2K3HA

Structural determinants for ca2+ and pip2 binding by the c2a domain of rabphilin-3a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
GALEFSLLYDQDNSNLQCTIIRAKGLKPMDSNGLADPYVKLHLLPGASKSNKLRTKTLRNTRNPVWNETLQYHGITEEDMQRKTLRISVCDEDKFGHNEFIGETRFSLKKLKANQRKNFNICLERVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rabphilin-3A
publication title Structural Determinants for Ca2+ and Phosphatidylinositol 4,5-Bisphosphate Binding by the C2A Domain of Rabphilin-3A.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2008-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2k3hA00
3F05A 4KITB 4OVUA 4F92B 2DMHA 3NZUA 3RDJA 1DQVA 3IM1A 2YOAA 3ZW3A 4FADA 4F91B 4BGDA 5T8IA 5CCHE 5JHBA 3L9BA 1HE8A 3KWUA 3R7RA 4ANVA 4ICWA 3PRZA 4TV3A 4FA6A 2NQ3A 3CSFA 2FJUB 4ANXA 1UOVA 5H4ZA 2Z0UA 4LT7A 1RH8A 2N1TE 1DJZA 2CJSA 3TJPA 3CSTA 2Q0ZX 2B3RA 2R83A 3APCA 3L13A 4AOFA 4FHJA 4URKA 4JPSA 1V27A 4XE0A 1WFMA 3L16A 3N5AA 4WWNA 4XZ4A 5CCGE 1QATA 2CHWA 4QJ4B 3R7QA 3B7YA 3W57A 1W15A 3QARA 4TUUA 4LDCA 2CM5A 3QR0A 3APFA 3LJ3A 2A5UA 3F04A 4IHBA 4L1BA 4NPJA 1E90A 3GPEA 4ANWA 4WAFA 4F93B 1BCIA 2K3HA 1CJYA 3NZSA 4EZKA 2WXPA 1E8WA 4DNLA 2DMGA 4KZ0A 2X38A 3KWTA 4FHKA 1DSYA 5EDSA 2WXRA 1DJYA 3F00A 4WWPA 5KJ7E 1UGKA 2NSQA 4IQHA 2K45A 4GB9A 3NSJA 4V11A 2WXFA 2ENQA 3L4CA 3PFQA 4FLHA 4NPKA 4Y1TA 2QZQA 3L54A 3QK0A 2A4ZA 3ML9A 4ANUA 4F1SA 2QZ5A 3IBEA 1DJGA 5H4YA 4PS7A 3TL5A 4PS3A 4BFRA 3ENEA 2ENPA 4FJZA 2WXOA 2BWQA 4NP9A 5G2NA 3S2AA 1RSYA 1W16A 2KI6A 3QR1A 3M7FB 1WFJA 5JHAA 4EZLA 2EP6A 1E7UA 2NCEA 2V4LA 3OHMB 4L2YA 3HIZA 2CHXA 1YRKA 4EZJA 1DJIA 4HVBA 3F01A 2WXHA 1E8YA 2ENJA 2WXIA 5CCJA 2WXJA 2D8KA 4L1LA 2LHAA 3FDWA 4NS0A 4QAMB 3QAQA 2UZPA 4J6IA 2ISDA 2CHZA 4A55A 4DK5A 2K8MA 4XX5A 2CJTA 3L17A 3ZIMA 3QJZA 2Q3XA 1BDYA 2WXMA 2WXLA 3ZVVA 4L23A 2WXKA 3DPDA 1DJHA 2ZKMX 1K5WA 1QASA 3JZYA 2WXQA 3FBKA 3W56A 1TJMA 2CHDA 1GMIA 4WEEA 3SD5A 3DBSA 3L08A 2K4AA 4TS6A 4WWOA 5G55A 3TWYA 3OAWA 2Y3AA 4FULA 3PYCA 4FJYA 3RPBA 3HN8A 3HHMA 3MJWA 3APDA 1UOWA 3PS6A 3P2BA 1RLWA 4KZCA 2CM6A 1DJXA 1E8ZA 1DJWA 4QJ3B 3ML8A 4Y1SA 3T8MA 4MJJA 4PS8A 3PREA 4AJWA 4LCVA 2JQZA 1BYNA 1E8XA 4OVVA 4GNKB 4QJ5B 1TJXA 2WXGA 4G11A 2FK9A 2RD0A 2YRBA 1E7VA 2WXNA 4ICXA 1A25A 4HLEA
chains in the Genus database with same CATH superfamily
2CO4A 2KQMA 3MRDA 4BZ2H 4M00A 2DIEA 4J3OF 2FDBP 2YFNA 1YPZF 4HLJA 2FB4H 5CCHE 1IBGH 5SWSA 2DYSB 3KR3H 3KWUA 3VQ1C 4N2HA 1A9EA 5HYQB 4DEPB 1L0QA 4JFFA 1BZOA 4PRHD 1I4FA 3PWPE 2CR0A 3VGFA 2Q10A 2EKJA 3BCFA 3P3RA 1T0OA 3C8KB 1QSFA 3L3HA 4UIMB 1UACH 1ORQA 4XP1H 1MHCA 2AK4D 4M5ZH 4AIZB 5FO8A 2CSPA 3TZVC 1GHFL 1NLBL 1PG7X 1S7WB 4OQ1A 3VJ6A 4G5AA 1E4KA 1G7QB 2OMNA 4FN0A 1T6VN 2FE0A 1D9KA 3SYAA 3NJHA 3E2HC 3KYKL 4KOBA 2VXVL 3RG1C 1ZAGA 3VXRE 2J7LA 4W9EC 4GRWE 2FGZA 4F8QA 2EE9A 5KN5A 4YHIA 2YFOA 4HZAA 3VH8G 4ENEC 4M8VA 1L0YA 1P2CA 4JZJB 1VRSA 2FO4B 4P2OA 2N3JA 3MNWA 5LQBH 4ZS7H 1K6QL 2Q2EB 5DD3L 4N2EA 4QHPA 4H20H 1UCTA 3CIAA 3CZUB 2NY5L 3S36X 3KDPB 2OSWA 4OZHA 4ZO7A 2JKNA 3G6JF 5CZKA 2KZ1B 2VXQH 3QXWA 4PWEA 4JQVA 5FR3A 1GGIL 3RQ3A 1IC4L 1S7VA 5A16B 1SJMA 4QRAA 2Z35B 5E8EA 4F58H 5DEFA 5ANMA 5EUKB 1RZJL 2ZSWA 3IXAA 3GJFA 2N4IA 3GMMB 3IMUA 4UINL 4C59B 3C08H 4FF9A 4JRXA 5D7IF 4Y19A 3GMOB 4BFIB 2UXFA 4JHAH 2YEVB 4HAKA 1E5BA 4XI5D 3KLDA 3VE0A 3ASWA 4EPSA 3VQ2C 4HUNB 1OW0C 3AGVA 43C9A 2ZP0T 4XOAA 1AS6A 4E5XG 3HAEH 3IYLW 4Y9EA 5AZEH 1OPOA 3EYVA 3GIZH 5CCKH 4XNAA 1S7XA 1SVCP 2XN2A 2XYBA 5I1DA 4CAGA 4A63A 2R4SL 5BZWA 1YY8B 4H8UA 3A5VA 3C5JB 3MJ9L 3PREA 4OB5H 3S9DB 3H9SE 2YGOA 3DWTA 1MJJA 4OGQC 4Q6YA 4N2BA 4WV1A 2COQA 3S96A 4TLSA 5JOPD 3QYMA 4L48A 5HDRA 3SDCB 3WLWD 2CALA 5KSBE 4UM9D 4NT6B 2PYEB 5C09D 3HOGA 4LEXH 5J1AA 2YBRB 1D7BA 4ZS6D 4ZBJA 4BFNA 1RSFA 2P28B 3D7PA 2G60H 1IE4A 1ZDSA 4YE0A 5KWYC 2QQQA 3LB6C 3G5VB 4HEPA 5DHMC 4DPAX 1J87A 1U8NB 2AQPA 2E7MA 2VLLB 4I3RH 3FYIB 4LIQH 4Z7VA 3TBYA 1MCWW 3DRTA 4JUSA 4X6DE 3LKOB 3WMPA 5M94B 2WVVB 4FFWD 1N8ZA 1RVFH 5D5ME 5HDBB 1JERA 4ILDA 4QJ4B 4I2XA 2DQDL 4R4NC 1ND0A 5CUSL 3U6XS 3E3QE 5EDXA 4B9CA 3H85A 2O5YL 2CM5A 3P69A 5C0AB 2CCWA 1M4KA 2E4TA 3OSKA 4NAQA 3MV8A 1RUAH 1HQRB 2NY1D 3NAAH 1J9SA 5DVMA 3D69A 1P6AB 2BIPA 2VC2B 5HPOA 2MEJB 3O3EB 3RPKA 1XCQB 3ISWA 3WNMA 3FPXA 4KKBD 5JPNC 3AFLA 4LBEA 4M4RA 3AQYA 4J4PA 4Q97A 3QDGD 3VXRB 2ENSA 4ZG1A 1WWCA 1E5ZA 4GRWB 3VXME 2VLRB 5T3ZH 3WXWL 2IPUK 4IK6A 4L8DB 4WO0A 3PPSA 3MV9E 4L0YA 4JLRB 2DLIA 4B5EA 1WBYB 1J0JA 2XUWA 2VDKH 4H0GA 4IOFC 4XNXL 1BYPA 1DBJL 3PNWB 4Z7OF 2WQVA 4GMTL 4OLZL 4ZMOA 3VFVA 3UCQA 3FUFA 4RNRA 3F7RA 5T1DH 3KL5A 1G7IA 4QHLB 4WO4B 1A3RL 2NNCA 2F9BT 3VAEA 4NKIH 1Q72H 3I3DA 3PL6C 1SN5A 3GS7A 1YEDA 3QFJA 2FECL 2EE6A 3QZOA 4G59C 4HKZA 4JFEA 5IP4A 4I1PA 3PAZA 3CN0A 1L7IH 2CJTA 1IAII 2FLMA 3PWPA 3SKNB 1FIGH 5HHMB 2EXWC 3IJEA 1BM7A 5TDPA 2F1EA 2A4EA 1YNTA 4PJEA 4JFWA 4ZODA 2OCFD 3TA3A 1DN2A 1J0KA 2GIYA 2OL3H 2WOYA 2Q86B 4XNUL 3RWDA 5I8CB 1IC7H 1MFNA 5A2AA 2DAVA 3HZMA 4TXVB 1A47A 2W07B 1SN2A 3VA2C 2QHRL 3GSNL 3EJZD 4DGVH 1X5MA 3TPKA 3UTTE 2IXQB 2ZCHH 5T3XL 4Y1SA 3MR9A 4WWID 3KHOA 1IM9A 3HN3A 2PW1B 4DF9A 2BHZA 1IIKA 2OR7A 3CJJA 1Q9WA 