2ZJSH

Crystal structure of secye translocon from thermus thermophilus with a fab fragment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
220
structure length
220
Chain Sequence
QVQLQQSGAELMKPGASVKISCKATGYTFSSYWIAWVKQRPGHGLEWIGEILPGSGSTNYNEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARSPYYYGNWDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Preprotein translocase SecY subunit
publication title Conformational transition of Sec machinery inferred from bacterial SecYE structures
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Protein transport/immune system
total genus 34
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2008-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zjsH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zjsH02
1LQSR 4CAGA 2VLRA 5ACMA 2VDKH 2J1KA 2W9DH 5KBNC 2GQHA 3KDMB 4G80A 3EDEA 1E0OB 1N3NA 2GTWA 1A7NL 3L9RB 4HDIA 1SYSB 4UTAH 3B5HA 5DK3A 4H1LA 1I85C 2R4RH 1AI1L 1BVKB 3EYUL 3DVNB 2R2EA 3I6LE 5C0BA 5CD3B 3N1FC 1TZHB 5CUSL 4ZXBB 1KPVA 1YEHL 1GAFL 3CLFL 4NYLA 4HG4J 1JZ2A 1YJDH 5JW5B 3UYRH 5E99H 3X12B 1YEJH 1A3LL 2A83A 5E2TL 3SDXB 3FQUA 3RWIA 4JDVA 1DSFL 2BNUB 4F80A 3MJ9L 5DVLA 3V79C 2EE6A 4P9HC 1P7QB 4JANA 1BF2A 4APQB 4ZOEA 4M6NL 3SDDA 1ONQB 3GMMB 3MZGB 4CJ0A 2NXZB 4Y88A 4AT6B 3V0VA 4LRNH 2BNRE 3LS4H 3MFFA 4HX1A 1Q0YL 1K3IA 4M93C 4JFZH 3BN9C 5E4EC 4XVUC 4HWBH 4WO4A 4MX7B 1L0YA 2WBJC 4QHUB 4W6WB 3CDGB 3JTSA 5J9PB 4R0LB 4HXBH 3KVQA 3FQNA 7FABL 1KCVH 3HI6L 5D2NC 5D7KD 4MD5A 5IGXL 3OKNA 5GS0D 4OLVH 3FO0L 4XBEH 4NN5B 3SY0B 1P2CB 4PJXE 3VXOA 5IB4B 1T7VA 1CDJA 1S3KH 3NZ8A 5JW4M 2J3SA 4GKSA 1TQCB 3MNVB 4DGYL 4JQIH 5HTSA 2DLFL 4HC1A 4JQVC 2NY4B 3RWCA 3ILPA 5I30L 1NJ9B 3MLXH 3G5VA 3LKNA 1NCCL 3O4LE 4DAGH 1Z9SA 1D5IL 1UH3A 4DKEL 4MMXC 1M4KA 3SCMB 3SGJA 4Y4FC 1ZT4B 2F58L 1HE7A 1T1WA 4EKXA 4FTVB 1BFVH 3NVQA 5EC2B 1RUQH 2IFFH 5FYKH 3RGVD 4ZAKA 1A7RL 3A6CL 5E8EA 2CUMA 5EU4A 2XOTA 5CGMA 4E41D 5F9DC 3FFDB 3IRPX 1T1ZB 1T5XA 3DHMA 5C0CA 5JXEC 4UTBL 2CIIB 4WDIA 3AFLA 1XGRB 4N8CL 5DVNA 3WEXA 5C0JB 1KTLA 2GAZA 1O7VA 1NMCC 5GGVL 4D9QD 1RUML 2ENSA 3MROA 4QRTA 4J6RL 1K8DA 2NX5A 1RZ7L 4YXKL 1HHJB 3VFMB 1N2RA 2N7AA 1BIIA 4XNUH 3QAZC 2NY0C 3HG1E 4BH7B 5FUZH 3MRQA 4M1CD 4BSVA 2OJEB 1MNUL 3JSSA 5DJYB 1CI5A 1CGSH 4P59L 1A1MB 3IFOB 5MERB 2AKRA 1OCWH 4UILL 1U3HD 4PREB 3NTCL 3BZEA 4L9LA 1V3MA 4YDVB 1GC1C 4YGAB 3KPRD 3BT2L 5BRZE 4FNLH 1FSKB 3FONB 1MJJB 4KXZI 8CGTA 3B9VA 5E94B 5FCSH 5GJSL 4XRCB 4IS6A 4KROB 4LVOB 4PLNC 5C08E 1W72A 4PJ7E 3WIHL 5CINL 1MAML 3MMEB 4NP4H 1JGDA 3KLHD 5FUCE 4KTYA 4ODSL 1RZGA 2C3GA 4YBHA 3PDOB 3V6OC 2A6DB 4ZTOL 1U92A 1N64H 5DQJA 3PWLA 4HSQA 4LIQL 2IG2L 3LSOB 3NCYS 5GSRB 2R1WA 4QOKB 2PYFA 3ARBD 3S3JA 2QSCH 3BE1L 5KOVC 5F71A 2ZUQB 4MD4B 2Q6WA 2OR8A 1ND0A 2MQ3A 2PYEE 3IDYC 1ZS8B 1SVCP 1PG7H 1YUHB 1J0ZA 2I24N 4R96A 3BDYH 2JE8A 4ZUVA 5BZWB 5DYOA 2NMSA 4WEBH 5AWNL 5KVDL 3E2HB 1E4XI 4ZQKA 3RWJB 4K8RC 1CD0A 1WBXB 4Y19A 5I1LB 4NRYA 2I60L 2A0LC 1LHZA 2AJXH 3QEQB 4HUNB 4AL8L 1A6AB 3M1BA 4XAKE 1MCEA 5E8NA 1CICD 2LABA 5HYQA 3MRCB 4O58H 1X44A 4Z7UE 3BD4A 5E6ZA 3G08B 2VDRL 2HVJA 4U1HA 5DUPL 3C08H 5AD0B 3HR5A 3FB6A 4U2YA 5EN2B 3S34L 5IB1B 5FDWB 4CMHC 4UAOC 1UQSB 1WZ1L 4Y2DA 1NEZA 1XH3A 1NUGA 1TJGL 1C08A 5CSZB 4KDTA 4F33A 5IMMB 5JQ6H 3EJZC 1FNLA 2VSDA 3D9AL 4FP8H 3S35H 4F3FB 3MRGA 2DQCH 1AGBA 3QSKB 4XCCH 2X1QA 5D7LE 5DJAA 1YEFL 1CTNA 3BGMB 2QADC 3UTTE 5HYJB 2D4FA 2FIKB 3BEWB 4ETYA 4YXHH 2YBRB 4NO0A 5B21A 1I3GL 4JRXB 3NCJL 3LQAH 2UZXB 1NCUA 4XP4L 4YFEA 3B3IB 2P8PA 1E4XH 1JGEA 1XIWD 3QXWA 5TF1L 2EE9A 4AM0A 3TT1H 3W0WE 1I1AC 3N1PC 4G6KH 1HYSD 3OAZK 3B9EA 2F54E 4PTTA 1CIDA 3O81A 5DD5L 5BV7H 1KULA 4XX1G 5DD3H 5C9KA 1C12A 2QQLL 5A1AA 2BXYA 4MNHA 3VFNA 1NSNL 4POYA 4NZRH 4ODXA 3LN4A 1UCTA 2AEWA 1P6FA 1FL3B 4UV7L 4XZUA 2NTFA 2ATKB 5JQHC 1FVDA 3OXSA 2YUWA 4FQIH 4GW4A 4PR5B 5DJDB 3NGBC 3MV11 3QCVL 4QKXB 4F2MA 2HLFD 5HDBE 4PJEE 2DQIL 1UZ6F 2GJZA 3QUZD 4X6CA 1J88A 3HNSL 3HMXA 3NMEA 2SEBA 5JO5B 3EJJX 5TQ2H 3ES6B 1M6OB 5J0BA 4F7PA 3GHEH 4P4KB 5C0RL 3W9DA 3QUXB 2HFTA 4ZFOA 5FKPA 1P7HL 1RSFA 3MBEC 4UB0H 4DGVL 4LPXA 4RMQA 1WJ3A 3AS1A 4XC3L 2KBGA 4G6ML 4GMTH 1C16B 2FR4B 4OTXH 1MH5A 2AJUL 5I19L 2EH7L 4PRDB 3O3UN 3WNOA 3CK0H 2OSLA 2H32H 3UZQA 2J6EA 2FH8A 4XB8A 4BKLB 3NCBB 3L3KA 3VDCA 2VQTA 3VRJB 2ZG3A 2EXYD 3CVHH 4X99B 1KJ3H 3E8UH 4YDLB 1J86A 2YN3A 5TFSL 1ZWIB 4B53A 3T77B 3S36L 1EGJA 1UEYA 4PRPB 3V6BR 4GG6B 1PX3A 5ANMA 4QWWD 3FFCD 4RISH 5JORA 3OF6A 3FO9B 2IPTL 3U30C 5I18H 2KZWA 4ZS7H 3EOBB 3ZE0F 2DM7A 5FUCC 3PHQA 1NUFA 1MCCA 3C8KB 1MUJA 4AIXA 5MENE 4YE4L 2MPAH 2PTTA 3GSUB 4NKDB 1FE8L 3MR9A 3DUUA 2CJUL 1KBGL 1EK3A 2J2ZA 1A3QA 3BHBB 3BXNA 5F7FA 4G9FA 3MV9A 4KZEH 5DR5L 1B4RA 3WKNA 1OP5K 1BVLA 3U1SH 3OAUH 4IRJC 3EW3B 2X40A 1AGEB 2G5RA 3V4VL 1BVZA 1N0LA 1J0KA 4IIQC 4OLUH 5HDOA 3VFPB 4PP1D 4MJIE 4OGXH 1HXMA 4PJHB 4HQQH 1ZVHA 2AEQH 3BKMH 1U95A 1EAPA 1S7UA 3C2SA 1P7KA 2G2RB 2IANA 4NSKB 3KLAB 1I7RA 3BFOA 3O45B 1F00I 3MODL 3MUY1 2D31B 3L7EA 4H5SB 3VH8G 2ED8A 4NIKB 4OD3L 1E6JH 2B4CL 3UTPE 4C58B 4FG6C 5FYJL 1FVEA 3WXWL 4UT6H 4YGVB 2WBWB 4N0FA 4D0DB 2NY3B 3SE9H 