3QW9A

Crystal structure of betaglycan zp-c domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
170
structure length
170
Chain Sequence
PNSNATFNMELYNTDLFLVPSPGVFSVAENEHVYVEVSVTKADQDLGFAIQTCFLSPYSNPDRMSDYTIIENICPKDDSVKFYSSKRVHFPIPHAEVDKKRFSFLFKSVFNTSLLFLHCELTLCSRKKGSLKLPRCVTPDDACTSLDATMIWTMMQNKKTFTKPLAVVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming growth factor beta receptor type 3
publication title Structure of betaglycan zona pellucida (ZP)-C domain provides insights into ZP-mediated protein polymerization and TGF-{beta} binding.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cytokine receptor
total genus 29
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qw9A00
3NK3A 3QW9A 3NK4A 4AJVA 5BUPA
chains in the Genus database with same CATH superfamily
1CFTB 1Z1WA 2JIXA 5D7LB 5GGSY 3O4LB 5ID0A 5DZAA 4PJ7F 3Q2CA 4MXQC 1W6LA 2FBJL 1N5AA 2OMTB 4J6RL 4YDJA 1TZHA 2WWNA 1NH6A 1E9QA 3DIFB 3L3JA 2BC4A 4JE4B 3HG1D 4M5TA 4HP5A 4TN9A 2CALA 1VPOH 2EXWC 2CG9X 4OV5B 1A7OH 1NAMH 5I8OH 3OLGA 4BGDA 4AYDC 3R19A 1Z3GH 4U1MB 3VXUB 3MFFA 1HHJB 3B3BA 4OZFH 3BWAB 3OHXA 2FX8L 1NMCB 4XCNA 1N8ZA 1ROCA 3WXVL 1PY4A 5DTFB 3ATDA 4A7TA 1CGWA 2QKIB 3CUPB 4GO8A 5FGCB 5IJKC 3QUHA 4OQTL 5I1LA 4GFTB 1WS7A 3E3QE 2QKSA 2IGFH 1Q90A 5J3HC 2H0PA 2WTPA 1NCCH 1I1AC 3E9UA 2RR3A 2JLLA 1NAKH 5D5MA 1KTRL 5K59E 4JPSA 3JWDH 1U92B 3QDJA 1EJ6A 3B9AA 3PWPD 2YSTA 4FCAA 3ESOA 4ADGA 3KNBA 2ODHA 2UX6A 1J1XH 5HYEA 2H41A 1FO0L 2UYLB 2X4SA 1W0WB 1ACCA 3AABA 4HQQL 3NIDF 4I89A 5DHVH 2AAVA 4HZLB 2WSKA 3GJEA 4JY6B 4LQ1A 4PG2C 4P99A 1MRFH 3OQ3B 5FA3B 1IKOP 5CEZL 1NBYA 3FFDB 5AW9B 5IW3A 5SX5H 3GI9L 1G7PB 3B56A 5J6HB 1BD2A 2CDGA 3QQ9C 1DVXA 2XHNA 3DOSA 3QIWD 4P2QA 4QXTA 3IFLL 4N0FB 5DMGC 3RB5A 4AG4L 1U8PB 4Z7OB 1ORSB 2CRMA 5BMFL 4WO0A 5DURB 4HEMA 4L37A 1A25A 3HJ0A 4LCYA 4Y5VB 4X6CB 3SHSA 1ZJAA 3CCHA 5F89A 4WFHE 2B08A 1RZ7L 2I32A 3GLDA 1CO1A 4YS4A 4L23A 3ARGA 3PQYA 3TN0D 4HG4K 5CBEA 3PCYA 3RWDA 4WZ9A 2VUKA 4F15C 2V7NA 1F13A 5D1XC 2IFFH 3CSTA 4O4YL 3QZMA 4LLQA 1CLZH 4TLUA 4JKLA 3L7FA 4LPTA 4GXUN 5EN3A 3N55A 4L4TA 5TDNB 3ABGA 4I77L 4P5SA 5DJ8B 2LVEA 2BIOA 1NKOA 3QZBA 4KUCF 4NQCB 4B96A 4WHTB 2NDFA 2C1PB 4M6NH 1M6UA 4GY4A 5IUCA 5JPNA 3DV4A 5KYNA 3T09A 5KVDL 3RPIB 4XVJL 3DXAA 3ZR6A 1FH5L 1KGCE 3P40A 3KLQA 3AITA 2F8OA 3STLB 1N68A 1PCXA 4R7DA 3LD8B 3HBPA 2WXOA 4HV8A 2PW2A 2FJGA 5ITBH 4RAHA 5EU4B 4MJ5A 4ZUWA 3WEXB 4DAGH 3RVXD 5KJRL 2E6PA 1ZTXL 1JWMB 3EDFA 5CJOL 3A0OA 4UOW0 3RURA 4I0PD 4IMLA 4JPKL 5F9DC 1FZOB 4ISVB 3DK0A 2UZIL 4WW1B 3ULUC 3O9WD 4LPYA 2NY2B 4JKKA 2ADFH 1I3RA 4JRXB 1G9NL 4ZMLA 1JGDB 1D6EA 3ECBB 2DLFL 2D9CA 1XGZA 2EABA 1NMBL 1HZLA 3BP7B 2ITDB 3QUYA 1MXGA 1ONQB 1U42A 3ZYJA 2E27H 3OJ2C 3C8KA 4HCRA 3KBFA 1SBSH 4M48H 1OAZH 4X8XA 1XD0A 1P7HL 2BSRA 4UQAA 1HHGB 3T2OA 4IOFD 4O51A 3ARED 5EMYA 3C6SB 3CZNA 4K8RH 2XZAL 4UTAA 2VB5A 5C0DA 2NY6B 4B50A 4KK8D 1IE4A 2ISDA 2OTWB 3IYLW 4EIGB 4AQEB 3GF8A 2WV3A 1UJ3C 2NXYD 3EAKA 4PVMA 3S96A 1BMWA 2D0GA 1MEXL 3UBXG 5IB3A 4F9LA 5EEXA 1U6AH 2ADJA 4E9RA 1XGQA 1N6QL 2X4PA 3M17A 1G6RH 1E4WL 1F4WH 4QRUB 3IDJB 4NZRH 3DJSA 5IFHL 3OKOA 3KS0J 3FCBA 1AXSB 4OZHB 4I1PA 2YQBA 3S2CA 1LDPH 5GRYA 1J5OL 1Z9SA 1V3MA 3B6SB 4ZQKB 5DXWA 5GPRA 3P73B 3QZWG 4XNYH 2QR0B 3CFQA 4N6QA 5CKGA 2ZUQC 3KPMB 2QMJA 3EHBD 4BKSC 1RJLB 4MCNA 5TQ0H 1OXYA 4KKCD 3AS0A 2A73A 2ATKB 3U7WL 5BUGA 1D7BA 2D03H 5CJXC 2YPVL 3ABKB 1A4KB 3DSNB 4JFEB 1U8JB 4ZUSA 1VEPA 4Y88A 5CR8A 32C2B 4MRBA 3R8BB 5AB1A 4ZX6A 5LLIC 3PGFH 4NZUL 4LLMB 3PLYA 5FYKE 1Y6KR 1DQDL 2X4NA 2UWEA 4YHMH 3BKYL 1TFHA 5DDHA 2ZUYA 4WK2B 1G1OA 4PJHB 2K4AA 4UILH 1QI4A 4YAQB 1O75A 2PCPA 5F9WC 1V27A 1GW0A 2DW5A 2MKLC 3HN3A 3QIBC 4PD4J 2A77L 3BEVA 1X7TA 3BKMH 2WN3A 4ODXB 5D96C 1DTUA 3VRIB 3UADA 1UM4L 3QFJB 1NCHA 3MNVB 4Y8DC 1RJCA 1HCVA 3UTZA 3U7AA 2YMXH 3HNVH 4R4ND 3QO0B 4NO2B 2EEDA 2VQ4A 4X42A 4RMTA 2HAZA 1RIVH 1H9VA 1OTUC 4Y4KC 5JHDE 4PJEA 3QCTL 1RZKL 1D5MA 2OW7A 1RLBA 2XVKA 3GS4A 4AC4A 4D9RD 4OZIA 2EE0A 4JJ5B 3LXUX 2W59A 4X8CA 3FO2B 5CS7A 3F83A 5CP3H 1LGVA 2CO3A 2QVTA 1A4JB 1HXKA 2DI9A 4X7SH 2CPCA 5HPMA 2XWTA 1CI5A 3WO4B 4L4VB 1ZA3A 4TF4A 1YJDC 3VWJB 1RP8A 2HLAA 1CD9B 3OKYA 5C0AE 5KSBF 1MCSA 1A5FH 5B1CA 5EZJB 1FVEB 1K8IB 4OZGB 3RKDC 4YMPA 4R7NB 1LEGA 3FUDA 3HC2A 2A9NL 4MA3A 1JRHH 4OCLC 4ZTOL 3G08B 1JGUH 2X4RB 4ABVA 2VLJD 3NFPA 4OQTA 2ENPA 3B7TA 1RUQH 3V0JA 3QXAA 2FK9A 4QXUL 2WM0A 2VABA 1YEGL 2OBGA 2CE6A 3QNZB 1GYCA 2JNZA 5I17A 3S5LG 4HJIA 2EO1A 3PNWA 4FNQA 3PHQB 2IALB 3MCYA 4MAUH 1T83A 1II4E 4FA7B 1FHNA 1NFIA 1URZA 3GC3A 4GNKB 2GUOA 3MRDB 1AE6H 4R84A 2R0LH 4IOSA 3NPSB 3DBXB 2PCFB 3AXIA 1FFOB 1FO0A 2EXYD 3NTCH 4U3SA 5KSUA 4ZW6A 4ZI8A 4RDBA 2QMKA 2IMMA 3ML8A 5K9JL 4PIRF 2HRGA 4XPBH 1L9TA 3SOBH 2L04A 2K3TA 5C0EA 4XBPA 4QJ4B 3RWHA 4O00A 4S1RL 1W72H 3M88A 3VA6A 1QP1A 2BVUA 5LGHL 4JGMA 2D0HA 5GIRB 3DO7A 3A5VA 4YSTA 2PTUA 3VWKA 5D6DA 1YNTF 1YYCA 2JKXA 3AJ7A 4OB5L 5LXGL 4EN3D 3T1FA 1IX2A 1C5BH 2V5TA 4MMYB 4WUUD 2GT9B 1JI2A 4Q7DA 5EFIA 4JFSA 3WS6A 4LK4A 1PD0A 1VJSA 2ZCKH 3TBBA 3ESUF 4Z3TA 5LNDA 1U9KA 2Y7MA 4OCRH 3IMRA 2CIKA 2X70B 1HK6A 1NWOA 5KVGL 4AQAB 4N0RA 