2K3HA

Structural determinants for ca2+ and pip2 binding by the c2a domain of rabphilin-3a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
GALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWNETLQYHGITEEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKANQRKNFNICLERVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Determinants for Ca2+ and Phosphatidylinositol 4,5-Bisphosphate Binding by the C2A Domain of Rabphilin-3A.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
molecule keywords Rabphilin-3A
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2k3hA00
2WXKA 4XX5A 3JZYA 3TL5A 4TS6A 4AOFA 3ZVVA 4FJZA 4FLHA 5G2NA 2A4ZA 3QAQA 4KZ0A 4NPKA 2K8MA 3DPDA 2WXOA 3F00A 3FBKA 1DJWA 4FHKA 3PREA 4XZ4A 1WFJA 4FA6A 2ENPA 1K5WA 2KI6A 4IQHA 4WEEA 3P2BA 1DJZA 3KWUA 4Y1TA 4LT7A 4WWOA 4PS8A 4L23A 4F92B 2DMGA 2WXFA 1UOWA 3R7RA 3APCA 4LDCA 3NZSA 1E7VA 3FDWA 4EZLA 5CCJA 1TJXA 3L9BA 2WXPA 4ANWA 4TUUA 3S2AA 2FK9A 2CHDA 1DJYA 2A5UA 3SD5A 2D8KA 4ICWA 3OHMB 3ML9A 2WXHA 4KZCA 4NS0A 2LHAA 1DJHA 2WXJA 3LJ3A 5EDSA 3DBSA 2WXLA 1RH8A 3KWTA 5CCGE 5H4YA 4L1BA 4KITB 5G55A 4PS7A 1UGKA 2NQ3A 4NP9A 1TJMA 3L17A 4EZJA 3PYCA 3PRZA 3RPBA 4ICXA 4ANVA 4HLEA 3OAWA 4F93B 4WAFA 4FJYA 3L13A 2QZQA 3PFQA 2ISDA 3QR1A 3L54A 3M7FB 3R7QA 3APDA 3CSFA 3MJWA 4URKA 1E8XA 1YRKA 1BDYA 2WXMA 1V27A 2WXGA 4NPJA 4PS3A 3T8MA 4DNLA 4EZKA 5JHBA 4QJ4B 4L1LA 2YOAA 4WWNA 1BYNA 4ANXA 2UZPA 4OVVA 1UOVA 2Q3XA 1BCIA 2R83A 2CHXA 2K3HA 1QATA 3CSTA 2CM5A 3HIZA 3IM1A 4QJ3B 3TWYA 4FADA 1DJIA 1RSYA 2CM6A 4FHJA 4Y1SA 2X38A 4G11A 4A55A 4HVBA 3ML8A 1E7UA 1QASA 4BGDA 1E8ZA 2WXIA 1W16A 4TV3A 4FULA 2RD0A 3ZIMA 2K45A 5H4ZA 2NCEA 3QJZA 3TJPA 1DJXA 2CHZA 2ENQA 2EP6A 2K4AA 1A25A 2WXRA 4JPSA 4ANUA 4QAMB 3APFA 2CJTA 2B3RA 2WXNA 3HN8A 2YRBA 3QK0A 4GNKB 1HE8A 1CJYA 1E8YA 4OVUA 4WWPA 2WXQA 2Z0UA 4L2YA 4MJJA 2BWQA 3ENEA 4J6IA 1E90A 2Q0ZX 1DJGA 4AJWA 3GPEA 3W57A 3ZW3A 4F91B 2Y3AA 3HHMA 3N5AA 3QR0A 2CJSA 3L16A 3F04A 1W15A 1RLWA 4GB9A 4IHBA 4V11A 1DSYA 1E8WA 5KJ7E 4DK5A 1WFMA 2N1TE 2V4LA 3NZUA 3B7YA 4LCVA 4BFRA 1DQVA 3W56A 2DMHA 2QZ5A 3NSJA 5CCHE 3L08A 5T8IA 4QJ5B 2ENJA 2JQZA 2NSQA 3L4CA 4F1SA 3QARA 3IBEA 5JHAA 3F05A 2CHWA 3RDJA 3F01A 3PS6A 2ZKMX 2FJUB 1GMIA 4XE0A
chains in the Genus database with same CATH superfamily
2FUQA 2BZDA 1OB1A 4WI7A 3T6ZA 3A6CL 2DQCL 3LB6D 2YA0A 1MWAH 3OV6A 1EK3A 5DEFA 3STLA 4ZPVA 5EORH 4Q6KA 3PGDA 2M83A 2ZXGA 2B59B 4J1UB 5CHNA 2YUVA 3UGEA 1JTOA 1WZLA 3ILPA 4D3CH 4U1KB 5KSAD 1MCPL 4FN0A 2AK4A 5EO1A 1FGNH 3OM3B 1ND0B 1WEJH 2TAAA 4J12A 5FGCE 2DD8H 5HI4C 3GFUA 3H9SA 4X4YA 3UX9B 4HOWA 1R24A 4ICWA 1LNUA 5LB1A 3O6ML 4MD4A 4JO2L 3V5HB 1B6DA 2G5UA 3VGAB 2XG5B 3C8HA 3KNBA 5ANMB 1D6VL 1MCDA 2LR4A 1UZ6E 2MQ3A 4MRCA 5EOCH 3BCDA 1LO4H 2JWYA 4LKXB 2DQTL 3P3RA 2JV6A 4LCWD 2LW3A 4F93B 1TJGH 3QXUA 1E40A 2V7HA 3INUL 1A7QH 1CLVA 2X4NB 3RZWA 3ORJA 4YOKA 4M3KB 3QHFH 3C75A 2R8SH 4WI0A 4YZFF 4H8WC 4HQQL 2N7BA 2YGVA 1L7TL 1G9NC 3DJ9A 2A6DA 2ITEA 3IRZA 4WWNA 5ID0A 1CPUA 5D1XC 4ZAKB 3I6SA 3JTTA 4KI5D 4MQ7B 3E6HB 4F27A 4PJEA 3EYSH 3BX7C 1FH5H 1HCFX 5FYJL 2J21A 4PP1D 4A55A 3D87B 4Q9BA 3K71A 3MBEC 1IE5A 4P07A 4XMXA 1GVIA 3QWRD 1D5IL 3BQVA 3GGWA 5C6PB 1A65A 5IV2B 3EUDA 1KCLA 2RD0A 2H2SD 4QLRA 1G0YR 1Y0LA 2NR6D 5EC1B 1FDLH 3QZWG 4UF7C 1NBYA 1TU2B 3BT2H 1N8OE 1T2QL 3KXFB 4UNUA 1S78D 2BSEA 2VMEA 1CE6B 5E4EC 4RRPA 3WE6A 2B5IB 1L5GA 4LLVA 2JTDA 3Q01A 3UAAA 5BO1H 1AZNA 4NQDE 3NIGB 5FOJA 1Y7VA 5C07D 43CAA 4J6IA 4KH2A 2J2ZA 2P8MB 4XN9A 3UTPD 3K46A 4XN5A 1TYRA 2ADGA 3T2NL 5C6TH 1R24B 5GRUH 1J5HA 4WK4B 5HGAA 1F2XK 4ZTPH 2L7QA 5T8IA 3FZUD 4HIEB 4MXVE 5PAZA 4KVNL 4O02L 1KJ2B 4FG4A 2Y9RT 4EUPB 4XMLH 1ZE3H 2B1AL 1PFCA 2ZKMX 4QYAA 5DK3A 1U30A 2AFNA 3QPQC 3ESOA 3GI8L 1XIWB 4JRYB 1CFVH 3CBKB 2Z31B 1WQVT 2DB8A 2Q7YA 4N9GB 2VDNL 2P26A 1WDAA 1X5FA 4LMQI 2E9BA 2IWGA 4K3HA 2V0AA 3QB7C 1P0SE 2L7UA 1L0QA 4EUPH 4FXKA 1A4BA 3IYLW 2NQDA 1H3XA 3T3MB 2GVYA 1EQWA 2C7FA 2CJUH 4XO3A 5LCVH 2VZSA 4OFPA 1URIA 1SN5A 3L4TA 4BZ1L 4OV5B 1MDTA 3B56A 3GHEH 1EA9C 1R0AL 1RUQL 4K8RD 3QUML 2BOBB 5F7EH 1TPXC 3U2SB 4FQJH 4WJKB 1AG6A 5CEXA 4JFED 3FT2B 4PGZA 3BUYB 1GHFH 1BVLB 3RJOA 4N24A 3T2PA 2CUAA 3MDJA 5EA0H 3QA3B 4PV9A 2MCPL 2W0PA 1JPSL 1BD2A 3CHOA 4AC4A 1OKEA 1AS7A 4M62H 3T2NH 2QDVA 3HHSB 1ZLVK 4NNYB 4OJFH 2FHFA 2DQEH 4YK4B 1TO5A 4G8AC 5BMFH 3DRQA 4Y5VA 4GO8A 5LNDA 3VXRE 3WG7B 2CDFB 1BWWA 1DCLA 3FT4B 3Q5OA 4IGBA 4U4IA 4MMZA 4Y16A 5I18L 1OWRM 4RGND 2CKBL 3MR9B 4OLUL 1YN7A 4FQIL 3WNOA 4A2FA 2LTQC 4YN3A 3NOIA 4PJ8C 3FHAA 4YMPA 5DHVA 3IDGB 4PJXA 4QUOA 3NP4A 4NCC2 1UWGL 2YXMA 2NSXA 4Q9RH 5F9DC 5DRWA 2CGYA 4OGAD 2IXQB 1X7TA 4JPSA 1DBAL 3T6WA 1OE1A 3FFCD 3PUUA 2XYCA 4FABL 3MRLA 3SPCA 4XNBA 5IFJB 4PJFF 5C09B 3JV0A 5CEYA 3LPGA 4LPUA 2A9ML 4LSVL 4M4RA 3BGMA 5EIQA 2VW4A 1JE6A 3QWQB 2F58H 3EDJA 4G7YL 1PNCA 3B8SA 4ZUVB 2C26A 2X0WA 2YKLL 1ZVHA 4OR1A 3WN5A 5IT2H 2WYIA 3GBML 4JRXE 5FA4B 4NKMA 1XO8A 2XZQH 5DUJA 4JO1L 5D2NE 4BKLA 2YPLA 5EOTB 4N0FA 4OTXH 5DR5L 2J1KA 5F97E 4NUGL 4YSOA 4I3RL 3H9ZA 1XD0A 4NN5B 5E1QA 3NJNA 2P42B 4PJ9A 5E6ID 1O7SA 2E27L 2E7BA 2EXWC 1JZIA 5FYLL 3NZHH 2JH2A 