4EN3C 5HSFA 1P7QD 5E2WH 1RIVL 1YQVH 1ZLWK 4APQD 4NZUH 5GGSY 4FFYL 2ARJQ 2QLVB 4LLAA 4L8SA 5IK3A 2NXZD 4ZDHA 1Z6JT 4LRIA 4JB9H 3DX7A 1T1XB 3KPMB 4CN6A 4MA1C 4HS3B 3HS0B 3O3DB 4J3OC 4LLDB 5C07B 1S5IL 5F7NC 5D5MF 3T2NL 1GH7A 5IESH 4NO2B 1RMFL 3FN9A 5JW4N 1TJIL 3LEYH 1A7QH 5EZLA 4NN6B 3CFEB 1XCQA 1U36A 2PXYD 5ALCH 5FFLA 2DQDH 3I02A 2CLRA 3D1MC 2YA0A 1OOAA 1J8HB 3VE0B 4JHBA 1RZKC 1REIA 3ZE0E 1D9KA 3VXRE 4XVSL 3L3HA 1F3JB 3NFPB 4NPYA 1PZUB 3WHE1 2P8LA 3B2VH 3ZDZE 3CX2A 2VQUA 4Y5YA 5C0IB 3BDXA 5TF0A 5JZ7D 1HH9B 2XACC 3UJJH 5IFJA 3CSYB 3TNNA 3P77B 1OP3H 4OGZA 3HE7A 1T04A 4P4RA 2OTUB 3HC4L 3L3OB 2EDOA 1CGYA 1KG0B 2B5IB 1KIQA 5E4EB 4OLXL 1CBVL 4KRMB 2EH8L 2R4SH 2WBJB 1IAOA 1JHTB 2G60L 1C5BL 3ZHDA 5D2NB 2D7QA 4HPYL 4PPTA 1K8IB 3DETC 4MA7H 1O0VA 3P11L 1DBML 5IB5B 4PGDB 2E7LC 3MOQA 3T3PF 4YHLH 1FC2D 4OZFH 3V7MA 4QRQB 3T4YA 4YQXL 1NL0H 5D93C 2WQ8A 3IDIB 3SDYL 5HGDA 5IVNA 3U6RA 2VXUL 1OAZL 4K7PL 1NCDH 2K7QA 2CRIA 1VKXA 3ABZA 2EEDA 4GRWB 4LLMB 1BJMA 2VDKL 2WIIB 4Y4FB 1GOGA 2W9DL 2DIAA 4I48B 1AR2A 2EIBA 4PB0L 4UTAL 4U31A 3ZDYE 1YNTA 3N85H 5AZEH 3GMQA 1U3ZA 4R90H 5KSBE 3KYNB 4Z7VB 1NLBL 1BWWA 4QRRD 2VL5A 3OBAA 4U1SB 1YN6B 3OJDB 3PWNB 4UNUA 3I84A 3CX5K 2QKIA 3UYRL 2OXHA 1X6LA 4Y89A 2YD5A 3X13B 4TUOB 4YHPB 3LKRB 3Q6GH 1TCRB 3FB7A 1BLNA 5EBWA 1L4IA 1KB9J 4LBEA 1SM3L 2W9EH 4KRPD 3RL2B 1S7QB 5K9OA 3OJMB 1IC4H 5SWSB 4JGJA 1BD2B 4WWKA 4K94C 4ISVA 3C5SB 1P4LA 1I1FA 4PGBB 5HVFB 2NY0B 1NMBL 2VIRB 1TVBB 4YHNA 5EO9B 2J8UB 3IAGC 4LRNL 3LS4L 1YPZB 5FV2A 5D96B 4OV6F 1NUDA 4YHIB 2P5WB 1PG7W 4JFZL 2VKXA 1QO3B 4HWBL 4EUPH 4ZG1A 4YZFF 2ICEA 4HXBL 4N8VB 1KCVL 4LAQH 2IAMA 2C7UA 4LSTL 3ZLQC 5HDQH 4OLVL 2VZVA 4XBEL 5BS0E 3BJLA 4X6CF 1UWEH 2GKIA 5IM7A 3WNLA 1S3KL 2R1YA 1S7VA 5DZOA 4RX4A 5DFWH 3T8XB 1EUUA 3BDBA 4JQIL 5I2IB 4P2RB 4QHMA 4X4YB 3SDDC 3S4SA 1WZLA 3OGCB 3MLXL 3SKNA 5HY9B 3S96B 1VPOH 3OKOB 3TVMA 3DRTA 4PLJC 4DAGL 4Y5VA 5SV4A 2W60B 3NAAH 4WO4C 4PV8A 4GAFB 4JO3L 3MCKB 4RIRB 4D0CA 3OXRB 2Z92A 3WDJA 4POZD 1IC5H 2IFFL 5FYKL 1P1ZB 1RFDH 1JZ6A 3KPLB 4YAQA 5L8KB 3V9FA 1U91B 1AC6A 5DJZA 5B8CA 4M6MH 5F6HI 3VH8B 3WIIH 3OR6B 1NANI 1T66D 4LHJB 4ALAH 1LO4H 1E28B 1I7UB 2OL3H 4OZHA 2BVYA 3JVGC 2LU7A 5FYLD 1QSFB 5J3HC 2HLAB 4LU5H 4E42A 3KLSA 4JN2A 4IOSD 5FGCE 4JFPA 4WI6A 4P23D 4XNUL 3SGJC 4Z95H 3NH7H 5IVXA 1JWSA 3L5HA 3S37X 3K2MC 4S1DC 3MNWA 5TE6H 3P9MB 2Z31A 1CGSL 5JW4Q 2FEDD 2BNRB 4PD4K 4YZFE 4OZIA 4CMHB 1EJ6A 1OCWL 3DPBA 4G8GD 5E95B 5T5FH 4G9DA 5IEHA 4Z0XB 3O6ML 3C6LA 1YEEH 3Q6FA 2XIDA 1ZA3B 5HPMA 3BP6B 2A9MH 1KXTB 4X7EC 1BQLH 4F7EB 4WU5B 3MJ9A 2WP3T 3VFVA 4QF1B 3T09A 1TZGH 5HI3D 3PL6D 4FNLL 2XWBA 1EO7A 3QHTC 2APVA 5D7JD 1FO0H 1D5ZB 5EC1B 2QADB 5BXFB 3MLRH 3QQ9C 3ARGA 4OFYA 4PJXB 3D85A 1CDIA 1IZJA 2FSEA 1UXSB 3QP3A 4KJQC 1F5WA 3MRFB 2IJ0C 3QUXD 1PQZA 4NP4L 2X1OA 4PRHE 4ZUUA 5ITFA 4PFEA 1OWWA 1ULVA 4L4VB 1WZMA 5DHYB 5K9QG 2GSIA 3IFPA 1N64L 5DF0A 4XP1H 4QTIL 1NANH 5A16B 4MB3A 4F7MB 1NGZA 2FRGP 4NT6B 5HHPB 3BZ4A 5CHNB 5GPRA 2QSCL 3UTQA 1RZ8A 5KW9L 4MJ5B 4MQ7B 4L9LC 2XKUA 3PIQB 4H20H 1GZQB 4JVUA 5T33H 1OAXL 3BDYL 3QHZH 1EO8H 3QDHA 3I85A 1HKFA 4Z76A 3BKYH 4U6XA 4Y1AB 2V2XB 4ONGH 4WEBL 2FGZA 2NZIA 3B9DA 5ANME 3F7QA 1C7SA 5C9JB 4PRPD 2R1XB 3JTTB 5EDXA 2VL4A 3NGBB 1H3UA 4KKAC 2FJHB 1JYXA 3VGHA 5DRWB 3TIEB 4L3EB 4KGJA 5T1MA 4TVPH 2AJXL 3GMLB 2XQBH 1ZK9A 5DEFB 4G5ZH 5I8KH 4BUHA 2FO4A 1D6VH 1INDH 1U8OB 1KJVB 1WV7T 1JMXA 4WFEE 3F7YA 2PCPA 4IHOA 1FFOB 3C08L 4JHAH 4NQSB 3HG1B 1CE6A 1IGYB 2N56A 4F9PA 4ZFGH 1QFWL 3ULUD 3WN5C 2MQ0A 4JGMA 1G84A 4Z7OE 1I7ZA 2DDQH 4HUVB 3TPUB 3BVNB 2EO9A 2B0SH 4H1LG 4JZNA 2ENYA 5ISZB 1J1XH 3RNKB 2L4OA 4ZUSB 4FP8L 3S35L 2NY2D 2XN9A 2DQCL 3JWDC 3DUHA 4XCCL 1IEAA 1QQDA 5BRZB 5ICZA 5A2JH 3TN0D 4J4PD 3GSRB 1S78D 3TWCH 3R06B 2NY3D 2W9LA 4M48H 2V5YA 1FFNA 1J0YA 3LQAL 1UVQB 3UYPA 6CGTA 3ARTA 3TFKC 5SV3A 2LQRA 2YZ8A 5F70A 3UROR 5F9JB 3CNKA 4RFOL 4XWGH 3TT1L 1ZVSB 3C9NA 4G6KL 5C07D 4IMKA 2J7LA 4Y2DC 3VFRB 2VDPH 5DD3L 1HXYB 2OTWB 4Z5RA 5DK0B 5CJOH 1ZANH 5LXGL 2VXQH 4NZRL 3BGFB 1B3JA 3GHBH 5F8RC 1F4XH 2WAHA 2PETA 3L3DA 2R2HB 4IIQB 3QIBA 2A9NH 4FQIL 4OZ4B 1NCBH 1UEMA 2R39A 2X42A 2YXMA 1HHHA 43CAB 1IL1B 4HKJB 5DJ6A 5ECJE 4HUUB 3H7BA 3OB0K 4S11A 1IGFH 2V5TA 4J2XA 2Y06H 2CGRH 5DMJB 4H0HB 4DKDC 1WIPA 2E27H 5LGJB 4OCYH 4H8WL 4BYHA 4P49A 1B9ZA 4LCWE 4QHNB 2CXGA 3GHEL 2R2BA 1T1YB 4JKKA 4Z7UB 3HZYB 2VAAA 1ZSDB 4AMKH 4UB0L 3V4UH 4DOHE 3FN3A 1YDPA 1DQMH 5D71H 3FZUC 1GJIA 3LQZB 4OTXL 3U0PB 3AY4C 2I25N 4MA1B 5KS9E 4OIBA 3SGEI 1ZT7A 3VXTA 4QHLB 3BN9D 4XVUD 2E9IA 4DJMA 2C3VA 4U7SA 3UAJC 2WBJD 5IQ7H 4JHWL 3W9EA 2AK4E 4YPJA 3CVHL 1KJ3L 3E8UL 2J12B 2CK2A 4P9HH 1B0WA 4UDTB 4B5EA 3BH9B 1R0AH 3EFFB 4RDQG 3B4NA 3K4DA 3MRDA 4RISL 1MI5D 5I8CA 1S7SA 5I18L 1GZPB 1P84J 3PHSA 4RMTA 3KPNA 5IHZB 3LN5B 2MPAL 1X5XA 2X7LA 4JFFB 1S8DB 3W0WB 1I8KB 3TT3H 4P3DB 1FNGA 3IT8D 3RWHA 4I0CC 5L88H 4AZ8A 2Z93B 4KZEL 1A9EA 5B38A 3Q5TA 4HS6A 2FHBA 2JJWA 4YBLB 1QBBA 3LEXB 1FRGH 4M8QA 1KPRB 3U1SL 3OAUL 4LCUA 5TH2B 3KG5A 1G7LA 4PP2B 4PG9A 3NN8A 5F6HJ 4OLUL 1LE9B 2LU4A 3PQYD 1K4CA 4GUPA 2FJFB 4Q6IA 4W6YB 1UM5H 4HQQL 3BKML 2AEQL 5JXED 1BZ7A 3DIFB 