2ZD0A 5HVHC 1CIDA 3D0VA 3LV3B 4XPFL 1PNCA 5I75C 4BSWA 4EI5B 4JAMB 1DBJH 4AYFB 5F6IB 1F4HA 2RACA 3QRLA 4V11A 4I18A 4L3EA 5IBTH 3SCMB 1IM3A 1BM3L 3D50A 4AXWB 4S2SB 2JF1A 1ROWA 3DMMC 3UG4A 4ELME 5D7IA 3U1QA 4NYLA 3FN3A 4OLEA 2EH7H 3BUPA 3I74A 3EJQA 1JXKA 8FABB 2XIBA 4PW3A 4OLXH 4KHXH 2JTYA 3KGSA 3D1MC 4WWKC 4ZUTA 2E7CA 1JPSH 1VPOL 3RFRA 2BOLA 1KCSH 3U6RB 4GXUM 3FQ1A 1NAML 5I8OL 5EEYA 4XCEA 2JKRM 1NOAA 3QORB 4UQCA 1QRNE 3GHPA 3MREB 2KT6A 1JYNA 1DQMH 1A1MB 1G43A 1Y0LB 5FF6B 5D1QD 5FWQA 4B3VA 3US9A 4QXWA 4R5VA 4NI3A 4J3OF 2GTWA 2P5PA 4FG4A 1TYJA 2XXCB 2BNUA 2J8UF 1EZSA 4HSCX 4KY2A 3OR6A 5F7BA 4B97A 1UATA 3L7EA 1WC7A 3RIAF 3GRGA 2ZP9A 4GG6A 2B4CH 1CLVA 3MLVH 1AGCA 2AZUA 2AJSL 3HRZA 1JYWA 5E8OA 4N1HB 2OI9C 2IGFL 4PP2A 3QI9C 4LVEA 3Q8FA 3F7RA 1U41A 2DEWX 3WU1A 2ZYSA 2X09A 2FNWA 3U9PH 1KIRB 2O6FA 4F2MA 3NG5A 5L4FA 1WISA 3N41F 3K6SB 1NAKL 1JG9A 3WY1A 3J2PA 5CHNB 4OUUA 2E46A 3ISRA 5CIPB 2ZNXA 4Q6IC 3Q5TA 4Y4FA 4Z8FH 4F58H 1Y18A 1FRGH 3C2AH 4FAAB 4UQBA 3S88H 2WTRB 4PH8A 4ALAL 1P53A 1J1XL 3FT9A 2A99A 2OTPA 5CEYB 4L8DB 2OMXA 2P3YA 2ILLA 5CP7B 4L5FE 4FABH 1UA6L 3U2IA 5IY5B 4G5ZH 3K7UA 3UTPD 2V8LA 4W6XB 1E5CA 1MHCB 5DFAA 5FW8A 2IEPA 3QFGA 4K3DH 3V7MA 5GZNC 5J1TC 1MRFL 1T0NA 2JKNA 2EYTA 4KO7A 2HLFC 4KFZC 5EOCH 4LOUD 4BM7A 1MHHA 1JNLH 2VN5A 2YJQA 5CU5A 3V55A 2GHZA 3ARQA 3W37A 2YPVA 2DYRB 1E5BA 5EUOE 3SPGA 3FUIA 1J5CA 4AC2A 4OSUL 4D0CA 3TCLA 2Y3NA 1MCCA 1XH2A 3FU0A 1OF0A 2AJZB 2OMWB 1UZ6F 1HI6B 4BUQA 4YZFE 1K3ZA 1TVHA 1ZJBA 4JB9H 2IG2H 1OTTD 1UT9A 2L0DA 1JP5A 1LEIA 2IAMB 3MV9E 1ZMYA 4JHUA 1OK0A 3QUZD 3EJZD 3BGAA 4Z5RB 2ZUTA 5CEXB 1RK0A 1J11A 5J9PB 4POZD 1NCBH 1ILUA 1B0IA 4FNLL 4PS3A 2APVA 1OCWL 1THAA 1CD8A 3QIUA 2E5EA 4Y8AA 1W0YT 2VZ3A 1QNZH 1WA2X 4NBXB 4X98B 3WS3B 1ZIAA 4A66A 5C0NC 5I1IH 4HSQA 1MVUA 5JQHC 2AEQH 3CVIH 3UJIH 4UTBL 4A7SA 2G3NA 3DGGA 1TLKA 5ESVA 3G6AB 3EH3B 5AQ0A 5C0FB 4HYTB 2R29L 1DCLA 1EPFA 4LSVH 1NC4D 4B0MM 4C54A 1ACZA 1I8IB 5E2JA 5I28A 3NN8B 3SBWA 4ZFGH 4WNQA 1V5JA 2FECL 3FU3A 3DV6B 4IKJA 4FFZH 1KB5B 3L4YA 1JPFA 1P6FA 2WINA 4BQCA 4FG2A 2BSTA 3L3OC 4JMNA 5D7LD 5DHEA 4QMEA 5KTEH 1JXFA 1FI8C 4LLDB 5C3LD 2C9XA 5DVKA 4AYSA 2XWBB 2QHLA 1E9PB 3ME0B 4U0QB 4YLBA 2ADFL 2R7EB 1ZV9A 3L5XL 4XPGL 3FYEB 3X17A 1XGUB 1NC2A 1X9RA 3VFRA 4DGYL 5DZ9A 3M86A 3O3DB 4GW4A 4BRJA 5DVNA 3DX0A 4M5SA 5KG9A 2E27L 1EAQA 1WWCA 3BN9D 4M48L 3OXRB 3B8YA 1LWHA 1U3NA 5EORH 1AHWA 1PJ9A 5ANMA 3T08A 1BIHA 1X4XA 1N8OE 4K8RL 3GTNA 2E7DA 2E9IA 2H1LM 5I71C 1HAWA 2ED6A 4GQPH 2NY0C 5EO0A 1IGCH 25C8L 2YKLL 3Q1EA 1MVFA 1XMEB 1HL5A 1ZXQA 2EVHA 3CK0H 4XMPH 3MUY1 1K6QL 3L9RA 2VZSA 5DRXA 1MCLA 4MDJA 2W0LA 4Q9CA 5JORA 2FHFA 5C0AB 3G6JE 5HBBA 3QDHA 3ILPA 5FB8A 4EDXB 4PB0L 3FRPB 4NZRL 1CI3M 4KJPC 3S3DB 4JHWH 3Q3GA 4YK4C 2A3TA 3UCRA 4G8IB 5IFJA 1W8NA 5AW8B 2HFFB 1LDPL 1TTRA 1R5VA 3MV01 4GOSA 4J1UA 4O02H 3TNMA 3BP5A 2DEYX 3ARTA 3C87A 1M6OB 2N56A 3CSYB 3SKJH 1TEFA 3U4EA 1CXKA 3MMEA 2OQJA 2UXVA 5FO8A 4XN9A 3H4HA 4HIPA 5EO9B 2OSLA 3EDKA 2UWEF 4NB7A 5DD5H 5GRJH 2XKUA 4QRRD 3T0WA 4AV5A 2FSEA 3ARBD 4UQ2B 4UWQB 3RGVC 1KBGL 1F02I 1IILE 2GG1A 1N3NB 3LH8A 5AYUL 5B38B 4N5EC 5I6KA 5EPMA 1EDHA 1U8NA 2KI6A 5DJ0A 3L9EA 3LZFH 3MODH 1ZLSH 4CILA 4GINA 3KWXA 5IWLC 2AQRA 1D5XA 4UILL 3FAXA 3ZIMA 5I76A 4AM0B 1NWPA 4NM4H 1KB9K 1XZ0B 3NJLA 3REVA 4PJEF 4ZMVA 1LD9B 2E47A 3Q1SL 4MD5A 4FLQA 4OZIF 1UKSA 4NT6B 1I85C 2YMXL 4XNMB 2C3GA 4FYRA 3B5GA 4MXQD 3EDJA 1QSZA 3I6LD 1BEXA 4TVSa 2R4SH 3H9SA 5CCHE 4LIQL 3S8WA 3IFNL 1XF4B 1MLCB 2A83A 4FLSA 4X99B 2FE0A 3MRGB 5T1LB 3VJ6B 5IBLD 4RBPK 2MCAA 1EHLL 2LTQC 4X7SL 4LMQI 4F37F 4ZRGA 4ETQB 4PTTB 5AAPA 1NAMA 1KDIA 3LZQA 1E8XA 3OKLA 4HJ0C 2OFQA 5ISZB 1DJGA 1JGEB 1YO4A 3IBOA 3ULVC 5L6YH 4A68A 1XV8A 3IDIA 1IEAB 3PP3H 4OZFA 5LAPA 4B9ZA 1A5FL 3FTSA 4OFIA 1TJGH 4P3DA 1AZNA 3KWTA 3D3VE 4OFDA 1BGXL 1SYVB 3D05A 1JRHL 5C0IA 2EQDA 5GS2H 5IW6B 2JQAA 4KHTH 1JGUL 4E41A 5DJZB 5CINH 1RHHB 5J3HD 3H7BA 1I1AD 2VO8A 4ELMB 4M62H 3Q7JA 1UYWH 4JKPH 4GS7C 4YHLL 4JRXD 5GGRA 1HXMA 4G83A 2C3VA 5E7FA 5DMKA 3B7SA 3FHAA 4WI4A 2AVFA 3QUKA 3EG9B 5JW3H 3RX7A 1WUZA 4BK4A 2NNRA 1XF2B 2R0LL 2WK2A 3KJ4B 4ODTH 3KPPB 4OQ1A 1I7UA 5DK3A 3LKQA 3NTCL 4JR9L 5JXAH 3K6FA 2X7LB 4MMXA 4TUUA 1OCZB 2WXKA 1QRNB 1YUHB 2GIYA 3QISA 1EMTL 1UJTA 4ANWA 2P1YA 2OMVB 3OR7A 4TOYL 3IGUA 1TOXA 1CGTA 5F7AA 2MWCA 4N87A 4J8RB 3DTUB 1ZGLA 1TYEB 1W72L 5CSZB 2PWHA 5GISH 1PF3A 1Z0MA 4NO0A 4QY8A 1W8OA 4FQXC 3K4ZA 2ESVE 3FO1A 5DMGD 4WU5A 5FC9A 5T5FH 3IMWA 3IJ9A 1FDLH 5ABAA 1BOGB 1QZ1A 2NY7H 1C5BL 1LXMA 1T7VA 1PCSA 3OG4B 3BH8A 5HGHA 5KYXA 3V6OE 1B4JL 3D9AL 3ARFC 3ASOB 2IANA 5IW1B 2F8XC 2W0FA 1TO4A 4MS8C 4PI0A 3C8DA 5KAQF 4CC0A 4Y2DC 3UP6A 3RWIB 2EDMA 2EEXA 4QOKA 4LFHD 2DWDB 1E43A 3CLFH 4NXSA 4GKOA 4OCRL 5B1KA 1NGQL 5D1XD 5ETUB 2JJVA 3FUMA 4JX0A 2R2BA 3RY6C 2QFPA 3U6XS 1HL4A 3L4CA 4KV5F 2AK1H 4I48A 5D7IF 5AAMA 4KI5C 3IAGC 1SUHA 5F3HA 2GC7C 4HXBH 2GFBB 2R1WB 4NNYB 3A67L 1SLUA 1SVZA 2CLRB 4Y16D 3V5DA 2YIHA 4QYOA 1RUPL 1IRAY 1F4YH 3DETC 1XIWB 5E00B 3CN1A 4A2MA 4UTBA 4UTCA 5TE4H 4NUMA 1F3RB 3WN5C 1R3LB 5EBMB 3R06A 4G9DA 5G5DB 1S7RA 3V9CA 1EFXB 1V8HA 1M1XB 2R29A 5CUSH 2CMRH 4KHXL 