3QW9A

Crystal structure of betaglycan zp-c domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
170
structure length
170
Chain Sequence
PNSNATFNMELYNTDLFLVPSPGVFSVAENEHVYVEVSVTKADQDLGFAIQTCFLSPYSNPDRMSDYTIIENICPKDDSVKFYSSKRVHFPIPHAEVDKKRFSFLFKSVFNTSLLFLHCELTLCSRKKGSLKLPRCVTPDDACTSLDATMIWTMMQNKKTFTKPLAVVLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine receptor
molecule keywords Transforming growth factor beta receptor type 3
publication title Structure of betaglycan zona pellucida (ZP)-C domain provides insights into ZP-mediated protein polymerization and TGF-{beta} binding.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 29
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qw9A00
3QW9A 5BUPA 3NK3A 3NK4A 4AJVA
chains in the Genus database with same CATH superfamily
5CR8A 2E4TA 1FV1B 5DHVA 2R51A 3C5SA 4UQ9A 1VGEH 2FUTA 5A2LH 1JRHI 2Y24A 2H7WA 1ASOA 5BNXD 1HN1A 1T66D 1PX8A 4M7ZC 4PJ9D 1L9QA 2HWZH 1RP9A 5TFSL 5J5EA 4IDLA 3QPKA 2VISB 4KX9A 3OKDB 3E1F1 3HS8A 2O6DA 2I5YH 2WAQA 3MNWB 2HSIA 1MHHA 1HKFA 3DDFA 1YEHL 2D8KA 3QULB 3Q2CA 2JQMA 2Q8AL 4DESA 2OX5A 4F2MB 2ZP8A 4OKVA 5C2UB 3EOBA 3BKCH 3KDMA 4G9FB 4YC2B 1MWAH 4JBSA 1FZOB 1KLUB 1ORQA 3RTQB 1JZ2A 2YKLH 1LP9E 1NGWB 2NTSP 2AV7A 3QCUL 5I19H 1VFAA 3AT0A 1KJ3H 4X5WA 2Y72A 3HCVB 3ARQA 3U6XS 2XFGB 3HZ3A 2OYKA 3ZKXB 4JDVB 5ICUA 1XVSA 4I2XE 2V7HA 1MCQA 4YLCA 1HWGB 4Z3FA 4F58H 3HNVH 1J1PL 3KBEA 3DECA 1LTXA 5ICZA 5IEKB 1G7IA 3WEBA 1IGCH 3SYQA 5D7LA 1YEFH 4EN3B 4XVSL 1V3KA 4WFFE 3U2SA 3U9UB 3S8FB 5L0QC 2X09A 4DETA 3RAJH 3RY6C 5IBLC 1F2QA 3LPGA 4Y4KB 4GRWF 2AFNA 4J3UA 4F24A 4EUPH 2EH8L 2E76C 1GPOH 3KLDA 4FZEH 3L4UA 3L7FB 5L4JA 4LFHD 3VAEA 1P9MC 4HFWA 2DLFH 2YPLE 4GQPH 4L0ZA 3KXFD 5B39B 2HFGL 5HGBB 4ALAL 2A73B 3EUDA 4A67A 1VSCA 1GR7A 1H6UA 3P40A 4ZUTB 3N40F 2AEIT 2Z6FA 3S2AA 3WIIH 5D1XC 3D06A 1JV5B 1ACYH 1MCWW 4PRPB 2D4DA 5C6TH 1SXNA 3S4SG 5I0DA 2W60A 4KITB 4EIGB 4K4KA 1JGDB 3OMIB 4XMKH 4G8GA 1CE6A 1MRDH 1QI4A 2AANA 2KYIA 3MJ8A 1MLBB 2Y2TA 2O5NA 4DSYA 2A83B 4AYFB 1XGUA 3DV4B 3AXLA 4I9XA 4WNJA 3V0VA 3WG7B 3TZVA 4BQCA 1XGYH 4ELME 4BUQA 5IGXL 1OB1B 4XNZB 3LDBC 1PF3A 2V5RA 4MNGA 1JYWA 1T5KA 3BO8A 4OGYH 2Y7MA 1KMGA 1KXQA 1KJ2L 1WS7A 3GSQA 4FADA 3S2CA 4JAMA 2AXHA 4M1DL 2P44B 2F9BT 4UIKL 5SWZE 1VCAA 4O2FA 9PCYA 2EEDA 2AQPA 5ILTL 5LG6A 32C2B 3HNSH 2HLAB 3M1BB 4NQCE 4UYQA 1EIBA 5ERWA 1IAII 4F2FA 2ERJC 2BWIA 5EC1A 3JUYA 4IIQB 5ITFB 1GOFA 4ANWA 1EZSA 4RGMC 5CCKH 3V8OA 3WO4C 4JFFB 2BSTB 2IG2L 2YAFA 1YPZB 1FBIL 4NM8L 1CJYA 4PJ9A 1SJEB 5FW7A 1OF2B 3ZX1A 5DI8B 5DMKB 5IMOB 2VR6A 4D8PB 2NSXA 4YHNB 2OR7A 1BQKA 3PQYB 3FO9B 4XXWC 3S97C 3KR3L 2YC1A 5FYKD 1A5FL 2G2PA 4QHNA 3S8WA 2F2HA 4ECNA 5KYYA 3HC4L 4CC0A 2F7RA 1ZV5A 4G9FD 4NCC1 1KG0B 4CUCA 1AQ8A 4NQSA 3RTQD 2B2XH 3TASA 1H5BC 4LCWE 3ZR6A 4G6ML 2MFNA 1QLRB 3BWZA 2NR6C 4KU1A 2OMVA 4NP4L 3L81A 2GFBA 1Q4NX 2I7SA 4AZUA 1Y6NR 4DKEL 2F7IA 1MY7A 4JX0A 1GAFH 4JL1A 4K9JA 3ZDWA 3WD5L 1XAKA 4LARL 4RNRB 4W9LC 1P2CA 1SM3H 1Z2KA 3FC8A 5FA4A 1HIMH 4EN3D 4M4RA 2VLJB 4Q2ZA 2OSWA 1BFOB 2TSBA 1PW3A 3T6QC 2V37A 4WHDA 2A7BA 2AAAA 4GRMB 5CU5A 3C12A 4Y4KD 3KGTA 4TVPE 4ZMXA 5HHOB 1JNHB 1TEFA 4QJ3B 4IOIB 1BQHB 4KUCD 4HLJA 3KXFA 3L3JA 3NJIA 5CZKA 2RFXB 3WY2A 4Z76A 2WUCL 2G9HB 1XIWC 1HI6B 2IPTL 4ZD3L 4P0DA 3FU8A 5C1MB 5JO5A 5B8CB 1D7DA 5E9DE 1KNOB 5J13B 5BJTB 3CSYB 3E8UL 2WBJC 1DBBL 4O58H 2XT1B 3H3PH 4KDTC 4PRPD 2ZUWA 2LQRA 1SY6A 3V5DB 3LQAL 5BMFL 1GYUA 4JY5L 2WXNA 5EO1B 3GJFH 1FFNA 4F7CA 1X7QB 4TVUA 3NCCB 1KDJA 2YGQA 4Z3IA 2J44A 4EUPG 1RUQL 3GSNH 2UYLB 4M93C 4MB5A 3BAEH 2BRRL 5IW6A 4A2HA 3VSVA 1A7OH 1SDAB 1RCYA 3WIHL 3IGLA 1E5ZA 3NN8B 3IJSB 4OIBA 1CDJA 1MJ7H 3H2QA 4JQXA 3D39B 2GC7C 4KGLA 2FVNA 2Y07L 4KFZC 1OT4A 1Z5HA 4LT7A 4WI5A 5KVFL 1OAZH 5I74C 4JKNA 4Y5VC 4ZO8A 3FONB 3L16A 4PRNA 3QUZB 3OAYK 1FL6B 3OLEA 3LZRA 3BGFB 1QFWI 1RZ7H 3ASNB 4P4KC 4XAWL 2JVUA 2P24B 1I7UB 4X9IA 4QHPA 1FV1A 2W94A 2WVTA 4LESA 3SOTA 4E9QA 2CUIA 2JJSC 1S7QB 4H8WC 4M5ZL 2LHAA 3EIFA 3H4HA 5C0EB 2Y7OA 4GQ9H 3SN6N 4JFFD 4NCDA 2V7NB 2UXFA 2XBDA 4AEIH 2VISA 4YHML 3V55A 3OKDA 3PQYD 2ZYIA 3MNWA 2FWOB 4F2MA 3QULA 2R2HB 2YMXL 3VFWB 2H1PL 3BVWA 1ETZB 4MAUH 1CZ8H 4G9FA 3HFFA 3KLLA 2WSKA 3ZJAA 3DX9B 2M26A 1FZOA 1KLUA 3RTQA 4NN5C 3RFZB 1NGWA 3ZKMC 3DX2A 1ONQB 4X42A 3GSWB 4HQQL 3ARDB 5A2FA 3H4FA 3FTWA 2QVKA 3HCVA 5D7IB 3F6IA 5FK9B 5I26A 3ZRSA 1CLZH 4JDVA 3TM6A 1RZJL 2BZCA 3ZTCC 4L4VE 4PLNC 1F45A 1I8MB 4KGJA 3MACL 1A8ZA 4IBYA 1TZAA 5IEKA 4ONHB 5SWQA 3N85L 4EN3A 1WZLA 1C9SA 2HFFB 3D85B 5B1CA 3BRDA 4NM4H 2ZOUA 3U9UA 2VLJD 3APMA 5C97A 2B15A 4QKXB 5JIQA 4Y4KA 3SIKA 3S3PA 1NMCC 2CKNA 2HN7B 3GHBH 9CGTA 1RVFH 2VOTA 4UMGA 4Y9FA 5HJGA 3L7FA 5HHOD 3PAVA 4R3SB 3HBGA 2BOBB 5F3BB 1UJ3B 1YNLH 3MLUL 5HGBA 3PJLA 2L7EA 4LSQH 5J3HD 3CIQA 1CE1H 4NT6B 4N90E 2ZKMX 3NK4A 4ZUTA 3EF7A 3AREB 4JQIL 2KPWA 1JV5A 5FGSA 4PRPA 2FNWA 2YK1L 3LRGA 1PJ9A 2F18A 3RIAF 3B34A 2PYFB 4CGTA 5HHMB 4NBZB 4Z3HA 2EUVA 1JGDA 2F61A 4W9GC 4E9LA 1K8IA 1IQWL 1MLBA 1WITA 1FPTL 2ITCB 4MA7L 2A83A 4AYFA 2XPYA 1PZCA 3DV4A 1WUNT 4P5TB 3O6KL 3BAXA 3W38A 2Z65C 3V0FA 5DUPH 5E00B 3ABMB 3LS4L 1JZIA 