4XX5A 3W5NA 4QDGA 3SKJH 4F8LA 3F7QA 1IQDB 2KPNA 3KLHC 2YC1A 4XAKE 2F8VA 4ODBD 1MW3A 1HS6A 2HFGL 3ARUA 2Q6WA 2KZKA 4FCHA 1LXMA 4LHUG 3GXTA 4NJAH 1NCOA 3JV4B 3P2BA 3UACA 1X9LA 3DYOA 5JPMB 3E9TA 1OLLA 2FATH 3FKUS 3VXSB 1SY6L 1YNLH 4U2YA 1QW9A 1HH9A 2W59A 3R06B 5ITBL 2QSQA 4JN1L 1B3IA 5DSCA 4LBEA 1HNYA 3REVB 4E2OA 1SY6A 4JKPH 4JY4B 4MS6A 5JZ7D 2AANA 3W9EB 3CQFA 1MY5A 3VWJC 4JEGB 4P5SA 2EYSA 3RAJH 1UM4H 4M61B 4FI7A 4RLDA 4M48H 5LGJB 1PF3A 5H4YA 4L1BA 1I7TB 3UGXA 1DN2A 5EOCJ 2ZAHA 4N1HB 4P5TB 4BQ8A 2O72A 5DRXB 3DV6A 1QO3A 4HIJB 2Z93A 1FNFA 2GHWB 3V5HA 3VRJB 3RLSA 3TBWA 4B7LA 3RFZC 1BOGA 4QCIA 3TWCH 3AFLA 4Q2ZA 4WW2C 3U36A 1IJNA 2XV6B 3S5LA 3BAXA 3WFDH 4HS6B 5DD0L 5FFOA 3GC3A 2BVPB 4XPGH 3FZUC 3KYKH 3VXNB 1ZSDA 4AW4A 5I73B 3C6LA 2OR7A 4TKWA 4YE4L 1OM3H 2YOCA 5TE4L 1U3ZA 4APQA 2FEEL 4GPVA 3R1GH 3TPKA 4MWFA 4M5ZL 4X9BA 2YAMA 4IIQB 4RWYH 3UYOD 4YQXL 5J6HA 4KAQH 1CB4A 3MROB 3IFLL 4PJ5B 3RWHA 2VIRB 5IR1B 1UXSA 1NUGA 2VXQL 2VNCA 2DDQH 4NCDA 3UPAA 3NRFA 4PJIE 3DUSB 4KJYA 2IH3B 2JB5H 4DPAX 3GLDA 4BQ9A 2MTAA 1RUKH 3MRBA 4NI3A 3U0WH 2OZ4L 1BQHB 1J10A 4HGWB 4HUXB 4JAMA 4A1RA 2CGZA 1T1ZA 1ED3A 1HQ4B 1UXWA 3HAEB 1AGEB 3FPXA 2V3EA 5IWLA 2FSEA 2V2XB 4FS0A 2NY3D 3ZSSA 1RURL 1MCQA 1NFAA 3FFCE 1UA6L 2OXGB 3PWPB 4Y89A 3KHQA 1NCBH 3V5DA 4A67A 2XETA 1I9EA 1MCLA 1K2DB 2D3JA 2WQXA 5CCHE 3RWJB 3LXAA 3EW3B 4G8GA 5D2LA 4WJ5B 4AGLA 3LKSA 3KBEA 1A6WH 5KVDE 3FO9A 4UIMA 2D2CC 2GK2A 4JM2C 4WUUB 5FWRA 5T5NG 3TEUA 4HJIA 3VU2A 4JRXD 5LCVL 1E6OH 3MRKB 4UUJA 1JNLH 3ZE0E 1W91A 2QQKH 2BVPA 4XXWC 3IETA 4Z7VB 4CVXA 1J8HD 2ADJA 3I6LE 3U48A 5E8NB 1KYAA 5DMKB 3PV7A 2OM5A 1EJOL 3G5VA 1XSKA 4PG9A 1TCRA 1RJZB 4OF7A 4TUJA 1XCTB 5KJRH 4IJ3B 5HHQB 3EF4A 2HFTA 4GUCA 2XZZA 3UDWA 4EZMA 4NQUA 2PXYB 2X4QB 3RGVA 4ODHH 3T0WA 1WZ1L 1DSWA 4HT1H 3OMNB 4KZDH 1PLCA 4MCNA 4H8UA 3MREB 3S2AA 2WPGA 32C2A 3FH8A 1YEHL 1ZHNB 2NNRA 2AEIT 3ARBA 4NN6C 1B4LA 3PWPE 4Z7WB 4BZYA 4RGNB 3SOBL 1BIHA 3ULVH 2JCCF 1QFPA 5T1MA 3IWUA 1BQLL 4NUJA 2R1XB 4ZODA 5CCKL 1MI5B 3FU0A 3OAWA 3I6GA 1N6UA 5L2KA 3LB6C 2AJXL 4NQCA 2PR4L 5FPIA 1KXQE 1M53A 4JQXA 4HOZA 4YHZL 4G8GB 2L04A 4UAHA 5D2LB 3VGBA 2DDQL 4NZJA 2CDGA 2X70B 3KLHD 1L9SA 4YC2C 1FNHA 3NIDB 1XGTA 3D4GA 4X50A 3MA7B 4OBSA 4IKNA 5IJKC 3GS0A 1ZV2A 2H1XA 2P5WE 4QJ3B 5EDXA 3VCLB 1XSOA 2OS7A 1DFBL 1PZCA 1CICB 2FUTA 2WXIA 5IVXF 3O11A 1T2JA 3WFHB 3COOA 4GP8B 3KLAB 4TUJB 4WY7L 5GS0H 4LLYA 3EYFB 3A6BL 4UTCA 3QI9B 5DMKA 3SCMB 1RURH 2GUYA 4A63A 3SPVA 3BD4A 3P0GB 2YRBA 4JJ5A 4IBUA 1P9MC 4UDUA 4U1SB 5L8LB 4LMQE 1QI5A 5J6HB 1AY1H 4KKAC 3BPCA 5DD3L 5J9PA 2ESVD 1U8JB 3QFJA 3FN3A 2FECL 3RNQA 4YDLB 4JQIL 1CI5A 4ZG1A 1G0XA 1FZMB 1MFCH 2W9LA 4LF3B 1A9BB 2PWDA 1P5UA 1RZJL 5SX4I 1GC1C 3QDGE 4RGOH 4XOCA 2DQUH 3SD2A 4G6JL 3O8XC 4OCYH 4D7PA 3D12B 3D33A 1HQRB 4Y9EA 1NOLA 2WZAA 4YJZL 1EVTC 2FBJL 3EJRA 4NQEA 2C9RA 3LQZA 3I02A 4GAJH 4JFDB 5D96C 5K1JA 2I07B 1JHLH 4Y4HA 3VH8G 5DCCA 3RL2A 3GPSA 5CJQH 2F5AH 5HYFA 1MI5D 4LLDB 1Q0YH 4HJJH 2DH3A 4TUKH 4W68A 4AJ0A 3QA3A 4FP8H 4TQPA 4NNXB 5IQLA 3S37H 2VZVA 3IPBA 4PM1A 3C8KA 3MMEB 2JK5A 1A1NA 2W94A 3Q1SH 3OKEA 3U9PL 2D03H 3ARRA 1LO3H 1UEYA 3QCUH 1TTRA 3MODL 2B4CH 4OZGA 1KULA 3QXAA 2B2XL 3V4PL 4PRPB 4F8PA 3QHFL 2DTML 5CD5D 1J8HB 3RWDA 5FYLE 1K6QL 3LEVL 2BVQA 3I85A 1RVFH 1SZNA 3OHMB 4LLYB 4X5WA 5IVXA 4FZEL 4N9OB 2DLTA 4XN4A 5CUSL 1A3QA 3BYTA 2ZYRA 1RI8A 2APFA 4U1MB 1U8QA 2FB4L 2FEDD 1KLGA 1XWVA 5C0BD 1ILUA 4J4PA 4PH8A 3QI9D 2ESVA 3HZKA 3MLSH 4M7ZC 2ZG1A 3BP5A 3QQ3B 2D7OA 3WLWC 1ZEAH 1NAKL 5CJQL 3MRIB 2JMRA 1GS6X 2HCZX 4YHMH 4MD5A 1E27B 4YDKL 5HDBE 1D5BB 1SYVA 4XI5C 5FA4A 5C86A 1HL4A 4FTVE 2OJEA 1CD1B 1NDMB 1ZT4A 2IO5A 3GMRA 3MV8B 1H9DA 2AS5M 5HD8D 1YUKB 5HI5D 5DUPL 3PHAA 1J5CA 1J0ZA 3IFOA 3SE3C 1QFUH 4UTBL 5KEZA 4X6CF 2HH0H 3ZZLA 3T0EB 2UUDK 4WI4A 1CS6A 5ITFA 3SKMB 2WO3B 3TVMD 4N0CC 1NC4A 4UOJA 5H4ZA 5C71A 4QRPA 1CYWA 3OAZK 4AJYV 4LZKA 3VQMA 3GSRA 1H5BC 3JWOH 5AOZA 3EO0A 4MNQB 4E9QA 4EIZC 1YDPB 1HE8A 5I1IH 1HEZB 3E3QC 4OJCA 2VISB 5ESAB 3WHXB 4U1GC 3VXUD 1HHIB 1AGCA 4BBWA 2AXGA 3BDBA 1S5HA 3DRTA 3KW8A 4GQ9L 3FQUB 2DQDL 4M1CD 4YHPA 2E8YA 3C60C 1OAKH 1S5IH 4PAZA 4GKSA 4D9QE 5DSCB 1Y6MR 1TTUA 4WFGE 1NM4A 1RULH 4WUUE 1WCQA 1PKQA 2B1HL 4RRPM 4MVBD 1KGCE 4ZFOL 3LN5A 3K1DA 4MJIA 4TXVB 2AV7B 4XPFL 1IJ9A 3IPFA 3HC0A 3TH3T 2C9SA 1U0QA 1BVNT 1CWVA 2P80A 5C92A 2WOYA 4FNLL 4K7PX 1ZSDB 4XCNA 1YYML 4X0NA 3RWJA 3TCLB 1X5IA 2D7PA 4WGWB 4AENA 1OF2B 3BQUA 3NAAL 4UT9H 4AOFA 5DA0B 4FLHA 4JM4L 1E67A 2PCPA 2XKUA 2O26U 4L2LA 4ZJ9A 3PF2A 2UVFA 1MJJA 1UH3A 2EO9A 2ENPA 1PJWA 5AB9A 1QRNB 4MNQE 3IU3A 5HYIA 3UOAB 1AD0A 4HIHA 1FL6A 2KDGA 4NWUL 4ZD3H 5F7MC 1A7NL 3HPLB 5KS9A 1NC4D 3DUSA 2YEVB 4JVUA 3ZE2E 5CIPH 3MRCB 2F53D 2FO8A 4IRJC 2I32A 5T5FH 1P1ZA 1IC0A 1LO5B 3ZHKA 5IJCC 3MV01 3ZXAC 4PRID 1SM3L 3FT2A 1K8DA 2QGDA 3OKMA 3NFNB 1EUUA 5DEZA 5LO7A 5HI5C 2VKXA 1J5OL 3VJ6B 3QQ9D 3RVVD 1YRKA 1QR4A 4Q0XL 4Y4FC 1CG9A 4U0RC 1F58L 2DQGL 2R0ZL 3RVWD 1S7XA 4JFEE 4NN7B 5CD3A 1AGEA 4B41A 3BFOA 3MRRB 2XRAL 1KCSL 4GSRA 4NWTH 3W9DB 3GTVA 1UJ3C 3FQRA 4OQ1A 3V6FA 3CLEH 4RDBA 3IDMA 4MMZB 4U31A 2Y7NA 2B9AA 4L1TA 1IKFL 5MP6H 1EJ8A 