1K2DB 3A4AA 3KGTA 5EUOB 2VDNH 3GMLA 3P4OA 5KVMC 1FNEB 1ZHKA 1JPGA 4NO3A 1KCSL 4WI9A 3F7YA 5E94A 2XN9A 5LCVH 3VCLA 5CN1A 1OSYA 2R1XB 4WF7A 5IMOA 4YIQA 2EUZA 4DOHB 5JOPE 5C09E 5C0RH 4HCIA 3PV7A 4UIKH 1JPTH 2UZYB 1KEGH 1YDPA 2HJKB 4RCAA 3QNFA 5TF1H 1GS7A 3RPKA 1XL4A 3U36B 5EU6A 4F7EB 3KLAB 5GGVH 3ZYZA 1PZBA 4J3XA 3U2JA 3D7PA 2FLMA 4NO5A 4FZEH 4DQAA 3LRSA 5I23A 4Z0BL 2ZSVA 3NOIA 2B4CL 2F53A 1QG3A 2HX8A 4L4VD 3MLVL 5D4IA 3NSFA 1NMAL 5B8CA 5B39G 5AW7B 2XFXA 2V9TA 1Y7VA 1OPOA 1B6UA 1JN6A 2GQHA 5JDJA 5IB1A 3U9PL 1DUZA 5EWIH 1O9VA 3IJSA 4LZKA 4X50A 4AGNA 5T3ZL 3TEXA 3KYAA 3EJCA 4IIQB 4F58L 1RKRA 5FK9A 4Z8FL 3I6GB 4JN2B 3P0GB 5I9QC 4QD2E 4XO9A 5D55A 1E27B 2OP4L 3LIUA 4POYA 1JXGA 4N25A 4P9HC 5DZJA 3T77B 7FABH 4K3DL 4G2AA 2IQ9L 1RHFA 4OF3A 2W07A 2WP3T 5DQ9B 3N04A 2GIXA 1JK9B 3N1PC 5E24E 4PLOB 4RZCA 4G8GE 2PYED 4FRWA 3EJRA 1YEJL 4YXKL 2BIIA 1MJ7H 5EOCL 1UWXH 1KGJA 1Y6NR 2BP0B 2F54E 3QNYA 5HHXH 3PAZA 3CFIC 3KYNB 1JNLL 1MG2C 1RZKC 3BUYB 3HC3H 3QUGA 1T7XA 3BVUA 4XZ4A 1IVTA 1MI5E 2ICWB 4N2AA 2V5SA 1HHIA 2ZOKA 3EFFA 4NFCA 3EFOB 3WMQA 4OAWA 4HMDA 3GRWH 2YXMA 3FOMB 2F8VA 4GQ9H 2LV4A 3W0WA 1BM7A 2R0WH 4K2UH 1MFDH 3EF7A 5BV7B 2OYKA 1DVYA 5KWYC 4U6YA 1AR2A 3QIBD 1ZT7B 2IG2L 3PWNA 2X38A 3RPBA 4PPTA 3D8MA 4E42A 3G6JB 2JK5B 3RE0A 1NCBL 1WEJH 5FXCH 3LHPH 3HE7C 1A7PH 3UROR 3WLBA 3X3FL 1L3NA 5IJBC 3JSSA 4UM8B 3CVIL 4K5PA 3MJ7A 1ORQA 3QEHB 1U95A 4GAYA 4XVSH 4AE0A 2CGYA 2QADC 5LNGA 5T8IA 2H4EA 2AQ2A 3EYFA 3QDGA 2F19H 3O6KL 2VE6B 4LSVL 3TBSA 5CP3A 2X4QB 5FKAB 4RA3A 3ARWA 1GJWA 2XWDA 2VDLH 3SB3A 1IAIM 3ZTJG 4NHCH 1MJ8L 3QEQE 5E03A 3PWUA 4FFZL 4GBXA 3BYYA 4K23H 4OLVL 5DC4B 2DYPA 5EA0H 4ICWA 3TVMC 4F9PA 2OAAA 1J8HE 3RKDD 2EE2A 2FVNA 3AM8C 4PRBA 3K2KA 4HH8A 4YX2L 1JTPA 3JZYA 3BAKA 2J1ZA 2J4WL 5HTSA 5EZLA 1DEDA 5F0LB 3QYNA 1EX0A 3BUDA 4DGVH 3SE9L 3ZSTA 4TRPH 2GHWB 3LNGA 4U2ZA 3CD4A 5B21A 1CE1H 3QQNA 2WLLB 3GKWH 4WEMB 3H7LA 4N2BA 1DSWA 1INEH 3D2TA 1JHTB 3ZE0F 2EUXA 5BUPA 2ZXCA 3PU7A 5EORL 1WWAX 1IGFH 3OB8A 3D4YA 4M02A 3D0LB 2Z92B 1E30A 1KGWA 2E3VA 2J57A 3SZ6A 2EP6A 3FN9A 3SN6N 2Q1EA 1ODUA 1VFMA 3WE6B 4JRLA 3VFWB 3WLWC 3U9UB 1OAJA 2D3NA 1I8MA 4XN1A 5M95B 5LXVA 4NWUL 1VACA 2WZ5A 5CD3B 5ICXA 4XMPL 4LF3B 4PN6A 3V9EA 3BE1H 4GSUA 4QGYA 2QQNL 1H5BB 4ZW3A 3DURB 2DQFB 3HJEA 4WWNA 1CXIA 4PJ7E 4IBZA 1ML0A 4KKBC 3T1WA 3D3VB 4JHWL 5E8NB 1W72A 1I7RA 1OAKL 4H1LG 4HDIB 2APBA 1HEHC 2HKAA 1Q38A 3S0PA 5K1JA 2HWZH 4NX0A 3DX7A 3MR9B 4GUPA 1E90A 4IHBA 4E9XA 1KGXA 1DQQA 5DK2B 4EJ1C 3PHOA 4DP9X 1BJMA 3BIBX 3SKJL 5I1GH 3ZOAA 3FTVA 3IE4A 3Q6GL 3RI5K 3WIHL 3BVDB 2J6EL 5CILH 5GRJL 5DD5L 4ZFZB 4MNQE 4ICXA 5E8DH 4Z7QF 4GH7B 4HUMB 4P4RB 4YSDA 3OLDA 4GSDL 2BOBA 4LHUG 4PJGA 4C83B 4KQ4L 2KLSA 1OT1A 4JHZA 4JM2A 5HXMA 4JANB 4L1LA 3KW7A 3U2SA 3UGUA 3VM7A 3WJLC 4PIBA 1FNHA 3LZFL 3MODL 5KUMA 4E0RB 2F74B 3P3SA 5I8EA 1VFAB 3U7YH 3VXQA 2BNRE 3DUSB 3CPUA 2Y2WA 4H0LC 3FQYA 5FA4B 4NAQA 3DMMD 3F5WA 3OF6A 4HFUL 3PPEA 1F1GA 5CU9A 1DQKA 2IADA 3MCLH 4K3EH 1ADWA 1RK1A 2KZKA 2O6DA 5AKTA 3MBEA 3VE0A 5L88L 2ESVB 4C56A 3IMVA 3KLHC 1J0KA 2R4SL 5F3BB 4RQQB 1K5NB 1FJ1B 5FWRA 3MNMA 3QAZC 5G4OA 4BQBA 1CE6A 1WZLA 3FQ2A 5F7YC 3P11H 4MAZA 3QJSB 4DGUA 1H15B 2QVKA 1CICA 1UENA 1OAXL 1I3GH 1X5HA 2XETA 5L6YL 1G87A 3OJDA 1Q94B 1WTGT 5BRZD 1FZKB 5C9JB 1TJGL 4P3CH 4NRZA 4WO4B 4YSAA 4WENB 1J05A 3L3KA 3SJVD 2GIMA 1CGUA 4DNLA 3QI9D 2GI7A 2DRUA 2FBOJ 4UQ9A 3V5KB 2IXQA 2HRPH 3MOBH 4M62L 4PJ8A 1UH4A 3I9PA 1F4XH 4DPBX 1HZHH 1UYWL 3ARDB 4JKPL 43CAA 2GAZB 1CFSA 1M7IB 2VITB 3NCJH 4G8EA 4APXB 4YDKH 4J2QA 1RZJH 1UXWA 2KS0A 1IL1B 2YAMA 4GEIA 1JF1B 4S0SD 4XAKE 1D5RA 3GKZA 3SDCC 3MGTA 1DO6A 4WV1A 1NIFA 3BUQA 4K3HA 4HLJA 3WJMA 2X44D 3CHSA 3WTSA 4U4IA 1Z5HA 3D87B 4JHVA 4IHOA 2Z1PA 3RNQA 1JVLA 3IMBA 5JXAL 2VJ0A 2J2ZA 5D2NE 5GZND 3OZKA 2WXPA 5GGSB 4ZYKA 5LUMA 3UFIA 1G7IA 3KEDA 4Q2ZA 4XOCA 1GRWA 5INCA 5KS9B 3D39A 3FSVA 4JZNB 1J5IA 2NZ9C 2HLFD 1X5AA 4WFFD 4YHYC 1D7DA 2RTTA 2WYHA 5GISL 3G5XA 3WI9A 2L7EA 1ODAA 2QFRA 1AGDB 1U8KA 2EJ1A 1BZ7B 3NK4A 3VXSD 2JCCE 4QRQA 5T5FL 4RX4A 4HUVA 5J6GB 5F0JB 4P4KA 4FQJH 2NY7L 2NW2A 3WUWB 4KH2A 4PJFE 4J5VA 3QC5X 2CO4A 1GTNA 4DH2A 1GC1H 3D4ZA 3N43F 5F7UA 2QT6A 4J28A 1HL9A 3Q8BA 3G5YB 3RNKA 5GZOD 1ADQH 2Z7WA 4JCMA 1Q9WA 1KJVB 3VDAA 3B3IA 5C07A 3D25B 4ZQTA 3CLFL 3LHAA 5BZWB 4GKNA 3Q9QA 1WK0A 5ABDE 3ATFA 3ECWA 4R8WH 1I8AA 4HS3A 1NEZG 2AK1L 3CFJB 4TV3A 5C0ND 3RWEB 1FFRA 2EEBA 1TFPA 3KL5A 3O3BA 2GSIA 1CFQB 4CUCA 5ABZA 4ONHA 2OTUA 3MRCB 4X4XA 1F4YL 4OM1L 1NIBA 5DUBB 1YQVH 5DS2A 1PG7W 2GTZB 1G7JA 3QZWA 4G8GB 2CUHA 5E9DA 4JK0D 4YL4A 3VI4A 2F54B 1MY5A 4UM9A 3RTQC 1IEBB 3ETSA 2YK1H 2DJ4A 1FYTB 4XNXH 4M6MH 3QJUB 4DEPB 3PAVA 2FZ3B 1XT5A 2CIIB 1MI5B 3L2LA 4N8CL 1GCFA 1MFBL 2DH3A 1KPRA 5H4YA 4PVLA 4TNWF 4MWFB 4FFZA 3BZDA 1YA5A 5IT2H 5SV4A 4MB3A 5C0RL 2J1XA 4UIKL 1JPTL 1I3VA 3OBAA 3MNZB 4EQ2A 1KEGL 3Q2NA 1A4AA 3SD2A 5K9KB 1A6ZB 2D8KA 2MQ0A 1ZA6B 5D93C 2GTQA 3WOVA 1MQKH 1WPCA 2UY7B 5KN5B 3HZKA 3ZO9A 5ISZD 1E5AA 1XX9C 3BD5A 3NAAL 4P49A 4L29A 5DMIL 5CIPH 1FFTB 5LBVA 4D2NA 2Y7QB 2BNQD 3FB6B 2NY0D 2XV6B 4N6RB 4UQEA 5EWIL 2QSCH 4WW2B 5D7SL 1B0GA 3VMNA 2J44A 1PG7X 5DRWA 