2ZJSH

Crystal structure of secye translocon from thermus thermophilus with a fab fragment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
220
structure length
220
Chain Sequence
QVQLQQSGAELMKPGASVKISCKATGYTFSSYWIAWVKQRPGHGLEWIGEILPGSGSTNYNEKFKGKATFTADTSSNTAYMQLSSLTSEDSAVYYCARSPYYYGNWDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/immune system
molecule keywords Preprotein translocase SecY subunit
publication title Conformational transition of Sec machinery inferred from bacterial SecYE structures
pubmed doi rcsb
source organism Thermus thermophilus
total genus 34
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2008-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zjsH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zjsH02
3PXHA 2XTJB 3IDYB 5ITFB 4FQIH 5DMKA 5FGSA 1S7RA 4I0PA 3TO4C 1ZLUH 1NGPL 2XWJA 5JDSA 4JY4B 1E6JL 4PGJA 2OR9L 1BFVL 4JY6A 4PV9A 1QR1A 2X89A 3SJVE 3FMGH 2HLFC 2P5EE 3QFJE 3HG1E 4ONFH 5HHVH 5TPWH 5C0JA 1HILB 2F8OA 4MAYB 2A38A 1P6FA 4N0UA 4H8WL 2O5XL 3FQTB 1YN7B 2E7LC 2D2OA 2VLLA 5GIRB 1O0VA 2F5AL 5F97E 4P9HC 5C71A 2GJ6E 4JGMA 1U92B 1ADQH 1QKZL 1IILE 4GAJH 1YNKL 1J1OH 4WW2A 5DRWB 3DVIA 1U36A 4XHJC 4OKVB 1X9QA 1KCKA 3LD8B 4GUPA 2GY7B 3S3JA 4OKDA 4ODTH 3UTTA 5GRVL 1KLFA 3B5GA 2XG4A 2HWZL 3TCLA 3FO1A 3ECBB 4DUVA 3IDGB 5IVXB 5J12B 4U6YA 4G6MH 4IRJB 3PWPA 4KV5F 3G9AB 4NKMB 2P47B 2X7LB 1S8DB 1LO4H 1NBYA 2ITCA 4OCNC 2P8PA 1MRFH 4DN3L 3MUGB 4YJZL 2UV3A 4NRZB 3RFZC 5DVOA 4X6FB 1BZ7B 5LCVH 1FG2A 1S9XA 3FO9A 3AS1A 2ARJA 5DO2D 3N1QC 4KY1L 3GRWA 3WLWC 1AKJB 5HHOB 3T4YA 2VLRE 2WW8A 3ILPA 1OAUH 1C08B 1FL5B 3PL6D 4OLXH 4OD2B 1CZ8L 5SX5H 3DIFB 1OTTC 4WFFE 3DGGA 1DUYA 3DMMD 3RWDA 1QSEB 2E5EA 2EZ0C 3EDJA 5EO0B 5IGXH 4JKPH 3HUJB 1KPRA 1Q0XH 3CD4A 4CVZA 3EOBB 4YFLI 3VFOB 3IDIA 3VCLB 4MZ3A 4OM0L 1PQZB 3KAAA 3PWVA 