1ZA3B 3FU3A 3PDOB 3TEUA 1G5GA 4AT6A 1YNTF 2C9XA 1OB1A 1PG7L 4PJXE 4NZRH 1Q90A 2IFGA 4CVZB 3H2WA 2IGFH 4Y2NA 5L9DL 3WDJA 2GJ6E 3MBEB 2X2JA 4H0IA 3IDNB 4KXZH 4L1DA 3T3PF 5A3IC 2V3EA 3D39D 4KMTH 2XNAB 32C2A 2HLAA 1VIWA 5KBMA 3QIWB 1SHXA 4JPIA 5I1IH 15C8H 1C08B 4NFBA 4AXWB 4IIQA 3QUZD 1YAZA 4N4YB 1G87A 1KENH 4NO0B 1F41A 4AV4A 5ITFA 5E7FA 1WZ1L 2JKIS 1CDHA 2H2SC 2F7OA 3SBRA 3WBDA 4PGEB 4JFFA 2BSTA 2IWFA 4JPWH 1UD8A 1YPZA 3RJOA 1SJEA 1VFOA 1OF2A 5DMKA 5DI8A 1O6VA 2BPBA 4M3JA 5IMOA 2FEDD 1DFXA 1MCHA 1OP5K 4D8PA 1B0GB 1OTTC 2KHAA 3O4OB 4GW5B 1LJMA 4YHNA 2QGCA 4F8PA 5DJ0B 1G4MA 3FO9A 1MWOA 2HRLA 2BDNL 1NJ9B 3DARA 3SGEI 1BMWA 5C2BL 1DVSA 1L6XA 4FL4C 1F97A 2NXZB 3CUPB 4HISA 4LCCC 2CMRH 2O4EA 1Q8MA 4K9EL 4OM0H 3GMRB 5HHPB 1KG0A 5KVDH 2EUWA 1TJHL 1RU9H 2QVIA 5HDQH 2FNBA 1HZLA 5F7EL 1TQUA 3NZHH 7CGTA 1J8HB 4NSKB 2NY2B 2VGLM 4IRSB 4X7SL 1W6WA 3ARDD 3PWVB 4TUOB 4XPBH 1QLRA 3GLZA 4OZ4B 3GFUA 3GJEB 1FFRA 4R26L 4F7EB 2E7DA 4Q9CA 2AQNA 1E8XA 2DMHA 4UMSA 1N5YH 2FJUB 2P4AB 4K7PH 3QHFH 4TOYL 4RNRA 4PPTA 3SE3C 1HINH 1KIPB 3L4VA 1S7TB 2J73A 1J9SA 1F00I 2VLJA 3D85D 1BFOA 4HXBL 4H26B 2UVFA 5L2KD 5E99H 3NP4A 5EU5A 1HJCA 4GRMA 1BJMA 1A9VA 4OD2A 4GAJL 4CKVX 4UQ3B 2WVUA 4S1DD 3IMVA 4ZOEA 1JNHA 1S3RA 3DROB 3FOLB 4IOIA 1BQHA 1P4LB 4MQ7B 4ZO7A 5HI5D 1ZE3H 2RFXA 3QDGB 4JRYB 2G9HA 1A47A 1HI6A 2EJ1A 3CFJB 2DBJA 5DC0A 4M6MH 5B8CA 1U8NA 3W1ZA 5GGVL 2B1HL 5LG1A 4KJWC 1KYOK 4UTAH 1KNOA 1GZHA 5BJTA 3CSYA 5AFAA 3ARED 5IMMB 2FR4B 4FQ1H 3R4DA 2YS4A 3ESUF 1S5IL 3V5DA 4K73A 4U3HA 1UEYA 5EO1A 4N0FB 5HHMD 3LKQB 2C9VA 1K4DB 1X7QA 3SDXB 4CSZA 4DHLA 2ZG1A 3MLWH 2E9JA 3Q2VA 4KK8C 5ESQB 1EDQA 2WXOA 4P5TD 2CGYA 3VGGA 5GS2H 2IWKA 5EOCJ 3QZBA 2VR7A 3Q5YA 5HYSG 1WD9A 4ODUB 5G4NA 1TZHB 2Z91B 3BCFA 4LOVA 3UJJH 5ITBL 2VSMB 5AEAA 2YXWA 3NN8A 5D4HA 3IJSA 5FC9A 2PR4L 2WXPA 3INUH 2ZKHH 3MBED 5D7LE 4S0TD 1LXMA 2WXFA 3D39A 4X4MA 4YK4B 3ZE1B 1KYOJ 4HZ1A 4DN4L 4YXHH 3QIWD 2ZWKA 3QUZA 3LNEA 1DJXA 1NL0L 2CO6B 1FL6A 1TTUA 2AHIA 2YGOA 3NIDF 3GYRA 2P24A 1I7UA 3VFMB 4NO0D 1KGIA 2GAZB 5I28A 2P5PA 1S7QA 4G7VH 4TNWK 4J3TA 5C0EA 4QXUH 3P11L 4F80A 2YPKB 4JM2A 4M3KB 2UWEF 1BPVA 4GO8A 4PIBA 2VDLB 2VH5L 5C3LD 1ZPLA 2FWOA 5I8EB 3FT0A 2HTKD 3ULUE 2R2HA 5EG6C 4FFZH 3V9EA 3A6BL 2NXZD 1ETZA 4O02L 3HAEH 3WIFB 1R5WB 3DX9A 3T3MB 2ARWA 3PABB 1L3NA 3W9DB 3RFZA 2WLKA 4N87A 5FUZL 1ONQA 5KSAB 2F5BL 2C3GA 3GSWA 5B1JC 3ARDA 1J8HD 4DKTA 2APFA 2NY2D 4WW2B 4A2MA 1A1OA 4N5EC 5D7IA 5FK9A 2JB5H 4PRAB 4WTQA 2AJVH 2RMNA 3F58H 2COVD 3MV11 1DQTA 5JHDB 2AJSL 3QUMH 3QAQA 1R1CA 1I8MA 1KXQE 1W80A 2YUXA 4MMZB 2LVCA 5TQ0H 5GS0D 3F2LA 3QWRD 4ONHA 5JW3L 4F15C 4Z8FH 3WFDL 4LEXH 3KLHC 4XMTA 4S0HA 1RJZB 1BBDH 1DJZA 1GL4B 1ZTXL 4XP9L 1ZWIB 5ELIA 2P49B 4JCLA 1TITA 4JFHD 1AD0A 5CP3H 4MAYC 2HN7A 4A6YL 1TJGL 1ZIBA 3U4KA 4R3SA 1OTSC 4FJ6A 4GNKB 1CT8B 5F3BA 2XVKA 4M6OH 4K94L 3QDGD 4JRYD 2OMYB 2HJFB 5E1AB 4W9FC 4NT6A 4OFQA 1OGPA 2BW5A 2HRHA 2DL2A 3AC0A 2I24N 4MJ5B 4XX1G 4YQXL 3N41B 1FFPB 3AREA 4LRIC 4DO6A 1B2WL 4RMBA 1UB5B 3UBGA 1NH6A 1ESOA 5F93C 2PYFA 4HIQA 5GGTL 4D2NA 1S7XB 2DIBA 2Z7YA 3BW9B 1T4WA 2GABA 5AB1A 3NSFA 2PWEA 3HI1B 4JO2L 3UTOA 4DPBX 3QA3B 2ITCA 2AITA 4UQIM 2GQHA 2LLLA 1TQCB 1RHFA 3MRCB 4P5TA 4G6JL 1XMEB 4R4NC 4YLQT 2G3ZA 5E00A 5C0FB 3ILQD 3O3AB 1V7NL 4KQ3H 5I6NA 1ZA3A 5HD8D 3PDOA 1MEXL 2HPTA 3QI9B 4A66A 2YD0A 5F0JB 2Y6SD 4BGLA 4APQC 3X14B 2R39A 2I9LB 1R3JB 4IDJH 4ZNEA 4CVZA 1CGWA 1Q9KB 4PYHA 4DIXA 3MBEA 2JKLA 4FXLA 3CN3A 3OKOB 3P3YA 3WLBB 1Y0LB 2C3VB 4J4PC 3LHPL 3IRPX 1N0XH 2XNAA 1T04B 1YC7A 3SBQA 3QIWA 3NH7H 2CGRH 1J5CA 1C08A 4C4UA 4AXWA 4NNPH 4LVOC 2Y5EA 1N70A 2XQBH 1IMHC 4NO0A 4C59B 3RZWA 1XCTB 2XDHA 5K1VA 2B8OT 3S35L 1JGVH 3QQDB 4KRMB 3S9DB 4PP1C 4IBLT 3WJLC 4PGEA 3X1EA 3KXFE 4G43B 4WO4B 1VJSA 3BC9A 1DVQA 3OXSB 1B0GA 2HB0A 2R9HC 4GW5A 1T5WB 1M9WA 4LCIH 2E59A 5DJ0A 2AK1H 4NWUL 4G83A 1NJ9A 1R6VA 2QVMA 3QW9A 3VFNB 1XSJA 1OLLA 1K6QL 3FN0L 4BSWB 3CUPA 4FS0A 3FTGB 3ASOB 2DQMA 3MLRH 4ZTPL 3LXUX 5JPNB 3GMRA 3GTVA 5DQ9B 1CD1B 1W72B 4L1BA 2YPVL 1MUJB 1Z9PA 2E8ZA 4M8VA 2WSDA 2FGZA 3HI5H 4F9LA 4LPYA 3CG8A 4OZHB 4JHBA 1J8HA 4NSKA 4IRSA 5KSAD 1PL3A 4MA1C 4TUOA 5CU9A 1DE4B 3P2TA 3PAZA 5DEZA 3GJEA 3Q9PA 1KLGB 4F7EA 1T80A 2JCCE 2EEXA 1RD6A 1KC5H 2PCFB 4JB9L 1G84A 4HAGA 5JHDD 3VA2C 5MEPB 3VXUB 1BD2B 1KTLB 1OGTB 3QWRA 5JUEL 3M1CA 2ZT9C 3BYTA 4M03A 5JA9A 5D93C 1KIPA 1XZ0B 1S7TA 1I1RA 2VERN 3W0WB 2NW2B 3J8F7 5AAWC 4H26A 1B88A 2EXSA 3HAEG 4R5TA 5A6IA 2MCG1 4MLIA 1RULL 2X6MA 5IBUB 4KXBA 4UT6A 2NCMA 3CN2A 1JHLL 2YKKA 4UQ3A 2X40A 1EMTL 5DYFA 3DROA 1IX2A 2BSED 3FOLA 4I7ZC 4ODTH 2N7AA 4Y2DC 1P4LA 4MQ7A 2UXTA 3QDGA 4JRYA 2R8SH 1MRCL 3CFJA 3V0EA 4OAWB 1BGXH 1PY0A 2MTPA 3K6OA 5IJKA 1A7NL 4OJAA 5FYKE 1JZHA 1Z3RA 3QJSB 1J7VR 3IGAB 2FR4A 5HDBB 1MPAH 4HPOL 2ZIDA 5DS1A 3TEXA 1UM4L 1G9NL 4PGBB 5F1SA 2G5BB 4G9FE 4N0FA 1K2DB 1HOEA 3LKQA 1K4DA 4UOW1 3VD0A 3GMQB 5DFVD 1AZVA 1Z9LA 8PAZA 2HPOA 4L05A 5ESQA 4UAOC 5FR3A 1TVHB 3DOIA 4RBPH 3WEOA 2P8MB 3UACA 1XGQB 1T21B 3CN1A 1MG2C 5D6DC 4OU3A 3QI9D 5L7XL 3E0GA 4ODUA 1MSPA 1TZHA 2Z91A 4GT0A 1TXKA 2BXYA 1NMAL 3AG3B 3HR5B 3LZNA 1JGUL 3ECUA 2MNWA 3SKNB 4NWTL 