2BRQA 3FBQA 4EZMA 3QDMD 3VH8G 4QTFA 3ZTJH 2GJ6B 2XWRA 4CNIB 5D1ZA 4TVPH 5DGRA 3QRBA 4A6YB 3ULSB 4ZUVB 2NW3A 4H8WL 1KXQE 2C7UA 2CHZA 2R0ZH 4MHHI 4OT1L 4RAVA 1OB1B 5C2BH 3K5SA 4U1LA 1IUZA 1J8HB 5C3TA 1TMCB 1K8DA 5GGQH 4JUTA 4AQOA 1TXKA 3FQTA 1G7QB 4FOMA 1GR7A 7FABL 4LU5L 4FD0A 2DMHA 4OD2A 4NQSB 5I8CB 4O02A 4G6MH 1H3TA 5E4AA 5GGRY 5MEPA 3S5LA 4X0KA 3Q01A 5HHXL 2WJ5A 4RWHA 1I3UA 4XNQA 4XO8A 1F6LL 3I2CL 3GIVB 2B5IB 3HAEB 3HC3L 4RVBA 3RGVD 2J6EA 4Y0GA 4Q9QH 4AL8H 2R1YA 2LW3A 1HYSD 4N5ED 4W9DC 2BS71 4L1DA 5T3XL 3M07A 4CVXA 4G43B 2APFA 3OGCB 3T0EE 5JPMC 4GQ9L 5ERWA 2R0WL 4K2UL 3VFPB 1MFDL 4GBXC 3FQXA 3AT0A 3KVQA 2BCMA 2EILB 3BN3B 4M29A 3KVPA 2WQSA 3KM1A 3BW9A 5C97A 3LY6A 4MB4A 5JW5A 3MV7E 1WEJL 4H1LH 4HZAA 4PJ7B 3LHPL 2G2RB 4LO9A 1A7PL 4K7FB 2PXYC 2I85A 4Y4HA 4OI8A 3R7RA 1SYSA 1RVFL 3RY4A 3WD5H 4LEOA 3RBGA 3MUGB 4QHLA 3GSUB 2G9HA 1NJ9B 3AROA 5FUOH 4MAYA 5AKRA 1R47A 2XICA 5D7HA 1KB5H 3RDTB 5FYKH 2F19L 3C5ZC 4P5TC 2OJZH 1P4LA 4PGCB 3CC5B 2P4AB 2DTML 3SGEH 1N0LB 4H8HA 4MNQB 4HJ0D 1HEZB 2VDLL 3ULVD 3BSZL 5J7CC 8CGTA 3C60B 4IEFA 2BFVH 4N2DA 4IIZA 2VZUA 3BLKA 5EA0L 4NN7B 1AS7A 3JTSA 2E6JA 3EDDA 3D6GA 2A5UA 1LO5A 1PW3A 1MZYA 3QWRA 4H8QA 1YN7A 1FVDA 5DWUH 1N5YH 3O8XA 2BIHA 2V9UA 2CO2A 3EXLA 4FFWD 3FT4A 4X80H 2B1OA 1CE1L 3M6DA 3D08A 5G4NA 4V1DD 2GSGB 3GKWL 2X28A 5H35B 1UUSA 4B95C 4DPRA 4MB5A 2EICA 5F7HA 2R59A 4I87A 2CCVA 2MQGA 4UT9L 5JO5B 1IGFL 4YHPB 3V4UL 5KYWA 4YLQT 5J8OA 4U1JB 4N4YB 3V0WH 3EOTH 1GGTA 3KWWA 4ATWA 1O7DE 1N70A 4JFPB 2YPLA 1UB6B 1W15A 3PGCB 3SO5A 2VXQH 3NIDB 3NQKA 4UNIA 4KTGA 1BBDH 4TTGA 1NCOA 3II3A 1GS6X 2VCOA 4PJAF 2Z65C 3DJ9A 4Y7MA 5EU7E 4HS8L 3ZQ9A 4N2KA 5F1KC 5D6CB 3KS0H 1D9KC 1FSKC 4RGNB 1AO7A 1HH6B 5A1AA 4CKQA 2HXAA 3BE1L 1ZLUH 2R56H 2P7TB 2HLEB 1EHAA 2NT1A 4JFQB 2PO6B 4KRLB 4PGEB 4FQXD 2IWEA 5IESH 5E23A 3EOAA 1MPAH 4RIRA 1ZE3H 4UB0L 4NKIH 3H9YA 1VIWA 5T5FA 3TPUB 5I66B 2VLKA 2FO4A 3FQRA 3OWRA 5TE6H 3ARFD 3TIEB 1TTGA 4B9GA 4JM2F 1M05B 2VC2B 4MS8D 3FPYA 4PWEA 1MHEB 3RUGA 5AW5B 5CILL 1CD1B 4Y2DD 3L13A 4AIXA 1DVFA 2VYRE 1Q1JH 1U2HA 1GS8A 3OZ9L 2CO7B 4DKFL 4ODUB 4P2AA 4JFYA 1CU4L 1DL7H 1OGAB 4ZZFA 1P7QD 2N4IA 2X6BA 2NUTB 2YGNA 4KI5D 1CICC 2R2EB 2VISA 4KRPC 1AI1L 5D5ME 3TWCH 5D2NB 5TJWK 5ACZB 1QUNA 1OPGL 2H0EA 3QDJE 5HDLA 1XCXA 3NZ8B 4I4WB 1SXZA 1HE7A 2E7HA 2YOCA 5IV2B 2UY6A 5MENA 1RUKH 1TNMA 4JJOA 3LKPB 1HQ4A 3MCLL 3MLRL 1FZJA 2N7SA 4K3EL 4P59H 7CGTA 2CHXA 4TUKH 5ADPH 4Q9RH 3S36H 1SXBA 5EC2A 2I26N 3ZQWA 4FQQA 3JV4B 4JLRA 3ABZA 4C58B 3FUJA 2JCCB 2W91A 3SIKA 2P47B 1QBLL 5J5EA 5JNYA 3W57A 2VSMB 2EUVA 2EIKB 4HKXA 1RCYA 1FNGB 2ROXA 1J12A 4PJFB 5GS1C 4YGVA 1NBZB 3QG7L 1BD2E 3P11L 1ECYA 1XGTA 3QJTB 3ETTA 4P2QE 4Z76B 1XGPA 3TZVB 2UV3A 3S8FB 4WI8A 5F1SA 3BHBA 1IBGH 1LMKA 2CRIA 3BGFB 1I3GL 1BVKA 4WWPA 4HEME 5FFOA 3GJFB 4U1KA 2M26A 3QQ3B 4Z7IA 3W5MA 1LE9A 3T71A 1OCOB 4XRCA 4JCWA 1MHPH 2IH3B 3JV6B 3HC0A 1E6OH 1XGRA 3GSQA 3GBMH 5CMAB 2WAHA 1B88A 4JQVA 2DL9A 1YPZF 2YD8A 1R3IH 3AMKA 3PIQB 4UDTB 1SVCP 4DGIH 3PQYE 3V0HA 3MROA 2HRPL 3KHOA 1H0DA 5DK0A 1GGUA 1UZ6E 1HZHL 3UBHA 3FUHA 1WT5A 3UERA 3JT0A 4YDKL 3QA3B 2C9UA 2ITFA 4L4TE 5D7JC 5I24A 4BFFA 1VZIA 3HS0B 1HOCA 3ARYA 2H9GB 4JO2H 1Q0XH 3UTSA 1NIAA 1ED3A 4K7PX 3DXAE 3V95A 1A1OA 2P24A 3KCPA 3O3EB 3PGDA 3MNWB 4YHZL 4QNPE 1NBVL 1CTOA 5JW4Q 1AQKL 4QLWA 3GGWB 2FJHB 2DEXX 2ETWA 4PRPA 2OMZB 5FUCC 4EO5A 4GG8A 4YDVA 1N18A 3CSPA 5C0CA 1I4FB 5DJ6B 1MOEA 2R15A 5AOZA 5FLUA 2RQEA 3HE6B 3VFTB 4U3XA 4Z3IA 4JFFD 1XCQA 1Q0YH 2VR6A 1QSED 4H5SB 5F1IB 3SD5A 2XQYK 1SFDA 3R4RA 2AXFB 3ILQC 3MRJA 2XJLA 3RIFF 1BVZA 2GEQA 1GC1L 4EDWL 3MU3A 4QTHB 3QB7C 2TAAA 4NZTH 5ILTL 3U46B 3BLPX 2VM4A 2XT1B 4Q4IA 3GRWA 4N26A 3LZRA 3WDJA 3TA3B 2EDHA 3PWJA 3SGDI 1CJYA 1FFPB 2VKWA 3FONA 2ATPB 4LVHB 4U1NA 3UZVB 4A39A 1A4CA 2VT0A 4PRIB 4R8WL 3BPOB 4KX8A 5DJCB 4O9HL 1GA2A 5A7BA 3TH2T 3U83A 4BFKA 2ZX6A 5LG1A 1HHKB 3OX8A 2DWTA 5GQBA 4RAUA 2HN7B 1BHGA 5DLMH 3VI4F 2AC0A 2X4OA 1U2YA 2H6PA 4M3JA 3ERXA 4MNHB 4TPRH 2XVBA 1JV2A 2A9CA 2DQDH 4UDUA 2DM4A 4DW2L 1BAWA 4BK5C 3EO9H 1HQRB 1YQVL 1GYVA 1JYXA 1YCSA 5F9WB 2CZNA 5E5MB 2AK4D 3BZFA 1DJIA 2YK1L 1JZIA 2BVPB 4O2EA 4XNXL 2ZWSA 4M6ML 1KXHA 4CAGA 1W91A 4L8SB 4TQ8A 5DUMH 1EH9A 5ESAA 2BP5M 1QYGH 4K9EC 1OP3K 5KSBB 1M2VA 2CKNA 2NSXA 2C3XA 5E1AA 3EW3B 1QHPA 5FOBA 3T0EB 2D2CC 4NNXA 4A37A 3OKNB 2P5ED 4PSPA 4DESA 1QO3A 3GSVB 4Q9BA 3BFWA 4PJBF 5MI0B 4CU7A 1TU2A 1QVOB 3AAZA 2HG0A 3IU3B 8PAZA 1FC2D 2UWEE 4PJDA 3C6LB 3GMNA 1J7VR 1GZQB 2C9RA 1K4CA 3CZLA 3IJYA 2FHBA 4PJIF 4GRMB 4J3OC 1AS8A 1AANA 3EBGA 5DZNA 3QUXC 3BPNC 3MUUA 1KYOK 3L54A 2YA1A 4WO4D 3VFNA 2E76C 4J12A 4PMEA 3SDDA 5I5IA 5EG6C 2WOYA 2BHFA 3WLWD 5JIMA 5CCGE 3IE9A 1D2PA 1HNYA 4M7LH 4I2XA 2YRPA 4XMLH 1JDDA 1J9SA 2ZG1A 4OJFH 1PNDA 3LNIA 4TNVK 4TVPL 3WBDA 3FQNB 4ERSL 1UM5H 2W5PA 4JDVB 3VFVB 1DJZA 4ZPVA 4OZIE 2V33A 1DQJA 2R0ZL 1RZFH 1NUDA 1T22B 3OMAB 1IC1A 4QDGA 2FGZA 3HUJF 2X6MA 3KWVA 2X89D 1YNTB 1CFBA 5C0JB 1A1NA 4ZXBB 3U4BL 4X9YA 1BLNB 1L7IL 4JFDA 4BFOA 2B3IA 3CN3A 4NP9A 3DNKA 1OSEA 2YUZA 2R9HC 4UNVA 5IHBA 5GRXG 4HJTA 2FR4A 4FG6D 3CFDA 4PG9B 1Q72L 4ZMZA 3D2UA 5JLZB 1F11B 2OR8A 