4QTHA 4YSQA 3H1ZA 1QW8A 1UJ3B 1UKSA 2GJZB 2CO7B 3UDWC 5I2IB 1SOXA 5D2LE 5IQ7H 2DIAA 4RGNC 2R4RL 1UM4H 3MCKA 4QXTB 3SGKC 2R15A 5EIIG 3CBJB 4K23L 1BQHB 2OXGB 1ET7A 4LLAA 5I1LB 3C60B 1ZHNB 3GMQB 5DC0A 5CEZD 5IHZB 4OM0H 3CLEL 1CLOH 1GGYA 2DKSA 2XC8A 3MACH 2UY7B 2BSRB 4YE4H 2HT2D 2B9BA 3APCA 3Q01A 3RZWA 3GUTA 3KW7A 1GTFA 1M7DB 2DIBA 2DZEA 1H3GA 4YXKL 2YMOA 3DMMA 1G9ML 1U92B 3PDOB 1LNUA 1JWSB 2IAMD 1A4KB 2RGSA 4KC3B 4WFGE 1HEJC 4MCNA 2KYIA 5KOMC 4Z3GA 5L2KE 5KG9B 3LKNA 4ZTEA 1AGEA 1Z5LB 5D5MB 3NDZE 3OHXB 4ANWA 5L0QC 3ZYOA 1GY1A 1T22A 4RIRA 1B4LA 2IDQA 3SDDC 2AK1H 3Q06A 2F53D 1GRWA 3IMVA 4NQVA 4ECNA 1KTRL 3KPMA 1CLZH 1JNLL 3DTXA 3Q3GA 4H4NA 4IRSC 5F7DB 4GB9A 3P9LA 1CGVA 2JH2A 1Z9SB 5IKCA 3SEPA 3KCPA 2HT4D 2IADA 4A7TA 3DUUA 1WFIA 2BIQA 3SKJL 2E4FA 1KENH 4LRIC 3RA7L 5KVMC 3H9SA 4RQQA 3TO2B 5I15L 2W9EH 5KZCB 5BV7H 1S9YB 4G8IA 3INUH 4WVRA 4KX8A 3VXMB 3W9DB 2ZUSA 1N10A 5CP3H 3VGAC 4EDWL 3UTQA 3T2LA 1TVHA 5KSBA 3FB7B 1MFBH 3FB6A 4Z7IA 3D0VB 2XG4B 3MV9B 3FW6A 1K2DA 4ZNEA 2X9XA 5TDNA 5IJKA 2JIXB 4QF1A 3RU8H 3NJGA 4BFBD 2OCJA 1ONQB 1U8CA 4U6VH 3TFKC 4NRYB 5J8OA 3CNKA 3TGXA 4UZGA 4TTGA 4RFOH 2X4OB 3GRWH 1T2JA 1N9PA 4FABH 1NOAA 3PAVA 3QFDB 1ROWA 4F80A 4I88A 3KLKA 1NL0H 3E1ZA 5I8EB 1DP0A 4X6DA 1AHWA 1L9SA 4JM2A 2ICEA 3S97C 5T1LD 1GOFA 2XRAL 3D3VA 3ULUE 4TS6A 3QQNA 5EA0L 2CKNA 1NZRA 2QELA 2V17L 3AS2A 4V2CB 1DTUA 4X0KA 3ESPA 4H2AA 5FUCE 4KX9A 1OHZA 5ACZA 2YD6A 2FX8H 4I7ZC 4B6ZA 3LHPH 4IMLB 5H35B 2JKIS 2Y23A 3NJVA 5F9OH 4GBXA 4HC1A 1HT6A 2WIMA 2DLGA 3MLWL 2JJTC 1I1YA 3EOAB 3IJHA 4YDJA 4YWGH 5IVXE 2D9QB 5GGVL 4E41B 3AVEA 3EYOA 4F9LA 3T3PE 2VO5A 1N59B 4YO0A 4MZIA 3UZVA 5ADPH 1O6TA 1TZ8A 2DL9A 4KTDL 4UT9H 3QUXC 3QEHB 4OD2A 1ITCA 3LKRB 1LO5A 1MIMH 5FCUH 3RY6A 3X12A 5CILH 3MQIA 2CJSA 2IALB 3QH3B 1MVUB 2UWEA 1EZSA 1G6RH 2PO6D 5E2JA 2CKBB 5JIKA 1PAMA 3NQKA 3Q0HA 4XE0A 5JORA 1RU9H 4XVSH 4F27A 1ET5A 2A99A 1ACYL 4AEIH 2HRPL 4MVBD 1ID5I 3OAUH 1WVZA 4R97C 1IBFA 4YSRA 3LJ3A 3CSGA 5FDYA 1CQKA 1EDYA 3PWJA 5SX5K 2BP8B 5EF3A 1RZGA 5KSUB 1JMZA 1Q90A 2ENYA 2NNXA 3MRKB 2DM3A 5F44A 3VI4F 2X38A 3VD7A 4HJGA 4MB1A 3V5DB 3FPYA 1AD9B 5GGTL 3ZL2A 3P4LA 1GS7A 4NB7A 4DVBB 1LO4H 5A2CA 4V11A 3F12A 1TZHB 1OAQH 3WNIA 4D9LH 1OK8A 3FO1A 3OM3B 1L9MA 3HKFA 2XQBH 5D7LA 3I6GB 4GKNB 3FUNA 1Q9LB 5I74C 3U7YL 4MYPA 4S1RH 2GYSA 2Y6SD 1E7UA 3RWEA 4QRPE 2EUZA 5D2LA 2GAZA 5E2UL 1CE1L 5F1NB 4HIPA 1KNOB 3T0EC 2WXJA 5KVDH 1X9RA 4YQXH 4IKIA 3MLXL 4XNZC 3S37L 2P8MA 2N0KA 5LXGH 4ALAL 1NM9A 4TSBH 1F4HA 1EJOL 3NIFE 1CGTA 5JO5B 4U1KA 3RIFK 1J1OL 5AG8A 1DFBL 3EGDA 3UERA 1HXYA 2WO4A 1IGCL 4HS6A 2XV2A 3DX2A 2FYVA 5EC2A 2XN9A 1EHLH 1OT2A 4G9DA 5D71H 1HHHA 3O41B 3NABL 1E27A 1W8NA 2WBKA 4JY6B 4FXKB 4CU7A 1ZJBA 4KVCL 5I6PA 1F4YL 3HN8A 3TIEB 4KZCA 1HU8A 3X17A 4U3XA 1MCPL 1HHKB 5KS9E 3K2MC 3ZBMA 1WC7A 1A9BA 1KIPA 3P4NA 4JKPL 4OIIH 4PJ9D 1E4KC 1SHMA 1A8JH 1DVXA 1NWOA 4TLKA 3EFDH 4UQ3B 4F7TA 2B2XH 4PLOB 3W5MA 4ZUSA 2K4WA 4GIPD 1FFRA 2X2IA 2DTSA 4HBCH 2J57A 3O6FD 1WUNT 1CICD 3LAFA 3IAPA 1F4XL 5FC9A 2J8UA 4S11A 2ZWNA 2ADIA 1TTGA 5DZAA 4YHKL 2C5DC 3RWCA 3MLVL 1G7JA 4U1IA 1AQKH 4L3ED 2DLEA 2VQ1A 5HHOA 3VD2A 4O5LL 1S3RA 3IETB 4NN6C 3VFMB 1PNDA 2JTDA 2HJLA 4M8QA 3LRLA 1AANA 3F64A 4PCTA 1T2QL 4Z76B 4GT7A 4U1MB 1AKJB 1YN6B 4A7GF 1MZYA 5DUMH 4OKVA 3TEWA 2BSTB 4JQVC 1GH7A 4JFQB 3ATBA 4L5FL 5DMJB 4PJXF 5IVOA 4GQRA 3QNXB 1KCVL 2VN5A 3QUMB 3WY4A 3VW3L 4FQIH 5BRZD 2HTLD 3VNZA 5SX4H 1HYSC 2GJ6D 4UNTA 3CUPB 1XGTA 3HPLB 1UURA 3LV3B 3QQ4A 3RWIA 2A74B 3BLKA 1KXQE 1N5YH 3CBRA 5DJYA 4JW3A 2BNRD 4R26H 1EWHA 4PJ5E 3LS4H 2D9CA 3WIIH 1ZLWK 4X6FB 5IROC 5C0DB 1B9KA 1LEIA 1R1CA 1EEUA 4GS7C 4YNYA 4JR9L 3CXHK 1QUNA 4CNIA 2MTAA 3PNRB 2GTWA 4BE6A 1MCFA 5LBSL 2BRRL 4G80B 3CCHA 4HUWB 5FO7A 1RPKA 5I73C 1FIEA 1IO4C 4DKFL 3QULB 1OAJA 4UI2A 1YRKA 4TUKL 1T89A 5DUPL 4AXWA 1J10A 1DVFA 1CD1A 1I9IL 4WV1C 3ZDXE 2P5WD 3T6WA 3BX7C 2BIOA 1MHEA 4JY5H 1HC1A 1H6TA 3D33A 4QRPB 2OKMA 3LQAH 1SXZA 3VXSD 1BWWA 2DICA 4M5TA 5B1JC 3VWKA 8FABA 5I75C 4PVBA 1AZUA 4A2GA 2DYRB 4G7SB 3O3BB 1TJMA 1HZHL 2UY6A 2R56H 3QISA 4JRYE 5TE7L 1X9UA 4YK4B 2DN7A 4YEFA 1R5WB 2HVJA 2WJ5A 2P47B 4YZFF 2DLFH 2YPLD 5HYFA 3FTGA 3BXNA 2VDNH 4CW1A 5T33H 4LPVA 4CC4C 1TTUA 1MXGA 1OAXH 4DESA 2VMFA 3EJRA 1YMMA 3HFMH 4NOBA 3K6NA 4HIHB 4O58H 3F58H 3KXFE 4RA0C 3SDAA 4J8RB 4AEHH 1OSZA 3BUQA 1R0AH 1OWRM 1RIVL 2X1PA 2XNAA 3DRQB 3DROB 3HRPA 5KS9B 4CU6A 1OGAE 4PR5B 1UZ8B 1EPFA 2P5EB 3C87A 4QT5A 3L5XL 4ACPA 2VR9A 3WHXB 2OTPA 3DNKA 1HILA 5C7XH 2IDTA 3CDGA 3QJOA 2H0JA 4ELMF 5I19H 3K6OA 3G6AA 4OR1A 3QNYA 4QOKE 4R5TA 1PBYA 3K4ZA 4KXAA 1CCZA 3JWOL 4WTZG 4MASA 5EIQA 4CADA 3BW9A 2Q0ZX 1LEGA 5JYLA 3MGTA 3I2CH 1C5BH 2KC0A 3CHXA 3OPZH 1QEWB 4S1QH 1SQ2N 4XPGL 2IBBA 3FCTA 5C8JB 2HLAB 3E0GA 5C9JA 3PG2A 3OKMB 4F8OA 2G2RB 1PJWA 3S3PA 1WZLA 2KDGA 3QXDB 3BFOA 4KZDL 2K3HA 1XD1A 1CFBA 3L5IA 3O2DL 1XCXA 3LH9A 3UPRB 5DJCA 2YSSA 2WGNB 3B2XA 3D50A 4ZPVA 5DLML 3HE7B 5KYUB 2JKLA 3KVDD 3AACA 4HV8A 4YX2L 1B0GA 2VISB 2CDFB 1GR7A 5TF0A 1MDAA 3PJLA 1THAA 4AK1A 4LLYB 2BK8A 3NCJL 4KZEL 3A24A 2G2PA 3BCDA 4X6CE 2BVEA 1MQKH 1MRDL 3MX0B 3A22A 2RAMA 4PJ5B 5EOCL 4BFRA 