3HG0A 2AABH 3CBJB 2ODIA 4MAZA 2Y3NA 1MOEA 5AZ2H 2CO6A 4EPSA 4PLKC 3MLVL 4PVLA 1VERA 3VFMA 1U92B 3APFA 1RERA 2GAZA 3LPWA 5L8LB 1LLAA 2WQWA 4WIQA 1WFUA 1JIBA 2ZCLL 4OLVH 2W07B 1VHPA 4LL4A 4KXAA 2DQ6A 2YPKA 2V33A 4L8CB 3IU4L 4PJ7B 4R6UA 3R06B 4NGHH 4TF4A 3MLSH 3LHAA 3IXAB 4KKCC 1BWMA 3GF8A 2L8AA 5EBGA 2X4OB 5FM5M 2Z7ZA 4P2OB 4PRPE 4FXGC 1MIML 5I8EA 1CGVA 1DQDH 1IBGH 3AS1A 3U4BH 4B5ZA 3K2UH 5HVWA 4ZMVA 3WIFA 3EBIA 1R5WA 3BWAB 1ZLVH 1CUOA 4AYDC 3PABA 4XN7A 3W9DA 1UCBH 1S7VB 4LL9A 5KSAA 1KSRA 3WO3B 4WW2A 4I0PB 1A3RH 2PN5A 4PRAA 2ZOLB 4TNFA 3UERA 4Y9EA 3KVDD 2G9KA 4QPEA 4M7LT 4LAQL 1O9VA 5JHDA 5AW1B 1OM9A 1XGRB 3P30L 1FIGL 3DJTA 2NY3C 5CJXA 2C5DC 3GRGA 4MMZA 4FHKA 5FHAL 1BD2D 3HZVB 3V6ZB 2WN3A 2GC4C 1FF5A 3CFCH 4JO8A 3OF6D 4BFBD 1RJZA 1GOGA 3EW3B 3W0WD 1F0LA 1ZWIA 2YSSB 3KWUA 1UWXK 4HUXB 1BG9A 1HL9A 2B4CL 2WWMD 3DYMA 4KX7A 4H8WH 4JZJB 4NS0A 5CEZH 3V79C 4PJCF 2BIOA 2F8IA 4TSAH 2BSEA 4KHTH 1DBML 1NICA 1CT8A 4YNYB 4Z7IA 4N28A 1PU0A 3WFZA 3PG2A 4JHZA 2OMYA 1CDGA 2HJFA 2JKTM 4S1RL 5E1AA 2X9ZA 3PQYE 4K3EL 4MJ5A 1FRGL 2OCJA 1B9KA 1FFPA 2WLMA 1UUSA 2YFNA 1OTUD 2GI7A 3CLEL 3SY6A 3T0EB 1UB5A 3AWEA 4KNSA 4G6AC 5B3JF 1S7XA 1JHTB 2HH0H 3HI6L 2A74B 2ATPB 1V3LA 4LRNH 2X4PB 3CWGA 3QDJB 4ZAKB 3TFBA 4QLWA 3OKLA 4M8UA 4DAGH 3QA3A 2C7UB 2OKMA 4K23L 3DVIA 3DOHA 2B1OA 3MRCA 4Q56A 2N0KA 2OXHB 3QQNA 1GKEA 3O3AA 3FQNB 5IHHA 3QI9A 2E7LC 1KCVL 4KROC 3BSZA 3X14A 2HVKB 1R3JA 2I9LA 1JMXA 1SZNA 1Q9KA 3ETSA 4CC4A 1NLBL 2WPGA 3OKOA 4QRFA 3WLBA 1E3XA 1KT2B 3D9AH 3PUUA 3KPMB 1Y0LA 2C3VA 3NFNB 2VLJE 1T04A 2QKIC 2VXUL 4PSRA 1NKGA 4ERSH 2XQ0A 1MNNA 3UYRH 3S34L 3L3OC 1ZGLM 1RIVH 1XCTA 1MFMA 5HHOE 5LNEA 2W0LA 4JKPH 1HH9B 2YWZA 3QQDA 3O0RH 2OXGB 4G43A 1NTDA 4WO4A 4J7RA 1I7ZB 4GRLB 3GXFA 5BV7C 3OXSA 4EE2A 3IPFA 3N0PB 1P6AB 4I3RH 2P3YA 1U58B 2OJ1A 3VFNA 4P2OD 4DP1X 4BSWA 3FTGA 4HWEL 1P6WA 5CSZB 2H32B 3CDCA 2V5MA 1CD1A 1W72A 2DWYA 4HC1H 1MUJA 1UWYA 4KXDA 2CRYA 4OZHA 5J0BA 4ICWA 1J1OH 3QRBA 4LQ1A 5I76B 2CDGB 1J1XL 4CVXB 1C1EL 5AYQA 1DE4A 1K9TA 1PD6A 4I0PD 4ODWB 4YUEH 5AALA 3T09A 1XEUA 3FKUS 1B90A 1KLGA 3QQ4B 3WMSA 2WXJA 5DRWB 3W3BA 3MGAA 2PCFA 4N0YL 4OGQC 3GZPA 3HFMH 2EAEA 1ASPA 5MEPA 3VWJC 2Y1ZA 3VXUA 4C4KT 1BD2A 1KTLA 5DCCA 3ESPA 3D39E 3GHPA 2XV3A 3II3A 3OF6A 4KHXL 3L8QA 1OAQL 1Z3GL 1VACB 1XZ0A 4FFYH 2NUPB 4FQJL 4A7GF 1KJMB 3W0WA 2NW2A 3IF1B 2DAVA 43C9B 4DVBB 1PZUB 1UASA 4IRJC 1CYWA 4YHPB 3PHOB 3LTVA 4KY1L 2I60L 4DZ8B 2PUQT 3FUDA 3N50A 4OVUA 4V2CB 4I8DA 4HA1A 1IC4H 3O3EA 2YBGA 4X99B 3RI5K 4BGDA 4Q52A 2XXGA 3K3QA 2AQ3A 4CAGA 2ENSA 3FUNA 4OAWA 4NC0B 3SJVB 2MTAA 4MD0B 1CU4L 1BZ7B 1U36A 1DYZA 2Y7SA 3FRUB 3UDWA 3IGAA 4PJ6A 1AZBA 2XN0A 5DK2B 3ETBJ 2M8XA 4Z7OE 5FLUA 4PGBA 5FCUH 2EXTA 3T0ED 1CGXA 4M1CD 2G5BA 1K4CB 2QPDB 4HEMA 4EDWH 3K46A 1K2DA 1LK3L 1NBVH 4NLAA 1S7SB 1PQZB 2FEEI 1XB8A 4TLTA 2K70A 2OS7A 4AIZB 4ZAKD 2YJQA 3QDJD 1UUNA 1AZCA 1PG7X 3BN9D 3GMQA 1E4XI 4FTDA 3NJKA 1FGNH 3AG1B 5IBTL 4DUVA 5D7IE 3VTMA 3BE1H 1MCIA 1TVHA 1ZDSA 2P8MA 1XGQA 2VXSL 1TO4A 1USQA 4KPHH 2EH7L 4U7KA 3UZVB 5JHLL 2ICWB 3EXLA 2MQ0A 3HR5A 3HUJB 4EMZA 1NSNL 3DXAB 2QPFA 3KYNA 1HWWA 1VEPA 4HUMB 4U2ZA 2ZP9A 4WY7L 5TF1H 3SKNA 1DBKH 1A7PH 1NGQH 2WLLB 2BVUA 4FZ8L 5L2KE 3KYKL 3ZGIA 1J8KA 4IGBD 2F58H 2Y69B 1GGYA 3LAFA 5CLYA 4NQQA 1U92A 1IBZA 2OZNA 3TTSA 1B3JA 4AJ0A 1SBSH 2JELL 4AVKA 4DOHB 1OEZW 3IGFA 1S8DA 4XHJD 2W07A 4NRZB 4WNQB 1G1YA 4L8CA 3FQ4A 4GRLD 4PJ7A 3R06A 2EDDA 4ZXBC 1LO0L 4AGMA 3IE9A 2JIXB 2JMRA 3IXAA 3CHXA 2VJ8A 1V5JA 3SPIA 4AQZA 2X4OA 2NY5H 1IBFA 4XBMA 5LCVA 1RK1B 2D7TL 3PWPE 1A7RL 3RUGB 1KXHA 1GMEA 3LXAA 1HSBB 2DQIH 3QIBB 3BWAA 2ADIB 4Y5XC 1DCLA 3SO3B 2BERA 1RPUA 4RA3A 3NTCL 3QXTA 1S7VA 4OSUL 4WTZG 2I07A 2XVGA 3CXDH 4TVPH 4W9KC 1R0AH 4I0PA 3HBZA 4PWKA 2FX8L 3P9LB 4QGYA 4WV1C 4HS3B 4W9IC 2ZOLA 3BVVA 5JZ7D 3O6LL 5KAQF 1TTAA 3WDHA 1NGPH 1PTZA 1X5YA 1DJGA 3H53A 4ZNEE 1ZGLP 2IF7A 1XGRA 4S1SH 4YFLI 2WXRA 4YSRA 4ZS6C 3WTUA 3OAUL 3ZSSA 5L6YH 1NQBA 5DHMC 3ZLQC 3HZVA 3V6ZA 4JQVC 1UWGH 1QNIA 1G7PA 4CNIB 2PTVA 1QX1A 3G7TA 1GKOA 3CFTA 1KB5H 2VQUA 2BNUB 4JKWA 4L1LA 3EO9H 4Y4HC 5I73C 5C6PB 2APWA 5JPMC 2YSSA 4HUXA 1R19A 4OJEH 2GUOB 4WWOA 4OB5L 5SX4H 4JZJA 1UATA 3FMGH 1BF8A 5KVEE 2OMXB 1PLBA 4MRCA 2XICA 1B2YA 3NIGB 5SWSB 1OP4A 1E8YA 4ZX4A 2WQAA 5C7XH 1GS8A 4FP8L 4YNYA 4HUNB 3UBHA 5KBLA 5BQDA 2FO8A 4LVEA 5CF3A 1KYUA 4MMXC 5FM4A 4JDEB 1NGZB 2WSPA 5EO9B 4MCMA 3SJVD 5C9KA 4KJPD 4KTEL 3IMSA 4ODVH 3T0EA 1L5GB 1M53A 5ALBH 3B9VA 5IHZB 1BWWA 2VYRE 2H41A 2ATPA 2JI1A 3FT4B 5LWYH 2AJYL 2X4PA 4ZAKA 3QDJA 2C7UA 4M7JH 1REIA 4LEOA 2J20A 1WWWX 3ZE2E 2OXHA 1LNUB 3FQNA 2ICWI 4DN3L 5A2IH 2J8UE 4OJDH 2VJXA 2HVKA 1X5AA 1XGZA 4XO5A 4TV3A 5JMOC 2AXGB 3QFGA 4UTBH 2BY0A 2WZAA 4KKLD 4XAKD 3EH2A 4HS8H 1KT2A 5EZOH 3NJJA 3DXAD 3KPMA 3OV6A 3FTYA 4PY8J 3D8MA 3NFNA 3CBKB 4XNXH 4GXVL 3H3BC 4GIOA 3UAJD 4E9VA 4HWNA 1CL7H 4JFHE 3RDTC 4GAYB 1YEIL 1GVIA 2NZ1A 1MCPH 2IDTA 2PTTB 1DDHB 4I3SL 3U48A 2WYZA 1HH9A 3GKZA 5IIEB 1PIFA 2DRUA 2OXGA 1QD0A 4JRYE 1I7ZA 3K2KA 4WWKB 3V4PH 4GRLA 3O2VL 5C0ND 3GBML 2GTZB 3G6DL 3QQ3B 1N5AB 5B38B 1U58A 2JIXD 2CH8A 5CFHA 1GHFH 5CWSB 2P42B 1T83C 4KVPA 4UOJA 