3CIAA 2QPEB 4ZNCD 1U0QA 1MAJA 1MJJB 2GCYA 4FERA 3TEZA 2F2HA 4AL8L 4MA1C 1ZHLA 2H3NB 3CQQA 4UAOB 1D5BA 1NKGA 2C8NA 1KN2H 4N90D 1VFUA 4LSDA 2FHCA 3L9BA 1JZ3A 3GIZL 1RI8A 1N4XH 5ID0B 1XCTA 4YJZL 1WRFA 5AVQB 1M3JA 3K4DA 3HC4H 5GS0D 1CBJA 4XXDA 1N5AB 2OL3L 4K4KA 1TZHB 3L3JB 1E9QB 1H8LA 2BC4B 1A9EA 1EEYA 1OTSC 4QHKJ 3QUML 3MLZH 4YNYA 3NJIA 1BPLB 4FFTA 3VG0H 5CLYA 3D33A 4NUGH 3KLHD 3RU8L 3MFFB 3AU1A 1WE5A 4WGKA 3MJ9H 5EC1A 5LGYA 5L7XH 2HFTA 3OHXB 2NMSA 1MWAL 2WXLA 1N8ZB 5FUOL 3QSKB 2AJVH 4H26A 3NPZB 3VXTA 1YNLL 4YDIH 2Y2YA 5CEZE 2EEFA 5KVEH 4NCDA 1YEIH 2A74C 4M7JL 1SMOA 4B6ZA 1URLA 5I1LB 4LDEB 4RMRA 2W65A 1DFXA 1N0XH 2BFVL 3ASWA 3B2VH 2J8UB 1FE8H 4K71B 1H6TA 5A6MA 3K8LA 3QPQC 3H42H 3IM1A 2HA1A 1KUMA 1FYTD 2BINA 3AMLA 3FB8A 3US0A 3UMTA 4XB7A 5D5MB 2MTAA 3QDJB 1N5YL 1S7VA 1AZZC 4NBZB 2HH0L 3CDGB 4MDRA 3OG6B 3HB3C 3VAEA 3MQIA 4PJ9A 2WD0A 3KNBB 3TT1H 2WWOA 2V6HA 4KX7A 1A6UL 1TCRA 2X4SB 5I74B 2WCGA 2ENYA 1HILA 3HZYA 3P0VL 1EEQA 3RJQB 3NK3A 4PS4H 3IDUA 1H3PH 3GJEB 1G9EA 3SDCD 4YSEA 4HT1H 4L3EE 3V0WL 3GSOA 4A38A 4LLVA 1IJNA 2GSMB 4ZS6C 3HNSH 1SXSA 1IQWH 3ZUCA 4D94A 4KV5E 1NBYB 1CFNA 3KEHA 2COQA 1BBDL 4QO1A 5DQJA 1JHKH 3IJ8A 2CDGB 2OI9B 4ZAKA 5KVDE 1ITBB 3Q9PA 1CQYA 4AQ1A 4P2QB 4QXTB 4WLCA 1UCBL 1XTLA 4WVRA 4ZT1A 1YEHH 3KDMA 4CL7A 3RX5A 1F0LA 4F33A 1FFQA 5I73B 1UWFA 2XBZA 2MOQA 2NZ9D 4NN6B 5BUAA 4L37B 1FPTH 2QBWA 4LCYB 4FKHA 3CCHB 1ZTXE 5F89B 4H8PA 2XPZA 3MGAA 4YE4H 2GJ6D 4NHUA 1HE8A 4B53A 1MPAL 1P9MA 4NXKA 3A6CL 1UD2A 4NKIL 1E2WA 3GB7A 3PJNA 3P3YA 1NL0H 3ARGB 5AVUB 3PQYB 5HDBE 5B39A 3NZSA 5CBEB 3QPXH 2D7OA 3RWDB 5TE6L 5K5YA 4FFYH 3IS0X 2ERJB 2X88A 4J3VA 5FO2A 5CF3A 4P23A 4LLQB 2X3BA 4N68A 3S35L 1ZRUA 5AW2B 4GG6E 3L7FB 2Y23A 3PY9A 2CH8A 2ICES 4L4TB 5CSBA 5SWZE 1MCJA 2EE6A 5HYQA 2JJSA 2W88A 1Q1JL 5IFAH 3PL6C 1BIIA 5AW6B 4MGXA 5IQMA 1TQUA 4WTXA 3W1ZA 5JPNB 3DV4B 2WKOF 2DY2A 4KI1A 3DXAB 3ESVF 4W1TA 3E9TA 3L3HA 4F2ME 2WNKA 4LBEA 4XC3L 1WHPA 4R3SA 4R7DB 1DP0A 1TTFA 2Z3FA 4PEEA 1GGIL 1EWHA 3UZQA 4HV8B 2PW2B 2FJGB 3V7AG 1O9WA 4Z1PA 4JVUA 5FUZL 4MJ5B 4ZUWB 3OB0K 4JGNA 3LRGA 5FYJD 4P59L 5H8DA 4ELDA 3K71A 4TUKL 3RTQD 5IHZA 3S36L 2NY5H 2DIBA 3IPFA 5DEGA 5C0BA 3MC0A 2H3KA 5ALCH 5FHAH 5AG9A 1P7BA 4LLAA 1I3RB 1O5PA 5ANHA 1D6EB 1O6VA 2YFOA 4PM1A 1PZUB 1MFVA 1Z9OA 1TMQA 2A6KA 2WQXA 1QTYT 3QUYB 3CHRA 3IJEA 3VVWA 4L1HA 1JZGA 5FO9A 3U1SH 2XTJB 3C8KB 4X7DC 1H6UA 3NCYS 4J4PA 3HHRB 1VB9A 2BSRB 1WA1X 3DTXA 3MBXH 5E7BA 3SEPA 4H8WC 2W9EH 4FTDA 1QFUH 4O51B 3RTLA 1CG9A 1LYQA 3EZJB 1HCZA 5C0DB 3HKZA 4FMVA 5SWSA 5K9QI 3QFDA 2YGOA 4M7ZB 4KNTA 1N6VA 4U31A 1J8KA 3UG3A 1E6OL 4WI0A 4XN7A 2C4FT 5AW0B 1NEPA 1C12A 3FU9A 3S96B 4TTDC 1IAIL 2XLLA 1NLDL 5K1VA 5IB3B 4DGIL 4NKDA 3VGBA 4D7PA 4KJYA 2ADJB 1E3FA 3O6FA 3ZKXC 1XGQB 2PP9A 2XFGB 2X4PB 1ZKAA 3M17B 3PJLA 3VXRD 2WZ0A 3AY4C 5JIKA 3GK8H 3GHBL 3JWNE 4CN4A 3ZDZE 2DL2A 3OKOB 2C5DC 4QRFA 1EEUA 2PKDA 4N3TA 2VDQB 1Z9SB 4YLCA 3FRUA 2K8QA 5A6IA 5J13C 1BAFL 1TENA 2WXHA 1EJOH 2Y1AA 1SHSA 2HVJA 4JO2L 1Q0XL 3KD4A 4NNPL 4YSUA 1JUFA 1E4XL 1U21A 2O5YH 4FTVD 5F71A 4RH4A 3NH7L 1E5ZA 2X2JA 2A73B 4Z6AT 2F7PA 3RDJA 5JZ7C 3QEGH 4MZ3A 4U6XA 5CCKH 4ZUSB 4MJ4A 4LFHG 1E5UI 1EDQA 4P5KB 1CVSC 4JUSA 3T65A 4I5BA 3N44B 1ZK5A 5JXEA 2X4UB 1ANUA 4HK0A 4ZK8A 2X4NB 2NSMA 2UWEB 2ZX5A 4WIQA 5DYOA 1MUJA 4E9VA 4JGUA 4RGND 3HPJA 3VFMA 4OFVA 2NY3C 3FZUC 1DANT 1A7QL 1P5VA 3H0TA 2PCPB 3FU6A 4ECNA 1RV6X 4ZNEA 3QCVL 2AKRA 3LXAA 4C57C 4L8CA 3BEVB 2NR6C 4FZ8H 3VYNA 1FNAA 4W6YB 3U30C 4NZTL 3UTZB 2F1EA 2FJFA 3FF8A 3I84A 3Q06A 3DOHA 5AOJA 3GSRA 3JYBA 1MCDA 4IGBC 3GT6A 2BP8A 3RZCA 2YSSB 5ANME 2WMPA 3R0MA 4PJEB 1MLBA 5AUMA 4Z95H 4RNRA 2XU9A 4ZOAA 3BI9X 4GW1A 4OZIB 5DJXA 4G6FD 2GJRA 2IVFC 1NCJA 3ZE0E 2PXYD 3QUMA 4NM8H 3S8GB 2X40A 1X5YA 4QUOA 3BPCB 2BZDA 2XWTB 5DLML 4H1LA 4R0LB 1KB3A 1T6WA 2F6AA 4P2RA 4XX1E 2C4XA 1MCHA 3RWFA 1GSMA 1ZA3B 4GAAA 4TPRL 2DQDL 1GL4B 2W1NA 1OGAD 3HLAB 2ORBH 5DS8A 3EO9L 2HLAB 4WCYH 3ZK0A 3ZMRA 4D8OA 1IM9A 4OI9A 5LGKA 1MWAA 3C5ZD 4P5TD 2WLJA 1DDHA 1LTXA 4KUCD 1LEGB 4MA3B 4MZIA 4M3KB 5DUML 4IRJA 3NFPB 4M8VA 3QGVA 4OCXL 3WJJA 5I1EL 4BEIA 3QXAB 4LHUA 4HK3N 2VABB 4UYPA 5JIPA 5LBSH 2VM9A 5I17B 2BXZA 2AEPH 3CZFA 3GD1C 3GS7A 2J20A 1KF9B 12E8L 2VAAA 3PNWB 3FUEA 1QACA 4EZJA 1A9VA 2N0KA 3FNKA 2BVQA 3EOBA 4AJ0A 1NFIB 2KHAA 3NCEB 4KMTL 2BX5A 2GUOB 1I1CA 5HVGB 2QJDA 4XWOC 3EO0A 5HHPA 1U93A 1Z0NA 3EYOA 2ZKYA 5KVGE 4I3GA 4LCWD 1FO0B 4U3SB 5E0FA 5KSUB 2Z35A 1ZVNA 3CV5A 4XVUD 5I19H 1BQRA 2Z31C 3A6OA 1T6BX 2WW8A 1EEZA 5IVNA 1T0MA 5C0EB 1ZLWK 2F7QA 4OZHF 3RWHB 1T80A 1NOFA 3I3DA 4QRPB 3GM8A 2HT3D 2ENSA 4LVNC 1A0QH 1MG3C 4XMLL 1AC6A 2WVVA 3ZLQC 4OJFL 3L9YA 3VWKB 2VDML 3SE8H 1BFOA 1EFQA 1YHPA 3H9SE 4FQCH 4ELKA 3AQDA 3IXTA 3T1FB 1UM5L 1K3IA 1AR1C 3NJJA 5EFIB 2IPUK 2DS4A 4P2OA 3GXDA 3A24A 2B16A 3AB0C 3BZ5A 3VQMA 3IB4A 3N0PB 1J8RA 1FNSH 1FFNA 2PW1B 1XR8B 3HAEH 1SPDA 1OP9A 2RALA 2CIKB 3SYCA 3UCQA 2BK8A 1VGEL 5B4MD 3CN0A 3D0VB 4PJHF 4APQA 3NJNA 2X1OA 1SEQH 3TO4A 4FC3E 4HOWA 4BSWB 1KJ2H 5I0YA 4JPQA 2B0SH 4NQTA 4E41E 1XDTT 3WELA 3UIZA 4GRWH 4I18B 4L3EB 1TT6A 2JE8A 3D69A 3SPHA 4J39A 3BH9A 3CDCA 5EF2A 1KN2L 1GYAA 