4ZO8A 1OTSC 5FA3B 3DLQR 3GXNA 3WTVA 5IIEA 1KFGA 3X3GH 1F42A 2HT2D 3QSKB 4OF8A 3GSVA 2DKSA 4L4VE 3BAWA 4X4XB 3MRJB 4MBOA 3N1MC 2ADJB 4JGJA 3KLDA 4OFVA 2RCSH 4CC4A 1U91B 1YZZA 5CEYB 4WV1B 3U4BL 3G6JB 1UKSA 3WEOA 1I8KA 3ULVD 4OFYD 1AG0A 5D6DA 3PV6A 1K8IA 3K72A 4N5UA 3VFUB 4FNLH 4HULB 3V5KA 2A38A 3GMNB 4LOUD 5TH2A 4JVPA 1RY7B 1V8HA 1GPOL 1IM9D 4LCVA 3A6BH 4YVUA 3KPMB 4UAOB 2OK0H 4MLIA 4P3CL 1L5GB 1U58B 2WMPA 1DLFH 4CMHC 1BVOA 3QR2A 3B3IB 1PBYA 4PREB 2P1YA 4LF3A 5I1JL 1C1EH 4R2GD 3Q8BA 1T1YA 4MAZA 4PMFA 4X6DA 3AZUA 5F1SA 1NL0H 2B39A 3BZEA 3ARSA 1WCBA 1I1FA 3RU8H 5C08E 1CDGA 1G6RL 4F9PC 3BVDB 4KK5C 1P2CA 1NMBL 1ZLWH 4M9OA 4ZX3A 1N5YL 4HUUA 1F6AA 3HB3B 5I1LA 2AQPA 2I24N 4M56A 2KYIA 1EEUA 5DQJA 3VFMB 1HOCB 2LTQB 3QEHA 4XI5D 3REVA 4QOKA 2WUCL 4YUEH 3RIKA 1MCSA 3CHXA 2FNBA 1HH9B 4MNGB 1AQMA 1JFQL 1U8MB 4XNUH 4E42B 2HUHA 1Y6NR 2GB2A 1P4LA 4KDTC 5HPMA 1E5UI 2GFBA 4HKXA 1L9TA 4NZTH 2BOCA 4JN1H 3ZDYE 4EMZA 4Q6YA 1AD0B 3DMMC 2V2WA 3QAZB 4HIHB 4Q4EA 3UG4A 1SY6H 2NNFA 4L0YA 3TH2T 3LNEA 3H2WA 2OMYB 4L29B 2LLNA 2EE2A 1HILB 4YNYA 5MHSE 5IHUH 2D03L 3DGGA 5LN8A 4P5TA 4DERA 5BQ7A 4K2UL 5F1IA 3MCLL 4H1LA 1BECA 4PLOB 4ZFZA 4DNLA 4FTVB 1E6JL 3JWNH 2XWZA 2X28A 3FRPA 2C4XA 3CE1A 4H1LG 4TQHA 3BP6A 3VXQB 5JOPD 3FB7A 3QUKA 2Z92A 4NIKB 3OSKA 4JG1H 4JR9H 2HX9A 4JFZL 4OY9A 2AEOA 3JV6B 1FE8H 2XY1A 5GSRB 4F2MB 1PSKH 3GYRA 1SJEA 3QQ4A 2P8LB 3BEWA 5C0FA 5DJ8B 5I71C 3GK8H 5B39G 5AAMC 2M26A 4J6RH 1R5WB 3KPOA 3C5ZD 4X98A 1DVZA 2ENQA 3V0GA 1FFTB 3UG3A 3R0MA 2IBZY 1EH9A 2BPBA 2ICWJ 5IHZB 2N4IA 2FWSA 3GSWA 4LEXH 5I5RA 1JNJA 1R46A 1FZKA 4I2XE 1IV8A 3OKLB 4ZUTA 1HHJA 2JF1A 1ADQL 1PX8A 1ZANH 4RMRA 3F7PC 3RGHA 3IMSA 3OAYK 1TVBB 2R4SL 3QWOA 4IIZA 1OGAD 3K2IA 2FJSA 4U4BA 2AK4E 3CZNA 1R3JB 3OG6B 4NC1C 4PRAA 3MTRA 3VI4E 1XIWA 2IGFH 5CZRA 3EYOA 4FQHA 1Q72H 3NEOA 5MERA 3NIFB 4D9LH 2F08A 3SBWC 2ENJA 3BRGC 3PAVA 5DHVH 1FAIH 1XHHA 4TQIA 4JPKL 1MNUL 1I8KB 2IANA 4NGHL 3UJIH 1GA2A 1MHCB 2VXTL 1QX1A 2GPZA 3C5ZC 1JV5B 1ETZA 3D3VE 4GJTB 5AFAA 5TD4A 1LEGA 4FJZA 2MRYA 4KNUA 4YL9A 1OAZH 4NPKA 5EBMA 1DVYA 5FX3A 3QEQA 4KQ3H 2G9KA 1AIZA 3ULUL 2DIJA 1O9WA 3S4SG 3V4LA 5EZPA 3UAJD 3HZVB 4PS8A 3TA3C 5INCA 4MZ2A 4MAUH 3Q6GL 4NZUL 3UC0L 2BIIA 4BQ6A 5K1VA 3S4SA 3RB7A 5DQDH 4YGVA 2CMRL 3BP7B 4IMLB 3EH4B 3ZE1E 4EZLA 4AGQA 1AKJD 4PD4K 3LXBA 4NQQA 5GS0C 3VD9A 2YGPA 3CFDB 1K85A 5HDOA 1UWXH 5EO9A 3U9UB 5IJDC 4LOUC 2HWZH 5I1EH 4KDVA 5DJXA 4JO3L 5C09D 4B9KC 4L9LC 4WI9A 3NPSC 5KYWA 4GINA 3BIKB 1JF1B 2LOEA 1HSAA 1OGAA 4AXWB 5B3JF 2PO6D 5LAXA 2WP3T 3L3DA 2V8LA 4NO0B 2C7UB 5FC9A 1MREL 3MLYL 3KMDA 1DUZB 1K8DB 3BJ91 4DOHE 1T0PB 3EAKA 1THCA 5CZXC 4XVOA 5FKAB 4NZRH 1RLBA 3GJEA 2XV3A 3LHPH 3BUPA 5ISZB 3IFNL 5CP7B 4A6YA 5CF3A 3GLEA 4UQ9A 3DJRA 1MSPA 3T4YB 2NXYC 2ZOOA 5FLUA 3SOBH 1MIEL 3KXFE 3N06B 3WFEL 5IB1B 4ODTL 2MPAL 1QBLH 2PN5A 4KK5D 4MQSB 2WGXA 3VWKC 5GGQL 4NFCA 4OLZH 4Z7NF 4HOMA 1KEGL 3QEQB 4UU9B 4HVBA 3DX6B 3L7FB 3HVDA 2A2QT 2NTFA 3CX2A 1CYXA 5E0FA 4NPYB 2A73A 1N26A 2MOGA 3CZKA 5SWZB 2OAAA 1IARB 2FX8H 3MRMB 2XZCL 4ODSH 2ZKHH 4FNUA 2NZ1A 3FF7A 4DP6X 4L05A 3BZFA 4TRPL 1JD9A 1U3HC 3GGWB 2YRZA 3CHQA 2PXYC 2R0WL 4R7NA 5K59E 4M5ZH 4YQXH 1PQZA 3CZUB 1RERA 5EIIG 5MP6L 3QR0A 3TP4A 4CSZA 3E6HA 1OAZL 3BWUF 4AEEA 1YMHB 2IPKB 3HS0B 4CVWA 1WFMA 3DO4A 3HN5A 4XPGL 5KVEH 4O2FB 1DQVA 2D31A 2P45B 3LS5H 4AYFB 3K4DA 4FMFA 4F15C 1T2XA 4ZSOB 4AQ1B 3ZKNC 3BLPX 2ZUWA 4Y5XC 3S3BB 3T3MF 5B38G 2A9NL 2D0GA 4ETQA 4RSYA 5EMYA 1TU2A 4U3HA 5E23A 3MRFB 1GMIA 1QNIA 2FYVA 2ROYA 3QEQE 4JJHA 4UQIM 1KEMH 1TFHA 1MIMH 4L5FE 4TM9A 5DD3H 5LG6A 3L3JB 2GSGB 2AW2A 5ESQA 1VACA 5INDB 3KGRA 1UACH 4MNGE 4LU5H 1ZTXL 3WS3B 5HVFB 5B7EA 3VGDA 3HFML 1QA9B 1WAAE 1O9VA 4G6MH 5I6XB 1T7ZA 3MBXH 2D4FA 5D70H 1KCVL 2PPFA 1LDPL 5CN2A 3NBNA 2ICEC 2UYLA 4K5LA 3TBVB 1R3KA 2Y36L 4PJCA 4IMKC 4Q6IA 3LN9A 2ZUSA 3RWFB 3MBWB 1GGIH 4MQXC 4XPAH 4PJHB 3PYCA 5AW9B 2QEJA 2FBRA 4HPOH 5CFAA 4GKNB 3C5ZB 2IMMA 3LH2L 3SDXE 2C34A 2Z64C 2NZIA 1E5YA 4FQIH 2BOCB 1JK9B 4RISL 1QEWA 1D7CA 2BP5M 4ENZA 4FKHA 3IAPA 1IBGL 3QNXB 3EDEA 5C0BE 1DBKH 7PAZA 4TLSA 4TVPL 3TJEH 3ZMNA 2GAZB 3VH8B 5B7FA 2YMTA 3DMMA 1OGAB 2F9BT 2GQHA 2PO6B 1E27A 1PKQE 1ZT4B 4G7YH 3SDAC 2J5LB 2FBOJ 3ZTNH 1SHXA 3LZRA 5F2FA 4P23B 4J3XA 3B2PA 2A9MH 2BFVH 4LSVH 2X42A 1Z6JT 4ACTA 1TUPA 2YUXA 4KNTA 2VWEC 5HYJB 4UOZA 3EHBB 3W82A 3QPQD 3DPBA 4PREA 5IQOA 3QIWD 4E9TA 5FYJD 2QQQA 2KLRA 2LE9A 2V9QA 3GQFA 4G9FD 1MCHA 3NTCH 4ZW7A 4KK9C 4XN8A 2ZIDA 3L1OH 2JKWA 3P9LB 3BAJA 5D7JA 3WKPA 1URLA 1VEMA 1UD4A 3EO0B 4MNQA 1RJCA 1FP5A 4PIBA 4UQ3B 4DPBX 1F4WH 3TNNB 1ZT1A 3LZNA 5CGYC 3GMPB 1W9XA 4DK5A 2GT9B 1EHAA 3M17A 4EI5B 3T2LA 1BZ7B 1SQ2N 2JSFA 3ILEA 4UANA 3TN0A 4QJ5B 1AGDB 2AZUA 1YNLL 2A4EA 2CDEA 4JY6B 2Y25A 3CXDH 1I8UA 1W0WB 1XGQA 2CXGA 3LRSA 5CBEA 3T1WA 3V79C 1U8CA 4AM0A 3CIAA 4GQQA 1JVOA 2WXPA 1CDIA 4PUBL 2AEPL 3RX9A 3EYOB 2W0LA 4FQHB 2WXKA 4L4TB 2D9CA 2HTKD 4NYLB 3HFMH 1XGYL 4MJ6B 3HBGA 3LY6A 2ROXA 3O45B 4HLJA 4ONGH 1X7QA 3PREA 4CUCA 1RJYA 4QY8B 3QUYA 5I73C 3VRJA 1LEKA 3IMRA 4ODWB 1P5UB 5HDRA 4L23A 3QP3A 2F19H 1HJBC 4NP4L 1F97A 3MJ9H 2WIIA 1AHKA 4JANA 1DP0A 4OZHE 4XWOD 