1WEJL 1IQDB 5JXEA 1AP2B 1JPTH 2AEQL 2J4WL 4PRPD 2IH1A 1KIQB 2JWYA 1Q1PA 2A0LC 2P24B 4NO0B 4Z7WF 2B08A 4ODHH 4Z7QF 4B9KC 1Z0MA 2FBOJ 4OCWL 4Y5XA 2NSMA 2VC2H 3SE4A 4OZ4B 5HI5D 5D6DA 1ICTA 2CLZB 3QRGH 1E28A 4U4BA 1OCRB 5EB9A 4C4UA 4OCYH 1MEXH 1TT6A 2CGZA 3CK0L 1MPAL 2R1XB 3FTUA 2CMRH 4U05A 3S34H 1UATA 3NFNB 2CXKA 4FMVA 4NSKA 2M83A 3QCVL 1TVBB 2EYTA 5ABDE 1ADQA 1VGKB 2WLLA 1FLRH 2LLGA 1AIFB 4K94L 5F1SA 2F5AH 3OJDB 3UBXG 3ESVF 3VSVA 1P69B 3RPBA 4NO2A 4YUEH 4OZIE 4TRPH 4PJ6A 2Y2TA 4XX1G 5DRWB 3VD3A 5BJTB 3DMMC 4JRYB 5D1QE 4PLKC 3FH5A 4KXBA 4ZFOB 3DO3A 5HHVH 1KJ3L 1GXEA 4PJFE 2YRZA 5J3HD 3K46A 2R8SL 2NW2A 3NZHL 4PJ7F 1PU0A 4KQ4H 3QQDB 4N26A 3T8XA 3PP3H 4N24A 4LL4A 4MD0B 4HP5A 3ARUA 3TPUB 2AFNA 4PSPA 2EIZA 1IZKA 3ZW3A 2VN7A 4CC0A 3KXFB 3W38A 4U1LA 3CXDH 1ZT4B 4FXTA 2H45A 1S7UB 4MAYD 4PJHE 3N6YA 5CS7A 4TV3A 3KLAB 1OGAB 3BJLA 1FVCA 3D06A 5JXAL 1DVQA 2VWEE 2Z0UA 3C8HA 4XCYA 4I13B 5HJ3B 4PJGE 4YXHH 1JXKA 1GS6X 2DWXA 2ZIDA 2YD5A 2NXZB 1BZ8A 2X4UB 4NO5B 4TSCL 3M45A 5BZZA 4FFVC 1QATA 5IB2A 1BP3B 1V05A 3OKYA 2JLLA 2XBDA 1F1DA 1Q9OB 5E1QA 2OTWA 4DP6X 3RFZB 3WENA 1NUGA 4TUUA 1T1YA 4YPGB 2V5RA 1RZKC 1FZKA 4G7QB 5IK3B 1HHJB 4GMSL 3IKCA 5ILTH 3ZQ9A 2E9JA 1R3KA 4LIQE 4EZMA 3PU7A 4BQ6A 4EUPG 4N85A 1QW9A 2PXYD 3GSRB 4LL1A 3UTSD 2G0LA 2CUHA 2JF1A 5LB1A 4LSQH 1WFUA 4G8GD 3DYPA 2CLVB 1RPQA 4ODWB 5D9SB 4OGYL 4DPBX 5DI8B 1AHWC 4UB0L 2G5RA 1KWKA 2ICEC 2J1XA 3KS0H 3OHXC 4JK0D 3CN2A 2GKIA 2VXUH 3GI9L 3CN1A 3E3QC 3JV4B 4MDIA 3D25B 3PHOB 3PQYA 4GRLD 3ZQWA 3HCVB 1CD0A 1WBXB 2QJDA 4J3UA 5C0BD 4X6CB 3WJMB 3KW8A 1GYUA 3D48R 3HLAA 2WXHA 5DHYB 4GJTB 4RWYL 4MMXA 5E8DL 2D0GA 3JYBA 5J6GA 1A4AA 2LABA 4GG6E 3IMSA 2X40A 4HWZA 1R33A 4FNUA 3E6HB 3DXAD 5ESAB 3BZ4A 1AVAA 1KT2B 2W9DH 3WEMA 2Q3XA 2CO2A 1J9TA 4MRCA 2NZIA 3O4LA 5D7SH 3VFOA 3LIZL 2NR6D 3OMZA 1UJTA 4F9LC 4F33A 1QASA 5F70A 3P77B 4YFLF 2ZX8A 1KGCE 3M1CA 3QI9D 1SJVA 3OB8A 4GAJH 4HMEA 1EFQA 3RY6C 4M6ML 2HJFA 4N8VG 1EHKB 4LLUB 4FJYA 2EO7A 3FF8A 5HHPA 1JK9B 2R9HD 4LVEA 2JCCE 1E4WH 2NNAA 3IXTA 1KYFA 4RZKA 4U7SA 2PPEA 1JWUA 4J6RH 5FF6B 3RVXC 3SQBA 4ORGA 2O5XL 2XXFA 3PIQB 4OZIB 4FA7B 5IFHL 1AXTH 4APQD 1G7MA 3TWCL 2Z9TA 5D1QB 3J27A 1DUYB 3GHPA 4FL4B 1S6NA 3MPCA 2AJVH 3OXSB 1TOXA 2EE3A 4TMPA 4D8PB 4WUUB 2HKFH 2Z4QB 1HH6A 1JOIA 5DZLA 4YAQA 1TJHL 5ESVB 3V0HA 3PRZA 5B38G 3FTXA 5JYMA 2GUOA 1KBGH 2GSGA 4WFHE 1C5CH 5GGRB 4ZMXA 2CLRB 3AQDA 3C6LA 2ARJQ 5AQ0A 4NJAH 1ZXKA 1X6NA 2WQUA 3FULA 5DK0B 4G6JH 2AZAA 2D7QA 3M86A 3IE9A 4IU2B 2E0PA 1ZIAA 3WFBL 3F7KA 4MXVE 5FUZH 5B8CB 5EUOB 2EDNA 5KVGH 3RVTC 1T66C 4OZHF 4G1MB 4JFUA 2NT0A 2FJHB 3RVUC 5ES4B 2PUQT 1MAMH 2VXQA 3O2VH 5BRQA 5K1JA 5HGHB 1A14L 1CFTA 2DDQH 4P9HC 5ID0A 1CPUA 1WHOA 2WNWA 4OFKA 1UM6H 3HC4L 2DQIH 1QFUL 5GGRY 2ZOLB 5FOBA 2TRHA 3CU1A 3CFJA 3EFOA 4AL8L 1UCBH 1CXLA 4P4KB 3F7YA 3U9UB 2MOGA 5E8NA 5JHLL 3J7HA 4KDVA 4LQFH 5I5RA 5JZ7D 4EIBA 2B1AL 3O6LL 4PJFA 1MCHA 3JTTA 4HX1A 3GBNH 3VFUB 3MA9L 5SWQA 3Q13A 4LSDA 2EP6A 3BN9D 1WRFA 1TNNA 2B59B 4FERA 5DHEA 1A65A 3HVDA 2F74A 3UFIA 2PTTB 2COVD 1UA6H 1PIGA 3AM8C 4KKAC 3PGCA 5FYLL 1WGVA 3DV4B 4ZYKB 1KIRA 2EEFA 3FU7B 3D85A 3QJSB 1UZ6E 3ETSA 3Q1SH 1VEOA 3TX4A 2RTTA 3FQRB 4WY7L 4B41A 5I1HH 1NMBL 2FX7L 1P84K 1I7ZB 3L8QA 1JYNA 5E56A 3FN9A 1J1XH 1R34A 3S8FB 1KBWA 5AKSA 5MEND 2OLDA 5GGSA 1BEYH 3DO7A 4X4XB 3GNML 4MS6A 4ELKB 4ZO9A 1QEXA 2EDOA 4FQXB 2AJUH 2GCYB 2VLJB 1JVLA 4NWUL 3O81A 2BOLA 5BVPH 1GW0A 3L3DB 1VIWA 4FXGA 1FPTH 2R0WL 2NY2B 4Z7VF 5F89A 4H1LB 4UAHA 5E51A 4PRBA 4WJ5A 2A6JA 1WD8A 4JGMA 4CL7A 3NZ8B 5HY9A 4WKZB 4P2RA 1AXSA 3AT8A 5D1ZB 1PD6A 3WS3B 3GXIA 3WNNA 3TO4B 2VDRB 2HX7A 1NAKL 4U1NA 2C8NA 3ULUC 1WJ3A 4F1ZA 3MNZA 3LXUX 1AJ7H 3NJMA 4Z77B 3VFRA 2K70A 3REWA 2C3VA 3SQOL 1JGUL 3BPCA 5FUCC 2XIIA 4YDKH 4NM8H 3AU1B 1SMDA 3OF6A 5T5NF 2EJ1A 3HG1E 3TBSB 3OKOB 4EVNA 4YHNA 4YHOL 4GG6A 2Y7NA 1BGXL 1PZ2A 5DEZA 5IFJB 3MLYH 2DJMA 1S9KC 1XR8B 4JJOA 1D5MB 1EDHA 1G9EA 3X2QB 4PLJC 2IBZY 5F0PB 2IWEA 1XXDC 1DVFC 3U6RA 1DLHB 1OM9A 4AVJA 4L3CB 3PHQB 1NCIA 1ZY9A 2OM5A 3V5HA 1D5ZB 2UXVA 2C4XA 4XVJL 1NM4A 1RP9A 4PCKA 5DYOA 4U1HB 5F7EL 3N43F 2AVGA 3FO0H 1LK3L 2JCCA 4ANKA 2X4SA 3O3DB 1PDKA 2A4ZA 3L7FB 4JM4H 1FORL 1W6LA 5DD5H 5IHUH 4PJEF 2OL3A 3ATEA 5EH1A 2VDPB 4LSPH 4PRHB 2ADGB 4LCWE 5JUEH 2V7HA 1GAFL 1LYQA 1IAMA 1MNUH 3B5TA 5DJAB 3WNLA 1OTTC 2M2DA 3NJFA 3U83A 2QADC 4HVBA 3SDXE 3BKMH 2A77H 3WL9A 4ZSOA 1JUFB 5IW6A 4RISL 5KYWB 1YO4A 3SDAC 3UGUA 4GRWF 2DQUH 1YEHL 1Y6MR 3D87B 3KYAA 4LCIL 1KDJA 4D7PA 2Z6FA 5TTRA 3QRFM 3D9AH 1DQML 3BDYH 5FYJD 5KBNC 2DM2A 5GRUL 5ELIA 3LN9A 3V6ZA 5A43C 3B9EA 1TETL 1CG9A 1ZHKA 4P0DA 4XCNB 1CFQA 3ZDZE 5H94A 3NPSB 1KV7A 2Z31B 2NYKA 4YSUA 4YHPB 4NQQA 3L3IA 4P05A 3QT2A 4S0TD 4LCUA 1C08A 3L1OL 4P2YA 5E5LA 1AO7A 4F57L 2FGWL 4KKCD 3K3QA 4Q2ZA 3U4AA 2AW2A 2HB0A 3BP4B 2D73A 5HJDA 4DT2A 1ILUA 5JMOC 4G9FE 1RUKH 4OZFB 5BXFA 1QLFA 3QWRA 1UVQB 1KJMA 3QJRB 2XIBA 4YK4C 4JQIA 4PRAB 4XP5H 2YOAA 5KSVA 3NBNA 2NTFA 1EO5A 5CZVH 9CGTA 5K39A 4LSTH 1U8LB 4JFDA 1FNGA 3TIDA 3EXLA 1BIIA 2AXWA 1PEWA 3RJDA 4QHUA 3BUYA 5ECJE 2FJUB 1NFDA 1YAZA 2MFNA 1NMCB 1CR9H 2D3NA 2D0HA 2VLKD 2ZXEB 3LNGA 4LEBA 1EHNA 