1NAMH 3KWWA 1NC4D 2BMKA 4N0UB 1RJZB 1W8NA 3SGEH 4JKWA 4OZHF 1WAAF 4R2GB 3LRSB 2D7MA 2EYRA 1F8TL 2AXFA 4B50A 5IG7B 5C0AE 5D1ZA 2JB6A 2K3TA 5SWSD 3SE9L 2A74A 1PAMA 5E2WL 5D93B 1YQVL 4NZUL 2BNQB 2B1AH 2NY0D 5IVXF 3HB3C 4M61A 5JDJA 1QRNA 3HRZB 3VWJD 4WNQA 4JB9L 3P3YA 1LDPL 4XPFH 1SJHA 2CKBB 5F1KC 5IESL 5L0QC 4GQ9H 3KPOA 3JXAA 1A7QL 1A6VH 4WJ5B 3MLTB 3B9KA 4Y7MA 5EU3B 2JJTC 2F53E 5ALCL 2M8XA 3GMPA 3VWKC 1N8ZB 5F8QC 2DQDL 4D0BB 2R0KL 1WBYB 5J57B 2O61A 3O3BB 4HJ0C 1IM9D 3IDNA 3QT2A 5TDOB 4V1DB 3OAZH 2CDFA 3GDBA 5L2JA 2ED9A 1A6ZA 1LEKB 3ARVA 3OKDB 4FXGA 3QIUC 5HVWA 1LD9B 3THMH 1GC1H 2VLRB 1FLRH 3UJJL 1DEDA 1G0YR 4WW1A 3Q0HA 4G80B 4HDIB 1N3NB 3PXHA 2GTWB 1QFUL 5IV2A 4H1LB 5ALBH 1A7OH 1T83C 1M7XA 2CQVA 1NEZG 1ZHBA 5F96H 1JZ7A 2R2EB 5C0BB 2R4SL 2XNAA 3I6LD 1KPVB 2VR4A 4K8RD 4NYLB 3VFSA 4ONHA 1BP3B 2A0LD 3FAWA 4MA7L 1G6RH 3QB7C 1JF5A 2A83B 3FQUB 3VCLA 1CDYA 3RWIB 4JDVB 3DO3A 3RTQA 1NL0L 4JANB 25C8L 2EDNA 4JO1H 1NCDL 2VDLL 3VFGH 1NKOA 1SJEA 3SDDB 4Y5XA 2X89D 3V0VB 3MFFB 4X7CC 5JPMA 4HX1B 4OZIE 2IADA 2BNRD 3V7AE 3ALXA 4TUJA 4WO4B 5GGVY 5C0DA 3JTSB 1WICA 4OZGA 4QRPE 3FQNB 3N85L 5AZEL 3PXJA 1TDQA 3EJZD 5EORH 5C3TA 1PBYA 3O9WA 4MD5B 3OKNB 4R90L 1SJXA 3O6KH 2AW2A 2N4IA 5IJVA 1G0XA 3AMLA 1NCWH 2NXYC 4HAFA 2HTKC 1XMWA 3EYOA 1BQSA 2QADD 1M05A 3O41A 3VXOB 3NZ8B 4LMQE 2VDOL 4GKSB 3VGEA 1BBJA 1O5DT 2FX8L 2ICCA 5KSUA 3Q6GL 4J3XA 1D5MA 1V8HA 1HINL 1RIUL 3ILPB 3RWCB 5EWIH 1H5BC 3KR3H 1MCSA 3QXTA 3G5VB 3LKNB 4N90E 2EYTA 5JHDE 1IC4L 4FZ8L 1I1AD 2VZ3A 2YA1A 1MFDL 2Q1EA 3DV4A 3F7PC 3O4LD 4MXWL 1XZ0A 4HIXH 2KUTA 2YD2A 1T1WB 1KPUA 4I4WA 3VD7A 2YPLE 1SBSH 4LKCA 1VHPA 3ARDA 4YC2C 4ZAKB 2P44B 5DMGC 5E8EB 5EU4B 3ME0A 2ADIA 3GJFK 4LDEB 3IRZA 5JLZA 1BEYL 2YWZA 1T5XB 4JO4L 2K1MA 5F89A 2E7BA 2ZUSA 4OKVA 4GRLA 5C0CB 3RDTA 5AUMA 2ICWI 1F3DJ 4WDIB 3MLVH 2AS5M 3WEXB 1ZLWH 1KTLB 2GAZB 2V6HA 1Q9KA 4KPHH 1UWEL 3VI4F 1RHFA 2R0ZH 2XKSA 3MROB 4QRTB 3U4EA 1OD7A 1WIUA 1K8DB 2NX5B 2BSTA 1N2RB 1BIIB 4C83A 1MCDA 3MBED 3MRQB 4BSVB 2AXGA 3HG1D 3VXMA 1VPOL 1K5NA 3RAJH 5IWLA 5D1QA 3RWGA 1NGWA 3F8UB 5JW3L 2AKRB 2HA1A 3MV7E 5DQDH 3NAAL 3RKPA 4BZ1H 3BZEB 3AGVA 4WEUD 3VGAC 5CFHA 2LFGA 3IS1X 4L9LB 4X4ZA 4I0PC 3UC0H 1RFDL 2BP3A 2H9GA 2DQTH 1XR9A 2VQ1A 1DVFC 1IKFH 1CT8A 5BRZD 4XXCC 4JZJC 4M6ML 3HRPA 3L3GA 3I6GA 4IS6B 1W72B 5CEZH 4ALAL 5IIEA 1LO4L 4MSWA 5IT2L 5C08D 2ADFL 4M00A 2OL3L 1JGDB 4QCIA 3H42H 2PKDA 3TBVA 4KHXH 4Q2ZA 2Y36H 1RZGB 2QL1A 3QUYC 2C4FU 1PW3A 4R8WH 1WZKA 1U92B 4LU5L 5DQJB 2X4SA 3PWLB 2R1WB 2PYFB 4Z95L 3NH7L 2Q6WB 4MD0A 5TDNA 1ND0B 1UWXH 3SKMA 5TE6L 2PYED 4TUKH 4R96B 4I3RH 4ERSH 2IEPA 4IRJD 2V7HA 3GKWH 1SQ2N 4ZUVB 5T5FL 2EDDA 4NRZA 3HNVL 5DYOB 1CLYH 1YEEL 4LIQE 2VLLA 5E08H 4ZQKB 1Q9OA 1NAKH 1BQLL 2Y4SA 4FQQA 4Y19B 4Q7DA 3D18A 4NRYB 1TZGL 1JK8A 2FD6H 2H1PH 1T80A 1WQVT 1FO0L 3M1BB 5K9KA 3MLRL 1MQ8A 5E8NB 4FG6D 4HIEA 1XGPA 1RZFH 4XAKD 3EO0A 1ZXQA 2DBLH 4LPVA 1MRFH 5HYQB 1HKLL 4QT5A 4EN3D 2HVJB 4OFPA 4U1HB 5T5NG 3RFZC 3SJVE 2NQCA 2ARJA 1BWMA 1MWAL 2BVEA 4AJ0A 5MHSE 3BZDA 3U7YH 3HR5B 4XP1L 3FB6B 1F4HA 4KAQH 4OM0L 4JFYA 4EDWH 1GXEA 1WFNA 2E9JA 4TSCL 3UPAA 1NFDA 4Y2DB 1NEZB 1XH3B 2UWEF 4IMLA 1C08B 4ZFFA 4X8XA 2X70A 1FZMA 3WNKA 4F33B 5T33L 4KH2A 1OGAA 3QHZL 3SQOH 2HTLC 1EO8L 1XF1A 3MRGB 3BKYL 1AGBB 4XCYA 3T3MF 5DJAB 3VGFA 5D7LD 1L9NA 2D7TH 3UTTD 4NO0B 2GYSA 3TIDA 2V9QA 3RY4A 1IQWL 4PJIE 4TVPL 1U8JA 3KHQA 2XQBL 1UM4H 5LVEA 4G5ZL 2YA2A 3I75A 2MKLC 2P8PB 5I8KL 1JGEB 4XCEA 1D6VL 3DVFA 4AM0B 4MVBC 4KRLB 1MPAH 4CN1A 3W0WD 5JPNA 4PTTB 5FGCB 1U42A 3VU2A 1C12B 2F54D 4JHAL 4DQOL 4MNHB 2EDBA 3VFNB 4YXLH 3G6DH 4ZFGL 4ODXB 3LN4B 3BI9X 1RZKH 4XZUB 2NTFB 3IU3A 4JKMA 1RU9H 1FVDB 2EDHA 3OXSB 3FO2A 4GW4B 4UOW1 2B0SL 3P4NA 1I1YA 1HZHH 5IMLA 4TNWK 1J1XL 2VC2L 4F2MB 3OKEA 3DETD 2GJZB 2BOCA 4OF8A 1O7SA 4X6CB 4E41A 5I71B 5C6PB 4PRIE 1AIFA 4OQ1A 2SEBB 5IOPA 2CDGA 4M48L 4F7PB 1BREA 3U7AA 1ZE3C 2G5BA 3W9DB 4ZFOB 5I73B 1GCFA 1Q8MA 5FKPB 3BZFA 1GSMA 3MC0A 3QYCA 2BY0A 2VLJA 4XWGL 4F8TA 4MB5A 2WLYA 4GAGH 1MH5B 3R8QA 2VDPL 3TO2A 2OSLB 1YEDA 4Z7NE 3MSPA 4DN3H 3L3KB 1ZANL 2HFFA 2VXQL 4WFGE 5DMIH 2VO5A 4LSVH 1U3HA 5DZLA 5HBBA 2JKXA 3FQTA 2A9NL 1KLGA 1NCBL 5ILTL 4X6FA 5ANMB 3A67H 4OIIH 4X4XA 3AUVA 3HZVA 5JORB 1IAKA 1IGFL 2Y06L 2CGRL 8FABA 3PHQB 4Q6YA 2XYCA 3UP1A 1MUJB 4TOYH 2PTTB 3HE6C 5MEND 4IMKC 2YZ1A 1MJ8H 3WJLA 1M1SA 1JPSH 3BIKA 3MR9B 3AU1A 3CPLA 3DUUB 4AG4H 4AMKL 1NQBA 3BXNB 1DQML 3MV9B 4G9FB 5D71L 4KUCD 1Z0MA 2HYMA 1YMHA 4ZUTA 5I76A 1BVLB 2YSSA 3CDCA 1WK0A 4PG2A 3KPPA 5DI8A 1KCSH 5F3HA 4J23A 3IKKA 4GBXC 4LSSH 3CDFA 5IQ7L 1B0GA 3FQXA 1RY7B 1HXMB 1WITA 4DUVA 2ICWJ 2NY6B 4MJID 1U95B 2G75A 1EAPB 1S7UB 3QRFM 1FL6A 1P7KB 1F97A 4MGXA 3WLBA 4Y4KD 2IANB 3DMMC 2Y1VA 3SOBL 1I7RB 3L7EB 3MFGB 2CUIA 1R0AL 1FV1A 1FVEB 4HGWA 3UTPD 4FXKA 1YY9C 4BK4A 4N0FB 2VISA 4BFIA 5FM5M 5DRNA 3SDDD 4L8SB 3GSNH 4ZDHB 5IK3B 4CBPA 1JRHH 2WQRA 1IM3A 3DX7B 3WIFA 4PLJD 1R3KA 4CU8A 3QPQC 3TT3L 4WO4D 4OZGE 4FFWC 1FBIH 5L88L 1EXUA 3LEVH 1FRGL 3ULVH 4UZGA 5EZLB 1XCQB 3V7AG 3ILQC 4ZS6C 1H0DA 2O93L 2FECL 5CP3A 4K7PY 2XY2A 3I02B 2X4NA 1NFIA 1UM5L 4N8PA 2CLRB 3BPLB 1D9KB 3L3HB 4G7VL 4ZTPH 