4PI0A 3K8MA 5DC2A 1JZ6A 4H26B 4AQ8C 3IJ9A 1U93A 5A1AA 3DBSA 3TJEL 3TT3H 4KITB 1DDHA 2F1EA 1DVFB 2XXCB 3HPJA 1DBKL 1BX2B 4UTBA 3MNMA 4EN2A 2B16A 4WKZA 3RWIA 1JV2A 1S9WB 4XTRC 3L13A 5GGSB 1OD9A 1JZDC 3OKMB 1SJMA 1THAA 4YX2L 3GNML 1E8XA 5CIPB 1FL3A 5GGVL 2J8UB 3DX7B 1TJIL 4UQDA 3EYFA 5HDQH 1MCKA 3C5SB 2R9HD 4HJGB 4X0KA 2IFFH 1OT1A 3B9KD 2YOAA 3A23A 1YMME 4IU3B 3W9DA 1J48A 1FORH 4KRPC 3UYRL 1Z5YD 3BZ5A 5IFHL 2X05A 4Z7UB 4DQAA 1IGMH 1WLHA 3S96B 2ZOWA 5D1ZC 3ERXA 3LPPA 1MJUH 5TFSH 4PYHA 2XX0A 4ELMF 3ARWA 3HBQA 2JE8A 2MCPH 1WAAF 2F54B 3L4VA 1BMZA 3O4LA 5HY9B 5JPNC 3FN0H 1F56A 4MJ5B 5E2VL 4G1EB 3BPCB 1NGXA 3EOYG 1I3GL 3OKNA 2OYLA 2QTVA 2ZICA 3P4MA 3FSZA 3B1UA 3HZMA 2CLZB 1YNTA 4BWUA 2Y7SA 4W9KC 1SQMA 3MGAA 1OP5K 3L4UA 3ZQWA 5CNHA 5T1KB 1EAJA 5AD0A 2ADIA 1D5ZA 3GB7B 5C0JA 4GIAA 3ARGB 2P5WA 1U8KA 4BV1A 3O2VL 1PMYA 2I07A 4HUXA 1QUPA 4Y4HB 2WSDA 4AY0A 1QLFA 1AZUA 3ULUF 5A2JH 2FSEB 4DGUA 5IEHB 2BM3A 1NAML 4HXAH 2HMID 4LVHB 2WMPB 4P2RE 2C3VA 3BUQA 3VSVA 1J7VR 3U4BH 2R4RL 3CIQA 2E86A 4LLMA 4GBXB 4F7CA 2DWDB 2O6FA 2VIRA 3KJ4C 5L9DH 4HZLB 4LL9A 4HOXA 2A83B 2F6AA 3DPDA 2QPDB 3ZTJH 4CSTA 4WUKL 1XH3A 1PIGA 4P46D 1G5AA 3QQ9C 2ZWYA 2JCCB 5E2UL 2K6WA 4J4PD 4UIKH 4ODVL 1IZJA 4MNHA 1ORQA 2XV2A 3SQOH 3VSUA 4PP1C 5CBEB 4XVJL 3EOTH 4PJDF 1A7QL 4QD2E 1RU9H 1AI1L 5J1TC 4ISVA 4JRYE 5AKSA 3QYMA 5KBLA 4IRZA 5D2LF 5I8CB 2AKRA 4UDTB 1C7SA 3K6FA 1WAAA 1OGTA 5EORL 5I6MA 4ELMA 2DMCA 3HZKB 3N04A 4OQTH 5DHYB 5GRYA 1LWJA 3D25B 4H5SA 4G8EB 4GKZB 5L4IA 3AADB 4XPFH 5DURD 4XWGL 4YWGL 3UBXA 1XR9B 1YY9C 4NQVA 5HVHC 1S3KL 2R29A 4JO4L 4PG9B 2EXYC 3IMBA 2KL6A 1HKLH 5ALBL 4QRPD 1F3DH 3VTAA 4ZMVA 5DA4A 4UV7H 3TURA 2HFEA 2NY5C 3IGFA 3MLVL 2BLFA 2BP0A 4M7JL 5D1QB 5AZ2L 1F90H 1K4DA 2WB1A 4WU5A 2VLKA 4XRCA 5IB3A 5JIPA 3LQAC 4HS8L 3G04B 3F12B 3EZJB 2ZOLB 1WP6A 2H8PB 2RTTA 4DO4A 2ZX6A 2CR0A 4AUJA 2OQJA 2WVVA 1IGYA 5BRZA 1PG7L 2JJTC 3TO2B 4KMTL 3EJTA 5AVYB 1HHGA 3WD5L 1FG9C 1IQDA 5INDA 1XTMA 4DAGH 3ARBB 2QDWA 2IDTA 1IGIL 4X4ME 3IRPX 3X17A 3T2QA 4A2EA 2K70A 1ZDQA 3KPNA 4JR9L 1YPZA 2CJTA 2PETA 3IWVA 2UXGA 3BGFB 2EICA 2XNAA 4D0CA 4KKPA 1RZIB 3EYUH 3FHEA 3OPUA 4W9ZA 4LCWA 4JFDE 2QGEA 3W9EA 4G8EA 1NAKH 3ES6A 2F5AL 3KEHA 4KHXL 5KW9H 3OKEB 4IJTA 1I1AC 1LQSR 3OLEA 3FSAA 3VWKD 5B8CB 4YDVA 3CN1A 4N28A 3VFSA 3FU8A 4F1SA 2X4TA 1QBBA 2N7AA 3H2QA 1XIWD 4TULH 5G4NA 3F62A 4XN1A 5EU3B 2CR6A 1EDYA 4AQAA 4JRXB 1AGDA 4B3EA 5IFJA 2CALA 2JKJA 1M71B 5IVZB 2E7HA 4JCLA 3VRLE 5GRXG 2DTMH 2HRPH 1WGOA 1X9RA 4AIZA 1A5FL 4DVBB 1ZT7B 5IESH 1EJ6A 5FHAH 3Q2VA 1P9MA 4YDIL 2YPLB 3I75B 3O3BB 3GRBA 5D2NA 3UTSA 5FYKD 5C70A 3QUYB 2OMUB 1XGPB 3GNMH 1JP5A 1KELL 1FYHB 4NQXA 4PVBA 1G9EA 5HGGS 3OAUL 4G2AA 4YHNA 1BJ1J 4IW4C 1AMXA 5IR1A 1CE1H 3RUGF 4LO9A 2X0VA 5GGSY 1A6VH 3VA2C 1E28A 3ECQA 4NHCL 1Z66A 3NQKA 4CADA 4EI0A 3MNVA 5FDYA 3ILQC 2KC0A 3VU1A 4OD2A 4PJDA 5IJKA 4LVHC 4U1GB 5I1HH 4XNZC 3APMA 2N01B 4UTAH 1NGWB 5I19H 3D52A 4YUEL 1A1MB 2XA3A 1DVFA 3LEYL 4PWFA 2A7BA 2CDEB 5F7BA 1Q0XL 3AY4C 2VDQL 3FQNA 1N67A 4NUQA 2WBJB 4KI5F 1MF2H 3HAEA 3V5DB 2D2OA 3CHSA 1JOIA 1JZJA 2HKFL 5CLTA 1BMWA 1ET5A 3LS4H 3RZCC 1EXGA 1UADC 1JTTA 1I7ZA 3ZMEA 1A7NH 4OI8A 3GRWH 5JW4N 4LEOA 3T4YA 5ICYB 5KZCD 2D7TH 4FULA 2EDBA 5BVJA 2X09A 4S1QH 5LNGA 1MHHB 4S2SB 4MQXD 4KNSA 4BH7B 3SDDD 3TCXA 5CEXB 3L5XH 5D1ZB 3NCWA 5CJ5A 4PW3A 4TVPD 4EJ1C 2YAHA 3T1FA 4Y19D 3ETBF 4NI6A 3IBOA 3RKDD 4HPYH 1H0DB 1TDQA 1QWHA 2JQAA 4WI5A 5L2JB 4HUKB 1AD9B 1JDDA 5E8OA 1L6ZA 3T04D 1MDAA 2E5EA 4XXWA 1BGXL 1N68A 1IQWL 2D3VA 3AUVA 1CLYL 1MWAB 2RFXA 2AV1B 2QZ5A 3JBG7 4MHHG 4Y16D 1E42A 3SDAD 5BV7B 4P57A 3MUUA 1A6UH 4PVNA 1AAJA 3VG0L 1RZFL 3U6XS 1H8LA 2CDFA 4I18C 3CDGB 1AI1H 3UJJL 3OKLA 3TJHC 4IBYA 2H3XC 3CFJA 5JLZB 3NJGA 5CZXD 2NW3A 5B38B 3RIAF 3WIHH 5T1DL 3EYQC 1KTCA 3DROA 4J3OG 4MXVF 4XXCC 2WKOA 4OGXL 2BDNH 4HXBH 2E3VA 3JWNC 3BDXA 2HJLB 4NZFA 5DO8A 3HG2A 2UY6A 4Y7MA 3WJMA 3ZTEA 2LFEA 4ONHB 4WFFE 1QA9A 4GG8A 1QBAA 1CL7I 3OZKA 1JCVA 1FFOA 4HXAL 4KJQD 4DT2A 1XB6A 2JCCA 1FNGA 1HEHC 4RSVA 1A7PH 1BJ8A 3OKNB 3ZKMC 3C2SA 3KL3A 2LU5A 4H4NA 5EPMA 3GZQA 2YAPA 3H0TB 2YD0A 4LCYA 4PRDA 5JPMC 1N59B 5ACLA 5ECJE 3CC5A 3WKNA 2W0FA 3RWCB 3GIVB 3T6QC 4K3DH 1W0YT 2IQAA 3EKCA 4I3SL 1UYWH 1DQML 4NKOA 5CZKA 5TE7L 1CXEA 3CDCA 1U3HB 3RWFA 5J06A 1DLFL 3RPBA 4APQC 1FBIL 1YEJL 1X5HA 3TBVA 1HNGA 3C6LC 2F7IA 3GI8H 3QUXB 3LKPA 2XPYA 1N7MH 2KKQA 4GT7A 2Q10A 3PWJB 4R26L 2ZPKH 3RY6C 3HI6L 4EDXB 1FIEA 3FO0H 4QNPF 4Z7WE 3I6KB 2C3WA 5L4MA 4P5TC 3E6FB 3ULUH 3RFZA 2GAZA 4KDWA 5DJAB 3JTTB 5BJTB 4Z0XB 8FABA 1KOAA 2XFXA 3G6JF 3VXSA 3SKOA 1ESOA 4P8QA 3K1KC 4P9HC 2Z6FA 3A22A 3D4ZA 4P2OB 2OBGA 4HFWA 1JGEB 1ZLVH 5BO0D 3MACL 3WL9B 1MVYA 4LOFA 2YZ8A 2R59A 3O3DA 3VSTA 4IBQA 4M02A 3TO4B 3FCTB 1GRWA 1YUHB 2J2ZB 1UD5A 4PY7B 5F9AC 3CXDL 3X1BA 4UT7H 3RUGE 4DN3H 1NCIA 1VAHA 4LGSB 4YE4H 3DHPA 3CWGA 3QXVA 4M61A 4N8VB 3DX4A 1KGIA 4PRDB 2J56A 2VDPB 2UZXB 3E80A 4C56D 1INDL 3KCPA 1JRHL 1T89C 4AMKH 3RWCA 1JHKH 2QQNL 3CVCA 4PWGA 2DBLH 3RDTB 5EBMB 1AR1B 3QQDB 1N4XH 4JHAL 4PJFE 4MZRA 1NGZA 1F1GA 4GW1B 4D8PA 4YSPA 3L1OL 4AT6A 3M1BB 1WFNA 2X12A 3V7MA 4PJ7B 3WDHA 2AJZA 1SJHA 