4OCYH 2DI7A 2JWYA 5D7IB 3C9NA 4NYLB 3WTWA 4KRPD 5E8EA 4QRBA 1BQSA 1BXUA 3KPQA 5LAXA 5IHUH 5AL8A 3HC4L 4M8UA 4AKOA 2F5BH 1NPNA 2WAQA 3QYMA 1NGZB 4ZUTB 1IKFL 4DK3A 4UOQA 1LO4L 3W11C 4JO8A 1EAPA 2IDFA 2X0VA 3P2DA 3VG0L 2BM3A 5EF0A 4XCEB 1S9YA 3OM3B 3GXIA 2CHNA 5HDBB 1SNRA 5L7XL 3IKKA 1QKZH 1QRKA 4PRID 9CGTA 4AW4A 1T5KA 3NRPA 4ABQA 2GTWB 2BNUB 4L0ZA 3KBEA 3OR6B 4PW9A 1S7XA 5KVEL 1WC7B 3FU8A 4KJWD 4GG6B 2FT7A 3KPSD 2ITCA 3WDIA 3HRZB 1PIGA 5E8OB 3INUH 5F8QC 4YHIA 2NYKA 1S7UA 4PP2B 4D9QD 3B2VL 1FE8L 3KPRD 3HG1A 1TEYA 2OSWA 2XVGA 4G42A 3ZRCC 2IANE 3H42L 4M7KH 4F8QA 3PNRB 1GY1A 1NEZA 3CZGA 4F2MB 2ZUXA 4I0KA 4HW6A 2W0PA 4WEEA 3SKUD 5IVZA 4OUUB 3SO3B 4CJ0A 3HFMH 3K6OA 4Y4FB 5GSVA 1Y18B 4QOKE 4X8JA 5HDQL 5IJVA 2H2PC 2X42A 3T0ED 3VQ1C 3EZ8A 4P06A 1PZDA 1TQBC 1ZS2A 4IRSB 5C08D 5INDA 2OMXB 4HULB 4N2CA 3UTOA 4K9JA 1XBDA 4P04A 5D7JD 5IIEA 4IU3A 3NCXA 1GGCH 4GMTL 4F7KA 1OHZA 2PYFA 4HT1L 4IDLA 5H2BA 4UT7H 4O5LL 5H37A 2RB8A 1UFGA 1T0NB 3HNSL 2DWSA 1IQWL 2IDQA 3JWOC 3QJFA 4DKEH 2EIDA 5HYSG 1LL1A 2V17H 3F62A 1B3IA 1JHKL 5BW7C 4G7YH 1JNJA 4XB8A 4DKAA 1JJUA 1MHHB 4R26H 2E4FA 3VGDA 1YEHL 3PWPA 3EYQC 2H0JA 1Z9NA 2HFGH 4DP4X 4D0CB 1FPTL 1ND0A 3TCLB 3PYCA 4AE1A 1NTDA 2XN9E 5K59F 4F2FA 3O6LH 4YE4L 3A22A 3KXFA 4ENEC 4NDMB 1XXDC 2MH4A 1CDIA 2J7LA 3VXPA 4GRLC 2CUAA 1TVHB 1E65A 4Z7NE 2QZ5A 1P1ZA 1FYHB 2AVGA 1X5IA 3C75A 3MV8E 1LEIB 3QPXL 4HGWB 4FFYL 5EU6E 3FBKA 4NIYE 2V3FA 1JZ6A 1CDHA 1SMDA 1RK0B 3QJVB 1PPIA 2BO0A 4ZXBD 3IMSA 2YOAA 4F3FB 3QIUB 2F53E 1G7LA 3OXSA 3B2PA 3VH8A 3C09B 4YEFA 3QWQB 5IFAL 2Q7NA 1MVUB 4WSGA 4WUKH 3DGGB 2DLHA 3IDYC 5GGUB 3LKRA 3C5XA 3K72B 4GXVH 2MNUA 3CAFA 1SEBA 2OS7A 4ANUA 3UJTL 2Q9OA 1Q4NX 4F7MA 4HUCA 3LAFA 1QPPA 4QAWA 3IDMA 3LNDA 3T4AA 1OD7A 1UACH 1RMFH 1CWVA 1I1FA 4NUPA 3TN0A 5LNEA 1GZHC 1JPFB 2J8OA 2WINB 2XY1A 3HEIB 4XT1C 3A4FA 2BSTB 3GI8L 2XKSA 2NY5L 4QHUA 3SDAC 3W39A 1QPKA 1R46A 2R4RH 1DQLH 5ALCL 3N2JA 5FHAL 1MCKA 3GHEH 2Z9TA 2AEIT 3ZVVA 2QDWA 4QGTA 2M83A 2NLJA 3JZ7A 2CR0A 1NC2B 3V5HA 3B9VA 5EOQH 4BELD 3APFA 4GW4B 5EU5A 5KG9B 3U1SL 1CCZA 6CGTA 2YD2A 1WZAA 2ZWNA 1EK3A 3QQXA 4AJWA 1GTFA 3RFZA 1LO2H 3MBXL 1AHWB 2P26A 3MXWL 4PMFA 2ARJA 4FYSA 4OGXL 5ANMB 1JMZA 2W9EL 5FCUH 2OXHA 1KNOA 5IBUG 1L5GA 1U8QA 2BCKA 1RIHH 5F7EH 1S9XA 3KL3A 5DF0A 3ULUH 5BPPA 1WSST 4FHJA 3ZE0B 3DDGA 4I0PA 5EO0B 5IROA 3W0WE 1PDKB 1GMEA 2YEQA 1BZOA 3CFNA 2Q76B 2XZCH 1QEWA 4J3OD 4AVJA 4JKNA 3L9RB 3VRJA 5DRXB 2CLVA 4MDJB 5JORB 2Y6TE 2P8PB 1U36A 2Y7LA 3P3RA 4XI5C 3ILPB 3QCUH 1G0XA 1YYLH 5FB8B 4XN8A 1WHOA 4KXBA 4JZOA 5HI5C 3Q3GB 5IFJB 4PHXA 1LMIA 2D0FA 3WFHA 4FXKC 2FL5A 3MCG1 4Y19D 1R5VB 4J1UB 3JWDC 4K07A 3BP5B 3AREA 3OKKA 5FYJU 4LIQE 3U4EB 3K91A 5ENWA 3MMEB 1KJ3L 2OQJB 3AXLA 3QDGE 4UMGA 5FO8B 4EUPG 2OSLB 3EGXB 3GJFK 5HHQB 4LSQH 5ID1A 2ZP0T 1N2RA 1I9EA 3TNNA 2FSEB 2R27A 4S1DC 3FCSA 2R9HD 5IJCC 1FIGH 1PMYA 2BIMA 5EPMB 1U8NB 5DJ0B 4ZUUA 2E7MA 4PB9H 1JDAA 2JKSA 4Z7QB 1I7TA 4MD4A 1A3RH 2APTA 4HIXH 1NBQA 5I76B 2G3XA 3UTQB 3DVGA 4W4OC 4YHOL 1EBAA 2EDDA 2CAKA 2YGVA 4FZ8L 3REVB 3NJHA 3TL5A 4RRPM 4MD5B 4AM0Q 3WJJC 1WCBA 2WBJC 5HSFA 1C5CH 1EDYA 3ROOA 2FECI 1S78D 1CF8H 3C5SA 1FL3A 1AZRA 3ARGD 1U4EA 1TSHA 2H6UA 5MHSE 1OTSD 5D2LA 3ALWA 3H9SB 1BQLH 1UWGH 4CSZA 1L9NA 1HC1A 5MERA 4M1GH 3WY4A 2A83B 3BOVA 2KLTA 3F7VA 2GEEA 4CC4C 5E6IC 1EERB 3BUTA 3LPWA 2XG5A 3CXDH 3PDGA 1NAMB 2D9QB 2DPKA 2RJMA 2AXHA 5I6XB 4M43H 1THCA 5F7KC 3SPVA 4WCYL 3MJ9A 3DXAD 5DFVC 4OZFB 2HRHA 3W38A 1WF5A 4P3DB 3SE3C 3LKOA 2IBBA 3JVGC 1XSIA 3MRLA 4A7UA 4E41B 2VMFA 4WKZA 1DJWA 2E7LA 3W9DA 4UOW1 3SQRA 1UA3A 1HEJC 4KO5A 2VLRD 3QPQD 3W2DH 4PLKC 5LBSL 2ZJSH 4GUCA 2FYYA 1R17A 1WA0X 1OE2A 3SDXA 1KTLA 1YJDH 1HXMB 4WFED 5GGRB 2C3VB 5SWQA 3L4TA 5DMKB 1OZTG 3V0FA 3WV0A 4UIMA 1R75A 3QUKB 2YRZA 4JPWH 2G2NA 4PJGE 1N19A 3BD4A 3QUYD 1KTDA 2VW7A 2YLKA 4MQ7A 4J8QA 1VSCA 3CVCA 2PPFA 2XTJD 1YECL 3B8SA 1I7UB 5AB2A 3EYVA 3LKQB 4JFVA 4Y5YC 1G7HA 1MCPH 1KCLA 4M5YH 4IK6A 3ATAA 4MMXB 3FMGL 3BWSA 2YAEA 5GJSH 3BPLB 3MRFA 5DHVB 4APQC 5CN2A 4ZS6D 3OR7B 3PABA 4Z7VA 2XTSA 3WAKA 1A66A 2X4TA 3QO1A 1ZGLB 2WQVA 3BEWA 4MQXD 3ZT5A 4QY8B 4NO0B 1GHFL 1UADC 4W9FC 2VNCA 1A0QL 1NGWA 1U8CA 2DQ6A 3FO1B 5DEJA 4C56E 2KYIA 4MJHA 5HYFA 4DFHA 1AKJD 4WU5B 2IO5A 2VR5A 5CZVH 2B39A 1T4KA 3N9GH 3OAUH 4FQCL 2HPTA 4OJDH 2E7BA 3BH8B 4RFNB 5HGHB 5KYXB 4LOVA 3QWNA 5A7EA 3DRTA 3UPRA 1TJMA 4BCZA 4G6JH 4JY4A 2IANB 1VHPA 2V5MA 1C08A 4LAQH 2W0FB 2ZX9A 2A9ML 3SE4A 2R8SH 5GHWH 1FNSL 5IG7A 1KCUL 3LN5B 2YARA 4L9LA 1T7WA 4OIBA 4B9IA 1B0RB 3BJ91 2CQVA 2R2BB 3BDXA 3V4VL 3M45A 4HWEL 4FFYA 1UFUA 5JHBA 4I48B 2B1HH 4DHLA 3L3GA 5F3HB 2B0SL 4U7KA 3D51A 3CLWA 4PJCA 3UPCA 3PL6D 1TQCC 3V5DB 3S5ZA 4ZG1A 3UC0L 4HWUA 1OP5H 4OCYL 4RMQA 1QR4A 4P46C 5EIIG 5EH1A 3E6FA 1GPOH 2ARWA 3L6FA 3R06B 1KY7A 3E80A 4G9DB 4LLYB 4JO3H 4OV6F 1S7RB 5IHUL 3SGDH 1DSFL 3AU0A 2F5BL 1I75A 2Z7ZA 5T3ZE 4WTQA 3P4OB 3QZLA 1ZHKB 2DKUA 1JPGB 4OCWL 4AKQA 5IM7A 1JRHI 4NO3B 3CXHK 3F7YB 1XGYH 5E94B 2XN9B 5DSCA 3VCLB 4FYQA 5K9QG 3OD3A 2EH8L 2LR4A 3FFCB 2XPYA 4YIQB 5IMOB 2NXZB 2EVJA 4U0RB 4JZJC 4UUJA 5T1JA 4OLWH 3SSGA 4A2EA 5FYLD 3RYMA 4Z7NB 4AV4A 1DN0A 1YDPB 