1TZHB 3MR9A 3O4OC 4U1GB 4IRSD 4RFNC 3U46B 4B53A 3BGMA 3WJLC 1S7UB 5C0GA 2R29L 2FEEL 4LPUA 3QDHA 4HIXH 4J4PD 5HGHB 4NFDA 3F58H 1D5MA 1A7OL 5EBLA 2E6JA 4Y4KB 3DVGB 2B7DT 5KZCB 3GSNL 2A9NH 1OSPH 4PB9L 4EI6B 3C8HA 2DAVA 1IC5H 4XVUD 5CSGA 4J3XA 4L3CA 2VH5H 5DMYA 32C2B 5L8KB 5CJ5A 4JDZB 3ZDXE 4JPIB 1S7VB 1FZJA 1Z0NA 3IS1X 5HGGS 2PKDA 3PWNB 1KIRA 4YXKH 4S1QL 4M48L 5A2LH 1I9JL 3BPOC 1PD6A 5E2WL 3Q5TA 1J9CT 1U91B 3QJFB 4R4FH 4ZUVA 2WBKA 3IYLW 4P2RA 4Y2DC 4ZODA 1UH4A 4KPHL 5A2KH 2X2YA 2YD3A 3VXME 3ZL4L 2ADFH 2O5YL 2BMKB 1J7VR 4GSDH 2WWKO 5I1KL 3CFKB 3MRMB 1T1YA 3KJ6L 4GQ9H 1DVFD 1DN0B 2Y6SD 1ZGLB 3TVMC 3NCCB 3TN0C 3QHTC 1YJDL 4U1LB 3REVB 3L7EA 2IJ0C 2LAAA 1QLFA 4NQEB 4MNQD 5E8NA 1R24B 5I15H 3MMEB 2ERJC 3T2NL 1P4BL 3HZYA 5BS0D 3UC0H 4X8JA 3QH3A 3VE0B 1H9VA 4H0HB 3RTQB 2DL2A 2VNCA 4MZ2A 3VMPA 4CU8A 5FYJH 2D7OA 3QNZB 1V3KA 5FUOL 4IDLA 3VRIB 3EOAA 1NSNL 3P4OB 5A2IH 3LKRB 5DWUL 1ZGLM 2D9QB 2AAVA 3QDMD 4JDVB 3MV9B 2YUXA 3M1BA 2X6MA 4ELMB 3VFSB 3TC9A 1N7MH 5ICYA 1Q9OA 1ZV5A 3P77B 1W8NA 4MJ2A 4Z7OE 5I1AA 2JCCE 1FFOB 3GMOB 1WUNT 4IJ3C 3NABL 4DKEL 4Q9RL 3U2SA 1MCFA 1NL0H 4UILL 1QSFD 4BKLA 5CJXC 3OQ3B 1X7QB 5KN5A 4WHDA 5TGBA 5D7LA 3T08A 4XWOD 4YGVA 5GIRA 2YD5A 1FLRH 2XKNA 2I25N 3VFUA 1U92A 2CXGA 3EO0A 5TFSH 4OLEA 4UI2A 4Z77A 4OCMC 4X6CF 5FV1L 3PGDB 1H3VA 2HH0H 3O2DA 4Z5RA 3E2HC 5F1IB 4FQIL 4QXGH 2W92A 4HUVA 3L9RB 4G8IB 5IVXA 3D39B 3MX0A 4MX7A 5ID1A 3ZDXF 4TNWF 3FMGL 4NKMA 5B8CB 2LTQC 5DMIL 4HK0A 4FN0A 4OLUH 3WFHA 4I9WD 5IP4A 1NDGA 4NBXB 4ONFL 3DX8A 5TPWL 4DFIA 2BDNL 1JL8A 1LMKA 1QRKA 4NNXB 1KOAA 2ZUWA 1OT1A 5ESVB 3KXFD 2J2ZA 3S4SB 5JOFA 3OKLB 4E41B 1ADQL 3WHE0 1FVCB 4UU9A 1J1OL 4O9HH 3IVKB 1H3GA 1MLCB 3VWJD 1AKJA 4MA3A 4ZPTB 4H1LA 1FN4B 1N6VA 4RDQF 1ZSDB 5MERA 3KNBA 4ODTL 4HDIA 4XCFH 2WBWB 4V1DA 4KRNA 5C0AE 1QPPA 1U8HA 5BV7B 2H6PA 4OF6A 4BYHA 1IZJA 