4FNQA 1WFOA 3LQMA 1A3RH 3MV7B 3TN0D 1G4MA 3LMJL 3T08A 5MI0B 3N1PC 2WCSA 2OZ4H 4GMTL 3U30C 1PSKL 1I9IL 1Z32X 2BJML 1JNHA 1PCXA 3CX5K 4WHYG 3PJSA 1VESA 3MLXH 3N41B 4WO4C 2PW2A 5C0GB 5FUOL 1RP9A 4GMSL 4ALAH 4Z8FL 2DWYA 1WFJA 4KMLB 1TQTA 4YXLL 1M9SA 1DSFH 1ML0A 4P57B 2PMZA 3CFDA 1AGFB 5E5RB 5GGTH 3WNLA 1EHLH 1CFQB 3GKWL 5CS7A 3QISA 3ZRFC 1ZKAA 4TL5A 3BKYH 4Q56A 5E8PA 3VSQA 4LE8A 1ZK9A 3BEVA 3CLFH 1NKGA 2NY0C 3BUTA 1S9XA 4YSTA 5J8OA 4AIOA 4AQ8A 3OTTA 3NAAH 4UT9L 3O6LH 4BHUA 3U9WA 1J9SA 4KU1A 4O4YH 1VZHA 2A9AA 3MRDA 3DJZA 1V10A 3MXVH 4I3RH 1NSNL 3RTQB 2YD7A 3C09C 3DDFA 5CILL 4Y16C 5FYJU 4I13B 3MA9H 1L9MA 4BFNA 5FHAL 2CO1A 1UJ3A 2X1WL 3W11D 5EZLB 4QHNA 4Y5VC 2CSPA 1J8HE 2A99A 2CO7B 3HI1B 4NN6B 5ABZA 3BZEB 4O2CB 4M48L 4AT6B 2C3GA 2VH5H 2A73B 1QFHA 1WHOA 3VI3A 3QZOA 4QHKJ 5I30L 3TBSB 1J05A 2Z4QB 5CP3H 3CMOL 3Q5TA 4LP4A 1TVDA 3V4UL 1VADB 1M7IA 4B9JA 3ALPA 1C12A 3VI4A 4Q58C 3RVTC 3HBPA 2G3MA 1BZDA 1I9RL 4GMTH 4JUTA 4U6XB 1PZDA 1FCCA 3IJHA 1EBPA 2LGNA 3T0XA 1KEML 5HI3D 3R18A 1XL4A 1DJXA 2L3BA 2P5EA 4FE9A 4GXFA 1FYTA 3GO1H 3NIFF 4RGOL 5EBLB 3Q0HA 4G5AA 3QH3A 4I9XA 1OF2A 1NSNH 4UQ2A 1M05B 1AP2A 4PJEB 5D7JC 4CN4A 3O2WL 2DH2A 3T0EE 4F7MA 2A6DB 4BGLA 1U4FA 5I8EB 1PD1A 2AQNA 1DUYB 4BKTC 4MMYA 4S1SH 2BJMH 4MQ7A 1I9JL 3DJSA 4F58H 5D4IA 5BS0E 4AE1A 2FD6L 5GGRA 4B9IA 4P49A 2Z1KA 1HHJB 5TF1H 3RWGA 3T65B 4XVSL 3I2CL 2OW7A 2G0KA 4JFFE 1QAWA 5E9DD 3L4CA 1NBVL 3ARXA 2BRQA 4YXLH 4PJ9B 2IH1B 2EE0A 5CEZL 3V55A 4W6YB 4R4BB 2ZCHH 4YBQC 2F68X 5KYUB 1UD8A 1EZVX 2GJPA 1Z0NA 4MDJA 5LLIC 4X80L 1LE5A 1OTTC 4HYTB 4Y4KD 3U79A 2PYFA 1CU4H 1BAWA 1N0XL 1WT5C 2BMKA 5JR1H 2IEPA 4Z3HA 3QUXD 3VFGL 3N6YA 4HSCX 3ME0A 1HEJC 1U2YA 3OSVA 1MFMA 4UM8A 5IMLA 1BM7A 2VDPH 4QRUB 1QFOA 4J3OF 4TUKL 5EBLA 2HJLA 4R7DA 1FGVL 4LASH 1TQVA 2NZ9D 1C16A 2DF3A 3LN4B 3ML9A 5TE6L 5KVEL 1BQ5A 3WJJC 2VQTA 1VFUA 3D34A 3NT0A 4OCXH 5JA9A 4UU9A 1LE9A 1RUAH 2RQ8A 2HT3D 3QJSB 1IBZA 1L6PA 1W72L 3DIFA 1SGKA 3SQOL 4HG4K 4RFEB 2QADC 1VCAA 4IRSD 1EEYB 4EI6A 2BVOA 1R33A 3IDYB 3CC5B 2EEXA 3G5WA 2HLFC 4R4NC 4BSVB 1ZLEA 3AS0A 5TK4A 5GGRB 3N0AA 1GGBL 2BSSA 4P2AA 3VXRA 3ZE2B 4IIQC 4N90D 4NKOB 3NJIA 2C4FU 2PYEB 3ECVA 4HDIA 2EECA 4JE0A 4KKAD 4EZKA 5DZOA 3ZGIA 2K6ZA 2Y5EA 3CX5J 1GGUA 1BQLH 2WWKT 1FFRA 3AS1A 3O3AA 4K3DL 5E6IC 4MNQD 3EJUA 4X7SH 4M6NL 3UZVA 1MFAL 3DX9B 4L18A 4WRLA 1Q9KB 3IK2A 2VLKD 5DTFA 1PS3A 3MRQA 2ARJB 1L9NA 1YMMD 4KKCC 4GBXC 1IU1A 3MMEA 4PB9L 4ZUWA 4TV3A 2FSDA 2BNUB 3EJZD 4P4KC 1X5JA 3MV9E 5TE6H 4HIIA 4ANKA 3POHA 5B3JE 3BKJL 1EO7A 4G83A 1H8SA 1M1SA 1GOFA 3H42H 5A43C 4KKNA 3ZR5A 5GGUA 5E1HB 4XMKL 5KJRL 1MQKH 1U8QB 3NG5A 2XNAB 4D0CB 5D7KE 2WXQA 2CKBB 1OP4A 2BSRA 3AC0A 3NP3A 3VFGH 1L9OA 3N42B 5I18H 2VR5A 1X5AA 1RZ8A 1ZS8B 4MNGA 3L3IB 1ORSB 1J1PL 2JJSA 5FKAA 4YDNA 7FABH 4NQDB 4N9GA 1A7BA 2X44D 4QTIH 3RILA 4JL2A 5TDPB 4P5KB 5E4AA 1TQCC 3QORD 1F13A 3O6KH 1QP1A 2OPCA 2DAVA 4S0TD 2KQMA 3VW3L 1UTDA 1HNFA 1BLIA 1OAQL 1FZOA 3CCHB 4OM0L 4WW1B 2WD0A 2Y6SC 1RZKC 3SE6A 3VWKA 2DQDH 1P5UC 4DGWC 5I5IA 1K4CB 3MCKA 4WK0B 2H6PA 4GW1A 5L7XL 4PJDE 3WEMA 2VSMB 1NMAL 2GITA 1SXAA 4X7TA 4G72B 4NQSB 3K3QA 5GGVH 2OMWB 5I15H 2WB7A 2VABB 1IBBA 1WUNT 1JWUA 5JXAL 3DXAD 4G6FB 4OCXL 3D05A 1JAEA 4ZOEA 3U7YL 5EUKA 3O9WD 3FCGA 2FX7L 5HDBB 1KJMB 1YYMH 2JVUA 2OMUA 3IVKB 1DTUA 4GG6A 3WTYA 1FAIL 2OSYA 5ESVA 1PY4A 3MCLH 1YY8B 3FQ1A 4XNXL 3MV8E 2ITCB 4HIXH 3PL6A 5I0XA 4GYBA 4YHIB 3NCYS 3TZVC 2ZWKA 5ES4B 4P3DA 2CQVA 2OTUA 1OM3L 4MXQD 1EO8H 5E2TH 5C0BB 2B5IC 4ZAKD 3UZEA 4YC2B 4BFKA 4KXAA 5HHNA 3Q6GH 4N2DA 3B7RL 3P77B 1PKQB 1E0OB 3MRGA 1U3HD 2YSSA 4RDQG 1J11A 3VD0A 3M1BA 4POYA 3P3SA 1QFWI 3O4LB 3ZX1A 3UZQA 4YXKH 1WSST 2WYZA 5HJGA 2QVMA 1IGTA 4XB8A 3RPIA 3EGDB 2AK1L 4NXSA 4PV1C 1NDGA 4OLXL 1A7OL 2R1WB 4IRSB 3UZEC 2X4UB 3F58H 4PMEA 1B0IA 2CM6A 3FSOA 4M00A 1TQSA 2DQGH 1MLCA 1XIWC 2GUOA 4JZNA 3F8UB 5L6YH 3SYAA 1C8PA 2Z31C 2XQYG 4P46B 4UCFA 2OCCB 5CR8A 5C0EA 4JDEA 1OCOB 1U6AL 3CH8A 2WQRA 2XQYA 4DZ8A 4HKJA 2NY1D 1Z9LA 5DO2D 1SFDA 2CBMA 5ILTH 1W6LA 4UDUB 4TNWK 4KMTH 4B95C 2UXTA 1DQIA 1A47A 3IDNB 2JKTM 2OQJB 3QUXC 3PGDB 1KB5A 3QBTB 5ADPH 2Y7LA 3NCJH 2LAGB 4GOSA 4L8DA 2HFFB 2YAOA 3MLVH 5CXPA 3IU4L 5MENA 4PBDA 1GL4B 5GS3A 4V2BA 2WQSA 4JY5H 2R7EA 3AWFA 2XTLA 2HTLC 3FO1A 4JAMB 1ET7A 5IQ9A 1GZQA 3ZE1F 3T4AA 2W80C 4BJLA 2ZXBA 4JO2H 2HLFD 4R4ND 3NSDA 3L7EA 3HE6C 4O5LH 3LRGA 4E41E 2AJUL 4FA6A 2ZUQC 4U1IB 1R3IH 2EDQA 1IC1A 2IAMA 2YWZA 5HHVL 5T3XD 4E68A 1T5WA 2EE9A 1OSEA 1AJ7H 2G9HB 4JFEB 1KBPA 3HAEG 5AYUL 4OFYA 4WUUA 5GHWH 4IYKA 5CGTA 4CBZA 1FNGB 4KXCA 3PWPA 4V1DD 4WEBH 2ZYSA 4XP1H 4H2AA 1MG2C 3MUHL 4G7VH 1ZT1B 2ZXQA 4PS4L 4OD1L 4TUUA 3FU7B 3BO8A 3BPLC 3GSXB 3S36X 5FLVA 1OQOA 4DUXA 2CD0A 4BSWB 1UZ6F 5HHOE 1ACYH 4PJIF 3B9DA 1SXSA 2XIDA 4XCFH 5H2BB 4W1TA 5E6IA 2XBDA 2AQSA 4L3ED 4AWJC 4EI5D 3FFDA 5F7DA 5IHBA 2IPTL 1FVEA 2VITB 3KPMA 3VMPA 3G5VB 4KK9D 1WZ1H 2FLRT 4PJ5A 3RWHB 2OZNA 4F9PA 5KVDL 1OCWL 2H3KA 2X9YA 1IGYB 1WVZA 1AE6L 1BREA 1TR7A 3DSFH 4IIQA 5DI8A 3WIIH 5BRZB 5CAYB 4F8OA 4WW2A 4ZFOB 4DJMA 3VXTA 2I69A 5I66B 1RIVH 3DSNA 3KYNB 2EJ1A 2NPLX 4MB3A 5KJ4A 3WTXA 2ADIB 4XNQB 1JRHH 2P44B 