4OCSH 1I3RB 3IVKA 3OLIA 2BZ7A 1GPOL 1JTOA 4URKA 1FG2B 4XCCH 5GZOD 2F61A 2ATKB 4W9KC 3M17A 1RMFL 1BVLA 3GBML 5IUCA 3D09A 5MERA 5JXEC 1KN4H 4JZOA 2IMNA 4XO4A 2FJGB 3DETC 2GITA 1XF2B 4H8WC 5CP3A 3ZDYE 2IH9A 1WPCA 1TTAA 4IHBA 4G6MH 3NCBB 4I77L 5KSBF 1H3UA 3EH5B 1FO0L 5DK3A 2G9HA 2P26A 1MWAB 1TQBB 1OM3L 4I4WB 4ZXBB 2OULB 4G8EB 4IDJL 1U95B 2GIMA 4TVUA 1WWAX 1EJFA 1UWGH 1ZK9A 4M7LH 5AOLA 4EUPH 5DD6A 1RL1A 1VA9A 4YDIL 3GRWA 5C09B 4KI1A 2X28A 2ZX9A 1FV1A 3GMNB 4B3EA 4ZMLA 2QZQA 1KCSL 4LCCA 5EO9A 2J6WA 5E8PA 3HS8A 4X6DF 3D8MA 2OJEA 1AGCA 5D5MF 2JNZA 2VM9A 3HKZA 1U8QA 1U41A 3AXLA 4J3TA 4DZBA 3RX9A 2PCPA 4XNQA 3CXFA 4LCWB 1IBYA 5IMKB 1BQUA 1W80A 4G1EB 2WXIA 4AITA 4BFJA 5CCJA 4EQ3A 5FYKU 2KZKA 1BWMA 1YHPA 4DSYA 2ADJA 2BFVH 2KLTA 4NIYE 2XZZA 3SDXB 1NBYB 1QD0A 2Y69B 3SPGA 2JELH 3DA0A 4PGEB 3ZX1A 1S78C 3QNFA 4NHCL 3HG1A 4QRSA 2AJXH 3SCMA 4YHYC 4HD9A 3TT1H 1TQUA 3FMGL 1P7KA 1SXNA 1KB5L 1SBSL 1XD0A 3QDGB 4JE4B 1RZ7H 4UT9A 2DRUA 3C5ZA 5E4EB 2OP4H 1TEGA 5DMKB 3N3EA 2QTVA 2J2ZB 1G6RA 4ZRGA 1QVOB 1CL7I 5D1XD 2UWEF 4MJ2A 5D1ZI 5KAQF 4O51B 1N70A 2FD6H 2E8ZA 4JPKH 4IBWA 4XAWH 4C4KT 4FX5A 5DEGA 3ZKXB 4MHHG 1BIHA 3LEYL 1Q8MA 1S5HB 4G9FB 2EIMB 5FGSA 4FADA 1LTXA 4RAVB 4Y2DA 5TGBA 2HFTA 4TVPL 2VL5A 3BRGC 2ATPA 4IS6A 4E0RA 4UBDD 2C7UB 4I0KA 5GS0D 4IGBA 3BEVA 1JI2A 4JCMA 4C56E 4YR6B 3VH8A 5GSRB 3ULVD 4OZFG 2QEJA 3QUYA 1GHFH 1NLBH 1QKZH 3LZRA 3V0GA 3TM6A 1F02I 1JS4A 3QUZD 2W88A 1XH1A 3BD4A 4X50A 5FYKE 4C8XA 3VTAA 2GTZB 3MMEB 1ETB1 2YKLL 1E3XA 3BKJL 2OMVA 2AJ3B 4CSSA 3A6OA 1RULL 2BX5A 3QDAA 4NZTH 5D2LF 3S5ZA 4GSDH 4WTXA 3OSVA 2ZAGA 4KFMA 1QRNE 4CILA 5DD3H 3VYPA 4E36A 4KVNH 1H0DB 3NSJA 4DCQA 2P49B 2X1WL 3EJCA 4Y1TA 2NY5H 3RJOA 3JXAA 3KLQA 4DQOH 3B9KD 3LKSB 1I7TB 1RHHA 4DGIL 3QORB 3US0A 2AV7B 5L8JB 3MROA 1WA0X 3M7FB 5EPMB 3RDTD 4QYAA 1RZJH 4E5XA 1A9VA 4BZYA 5I1GL 3BH8A 2PR9A 2BVTA 4UM8B 1IRAY 1F6AA 3ZTDC 3G6DL 3HC0A 3P3SA 1HOCB 1J9QA 1RUQH 5AVQB 2XY1A 4BUGA 1U58B 2J20A 4G83A 3K71B 1IBZA 2V7NA 4XBEL 5FW8A 4P5MA 3R18A 4JO3L 2F53B 3WN6A 1HOEA 2A9MH 1HQ4B 3FBKA 5DR5L 4P4RA 4CMHB 4H13C 2V5TA 3C6LC 3K6SA 1E4HA 4PG2A 2FYYA 2W60A 3CZEA 3KD4A 3MBEA 3HG3A 4GQ9L 5TDOB 4GXFA 5DC2A 1PX8A 4PS4L 2ZOKB 4ZZFA 4KAQH 5JW4R 1HI6A 3OR7B 4K7PY 3TFBA 1AMYA 1KCWA 4GW4B 5EC1A 3V4PB 3PLYA 2FEDD 1AOZA 2BXZA 4G6AD 3R8BB 2J43A 1RUPL 4WTWA 1YC7A 1DE4A 3WG7B 2I32A 1SVZA 5IM7A 5HYQA 2L0DA 2X3BA 1PY4A 4BZ1H 3ULUF 3F7VA 5HGAA 1C16B 3M88A 1BW8A 1JK8B 4QRUA 2FCBA 2IC2A 4OT1L 4N2CA 4PREA 5D1QC 3RWJB 1ASOA 1ES0B 2ZWLT 2H3KA 4J3OD 5T1LB 2UZXB 2DQDH 3DDGA 2B3IA 4XNYL 5CUSH 2KDYA 2QKIB 2C9RA 1FL3A 2G4GA 2MNJB 4GXVL 1MQ8A 1JHTA 1A0QH 4I1NB 5BVJB 1QI5A 5LG6A 2Z7UA 5IVXF 5FHAH 1W6WA 3QIBA 2D3LA 2FQGA 4UTAH 5FO2A 5K9KA 2WVUA 5IG7A 4GAYA 3U1SL 3T3PF 3CFDA 3DGGA 2VWEC 1EBAA 1EBPA 3PHAA 4MQSB 3P11H 4XMPH 3HHSA 5C1MB 1C12A 4U3SB 3F8UB 4DJMA 1QRNB 3I9IA 4XNXH 1DBJH 4Y16D 2CIIA 2PTUA 4GMTH 2B4CH 1NOLA 3I02A 1ZKAA 3RNKB 2F58L 2A9AA 3S2AA 2PO6B 3Q5TA 3JV6B 1A3RH 3WIHH 1ZTXE 2YAMA 4H44C 4P4KC 3IS1X 4R9HA 1V55B 4FXGC 4LAQH 3EGXB 5H2BB 5C0CE 2HH0L 5DJXB 3ZSTA 4R7NA 5AAMA 3IFNL 1OSYA 3MA7B 2UZPA 3UPCA 1P5VB 2XWZA 5E2TL 2X89D 3D52A 3PWVA 5F7FA 4M5YL 3UZEA 4POZC 3OWEA 4AIOA 4C56A 4PGZA 4OFYA 2IH8A 1C1EH 4XNUH 1M1SA 1NCCL 4HKXB 3P9WB 5E1HB 2ARWA 3RX8A 3V8OA 5C9KA 3S8GB 1HK6A 2DBJA 5JPMB 1HEHC 4LMQE 1XGQB 3UJJH 2QHRH 3GSNH 4HJSA 4KO7A 5J6HB 5EIIA 2K7PA 4I0PA 3MNVA 3F5WB 5C07D 2VE6B 2NY7L 3APDA 5AOKA 5T3XH 3EH1A 2H2PC 1XL6A 1JPEA 1ZV5A 3ZHKA 3C5JA 5C0FB 4EN3A 4NUQA 1MI5E 3RVWD 4XMZA 4QY8A 1EAJA 1T3FA 4N87A 3NEEA 4GW1B 1J0IA 3NIFF 4O00A 4HLEA 5JW5A 4JG1L 2R4RH 1OCWH 4FQXC 4KNQA 3CVHA 4DP2X 1DL7L 2Y5QA 4F92B 4UV7H 1NGXA 1TNMA 4I9WD 4XO8A 2JSFA 3LXBA 3MYJA 3QDJE 5D6CA 3ZL1A 3CLEH 1ZT7A 3O4OC 4WRLA 3V0VB 1DO5A 4Y4HA 2BCMA 1BD2E 4QUOA 5EOTB 3U9PL 4HGMA 2GBTA 1E9OB 3OKNB 3QUKA 4MKTA 2Z93A 2J88H 4MZRA 5IHHA 1TEYA 2YD9A 3LKOA 4FQPA 4BRVA 5KS9F 1TYJA 3GTTA 4EDXA 2VZVA 4UQ2A 1DSWA 1JZ2A 2G5BA 2IWGA 1GTNA 2QSVA 3EBHA 4DQAA 1CL7H 4Z78B 1PZSA 3A67L 4MXQD 2CDEA 3MXVL 3CTTA 1VB9A 4X5XA 3LQZB 1VFOA 1OLLA 1ZSHA 3D2TA 3HI1B 5E6IA 2WXPA 3CPLB 4U0RB 4GEIA 4DNLA 3BP7B 3O3EA 4WHTA 3BO8B 1FDLL 5A3IC 4IYKA 2X2HA 3ELAT 1GYWA 1HVXA 4KUZL 5I18L 4ZQTA 1CICB 4IQHA 3UTZB 1BFOB 5F7LB 1N6QL 3SKJH 3QIWB 4JVPA 3RA7H 5GRXG 2VLRA 3AWEA 4XPHL 1DCLA 2QSCH 5JW3H 4F1SA 5F9JB 4YBQD 4KV5E 3GO1L 3ABGA 5T1KB 2OYMA 4EDWH 3E38A 1MFDL 5J89A 2MHAB 5IFAL 2CRIA 4MQ7B 2E74C 5JDSA 1S9WB 2HVKB 3TOPA 5FO9B 1ZWIA 4HS8L 1XBDA 2WV3A 4M29A 4XE5B 2XT1B 4W9CC 4QAMB 1OTUD 1H6EA 3S6CA 3Q44A 1TQWA 4K7PX 2ZZUT 1TMCB 3KWXA 1A7QL 4FRWA 1YJDL 4PV9B 5BRZB 3GXFA 4X8JA 2OXHA 3S5YA 1LWJA 4W9ZA 4QRQA 2CR3A 4A7QA 3L3OB 2BJML 4P3CL 1OAZL 4ZD3L 1FZJA 4BFKA 2AXGB 2XRAH 5GS0L 3QG7H 4R7VA 2Y7QA 2BNRB 5EA0H 5I8CA 5FB8B 5GZND 2VZOA 5I0XA 4CVZA 2XX1A 3EUDA 1BVZA 1T6BX 1UT1A 3FUJA 1AHKA 1XF1A 4K5LA 5TE6L 2YEZA 3H6AA 4JFPA 3B1TA 3PS6A 4HIXL 1BQKA 3US1A 4GXUM 2EC9U 4FNTA 5EO1B 2WTRA 3EOTL 1WAEA 1SQMA 4N6RA 1YVLA 3ZDXF 2M26A 3ZK0A 5BV7C 1KCRL 3NPSC 2OFQA 2Z31C 3KEDA 2WZAA 1UJ3A 1BYOA 2OJZL 3QJUB 4A7VA 2P5WB 1H5BC 3ROLA 4B9PA 