4I3SH 4G6ML 4H5SB 1NUNB 1SJVA 4LLWB 2EEAA 4EIGB 3PHQB 3TNNB 1IFHH 1LO4L 5ENWB 5HGAB 4Z0BH 4L29B 4YFDB 2R2CA 3IJHB 3ZE2E 2X10A 1PQZA 3CSYA 3GMRA 3TJEH 4TTDD 5INDA 3U46A 5MEPB 3BP5A 3BYTA 1HK6A 1VHPA 2FB4H 2AJZB 4KUZL 4LP4A 5LCVL 2YRPA 2EC9T 5JW5B 5L2KE 5D8JH 1JWUA 2D9CA 3DVGA 3LEYH 4X6CB 5BZDB 4X99B 3QUZC 4ETYA 2Y25A 2I9LA 4GQPH 2V2TB 1OAUL 3SGJA 4OLXL 1N5AB 1NGWB 4NHUB 3QSKB 1MCNA 3TA3B 2NY7H 3WD5H 3D69A 1KTLB 3ZT5A 2ICES 3QUYB 5DHXB 5EBWB 1KTDB 3MUHL 3PG2A 4WEBH 5IGXL 4JKPL 5FCSH 3BPLC 3ES6B 2B0SH 1MFCH 4U0RB 4GKZB 2HG5A 1E28A 3ULUH 3QEQB 5AWNH 4Z7OF 1C12B 2YD1A 1KT2A 4X4XA 5DD3H 2JCCF 4S2SB 3T8XB 3V5HA 4M7KH 5FCUH 2GHWB 4HIXL 3AC0A 1P1ZB 3F58L 3FQXA 3BESR 1F42A 4PUBH 4Z95L 4JANB 5C0CA 1OSPL 1KJ2B 1HHKA 3LH2H 4WI3A 2AQ2A 1IC5L 4HCRH 3RWIB 4RNRB 3QWRD 4L4TB 3QIWB 3B8YA 4KKCD 1DN0A 4O2CB 4PJFB 4Q6IB 2IAND 4ZAKB 4WU5B 4YXKL 1JWMA 2BFVH 3WUZA 2H3NB 3EFFA 4NQEA 3MRNB 1VFOA 3BHBB 1R24A 1QSZA 1PFCA 2LU4A 5I0ZA 4R4FL 3TN0A 3TH2T 1OF2A 3BISA 1GGUA 3C5SA 3U9UA 2HMIC 4P4KD 3LV3A 4QXTB 1HSBA 4ODXA 3VD9A 1Q9KB 4PY8I 4NPYB 2ADFL 4YFEA 1I7TA 4D8PA 4KJQC 5KVFH 4GSDL 5DLMH 3ZTJG 1UC6A 3O4LA 4G5ZL 2NXYD 4MJ5B 4GQ9L 1BF2A 2YXMA 3MRFB 4TUKH 1QFWI 3RU8L 4JAMA 1Q94B 3L3HB 3GIVA 5JHDD 1LDSA 1RZIB 1VPOH 3B43A 2BY0A 4RGMB 5GGTH 2OZ4H 1IAIH 3ALPA 2EDHA 3GMOA 5I15L 3BYYA 5DD6B 1BBDH 1X6NA 3UC0L 4F37F 1IGYB 4JM2B 1TCMA 4KQ4L 2P5EA 3HPLA 3QFJA 3HG1A 3NFNA 1S5IH 4G7VH 4KK6D 3O6FD 3KLAB 5F88B 3QIBB 3ZE2F 3SEPA 4J12A 1VEMA 4WY7H 1FL3B 1YUHA 2XA8H 4L8CB 3AM8A 1TTGA 3TYGH 1QFHA 4YO0B 5CJXA 2CMRH 7CGTA 3P9LA 1K8IB 3WSQH 2GJ6A 1PKQE 5EORH 1UWXK 4QRSB 4KK5D 5L7XH 1UB6B 1N7ML 3PGDA 4PYGA 5EO1A 1TVDA 3EYQC 3FB7B 1LNUB 4M6AA 2HVKB 3B83A 2DQFB 2MKWA 3QAZC 1S7XB 4HLZG 1KB5B 4IIQC 3OF6A 2XYCA 4ELKA 3SDXE 1NL0L 1N8ZA 3TH3T 3PUCA 3V6OE 4PP2B 5AD0A 1KCUH 3GSUA 4WHYG 1QBLH 1A6UH 