1EO5A 3VXRD 4RA0C 4NPYB 5J3HD 2P8LB 3CX5J 5HYEA 4Y5YB 2C4XA 2F15A 1KN4H 4WHYH 5M95B 4YDJA 5HGBA 3MZTA 5IFJB 2B1AL 1AY1H 1E4JA 3D2UD 3TNNB 4L3CA 1XIWA 5KVGH 3HE7B 1WWAX 3MOAH 5CLTA 1T04B 4S1DD 3MRRA 4P4RB 5D1XA 3DYPA 1BGXH 3MREA 2GK2A 5C0NC 1KNOA 1KIQB 1UA6H 2I9LA 3KGRA 4RMRA 4GQ9L 2MJWA 3MV8A 3IF1A 3QUKA 1IAOB 2CR6A 4BSJA 4PJFF 3EOAA 5HXMA 1A6VL 4RBPH 1HHIA 5IFAH 4UQ3A 5I1KH 4QTHA 1LMKA 4EI5C 2V5SA 1U2HA 3QQ9D 1AD9A 2CUHA 3R0NA 4KJQD 3T4YB 5JOFA 3A6BH 1TTFA 5HGDB 3U6RB 1UKQA 2H32A 3QUZA 2H3NA 9CGTA 3EZJB 1VKXB 4KK8C 4J3TA 5CZXD 4EXKA 3THML 1GC1L 4LSQH 1FLRL 1NFDF 2A6KA 4I13B 1P69B 3RVUC 1YNTB 3GMQB 5ALBL 3CD4A 4Z8FH 2OR7A 1MFNA 1WF5A 2E6JA 3B9KC 3OB0H 5F96L 2VL5B 5GGRA 1LO0H 3PWVA 1JV5A 3VRLF 4KKAD 1JF6A 1GHFH 1LK2A 2QKIB 1VENA 5HJ3A 4XPAL 5T3ZH 4GFTB 1G6RL 3FB7B 5F6IC 1BLNB 5EBWB 4U2ZA 4G3YH 4LBEB 3EGSA 1QD0A 3FFCA 5K9OB 5FK9A 4WWKB 2E6QA 4ISVB 4DFHA 1P4LB 1I1FB 1G7JA 2JCCA 4JO1L 4UT9H 4FQ1H 4I5BA 2LAGB 4CDHA 4YHNB 2E9BA 3ZHKA 4FQXC 5EFIA 2EE3A 2XQYK 5HHXL 1YECH 4ZO9A 1JHKH 1Q38A 4RRPG 3U2SA 3MYJA 4HMEA 2XTJC 2ICEB 5FAAA 2IAMB 3LH2L 2C7UB 4PD4J 5EORL 3O6KL 4BQ9A 1EZVY 1NCWL 3HNTH 4L3AA 2I07A 5IM7B 5BS0D 4AEHH 1KIRA 3CU7A 4MNGA 2R1YB 1S7VB 4KVCH 1X7QA 4L8DA 5KSVA 4P57A 1OSZA 4CUCA 3ALPA 4QHMB 3TFKD 5C7XH 5EWIL 3S4SB 3KR3L 3GI9H 3UTSE 3SKNB 4CVWA 3TO4D 1X5FA 5C2BH 3ZMRA 3TVMB 3DRTB 2UZYB 2R56H 4Y5VB 4GS7C 4HIXL 4PV9A 4ZSOA 3UMTA 4PV8B 1YNLH 4OCRH 2G9HA 1SBSL 2B7DT 1OGAE 4HJGA 4D0CB 2Z92B 4YAQB 3RJQB 4PRAA 5C6TL 3ESVF 2ARWA 4LLVA 4YHZH 3V6ZA 5DJZB 4OAWA 4TNVK 5B8CB 4YIQA 3TC9A 1NGQH 4N68A 1JJUA 2BY2A 4M1GH 4UOJA 2PNDA 1NBZA 3L7FA 5IB2A 2WUCH 1FNSH 4OZHB 1KTDA 2PXYA 5FYKE 2JJSA 4NKOA 4LSRL 4OGYH 4M43H 4E42B 4JN2B 5EBMA 4PJ9C 4JFPB 5IVXB 1JWSB 3GM0A 1TZIA 4CW1A 3MNWB 3FZUD 1V7NH 1DQQA 2V9TA 2Z31B 3ARDC 2P45B 2D03H 4U0RC 3VD9A 4HULB 4OZIB 3SKJH 4AY0A 5DQDL 2OS7A 4G9DB 5IEHB 3C6LB 5CKAA 3Q6FB 5B38G 5HPMB 4JY6A 4BZ1L 4NKMA 1TENA 4X5WA 3RDTC 5GJTL 3UC0L 4NOFA 3VFVB 3MRLA 4BFBD 5KZCB 2DQTL 4U1KA 2XWBB 2KDGA 3ARXA 1ES0A 1Z9LA 2W38A 1WGOA 2GJJA 3ARGB 3D85B 3FKUS 5BW7A 2FSEB 4K9EH 4WHCA 3RZCC 5CEZL 3I50L 1PQZB 4ZUUB 3DURA 3H42L 3U4BH 4M62H 2BFVH 5ITFB 5IB3A 4PRHD 2Y36L 2VLJE 4MZ2A 4R8WL 1F90L 1IC7H 2GSIB 3ETBF 3IFPB 4GSDL 3P4LA 4UQ2A 3IDUA 1NGZB 3R4DA 3S5LA 3BZ4B 1ITBB 3UTQB 4NQCE 4HPOH 1F4WL 1RZ8B 4MQXC 5DUMH 5JA9A 3D3VA 5I16A 3TJEH 3O6FD 1F58H 2AQ1A 2XWJA 4TUKL 1H8NA 4I3RL 5T1DH 3GKWL 4Z76B 4U6XB 2EDEA 1T0NA 3VMPA 1CLYL 1QNZH 1ITCA 1AXSA 1CF8H 5DWUH 1ZHNA 1JVKA 1XF2A 1MY7A 3O2VL 5T1MB 3TNMA 1FG2A 2FD6L 2H1PL 4QRRA 2R15A 4W6XB 4M1DH 1Z5LA 4HZLA 2FO4B 5C70A 2CKNA 1RZFL 5F9OL 2DBLL 1DANT 1FNAA 1MRFL 4HFUH 3DXAE 5HGGS 3F7YB 2PCPB 3G5XA 4IHOB 3BAEH 3SN6N 4O02L 4RGOH 4WFED 3RIFF 1T7WA 3FRPA 3QHFH 3HB3D 3KYMA 1OWRM 4NCC1 5FM8A 4LGPB 1CE6B 4EDWL 2PW2A 4FN0A 2NY1C 4RNRA 1FL5A 1I7ZB 3LMJL 5BZDA 1T5WA 4HK3J 3NPZB 3CFKA 4JZNB 1VADA 3VXQA 4GRMA 3SQOL 3P9WB 2XN9B 5MEPA 5FO8A 1FPTH 3V8OA 1I9EA 1IEAB 1QQDB 4HCRH 3KPSA 5EOTA 3VWKD 5ICZB 2RR3A 3Q2CA 3U0TA 2D7TL 4G43A 3BP5A 4LPTA 4NC0B 1CR9H 4HJ0D 1OVZA 4YLQT 1FFNB 2YUXA 1UM4L 4YPGA 5J1TC 4D8PA 4OCMC 4YWGH 2Q8AH 3WHXA 2JIXD 4CDGC 4Q9RH 3QIUD 3BOVA 5B22A 4XWOC 1ZEAH 2KQNA 4QEGA 3C9NB 3EYVA 4XPGL 5JIPA 3FHQA 3WNMA 3GIVA 3GJFH 2ILLA 4HHAA 4M8VA 5GRZA 3EHBC 4Z5RB 3O2WH 5J89A 3NIDE 2CLZA 4YXLL 3G6DL 2MTPA 2KKQA 1RZKL 3L3DB 2R29H 3KPTA 3QIBB 2KL6A 4U1LA 1HHHB 5DJ6B 3RVWD 2BSSA 4MB4A 3H7BB 1N26A 4P9MH 3F58H 3MTRA 4U4BA 1JIBA 1DBKH 4JHZA 4Q0XH 3VI3E 1CZ8H 5DURD 4WW2C 2DB8A 2FLBT 1PX4A 3QIWA 1QBAA 4I3GA 2R2BB 3VXPA 4NQTA 2VDNH 4LCWD 2JCCF 3DSNA 2P5EE 2VAAB 5INCA 1YDPB 3NIFF 1AO7E 1MFBH 1JCKA 4GAGL 4KTDH 1ZT7B 1FO0A 4P23A 3VXTB 3MV8E 4R7NA 4KI5E 2C3VB 5LBSH 2IMNA 3SKUD 3RX5A 4E5XA 3W9EB 2YK1H 1DBJH 2QEJA 2X2YA 5I8OH 5DMIL 2AK4D 3CMGA 4G8GA 2NXYD 2GJ6E 2HTKD 4LSVL 1DBAH 1E6OH 2VLME 5E56A 1CXFA 3Q3GA 4E9LA 3MRDB 4OIIL 5H2BA 3VXUE 3PP3K 5I8CB 1G7IA 1S7SB 3PL6A 3VG9B 1PDKA 5D7JA 3FL7A 2E7HA 3KPNB 1EEZA 1L0XA 4PLKC 1VACA 3TF7C 2QHRH 5CILH 5EUOA 1NBYA 2X7LB 1MJ8L 4AG4L 1L7IH 1FNGB 3P0VH 3RWHB 3HC0A 4PJAA 4JO2H 2X1WL 1A9EB 5B38B 5L8LB 4FQJH 1EBPA 3TBSA 4HS6B 4M8QB 4LCUB 1OT1A 5DMGD 5DEGA 1G7LB 1KCSL 3LOWA 4PJDA 4NQDE 4OF5A 3NN8B 1KB5H 4PG9B 5F44A 4NHCL 4JDZA 4LHUG 1K4CB 4GUPB 4F15C 1QPXA 4Q6IB 4TSAH 3SDCA 2KQMA 1BZ7B 1VFUA 3QWRD 3KWWB 2BMKB 5EIIA 1N7MH 5JR1H 4MJ4A 3HC3H 1KCRH 3HTLX 3L5WA 2EYRB 2AXFB 3QNYA 4HV8A 5D1ZB 3SHSA 2JB6B 4PJBA 3PGFH 4PJGE 2A74B 5C0AD 3WJLC 1QVOA 1YQ2A 3IFNH 5HYSA 4PJCE 1J05A 4IOIA 4QNPF 4M61B 1QRNB 4PJ5E 3B9AA 1JRHL 4WNQB 2FATH 4U3XA 3MBXH 3P4MA 1AH1A 3FOMA 1SJHB 1RUAH 1ZLSH 4PG2C 2JJVA 5GS2H 1FBIL 3DSFH 4K71C 3STBA 1V7MH 5I1HH 3LEVL 4LKXA 3KPOB 4PGEA 4LCCC 3ULVL 1F42A 4I0PD 3QUMH 1A6UH 1IT9L 2BC4A 2Z8SA 4OM1H 3B9KB 3S36X 1DVFD 1DDHA 3BQUC 4MNGE 3GMPB 4G8IA 2F53D 1OTTC 2VABA 4QXUH 5EZJA 2O61B 3WFEH 4RX4D 2BSED 3IDNB 3RZWA 5CLWA 2L7JA 1KIPA 2CDFB 5L2JB 1A6ZB 3TN0A 3QUYD 4UBDC 4YHML 5A2KH 4FXGB 2XPGA 3GBMH 3KHOA 3T0EA 1KN4L 1CD9B 3GBLA 3SBWC 3OAYK 2GW5A 4GXUM 4CN4A 1SY6A 5DD0H 4WW1B 5F7HA 5KVGL 3F7RA 4UNTA 5IV2B 3C87A 3DROA 