1W2KT 2ZUWA 1EGJH 4PB0H 4AV0A 2LW3A 3OZ9H 4KTDH 4WWKD 2V5MA 4N28A 3VMPA 1IAKB 3GMQA 4K4KA 2DWEB 4E9YA 1T0PB 5HDLA 4E68A 1I1RA 2UY7A 4XOBA 1IGMH 3QDJB 4MA1B 1ACYH 5C0CA 3TV8A 4P5TA 3IS0X 3MJGX 2EYRB 4OZFH 4XOEA 1BD2B 2BW4A 4MNQE 1X5LA 3UZQA 2WN2A 1O75A 3BPNB 1SY6L 4BH8A 3LIUA 4PB9L 1WWBX 4IJTA 4NXSA 2O6FA 3NDYE 4LDCA 2QQNH 4XN9A 5CJBA 1QWHA 5GS1B 3APMA 1FSKB 3BPLC 5L8LB 5SWZE 3UXFA 3LSOA 1F42A 4L4VA 5JNYA 3T4YB 4OAWB 2XACC 5GGTH 4HGKC 2E3VA 4U7MA 1WDAA 4WSKA 3O8XB 1IKNA 4A7SA 4KROB 1FNFA 3IGUA 3KGRA 3B2VH 2ERJC 2RBLA 5L88L 5DZ9A 2H32B 2XN1A 5AENA 2J6EH 3U7YH 4ZXBC 4IEFA 4N0CC 4QXGL 5BS0A 1KGUA 3W9DA 5E2UH 3BIBX 4OLXH 3DI2B 5HYIA 5D7JD 2B39A 2KUTA 3WMSA 1F2XK 4X0NA 3AAZA 2WMPB 3QYNA 2MRYA 1PKQB 3S37H 4J3WA 5FFOA 1ECZA 4ALAH 1XGRA 1KJ2B 4OW6A 4U6HB 4Y5VA 3PGDA 3V0WH 4L2LA 1J1OH 1DFBH 1JF1B 1IIIA 2D2OA 4AZ8B 1NC4B 3CN3A 1J7VR 1SDDA 3BYTA 3EJQA 2XZCH 1YEGL 4GKLA 3VRJB 4AT6A 1OV8A 3S3CB 5IQ9B 5CMAB 5LNEA 5DURD 3NABH 4G7RB 1KFAL 4KVCH 4PBXA 4IGBC 2HAZA 3HPJB 4Z0XA 4BH7B 4V1DE 5BW7A 2WKLA 1HH9B 3CZFA 4IOIB 3V5KB 4C4KO 3HEIB 2F54D 4MXWH 3UC0L 4Z3IA 3QUYC 2VKXA 4MBOA 3MRJB 2YAFA 1CYXA 3EO1B 4PV1C 3SPJA 1JVKA 3NEOA 5BOPA 4ONGL 4AC4A 4BHUI 1HXMA 4X4YA 4YC2B 3MOAL 1ZLEA 4FTDA 3H54A 4PJBA 3L5WA 2C1OB 4PN6A 2X10A 1BBJA 2OQJB 5DO2D 5HYSB 5TQ0L 4Q8BA 4YHKH 3BQUA 5DD1L 5J12B 3KGTA 1E9QB 1HE8A 3FHQA 3STZA 1IU1A 3UTOA 3OAZH 1NGYA 4O5LH 1OTSC 3RWFA 3QEHA 1B9ZA 2WBJB 3DKHA 4CGTA 5DJDA 3P9MB 4H5SA 2IALA 3O0LA 4DP5X 4KK9C 4R8WL 2WLIB 3T3MB 1ZT1B 1F00I 1DQQB 1SMAA 4L5FH 5AZ2L 4X5WB 4OI9A 3P3UA 1OGTA 2ED8A 4RMSA 4YBLB 2I60L 1QABA 4PJFF 1FNEB 3FQXB 3VW3H 1A1OA 5LN8A 3NK3A 1U8HB 4UF7C 5SV4A 1BCIA 1PZ5B 1OB1A 3FU6A 4PP1D 4WIQA 3TEXA 1TU2A 1U9KA 1K9TA 5FCSH 2ZWKA 3IFLH 3NACL 1E2ZA 1KJVB 3IDMA 3ZLQC 4PJHF 2WXRA 3AWGA 3L6FB 5SWZB 3TZVD 4DUXA 3IDNA 4LSRL 3PFQA 4P5KB 4JR9H 4PJGF 5CLZA 4MAYB 2H3XC 5LBSH 5HBBA 5C08A 3VFWA 2BRRH 1KPVA 1PCXA 4UZSA 5ALCL 5CJQL 4DKFH 4PJIB 5JHAA 5CEYB 2CK0L 4PG2C 5C6TL 4LOUC 2HP4A 3MBEC 1Y18B 2CAKA 2OX5A 3HIZA 2AEIT 2C4FT 1I1AA 1P1ZB 1WBZA 4NKOB 1WD9A 5F1NA 4LB8A 5A40E 3W11C 3QAQA 4LCYB 3EJYC 3QORC 4DK5A 1ED3B 4W6XB 2APXA 2A6IB 4A66A 3DX8B 1Z7JA 4YXLH 5HDOA 4NQSB 3WFZA 3NG5A 3VXTB 2ROYA 4A2FA 4HIJB 3BHBB 4AYMC 4IKJA 5I8KH 4XC3H 1K4DA 5CEZH 1I7UB 4MNQA 2FWUA 1CGWA 1F1AA 4G2AA 4HK3J 1GMIA 1L0XA 5KYYB 2W80C 3H9HB 1FH5L 2NUTB 4AQOA 1G1OA 1YEFH 1NIAA 4JFXB 4OIAA 3R06A 3G5YA 5I5MA 1JNJA 3KPSA 2OMUB 3VGHA 1L6ZA 3B2UC 5ISZA 5IJCC 4D0BA 4V1DB 3IDYB 5KYNA 1MY5A 1UOKA 2Y1AA 3N85L 3WNJA 4WTZA 2DEWX 4EI5B 1AGFA 1ACZA 2ZQKA 4YVUA 1XGPB 3VG0L 1UFUA 5E4AA 4GG6F 1RIVH 4LF3A 4LRNH 5IMLB 1T1XA 3QIBC 3S88L 1TZAA 4NQDD 1PZUB 4E9LA 4F3FA 3FXIC 2ESVE 3VXUE 5KBKA 4LHUB 4KMQA 4RX4D 1HTYA 3O9WB 4M7JH 4YSEA 4EOWL 3VWJB 1EZLA 3LQAC 4P23D 3CSFA 3EAKA 3JWOH 4KXZI 3BN3B 3P4MA 4F8TA 3H2QA 2JCCF 4XPGH 5E99H 4QPEA 3V4VL 5IBLD 1NGZB 4K9EH 2VDML 2MKLC 5C0IB 1NGQH 4B9JA 2ICWB 3U0WH 3DYOA 1X5IA 1EAPB 4XGZA 1OP5K 4KZDH 3V4PH 5C0EB 3ZL4L 2AEOA 2IG2L 2EDTA 3QNXA 1AYRA 2VABB 3N1QC 3QR0A 4FKKA 5IB5B 5DHDA 3O2DH 2MKWA 5AAMC 1R47A 1SLUA 4I18B 4APQB 5DLMH 1TCMA 1HL4A 5FYJU 4YX2H 3JUZA 3UZEC 2A74A 2QKIC 3ATFA 2AXHA 1MIEL 2X9ZA 4QHMA 3T65A 3UBHA 2WTOA 2ZOOA 3NCJH 4R4ND 5DT1H 4KZEH 3CWGA 4GFXA 1DBBL 4HIIB 2EDEA 1KPUB 3R8QA 2X1XR 5EOCH 2GABA 3I3BA 1WEJH 4JMXA 1OF2B 1XF3A 4N2FA 2AEQH 4MXVF 4KWUA 4WI0A 5JIHA 3ZE2B 3J2PA 4CKVX 1V7ML 1NC2D 3V6BR 2YRPA 2BOBB 4R3SB 2CBPA 4JFOA 1VFMA 1TZGH 2ZSVB 3UBXA 5FIEA 5DCCA 4GAGL 4QXUL 3VXNB 4EAEA 4EN3C 4AJVA 1JNHA 4GFTB 4JS7A 4BEIA 2WOBA 1JYWA 1F45A 4GIOA 4JHBA 5ETUB 3TBBA 2YUWA 4G8FA 5L2JB 1ZANH 3ZO0A 4PGBA 1L9QA 5KTEL 1NDGA 4PI0A 4IOFD 3P0GB 1HSBA 4NQEE 5IT2L 1TJGH 4F5CA 2CO6B 1UM5L 4K94H 2H2SC 3MRIB 4RRPM 1RKRA 4Y4HC 1QAWA 1WYJA 3BE1L 4WDIB 3PL6D 2Y3AA 4F7CA 1YQ2A 2FATL 1TMQA 4FYQA 1NDMB 1IT9L 1Q38A 1RJZA 4QJ3B 2EXWD 3BH9B 3ARFA 2R8SH 3NZHH 1EFXA 5AD0A 3WNPA 5JPMC 4MX7B 2AHIA 3OZLA 1G7LA 4U0QB 4MWFB 3B9AA 4AH2A 4G43B 1UXSA 3GMPA 7CGTA 4WTQA 1R9FA 2DQMA 5E6IC 4K2UL 4JHWH 1DBAL 4AMKL 1CFNB 3MFFB 2EDMA 2WZPA 3ZT7A 3RGHA 1IFHH 3DHPA 1L5GB 5JXAH 4WU7B 1JFHA 5E9DA 3QXVA 2ADYA 1U21A 4PRIE 3VXUB 4EUPA 5GGQL 4X4MA 4H8QA 3LRSB 4LKXA 4LNRA 4P04A 2TAAA 5D4QA 3STLA 3TJPA 3WN5A 5MENB 2F8OA 3WFCH 1KLFB 3NIDF 2CR6A 2E6PA 4R6UA 1YC8A 4WW2B 4RGND 1J8HA 4UQBA 2WKGA 4RMUA 3E6FA 4PUBH 5AWNL 4GMSH 2BWIA 2R1WA 1WV7T 2X0WA 5IEHB 3M8OH 5IMMA 1R75A 5GXBB 4XPBL 1A1MA 4AQ1A 3IPBA 5EO0A 4NI6A 1BPVA 3IU3B 1J48A 4AM0B 3T6ZA 5KYUA 5J1SC 3HE7A 3D07A 1LE5B 4H26B 4UB0H 4AM0Q 4K71B 5BZDA 2ZOWA 5K5YA 3KWWB 4ZX4A 1O7SA 5CGYC 2DBLH 3GI9H 2YQGA 1RJYB 2PP8A 4PMFA 4JREC 4U0RC 3W9EA 5AB9A 2DI9A 3I6LE 2ID5A 4MA8H 3T0AA 3SDDD 3KPQA 4PJAE 1D7DA 3WUWB 3QIWC 2ESVA 4N8VA 4L1SA 1YZZA 4IRSD 3VX0A 5CFAA 2IGLA 1DQJA 2RJMA 1PSKL 3VFNB 1B0RA 1GZQB 5CLYA 2LFGA 5K9OA 1TENA 2L8AA 3ULSA 2ZXCA 1QI4A 4Q6IB 4AYEC 3WEBA 2FRGP 1NTDA 3LIZH 4MB3A 2CWRA 3E8UL 5IEKB 3NFNA 3ETBF 4PJDB 3KPOB 4QRRE 4X42A 1TVBA 1KBVA 4P46A 2ZKHL 5FECB 4OCXL 2UVFA 3MJ8A 4HIEB 1G4RA 4BZ2L 4X7TB 3U0PB 4YHZL 2FB4L 3RZCB 1QPPA 3A47A 5EU6D 1U3ZA 3H3BC 3QPXH 