3JV6B 5HHPB 1PX4A 2IQAB 1FLRL 1RIHH 2FZ3B 4GKSB 5SX4I 5KW9L 4R4BB 1KJVA 2BVEA 2NLJA 5TFSL 5EOQH 1PG7X 1S78D 3QHZH 5HTSA 3DX9A 2HH0L 5D70H 2GAZA 5DEGB 1ZSDA 2VLRA 1A1OB 4NCC1 1X4ZA 4QXGL 1MFDL 1GGBH 4CW1A 2VWEE 1RULH 4GW5B 3FB5A 4I5BA 1IGTA 1MEXH 4WO4B 2VXQH 4PG9B 2UYLB 3SE3C 4OLUL 4U1JB 3TNNA 3ISWA 3JVGA 5J9PB 3G04A 25C8H 3D3VE 5MEPA 4Y2OA 2YZ8A 4K94H 1A9EA 4RBPH 2ZG2A 3NFPB 3KPNB 1K4CA 1MI5B 5F89A 1HXMB 1CYGA 1PY4A 3JTSB 1K8DA 4OQTH 3TYFB 2OBGA 3T0ED 4O9HL 1FFNA 5D2NB 3TFKC 4HUKB 5I16B 2PXYC 3NIGF 1EGJH 4OZHB 5EOCH 5HD8C 1NGWA 5EIIB 4XCFL 1RZJC 1KPVA 2UVFA 1CWVA 3BT2L 1C16B 3DSNA 2X4UA 1ZLWK 1Y6KR 3QUZA 4MAUL 3BRFA 4I3SL 4B50A 1EZVX 5DXWA 3RUGB 4HBQA 4NQUA 5DZLA 1CVRA 3QQNA 5DK0A 2Q8BL 4Z0BL 3W9EA 1OWRM 1NKRA 4U4BA 3UEZA 4F57L 3TJEL 1MHCA 1LE9B 5DJ8B 3ZYZA 3MUZ1 4EUPG 1IARB 2CO7B 4W6YB 2FB4L 4HV8A 5HDBE 3NN8B 4Y16B 3K0WA 3LEYL 4DWHA 2YPKB 3THMH 5HJ3A 5HI5D 2HP4A 2WWKT 3C60D 1MY5A 1WICA 3VXMA 5F9JB 2E9JA 4ZS7L 3IGAA 1HHHA 1UZ8B 2QHLA 3MBXH 1DQLH 3MYZA 4JRYB 2V17H 5IW1A 1EBAA 2NY7L 3WD5L 2VLJA 3EIFA 4YH6A 4IDJH 4Q6IA 5DQDH 4WEBL 4WU5A 5SV4A 3OX8A 2MCPH 3MRPB 3U1SL 4X7SH 3MLUL 4XPAH 1MFCL 3ULUL 4FG6C 3O0RH 3K80A 5AWNL 5IK3A 2YA0A 4E42A 5DD3L 4M7KL 5FCUL 4P2OB 1OD9A 1T7XA 4NC2B 2CQVA 4GT7A 4QXTA 3OJDA 5D7IB 3SDXF 3OKEB 2E9WA 3A6CH 2ICWI 4PUBL 4ZDHA 1BWMA 3LH2L 1TMCB 3DGCR 4Y1AE 1J05B 1X6LA 3CFDB 3IFOA 2XNAA 4QNPE 1BWWA 2VDMH 5DHYA 1U2HA 1WZ1H 1F4HA 5EU3A 3Q0HA 4EUPB 3TBVB 1D5XA 4PLKC 3T1WA 2VN4A 4MXQD 3R0MA 2X4OA 5IFHL 2RFXA 3MNVA 2BFVL 2W60A 4KK8C 1RIUH 5KANG 2N56A 1FORH 4JZOB 1S5HB 3MYJB 2P8LA 2R2EB 1ZHNB 4MHHG 2B39A 1JRHI 4XPHH 3TV3H 4M3JA 2JCCA 5DD6A 1WITA 4DKFH 4RZCB 4IS6B 5FYLH 1AGEA 3PABB 3CLFH 3H3BC 5EO9A 4AENA 4LKCA 3OAUH 3I3BA 1OTSD 5L2JA 1MHPH 1NDMB 5KVFL 4LP5A 5E95B 5DLML 4PRPD 1XFPA 2DYPD 5T3ZL 4QRRB 4L4VE 3FQRB 3GMPA 