1BGXL 3LQAC 1UM6H 3IVKA 1X5KA 1ZHBB 1UA6L 4EQ3A 4NFCA 3QCTH 2XNAB 4P2YA 3VMNA 4XC1L 2GEEA 2XTJB 3O3EA 2YOCA 4KKCC 1I85A 4X4MA 2EZ0C 4OCXL 3VFSB 1JBJA 4ONHB 2VR5A 5IFAL 1C5DA 2AJ3A 3AROA 1MCPH 4M7KL 5D9SA 3VCLB 2JELH 1HWHB 2EDTA 3RTQB 4LMQI 1E27A 1CS6A 3T2OA 3P9LA 2FCBA 3K1DA 5GS3A 2HRPH 3N0PB 1SJEB 4Y5XB 4ZPTA 3FQRA 3FT2A 4X9BA 5CJXC 4PY7A 5D1XC 5JPMB 1OB1A 2IADB 4Z78A 4ZMAT 3FO1A 4YK4B 4U33A 2R9HC 4TUJB 5KN5A 4WTWA 3K74B 4H8WC 4HEME 4EJ1C 5C0DB 4KI5C 1L0QA 1UZ8A 1FGNL 4OZGB 1MHHA 1SJVA 5ESVA 3O9WB 4QRPD 4Z8FL 2HTLD 3RWDA 3X14A 3EYUH 1X5JA 5IJVB 2FH6A 3EYOB 1M05B 3O41B 2C1PA 1YEHH 1GAFH 3ISWA 1GHFL 4MNQA 4MYWB 1BBJB 5IW6A 1VEMA 5T3ZL 3MXVH 2F74A 3QQ4A 2EXWC 5KSUB 2A38A 4MHHG 1LVEA 3PWPE 1D5MB 5E2TH 4DKFH 3D39E 3V95A 1DSFH 4OKDA 2EYTB 4P2OC 4MVBD 1JPGA 4N90D 1MI5A 3DV4B 5JHDD 4X6DA 1XZ0B 3LD8B 3D3VE 4FQ1L 4JQVA 1KPUB 1CDGA 4I4WB 4PBXA 1NAMA 3N1MC 1H3WM 3EYSL 4LKCB 5ENWA 2YPLD 3ARDB 3WFHA 1QFHA 4LCIH 1U93A 3FQWA 4NJ9L 4TQEL 2X4TA 2ADIB 2EDQA 4UIKH 4WI3A 5CGYC 1YEGH 5JLZB 1KGCE 1MCRA 1I9JH 2OCFD 5F89B 5DJ0A 4JKPL 4OKVB 5C0GA 4GRLB 3T04D 4XMPH 3RDTB 5AUMB 3ZSSA 1CN4A 3V5DA 3RNQA 5AAMA 2VOTA 4KJPC 4IBLT 1Q9KB 3W5NA 3HNTL 4C56A 4MA8H 4L4TE 3PQYA 5FIEA 2Z8VC 4U1GB 2ZKHH 3ZE1F 4HAGA 5JXEA 1NC4A 3U4EB 4V2BA 4YBQC 2A73A 4HIIA 4DGYH 1H3PL 2BSTB 3QI9A 4C83B 3MRIA 1F2XK 3C60C 5C7XL 5KAQG 3GI9L 4HJJH 2AXGB 3VXMB 1K5NB 1UT9A 5F21B 5FGBC 5D1QB 1S9YA 3RWGB 1NGWB 2VWEE 5JHLH 3MV7D 5JNYA 4OCRL 2VJXA 4TTDC 3VWJA 4XNYH 1J0JA 1KYOK 3EYFA 5BJTA 2WANA 2IPUG 2H9GB 1XR9B 3KPSE 2VQ1B 3SE8H 4WTZG 1CT8B 4S0TD 4IM8A 1NGQL 3L3GB 3EDDA 1P6AB 2HJLA 3I6GB 3RBGA 4M1GL 4IRSA 4CMMA 1J0HA 1QFOA 5IIEB 5DK2A 4MSWB 5JUEH 3OX8A 2WUCL 1FNSL 5DZNA 4QCIB 2YR3A 3VW3H 35C8L 5GGVH 3TBVB 4Q2ZB 5DHXB 2CO6B 4OGYL 3HAEH 2X4SB 4N5UA 5DJXA 1IM9A 3HE6D 4ACPA 5EUOF 3DO7A 4MWFA 1OGTA 4MD0B 5TDNB 4N9GA 4PJAF 3VFUA 3SKMB 1S7TA 1V7NL 3CFJA 2D03L 2X09A 4TSBH 1GRWA 1G6RA 1ZT1A 4HWNA 4X7TA 2V7HB 1LP9A 4WEMB 3SKJL 5FM5O 2X4RA 4NRZB 4UILH 4PJDF 4GBXD 5A43C 2VLLB 1G1YA 1Q9OB 3NTCH 5D7IE 4FQQB 5CSGA 5I9QC 1F6FB 3M8OH 4JPIA 3IU4H 3D18B 3L3IA 4JPWH 1KLUA 1XCTA 1JK8B 3X3FH 3DMMD 2PXYC 4WUUE 2JJSC 5K9KB 1KN2H 3ROLA 4HIEB 1XGPB 2DQJH 4ELME 3MUJA 5L2KA 3EO0B 4K9EL 1AKJD 1YY9D 3IYLW 1FJ1A 4QT5B 1EEUA 4M4RA 4PJBF 2BK8A 1CLCA 5SX5H 3U4BL 3UJTL 2RJMA 3JWNC 2BFVL 3QDGE 4M62L 2ARJB 2HN7A 1TTUA 4HLJA 3SJVD 1IC7L 5T1LD 3RPKA 3IJYA 1DE4A 3QWOA 5MHSD 4JFYB 2AABH 5CSBA 3QPQD 1HIMH 1NFDB 4HPOL 5C09E 3UO1H 4FFWD 4IMLB 4ZFFB 5DUML 2YEZA 2X89A 3QFJA 2X70B 1FZMB 4MS8C 1F58L 3HI1A 3T65A 1OGAB 5T1DL 3ULUF 4JFEE 4XCYB 2DQUH 3ILQD 4ZS6D 1X4ZA 3FMGL 4O4YL 2NYYC 2Y7QA 3WDIA 1QNZL 1ZAGA 3QFDA 4JFXA 1DQDH 4ODUA 1CF8L 3UDWA 3VFWA 3QWQB 3TIDB 4NQEA 5BW7C 5I75B 2I60H 3V2AR 3EKCA 1U8JB 3AC0A 5CKGA 4M1DL 1MVUA 3I75B 1U6AH 2J5LC 4XCEB 1EZVX 3V5KA 2XXMB 4HFUL 1ADQA 4I2XA 3BUTA 3BAEL 1NH6A 5JPNB 4RGOL 2DICA 5DD6A 5DUPH 5J8OA 4AQOA 1NGPL 2Q7NA 4OCWH 5IFHH 4FABH 3BD3A 4TVPE 3SE4C 3QG7H 3S3SA 2APTA 1I1AA 5E6YA 5C0ND 3O4LA 5F88A 1WZ1H 1CK0H 1TJGH 4NBXB 3IU3B 3U36A 4TN9A 3EFDL 3FO2B 3P4NB 1I1YB 5IMLB 1IAIM 4WV1C 3D9AH 3W39A 3OKEB 2CRMA 2BOCB 4E41B 4EI5D 4HCRL 5ELIA 4F37F 1AIFB 4JDTH 4BFGA 5IOPB 2CDGB 1I3RA 4PRID 2XG5A 2ZCLH 3U9UA 4R6UA 2G5BB 3ARFC 3ZYZA 5GXBB 4LNRA 2H26A 4QY8A 2W0KA 3BZFB 2OQJA 4YWGL 4KK8D 5GZOC 3BN3B 4Q9RL 2VLJB 2Z91A 5EIQA 1ZEAL 5FGSA 1UG9A 2W65A 2XA3A 3K7UA 4UT7H 2VWEC 3TO2B 3MBEA 2BHYA 4OD1L 1YEDB 3RVUD 7CGTA 4LFHD 3O2WL 3RA7H 4P3WA 2HFFB 3B9KD 5CJQH 4WFGD 2VB5A 32C2A 1U3HB 5D8JH 2R29L 3FQTB 1KLGB 4HMCA 3GRWH 4F15B 1Z9MA 4X6FB 2ICWA 3WYRA 4NDMA 2ZNXA 4X4XB 5DEZA 4P9ML 2DQIH 3CC5A 3HZVB 2ZUTA 1DBKL 1IAKB 4FQCH 4Q0XL 8FABB 1CZ8L 3T0EE 3ZSTA 3RUGA 5D70H 2GFBA 5E00A 4LNVA 5C0RH 5C08A 2W0PA 3L5XH 3QDJA 2VDNL 2QSTA 4PJ7A 4X6DF 3BIKB 2B39A 3AU1B 3CPLB 4L8BA 2CKBH 2EDJA 4XC3H 4YHKH 4G6MH 1MFBL 5FV1L 3EUUA 4FQXD 4RGNE 4ZUTB 1YMHB 5I76B 4KTDL 1P53A 1NLDH 2YSSB 3LKPA 4PGCA 3KPPB 4OLWH 5DI8B 5E5RB 5F3HB 5DT1H 1IE5A 2N1KA 1N6VA 4N0YH 5TE7L 1B0GB 2XTJD 2BDNH 3FQXB 1OARL 3S35X 5M94B 2PYEA 2YK1L 1DBJL 5I8OL 1X9QA 5E9DA 2G75B 4KTEH 4CADA 1FL6B 3WLBB 3MRJA 4IRJA 5IR1A 2AJVH 1JGLH 1DBAL 1S7RA 3W11C 4JY5H 1FV1B 1E6OL 4KV5E 1IGTA 3S36H 5ADOH 3MXWL 2CIKA 3QIWC 4HGWB 4FXKB 4U1MA 4B7IA 1WWWX 2VISB 4BFIB 2IPTH 5ID0A 3PWJA 2VTFA 4CNIA 5DRNB 1F3RB 2OP4H 1L6ZA 5KG9A 3MUGA 3IGAA 1QLRA 1IM3B 2DTML 2QHRL 3WIFB 4EN3A 1R3KB 5CZVH 5J7CC 2ORBL 4H25A 1EHLH 1L7IL 2DQHH 3P0VL 1EXUB 4JO2L 5H37H 2I9TA 1RQ5A 1QSEA 4FQJL 1J5OL 1FH5H 3BH8A 3FT4A 1YPZF 3C09C 1Q9LA 2ADGA 4MXVF 5DRZA 1X5ZA 3TH4T 1KB5L 1H0DB 3GSXA 4OZFG 2X4NB 2BX5A 1NFIB 4TSAL 4XT1C 1T21A 1MCLA 1R5IA 1VFBA 3WDHA 3OKLA 5HI4C 5BV7B 1WFUA 5HI3C 1JGUH 1A4JA 2LVCA 3HC3L 1KCRL 2ZSWA 4LP4A 3MODH 4R4BA 4RAHA 5CP7A 4HIJA 5D7LA 5J11C 4OD3H 1ODAA 2DI7A 1JWUA 1V3KA 3WXWH 3UTTA 3WS6C 3QO1A 5IF0A 3WFCH 3PGFL 1JZ5A 4PJ9D 4YDJB 5HGBB 4H0IA 3IFNL 4G8FA 5L8JB 1IAII 4L3CB 1XIWB 1FCCA 2ZOLA 3MRRB 1F02I 5D7SH 2FATL 5D1XB 2YS4A 3DARA 3ARDD 3TJHC 3I3BA 4O00A 5DDHA 3MREB 3S5LG 5ACZA 4HZAA 1RUAL 4JFDE 4RFNC 1ZLSL 1LP9F 5DSCA 1KNOB 2I9LB 4BZ2L 2X4QA 