5AQ0A 3Q9QA 1ZVNA 4MB3A 1TEGA 1X5FA 4NC1C 4YVUA 5CSZA 2CIIB 2AJXL 1DQIA 2H32A 4KI5D 2DN7A 1QSVA 3QIBD 2EE2A 4NXSA 1EDYA 3SDXE 4IKKA 2YUWA 5KANI 3FU9A 1F02I 3GWJA 5F8QC 5HVHB 4BH7B 4QJ5B 1OGSA 2CCLA 3CLFH 1NAML 4J6RL 1YEJH 5IM7B 4TTGA 3T6XA 3R0MA 4ORGB 4ODWA 1FZKB 2PPAA 3EFFB 4Z7UF 4OF3A 4OLUL 3QQ4A 5DD3L 5DRWA 3DO7B 1X5HA 1XAUA 2PWFA 1KXVA 5M95B 2IDUA 4XH2B 5DC2A 3LMJH 5H37H 3EYUH 3ZPDA 5J12B 5JYLA 1A25A 2KLTA 2V2WB 5GIRB 3VGDA 1VACA 4LOUD 5IMKB 1I9IL 1KJMA 4MXWH 5BO1L 3ZHFA 1FFQA 3IF1A 43C9A 4DVBA 4HWBA 3VG0L 5BZZA 1E9OB 4YHPA 2Y1AA 3PHOA 4LDLB 5CMAB 3ME0B 1PAZA 4DZ8A 1OIOA 1BIIB 3VYPA 4POZD 5F9WC 5AZEH 1E2ZA 1RUML 3QT2A 1RIHH 5EWIL 4PI0A 1E4WL 4DCQB 4J3SA 1C8PA 3UPRB 4PJ8B 1Q72H 2H45A 4XNYH 4OQTL 3UABA 3SJVA 1AJ7L 1T0MB 3L5WB 4KVCH 4MD0A 1FN4B 1BZ7A 3FRUA 4YEEA 2VDOL 2VW6A 3BN3B 3GHEH 2FH6A 5DK2A 5GZNC 3S36L 1F2XK 2CRMA 2EVGA 1HNYA 4W81A 3DGGB 1K4CA 2QSCL 1NEPA 2JQZA 1F4YH 3MRBB 1D5XA 4RDBA 1S7SA 1PQZA 1TQSA 3T3ME 4ZZKA 4AIZA 3LZPA 2E9BA 2OL3L 3WNPA 3W2DH 3WIAA 3BESR 5C0CB 5SV3A 4Z7QE 2BO0A 2Q20A 2PO6B 3KJ4C 3QC5X 5JHDE 3UG4A 4MNQB 2PYEE 3QEHB 2JK5B 3UZVA 2CUMA 2ICWA 4NZTH 3AITA 4QOKB 5EZIL 1PKQE 3BKJL 3HUJA 5AYTA 5FV1L 3WNLA 4DFHA 1PJWA 2CNYA 1KUMA 4XRCB 3UAJA 2WLLA 4BZYA 5K1NA 3PGFH 3S35X 1X3DA 2KZKA 3Q6GL 1BPLB 1I8IA 2EDQA 1WFJA 4FYRA 1FNSH 4J28A 3WS6C 3DUSB 3V4LA 3UTSB 1BBJB 5DJYB 1ZHBB 3ZTNH 3VXRE 5FA3B 1CICC 5DR5L 4N1HB 2KT6A 1TIUA 3V5HB 2WLIB 3QJXA 4O9HL 2WQXA 5DUBB 4H5SB 2V9RA 4WNQA 4PRHE 4OV5B 4WWKD 4PGDB 4MA3A 2JIXA 4N6RA 4NUGH 2KBGA 2OMZB 1B4RA 1SLUA 3U7YL 1T0PB 2EDYA 5G2NA 5ICXB 2GBVA 1J9TA 1RK1A 5D7JB 3RUGA 2JQAA 3ETTA 1HSBA 3QIBA 4R9HA 3LCYA 2R69L 5JQ6H 2ADIA 4XVTL 3TJHC 2C9PA 1E9QB 3EDJA 1ORSB 1AZZC 2IMNA 3X12B 5F2FA 1PDKB 1WIPA 4G7RB 1Q1PA 4TPRL 2AVGA 3P9LA 3SE9L 1SDYA 4HS3A 1X9UA 1H9DA 1IUZA 1JFQH 5E9NA 1KELH 1CGUA 2JTDA 3GS4A 1BFTA 4L8SC 3BPLB 1NKRA 3FNKA 4KTDL 2A77L 2CBOA 2LABA 2NZIA 3IVKB 1SDDA 2R56H 4CNIA 2BNUA 2DWTA 3T71A 2VDNH 2YHGA 2GUOA 5FWQA 5I82A 3EO0B 1BOYA 5MERA 1NFKA 1WFTA 3ZHKA 2OMXA 1KZYA 4PJIF 2A1WH 3QUYB 4GEJA 5SWSA 4KKBC 3MJ6A 4DGVH 4RFNC 1BF2A 1C8QA 1TQVA 2HZHA 4LOFA 2LU7A 3MKKA 4Y19E 4KUZH 1RZKL 4JDEA 4PJ8D 4G11A 4FABH 2XV2A 3DMMC 5EO9A 2CJSA 1UFUA 3MBWA 2YR3A 1UCTA 3NJVA 5GRJL 5ADPL 4LU5H 4AQ1B 2EVHA 5H37G 1L5GA 3BP4B 3GK8L 3A0OA 5IHZA 4WSKA 3L08A 4ALAC 1X5GA 3CGTA 2XA8H 2ZKXA 3T2QA 3V4VB 4DQOH 1SEBB 3EADA 4OZHE 1MIEL 1CPUA 4OIIH 5CIPB 4X6EB 1QATA 4Y8DC 4ATTA 3GZQA 1MCOH 1LNUA 2FO4B 4M29A 4B60A 3O2DA 4XTRC 5C0CD 3U79A 5HSFA 1WEJL 2PO6D 3D4YA 4U6VL 4BQBA 2AXGA 4MNQD 2XPGB 4JMXA 1BD2E 4G8IB 3S88H 3HMXL 4QOKD 1JVLA 4OIAA 3O45B 3BSHA 3FH7A 1CO1A 1HCVA 4OGAC 3ULUH 3REVB 2JFCA 1G1CA 1CDCA 5HHXH 4GAYA 1IVLA 2B08A 1R75A 2PTTA 2DDQL 1DDHA 4MZ2A 1M9SA 3D08A 4WHCA 3UTSD 1P7BA 3ELQA 5IIEA 3IDMB 1MCFA 5GGQH 1YEEH 3S4SB 4M7KL 2Z8SA 4WWKA 4OCLC 4Z6AT 2GTZA 3QQ3A 1TJIH 2P7TB 3SGDI 1N5AA 5B38A 2O5YL 5GISH 4HK3J 5CWSA 4H8PA 3RBGA 1PNCA 5EUOB 3IT8D 4K5NA 2R23B 5HDBE 1AKJB 2FX7H 3FQ1A 4DP9X 4HEME 5D7JD 3K80A 1UTDA 2CIIA 4AGOA 3UP1A 4KQ4H 5AW9B 3MJ9L 3Q01A 3S96B 4Q0XH 5T3XL 5KG9A 1KFAH 4H8QA 4OLEA 5CGYD 4BH7A 5IM7A 4JFZH 5AW6B 3BKMH 4ORGA 1FZKA 3EFFA 2DM4A 5LHDA 1ZJBA 3DO7A 5EZJB 1NOFA 4LKCB 2WQSA 1JRHH 7TAAA 1HKLL 4XPGL 3VRIB 2GW5A 3CMOH 2EACA 5CJOL 3WFEH 4FF9A 4R7XA 3RVUC 2GBUA 4XH2A 3TFKD 2V5YA 2V2WA 5GIRA 1J9CT 3BZ4B 2NY1B 5IMKA 2ADJB 5FKAB 4RH4A 2X6AA 2B59A 4HCRL 2WKLA 1E9OA 3L5XL 2O61B 4GLRH 4PWEA 5CMAA 3VRLE 3ME0A 5ADOH 4FNSA 4J8RB 1XCQA 3SD2A 4RFOL 1BIIA 3C09B 4DW2L 3RG1C 2O6EA 2VXTH 4AUUA 5A2BA 3WNMA 3K91A 2Z93B 4DCQA 4PJ7E 4HX1B 4PJ8A 3UPRA 1IKFH 1BVOA 1TJMA 1NFDF 4FDWA 2CM5A 1T0MA 1FN4A 2P47B 4JO1H 1UURA 3WTTA 1EBPA 1DR9A 3BZFB 3DGGA 3MRBA 1C12B 4JE0A 5EU7C 1FC2D 2DEYX 5I6PA 2H8PB 1RUPL 3ZL4L 1DBAL 2NNRA 3U30C 1B6DA 1GW6A 1RQ5A 4OLXH 5DK3A 1L9PA 4MNHB 2V9UA 5CD3B 3SKUD 2R0KL 3B5TA 2PTUA 3FK3A 3LQAC 5C0CA 3L3HB 2GBAA 1U8MB 3KW8A 2PO6A 5IROA 4XBEH 3QEHA 2JK5A 1ASQA 2H2PC 4NX0A 4QOKA 1D3CA 1IFHL 2CDEB 2CNZA 4TUKH 1UGKA 4OM1L 1DQLH 2VZVA 5CGMA 2BWDA 4XRCA 1W16A 3QEGH 1SY6H 4XCYB 3UEQA 3E3QC 5B7FA 2OPCA 3ARBB 4FNUA 3GB7B 3GO1H 3BXNB 1TOXA 4X80H 2HRPH 3DUSA 3UTSA 1BBJA 1EJFA 1ZHBA 5DJYA 3W11C 1FH2A 1L7TH 2X6VA 5FA3A 1TNNA 2APXA 3EKCA 3RPIB 2P5EE 4HKBB 3V5HA 4AX3A 2WLIA 1JZ4A 5DUBA 3CDFA 1RZFL 1LK2B 4H5SA 3BZEB 5F9AC 4OV5A 4PGDA 4IHOB 5DEJA 1LO3L 4AW7A 1I3GH 4BM7A 3CFEB 4MDJB 5LNDA 4PG2A 3SBPA 4X7DC 2EXWD 2OMZA 1UENA 1MFDL 2JTYA 2ARJB 3LD8C 3QO0B 1QHQA 4AMKH 2BS71 3T0EE 5ICXA 4H4NA 4XC3H 3GPEA 1L0PA 5D7JA 1AKJD 4LCVA 4HJ1A 1TQBB 2VUKA 1BXUA 4P5KB 5GRXG 3UP6A 4P57B 3QDJE 3OR7B 5T5FA 2AZUA 1TKWB 5H35B 1IAIH 3QNXB 3UXFA 1ORSA 1TF4A 4FULA 2X4TB 5IB1B 2DQUL 1PDKA 3NCJL 4DPRA 4P5SA 5J89A 2WNKA 1MKFA 3FT1A 3MA9L 3ELAT 4QEGA 2W9DL 1NCTA 2YZ8A 1H15B 2E7CA 3KYOB 3MGOA 3P9WB 1Q38A 2FEJA 1E7UA 1YJDL 1F6FB 2IPUK 5FYKH 2R27A 4AJVA 3IVKA 1PSKH 3OKNB 3TCXA 3FZUC 4O00A 1FNAA 1GY2A 2AGJH 2J88L 5CUSH 2NY1D 5AWNL 5BVPL 1N26A 2ID5A 5AW2B 2WV3A 4TNVK 1XHHA 4PJHF 3AU1B 1RZJC 3EOTH 1JZEA 1NMBL 3EO0A 3WXWH 1JS4A 4Z78B 4MTMA 4ZK8A 3GIZH 2BY1A 3QUYA 4W68A 