3ET9F 2EUZA 4U1NA 4LBAA 4MGXA 2YPVA 2MKLC 3VXME 1MHPL 4GI9A 3WJJA 2J71A 2GK0A 5GIRB 2A77H 2NY5L 4PJXF 1WBXA 2DWEB 3SE4A 3F7VB 5ID1B 5GRVK 2AJUH 2C3VB 2WIMA 4FX5A 2XOTA 4OCYL 1NBZA 3ULSA 1Z9OA 2P24A 1M7DA 3WY3A 3GRWL 1GS8A 2G2RA 2AMUA 2ERJB 3MACH 3DVNA 4AZUA 3GPEA 5FYJE 4AYDC 3TU6A 1FO0A 5LNEA 4YL4A 1WO2A 1F5WA 1A21A 2V7NB 4TVPE 2E4TA 1E8WA 2DN7A 4CJ0A 1CQKA 4XB7A 5C0NC 5A2AA 1GJUA 3LIZA 1WHPA 2X3BA 4LU5L 4Y9GA 2VDML 4H8HA 5T1KA 3MLUL 3WELA 2XN0A 5BPPA 4IJ3C 3VX0A 1YEWA 1RJLA 4G1EA 4Z7QF 3SCMA 3MJ7A 1MHPH 4OGYL 4S1DC 4WW2B 3VXMB 4X9IA 2C1OA 4L3FA 2NXZD 1BGXH 1ZHNA 3QUMH 4B96A 3W39B 4JFVA 4LLAA 3MZGB 2EDLA 4I4WB 4OB5H 4UT6L 4X8GA 4P4RB 2YEQA 3HE7A 1WS7A 1WZAA 1IBYA 1TQBB 5F7UA 4LLMB 3TF4A 4H0IA 1SHWA 32C2B 3PQYD 4MB4A 3BE1H 4RX4A 1DBBL 3OX8A 3FO1B 2DQUL 3N40F 1D7BA 3LNHA 3TWCL 2F74B 3NZSA 4AH2B 3CDZA 3NMEA 4FOMA 1FC2D 3GMOB 3QEGH 3UJTL 2DWEA 3SYCA 2NNAA 5D8JH 2AQ1A 3EYVB 5I15L 1JWSA 2CO6A 1VJSA 3GF8A 4ZXBD 1WE5A 4JFOA 3UMNA 2O6PA 4LEEA 4GQRA 2Y24A 4NSKB 1WS8A 3D4YA 5T5NF 3JYCA 4JPVH 4F9LC 5FECB 1FYTE 3QJXA 3UC0H 1RZ7H 4AYBA 2BIHA 4OBRA 1XH0A 5EN3A 3PP3K 3BW9A 1JYNA 3A3YB 4NP4H 3P73B 3LZQA 2QV2A 4Y4KC 3EH3B 1MI5E 3HHRB 4ETYA 2V7NA 2EILB 5JOFA 3MOAL 4UWQB 4HS6A 1BZ7A 4I3GA 2NLJA 4RIRB 3BQUC 4NOBA 4MCYA 3S98A 1YEDB 1HT6A 1XL6A 1VFMA 4X6BB 3TBYB 1C12B 2Y23A 3VI4B 5I1KH 3UZQB 3RURA 3PWVA 3B6SA 4G11A 4XX1E 2DJ4A 3CFBA 4J3OC 1QASA 1CLOL 4PJCE 2C9AA 4NZRL 1EEZA 4U1MA 5LQBH 5DFVD 4UB0L 3SY0B 3FO2B 1UKTA 1NUDA 5DR5H 3C9NA 2PTVA 4ZT1A 4KK6D 1TKWB 1BFSA 4OZFG 4BSJA 1NPJA 1OF0A 4K8RH 6TAAA 5DJXB 3ZR6A 1HKFA 3AU1A 1RZ7L 4FXKC 2Q76B 2Z0UA 5JO5B 5E1AA 1JF1A 3BESR 5B1BB 4A7GF 3MLPA 2Z8RA 2ATKB 1V3JA 3ARFA 2H1PL 1INEH 1QQDB 2J73A 2GABA 3LDBC 5HYJE 1H5BA 1NCUA 4HZ1A 3VH8A 2V2XA 4ES9A 3VYOA 5DEGB 1OP3K 3LXCA 2VDKB 4WO4A 5GISH 2JCWA 3ETTA 5D6CA 1AFVH 1C5DB 2XVBA 1ET8A 4JANB 2F19L 5JHLA 4AL8C 5IG7A 1SHMA 3SE3A 4W6WB 3ZQ9A 3K74B 5FO8B 3Q13A 1LO4L 4G1MA 1WA0X 4MXQC 1XFPA 4I9WE 4IS6B 3T09A 3Q6FA 2YPLE 2CKNA 3BN9D 3JT0A 4E41B 3OC8A 1TJHL 3OLDA 5E9NA 1ZPUA 1B2WH 2QHRL 2ZKWA 4X9HA 1UB6B 5DRXA 4BWTA 1UH4A 3RUGB 5AAPA 5TGBA 2J57A 3KS0H 2DD8L 2V9RA 4FHKA 5SWZD 3VFNB 6CGTA 1ZGLM 3D39A 2YSSB 4FFTA 3Q05A 1Q94B 5AUMB 1AKPA 1CE1L 2IADA 1WRFA 2I5YL 1KGYE 3B2VL 1G6VK 3ARDB 2P9RA 2X2HA 3KPSB 2PYFB 1HZHH 4NENA 1AQDB 4LPVA 3RVTD 3RWEB 3WXWL 4ZMWA 1UHVA 2JKIS 3RYMA 3X14B 1DEEA 5TPWH 5DRWB 2IAAC 2ITDA 2B9BA 3H53A 1KV7A 1TEFA 4N0UB 1RP8A 2XKSA 2Y6SD 3OB8A 2Z31D 1KG0A 5F9OL 2QMKA 3LCYA 4NO0D 1IC7L 3OWEA 3V4VL 4J2QA 4EI6B 1IIKA 5IM7B 2ADFL 2VW6A 3EYQD 2W95A 3GSOA 3QRGL 5I1CL 5F8QC 3VI3F 3MJWA 4Z7QE 1TEYA 4FLQA 4OZ4B 5EF3A 3AJ7A 3L9EA 4HH9B 2E76C 4ELKA 1B0RB 1T03L 1GGIL 1GC1L 3T4AC 3DBXB 4HAFA 4R0LB 3SPIA 5BQDA 2FLMA 5AALA 3VGHA 4ANXA 5FM4A 1BCIA 3FUFA 4U3SA 4Y2LA 5IMOB 4MA8L 4N2NA 1QHPA 1CF1A 4S1DD 3WS3A 3O8XA 3KS0J 5KANG 4O9HL 2YD2A 3CZEA 2J8UE 4NZDA 5JPMA 5FYKH 3KPLB 5F3BA 2NUPB 3AQYA 4M5SA 2ADGB 4O51A 2AXFA 3WFHA 4ALAL 2WXRA 5I1EL 4X8JB 2YS4A 3TYGH 3KNBB 5ANMA 2N0MA 2JELL 4Q6IB 4WTWA 1O5PA 1FZKB 1T66D 4F7EB 1M7IB 1BXAA 5F1NA 2TRHA 4PJHA 3Q2NA 5E08L 2EYSB 4GFTB 1NMAH 1XGYH 2FGWL 5LGJA 1QOKA 1N12A 4AVHA 4E5XB 1NMCB 2DQJH 2WLLB 3IE9A 2Z31A 1B3JA 4P3WA 4UM9B 1DQQA 2DQIL 4N0YH 1TITA 2ZNXA 3DMMD 4PN6A 3P30H 3VGGA 3FHQA 4NBXB 4G3YH 2VE6A 3IDXL 1JPST 1HZLA 2W9DL 3QORA 5C08A 1I85C 5B7MA 2QLVB 2HG5B 1KN2H 5F0JB 3MRPA 1B0RA 1PLGL 4GAGL 2KERA 2QADD 2H0JA 4QO1B 5FYKL 3ZKXC 4L4VD 3U0TB 4LP8A 3QDMD 2ZX9A 3SKUD 2NX5D 3BEVB 2Q87A 3IFNH 4DSYA 2FJHA 2KHAA 2WN2A 35C8H 4TRPH 4HK0A 3CK0H 1H9VA 1KJMA 5ALCL 4ES8A 1X5ZA 2XXMB 2ZJSH 5LWYH 2OK0L 4UQEA 4WTZG 1P6WA 4UILL 2JXMA 4F57L 3INUH 2CWRA 4AK1A 3SZ6A 1KY6A 1DCEA 1JGDB 2C3XA 4XBEL 5DJ0A 4YIQB 5EA0L 1OE2A 2VQ1B 4JFFB 4WWKD 1HXKA 1UACL 2ZPKL 1M6OB 5CU9A 1FFOB 1LK3H 1F8TH 2DZEA 2IWEA 4GS7B 4CW1A 4YXHH 5LXGH 3BUDA 1KJ2A 3BSZA 4XNAA 4EKXA 4QHKI 1SMAA 3MV8D 3D85B 3S0PA 2OTWA 25C8H 2H1LM 1GGCL 3HE6D 4R83A 3IDGA 4AG4L 4AVIA 5JNYA 3ESPA 2XY2A 2E9JA 1PVHA 4M6OL 3UTPE 3TBBA 1DVFC 2ORBH 1T2QH 1NCCH 4UM9A 1W72H 4I89A 2BSDA 2X3AA 1N0XH 3ISYA 1FDLL 2TSBA 3PGCA 1T80A 5J11C 2EUXA 1XGRA 4NQCE 2A74C 1ODAA 1TZAA 2V37A 2E9GA 3QORC 1YEKL 4ZMQA 3SY6A 3IKKA 2HJKB 4LLUB 3T3PE 5KSBF 1U92B 1T7YA 2VT0A 3MVSA 3TIDA 4YXKL 4ODXA 4QO1A 3N9GH 2WN3A 3L3OB 5B1AB 3H4HA 1T0NA 3HJ0A 3D09A 2IGFL 1INQA 4XGZA 3N43F 1A25A 1QMUA 1Z9SA 4RETB 2AF2A 5CSZB 1SBSH 3APFA 3LV3B 5IWLC 1YC8A 2WXNA 3AQDA 4PJ8B 4ORGB 3BUYA 4Y2DB 2EDDA 3KCWA 4TSCL 2R2HB 1ZHBA 4X7SL 5EN2B 3ENEA 5C07A 5KVEE 5GSRA 5DTFB 3FRPB 1KJ3L 1M6OA 3NH7H 3D18B 2HRPL 2OMVB 4UOW0 1FF5A 3D1MC 1IBGH 4Y88A 3WTSA 3E38A 1UM4L 4KH9A 1MZYA 1QSEB 1A1OB 1ID5I 4N8VA 3W56A 1S9YA 3G5YA 1TVHB 1EHKB 2GEEA 3KCPB 2H3NA 1S7WA 2OL3H 4YR6B 4K9JA 3I84A 1IEHA 5LBSA 2WBJD 3RBSA 3D2UB 1NCAL 4KZEL 2CZNA 1CTMA 1QLRB 4GW4B 4XCNB 4JCWA 1JPTL 1B6UA 1XZ0B 5FK9A 3QAQA 5DD0H 5TK2A 3FBKA 5DD6B 3TO4A 3X3FL 3ZZQA 4G6JH 1QSZA 3QHZH 3DURB 5IP4A 1MFCL 4FFYA 1E2VA 1JXKA 4KK8D 2GBAA 1Q72L 1RQ5A 2H6UA 5C08B 4M4RB 2C9UA 2B15A 3QQDA 1BMGA 4ZI8A 2JLPA 2P48B 3Q2WA 3H3PL 2J6EA 3VFSB 3CVBA 1OCWH 