2BNQE 3PQYE 1UKQA 3X12B 2OXGA 4TUKL 1C5CH 3HE6D 1LNUA 2AABH 1EFXB 4I0KA 3FQWB 4ZYKA 3HNTH 4RCAA 3VXOA 3GSRA 1VPOL 1AO7B 4PJ8B 2DOCA 4WUUB 5CMAB 3VGBA 5JXED 1DQMH 3V6OC 5GGTL 5ILTH 2OZ4L 5I1EH 1IAIL 4WI6A 2DD8H 1S9VB 4Y5VC 3U0PB 3MJ9H 4GS7B 4ONGH 1MCEA 3EJJX 4RX4A 5DDHA 2ZZUT 4G7VL 1S5IL 4IIQA 5IB2B 2XOTA 1QTYT 4PJCB 1A7RH 4JQXA 4WY7L 2XA8L 2FZ3A 3K8KA 4KJPC 4XRCB 4CRPA 4OZFA 3SKMA 3TYGL 3DVNB 3U0TA 1MFBH 1E4KC 2IH3A 5D5ME 2XQYG 1XGTB 3WSQL 3W11D 4ZNEE 2VWEC 5L7XL 3V4UH 4UZGA 1EUUA 3HB3C 4KKNA 1IMHC 3KPSE 4XBPB 3RIAF 1TTUA 3ZE0E 4TNVF 4RAUA 2PF6A 2CLZA 3JTTA 4HS6B 2HVJB 4XB7A 3DI2B 2P1YA 3STLB 5CZXC 3L3JA 5C0AA 1P7KB 2AVGA 2AJVL 5JW4N 2YRZA 2AXFB 3AY4A 2VQTA 2YS4A 3SBWA 3OGOE 4Z7WE 2AKRB 5EUKB 1KCUL 4BSVA 4MCZB 1G6RB 1QBLL 1AIFB 2YOCA 1LO5B 3RL2B 5GJSH 4PRDB 4QF1A 4X5XB 4P9ML 4FZ8H 2ICEB 5E4EB 5ICZB 1YEIL 1AFVH 4PJXB 1YEKH 5EOQL 5JOPE 4OV5B 3QHZL 5HHQA 2NY4B 5DHVH 2VR4A 5D70L 3WS6C 3GMMA 5DYOA 43C9B 4QYOB 3IDJB 3WIIH 3L5WA 1GGBL 5ID0A 3WCYA 1RULL 1Z6JT 4QNPF 2FCBA 4AT6B 1T20A 2CKBB 4NOBA 3CAFA 2PXYA 1XMWA 1MEXL 2WK2A 5DJAA 1HNFA 5BZWA 2SEBB 5FO8B 4DUXA 1BF8A 1FC1A 5DJ8A 3TZVA 4AK1A 5MEOA 1MRCH 5EULV 3L7FA 1X5KA 3NN8A 3LSOA 2D7QA 1FNGA 4OQTL 1EEYA 1EDQA 3WNKA 4CBPA 3BVNB 3OR6B 4Y4FB 3OZ9L 5IVZB 5DC0A 1EGJL 5C09D 5TE4H 3RWJA 1N2RA 1X5LA 3ESUF 4P5MA 1UKSA 1Z5LB 3ILQC 4ALAH 1D9KB 2NYYD 4XBGA 4GW4A 1EA9C 4QOKE 4NJ9H 1LEKB 4JFZH 5FK9B 3O9WC 3CVHH 3WNOA 2HT3C 4HJJH 1M05A 2FIKA 4IHOA 4XZUA 1DBBL 1RZ7H 5F8RC 1V05A 3TJHD 5H8DA 5IT2H 4F9LC 1T3FB 5C0FB 4L9LC 2ESVD 4X9IA 2KZWA 1NC4A 1X3DA 1NBQA 4U6XB 1OGTB 4LCCC 1J05A 2ILLA 3BZ4B 3S97C 3VMOA 1DQLL 2V17L 4YHKH 3RPIB 2EDKA 4IDJL 4Y5XB 5DQDL 1UWGH 2QSQA 1L7TH 1AE6H 1WLHA 4QHLA 4X8XA 4JKMA 2BVUA 4XCNB 1VADB 5BRZB 4JFDD 4X7SL 4XPAL 4H26B 1AXSB 3M8OH 2EO1A 4B41A 2PW1A 3O0RL 5CD5C 4ZXBC 4I0PD 4RZCA 