1QKZL 3D39E 2MEJB 3UAEA 5EU6B 1R6VA 3FU7A 4G9FD 2R23A 2WWKO 4AYGA 2XA3A 2XWJA 5HPOA 3LRSB 4ATTA 2F53B 2JTDA 2WGXA 3LEVH 1CXHA 4CADA 5AAWC 5IK3B 3C6EA 3INUL 3VTMA 5E2UH 4ELMF 4KTEH 5B8CB 4HHAA 2V3EA 3IF1A 4LB8A 1JN6B 4KROB 2LLLA 2GJPA 1H8OA 1SUJA 2D7TH 4M7KL 3HPLA 3IJSB 4LCIL 1ZS8A 3CX2A 5D71H 5C07E 5FK9B 5CGMA 1Q9OA 1MJUL 3CQFA 5D1QA 3GS0A 3B2UD 4AOFA 5JMRA 1D5IH 1QZNA 1JK8A 2CJ3A 5TF0A 1G6RB 4JPVH 5FUCE 3QEUA 3GBDA 3WCYA 4QF1A 4F93B 3JVFC 4UT7L 5F1NA 5FM5O 3WKNA 2W07B 4DKEL 5KSVA 2G3ZA 2OMBA 5C09A 1NICA 1HHHA 3QIWC 1KIPA 3I3BA 2V17L 4RZCB 1CDCA 5E9DE 4WFGE 4ZO7A 4RWYH 5FECA 3TPKA 4HOMA 4G7YL 4OFPA 2VJXA 1PJWA 3F58H 3QNYB 1JZDC 3SQBA 4EZKA 5EBGA 4GT0A 1IKNA 4KQ3H 1YMHA 2DQUH 1DE4A 2WSPA 1A2YA 3VSQA 4PV9A 1HHIB 2ZOKB 3EFFB 1GOHA 3IN0A 3MLWH 4NQDD 2E9BA 3L2MA 4OGAC 4QRPD 4OAWB 4RLDA 4U1GC 1W0VA 3T4AC 2VGLM 3O6LL 4RRPG 2BSBA 2EC9U 2NY3D 3B9KC 3U79A 2WZPD 4YQXL 1X5MA 5KOVC 3CFMA 2AZAA 4U6YB 4MMZA 4TMPA 3UDWC 3PWNB 1CC3A 2NR6D 1J9RA 3L3IB 4TSAL 4E42B 3FHQA 2XQBH 4LCCC 3RB7A 1F90L 2PMZA 4NC1C 5E2TL 3LPOA 1FH2A 3DX8A 2HMID 1IBDA 5L2KB 3PWLA 3OAYH 4IGBD 3WLBB 4NFBA 5BZDA 4PS8A 4XB3A 5EEVA 2YD9A 1S8DA 3AC0A 3MJ7B 3RLSA 1ORQB 1U95B 3PV6A 4GXVL 4AKPA 4FI6A 4EUPH 4OTXH 3S4SG 4XCFH 3EYFB 1CL7L 1BJ1J 3QXDA 3TBSB 2H3XC 2BLFA 5EUOF 4NQXA 4X6DA 1AJ7L 2JI3A 2B77A 1UACL 1YZZA 2DMKA 4W9HC 1IU1A 3PWUB 4GBXB 4QT5B 3QUZA 1X7QB 2DYPB 4TNVF 4XCYA 3O9WC 2HSIA 4FG0A 2OMNA 4YZFF 5DCCA 3R18A 3BIKA 5FEBA 4KAQH 1I8LC 4PRBB 2D31A 1G1CA 4NQED 2R4RL 2O5NA 4HCRH 5EZLB 2VW4A 4W68A 4DP1X 3Q43A 1SF5A 5C7ZA 4N9GA 3RVWC 2Y06H 3MA9H 2H45A 4QKTA 2ZXBA 2ZUWA 4BKLA 3P2BA 3NEOA 4JFZH 3BDYL 4DVRH 2Z1KA 3KLSA 5LBSA 4AEHH 4GYBA 4XO5A 2OSXA 1KXTA 1NC4A 5TFSH 4BFBD 1J1PL 1WZKA 5A2IH 4KK8C 4WK4B 3X1FA 1LP9A 1UOLA 5FCUL 1GJIA 4LARH 1QSVA 2P9RA 2HYMA 2QQQA 4N1EA 4MSWA 5F7EL 2NXYC 1G5AA 2Y36H 3ULUL 5D7LA 4MDIA 4QI3A 1HZKA 1NCGA 4F1ZA 3VVVA 4MCMA 3MLPA 4UBDC 4O58H 5F96H 1I8MB 1JAEA 2CK0L 3LPFA 1VACB 5ICXB 2MCMA 3W81A 1C1EH 2YD4A 2PR9A 5E0QA 4JHBA 1WBZB 3K0YA 3WHE0 1YYMH 3FTXA 3QEQA 1CYWA 1YYLL 2K78A 2VSCA 2YEVB 3UP1A 3VXOA 4RISH 5BXFA 3MZTA 2W95A 4FXGC 1W72B 1I7RB 1YAIA 4Y4FD 5TDPA 4E5XG 2NUPA 4GJTB 4KWUA 1NFDA 1AR1D 3DX7B 4GUPB 4IRSD 1DQQB 3QK0A 3PHOB 3LS4H 2C9PA 2X1WL 3MRKB 5DEFA 3VGAC 5KYUB 4JDTL 2A7BA 4KXAA 3RAJH 1JD9A 3H53A 4XE5B 4KKZA 4N2IA 2AQ1A 2YWZA 3F7PC 2BOBB 1PYWA 4PJGB 4NJAL 1P84J 1T4WA 4FS0A 4JM2B 2RH0A 3U2SB 2HVBA 4UT6H 2IGLA 4YSRA 2CA4A 1IAOA 5E6ZA 4RA0C 1S7QA 5CN3A 3V4VA 4HJGA 5I8EB 3WFDH 2EIZA 2PTTA 3VXQB 1A3RL 1BFVH 2BSDA 3DJTA 5EDXA 5AKSA 4ACPA 4YBLB 4HIXL 5I1HL 2L7QA 1NDTA 2YAFA 2K9FB 2ICEC 3F5WB 3KE0A 4MXVE 4AGPA 4W9ZA 3K80A 1NUNB 1W0WA 2IADB 2FBJH 4J6RH 4I3RH 1QNIA 5CLXA 1RK1B 5IMKA 3WEOA 4BUGA 5BNXD 1MELA 2ZXQA 3MBEB 3VE0B 4C56B 1IIIA 2J72A 1ZTMA 1N59A 4PLJD 3SYAA 4BZ1L 4EI6A 4OCSH 3ZL1A 3OAZK 4I0CC 2HZHA 4QRRA 2SEBA 3MLUL 2AAAA 1F1DA 3ARBA 1UWGL 4YC2C 2YPLE 5JW4N 2ADYA 4W4NA 1CE6B 3KR3H 3QIUD 3TBTA 3A3YB 3T2PA 2QDVA 2VLLA 3CXDL 5HJGA 2IBGA 3AT8A 1FA4A 2A4CA 3KCWA 1AO7E 2BJMH 4YUEH 3ESPA 3QZPA 3OJDB 3FHEA 4NKMA 5A2BA 3FTGA 1U8MB 3TTSA 4ZMWA 4NRZB 3FKUS 4GLRI 1KYFA 1J05B 4Y5XC 1OSPH 1RZIA 3EH2A 4I9WD 5H94A 6TAAA 5DWPA 3SDXF 4X7EC 2PP8A 4X9GA 1IC4L 4NSKA 1KLFA 2VLKE 1UD8A 1CVRA 2GC4C 2WZAA 5D1ZI 2ZJSL 2EKSA 4PJ8B 3D34A 3O0LA 43CAB 3RUGE 1YPZB 1YJDL 1CFSB 2IH8A 2NY4B 4G8EB 1Z5LA 4D7BA 3ULVH 1UXWB 3VACA 2NX5D 5SX4H 3BVWA 2CKBL 3MGTB 4WV1B 4H4NA 2MNJB 4ZTPH 4FQ1H 1UHVA 3WJMB 4R7LA 4DZBA 3I75A 2COVD 1CN4A 5AZUA 4IHOB 5GXBB 3RNQB 4CU8A 5IJKA 2P8MA 4PVNA 1Q1PA 3FO0H 1BG9A 3LZNA 1PZCA 4M5YL 2J2ZB 4K15A 4QHMA 4F37K 3GI9H 4GO6B 3ZHNA 5GJSL 3NMEA 4ZYKB 1MAKA 1G7IB 1YAZA 4LL1A 3TO2A 4Q2ZB 4Y1AD 4JREB 4Z3FA 2YD1A 4RSYA 3D39B 1I1AA 5MENE 2APWA 3UABA 2QV2A 4LCUA 2NY1B 1SOSA 3G5XB 2VN3A 2I24N 4EN3C 3TESA 1U8KB 4DKTA 4WJKB 2YUXA 3LPGA 4QRQB 3B7RL 4HUVB 1DZBA 3GMRA 1NANH 4P4KB 4YR6B 2QPSA 1XEUA 2NW2B 1BBJB 3LDBC 4HKZB 3F6LA 2DD8H 2CNYA 1KC5L 3UEZA 1QFHA 3RJDA 4TXVB 1OQXA 4ENED 3ZT6A 4XN5A 2P80D 3RNKB 2R8SL 3HZ3A 2BVEA 3T0AA 1Q9WB 1M2OA 2Z8RA 4ZBJA 5FR3A 4PG2A 3ZTNL 4Z0XA 5C07B 4O4YH 3UBXB 4OIAA 4PJCF 1T5WA 4WSKA 3V6BR 5KYYA 4GKNB 4I77H 4XMXA 4HS3B 1A8ZA 3UTTB 2B1HL 1KFAH 2NYYC 4KDVA 2ZF8A 1HAUA 1ZHNA 3R0NA 4XVJH 3O3BB 1UEMA 1FH5H 3CC1A 4FGMA 4GSQA 4ONHB 3ZZLA 1MF2H 3DA0A 4A67A 2OTUB 4X4XB 3NGBC 4M4RA 3ZL2A 4TLSA 3NIGE 2G0LA 3QZWB 1G7JB 5E9DB 3UL4A 1GPOL 1BVLA 3VI4B 3VQLA 4DUXA 1AKPA 2D7MA 1AXSA 2MTPA 3ES6A 4UM9B 1ZTXH 4JO3L 3KZ8A 1GVIA 5GRUH 5CJOH 4FFVC 4JPKH 4G1EA 4JFTA 1PL3A 2QR0A 1A3ZA 5E4OA 5IVXA 1KPRB 4OBSA 5D1XA 4KNQA 3IRZA 3NSJA 3UTSE 1XGYL 3MCKA 4RETB 2DLFH 3MRRA 1KZQA 3ZZSA 2O61A 1ZPUA 1A4KA 4HH9A 3VD3A 1QFWM 1TQVA 2JSFA 2VERN 3H9SD 4JY5H 32C2A 4FKEA 4B5ZA 3WFEL 1BF8A 4D0BA 2AW2A 4PRPE 4Y16A 2YN5A 4A2HA 1MAML 5C70A 2EDNA 5C0CE 3G5VA 2LU3A 4N0UA 2JJTC 3IU4H 5BO0D 3HZKB 3LEVL 4PJBB 4KMLB 4U3HA 5ELIA 3CMGA 4L29B 3SQOL 5E2UL 1JVOA 2MQCA 2DQEH 4KTEL 1KPUA 4QRAA 3T9WA 1MRDH 1DVTA 2DJSA 5KSAC 3WYRA 5I5MA 4X4MA 4W70A 4RDQG 2D7TL 2ZG2A 1B0GB 5T3XE 4LRNL 3KBHE 2MHAA 5DRWB 4JPIA 3T0XA 1HYRC 4D3CH 4N2HA 