4D8PB 2DM3A 2QADB 4N3UA 1Z9SB 4ZFFB 5ID0B 2BHFA 2QVKA 4AZ8B 1BYPA 1NCGA 4ONFL 1SDYA 1TYEB 2KPWA 3N2JA 5IBTH 1SBSL 4ODTH 3QG7L 3SJVD 3QDGB 2HSIA 2XWDA 2HVJA 4NKIL 1AS8A 1YYLH 5E24E 4N5ED 1SEQL 3TPUA 4PUBH 2AJVH 5AZUA 4KVCL 3KXFA 4XXDA 5B39A 1TZHB 4F2EA 4X98B 5L2JA 5T1LA 4TVSa 3JV6A 3ZYZA 3W0WD 3B5GA 1S7TB 2A9BA 2FECI 3BCFA 4G5ZL 4JDVB 4LHQB 1H0DA 1KCBA 3BEWB 4N3TA 3HLKA 1J8KA 5JQHC 2WZPA 3MJ8B 4HHAB 1OCCB 4PJ9C 1HSAB 1UUSA 3NFSH 4WENB 1TETL 1QVOB 2JNZA 2PR4H 1ZAGA 5EZJA 4NC0B 2J4WH 2ICWI 1KCRH 5B21A 3KWWB 3GSQA 4LEBA 4C83A 3DURA 1ZEAL 4Y2OA 2D3LA 3F3HA 1MPAL 2W38A 2FWUA 3Q6FB 1LMIA 1P4UA 3K0WA 3IMUA 1UZ8B 4JGUA 5J6GA 3SEPA 3V0DA 5AW4B 1ZLWK 4DP9X 2J5LC 1F4XL 3ARFC 5EH1A 1HXYA 4QRQB 4HEME 4FFZA 1N19A 2QGCA 1T1XB 4A6YB 3MLZH 4H13C 2NZ9C 3F6IA 4WWKC 4R96A 1ZGLB 4AYMC 1BF5A 1RUPH 1IAII 3DC0A 3JWOL 1LYQA 2N7SA 1FNSL 4UT6A 4GG8B 3H0TA 2YPKA 4H8PA 3WEAA 1H15B 4S1RL 1AIFA 5CINH 1SDDB 3MNZB 2K6YA 1AQDA 1NTDA 4LOEA 3GIZL 4AGNA 3PWLA 4PJ8A 2JQZA 3IE4A 2ZSWA 4Z7VE 2ZNWA 4P48A 3AW5A 1RUML 1VZIA 5C07B 1ID2A 2ZKXA 5DVNA 3PL6D 4HCRH 3SPGA 3V0WL 4MJ2A 3D9AH 4HWZA 4Z3FA 3H6JA 4KV5F 4G42A 1B88A 1VGKB 1NPUA 3UTZB 2KI6A 2LABA 3POCA 3VDCA 4AMWA 1RULL 3ABGA 3V95A 5DZVA 2QSTA 4Y5YC 2CR3A 5IBUG 4J3OH 1X5LA 3ZE2F 3VFWB 1BFOA 3QO1B 2ED6A 4N85A 2ZF9A 3RA7L 1QPPA 1IBHA 4Z77B 3KPRB 4GI8A 1KBVA 2CG9X 4PGDB 1OVZA 1OAUH 1W72B 4U1HA 4PSPA 5HI3C 3DO3A 2CK2A 4HMCA 2IAND 3CK0L 3GSVB 4O02B 5HHOD 2HX8A 4N2BA 2F5BH 3DETD 3HE7C 3SDCD 3HNVH 2WXMA 2ZOKB 1OAJA 4FQLH 1A6VL 3VE0B 4PRPD 3PNWB 5DMJB 4DK6A 3WHE0 2V5YA 1A0QH 2VB5A 1FL5A 1ZLUK 3L5XL 4ZMLA 1XF2A 1JBJA 3WJLA 4MCYB 2NYYC 3AROA 2HKHL 5JUEH 2NY2D 4UBDD 3ZSTA 2VZTA 3PAZA 2K3HA 4I77L 2E9IA 4L8BB 4AX3A 3I75A 3HI5L 4YPGA 2WTPA 1YHPA 1OE3A 5C2BL 2IQAB 1IC5L 1A6TA 3C6EA 4XC1H 3BDYL 2DYSB 4OCMC 4Y1AA 1UA6H 3BQUB 4DEUA 4WI3A 1FO0L 3LDBB 3CFKA 1JUFA 1GW6A 3O41A 4B9PA 3GXIA 1AE6H 2OA9A 2EVJA 3U6RB 4HEMA 4WNSA 4C4BA 1J12A 3KL0A 3VW3H 2B3RA 4PBXA 2PP7A 1CD1A 1NDMA 1PG7H 2P49B 2WQVA 1GYWA 3GMRB 3OVUB 3H2PA 2H47C 1M42A 3DECA 3ZO9A 2C9QA 3ABZA 5E70A 3RFZB 1P2CB 5JHLL 1IGFL 2H5UA 3F85A 2VLRB 3QUZB 1W0VB 2J55A 3SE4C 4MD0A 2VLJA 4YDKH 4DQOH 3QHZL 4ZQKA 1S7QA 3QCVH 3LEXB 4G6AD 2QR0B 3MBEA 1E9OB 2PYED 1LK2A 2FX7H 4GRMB 5HDBF 4JDTL 3CJJA 5F96H 3MHZA 3SHSA 1J0YA 2DIAA 1XGTB 4BELD 1DLHB 3P9MA 3WYRA 4GRWE 1UGNA 4LSSH 2MCMA 3RGBA 4FA8A 5EO0A 5IVNA 3VDBA 2ZOKA 2PCYA 2VC2L 5AVVB 3OR6B 5DJYA 1MRCH 5BV7C 1NFDF 1P7BA 1EX0A 1MUJB 1PAZA 2HYMA 3QXDA 4F37K 5IOPB 3P77A 4ADJA 2JIXD 3CH1A 5CEZD 5SV3A 1IC7H 3DK0A 1OAUL 5BS0A 4OUUA 3V2AR 1NCDH 3RY4A 1W0WA 1XGQB 5HYQB 2AJVL 3ESUF 4LHUA 3ROOA 5FW6A 1O6TA 5CCKH 5CEZH 1IB5A 3L2LA 4BK8A 5F71A 2E74C 5KSVB 3AAZB 2ZSVA 2QFRA 3HUJF 1MW2A 5DI8B 3JVFC 5T33L 3WTUA 2NQCA 4QRAA 2MCG1 1VRSA 4NKDA 3SDAA 3G5XB 3PRZA 3B2VH 5I26A 5IM7A 4MXWL 1AO7D 5DJ6B 1BBJB 4OZFA 4LNVA 5I74C 5DD1H 2AV1A 2RFXB 2QKIB 4U1LB 5C0CD 1YEGH 4QY8A 4BHUI 1HQRA 3L54A 1EGJH 4GRWB 5DHEA 1IAOA 3DGDA 2HH0L 4O5LL 1BW8A 1NC4B 1I7UA 2VXSH 2V5RA 1C5CH 4OLEA 3EHBC 1U3JA 2VM3A 5EB9A 4Z7OB 3G04A 3KD4A 1UC6A 5I8KL 3NFNA 1CFNA 2R27A 1BVKB 4IMKA 4Q6IC 3F65A 3L3GA 3BYYA 1UM6H 3Q9PA 1QBMH 3MLTB 1BG9A 3DGCR 3I6LD 4C56B 4OF6A 1MAMH 4HA1A 4EN3D 1T1WA 2VLMD 3FQTB 3QNZB 2JB6A 3L45A 4KO5A 4R26H 4HIJA 5HGHA 1M1XB 1KC5H 4M1GL 3EIFA 3GJFB 1ZV9A 4JQIH 1VGEL 3FUIA 3K5SA 1ZY9A 1BQHA 3EJJX 2X89D 2Z93B 4TVPH 1U8IB 2VR9A 2X2JA 3FUNA 5E6ZA 4X5WB 1CL7H 1BF8A 5HYEA 2ZSVB 3CN0A 4FYQA 2KT6A 2OSLA 4WU7B 1BXUA 3ARED 3DARA 5F6IB 2MQ0A 3RPIB 3S8GB 2VDQH 3HE7D 4KKLC 1PYWA 2QSVA 2PCPB 3TTSA 4AEFA 1GCYA 3CSPA 3VXMA 3GKZA 2BY2A 1X5MA 4NM4L 2R29L 5AVWB 3S9DB 1MQKL 4N68A 3MFFB 3Q44A 3RZCA 3C6SB 4J8RA 3DHJA 1J0JA 3PS6A 5E1AB 3GS4A 2E9WA 3DJTA 1LDPH 3BGAA 4H25A 4MJIE 5B4MC 1I1AB 2EEFA 2VW7A 2UWEB 3S3PA 1JK8B 2EYTB 2Y69B 1CD0A 2ALAA 4HJ0C 1RIHH 2R7EB 3GMOA 4IM8A 1F02I 2FVNA 2P3YA 4BSVA 1WUZA 3OZ9H 3CSYB 4L3CB 1LK2B 4ZTPL 2WQWA 2PXYA 2X4QA 4ZNCD 2GW5A 2NX5A 4KTYA 2R2EA 4K3EH 4GS7C 1U8KB 2CDGB 2X70A 1N6QL 3QDME 4XH2A 3GJFA 1FL3B 2DKUA 4ZZFA 4ZS6D 4C4KO 3LNDA 1AR2A 4P2QD 3FQTA 4TTGA 2AXWA 3UERA 3L4YA 3BW9B 2LHAA 5DK2A 2I60H 3RWIB 2UXFA 5MEPB 2M8XA 1ZHKA 2YD3A 4HS8H 5F0LB 3BJLA 1QFWH 3SODB 3D06A 3IDJB 2EXWD 3L17A 3NIFE 4CMHB 5L2KB 4PP2A 1OT4A 1XGZA 1JG9A 1T6BX 2FAUA 3IDUA 4K3JL 2XDHA 4G7QB 4HWBH 2OP4H 2VXQA 2ZXEB 4PJXB 3S5YA 3L3KA 2D4DA 3CFCH 4MJIB 4Z76B 3VXSE 3H42L 1UM5L 3PWUA 5IW6B 1UYWL 5L8JB 1QTYT 1D7DA 1JNNH 1SNRA 3BRDA 4GW5B 5C0AD 4K9EC 2DRUA 5C0CE 2FB4H 4O02H 3C08H 2RB8A 4JUSA 5IMMB 3HMXA 4DCQB 2E7LC 1E9QA 4BGDA 1XF2B 1H8NA 4X7TB 4TF4A 5DS8A 3LZPA 4NKMB 2V5TA 3F7LA 3O4OC 2VABA 4M93C 4U6TA 3DI3B 5FUCC 1FFPB 4OJAA 3L9RA 4HBCH 1WC7B 4DWHA 3QT2A 2W8CA 1OK0A 1NLDL 2F8OA 2ZOLA 5E4IA 3QWNA 4QLWA 4APQB 4O9HH 4Z7QB 3TA3A 3H1ZA 3DYPA 3L3GB 4OIBA 4WW2F 3CU1A 4KUZH 1HWWA 3ZW3A 1FGNL 3QI9C 3HI5H 2EDYA 2PKDA 4A2GA 1TIUA 3CFCL 3F12A 2QVIA 1U33A 3WLWD 5LGYA 1Z9MA 4HCRA 1KF9B 3KJ4B 4KO9A 3T0AA 4GBXA 4EEEA 4NRZA 1U8PB 3T2OA 3HC3L 1FO0B 2MH4A 4HC1H 3UTOA 4XBGA 3DHUA 4GLRH 1YCSA 5A6LA 4U7MA 2AAAA 5KVFH 1FL5B 3LEXA 5ISZA 2XQ0A 5B1KA 