3V9FA 1F8TH 1CYXA 2VDRL 2YEZB 2ZE0A 4WDIB 5E2TH 4AGLA 3O2WL 3VMPA 3HA0A 4QHLB 3CE1A 3NAAL 5F7LB 3TONA 2ADGB 3PP4L 4ZPVB 1FYTE 3Q2LA 1BDYA 1X6LA 3L1FA 4HMDA 4AQ1A 3BP4A 3UBFA 4OCWL 1ODUA 1F11B 4XPFL 1V7ML 1MJUH 3V4VA 3DYPA 2B1AH 1SEBA 2Z9TA 3J07A 1OARL 4U1HB 3H55A 1E3FA 4LCUB 5CIPA 4X6EA 1I1AB 3L13A 2X1XR 3C8KB 2WQUA 1AY1L 4KK5C 3SDDA 2FO4A 4AJWA 1AO7B 4B9GA 3PE9A 4IKJA 4NN7B 4H2AA 4PS3A 4F9PC 2DD8H 3GM8A 1XSIA 2F19H 4QRUB 2AERT 5AW8B 3ZSTA 4G8IA 4H2CA 1DQJB 1EXUB 3N1MC 1UD2A 2Z0BA 4R8WH 4XP6L 5AVWB 3VH8G 5LQBL 3O45A 1GC1L 3LH2L 1LEIB 3NRQA 5CJQL 3REVA 4HEPA 5F70A 4KKZA 1XCXA 3ARBD 1D5IL 1IEHA 5JPNC 1HL5A 1O7DE 1RPQA 4OCYH 2AEQH 2X44D 3ZO9A 1HZKA 2PPFA 4M00A 3S4SA 3D34A 2AP2A 5D7SL 4TL4A 3LQZB 4LFHG 2EIZB 1IGFL 2ZPKL 1FP5A 2P7TA 2BIIA 4GS7C 3I9AA 3SJVE 3JQOB 3MCLL 5EUOA 2L7JA 3GZKA 2R23A 4UTCA 3WFBH 1WBYA 4XP4H 1AKJA 4C55A 2FQGA 2PWHA 2CWRA 1W0YT 3HJ0A 2GKIA 3KWWB 1JJUA 1I8LA 3S96A 1N3NB 3GDBA 2YAMA 1P53A 2I25N 2VR8A 2BP8B 1OE3A 1QFWH 4BBWA 3EYSL 3SQOL 4BQ9A 2DH2A 4K9EC 3HNTL 1KJVB 3KS0J 1OCRB 5EZJA 4LKCA 5TE7H 4D3CL 3GJFB 2WZPD 1CLOL 4LQFL 4XAKE 3VRIA 5E5MB 1AIFB 3DXAE 4NKDB 2VDKL 2GIXA 4JZNB 2OW6A 4LPWA 1CLYL 1RUKH 4X4KA 5DD0L 1QWNA 2PKDA 3BZ4A 4BIKA 3C6EA 3LXBA 4HS6B 2ADJA 5E08H 2XRAL 5FKAA 1JV2A 2NNXA 5HJBA 5B3SB 1N4XL 3FT9A 3NDYE 2Z8VC 2O61A 3ZR5A 1YN7B 4ILDA 3EH3B 5HPOA 4J8RA 4RISH 3LJ3A 3Q2WA 1AXSB 4DOHE 2M83A 5F7KC 5CD5C 5F0PB 1SJXA 1D6EA 3SYCA 1TDQA 2Z93A 3MV9B 4HX1A 2V8LA 2HT2D 3N04A 4PS7A 4ZT1A 1F4WH 3QWOB 2VMEA 4V2BA 5FYKU 1FDLL 3NJHA 1ZV2A 4BSJA 2ZSWB 4HBQA 1Z7JA 1A0QH 1MCNA 2X05A 4EKXA 3BZFA 4GP8B 2VMFA 1DSFL 1C12A 3P2BA 3B2DC 5I1CL 4CN1A 3SO5A 2FWSA 2H8PA 4XMPL 5KSBF 3WKPA 4EI0A 4XXDB 1U3YA 4XT1C 5TQ2L 1KN2H 4LSTH 1I1AD 2B20A 3GMLA 2A2QT 4MNHA 3V52H 5CD3A 1HVXA 2XN9D 1AANA 3SHSA 5DQDL 2WP3T 1OAXH 2J57A 3L3HA 2WKGA 1J11A 5LKNA 2F1EA 2N7SA 1AO7D 1U8MA 5C07B 3TH2T 3ZGHA 4AL8H 4OD3L 4XMLL 2QQLH 4APXB 1OAJA 2CDEA 1BZ8A 3I9GL 2G2NA 3R1GL 2XWCA 1LDPH 2NYYD 4BUGA 5E2UH 3MMEB 2IIJA 5IG7A 4XCYA 3KW7A 4Y4FC 4Q14A 2DI8A 5I23A 4EBQH 2EDWA 4LB8A 4M6NL 4PJAF 3MRKB 3H42H 2Z7UA 3GB7A 2PPCA 3BXNA 4JVWA 4BK4A 2DQTH 3MRPB 4KMLB 2X1OA 2CO7B 2V0AA 1L4IA 3NIGE 4TUUA 3RPIA 4Z95H 4HKBA 2FO1A 3UIYA 5LLIC 3BZEA 1WJ3A 1LK2A 2ZUQB 2VDML 1VADB 4IHOA 5F7HA 4EZJA 4P3WA 5B39G 2FLRT 3CFEA 4MDJA 5I1LB 1KCBA 3B9DA 2WK2A 3QO0A 2ARJA 1JPGB 2ZTBA 4CVUA 3LIZA 1I8KA 4RGNC 2DTMH 1SEQH 2F74B 2L04A 3TT1L 4AEHL 3QRGL 1YYLL 4IOFD 4N0CC 2JKWA 4P57A 4P5KA 2UY6B 3OR7A 2VCOA 3SE4C 4U1MB 4AG4H 4ZMYA 4AMWA 1M3IA 1TKWA 1UH4A 2CHDA 3QNXA 5IB5B 3S3JA 5H35A 2X4TA 5IB1A 4B50A 3TNMB 2KZ1B 1J88A 1NLDH 4I89A 3GUTB 4QWWC 4R2GC 1X4ZA 2J2ZB 3CZGA 3IRZA 1TZGH 2FUQA 1H15A 2WZPA 2XKSA 4F3FB 4KH2A 1E2VA 1ZAGA 4MLSA 2ADYA 1HX0A 1LMIA 4B7IA 3G08B 3OKNA 1TENA 4HOWA 1FNFA 5DJ8B 5D9SB 1T6VN 4ZUSB 5DHYB 3O3DB 4N2MA 4ANKA 4NO5B 3SGEH 1D7CA 4M1CC 3MNVB 2JI3A 3MAWA 2UUDK 4Z78A 3ZMRA 4PV9B 1VFBB 3W56A 1HHKA 4TYUA 2CK0H 3FQRB 4ZFFB 2E47A 5AENA 4QHMB 4LHJB 4PJFB 2YEZA 4WDIA 4NLHA 1S3KL 3S36X 3MV9D 3QORB 2CKBB 4QHLA 5F1NB 3PIQB 3PL6C 2ADGA 4OLWH 3UC0L 4ZPVA 4BV1A 1YQ2A 3R0NA 1WA0X 2L4OA 1AGFB 3JWDC 2XTSA 1F11A 3B7RL 2LVEA 4K94C 3VI3B 5KYNA 2F1AA 2AQSA 3OWEA 1NPJA 4Q8BA 2E7HA 3VYNA 4U1HA 2XKNB 5DD1L 4LCUA 4IGBC 4H1LG 1I1AA 3UO1L 4Z9KB 1M2VA 2GCYB 3C8KA 4OZGF 2ED6A 3D69B 2OI9B 2OZ4L 3RHWK 5MI0B 5D70L 1TZIB 3QYMA 1OT2A 4WUUE 1EO8L 1MAKA 1FORH 4RA0C 3P0VH 2R29A 3COOA 5C07D 4FA6A 1PZ2A 2P5WB 4QRUA 5F8RC 3KAAA 3LKOB 3DO3A 3TIDB 3FO0H 1DQJA 1EXUA 3G6JB 2VDRB 1NCDL 1EV2E 3UMTA 4TS6A 1NCAH 1G7LB 1LEIA 2CBTA 5L4FA 5DMYA 4NRXB 4KOBA 4N0UB 1UFGA 2XWXA 4K5PA 1H3UA 4JJHA 3GI8H 3JTBA 3TBYB 2C9RA 5EMYA 1AOHA 1J9RA 3LPFA 5IREA 1GCYA 3LQZA 2EIZA 1BQHG 1A65A 2DYPB 2EH8H 3DVGB 1BP3B 3N1FC 5DWPA 3U0WL 3ALPA 1A6UL 3LPOA 4CGUB 5IR1B 1JGEB 4AWJC 1MNUH 3MLZL 5CZXC 1E43A 3PLYA 5ESAB 1MAML 4QD2E 1YHPA 1FSKB 4HV8B 5DJAB 3KWWA 4Q9RH 1CFTB 2VDPB 4AVIA 5CAYB 4POYA 1N3NA 4X5LA 4XO4A 1OHZA 3BT2H 5KVEH 2HKFH 4DEUA 4FKHA 4R0LC 2E56A 2BP8A 3IMWA 1JXKA 1L0YA 5C0CE 1YEWA 1O7DC 4P2RB 1KJVA 4CW1B 4MNQE 5HHQB 3N43F 3GJFA 1J10A 4QOKE 2NT1A 2VLMD 5E5MA 1AIFA 5KOVC 2BS8A 4NKDA 1ZOXA 2DM3A 4JZNA 4DZBA 2WMPA 3FB7B 3FTVA 1IILE 5KJ7E 4HS6A 1NC2B 3OAZH 2G3XA 2KZWA 3EJRA 3CSGA 4R4FL 5F6HJ 2HT4C 4OLZL 3ZHDA 4QTIH 3G9VA 1SFHA 4G5ZH 4IIZA 4AITA 4A2LA 1UACH 2CHNA 1FQ9C 2X89D 1YN7A 4M1DH 3UTSE 1H6FA 4YL4A 3T2NL 1JWUB 2DJSA 1AXSA 3I85A 1FLRH 2H26B 2XTJB 3S37X 2FBOJ 3LEYH 2MSPA 3DNKA 2J43A 3MV9A 4FXKC 3U30B 2HMIC 4JHUA 4FQXB 1RP8A 3QORD 1N8ZB 3QWOA 4TSBL 4PJEB 4UNUA 5ID0B 2ICES 4JE4B 2IG2H 4ODSH 1BEYL 4LO9A 3Q1SH 4NM8H 4PUBL 5C70A 5T3ZD 2VQ4A 4K3JL 2ZSWA 3MNZB 2MMXA 2VIRB 3D3VB 1YQVH 3VI4F 3BUDA 4DGUA 3DHPA 5GGUB 4KAQL 1XD1A 2JJTA 5JQIB 3U9WA 3KR3H 1X5MA 3IAPA 2OJEB 1QSZA 1JK9B 1JPST 1EGJL 4XXDA 2Y2WA 2IH3A 3BZ5A 3KJ6H 1DBJH 5LAXB 3V6OA 4ADIA 3ZZSA 1J5IA 3QG6B 5AOLA 1NM9A 2DMCA 5HDLA 4LLQB 1FNEB 1G9NC 3DIFB 2VITB 2DMKA 4LSDA 4NAQA 1TLKA 2A0LD 2PCPB 3WN5C 3WY3A 3U2IA 4HF5L 4WI0B 4XCEB 4XBGB 1RIUH 1KBGH 4P59H 2MJWA 4JFVA 1AI1H 4F91B 4APXA 2P5WD 4NAJA 4G6MH 2FK9A 1E6OL 4K3DL 4OLYL 