3UZEA 2F54A 3DSFL 1TJIH 3IF1B 1V7ML 3IETA 3MV8B 3IDMA 3QUKB 3ARYA 3ZT5A 5I1HL 5J13C 3SDCC 3EOAB 3RDTD 2AQ3A 3QUML 3WKMH 1A6UL 4MJ6A 4OM1L 4C56E 1HHIB 4UQ3B 4QTHB 1QLEH 1U8NA 4NFBA 1AD9B 4QXUL 3WFEL 3RPIA 3RZCD 1KCKA 3BP4A 5JOFB 5I1IH 1JZ4A 5FCUH 4XVSH 2H32B 4E0RA 4PJEA 3BSZL 3QUZB 3LZFL 2H3NB 2P7TA 1MEXH 2V9RA 2XZAH 2OX5A 4Q9BA 5B39A 5EO0A 3LB6C 4EUPG 1BMGA 3FRPG 4EOWH 2A6KB 4XNQA 1GIGL 4K23L 5DD0L 3FOLA 4MQXD 4LPWA 1CXEA 2GT9A 3HC4H 4NUGH 4LHUD 2HKFH 3U79A 1QYGH 4KK9C 1UM6L 4OBRA 2YUZA 5GGRB 1IAIH 2EDYA 3PWVB 1JV5B 3V6FA 1F11A 2G60H 4MAUL 3KJ4C 3RWFA 4YJZL 2B2XH 1LK2B 4KJWC 4OJFL 2X44D 5HJ3B 4G7YL 1J12A 1MCPL 1T6WA 5FOBA 2JELL 3EGSB 5J6HA 4QXGH 1NBVH 3T0EC 4KWUA 3FFCB 5FK9B 4H88H 1G7JB 2JCCB 5LGKA 1XGTA 2X9WA 2VZTA 5C6WH 3UCRA 4I5BB 1K3ZA 3LPGA 4PGZA 1GGUA 4QGYA 5EFIB 1JN6A 4M7LL 1A9BA 4G6JH 2NY1D 4HBQA 4RGNC 5MENA 1QFWM 1MHEA 3U2SB 3MYJB 4PB0H 5ICXA 1R24A 1M71A 3GMRA 2XZZA 3OKKA 5J12B 3PP3H 1NLBH 3JV4A 3GSNA 1RJYA 2I07B 5L2KE 1KIRB 4MNGB 3WFZA 1CWVA 4MJIA 4DEPC 1T0MA 1X7QB 4NN7C 4L8DB 4Y4KA 3MXVL 3RKDC 5KSVB 1EHXA 4P57B 1OSZB 5DS8A 3KS0H 3CJJA 5K59E 4DKFL 1SM3H 3HA0A 1F2QA 4XWOD 3UTSD 1AFVH 1XGQA 5C1MB 1W0WA 4PV9B 4U6VH 4ZSOB 1NMBH 3QFJE 1JGVL 2G9HB 3EHBD 4HJGB 1A3RL 2VZSA 2P49B 3ELAT 1OGAD 4JEGB 4KY1H 4PRAB 4LCIL 4X6EA 4LLVB 3V6ZB 1RD6A 4OD2A 4UIKL 1YEGL 2HWZH 4W4OC 4OAWB 1R3JA 4YIQB 5H8DA 5I1GL 2K9UA 3NIGE 4NQEE 2DJUA 1I9JL 4XMPL 3ZKSD 4LSTH 4GLRI 1BIHA 1J1OH 1NBZB 5HHOA 3VD4A 3L7FB 5IB2B 4Z7WE 2WP3O 1MCKA 5ERWA 3D0LA 1UJTA 1KTDB 2PXYB 4MA8L 4NGHH 1CU4H 4NKOB 5FYKD 4JREB 2ZKHL 4MHHI 3CXHK 4I2XE 3ZT6A 3RUGF 2IBZY 3AREA 1CYGA 4HK0A 5EBMB 2Z4QA 4MLSA 4PJ7F 2BHUA 3JVGA 3NPSB 2YUVA 4LSPH 1VFOA 2XZQH 3VXRA 1TZIB 2WINA 4HH9A 3EIFA 4CW1B 2LTQC 4HJJL 1DQQB 4LCYA 2X10A 3CZJA 2AV7A 5JHLL 4MQSB 4OCLC 2MCPH 3GFUA 3D2UA 4JO3H 5ID1A 4JY6B 4XNYL 3HUJE 4NKMB 1MVFA 4OQTH 4X5WB 4AIOA 5BVJA 3MRLB 3LY6A 1BBDH 5JMRA 1IARB 3D5OF 3SE8L 4U1KB 1NPUA 1ES0B 1CTOA 2PW1A 4Z0BL 3LV3A 2D3VA 4RGMB 2FGWH 3JV5A 2NW2A 3GSQA 5E5UB 3O8XC 4QRUA 2D0GA 1BFOA 2F9BT 3OAYH 5JUEL 1CE1H 5JTWA 3QDME 3NACH 3QI9C 3DURB 3VW3L 6FABH 1CD1A 5IB3B 5E5MA 3DJ9A 1FORH 4JR9H 4PLKD 2VLJD 5EUKA 5B3JE 1OM3H 4UQ2B 4GLRH 3CH8A 4K3GA 5GGSA 5HYSG 3WUWA 4AQ1B 5LJYH 4Z7UF 3S5LB 1EEYA 1A7PH 3QQ3A 3HZMA 4NQCD 5CEZE 4FQ2H 3D3VB 3VWJC 5I16B 1A2YA 4PYGA 1KXVC 3WNPA 2XWJB 4TSBL 1NEUA 1J1PH 3OTTA 4I18A 1T0NB 3O6MH 2XY1A 4DKAA 3DVIA 1AXSB 4XTRC 3F65A 1U9KA 4JFQA 4IRSC 1ZHNB 3I2CH 3M8OL 4O51A 5MI0B 1W0YT 1XF2B 2NW3A 1W2KT 3IU4L 4GXVL 4JPWL 3TNMB 1FG2B 3B8SA 3X3FL 3INUH 4QRRB 1OQXA 5KSBA 2B1HH 1Z5LB 3RUGE 1KN2L 4HZLB 2QQQA 2DQJL 1MJUL 3QDJE 4URTB 2RGSA 1QFWI 4HUKB 3G5XB 1QLFA 3DXAD 3ECBA 5IBUG 4J3SA 1I4FA 4XMKH 1B0RA 1ZTXL 5C0FA 3KYMB 4KRPB 4M3KB 1AGCA 4QTIH 3NZHH 4D2NA 2AABL 2PW2B 4N1HB 5SWZE 4RNRB 5IW3A 3WL9A 3T4AA 1FL5B 4QXWA 1HIML 3SDAC 2GY7B 3MRKA 3UO1L 5BZDB 5KW9H 1EAJA 1T5WB 5E9DE 2IPKA 5IHLB 2FZ3A 3CFKB 1EHNA 4OI7A 1VADB 1OAXH 4GRMB 5AYQA 4U1NA 1IGIL 5MEPB 3WN5A 5FO8B 2V17L 2J8HA 2DQUL 3CH1A 4DCQA 4JM2A 1OAUH 3KPSB 3BQUD 5EOTB 4ODVH 3EDJA 1DQDL 1OTTD 4OFIA 3U0TB 5FHAH 4G43B 3BP5B 2YPKA 4FMKA 1BOGA 4M7JH 2AXHA 3FHAA 2ICES 4YPGB 5HDBF 4PJEF 2J8OA 3EO9H 1CQYA 3EDFA 5BS0A 3LKOA 5I74C 4D8PB 4UBDD 3OPZL 1U6AL 3WHXB 2AJYL 3EYVB 3BPNC 2IH1A 1BF8A 5M7QA 3GIVB 5F7KC 1QSEE 4HHAB 4OCWL 4F57H 5IFHL 4FABL 3QG7L 3TO4A 1U3YA 2CLZB 2DJ4A 3CAFA 4RFEA 3ZDXE 1QFWH 1J7VR 4XBPA 1ZMYA 4P2QA 3KS0J 5F9WC 4ELKA 1CK0L 4JRYA 1CG9A 2EIZA 1MIML 5ESQA 3UDWC 4U1LB 4KKCD 4RAUA 4LASH 4DGIH 2EZ0D 1CLZH 2BSSB 3GMNA 3TH3T 1I8IA 4HEPG 3H6JA 3L1OH 4M4PA 1FYHB 4NM4H 3UX9B 5GS1C 2WWMC 2EIDA 4PTUA 4B7LA 4AENA 4JDTL 4K07A 3UPCA 3QIWB 1KFAH 2ZCLL 3O3AA 3PV7A 3VXPB 3H9SE 3MLZH 5INCB 5SWQA 2M26A 5F7EL 4RFOH 3U48A 5D1XD 4DWHA 3GK8H 3ARZA 1AO7D 4UT7L 1FO0B 4P23B 2R9HD 4R7NB 3WE6A 4LLYA 2YHGA 3MV8D 4KI5D 1U41A 4E5XB 4X9HA 4KUCF 3RA7L 3CVIL 5LXGH 3AY4A 4B41A 5IVOA 4G8GB 5CJQL 3R8BB 3F12A 3SKOA 5D8JL 3UBXG 5DVMA 5MP6H 4Q9QH 4KVNH 3GRWL 2FWOA 3Q3GB 2VLMD 4Y4HC 1Z0NA 4EQ2A 5H2BB 1G7IB 3PL6B 2EXWD 5DMKA 2ERJC 3VXUD 2XXCB 1MFEH 4FQCL 5D7JB 5AAWA 5BOPA 1KOAA 4OCSH 1EEZB 1LGVA 4H8WH 2R8SH 4XVJL 1VACB 5D70L 1F4YH 1VEPA 4P2OD 2P42B 5EUOB 1NBYB 3L5XL 4PRHA 4N0CC 5I17A 3HC0B 2CKBL 4PJAB 5T1KA 5CEXA 5DXWA 4YHKL 4I1NB 3TBSB 1NLDL 4HWZA 5IKCA 4GJTB 2D9QB 1KTKE 1S7WA 2X41A 5DEGB 4OLWL 5DT1L 4PJDB 5CGYD 3SQBA 1R5VA 4JDZB 4N0YL 4NQDD 5J13B 2BDNL 5I8EA 4JHWH 4P46C 3O6FA 5TDPA 3SDCB 3P30L 3OMZA 4KTEL 5EIIB 2AJVL 1ZOXA 4KJPD 3MJ8A 1JGLL 2XV6B 3L5WB 4NCDA 4JY5L 1MRCH 5ADOL 2D7NA 2W07A 3SEPA 5DVKA 4CVZA 3QNYB 1A5FH 4HV8B 5LCVH 1KT2A 4PJBB 4YBQD 3TBYA 1UKSA 1MCQA 1QVOB 5HYSB 1J05B 4IOIB 3C60D 3GEWB 2OP4L 4YNYA 1JYWA 4AK1A 3P4MB 5DD1H 2OLDA 4MXQC 4PJ5D 3OHXA 1WTLA 3FOMB 4HUMB 4IOFC 5F1NA 3ZDZF 5CZVL 1EHLL 2Y9RT 2DQHL 2YXFA 3T1FA 1A1NA 4TTDD 1CGVA 4LKXB 5FHBH 5TPWL 1FH5L 4PGEB 1H3XA 2BC4B 4GW1A 1DDHB 3MNZA 5F72S 1G1CA 4G8IB 1FLTX 2VABB 4RDQF 3DWTA 3SGKC 1V05A 3PP4H 3KJ4B 5EZJB 4ONFL 1E4KA 2NY2B 3GJFA 1KIPB 3NFSL 1JGUL 2JJTA 2YD4A 2DS4A 1U8QA 1X5AA 2WZPD 3ULVE 1DUYA 5IBUB 3VWKA 3TN0B 1VEOA 