4ZMQA 3KPPB 4F2MB 1NLDL 5F88B 4JZNB 5B38A 3TFKD 1IE5A 5F7AA 2O5XH 4P5TC 2XTJE 2J1YA 3L3OC 3SDXF 3BSGA 3ETBJ 1VF5C 5IFHH 1N0XL 4LQ1A 1YN7A 2WINA 4MDRA 1UACL 2Z65C 3FCSB 3RGVA 3ARDA 3ECQA 2E6QA 1FL5B 2P7TB 2HWZL 4XP1L 2EVHA 1G7HB 1S7RB 3G5ZA 2XWTB 3NA9L 5EWIH 5T3XE 1TJHH 4EF3A 3SDYH 5IBUG 2AITA 4M3KB 1S7UA 2XG5B 1F11B 4N0UE 3M1BB 4X9IA 3ZDZF 5LDSA 1IKNC 4FQ1H 5F72S 3KYMB 5ITFA 3QAZB 2NLJB 4QXVA 4PWJA 1MCLA 1YDPB 4P49A 2ICWI 2XV0A 2BCKA 4Z95L 3WFBH 2AJZA 2DY2A 2IANA 3N44B 1PYWB 2RQ8A 5LQBL 2BLFA 4ZS7L 1PKOA 3SZ6A 3D39A 1YEKH 3L95B 4U1JB 4H20L 1CD9B 3R0MA 4Z3FA 3QS3A 4U33A 5AW2B 2J71A 3P3TA 3HMWL 4NQEA 5C0NC 4MD5B 2P80D 1CFVL 1T4KB 1WUZA 2VITA 3ALPA 3FUEA 3NSFA 1UG9A 2DYPA 3HJ0A 4S2SB 5BCAA 5IV2B 4Y5VC 4MA1C 3MV7E 3R4RA 4JQXA 4PJCE 2DQJH 5ESQA 3U0TA 3TNNB 2AKRB 1MUJA 1CB4A 4AL8H 1D5BB 1PVHA 4G3YL 1I75A 2H6UA 1TR7A 1X7QB 3LN5B 4X6EA 3II3A 2XQYK 3C08L 2EZ0C 5F7UA 1Z5YD 4LGPB 3O6KH 1BMZA 3HE6D 4KXZH 2VAAB 1ZHLB 4JHAL 4XMTA 3C5SA 3MA9H 2D7MA 2SEBA 3K2UL 3M1OA 4HZLB 4N4YB 3OAYK 5LNDA 2ENPA 2GJRA 4PTUA 3TVMA 4LKCB 1T20B 3CH1A 4KROC 1X4YA 4IBVA 2H26A 4R4BB 2GW5A 2KL6A 3OXRB 5FOJA 5AZEL 3ZDYF 3MJ9A 4LLWB 3ILDA 2NX5A 3LDBB 1JZEA 1PL3A 3GIZL 4WI7A 1JZIA 4KNTA 1CK0H 5KSAA 5E23A 3FNKA 5CU5A 2BNQA 1N3NB 4WY7H 1AXIB 2QSTA 4PRIA 1IC5H 1NMBH 3NJIA 3Q2LA 3GBEA 3DURA 2HN7A 4P57A 4KO6A 3T04D 4AYFA 1DUZA 4PRNA 3BQUC 4LOVA 2H32H 3AY2A 2HG5B 4B0MM 5J13B 1JFQH 3OWRA 4WF7A 3UAJA 3GMRB 2ORBH 4LEXL 3TBCA 1YECL 3FN0L 4HYTB 4NWUH 4QRRB 5IB4A 5DZJA 5JHMA 3L1FA 5AUMA 3NK4A 2Q7NA 2VJ8A 2X4QB 3VFPB 1A6WH 1DBKH 1KJ2H 3L4XA 4PS8A 5DJZB 3IWVA 3D4CA 4OD3H 4FTVA 4DP9X 3S35X 2HMID 4N0RA 2XTJB 1SYVB 4HKBA 5ID1A 1NAKH 3JV5A 2DMHA 4MDJA 2Z34A 3I9PA 3U46A 5G5DB 5A2BA 1X5KA 4M02A 4UTAA 4UAOC 3T2OA 3SQOH 1RUAL 5FA3B 3NAAL 4RZCA 1CDUA 2ARJA 4ABQA 2A1WL 2YD3A 2NY4C 4LLDA 2P8LA 4K3DL 3MKGA 1JHKL 1T83A 3WAKA 3TP4A 4N0UB 1KTKE 3RTQA 1OAYH 3CE1A 4XZ4A 2EXSA 3BUDA 1CXKA 4KK6D 3E1F1 4QCIB 2QPEB 2E56A 5J12C 5F0LB 1HDMA 5EG6C 1ZVHA 3P4OA 4N8CH 3DJTA 3WFHA 1I1AC 4RVBA 2VDKL 3WIHA 3K6FA 1KPRA 4NRXB 3W0WE 2AXFB 3OJVC 1EJ6A 5EEVA 1MY7A 1INDL 1B3IA 5T1DL 5CIPB 2YD7A 1JG9A 2O6DA 1LK3H 4NKIL 3U4EB 3LKPB 3J07A 1TZIA 2A9NH 1GZPA 4DPCX 2OI9B 4PJCB 5HTSA 3UEZA 1HWGB 3K6IA 1LP9A 4LOEA 3JWDH 4TUJB 1DVSA 1A7OL 3C5XA 1GAFH 3B9DA 3ERXA 3SPVB 2YA0A 2CRMA 4HCFA 1HYSD 3T1FB 5LHDA 3GSNA 2OMXA 1WFJA 5B1BB 3K72B 4JRXD 1KEGH 4Y19D 1TKWA 2W0KA 4XCFL 5LAXB 3L2LA 4U6XA 1MHHA 3VACA 4A6YB 2JI3A 4Z1PA 2C3HA 3PWUA 1U33A 3OKKA 1YEHH 3DDFA 5IB3B 5IROD 2FBRA 1WHPA 1J5IA 3MRMB 2VQTA 2LVCA 2Z8WC 1DQMH 4FJ6A 5JTWA 1OF0A 1R5VB 4M1CD 5GRUH 2XA3A 2OYLA 4HKJB 2XWCA 4WKXA 1TETH 3POHA 3B34A 4BCZA 2VJXA 3LKQB 2LLLA 3KNBB 2G0KA 1WK0A 2CBOA 5AKTA 4E9VA 2E6JA 4NQXA 3BD3A 2P45B 4XODA 4ZAKA 2GCYA 3L1OH 5DA0B 2VLJA 3D4YA 4K55A 1E6JH 4JKKA 1DJXA 3L3DA 1FHNA 2GHZA 4P3DB 3WTWA 3MV7A 3JYCA 4LU5L 1FGVH 1CLOL 1JMXA 3WJMA 3EYSH 5D2NE 1BAFL 4XN2A 3VXOB 4UOZA 2GB2A 3RDTB 3VXPA 1KN2L 1XXFC 1EXHA 4FQHB 2OJ1A 3GXNA 4IRJB 3MRCB 5I71B 3CDZA 4ELDA 1U8KA 2IBGA 4D9RD 2I9LA 3UJTH 3RX7A 3IJYB 1KG0A 2EC8A 2BOCB 4D0DB 3WTYA 2V9UA 2X3AA 1XTLA 3HB3B 4FXLA 4L8BA 4R7DB 1BM3H 4L37A 4WENB 4A1RA 4ENZA 3P2TA 1IV8A 1FYTA 1G7PB 1GPOH 2AK1L 3MKKA 4Y8AA 3BI9X 3I74A 3QJVB 4YDZA 3GBMH 1AGDB 3VFSB 2Y1VA 5LXVA 3FOMA 3MV8D 2TRYA 4D0CA 1N2RB 3O9WC 3LH2L 1W15A 1KENL 3MDJA 2IV8A 1K8DA 2C3GA 4I77H 1CDHA 4P99A 1OM3H 1E90A 3INUL 1JZ3A 4WAFA 3QNZB 1VADA 1XIWA 3RL2A 4OSUL 1P4LB 3WGUB 4IDJH 5E00A 4H25B 2K9FB 1MFBL 3NJJA 4DGWC 3TCLB 4L5FE 3TC9A 2PYED 1DR9A 2WZ0A 3MC0A 4OH2A 4DKTA 1FL6A 3W0WB 1SOSA 2A3TA 3TEZA 2CPCA 4IW4C 4U6VL 3MGOB 4HHAA 4JRLA 2BMKB 3ZU8A 3GRWL 3RY5A 1IEAA 3QIUB 5GGVY 2EDRA 5B4MD 5JHDE 3MTRA 4MMYA 4I18C 3WE1A 3NH7L 1ID2A 3DUHA 3VMOA 4OCRL 1YPZB 3O11B 2PETA 3OHMB 3PWPD 4Q9BA 3EOBA 2AK4A 3QA3A 4OJAA 2EUXA 1JV2A 3ARFC 1YQVL 2L7UA 4YIQB 1T6WA 2EH7H 3O3AA 4L1LA 5DMGC 5KYWA 1URZA 5C0RL 3JZ7A 3AT9A 1HCYA 3NJXA 2ZE0A 5JLZA 1MW0A 4HS3B 1ZVYA 2RHEA 2XU9A 3V6OA 1EUUA 4DEWA 3GGWA 1X9QA 2K6YA 1KLUA 1KB5H 1NAMB 2A0LD 3BUIA 4J3BA 1PY0A 5I6LA 4UQIM 4XCNA 4ZFQA 3C6SB 3VXRD 1B4TA 4P59L 5L4JA 3DJ9A 4CVXA 5ICYA 3FHEA 2F18A 3IGAB 5KVEL 2YIHA 3WN5C 4CMMA 5ADPL 5IF0B 1S8DA 4UT9L 2UX6A 5C0JB 3X1BA 2BC4B 3KDMB 2FR4A 2HFFA 4AK2A 2LE9A 3ML8A 1MIML 3T71A 5JOFB 1HHIB 5CILL 2LFEA 3VD5A 2YC1A 4QYOA 3UMTA 4OZFA 5DQDH 1G6RL 3FT4A 4UTBL 4XXDA 4KK8C 2P43B 1A7NH 3VD9A 1P1VA 1INQB 1RU9L 3MLSL 3LEYH 4XVSL 3GEFA 3ZTJG 3F7LA 1S9XA 2APWA 4H40A 3FH7A 2O5NA 2CUMA 3DGDA 4AQ1C 1PFOA 3S2CA 1ZLVH 1ZA3B 4R96B 5DUJA 2ZUUA 2WIIA 5GGTA 4M9PA 4PLKD 2VR5A 3KS0J 1I7RB 1NKRA 5INCA 4LLMB 5HHNA 5IQMA 5ACMA 3RVVC 1ZOXA 1E3ZA 4ONOA 2FT6A 5D8JL 1LO4L 5I76B 4D9LL 5D7IB 5EU4A 1N5AB 2J6EA 4TF4A 3UAAA 2YPKB 4RRPG 3I50H 2YKLH 3BKJH 1RULH 3K0WA 3CFBA 1VSCA 2H6PB 2DQFA 2FVNA 1QLEL 1SDAB 4XN4A 2BP0A 1AOHA 5CJ8A 1U8PB 1U8MA 2F6AA 3OR6A 2WYIA 1FA4A 3H9SD 3ZE0E 2DLTA 4UM9A 5CP7A 1KXHA 2A73B 3AZUA 5CN2A 5LXGL 4TSBL 4RLDA 4P46C 4DGIH 1JZ6A 2VH5H 4W81A 3ZHLA 4YBQC 5DMIL 1R5IB 1CLCA 2Q7YA 3SYCA 1W72H 1IEBB 1M1XA 2Z64C 5G2NA 3A23A 4WGVB 2CNYA 5HHXH 1QLRA 