2YKLH 2J8HA 1XF2A 4LHUG 3N9GH 3PABA 4ZO7A 3VD3A 3HUJE 2VE6A 2A77H 3A6CL 2X89D 5CGTA 1DN2A 3MXVH 5C08D 1NDMA 4JPKH 4HS8H 5FO7B 5DJYA 1U3ZA 1JK8B 3ARDC 4N0YL 1OARL 5CJQH 1H8OA 3DX7B 2VDML 1NCWH 1S7TA 4KVCH 4QRRA 2W9DH 3CFEB 5GGVH 3FQRA 1PKQA 5SX4H 3CZJA 1BLNB 3UBXG 2OR7A 2EE2A 5DF0A 3DV4A 1RIUL 1JF1B 4WUUA 2WUCL 3R4DA 4NUJA 3BZDA 4XPHL 2JJWA 4F7EB 2ZKHH 3TV3L 3INUH 3UTTD 1E4XI 1JN6B 4KMTH 5DJDA 2OCFD 5FYLL 4PJ5B 3SDXA 1KV3A 4YBQD 3PWPD 3V6OA 3OKKA 4G42A 3OAUL 3C5ZC 4Y5VA 1D5BB 1MHPL 1BJMA 2V9RA 4KVNH 3EGSB 4JRXA 1NGYB 3W2DH 4F7TB 1L6ZA 3ZE1E 4M1DH 3ROOB 4LHUB 1JNNH 1C5CL 3NAAH 1D6EA 2RR3A 2AABL 2VTFA 4LSRH 1GYAA 1E4KA 3HNTL 3ESVF 3CCHA 3I02A 3CXDH 3T3ME 4JHBA 2HVJA 4PREA 3VFMB 3KYOB 5ILTL 3VXTA 5I1EL 1N0XH 4K71B 4LBEB 2DD8L 4L8DB 1CQYA 2GUOB 4ONGL 4UBDC 3HLAA 3RVUD 4XHQA 2AXFA 1NUDA 1GPOH 3HKFA 4JE4B 5KVMC 5F7YC 2RCSH 2NPLX 3UBXB 4K55A 1AIFA 3RL2A 2HAZA 4PRDA 3P9MB 4EI5B 1CE6B 2LQRA 4NQVB 3EYOB 2ARWA 1MFBL 2GITA 2ICEA 3Q3GA 4U1HB 4Z7VE 4Q2ZA 2DJUA 3QPQD 1WZKA 3FAXA 2ZOKA 3V4UL 5HHXH 5IB1A 4WWKB 4YZFE 43C9A 2AV1A 1JBJA 3FO2A 1XF5B 5CHNB 3RX8A 5JPMB 3GMLB 2BVYA 1OAZH 2CKNA 2XTJC 5FUCE 3GKWH 2PTVA 3CPLB 2CKBA 3CNKA 4ELME 1I75A 4ZD3H 5E8PB 3MUJA 4LSUH 1MHEA 2HJFB 1I7RA 1QA9B 1HINH 1T21B 4PB0H 1G9NH 4NO3B 4OIIH 4HK3J 5GJSL 3X13B 4MAYC 1T04B 2EDQA 2RB8A 3NIFF 4FZ8L 1TVHB 3OXSB 4IMLA 1YEKL 2JJVA 3G08A 4LCUA 5JO5A 4UT6L 4P2RD 3UX9B 4JFEE 5AYQA 4CVXA 4G8GB 4BQ8A 4YC2C 7FABH 3WIIL 4XNUH 3LD8C 4PGCB 3GFUA 1KB9K 3MNWA 2NXZC 2JJSC 1B0WA 4RRPG 4LF3B 1J1PH 2YZ1A 4X80H 3DRTB 1IM3A 1DL7H 3E3QE 1TNMA 5J12C 4ZS6C 4IRJC 4H20H 1I9RH 5FXCH 3S5LA 4H25A 1T1WA 1UKTA 3WDHA 4PJIB 3PJSA 4NQCB 3BXNA 4LSVH 5ISZD 1EJOH 3O9WA 2NY5H 2HJKB 3BSZH 5KSUA 4FQJH 2AS5M 3PWJB 1M7XA 1UFUA 2Q87A 5CGMA 3L6FB 2VDNH 4S11A 2X1WL 4KXZH 4ZSOE 5IB5A 3WIFB 1SJEA 5CLWA 4Y1AA 4F9LA 4L9LA 