1F8TH 2XPGB 3T0EB 3L6FA 3C8DA 4POUB 1YC7A 3WFCL 3UTOA 3K46A 1F6AA 4J3WA 4P3CH 1R3HA 3SDXE 2JIXA 1H15A 3MLWH 3QIUA 5D7SL 1LDPH 4OGAC 3IVKB 1R5WA 4WIQA 3TLRA 1I1CA 4KDWA 3RIAK 2YRPA 1XF5A 5HHOE 2HJKA 2W0LA 3O3EB 3PF2A 3Q5YA 4JPVH 4MA3A 3ZT7A 3ZDYF 3WKML 1T83A 3BGAA 5CD5C 1G7MA 1E4WH 1C5DB 2AJ3B 1QLEL 3KPQA 1TQBC 5KSBF 2XTLA 5D9SB 4QHKI 5SX4I 2R0KH 5EZOL 2J88H 5I1IL 1E27B 5FCUL 1U2CA 3P9LB 1MEXL 4ZPTB 3FQRB 3RVVC 2XZAL 3FT2B 4PY7B 1EX0A 1OB1B 4GMSL 4OLYH 4Z78B 4PJ8C 3FO1B 4LCWA 4KDVA 2GITA 4EOWL 5EH1A 1IGJA 5KN5B 3IS0X 1UZ8B 1QFUH 4NUGL 4MS8D 2HKFL 1MSPA 1MHHB 1QYGL 5ESVB 3R1GH 3EYQC 5GRUH 3RWDB 3X14B 4M93B 4Z6AT 2ID5A 5KS9A 4JM2F 2NYYD 1UWXK 1CFQA 1IAIL 2C1PB 2ZCKH 1L7TH 4FTVE 4HGKC 3BRFA 4MNQB 2RIKA 2B2XL 4UUJA 4D9RE 3EAKA 5IW6B 2AK4A 2F74B 3QQ4B 2RQ8A 3IDJA 4OI9A 5IBLC 4F58H 5L7XH 4RMVA 3TCXA 1JE6A 3PWPD 3EOYG 4QXGL 1NBVL 3MX0A 3D39D 3E0GA 4H88L 1JPGB 2J4WH 1MI5B 1KB5A 25C8H 4X6DB 5F3BA 3MO1A 4PS4H 4JCMA 2VDLH 2ZUVA 3C5ZC 1H5BA 3OL2A 3D3VD 3IFLL 5LG1A 5SX4H 3SE3C 1NAMB 5T3ZE 4I9WE 4ORGA 5ENWB 3WFHB 2EE2A 4G6JL 1ED3A 1U93B 3FQWB 3DGCR 3TA3A 3T2QA 3U46A 2X4TB 1VGEH 3WV0A 5DJ0B 1FFPA 5C0GB 1KGCD 4ODTH 5DFVC 4EVNB 4CL7A 4CVXA 3V5DB 3RNQB 1IGCH 4C56B 3PQYB 4L4TD 4U3HA 2VDOH 2VRAA 1EVTC 3QWRA 1NC4B 3IDGA 5D2LA 3VD5A 4CJ1A 1UC6A 2FX8H 2A73B 3ARFD 4HIIB 3QI9B 3MRIB 2GIYA 4MCZA 1NMCB 4CKVX 3CFBA 5KTEH 1HINH 1RIUH 2FB4H 3QUMA 1UB5A 5GZOD 2FL5A 4M7ZC 3FB8A 4D9LH 4FZ8H 1UJ3C 1MFDH 1S9YB 1AFVL 5C0AA 1ZGLM 3FTGA 4MXWH 1V3JA 3QAZB 4M6AA 4U6VL 5JNYB 1AD0A 4JVWA 3SGDI 3VWJB 2ITCA 2F5BL 3EYFB 5BJTB 1JI1A 4KY1L 4QOKE 1GVIA 3SO3C 1CXLA 4U0QB 1R3IH 2HWZL 3V0AC 1DL7L 3KPSD 1BEYH 2E8YA 2F19H 4JO4H 1UYWH 3PE9A 2ZPKL 2HJLB 1T4KA 4IRSB 5C86A 4CMMB 4I0PA 1J1OL 4OFVA 4Y4KC 5DK2B 1DVFA 3OX8B 4HUXA 4H26A 3BISA 3RVXC 4XXCA 1I8LA 4JZJA 4NGHL 1CU4L 3MRMA 4RWYH 2F53A 1K2DA 1WEJL 3X17A 3V8CA 3ULVC 4ZXBC 5FO7A 5DJXB 5IQ9A 1IM9B 3IAQA 3QEQE 2VXSL 3DO7B 4MWFB 4S1RL 1OGTB 4LSPL 2XZQL 3G04B 4N0RA 4DZ8A 1FCGA 1NGYA 3QUYA 4N9GB 3VFUB 1S7TB 1IEHA 3CFJB 4P2QE 3MUZ1 2MOVA 4U49A 1G6RB 1ZT1B 2BXZA 4X7TB 5JW3H 4JRYE 1HEZA 1LP9B 2MCPL 2X4RB 3O6LL 2MNUA 3IDYB 4MDIA 5F7YC 4XP9H 5T3XH 1IILE 4OQTL 4M7LT 4YHYC 3HMWH 4JPIB 3L3IB 3A6OA 1KLUB 1BBDL 1XCTB 5A2LH 3EOTL 1PLGH 5EPMA 3W11D 3PGCA 1VFAA 3SGDH 1R3LA 2FGWL 3ROLB 2L7UA 4WUUD 4R0LC 3NABH 5L2KB 3QIWD 3AREC 1FJ1B 5DHVH 5IT2H 1CE1L 2ADFH 3QQNA 1XGYH 3NACL 3CDYA 4ODBD 6FABL 2UV3A 4NN5C 5HYJE 4TPRH 2HN7B 3QDGD 1FORL 2WMPA 4JR9L 1PKQA 1XT5A 2NNAA 1DE4B 3IJYB 3QWOB 1OM3L 1FIGH 4JRXE 3BPNB 2VDQH 1QZ1A 4J12A 1A7PL 5CIPH 4OCNC 3QISA 1WUNT 4FQ2L 1FHGA 2NY4C 2C26A 2YEZB 3QFJB 5J1SC 3STLA 4K3EH 3HI1B 3T65B 1J1PL 5CEYA 3C2AH 4UAOB 3S98A 2X4OA 3HNVH 1QBLH 4AIZA 3SCMC 2Y7QB 4JFED 2XG4A 4TULH 3OV6A 2P4AB 1FC1A 3QFDB 4JFXB 4ODUB 4Z7OF 3VFWB 3NBNA 3I2CL 1G7QA 4NQEB 1KACB 3L3JA 1U8PA 4QRPA 5HI4D 4LDOB 2WM0A 3LVEA 4MJ2A 2W1NA 3INUL 4ZNEE 1JYVA 1MVUB 2B1HL 1BQHA 3F7VA 3RVTC 1FYTA 1NC2D 3V5KB 1HKLH 4I2XB 5BMFH 5DD6B 4XMKL 1MWAH 5CZKA 5B39G 4BQ8A 1KJ2H 5CZXC 4YX2L 3TJHD 3NZHL 4P2CG 4TVPD 5CWSA 5I1JL 1I1AB 4OM0H 1TITA 5JHDA 3O4LB 4TSCH 5F88B 4I18C 1JTTA 3U36B 3H3PH 3MA9H 5JOEA 3SDCD 2YPLA 5F7WC 4YH6A 3W39B 2ZP0T 3V52H 3ZO0A 1OAUL 4QHKJ 4ODVL 4XHJC 2YMXH 5FHAL 1I3RB 4DUWA 1A64A 1IQWH 2M1KA 3U9UB 2BVTA 3IXTA 4M7JL 4OFKA 1OW0A 3NCYP 3RWEA 3EO9L 4LNRB 2H26B 1FSKC 3BPOC 4QY8B 5LGHH 5T5NF 2NY5L 2OQJB 3GUTA 4GG6E 1VCAA 3VMOA 4OUOA 2Z91B 1ETZA 1OTSC 2W65B 3LB6D 4KROC 4LVOC 3G5YA 3MBEB 4DVBA 2IBZX 4JG0H 3ARWA 4F57L 5H94A 4DQOH 2I27N 2YKLH 3VD3A 1SBBA 2DIJA 4KK9D 3WS3A 1T89C 2PR4L 1RK0A 3QJFA 3MLUH 2VXVH 4Y0GA 5JOPE 3AS3A 2L0DA 32C2B 4JM2C 3U4AA 5KS9F 3MV7A 3HAEA 4LL9A 4CGTA 1BX2A 2DQFA 3VRIA 4PRBA 4YO0A 2ICWB 4LASL 1OF2A 4KJWD 2VC2H 4NDMB 4P5KA 4DGIL 1CLZL 3CC5B 3I9GH 3L1OL 4NM4L 1MCBA 1QHOA 5BOZG 3O2DH 3PDGA 4PJHE 3E2HC 4XMLH 1HQRA 1X4YA 3GB7A 2GFBB 4KK6C 3RUGB 3T0ED 1KFAL 4RBPK 5E00B 3VDAA 4NKQB 4EXPX 5FYJU 5C08B 1LO2L 3QDJB 4PJ7B 3U30B 3CLEH 3BRGC 4L8BB 3MLZL 3BEVA 1KENH 1IQDA 2W59A 3TO4C 1A0QH 3GK8L 1A6PA 4ZOCA 3VG0L 3HE6A 2M2DA 2H45A 3LKPB 4RGND 4PGCB 2X4PA 2YRZA 1PEWA 1DN2A 4RRPA 1HNFA 3STZA 2PYEB 3WIHA 5E9DB 3AS0A 4CADB 5IVZA 4RMUA 5IR1B 2R23A 3MRJB 4IRJB 5DJ2A 4HUWA 1CDBA 4GBXA 4NNPH 1S7RB 5D72H 4XPBL 3VFRA 5HYFA 1IGTB 5MP6L 4Q9QL 3R0MA 4KVNL 5GRVL 5ILTH 4WHYG 2CIKB 4U1MB 4XVTH 4LVEA 3S3PA 3DMMA 3RKDD 5ID0B 5TGBA 1MFEL 3PWJB 1AXIB 4CNIB 2FDBP 4OCSL 3RX7A 5KG9B 3MUGB 3IGAB 2R8SL 1F4YL 1QLRB 1AKJA 1J8HE 4M5YH 5J6GA 4EN3B 3G5ZA 3D6GA 4JQXA 4H25B 2QQKH 2FECI 3LKSA 1F45A 3AM8C 3SJVA 3ZL4H 2I9TB 4K9EC 5T1LA 1QSEB 5JW4R 3BH8B 3FT4B 1II4E 1Q9LB 2ADGB 5DGRA 4Y8DC 3T0WA 5DRZB 3K8LA 4FQLH 4Y8AA 1SMOA 3RHWK 3GSXB 5I1CH 2FBOJ 4N1CA 2AERT 1CGTA 2PUQT 1T21B 4MNQD 3UBXI 1R5IB 1VFBB 3OKLB 3HFMH 3O4OC 3C6SA 1X3DA 1RZJL 3SOBH 1A4JB 2ZSWB 4R4BB 5CP7B 4HIJB 5D7LB 1MRCL 3UTZA 4TNWF 1JWUB 3UTTB 1A5FL 5LCVL 3QO1B 1T7XA 5IF0B 2V2TA 2MCG1 1N4XH 4NNXA 1Q0XL 4R3SA 4PJIA 4G8FB 1Y18A 2ZOLB 5DD1L 3WUWG 4U1JA 5DDHB 5ACZB 2UZIL 2X9YA 5DSCB 4P4KC 2X4QB 4JFDD 4HKXA 2F54B 3LRGA 3IETB 3IDMB 5FHBL 2ESVA 3O6FC 1ERNA 