1N4XL 3G6DH 4K07A 2ODHA 1DANT 1E30A 2G75B 1BOGB 3HZ3A 1IFGA 1XF5B 3KYNB 4Z5RA 1FFPA 3N06B 3QZWB 1W0WA 2DKMA 2X4RB 3DI3B 3PAUA 1OP9A 3HG5A 1F86A 4JO3H 3VRIA 4D8OA 5EEWA 4HGWB 4K15A 2BY0A 2N7BA 4P5RA 2DKUA 3BAKA 3US9A 5DR5H 1XEDA 1HSAB 2YWZA 1N0LA 4P07A 1RI8A 4JO8A 2A83B 4J3OG 4KV5F 4X83A 5K69A 4HBCL 4L18A 5F9WC 2J44A 1JWMB 1IAIL 4XNMA 2X53A 2CCVA 2VQUA 3AS0A 1ETJA 2Y3NA 4G72B 4M62L 3UYPB 1UOWA 2DWDB 2O72A 3GINA 3I6KA 2DMKA 1WFOA 2NY5C 4FI8A 5KZCD 4J5VA 3VXMD 3G5XA 2AQ2A 1BLIA 1PTZA 2X70A 2P46B 3MFGB 4PS4H 3BSHA 5DQ9A 4O51A 3FRPG 4K3GA 3V9CA 3MV9D 2OMYA 3GDCA 1B0IA 4Y4KA 3W82A 2O6PA 5AW6B 4B0MB 2JIXD 1YNLH 1L9TA 3RZCC 1I9RL 1RZJC 2YD4A 4XBPB 1H3VA 1LXMA 3IM1A 4JQXC 5JHDA 1CDIA 4GQZA 4MCYB 1NBCA 1U8JA 3HG0A 4YGVA 2EDFA 4LBAA 5INDB 3AMLA 2MCAA 3RVXD 1Y0LA 2IIJA 4JDEA 4AV5A 3FQNB 1FFQA 1JGDA 4YR6A 3KBPA 4XNYH 1UH2A 3QJFA 1N5YL 5J9PA 4PEEA 1GGUA 3QUGA 1J12A 4Q14A 4R26L 4KQ3L 4ZUUB 1FFOB 3CFUA 4GXVH 5LBSA 3LS4L 1LE9B 3ARYA 1P9MA 2Y5TB 2DF3A 4I87A 3U25A 2AV1B 3SE8H 3TVMC 4PVNA 3V6FA 1OGPA 2OMZA 1G5GA 4RGMC 4HG4J 2EAEA 4KFZC 1WCBB 4B3VA 3KGUA 4RFNC 4NCC2 1KUMA 5DZOA 5EEZA 3EYQC 3U1SH 1VFAA 3H56A 1UQSA 3UTTD 1FVEB 5HGDB 5BOZG 1BAGA 3FFDA 5FYJH 1Y6KR 2XFXB 5EZJB 3VFTA 4NYLA 4PM1A 5MEPA 2NSQA 5IVZA 5TH2A 2NXYB 4JY5L 2NMSA 3RVTD 3G04A 3RVUD 3BLBA 3ZE0B 4QTIL 3UAJC 3ARBB 1NEZG 5F3HB 4KK5D 4FQ2H 4FJZA 1CGUA 3VA6A 5CBEB 1K3IA 4WU5A 4OBRA 2ALWA 4PG9A 2BVPB 2GIXA 1E8YA 2AQNA 2IAMA 3KPRE 5E2TH 1NUDA 1AIZA 5GHWL 1HOCA 3TH3T 1E9PA 5AVWB 4L9DA 4M5YH 2DLFL 1MW1A 5T33L 4B7IA 2J8HA 3H2PA 1UYWH 4MNHA 4WFGD 1IGJB 3L17A 4XX5A 1USQA 3QJZA 1NCCH 1S7SB 1ZE3H 4KO9A 5IIEA 5L2KD 3FSWA 1MELA 4PV8B 2LTQC 1DJHA 3DK0A 1R0AL 1CGYA 4KJYB 5J11B 2VGLM 1SBBA 2AJYL 3LDBC 5IB1B 1NCJA 3HFFA 4KBPA 4P8QA 1WT5A 2R39A 4KKAD 4MLSA 3S37X 5EN2A 3L1EA 3FO9B 1RJLB 5IBTL 2BHUA 5C7XL 3T0XA 1AY1H 1QFPA 2EKSB 4NXKA 3AQZA 2FSDA 3RTQC 4ZTPH 1FJ1B 5J13C 1P0SE 1RV6X 1ETZA 1JYXA 1C5BL 2O61B 3OV6A 1FZMA 4N90E 5DVKA 1TO4A 3RI5F 4JPVL 4KITB 3VNYA 3JWNG 3NZUA 3NSCA 3SKMA 1XGUA 3GZQA 4BGDA 2DB8A 3O2DA 5I0ZA 1T0MB 4OJDH 1RIHL 4PJ8B 1QWNA 5JHBA 4OF7A 1F3JB 4GRMB 5B22A 3WO4B 4J3XA 1GGBL 1JPGA 1NIBA 3VU1A 1QO3A 5CWSB 1C16A 4K8RD 1O6SA 1DJZA 4DOHE 2XTJC 4W9LC 1R3JB 1UWFA 3FB8B 4L4TE 2NRDA 4G6KH 1XWVA 5KVFH 3HNTL 5KBMA 3A67H 2F54B 3FKUS 3CZSA 3EZ8A 3MXVH 2VSDA 5AAWA 3MLTA 1WAPA 3ATDA 1CBJA 3BZDA 3ULUD 1MQKL 2GY5A 2IGTA 3ILPB 1NGWA 2KBGA 3GBLA 4MCZB 5DRXB 5DFTA 5CBAA 2D7PA 5C2BL 4FAAB 2VZUA 4TNVK 1FDLH 4ZO8A 3SGEI 4LEOA 5EOQL 4NKMA 4ODHL 3DIFB 5I18H 3ZMEA 5CKGA 2VC2L 3LRMA 5C70A 2X4PB 3LEXA 4U3SA 1ZA6B 1NICA 3B6SA 4NNYA 3WFEH 1E4JA 4F7PB 1OVZA 1OAUH 3GO1H 3JTSB 2BIMA 1R3IH 5CZRA 2E7HA 4PLJD 1MFDH 2HZHA 3AS1A 3GXTA 1MEXL 3MZTA 1ROCA 3S34L 2X6BA 1DVFD 1RLBA 2AXJA 2QHLA 1FLTX 5IFAH 1FC2D 2XYCA 3RNKA 4ZAKC 3KPNB 1K3ZA 1HZKA 2IH3B 3KPLA 3O3UN 1AKJD 2YARA 4YDVB 3NCYP 3KL3A 2H1XA 5LGJB 1FLRL 3U36B 1G9MC 1BSIA 4DVRL 1TLMA 2F5AL 1VKXA 4HT1L 3EGXA 3D2UA 3ARGA 2DMBA 4TRPL 3RWHB 1A7QH 1YJDH 3ECVA 3TU6A 1P5VA 4HSAC 3U4BL 3EG9A 1JI1A 4YJZL 1SUJA 1L6PA 2AS5M 4PJXE 4HMCA 2BJMH 3KPRB 1OAZH 1XF4B 2JXMA 3B83A 3CZJA 1E43A 1MZZA 4ZT1A 4ZUTA 4MJHA 3FOLB 2WQXA 3VVWA 5GS0H 3S3JA 1DHKA 1OTTD 1BF5A 5FYLE 2XZQH 4PY7A 1XR9B 5CHNA 3TZVB 2ITDA 2I85A 5DDHA 2W81C 2AGJL 4S0SD 3CSYB 4HIXH 5LCVL 3CXDL 2R0KL 3ZR6A 3L3GA 3SDAD 2K6WA 3MHZA 4RAUB 4JFZH 1NBZB 2ZAIA 1RUML 3TN0A 3E2HB 3T2NH 5F3FA 3IBOA 2I9TA 1KCRH 3X11B 5F3BA 4YXHL 2BSED 5DZVA 1TJXA 3GB7A 1SLXA 1DO6A 3I85A 1M2VA 3M07A 3I75A 2PWDA 4TQIA 2OR8A 1QYGH 4HK0A 4QRPD 3ZTJH 1AACA 4JANA 2NY6B 2D7TH 3EW3B 5DFVD 3UJIH 2IPKB 4NQCE 3VGEA 1NUNB 1XSJA 3TYFB 4W4NA 5CJXA 4LT7A 4MJ6A 4HHGA 4QLWA 4IRJC 4M61B 1J1PH 4Z8FH 1PS3A 5I71C 3NUKA 3U2IA 5HHQA 5CD3A 1P5UB 1SY6H 3SE3A 4YDLC 3RWGA 4XBGA 4DOHB 35C8L 1L4IA 3HB3C 4M3HA 4PIBA 4L4TB 1DN0B 3ROOB 4NC2B 2VXUL 1FRGH 1R3HB 5DYFA 43CAA 2WWKT 4B7LA 1IAIM 2X4TA 4PGCA 3SB3A 4PJ9A 3DTDA 2QV2A 1SJHA 2ZXQA 2EE2A 3P73B 4X9GA 5AYUH 1D7FA 1F97A 4GSQA 1AD0A 5L4MA 5FAAA 1OT1A 5K1NA 3AS3A 1VGEH 5CSZB 1YSOA 4N0FA 3O6FA 4EQ2A 4WWPA 5I5JA 4QLRA 5L88H 1BFOA 1QTYT 3LIZA 1YUHB 3LN4B 2WVSA 4WGKA 4LL9A 2QR0B 4JO1H 4JY4B 1A6PA 5D7SL 2PCFB 3GSXA 4L3EA 4BK4A 2WJ7A 4HOXA 1L9OA 1MF2L 4ELME 3WMQA 4DH2A 3TBTB 1LD9A 5I0VA 1W16A 3GZPA 3WTSA 4DN4L 4ZMWA 1KTDA 1MFAL 2ZJSH 4FMKA 1EZVY 4M1DH 1D6VL 4WCYL 1E4WL 2FIKA 1HE7A 5DJ2A 3MRPA 3L9RA 3DPBB 4I89A 4HSQA 4MB5A 5BRZA 4ODXB 2Q6WA 2GJ6A 4U6TA 4MJ4A 2O5ZH 1KULA 1IEHA 1AXTL 3EZJB 3VUAA 1FI8C 2KLRA 2X4NB 2X7LA 1OD9A 2CBTA 3GDBA 2XVBA 3IK2A 5TF1L 4PJXB 1OO2A 5CSGA 3RNQB 5FB8A 3NSDA 3IAGC 2GVYA 2AJVL 3UC0H 5D96B 4J3OH 1PQZB 1UXMA 4LLQA 4R2GC 3NGBC 2VKWA 1KBGL 4PJ5D 3H0TB 4Y7OC 2R29L 3MNMA 1MCJA 3MOAH 1S78D 1M7XA 4NO0D 1X5JA 4M8RA 4QKTA 1C5DA 3PV6A 1GOGA 1WLHA 2FO8A 5DTFB 3SZKC 3V9FA 3SO5A 4XNDA 2X2UA 4MSWA 4O4YH 1J11A 5JPNB 5FUZL 3VD1A 2CD0A 3TONA 2QQKH 5KVGL 1WE5A 5FM4A 4WJG3 4Z7WE 5DD1H 5GJTH 4Z7QE 4ALAC 4P2QE 3O2VL 4NAJA 3AREC 1H8SA 3VXSA 4NBYB 2O93L 2V6HA 1BZ9B 4FQQA 3HLKA 4BKLB 4LASL 5B3SB 5C97A 1QR1B 3BP6A 2VRQA 3T4AA 1Z9MA 4X99A 5D2NC 5DSCA 4F2FA 5CEXB 