5EZIL 3ZTCC 1LP9B 1CFBA 5DJ2A 3F00A 5L2KD 4E0RB 4H5SB 1SM3H 1VFAB 3MRGB 5IOKA 2VZUA 4LT7A 1A3RL 4AL8L 3IU4H 2X9WA 5J13B 2BVUA 3HG0A 1IKNA 4PJFA 3UTTE 4KTEH 5KSAB 3QXDB 2GJRA 3US1A 3FTZA 2FK9A 1HIMH 4DN4H 3S5LB 2NY7H 3VRIB 1T04B 1SLWA 4N2GA 1FORL 3SGJC 5TE4H 3UYRH 5E99L 4OSUL 2FEJA 1JMXA 3TLRA 2D0HA 2J3SA 3RNKA 3VI4F 2ZCLL 3GMLA 3RKDC 5F9JA 3LRHA 1LL1A 2FNWA 15C8L 4S10A 3U30B 1CLOH 4EOWH 3CU7A 3Q8AA 4NJ9H 5D93C 3FU5A 3RBGA 1SRDA 1OSPH 4TNGA 3W2DL 4AQ1A 1B0GB 4M5YH 3DHMA 2ED9A 2BCMA 3NZ8A 2WKLA 2ZONA 5DZ9A 1ZMYA 4ZZKA 3NTCL 5A3IC 1JXDA 5GGRY 5IEKB 4QGTA 3KM1A 3QCTL 1TSHA 2O30A 4NKIH 4KTEL 1NLDH 1ZLUH 1HVXA 1HE7A 4L4TE 5C0BA 4JFOB 1P4BH 2N59A 3CH1B 2MHAA 3GXUB 4P99A 1EUTA 2BRRH 5E7BA 5E94A 4CGTA 1N64H 5C6TL 5DDHB 5EO0B 1URZA 3NPSB 1FLRH 2BIMA 1H6EA 4L2YA 3AWEA 5A16B 1KN4H 3B2UC 3QW9A 1R5IA 1LE9B 1TF4A 5DUPH 4OLVL 1IAMA 3P54A 2MWCA 1Q0YL 5AD0B 3QE5A 1OM9A 1WIUA 2ORBL 2X6CA 3G6DH 3GBNL 3S97C 4BXSV 4DVRL 5SWQA 1KPRA 4PD4J 3UFIA 3JTSB 4PRIE 4CVXB 4HV8B 4LRNH 1T4KB 2OL3A 4BK5A 1TNMA 3QDJE 4FD0A 3PAYA 4LESA 5LBGA 2C9XA 2AABH 4OZIA 2NCMA 4FYSA 1J5IA 3IBEA 4K07A 3KVPA 5BRZD 3WFCH 5EN2A 3FB7B 3ARZA 1EFXD 3QUKB 1BG1A 3WUWB 4B27A 1HIML 1VZGA 2V9TA 1JGUL 3OJDA 1BX2A 1I7RA 3FTVA 1QEWB 3EFOB 2YC1B 1JWMA 4IOFC 2XZCH 4ODSL 3NSYA 4G43B 1RUQH 3KLLA 4JFPA 2BCKA 4RMUA 1QEXA 4YFLF 3G5YB 2FWOB 1J1XH 1MEXL 4NX0A 3D30A 4LLQB 4PW4A 4ETQB 3IXTA 1TJGL 3P69A 3R7RA 3A5VA 1VKXB 4X0KB 2MIZA 4N2IA 3T0EC 2CK0H 1N5AA 4FFVD 3IFLH 1U4EA 4ZUSA 4RH4A 1CF8H 1C1EL 1S9VB 2NY3C 5D5MB 2DICA 3H7BB 2GSIA 4LVEA 2QPSA 4LOVA 4UAOC 5JNYB 4PCKA 2CO7A 2DQEL 2FO4A 2PW1B 1EFQA 2IV8A 3BGFC 4ICXA 4U6HA 1W72A 4L4JA 1A4AA 1YNTF 3HG1A 1KTJA 4YEEA 5KOVC 4TLTA 1U92A 2VZ1A 3L7FA 1F45A 1CO1A 3JWDL 2Z4TA 4PLNC 4Y4FA 5C0CB 2KQNA 4M03A 1WWAX 4NC2B 2ESVE 4FL4C 2F8IA 4LSRL 1RCYA 4E41D 3BH8A 3CVHH 3ULVF 3DVIA 1A6ZA 5DVKA 4OTXL 3AG3B 2BH0A 1KJ2H 4M1DL 5INCB 2ZYHA 1HK6A 4OF0A 3RG1C 5K33A 3WY1A 2HVJB 4X5RA 2JKXA 4TLKA 2A0LC 3FCUB 3MBXL 5TJWK 4XPHL 3JWDC 4IRJA 4RMSA 2ZQKA 2BCKB 1Y0LB 4LLVB 5KYXB 3FRPG 3BPLB 2NY1B 2ICEB 3KPSD 2QQNH 2H45A 2ZZUT 5GJTH 3V7AG 4Y1AD 4FI6A 3FL7A 3QK0A 3EUUA 3NJKA 1HDMB 1NQBA 1WIOA 5BZWB 1E65A 1A6PA 2ZXAA 1FH5L 5FYJH 1N10A 3DX2A 2D73A 1TZ8A 4ZSOE 4G70B 3VFVB 5I0WA 4K73A 3RQ3A 5FYLD 4CU7A 4ZMTA 5JIIA 4LPCA 2V4LA 4Z3GA 1UH2A 1E5BA 4OZIE 2NT0A 1F3RB 5KG9B 5I6LA 3LD8C 2WGNB 3IDMB 4GAFB 4MBRA 4H8QA 4G8FA 1FHNA 3IAGC 1LLAA 5MHSD 2XTSA 4NIYE 2QR0A 4TQEH 4QIRA 4LDEB 5F3BB 2L4OA 4FG6D 5JOFB 3ZLQC 4Y4FB 4GXUN 1EBAA 2Q7YB 1SF3A 2WINA 4QHUB 3X13A 4AQ1C 4Q52A 2W0FB 3RY6A 5AOMA 1LK3L 5LXGL 2CXKA 5E4EB 1J9QA 5GS2D 4KJWC 4OM0H 3VFMA 3BWSA 2G75A 2K8QA 4WSJA 1CTOA 3D2UD 3FQ4A 1WICA 1OY3B 5F7YC 1G7JA 3WMPA 3U1SH 1HYSC 4N26A 3TONA 4TPRL 1JK9A 4ZNEE 5AVZB 3VQ2C 5I1AB 2ICEA 4NQXB 2VC2H 1DE4B 4LQFL 3S36L 2BVOB 4IHOB 5DJDB 3BWAB 1U42A 4G6KH 5D55A 4XCCL 5HHMB 2YARA 4AI7A 1G7QA 4DKTA 1VSCA 2MOVA 2DOCA 4WNJA 3B2UD 3U4EA 5A2LH 3F7YB 1IKNC 5KSBB 3SN6N 5KVGE 4LRIA 5EU6A 2FJHB 2D31B 4U6VH 3STBA 5BZDA 1NCHA 1IGIH 4AM0Q 5GRVL 5FV2A 1XR8A 1KMGA 3HRPA 2ZYIA 3N43B 4FQXA 2BFGA 1S7RA 1RXLA 1KYUA 4PQXA 4JFUA 1P7QD 4HFWB 1HINH 4JPWL 4NRXB 1RHHB 1FVDB 2HWZL 5C97A 5DQ9A 4J4PC 2IG2L 3BD5A 2G2PA 1DBML 1KGCD 2CGRH 1HOCA 3JVGC 1Y6KR 3QEHB 4M8UA 4LGRB 2I9LA 4Y1SA 4KRLB 1P5VB 1BZQK 1OAYH 2PNDA 3M1CA 4J1UA 5CHNB 2DWXA 3MRLB 4JG0H 4BM7A 3W2DH 3N85L 4NCC1 1KCUH 4IS6A 2UZXA 1D2PA 2KH2B 3QJRB 5CJBA 4L3EA 3WNKA 4WWPA 4ABQA 3GRGA 3WFEH 2Y4SA 3V6OC 5SWSE 3RRQA 3OKDA 4GKLA 3QYCA 3W57A 2WV3A 3HHMA 3N5AA 3UCQA 1A22B 4IHOA 5DJDA 5K9OB 4LVNC 5AW7B 5L4JA 1T5XB 3QIUA 5C9JB 1D9KB 1YN6B 1BZ8A 3NZUA 4NZ8A 2VMCA 3CVDA 4L8CB 1EHNA 1AP2B 1X4ZA 3MX0A 4I7ZC 1I75A 4WW1A 5JHLH 3VXMD 4OFKA 3PHQA 4M3HA 3VACA 3G6JA 2VLKE 2GTWA 3U2IA 3PP4L 1G43A 4JMXA 3SPHA 4YSEA 2OL3B 1R6VA 3MOQA 1U41A 4DIXA 3MN8A 3JWOC 1P7QA 4JN2B 4HZAA 5CKAA 4DP7X 5JPNB 3FAWA 3GMMB 2FT8A 3QJVB 2H4EA 1GOGA 2R23A 1D6VH 3ROLA 2L7JA 1TVBA 1T0MA 1BQSA 1QSVA 3AT9A 2Z7WA 2EDRA 3DOSB 2VLRE 1U58A 4J3OD 5F9WB 3SYOA 5GXBB 5DWUH 4TULL 2Z35B 3GJEB 2PXYD 2OJZH 3V9FA 1KZQA 5HYJD 4O2CA 3ARYA 2FWOA 3EGSA 5EPMB 2NUPA 1JPEA 1S7XB 5CD3B 1X5GA 4JFFD 5E9DE 4BA8A 3AUWB 1WBYA 3BIKA 3HI1A 4HCFA 1O7VA 1CR9L 3KLQA 4OZIF 2BNQB 5D2NC 3UADA 2ZXWB 1OALA 3GLAA 4S2SA 2QPUA 3W37A 1LD9A 3CQQA 4PP2B 5SX5K 3M07A 2A1WH 3QIUD 4I9WD 5EEXA 3B83A 3DOIA 4PJAA 3KL5A 1IGFH 3K8KA 5FA3A 4DKEL 1TPXB 2XWRA 5C1MB 2ATAA 1BDYA 1V27A 3FQXA 4NPJA 4AV4A 3S3DB 4N0UE 4HKZB 3PWJA 4EDXA 5E6UB 1IEBA 1R5IB 4GP4B 1KENL 2OW6A 1F18A 3JUZA 1BZEA 1Q90A 2QTEA 3FUKA 5IMMA 1T4WA 1ZJBA 5FUZL 2X9ZA 1D2OA 4P4RA 2CBPA 3V10A 3SBWA 5KSAC 2QL1A 5GZND 3QXTA 2BS8A 2BC4A 4FL4B 1CGXA 3FTGA 3UO8B 3UTSE 3QXWA 3WNMA 4B5EA 1QHOA 2Q3AA 1UUNA 4XVTH 1X5XA 3IXAB 1JCKA 5FF6B 4QTIL 1L0PA 3OJDB 2VR4A 3SKMA 1KCSH 4EQ2A 3CHRA 3UDWC 2Q8BL 5EEYA 1RD6A 3IN2A 2OCJA 1H3GA 3TO2A 1Z9NA 4R0LA 2FJGA 4AJWA 1RUMH 3L9YA 2NY0B 4U3SB 3QDGD 2GJJA 3UTTA 4DKAA 2NDGA 2COQA 3C87A 3T3ME 4XO4A 3U4AA 1I8LA 1VKXA 5BOPA 2HRGA 3OB0H 5I28A 3A47A 5CU5A 3RDTA 3LZOA 1QTSA 4PV8B 1CLCA 5KS9E 3BKJH 1IUZA 2FX8L 1OT2A 4YHPB