1EDHA 5K93A 3MMEA 5DVPA 4S1QL 3VDAA 4UV4L 2PW2B 4G7SB 3H1ZA 3MRKA 3CSTA 2NNAB 4N2GA 5B1BB 1ZK9A 1BM3L 1IGML 3L4ZA 2CO7A 2WZ6A 5KS9F 3K8KA 3QUXC 2ZG3A 3V4UH 2UY7B 1VADA 4PB9H 1OCZB 2F68X 2DYPD 1MCRA 2Y5QA 1R9FA 4GAGH 5I1LA 1R3HB 3KVPA 4FI7A 4TSCH 2NW3A 4DGYH 4QUOA 1MFBH 1JPGA 2V6HA 3KL0A 3GINA 4MQXC 5DWUL 2FT7A 3T0AA 2YUVA 3TNNB 3VU1A 2FBJL 4ZD3H 2IPTH 4M7ZB 2BMKB 2VJ0A 4XI5D 2F74A 1ROCA 5HYSA 2H1LM 3GSUB 1ZT7B 1IC5H 2UY6A 2HG5B 4U1MA 2EKJA 2QZ5A 2OK0H 5IB5A 1KULA 5BMFH 2NXYC 3GUTA 2HLFC 2A9NL 2EYSB 1X4YA 4JN1L 2J2ZA 4P2RD 4GIAA 4F3FA 4X98B 1JTPA 2EDTA 3C5JB 2VDLH 3FBKA 5I5JA 3G08A 2BRRH 3H6JA 2Z4TA 3PU7A 3TA3C 4RLDA 5DJ8A 5D9SA 2GHZA 5E1HB 1ZHLB 4ZUSA 2V2XB 5DHYA 1NC2D 2XN1A 3O3DA 4KK9C 4PJBB 4NO5A 5E51A 1GSKA 3MNVA 3JWOH 2X89A 3HC0B 1KGYE 3NA9L 1RJLB 2Y07H 1KCRH 1VFBA 5DJDB 2CBQA 5EDXA 4ZFFA 3LN5B 4QHMA 3QHZL 4OFIA 2XTJD 4IRZL 3C60C 4PJFA 5L0QB 4WVRA 3M1OA 25C8L 4CL7A 3MC0A 3QORA 2CKBA 5F1NA 3KCWA 4DK6A 4FQXD 3PIQA 5FUCE 5EUOE 4ZQKB 5C09B 4QF1B 3NSYA 4U2YA 2WAHA 2XTLA 1AGFA 4XP5H 5HI3D 4BSVB 3RX9A 4FAAB 2FQDA 4NZUH 3D3VD 3VI3A 2G4GA 1OKEA 4Q7DA 4N8CL 5D1XB 2QADC 1Q9LB 2XKNA 3ALWA 2WZ0A 1CG9B 4FA8A 1QRNE 2GCYA 1DVFC 4RX4D 1KCUL 1YMHB 3D69A 3LEXB 1THCA 4JM0A 4K2UL 2X70B 1LM8V 4XWOC 4WU5B 5FUOH 5BZXA 2XIDA 4PVBA 3GI9L 3SGKC 2P5WA 4FTVB 4HUCA 4XC1H 3LKOA 4P2CG 3TIDA 3HEIB 1TMQA 2LTQC 1ODAA 3G6JA 1XGTB 1M1XB 1BVNP 1KTKE 1G7LA 4JFDE 4ZTEA 3B2XA 3T04D 2XWJB 5I9QC 4QYOB 4NRXA 4N0UA 3LDBB 1ZRUA 3MACH 3V6FB 4UINL 5TPWL 3TBYA 2Q7AA 3HG1B 1I9RL 1NAKL 1PD0A 4GPVA 4TTDD 2ERJB 2X9YA 1SOSA 2ORBH 2DYPA 3DVGA 2CPCA 1A6WL 3T65B 1I9JL 4HU2A 5DZLA 4RGMB 3IETB 5ANME 1JGEA 4JRXE 3UCQA 3WO4B 1QG3A 2VL5A 4D9RD 3N5AA 4NFCA 1GIGL 5ALCL 5ESAA 1EWHA 4HV8A 1YDPB 4L1SA 5DJAA 1E27B 3VGEA 3CVIL 5K9JH 4JQIH 4IU3B 1VAHA 4KY2A 3JV0A 3MUZ1 1YEGH 3BI9X 1QBBA 3MLYH 1BVKB 4RWYL 1U2YA 1MVYA 5DURB 4UANA 4C58B 4P2RA 1UGNA 4KO5A 1BFVL 3G9AB 1IQWH 1FPTH 4CW1A 2VSKB 5HHQA 1UKSA 1AKPA 1UOKA 1H5BB 4YX2L 1M7IB 3FB7A 3LQMA 4K8RL 5F21B 4NP9A 3BPNC 4U0QB 1NC2A 3IDXH 3A3YB 3ENEA 3K72B 4TULL 3MOBH 4G6KL 2BSSB 1P1ZB 4TVSa 2VB5A 1W72H 1H3PH 1S5HA 1JWUA 2DQDL 4I9WD 2H26A 4P9HH 3UOAB 4FQ2H 1KN4L 3SQBB 1S7RB 2JSFA 1JSYA 1MG3C 5IBLD 4FQXA 1WZ1H 4ZTOH 5I71C 3NFPB 4MX7B 1N8ZA 1RPKA 1J8SA 3VXMB 4PJEA 3ZE0B 2QBWA 5F7UA 5ID0A 4P9MH 5C09D 1AOZA 4MZRA 2IDFA 4OJFH 2PNDA 3GLDA 2VIRA 1XIWB 5CGTA 5EN2A 4Y9CA 2VN4A 4N20A 5GGUA 2WO3B 3WEAA 3GTNA 4JFEB 1CGSH 1HE7A 1S4IA 4MVBC 4JANB 2OJEA 4DKDC 2WBJB 5EFIB 1JK9A 2WXLA 5D1XD 2X1PA 3Q44A 3WJJA 1DFBH 2MPVA 4RX4A 4YSDA 5LAXA 4UF7C 1H3WM 1EEYB 3QG6A 4LLQA 3IPBA 1FNEA 3WY4A 5MP6L 2VITA 3RIAK 2AJUH 1INEL 1ILUA 2PCPA 4B9KC 5BCAA 4XCEA 4XBGA 4WQOA 3LRHA 4AVHA 3FTUA 1N7MH 2HFEB 2XJKA 3DJSA 4FTVD 4M93B 3HHRB 4BK5A 1ND0B 2R7EB 2ZAIA 4QRAA 2HTLC 2O30A 5DHDA 4UB0L 2PLTA 4EF3A 1OW0A 43CAB 1PAMA 3RYMA 2NNAA 4Q58C 1JVOA 4ZDHA 3VFOB 5AAMA 4DO5A 3HG1D 4HXBH 3QSKB 3U36B 5HBBA 5I74B 4Y5VB 2UY7A 4CDGC 4GAJH 4P4KB 1NZRA 2UXGA 3FL7A 5ES4B 2ZYSA 1R3HA 2APBA 2ENPA 4TL5A 1LQBC 3AG2B 3DDGA 3KLSA 2I9TB 4RDQG 5AG9A 2Y0SA 4BQ8A 1A14L 3NRFA 2P8PB 1XT5A 3TNNA 5I1HH 3L3KB 1BXAA 4Z7NF 1U6AL 4P4RB 3PPEA 5HHVL 1JPTL 3GSUA 3ZL1A 1ZT7A 1F90H 3DSFH 3VE0B 2HG5A 1BQSA 4MGXA 2EICA 4OF5A 2HFTA 1BZDA 1XTLA 2XN9E 4PW3A 3GQFA 5L4MA 4ENEC 3HG4A 5TH2B 1KLFB 2IQAB 2EYSA 4WZ9A 5DURD 5I24A 1GGIL 1TQTA 3KYAA 1AO7E 1L6ZA 2PW1B 3EJZC 3VMNA 3X11B 4NN5B 4X98A 1HXMB 3JVGC 4H0GA 2NY7H 4Z0BH 5CBEA 3C5JA 4YXLH 1P1VA 2FATL 3HRZC 4WW1B 5JDJA 4LPUA 3ARGC 3QEQB 3J7HA 5F1IB 3ILPB 4UU9B 1M7DA 2XSKA 3FFCB 2NR6D 1ZHLA 4PTUB 5LCVH 2V2XA 3BUYA 3I75B 3DETC 4XCCL 1IGIL 4PJBA 2RALA 5FO7B 2R1WB 1CK0L 2XWEA 3HZMB 5J1SC 3BAWA 3HC0A 1SN2A 1RJLA 1U8CB 3H7BB 4UT7H 1XL6A 1H0DB 3T3PE 5EU6B 4PRDB 3RY6A 1TEYA 1WIUA 5EEUA 1NMCB 4JFTA 3K0YA 3K6FA 1T6WA 3TS8A 4ZQKA 3DLQR 5C09A 5A2KH 1X5JA 2MNUA 3ZDZB 4KZEH 5IHUH 4I13B 4QF1A 3P11H 1P9MA 1BX2B 1LP9B 5C08B 4JPKL 1YUHB 5F7YC 4XXCC 5FYLD 2WQRA 1XIWD 4LBAA 3H3KA 2D7PA 1R46A 1YNKH 3KGRA 5E4AA 3RWIB 4XZUB 2VXVL 4JFED 1S7WB 5D1XA 2JV6A 1Q9LA 3UAEA 1CG9A 4X2UA 1VGEL 4R97C 4BCZA 4CMMB 3FTXA 3LEXA 4I85A 4ZMQA 2YN3A 3RWFB 2X70A 4AKQA 4Z7VB 2HWZL 4WU5A 4WF7A 4M8QB 3D33A 5GJTL 2EE9A 2VE6B 2SEBB 2D3VA 5T5NF 4FTVA 5JOEA 2I5YL 2UX6A 4TQEH 3RZCC 1XGTA 1M1XA 2VLLB 2HUHA 4XODA 5AOMA 3WAJA 4O51B 3BWUF 2YD8A 5FFLA 3AUVA 3BKCL 4QGTA 4MRBA 1G43A 1MWAL 2XWJA 4QYOA 1HDMB 5FUCC 3RKDC 4BINA 3LVEA 2DQFB 3Q48A 4ORZC 1ZLSH 5JHMA 4QMEA 2YKLL 2BC4B 1OAUL 3CHSA 2YPLB 1S7UB 2FJFB 3MBXH 3V6FA 1ZK5A 2WO2B 1TPXC 1E50A 5I19L 1F3DJ 1KJ3L 2FIKB 2PWDA 3TCTA 3HG1A 1FNLA 1SMOA 1NIAA 2XJLA 5IBUG 3UJIH 1LMKA 1DVXA 3Q13A 3H9HB 1E4XH 5DSCA 4DK3A 1QW9A 2VRKA 1DANU 1WCQA 4F58L 2DLEA 3HNVL 1J5HA 4P4KD 4WKZB 3T65A 1TJGH 3DX8A 3GEWB 4GG6F 2QQKH 2FECL 2YD9A 4OCRH 1IGTB 1IGCL 2Q2LA 3C6SB 3IETA 1YEFL 3CD4A 4F7TA 4GKOA 2CO2A 2WTOA 1Y07A 3MRGA 3FUFA 4ZW8A 5DC9B 3RAJL 1Z5LB 1YDPA 3QZWB 4Y5YC 1E27A 3BKYL 3LNFA 1E9PB 1WFNA 5E6IC 4IU3A 4JG0H 3I6SA 4XXWA 1GPOL 1TLMA 2EDBA 4FZEL 1VLXA 3IGKA 4I87A 5GGTH 2VAJA 4LCCB 1BVKA 1S9WA 4FL4B 4W9JC 4JM2C 2DLFL 2X4RB 1ZLWH 3ZL2A 1L9OA 