 4U2ZA 3N0PB 1XGRA 4K7PH 4RZCB 4HLEA 4XNYH 3ZTJG 4L9LA 4U6XA 2CLZB 1PS3A 3RG1C 3CIQA 3P9MA 4MHHG 5LNGA 1F6FB 1MHCB 3OHXB 2VDOL 1JNHA 1AZUA 2MMXA 1FIGH 2CA4A 2VLMD 1FCCA 4OCWL 3FAWA 4Y2DB 5G5DA 5IW1B 3QZMA 3SO3B 4B5ZA 1TSRA 1S6NA 5AUMB 1MJJB 1KEGH 3MGTA 5HHMB 3MRBB 2EIJB 1WC7B 3ROLB 4P57A 4HG4J 1IGYA 2BSSA 4YSOA 3GHEH 1BF8A 4U1GB 1AZZC 3HI1A 3OGCB 1IAKA 4GG8B 4UIKH 5GGUA 2X7LA 2B5IC 2ICWB 3QHFH 3VD4A 1W9XA 3MRGA 3QUYA 4Z7VE 2JXMB 1WBXA 5KYXA 4BH7B 4MD0A 5DEJA 4AEIL 4L0PB 3HG1D 3N42F 5CIPH 4Q6IC 1JFQL 1PAZA 5J4MA 4L9DA 3AGVA 4EPSA 3TZVA 1NFIA 2VLLA 1IGFL 1TETH 3ZPDA 1KC5L 3ET9F 3EHBB 4KTDL 4OGAC 2W59A 3CQFA 3BYTA 2A6KA 4ABQA 1E5BA 3LSOB 2EDFA 2P28B 1DVTA 3BDBA 3UJIH 3WFEH 5DD3L 3IRPX 3LXUX 1S9YB 2PETA 2CNZA 3BN3B 4X80H 3INUL 3QI9D 3IGLA 2W0FA 4PY8I 3S36H 1FLRL 4LQ1A 4L8SC 1HSBB 3DSFL 3VE0B 4PBDA 2PO6D 1Q94B 3CIAA 3ARUA 3IWUA 4M5TA 4X6DB 3W0WE 1DVZA 1NCIA 3BP6A 2R23A 3UEZA 2DWSA 2ERJC 3WN5C 1PQZB 4DUWA 5I6LA 4PVNA 2ZOLA 1Q9KA 2B7DT 4ZJ9A 2AJYL 2MCAA 3O8XA 3H9SE 4AMKH 1RZGB 4JVPA 4TQEL 3H3KA 3H6AA 1AFVH 3EJSA 2BNRB 3HG1A 3ULUH 4QRUB 1OSZB 1RUAH 1GVIA 4K7PX 3STZB 1IL1A 1GGBH 1I9RL 5T5FL 4R7DB 5E9DB 2AC0A 3OR7B 3BH9B 2Z4QB 1CFNA 1FIEA 1MFEH 4DKFL 4UDTB 5BUAA