4ONHB 1NAMH 5ANME 3IFPA 4G6FD 5DEFA 5C7XL 4J1UA 2DQGL 2XZZA 3ZE1F 5A2JH 1TVBB 3VFVB 4NJ9L 1VADA 5BRZA 4X6EB 2WIIA 1JGDB 1G7HB 1NCTA 3CVHL 4HJJL 5C2BH 4HJ0D 3T3MF 4RGNE 2Q76B 2HTKC 3WEXA 2WBJC 1RZ7L 3C8DA 1WBZB 4YXLL 1ZT7A 3HPJA 5IT2L 4MDIB 1GOGA 4NN7B 4FMKA 3LZFH 3VFTB 4ZXBA 2XZCH 3L3IB 1JK8A 5KSAA 4X6BA 3QDJB 3LPFA 5D7LD 4YHKL 3OKNB 4KI5D 4TPRH 5IJVB 2WANA 4DKDC 2D0FA 4Z7VF 4L4VA 1L7TL 1AE6L 2BNQA 3MV11 4LGPB 1NGXB 4GRWB 5BMFH 1TJIH 4XAWH 1U3HC 3QPXL 5DRZA 5T33H 5J6HA 5EBGA 1CDJA 4HWBH 4YZFF 3M8OL 2P46B 1NCAH 2VO5A 1JN6A 4UDTB 1X5IA 3O3BA 1RU9H 2CDGB 3AB0C 4RMVA 4XHJD 1RUMH 4BH8A 2A77L 3RBSA 1PW3A 3F6LA 2IAMA 5I8KH 4AIZB 4JPKL 4HS8L 2ZUXA 3U4AA 2QQKH 1CXHA 2ADIB 2AI0H 3MLTB 1ZT1B 4RWHA 5CJQL 1B2WH 5H94A 2AQ3A 4KVCL 2W9DL 1WAAE 5TF0A 5GGVL 3I75A 4ZNEA 4CMMB 2HLAB 3Q48A 4PJAF 1II4E 4NUGH 5K33A 1CBVH 3BDYH 3PNWB 5JQHC 2CLRA 4AH2A 5CWSB 1AKJD 5HHOD 1IEBA 4JHZA 5K9KA 5JW3H 3VFMA 4XP6H 3KYOA 4IBLT 2A6JB 1NGQH 4NZTH 2ZKHL 3INUL 1SY6A 1JPTH 4V1DD 5D1XC 3MPCA 1RMFH 4TSCL 3BH8A 4KK9C 1ORSB 4PRHE 1QSED 2FD6L 1ZMYA 2AV7B 3L95A 3BI9X 4MDJB 1BM3H 4XT1C 5FB8A 1SEBB 4KVNL 1GZQB 2VLKE 4F7MB 4HIIA 3C09B 2W0LA 3W2DL 1KACB 4M1DL 5T3XH 3NIDE 4R9HA 1DEEB 4XNMA 1CD1B 1JNNL 3NCYS 3MO1B 3UTPE 5EU4B 5FUCC 3NAAL 4FXKB 5KZCD 4LSRL 5DC4B 4U3HA 1T7VA 2EE9A 3IS0X 3CXDL 4PJBB 3VXRE 1U8LA 1FV1A 8FABA 5J7CC 1INDH 1N0XL 4JG1L 4W6XB 2QSVA 5E03A 1MCCA 4Z7NE 1GPOL 4J23A 5I8EA 3NGBB 3BE1H 2RCSL 5FOBB 4I2XA 2FEDC 2FJHB 3QWOA 1TQBB 3TNMA 3HAEH 1LVEA 4HIEB 4KRPB 5DRXB 4ZUTB 5I18L 2R23A 2D3VA 4LLDA 1XF4A 3EHBD 1TVHA 3ARSA 3OXSA 5EUOB 1WBYB 3Q6FA 5JW4R 5DRNB 1SJHA 1QD0A 4I3RH 1ITBB 4PJAB 5HHXL 1M4KA 2H2SC 5F70A 1ZHBB 3N06B 4MD0A 5C0CD 1T0NB 3W81A 2CDEB 4Q9QH 5DMJB 1S9YA 1KYOK 1I1AB 2DQDH 4OFPA 1FC2D 1UXWA 1OAZL 1XGQA 2ATPA 4PJ9B 3I3EA 4TUOB 4TOYH 3S9DB 1U3JA 4OUUA 1AGDA 