2I60H 2UYLA 2AP2A 2Q9OA 1N18A 1UCBL 4OV6F 2OMWB 2YEQA 3G08B 1WAAA 3PL6B 4U6YA 3RHWK 2CKBL 3AG2B 1VENA 2QVKA 4LQFL 2YPLA 4JRYD 3ECWA 4AJ0A 2GK0B 4FFWC 3S5LB 1QPXA 5AL8A 3GBNL 4JDZA 3OB0K 3HS0A 4B60A 2H0FA 3NACH 1MOEA 4H8VA 3TNMB 3X1NA 1T5XA 3ARRA 4X9YA 2OA9A 5EU3B 4GI8A 4NFBA 5F93C 2BVUA 3CVDA 4QRTB 3QEQE 2W95A 3L7EB 4LSRH 3KXFD 2X3CA 3FFCE 2R1YB 4HPHA 2V2WA 1J5CA 4N2KA 1BREA 2W0FA 3CX2A 3B3IA 3DBXA 3DOSB 3MRNA 2R2HA 1OGAD 4UYQA 3CDYA 2K1MA 3MSPA 4MMZA 3BWAA 5CJQH 5I1HL 3CHRA 1YNKL 2CK0H 3HAEG 5C6TH 1EH9A 3MUUA 3I9AA 2E46A 1ZGLA 1KXTA 2WXOA 2F1AA 5E6ZA 5EHFA 3BWSA 1J1XL 4QOKD 2NXZD 2VIRB 3I84A 4UU9A 5DC9B 5EZLB 3GSWB 1BEYL 3K91A 4RWHA 5AVSB 3VXQB 3WGVB 3LPFA 2RIKA 4MNGA 1BZ7B 4RGNB 2Q76B 1REIA 4ELMB 4ETQA 4UOW0 5KBPA 2AJUL 1CURA 3CN4A 4L8CB 4HJJH 1EZUA 4NQCA 4Y4KC 3ZKNC 3VD4A 2XXGA 4MJ5A 4QDGA 2VO8A 2R27A 4ISVA 3ZZQA 4AZ8A 4QHKI 2B9AA 3SGEH 2FLRT 2XFGB 4X80L 5CMAA 3RUGE 1JP5A 2C9UA 1GYAA 4K5MA 2WNKA 3B7RL 1M7IA 4XXCA 1FH5H 1SYSA 2BW5A 5DHVH 4PRDB 1KBBA 4K8RL 3FF7A 4DW2L 5D93C 3BVXA 2WNXA 1AJ7L 4PJAF 2E27H 1T04A 4RBPK 5BQ7B 5L0QB 3QS2A 1VZGA 3VG0H 4B5ZA 2W0PA 2JQMA 1P9MC 4TYUA 4NO3A 3NCYS 4NM8L 4PRPA 4DAGH 1T1ZB 2ZP9A 3U2SB 2QPFA 3BZFA 5AYTA 4APXA 3B1UA 3N2JA 1JIBA 3F05A 1T03L 3ECBA 4XH2A 3S4SA 3CVCA 4EOWH 3FTWA 1HL9A 3JWNH 3FQTB 4NAMA 3FFOA 3EJJX 4IIZA 5E9NA 2CHNA 3WNKA 4Z7WB 1A5FH 3H42L 4H0LC 4DUVA 3QG6B 2YO3A 3VGAB 4Z7QB 3FAXA 2NTSP 2AANA 2WYTA 4MA7L 2F7IA 3L3JA 1BQLL 5E4IA 1A6TB 5B1AB 3V4VH 1AZZC 1RZFL 3A6BH 4F7MB 4TVPE 5T5FH 1KB3A 2VDMH 1LP9F 3FO0L 1IJNA 1LMIA 2E7LA 5B21A 1QACA 4JM4L 3FBQA 5DD5L 2PKDA 5SWSE 4JKMA 3J8F7 4ZW7A 1EAOA 3IRPX 4JFFE 4OLWL 4EI6B 3AMKA 5C3IA 1MNUL 2R2EA 2XXCB 4YMPA 3QUML 1I1FB 1QSFE 2IMMA 2WSKA 5D1QD 3K6DA 3DX7B 1XVSA 4K3JH 5HVFB 3I9GL 3BKML 4LP8A 4MAUH 3HG4A 3L6FA 1DBBH 2VDQB 2GFBB 2CUAA 1T0NA 4MAYA 3QEQB 3T0VA 1ULVA 4N68A 4PJ7B 3CFCL 4X98B 3VRLE 1V7MH 3BDYL 3FRUB 3JWOC 2HT4C 3EBGA 1FO0B 1BBDH 1Q9KA 3EADA 4KH9A 3SGDI 1QA9B 4GAGH 1WISA 1J05B 2CHXA 4GQPH 4NKOA 4P2QA 3DVFA 2CBQA 3VCLA 4NHUA 3T2PA 4E42A 3DV6B 5A7BA 1ZSDA 2BNUB 4BIKA 4JFSA 4PJCF 4WI5A 3ARBC 3D4GA 4C83A 5F1IB 4HA1A 2QVTA 3CC5B 3O45A 4DPRA 3QUXB 3KBEA 4OZHE 1O7DE 1BVOA 1CFSB 3S8WA 2KMWA 1RUKL 4BSWB 1Z3RA 3OD3A 1MLCA 2PXYA 3ES6B 1FCGA 4TLUA 3A0OA 3UTSA 1O5PA 3T0WA 4ZOAA 4G8GA 1A8ZA 3BE1H 2YUXA 3OX8A 2WKOA 4P4KD 3IDGA 3WTXA 5E24E 1XZWA 2FATH 3GD1C 1DLFL 4OFVA 4C54A 4A7UA 1RK1A 2V3FA 1OQXA 4R97B 2OR9L 2DJUA 5JQ6H 4GRLA 2QLVB 2JQZA 1DQTA 1HAUA 3FCBA 3SSGA 5J11C 5F2FA 5HI3C 5C0BA 1BG9A 3FFCA 5AW9B 1AHMA 4U3HA 1DBAH 5EBMB 5FKAB 4HEMA 4BWTA 1BJ1H 2RQEA 1QQDA 3B2DC 5AOJA 1M6OB 1RK7A 3DXAA 2H2PD 4G6ML 5GGQH 4WK2B 3X14A 4AUJA 1MJUL 2Z92B 3Q8FA 4N2MA 2YQ3A 1KGJA 2BVOB 1A6ZB 2DMCA 4O2CA 2UZIH 2R83A 5A2FA 2A9DA 3SYPA 3QI9A 1FVDA 4K94C 4KKLC 4UANA 1JF5A 2CGYA 2GSIB 2MQCA 4FQXD 3T0EB 5HYJE 1M9WA 5AWNH 4PJ8C 1QBAA 4XNZB 3EJUA 1KGCD 4QY8B 9PCYA 5PCYA 3X3FL 5C0EA 2L04A 3MRDB 2NY2D 3RUGA 5F8RC 4R7LA 2BSDA 1HHGB 4MVBC 3SBQA 3ARGC 5SWSB 1JBJA 3ZZLA 3CFKA 2YUZA 4HPOL 3D1MC 5D1ZD 1EANA 2ZXAA 1A9EB 1ZGLP 4JFFB 3POCA 5CN1A 3TO4D 4XWGH 1I4FB 4DP1X 4I2XE 5EULV 1PF3A 1I8KA 4OKDA 1QSFB 1ACCA 2E9WA 4FLHA 1ORQB 2X6MA 1JZ5A 1MHCB 4NDMA 5FO8B 1KB5A 2JELL 4JHVA 3VJ6B 4QRBA 3PUCA 4LZKA 4U3CA 3KJ6L 4NP9A 2BWQA 3TT1L 1U3YA 4H88L 5I0YA 1YCSA 4WFHD 2B1OA 4M6NL 1D9KB 4HPYL 3GI8H 2RB8A 3TN0C 2ZSVA 3ESNA 3Q2VA 3IFPB 4E9SA 1PSKH 1RZ7L 2FX9H 3QCUL 4UQCA 3U30B 3C09B 2OP4L 5KN5B 4YHIB 3S3BB 1P2CB 4HJ0C 4P2OB 1QBLL 4GLRI 3MNWB 1OCZB 3CSPA 3E8UH 5DS8A 4MB4A 2FD6L 1JDCA 4NN6B 4HAFA 4KI5E 1BHGA 3II2A 2ZKHH 3LXAA 1G9NL 1F13A 1K8IA 4OCXH 4XHJC 5CSBA 4OZHB 4YHZH 1I8IA 5CJXC 1CD8A 5G55A 1NLDH 3QFJE 4JFEE 4WDIA 1GJIA 2WLKA 5E8EB 4XAKE 1OLZA 5DEFB 3WI9A 5ANMB 2IWKA 1N0XH 2ZSWB 3IXAB 3GJFB 5LLIC 3L5HA 2CUIA 3SE3C 3OL2A 4PJEE 2YOCA 3UYRH 2VRAA 2HWZH 4JRXB 4NM4L 3LH8A 4Y19B 2JB6A 2J1KA 1QKZL 3NA9H 4ZFOL 4BA8A 3VE0B 2B5IC 3BVDB 4I5BA 4GS7B 43C9B 1XTMA 4M9OA 3SE9L 3MRHA 2VT0A 3O6FC 4GUOA 3EYVB 3DHMA 4NZTL 3VDCA 5JIIA 1S7XB 4TQEL 1YG9A 4Z95H 5I73B 3HZVA 4GSDL 3HG2A 5I1DB 3BGMA 3FUIA 3SY0A 1E65A 3CQQA 5BZWB 2YLKA 2WWKO 2Z31D 5CO1A 3BZEA 4OCMC 4KVNL 3DHUA 3MREA 2NQDA 1MJJB 4WV1B 3S96B 2NY6C 3ARWA 3GJEA 3HMWH 1OP3H 4DQOL 1CFVH 2XKNA 3ZDWA 1W72A 1QZ1A 3GSQA 3IPEA 4MA3A 3DX0A 3HZKA 5J1AB 3ULVE 4FHBD 5I75B 4NNPL 1EEZA 4G3YH 4KJWC 3V9EA 3IU3A 3MCLH 3ZT5A 1P5UC 1ZIBA 5I66A 2WBWB 4AM0A 3FONB 4NC1E 1J8RA 5IY5B 5IHBA 4BUQA 1RUQL 4WEBL 4OGAD 4Z7VB 3TBYB 3K2UH 3ML9A 1N8ZB 3NRFA 4FG6C 1JGEA 3BDBA 4I2XB 4Q4IA 1ND0B 3V7AE 1ZHBA 2EIJB 4M03A 2H4EA 3A3YB 4L8SA 2A9ML 4OTXH 3TYGH 4BGLA 3TF4A 3RL1A 3MV8B 4IBTA 4FYRA 2OYKA 2WWOA 3D69B 4C4BA 4QD2E 5I1EH 5AVUB 3QDME 3HG1D 2WQSA 1IKOP 5EORL 3NESA 3IFOA 4NRZA 4M4RB 5MEQA 4DFIA 4L1DA 4ZXBD 4PWKA 4JX0A 2XPYA 4N0CD 1R6VA 1A66A 4KAQL 3D4ZA 1RK0A 4PJDA 3U82B 4Q9RL 1UB5A 2EEAA 3S98A 5HYJA 4BK5C 4ZMNA 5FECA 1YECH 5EZOH 4LESA 3VQLA 3FN0H 4ZNEE 4AL8C 3GM8A 2E7DA 4TUOA 3GT6A 4TNWF 3VFVB 3T4AC 4RNRB 4ANXA 1PZ3A 2WSPA 4JNXA 1G7IB 1EDQA 1H8NA 3QJHA 5E2WH 3NSYA 4GT0A 2ALAA 3RGBA 4UT7H 4BZ1L 2YA1A 4S1DC 1XFPA