1A1OA 1LEGA 4GRWE 4KKBC 4MJ6B 3ARPA 5ACLA 1U58A 1RHHA 4C56D 1KIUA 1U8NB 3O0RH 5D2LE 2IQAA 3PP4L 3O8XD 4G6FB 3RPIB 3NCEB 3BP4B 1OAYH 4Z7VE 5E8OA 1LEIA 3QI9D 4E0RB 4PJEB 4EI5A 2E7MA 4G7VH 4PUBH 4YDLC 3EO1A 4C4KT 4EEEA 2P7TB 5BCAA 2NY7H 4HT1H 3JV6A 1DN0A 4PRIA 4XHQA 5B39B 5EO0B 4JZOA 1HSBA 3O11A 4OSUH 1CGWA 1X5GA 3MLYH 3ZE2E 4P3CL 2ZUYA 4XNQB 3GRWA 3FOLB 1NCNA 3NA4A 1WSST 3MLWL 3CUPA 2GT9B 1L9MA 1BD2E 2UUDK 4OZIF 2Q87A 1EIBA 2P43B 4KUZH 5KVEH 2I5YL 5EU6A 2C3XA 4XTRD 5AZ2H 2J8UE 3V6FB 1F11B 1EJOH 4M03A 4JPVL 4IRSD 3RWFB 5DGQA 5JIHA 2P5WE 5GZNC 1E4KC 3DX8A 4QLRA 2HH0H 1VERA 1INQA 1E4WL 3KYOA 1SVZA 2XFXA 5HI5C 5IMOA 5FOBB 2DMBA 4GKNA 2CRZA 5J6HB 3K4AA 1ZKAA 1S9VA 5EIVA 2J88L 2A2QT 4JY4A 1CGXA 1XGTB 1NDMA 1HILA 4PB9H 1YN7A 3CXHJ 4NC1E 5AYUH 1JN6B 4IRZH 1MCFA 1A9BB 1RK1A 4OLYL 5MENB 5E6IA 4HFWA 2DAVA 1PY4A 3WO4C 4P2RE 3SDAD 3T08A 4A6YH 5I0DA 2HVKA 1MHEB 3EZ8A 5ICXB 4EDXA 1R24B 1M71B 1Q9WA 3GMRB 1AQDA 4Z18A 4FQXA 2ZWLT 4FZEL 3OKKB 3R1GL 1U8HA 2C1OA 5GRUL 1MHCA 1CFNA 3JV4B 4CU7A 1JTOA 5FYKU 1G9NH 3CU1A 3GSNB 1RJYB 4X98A 2ZCKL 1L7TL 5F97E 5L2KD 1PJ9A 4MJIB 1T0MB 1TCMA 3RVWC 1J18A 1G9EA 4XPAH 4Y4KB 4L9DA 4NN6C 5DS8B 3EJYC 1HDMA 4F58L 2CO7B 5L7XL 1PKQE 2YC1A 2CSPA 2IH3A 1DFBL 4LVHC 5ITBH 1W0VA 2J4WL 1XGQB 3BYYA 1N0XL 1W0WB 4PS4L 5IBTH 1QSFE 1UKTA 3QFJD 3T0DA 1UWGL 5DTFA 2OJZH 4JRWA 1MFAH 1CCZA 4X6EB 5HHXH 1VGEL 4OD2B 5DQ9A 1R3JB 1JNHA 3MQIA 1HH6A 3S88H 3MGAA 1WVZA 3LH2H 4NQED 5CJBA 4ODTL 2ZJSL 4YHYB 1UH2A 5HHOB 2VE6A 1IGCL 5ERWB 3D0LB 2APFA 2B5IC 2H2SC 4DW2H 2WWMD 1OLZA 1FYTE 2APWA 2GI7A 2BZDA 4JN1H 4X0KA 2VUOA 2AJSH 3AREB 2W91A 43C9A 4HK0B 4HGMA 1LILA 2Z4QB 2GSGA 2F8OA 1I75A 1ORSA 5KTEL 3QBTB 2KPNA 3U83A 3VXRB 2WINB 4HH9B 2C3HA 2FB4L 3T0XA 1RV6X 4ORZC 4D9LL 3TV3H 4LCYB 3S6CA 2AV7B 2VZ1A 4PJ9A 3TA3C 4FOMA 4L4VE 2RFXA 3D2UB 4OF6A 5ID1B 3E1F1 5KVFH 3MLPA 5BVJB 2OK0L 2F5AL 2MHAA 5C6TH 1R3IL 5GIRA 2EC9T 2PW1B 5GS0H 2F19L 2P8MA 1UYWL 3LV3B 2NW2B 4OUUA 2IBBA 1R6VA 3GSQB 4Y4HD 1UXWA 4QRUB 1BFOB 3GJEA 2FIRT 5I1DA 4Y1AE 3I3EA 2COQA 2ZZUT 1QR1A 2EDLA 1CD1B 3QDMD 5E5MB 4RWYL 4LSRH 4MLIA 3QPXH 5EUKB 4ESKA 4J3UA 4HW6A 4L3EE 3RZCA 3N9GL 1D7FA 5GGSB 3WUWB 4PYHA 1EEYB 1CFSA 4HIHA 3QQ3B 4N0CD 3HZMB 3HLAA 4LPCA 1AR1C 1A2YB 1RULH 5CEZD 2VXTH 1FZOA 1IMHC 3TYGL 1U8IA 4I18B 1ZGLP 2RHEA 3KYKH 5BO1H 4XP9L 5T3XL 4P46D 4JFQB 4LHUA 5GJTH 4O51B 3HMWL 2DYPD 5C8JA 1CXIA 2NW3B 3B5GA 4X6BA 2VDMH 5D96C 4NC2B 4LARH 4K3HA 3IJHA 2FX7H 1PLGL 5KSBB 5D5MA 1I8LC 5DC9B 3PWUA 5ISZE 3NABL 3ZTJH 4R26H 1QA9A 4F37K 3K2UH 5E7BA 3I50H 1QLFB 3QDJD 1XGYL 2ED7A 1EFXD 3ECBB 3MOBH 4PJIF 4WI5A 1I4FB 4G8EA 4TPRL 3BPOB 1B0RB 5C0FB 1F90H 4GSDH 1AGCB 2IGFL 4NC1C 2HMIC 1VESA 1EERB 4MXQD 1FIGL 4IOFD 2VDQL 3WL9B 3G6AA 3T4AB 4PLOB 5SWZD 3MRKB 1F4WH 2IPKB 2FZ3B 2EYSA 4K3EL 5E9DD 4U1NB 3C2AL 2FYYA 3WN5B 3CH1B 1QBLL 3H3KA 4JM2B 4DCQB 5A40E 1U8LA 4TULL 1FAIL 1AE6H 3BMWA 1NCAH 2YPKB 2VAJA 1BOGB 3O2VH 4Y2OA 2HFGL 4P5MA 4TNVF 5BS0B 3LKOB 5E03A 3SPVA 5F9OH 2WK2A 1K6QL 3LAFA 4KZDH 5BMFL 2IH1B 1DR9A 4HWBA 4O02H 5TE4H 4WWID 3CSPA 2A6JA 5HGHA 1B2WH 3QA3A 1QSZA 1QSED 2EIEA 2OR9L 1KJ2L 3DECA 3TO4B 4LSDA 4RFEB 3UTSA 4OGAD 4HXAL 2ZOKA 2XRAL 3JUYA 2EDXA 3PV6A 3QG6A 4XBPB 4P2QB 4XXDA 4ELKB 3LMJH 4JRYB 5E1HB 1CG9B 2EIZB 5ESQB 3H3PL 3MA9L 4KXZH 1EUTA 2D2OA 4RAUB 4Z7NF 3GMNB 5CD5D 1I8IB 3W5MA 4BQ6A 3WMSA 3V52L 1DQLH 2MFNA 3CMOH 1GYAA 4PTUB 4AENB 1JHLL 1YZZA 1DLFL 3HZKA 5I66A 3CXDH 2YMXL 1JZ8A 4R4NC 3O3AB 1F4AA 2VN7A 3LIZH 1YMMA 5LGHL 1QSVA 4K3JL 2AAVA 4OQTA 4WW2A 5SWQB 3HPLA 2VUYA 3H9SD 2WSKA 3RVVD 2RB8A 4K2UL 2Y5TA 4ZNCD 1ORQA 4PJ8D 4XPGH 4KFZC 4LLYB 3WE6B 2ESVE 1KC5H 4JG0L 4ZPVA 3AVEA 4HF5H 2P46B 2YKLL 5CP3H 1A02N 4JFFE 3EYQD 3MLUL 2VXVL 3PABA 1JI2A 2UVEA 1JTPA 3F12B 3SKOB 1JZ3A 5F1IA 1HHKA 4X7SH 2FWOB 3MUHL 1FNHA 3L5IA 4G6FD 2VLKA 3ZYJA 2FHFA 4XNXH 3O4OB 3I9GL 4XP6H 5DMKB 3GGWA 1OW0C 3BW9A 3GO1H 4ZOAA 5IBLD 3O2DL 3SO5A 4XMLL 2DD8H 1D5BA 1X5IA 2VERN 4N0UE 12E8H 1T03L 1JNLL 5EOQH 3CLEL 3GMOA 4PRHB 5I17B 3C5ZD 1KENL 5T1KB 5CEXB 3LS5L 4O2CA 1A0QL 3QO0A 4HWZB 3MYZA 5IKCB 1S7WB 5ICYA 5EU6E 2BNQE 5GRYA 1AXTH 3QULA 4NQCA 1R5VB 4LAJH 1PYWA 1A4KA 5I8EB 4OZGF 3O6FB 5TDPB 5DFVD 5F1OB 2B8OT 3MJ8B 5ETUA 4NNPL 5D72L 4LQ1A 5LQBH 2Q8BH 1JRHI 4CVZB 4UU9A 4XVTL 1KT2B 3TBYB 2ITDA 1JWMA 4JLRA 4FFVC 2OZ4H 4DZBA 5HD8C 3CFDA 4M02A 4XPTL 1UH4A 4YNYB 4N8VG 4PBVC 2HT3C 2VITA 4M5YL 3WFBH 3OHXB 5F1NB 4V1DE 1MOEA 5DUBA 3DXAA 4X5LA 5IEKA 2QQKL 4ZODA 4KC3B 3T1FB 3ZL4L 5GHWH 1A1NB 4HWEH 2VLRE 1KLFA 4GW1B 4FQLL 2BY1A 1SHMA 1WBZA 4P5TA 5L0QB 4WTZA 4NHCH 3MNZB 5I1CL 1IKNC 4LCCA 1S9XA 4X83A 3FJTA 3LRHA 3HFML 3GJFB 5FKAA 3BGFC 2EDWA 3HN3A 1ZHLA 1U8QB 3H3BC 1LO3H 3N1GC 5C0BE 3RVXD 4XPHH 1DUYB 4YFDB 3BQUA 5HVGB 3VWKB 5FEBA 3RI5K 3ULVD 4ZXBD 3L6FB 1ZLVK 5EOCH 1UZ6E 1N4XL 1X5HA 4JQXC 1F6AB 1DUZA 4L1DA 2DLGA 1R3HB 3IKCA 1T22A 2UYLA 2JIXB 1H15B 3QIUB 5IUSA 1LDSA 3PNWA 1R5WB 3SBWA 3ESUF 4X80L 1FDLH 1ZA6A 3WO4B 5FO9A 1XF5B 2V7NA 2YD6A 4KRNA 2HJKB 4MA3B 1IT9H 5HHOD 2Q86A 1G7MB 1ZVYA 1H3GA 3KPQB 4WVRA 3U9PH 1PY9A 3O0RL 1G9MH 2NR6C 5DRXA 1P9MA 1OHQA 5EBGA 1VGKA 3ARED 1D3CA 1OAYL 1UACH 3E6FA 1BQHG