1V54B 5D71L 3S3BB 5JHLH 4ONGH 5AD0A 1B3JA 2WKGA 5IREA 5D1ZB 3TTYA 5DZOA 1F56A 3MO1A 4TQEL 5IF0A 4XI5D 1D5IL 4MBOA 2C7UB 2Q87A 2XBDA 4AZUA 4RAVB 3PUCA 4U1LB 5EZIH 5DI8A 2CM5A 2FSDA 4XH2A 2E4TA 5HI5D 1K8DB 2DQJH 4JPVL 3FQTB 5L0QB 4L4VA 4XE0A 1PKQA 4JE0A 3AS1A 3QQDA 4RFOH 3I6SA 3U7WH 4OD2B 1CK0H 1JXJA 1WFTA 1ZK9A 2YPVH 4C59B 4O02B 3WUZA 5EZJA 4RMWA 5MEPB 2CBPA 3MKKA 4J3SA 2VDRH 3S5LB 4X0KB 3F6JA 2FX7H 1U3ZA 4PJXA 2V9RA 4KQ3L 4XNQB 1FC1A 4ZW8A 1DQDH 4S1DD 3QHFL 1BEYL 3WIFA 2R1YB 3MRIB 3RA7H 1URIA 1L0QA 3NZHH 4JRYD 1SJHA 5J12C 4CVXB 4P9HH 2FBRA 4YO0A 3ZE1E 2I60H 2X2UA 4F8NA 5ERWB 1FAKT 3GXNA 3AVEA 4P0DA 2Z4TA 3S37L 3FQXB 3OSVA 1IFHL 4ZDHA 3SOTA 5HHVL 4GB9A 1JGVL 1SF3A 2EIMB 2HTKC 2WBJD 5JW5B 2XQBL 2PYEA 3V10A 1R1CA 3QCTH 4NN5C 4PJDE 1QEXA 2J5LC 1RZKH 4B41A 5CJXA 2RMNA 4Y4HB 1SYSB 2WO3B 1X6NA 2I7OA 2DQGL 4LEOB 4QHLB 4BZ1A 3QPKA 2EDFA 3PWVB 2G9HB 4ODHH 2XN0A 4LGPB 4MAYB 1E8WA 3VXMA 3X11A 5E6ID 1C7TA 4OTXL 4JEGB 2ZYIA 4MQSB 4RGMB 4XCFL 4I1RA 1P4LB 4BDVA 2D3JA 4I2XE 5D4QA 5DRNA 4HIEB 1G7MB 4CW1B 3QIBA 3HN8A 1WTLA 4BFIA 4IEFB 3NJKA 1KBBA 2MNWA 2A9NH 5DFVD 4P2YA 4ZTOH 1MNUH 5E08H 2BY0A 1DLHB 4WGVB 3CLEL 3JTSB 1YMMD 1NQBA 4KAQL 4BE6A 2XIDA 2BVTA 1TDQA 3SGKA 1LO5B 4O2FA 2XJKA 5F7MC 5BS0D 2Z0UA 4PRHD 4JFDE 2A6DA 4Y4KA 1YN7B 1FVDB 5DD3H 3UPAA 3O8XB 2VR3A 2Y06L 3MA9L 4NS0A 4PLKD 3FT4B 5DS1A 3RVVD 1YEKH 1NDGA 4C4KT 3WGVB 5LO7A 3FFCD 2NXZD 3MRHA 4DVRL 1NMCC 1FCCA 2QKIC 4QHPA 3MV7A 1LILA 5KYWB 3L08A 3KWWB 1OT2A 1T20B 4PGBA 1MIMH 4WW2F 3WNIA 4LARL 2YPLB 1JCKA 4MA8L 2CKBA 1M56B 4Y7OC 3EBAA 2Y36L 2A9AA 5HDOA 2DB8A 3ZKND 1HESA 4NZJA 1S7TA 1U8OB 3H3PL 5F96L 4S1RH 4XX5A 5LGHH 1AO7B 1B4LA 2J3SA 5EZOH 1W2KT 4YVUA 3TBWB 1N6UA 4J6IA 4K8RD 2Q6WA 5LXGH 5B7MA 4RISL 5EU3A 2WY3B 1EZUA 3EOAB 2N59A 1KELL 3E8VA 4RIRB 3CX5J 2XXGA 3C2SA 2D7PA 3K5RA 3M7FB 4JG9A 2VLKB 4FP8H 3FQRB 3L48A 3RHWF 3LS4L 2YBRA 3ZE2F 1J5HA 3K2MC 2MQ3A 1FN4A 2YLHA 4LEBA 3RAJL 2V8MA 3RUGB 4J2XA 1Z9PA 3DPBA 1BVOA 3KH4A 5IB5A 4WTZG 1DVFB 4XPFH 2JKWA 1NCWL 1UM6L 5DU7A 3X13A 1XH3A 4LL9A 4N0YH 1ES0A 4JFYB 4GRWF 4UT6L 3VW3L 2LLNA 1BM3H 3ECQA 2VISB 3T6QC 3MV11 4Y5VC 1BFVL 5I0VA 1AHKA 1UGNA 3LQAC 1QUNB 1Z9MA 1TJIL 5I0DA 2VZVA 5MEQA 1H8SA 3V0VB 2GKIA 1V7MH 2UY6B 4P46D 5MENB 5HYSA 1HQ4B 4U1IA 1FZJB 4I3RL 5CP7A 4LASL 1INQA 1NIDA 5EC2B 3P54A 1TQWA 1CR9L 3L1FA 2AV7A 4FQQB 2OJ1A 4OCSL 1UT1A 1QI5A 4XPAH 2JJWA 3VFGL 1ZV2A 4N8VG 3X2QB 4M8QA 5IBLC 5JNYB 2DTSA 2Q86A 5KANG 5B1JA 1DBMH 4HKXB 4YGVB 1MCQA 2VDNB 3KR3L 5L2KD 1HJBC 4EBQH 4ZSOA 2VMEA 5C92A 1XGTB 2CLZB 4G72B 3WDHA 1XGPB 4KH9A 1QWNA 2B2XL 2BJML 3BHBB 4YUEL 1PY9A 1BVKB 5E4EB 1TITA 3LD8C 3DMMA 1R3JA 2Q7YA 2V5YA 2AJSH 4U1KB 3HNTL 4TUOA 1LE9B 2AJZA 4EOWL 3G9AB 1GKEA 3OJMB 4XRCB 5FGBA 4HPHA 5EF1A 1N7MH 3HC0B 3BX7C 5C86A 1XGRB 3GSQB 1OSPL 3LOWA 4XNAA 4BFRA 1S7SB 4WWKA 1S7WA 1BX2A 3MROB 2NY2C 2W8CA 3NIGB 3IN2A 5FS5A 1H0DB 4O2CA 2BHZA 5DK0B 2OJEA 1EVUA 3X12A 2FD6H 2WUBH 2OPCA 3QR1A 4ALAH 3ULVL 3EUUA 5K39A 5GGTH 2IV8A 1HOCB 5DHDA 1DBBL 3KAAA 2EACA 1UA6H 2AFNA 1KG0A 2PPAA 3DX9A 2IBZY 1T1YA 4FQ1L 1UZ8A 4ZTPL 3UTSB 4ZMQA 1V55B 5BRZA 2EO9A 1ED3B 3L4UA 1A1OB 2Y1ZA 1JWSA 2P24B 3FO0L 2DDQH 3PGDB 4KZ0A 2NY6C 1XSKA 4WY7H 2LU4A 5MHSD 2R51A 3SJVA 2EYSA 4LNRB 3PXJA 3V6FA 3QI9A 3MUJA 3FB5A 4PRPB 3UAJC 4GG8B 5CJ8A 4YDVB 5E6UB 5C0CB 4TULL 4E68A 4X2UA 3S34H 2XWCA 3VG9B 2P8LA 3EIFA 3LS5L 4OSUH 5C0BE 4HBCH 5E6YA 1XCQB 5IQLA 4X83A 4Q6IA 4S1QH 4KXZI 4W9LC 2K6ZA 1SN0A 5JA8B 4TQHA 4L0YA 2IAAC 3MRJB 4OGAD 2DD8L 2K7PA 1JHLL 3G6DH 1HL8A 2W38A 3B9KD 2EIBA 3K0WA 4HG4J 2X2IA 4LVOB 1W8EA 4NOFA 3CSGA 2IPTL 3GLAA 3PWJB 5GZNA 4MLIA 4FNLH 1OCWH 4GSXA 3FONB 3ORJA 4U1NB 1BWWA 1JZEA 2F1AA 5SWSE 4UTBH 1KFAL 4IKKA 3VU1A 3KPLA 4Y16C 1PEZA 3OX8B 3AT9A 4RAUB 3VXSA 1QTPA 5DYFA 4PRDA 2ENQA 1ZVSB 2X4OB 2H6PB 2NQDA 3BAIA 5HYJA 5SX5K 1JV2B 1MF2L 2IDTA 2R29H 4JM2D 4UDUB 2M1KA 2ZONA 4FNPA 1ZXKA 1J88A 2JCCF 5IVXF 9PCYA 3LZLA 3BZFB 2V0AA 5C7XL 5T33H 4EUPA 4O2EB 1YC7A 5GRUL 4PJFF 4J7RA 5HI3C 3ZHLA 5ESAB 1ID2A 1M2VB 3EF4A 2RBLA 2VDLB 2YR3A 4M1CC 4XWGH 2HKHH 4TVPE 4AV0A 4ANVA 3TGXA 3KYOA 3L5XH 4XPGH 5E1AB 3MBED 5FOBB 1FV1A 4FI7A 3PFQA 3POCA 1B2WL 4HAFA 4DGYH 4JY5L 4NNXB 3LIZL 3ZO0A 3P4NA 2BPBA 1QO3B 3RVWD 5FYJH 4EPSA 1TU2B 2HX7A 2X1QA 3WO4C 1UEYA 1ZVHA 3AAZB 3VWJC 2BHYA 5TDOA 3V0GA 3IU4L 4PJDB 3GMNB 3RWGA 3PP4L 1FL5A 1PLCA 1YEFL 3S3PA 3IJYB 1TTUA 4YDLB 4KDWA 3ULUF 2Y3AA 4ZNEE 2DQEL 25C8H 2YKLH 2WN2A 2GBVA 1DBKH 3TFKD 1MRDL 3TBVA 3LYRA 1TEGA 2OKMA 3L3OA 3SPCA 4H25A 2CNZA 1G0YR 3N1QC 3VFNB 3SDDB 1K6QH 5T1DH 4PCKA 4UBDD 2FWLB 4FL4B 4D3CL 4I2XB 5JHLL 4ONGL 4PB0H 2DQTH 3L3DA 3ZX1A 4NCC1 4DP7X 4PHZA 2PWGA 1DQJB 4YHNB 4R6UA 3MZGB 5EZIL 2OR7A 2IFGA 2W80C 3IPBA 2FLRT 4TNWK 2DQJL 3NPSC 3T8MA 3TASA 4P2RE 2E74C 4JFDB 4RFOL 1RZJC 3RKPA 2OM5A 1CK0L 4IW4C 1IEAA 5J1SC 5CAYB 4M93B 1ERNA 5CWSA 4X0NA 2BNQA 4NI6A 5CLWA 3JXAA 1BDYA 3HZVB 2VDRL 4WEBL 3NSDA 2FR4B 1YEDB 1KBGH 4ZD3L 1WAAA 5AYUH 1MFNA 2FX7L 3D2UB 4XXCC 4DO6A 3QDMA 1OP4A 1R5IA 2GCYB 1FGVL 1X4ZA 2VLMD 3D39D 4LP8A 4HJJL 3RA7L 1ZHLB 1WP6A 3DHPA 4BFNA 3NZHL 1D5BB 1NCUA 2YQ3A 2VN4A 3NVQA 4KKLC 1J0HA 4OD1L