3RL1B 4JO2H 5BW7C 3B7SA 2O6FA 5C07E 1FVEB 3VYOA 4DERA 3WIIL 2N0MA 3ZKMD 2NY6C 1ZV9A 1ZHNB 1ACYL 2X6CA 4G6JH 4BZ1A 1RAMA 2E6QA 3MCG1 2W1NA 3F65A 1H5BA 3EJSA 5C6TL 3QEQD 4JR9H 1M7IA 5AD0A 7PAZA 2NR6A 3E7JA 3FFCD 4LIQE 3K72A 1A3LH 4XMKL 4LLDB 2BSSA 5KJRL 1MRDL 2H32H 1P1ZA 3RVXC 3F5WB 3HB3C 1ADQA 2VR9A 4U1JB 5FGCB 1MCDA 4I5BB 1VZIA 1ET8A 1ZKAA 2TRYA 5E6UB 3NYKA 1BCIA 1KCKA 3DA0A 3B1UA 1A02N 4G1EB 1NOAA 3FTZA 5EU6D 3SQBA 1S7RA 4OGYL 3U1PA 1HYRC 3S35H 2UXVA 3NFPA 4MX7A 3QEUB 4LLYB 2P1YA 1TR7A 4D9LH 3VXMA 5PAZA 1H9VA 4DUXA 1IVTA 1VFUA 3HNSL 5C08D 5TDPB 3F3HA 5ECGA 1SLVA 4JFEA 5D1QC 4AYSA 4HWBH 4JANA 1OK0A 2WBJA 3FS9A 1K6QH 2VKWA 4KDTA 3PFQA 1UQSB 4ZTPH 1ZIAA 1EEYA 5EDSA 4HZLB 2F5AL 1J9QA 2FYYB 2BWQA 1D2OA 2F1BA 2VLME 5F72S 5J8OA 4NQEB 1AQKH 4WFFD 2HFEA 4RRPM 4X6CF 1JPEA 1EEZB 3VFVB 3ZKNC 4JUTA 1ND0A 2R7EA 4YHKH 4KNUA 2Y3AA 4QTHB 5IVZB 5B7EA 43CAA 1HNGA 5B1KA 1YY9C 2YPLD 5CEYA 2B2XL 4W9HC 2EYTB 3E1ZA 3VUAA 1G9EA 3U1SL 2MCAA 3VFOA 5A3ID 1BOGB 1ACXA 3U36A 1G7QB 1X7TA 2PP7A 1CIUA 4Y5VA 4ZFQA 3P77B 1JDAA 1THAA 1GAFL 1JHLH 4P4KA 1Z0NA 2OYPA 3UZEC 1JCKA 3KEDA 5T3ZE 1ZEAH 2JJSA 1SM3L 8CGTA 3WTYA 2I9TA 4WRLA 2H2SD 2BVQB 2JKSA 2P8PA 3RWGA 4B9FA 4P4RA 4OR1A 3RURA 3VI3E 1A7NH 1ZT1B 4XN8A 1M57B 1OTTD 4A2FA 5DUJA 3MI6A 3VE0A 3WUWB 1CGTA 4N2CA 2ICEA 2QFPA 4QYAA 3QFJB 5IQ9B 3LY6A 2CJUH 3TPUB 4FOMA 1G9NH 5E2JA 4FQPA 5D71H 5TH2A 1KLFA 2IQAA 3OG4B 1QR4A 5GRZA 1DLHB 3B56A 2PW1A 1DLFH 4LVHB 3NCEB 1UA7A 4IYKA 1HXMA 2P5WE 4G7YH 4OFPA 3ZDXF 5F88B 2CHWA 4O58L 4OT1H 4WW1A 4TKWA 5F1IA 3QEQA 3X3GH 2WLZA 4KRNA 4UU9A 5FHBH 2R1XB 4WSGA 3FFCA 5EOTB 4CMHC 5L7XH 4ZPTB 4PTUA 3S3SA 3UTZB 3B6SB 4NHCH 4GSUA 4CSPA 4ELDA 1NMAH 2R1WA 3IMRA 3QQXA 4RSYA 2V3FA 2ADFH 3HZMA 5I8CB 4F15B 3GSNL 1U8CA 2RCSH 4LNVA 3BAEL 3ORJA 3BUIA 4PY7B 3TESA 3H7BA 5EU3B 3FQXB 4RMTA 1H0DA 1CF8H 4TLKA 1A7OL 5EU6A 4KTYA 1ZVHA 1DHKA 4PRDA 3UC2A 1YYMH 4HYTB 4MAYB 4BKTC 3GMOA 5I30H 4WTZA 5HI4C 1JUFB 1AE6L 3ZYJA 1U8QB 2RTTA 4NZDA 2HX7A 1BX2A 1LP9A 4QRTB 5C08A 1YUHA 3GXDA 5DJCB 5C3TA 2J21A 3OB8A 3RWIA 3S0PA 1HWHB 3F12B 4XZUA 1RZ7L 1RZKC 1S7WA 4KJWD 3VACA 4BFJA 4MYWB 3T4AC 2H6PB 4K0OA 4A68A 4YPJA 1L9RA 5HDWA 2ATAA 2ZCKL 4IBUA 3GNML 4GQ9L 1NCIA 2IJ0C 4LLUB 3RWFA 1MCCA 2GSIB 4Z7VA 4M8QA 4AEIL 4P5RA 2VE6A 4UWQB 2SEBA 4NFDA 4HC1A 3OHXC 4KK8D 1AZUA 4NQED 1R3LB 2VLLA 1VF5C 4GMSH 1MCSA 4O51A 2P8LB 4MAUL 4TVPD 4APQB 1HDMA 5IVOA 2OMUB 2OTUA 1FIGH 2IPUG 4HDIB 2DQFA 1INDH 2BC4A 1OM3L 2YPLA 1S7UA 1OHQA 2FJFA 5FHAH 1TFPA 4C56B 2P45B 2P9RA 3FF7A 1TSRA 5LN8A 4IMKC 1JN6B 1MCLA 2ZX7A 3FHAA 3QJZA 2EDFA 4LPVA 4UCFA 2XTJE 4PJDF 3RBSA 3H9HA 1KIQB 4ZX5A 2B4CH 4JFQB 2YD5A 3ISRA 4LVOB 5SX4I 4KX8A 3O2DH 3SKJH 1JP5A 3CAFA 4XMVA 4WKZA 3IS1X 4XN4A 1M7XA 3V0IA 4CADB 4HULB 2CDFB 2Y5TB 1IGTA 4LE8A 3C6SA 3EBHA 1RL1A 1CXFA 3P0YL 1CF1A 4HKZB 3RPBA 1KY7A 3D3VE 3UPAA 4K3EH 1EQWA 1U3JA 1Z5LA 3QZWA 3SKMB 2AQ1A 1E9PA 1I7TB 1H3GA 4BFRA 3GHBL 1RVFL 3QRLA 4GYBA 4PJXB 4YHOL 5FW6A 2BVTA 3KG5A 2DWEB 3QFJD 4LCCA 1MN4A 5E0FA 2VQTA 1IT9H 3HI6H 1R47A 5ESVB 5IKCA 3JUZA 1YNLL 1EO7A 1KPVB 4LSQL 2E6JA 3U4AA 1LL1A 1CE1L 3AT8A 4LASL 3RL1A 1FVEA 4NQCA 1DZBA 4K23H 1RK0B 3CN0A 1ZHNA 2FHFA 4MA1B 2N56A 1CLCA 4N2FA 4DPAX 4WAFA 4N5ED 4KDVA 1KCVH 2EIBA 4FG6C 3D2UB 4LLDA 4B6ZA 1OOWA 3F5WA 3ZZ1A 5KYUB 2B39A 5J7CC 3OSKA 3CIAA 4U1JA 4I5BA 5E1GA 3SE3A 4KQ0A 5D93B 3B2UD 2VXUH 5DUPL 5EB9A 4KFMA 3NZUA 4K5OA 5AW0B 3KLHD 1CD8A 2H6OA 2ZUYA 1CL7I 4G1EA 5IJCC 1E30A 3BJ91 4NZRL 3S34H 3IWVA 2IGFL 2IH8A 3MXWH 4PCSA 3EJQA 4MAYD 4W6XB 4M48H 3QEUA 1AHWC 4LLYA 3ZMNA 3GXMA 4Z23A 2A6IB 3MV7B 1DSYA 4D9RE 4Y2DB 4KMTL 3RJQB 2FGWH 5TDPA 5I1IL 15C8L 1IE5A 5CILH 3OQRA 5AOJA 3ULVC 3CZKA 2D0FA 3T1FB 3TYFB 1UT9A 2OP4L 1KENL 4JJOA 2AEPH 3DBXB 5IQNA 1UH3A 1SXSA 1UQSA 3PY9A 1F1DA 1KTBA 3K71B 4UILH 5I1EH 4YO0B 4JPWL 2X4QB 4HZLA 1KGJA 1AS8A 4MHHG 1MI5B 1E5AA 3ULUF 2FYYA 4W4OC 3MOQA 3VSQA 3WE6B 3PCYA 1A4CA 2HKAA 2GEQA 4NQEA 1A3ZA 3LN9A 4UAOB 3CFDB 1EEZA 2C4FU 5DJXB 4HT1L 3VFVA 2WLYA 4R4ND 4AM0B 3D6GA 4MD4B 3MTRA 4OM0L 4N0YH 2FQEA 4QTHA 5I8KL 5B4MC 4PJBE 4IK6A 5IVZA 5KVDL 5L88H 1F4HA 4HJGB 3U82B 3GXUB 1RU9L 4DFIA 5IF0B 1L9TA 3NZHL 4MMYB 4KHXH 2EYTA 4C56D 1Z3GH 2C9AA 4FQJH 4I9WE 4DH2A 3MX0B 1W0VB 4XPBL 1BOGA 2L7UA 4J4PD 2VXQA 4JZOB 1G7QA 1UWEH 3FU6A 2B16A 2H4EA 3CVBA 3G5YB 4MJ2A 3FO2B 1N5YL 1UC6A 4K7PL 3QHFL 4QXWA 5C09E 2R0LH 3RL2B 1HINL 4PP1D 2BVQA 5K33A 5IQMA 4JRLA 4JW3A 3LOWA 3L54A 1ZT1A 4M4PA 3ZZQA 1FL3B 2R9HD 2XWBB 4CDHA 5TGBB 5IFAH 4FXGB 3QFJA 5IQ9A 5I1JH 4JKKA 3D4CA 3TPUA 1Q1JH 5T1JA 3MO1B 1QPKA 2WTPA 3GRWA 5EU4B 5I16B 1LK3H 1WDAA 1DLHA 2H3KA 2H47C 3C8DA 3M7OA 3TL5A 4M6ML 1LHZA 2Z35B 2MRYA 5H4YA 4IBVA 2PF6A 4FTVE 2A3TA 4UTAL 3ULAB 3OLIA 2NY4C 2VZ3A 2KKQA 4R83A 5F88A 5B1JA 5EF3A 1M1SA 1B0RB 1OP3H 5J06A 4FKKA 4U33A 2YAQA 2R1XA 5JXEC 4FI8A 5EOTA 1RFDH 4X9YA 3FCUB 4ZPTA 2X87A 2EH7H 3B6SA 1CXKA 1TZOA 3D2UD 4QKTA 2A9BA 1T89C 3EYFB 3HLKA 5BOJA 1WAPA 3EYOB 2NY3B 1NSNH 3MLWL 3QXVA 1KYAA 3L6FB 3BUBA 4WY7H 3PDGA 4PWJA 5T5FH 2B7DT 2FQFA 1YJDC 2J6EL 3HG1E 1JNNH 5I8CA 4PY7A 4LVNC 5EU3A 3FQXA 4AC4A 4RQQB 4EIUA 1OAKL 1W91A 1AXTH 4E9YA 2ZAGA 2BY3A 3UJJL 4MAYA 1YC8A 3OVUB 3DIVA 5E6RB 1A4KB 3INUL 1NCNA 2C1PB 1PGRB 1U8QA 2WLNA 5E8PB 4LSRH 3MV7D 3QZOA 5B38G 4QRTA 3QIUC 4Y2DD 5DJCA 4O4YL 4YH6A 4YXHL 3CVHB 3BGMB 3N44B 3LZQA 3STLB 2YA2A 3F7YB 3WFCH 1CDYA 5FECB 3F12A 1XH3B 4LRIA 3DHMA 4WEUD 2VABA 1YCSA 3FXIC 1X9RA 4XO9A 1XR8B 2D7TH 2H6PA 5G4MA 5I18H 5JDSB 3R18A 4NIYE 4QXUL 3FB6B 1EX0A 2R1YB 2VDQL 2VM3A 4UZUA 4LLUA 5DD5H 5TE6H 2GSIA 4X7TB 4XNDA 1MI5D 2YO3A 4I77H 3VNYA 4A7VA 1LE5B 1XF3A 4ZFOL 3VU2A 2A6KB 1E67A 1QLFB 2J6WA 4FFZL 3VB9A 2XI9A 1XH1A 2P8LA 4KROB 3RA7H 4APQA 1LO4L 4HDIA 5IFJB 4B9CA 3IJ8A 2H0FA 1FO0B 4GQQA 3V4VH 2MWCA 3D0AA 3ZY7A 3EYVA 2WWKT 4J3OC 4C56A 5HVFB 5JIMA 5CIPH 4J4PA 1JN6A 1QSFB 2PCXA 2JB5L 2QKIB 1M71B 2AJVL 5H37A 1GC1C 1KIQA 3EBAA 3F58L 3OZ9H 4JFQA 5DZ9A 4YS4A 4OB5H 3KPRB 2AF2A 4XWGH 3QUML 3L3OB 4PLKD 1DJWA 1LVEA 4L1TA 4CADA 2W9LA 2CDFA 2Y5TA 5EA0H 3WJLA 5J57B 4LEXL 4NUMA 2W5PA 1QEWB 3ZN6A 4A7QA 2QPSA 1T0OA 1F5WA 5FYLE 3MOAH 4HKZA 5GHWH 2OMWB 3PAUA 5BV7B 3ZTJH 2DIAA 3ATAA 4JDTH 1TTFA 3SKMA 5IUSA 1I7TA 1OLZA 4ZW5A 4P23C 4DF9A 4KKCD 4PJXA 4XGZB 3Q06A 3VH8B 2DWEA 3VXSE 1IZKA 3HE7C 5ESVA 1K5NB 4UZSA 2AJ3B 1EZVX 1KPVA 2AJYH 4ZW3A 3D51A 2OYLA 1JG9A 1NCOA 1O75A 2R0WL 4FHJA 4X6FB 4LSVL 1RK0A 2CK2A 2ZXBA 1N0LB 5DVMA 1CVRA 3L9YA 4PI2A 3HBPA 3UAFA 4DN3H 4L18A 5KWYC 4JREC 3UYPB 3BQUC 3D2UA 4M5YH 1B4LA 3I3BA 1QI5A 2OR9H 5KYUA 1CXLA 3VWJB 4UT9A 2NY3D 3MCYA 5KSVB 4F8NA 1MFEL 1ZLUH 2ZUTA 1I9EA 3FPXA 5CGBA 5FYJU 1TYEB 4F1ZA 4OKDA 2ED9A 4P3CL 5AAWA 1YEIH 3M8OH 1X5IA 4G7QB 4IDJL 4IRJB 2ZWSA 2ZOWA 1G0YR 1LGVA 4N3UA 1SJVA 3MV7A 3H8NA 1C7SA 4Y2DA 3WI9A 1N0XL 4HPYH 2IPKB 4PWGA 2CGRL 2YD6A 3KM2A 3GBMH 5DJ2B 4KUCF 3RWEB 2N3JA 4NNPL 3IFPB 4BWUA 1L0QA 1SUJA 3TH4T 3T1FA 3TYFA 5EOQL 1I75A 1S6NA 2QHRH 3VDCA 1QWHA 3BAJA 3DBXA 1RZIB 2JCCB 1JGVL 3ARZA 1EA9C 4X4YB 2VWEC 5E8DH 3K71A 4YO0A 4G6AD 2X4QA 3JWNC 5DU7A 4KTGA 4HJUA 1MI5A 3Q5TA 4ZS7H 1FGVH 2VZUA 5JIPA 1RLBA 4LCIL 3WE6A 2AK1L 1HHGB 5GSVA 3BYYA 3QEQE 2GUYA 1AIZA 3CFDA 4DP8X 5DJXA 2WYIA 4IEFB 4AM0A 3FFCE 4OLUH 3MLRL 4OFYD 4KKAD 5D6DA 4AVJA 4KROD 2XG4B 1N6QH 3OJ2C 3SYPA 4HJGA 3KDPB 3HI5L 1EUUA 4PW9A 4HJJL 5IF0A 4FQCL 4MMYA 5D1ZC 2F53E 5LGJB 1QSEB 3E2HC 3MX0A 1W0VA 1I9IH 2QL1A 3PDDA 2ZX8A 4JZOA 3U2JA 1QSFD 4HIEB 2N01B 2W0PA 1DEEB 5EU6E 4ONOA 3G5YA 4WFHD 1AYRA 3ALXA 3FO2A 1KC5L 3RX5A 2HYMA 3QJRB 3KPRD 4GLRI 2EDRA 1ID5I 1O7VA 4XNBA 4X9BA 5EIIB 2B5IC 4PJAB 3ZDZE 3RL2A 5C08E 5EWIH 4AW4A 3AS2A 2N7BA 1FNGB 1PBYA 1N6UA 4HXAH 4ZXBB 1IQDB 1FL3A 4IW4C 1YPZF 2D03H 2XWBA 4G42B 1Z66A 5TGBA 4FXGA 5GQBA 5IJBC 1MFCH 3HPJB 3MO1A 4ODTL 4D9QD 5EU4A 5I16A 3L4YA 5F7FA 3WTSA 3QXWA 4Z7VE 4E42B 2X5PA 1BGXL 1F58H 2OL3H 3MRRB 3FF8A 4Y5XB 2QZQA 2Z35A 3VTAA 2Y1VA 4YSQA 1HL4A 4IOSD 1R3IH 1G6RB 2AAVA 3DTUB 4P46C 4IJTA 4K07A 1B0RA 4OD1L 2XUWA 5I15H 1MPAL 4WV1B 1TJXA 4F8LA 3AAZB 5EO0B 3NIFF 3LIZH 4UOQA 3APCA 3WMQA 3OHMB 1EJ6A 1SHWA 3N91A 4WI3A 3EYFA 3ZTJG 3TF4A 3EYOA 4HEPG 1NC4B 7FABH 1FIEA 2EIKB 3L6FA 3B8SA 3VWJD 1BZOA 2A6DB 1U3NA 5CCJA 5I73B 4W6WB 2FH8A 4Y4HB 5JPMB 4RQQA 1Q9WB 2YJLA 3Q6GH 2NQCA 3T8MA 3JT2A 3JV5A 1HEJC 3VWKC 4BE5A 2FRGP 4I1PA 4IRJD 4Y2OB 3QYCA 1A4KA 3M46A 5CP7B 4H25B 5E8PA 1ZXQA 3AXIA 2RAMA 1BAWA 5BZWA 2VN5A 2AABL 2IOIA 2V3DA 3CVHA 3BGMA 1JDCA 3BPOC 4MMXB 3STLA 4W9ZA 5FECA 3NK3A 1XH3A 1ZJAA 3FCTB 3Q0HA 1D6VH 1XR8A 4J2QA 1XSKA 2X41A 4NQVB 4YHIB 5JDSA 3RRQA 3VFRB 4YSEA 4D0CB 4OLVL 3FB6A 2PXYC 2R1YA 2PETA 3A67H 4X7TA 4XVTH 2XXMB 4OGZA 4FFWC 4F7MB 1QZNA 4NGHL 3CK0L 1LE5A 4G70B 3LNIA 4N9GB 4YHYC 4RMWA 4DNLA 2A6KA 3O3UN 3L1GA 3R19A 4M6AA 1QLFA 1WZAA 4PD4K 3KWTA 1DQDL 1IBGL 2X7LB 1KGCD 3TEWA 3K2UL 1RI8A 4OV6F 5DLMH 2CBPA 2E7LA 5KTEH 3K6IA 3C08H 5IFJA 4KTDH 1D5ZB 1URIA 1UCBL 2WUBH 1FO0A 4XPTH 1KCSL 4ADGA 4U6HA 5FGCE 1WC7B 1A3RL 4GKSB 1QSED 1QSFA 2QKIA 1D5BB 1M71A 4L1HA 3MTXA 2OAAA 4Y9GA 3RDTB 3KPRA 3L3GB 3L3OA 2YARA 2DTSA 1X5KA 2YQBA 5FX3A 2JNZA 2R29H 2XY1A 3N6YA 4H1LB 1ZLEA 4N2BA 1QEWA 5TF0A 3SPVB 2OMWA 4H13C 4PD4J 2N1KA 3S37H 1AH1A 4ZXBD 5CEZL 4JM2F 1YMME 4NI3A 4XGZA 4KHTL 3VXNB 1DSWA 3VH8A 3GK8H 3V7AE 3WTWA 1U4EA 3KHOA 1IGYB 1UA6L 1K5NA 5KSUB 2AJ3A 1FVCB 5E94B 3TA4D 4OGXH 4KZ0A 3EG9B 5DUMH 4IOSA 4X6FA 1KWKA 2YAOA 4NQEE 2DL9A 1N0LA 5DQJB 2WOBA 3JTTB 3QAZC 5CINL 5JR1H 3TO2A 3IJ9A 4WO0A 3VJ6B 2G5UA 1UKQA 1JGLL 3RWHB 3P73B 4N8UA 3UYPA 4QT5B 5JOPD 1U2HA 3IU3B 5D7IF 1Z9OA 2ESVB 5GGSB 2D7MA 4DAGL 5A2JH 1QTSA 2AI0H 4U7MA 5E6YA 4ZS6D 2VNCA 3VWJA 4EN2A 1NC4D 1EFQA 4ZYKB 2XZAH 5E0QA 4Y4HD 4IRJA 2ZF8A 1PZAA 3AB0C 2BJML 3D9AL 3UCRA 5F9WB 2UZIH 5H2BB 5IVNA 2IPKA 5KVMC 4ERSL 2DWDB 5DJ2A 3RWEA 3IFPA 1CTOA 2L3BA 3NFSL 1AHKA 1UWFA 3V0JA 1SVBA 1RIVL 3CPUA 3EGDB 3LKNB 3QFJE 1RZIA 2JCCA 1AR2A 2VUOA 4X4YA 3VDBA 3Q6FB 4XNUL 4LNRB 4YSUA 3I50H 2ZCHH 2VRAA 1RZGB 2R0ZH 3C75A 4HJEA 5ID1B 2I27N 4N2HA 1N12A 5I66B 4I3RL 5T1DH 1Q0YH 4N8VG 2A9CA 1OV8A 4OIFA 1HHGA 3C5ZC 4NENB 1PNDA 2ITFA 1EK3A 3LXCA 3MV8B 4IEFA 3RVTC 3HG5A 5JMRA 3QZLA 4MXQC 4TRPH 4LPCA 5DT1H 4N2DA 2ZXCA 1OWRM 3KJ4B 2XG4A 1BMZA 2WWNA 3T2LA 3P4MB 4QXTB 3QJHB 7PCYA 1J1OL 2YFOA 1F3DH 3TGXA 2WVVB 2Z7WA 1QSEA 5LGJA 1F18A 1QASA 3D52A 3NT0A 4YUEL 1WBZB