4HUUB 4LF3A 1G9MH 2ZPKH 4ZD3L 3DO7B 3P4MA 4LSUL 4JZNA 4YQXH 5CEZD 4JFXA 4L9DA 4K7PH 4QOKA 2Q8AL 3GHEH 1BHGA 1HNGA 1MAJA 2FLRT 2JJSA 4KROD 4PB0L 3AREB 1G9NL 4HFWA 2VQ1A 4PBWD 4OIIL 3RNQB 4K8RC 4NQED 3GSNA 4FXLA 3RWGA 2BVTA 1YDPB 4AM0B 2UWEB 1HDMA 3TN0D 1YN6B 3AGVA 1MJ8H 4N5UA 5B39G 2G5BB 3QEUA 1MPAH 4X7TA 5B3NA 4KMLB 2P24B 3O11B 4KUCF 7FABL 4YBLB 1F00I 4XNUL 1TITA 1JI2A 4IMKC 2HYMA 1BFOB 4FFWC 4Q7DA 3MA7A 5IF0A 2JKXA 3QEHB 1VGKA 3OAYK 1J1PL 2VXUH 3O4LD 3Q5YA 2VZ1A 5E4IA 1CTOA 1B6UA 4RGNC 4X80L 3VFVA 3GMQB 1YECH 1LEIA 1DL7L 4X6EA 1FIGH 1EFQA 3OAZK 3S98A 1JHTB 4UUJA 4H20L 1I9RL 1YY8A 4FHBD 1Z9LA 2ZG1A 4CL7A 2VDOH 2XPGB 3H9ZA 1M7IA 3U0WH 5GS0C 4GG6E 4FFVD 1KIUA 5E99H 5ESAB 1F6AA 4MVBC 1WBZA 4LSVL 5IV2A 4HC1H 4KZDL 1EJOL 2I07A 1RURH 3BSZL 4FQJL 3S6CA 3RY5A 3HC0B 4Y5YC 5FECB 3AS3A 2VDNL 4KRMB 2WBJA 2P5ED 3QFJD 1M6OB 2Y5EA 3UTQB 1BJ8A 3IJYA 3OKNA 5MENB 4XMKH 1R5VB 1NAML 2YBRA 4QCIA 1HKLL 5FHBH 1BX2A 3TA3C 2GJ6D 2FO1A 2VDPH 2GCYB 4X9FA 1DQQA 2Y7QB 4OZHE 1J0IA 2GK0B 1FNEB 1TETH 2GTZB 3G5ZA 2H8PB 2GW5A 2DI9A 5C2BL 1ZHLB 1E4WH 1S9WB 1QUNA 1FG9C 3KLDA 2CDGA 5GGQH 1A6AB 4XXDA 1U3HA 3OF6D 4Z7NF 3ETBF 3VWKB 3LZFL 3DPBA 4Y88A 3WKNA 4AIZA 2XZCL 3MV8A 4WTXA 5FA3B 2DLFH 1BEYH 3TBTA 2EO9A 4YDLB 1JUFB 3BQUB 1RVFH 2Q3AA 5IQ7H 2Z31C 2ENYA 1J88A 4K7FB 5CEXA 5BXFA 4CJ1A 4H0GA 4WI7A 4CMMA 1XZ0A 3QIWC 4XX1E 4R26H 3I50H 1N64H 4Y7MA 4OZIB 1UVQA 2EYTA 2VITA 2FO4A 3PV6B 5BMFL 4G7YH 4HKXA 1IM9A 2V5YA 4XAWL 3RVXC 4HWBL 1ODAA 2YPLB 3KLSA 4NDMA 2VLRD 4P46A 2FGZA 1NCAL 1Q9WB 2CIKA 1RU9L 1F8TL 2V7NA 4LMQE 4G3YH 1Y6MR 1RUML 2X4QB 1ORSA 3BIKB 4WFFD 3VGAB 3MLSL 1ZLSH 5CJOH 3LPWA 5T3ZE 4MJIE 5JMRA 5I8KL 2AV7A 3CH8A 3O2DH 2ATKA 2EC8A 5D1XA 4P9HH 3ZKNC 2QQKL 4OIAA 2AI0L 4QRPB 5GGSA 1B2WL 2JK5A 4KDWA 5CP3A 1B3JA 5KG9B 4RA0C 3ARGB 1EERB 5F7DA 1DEEA 4Z7VA 5IB4B 4ZUWB 5EU4A 5JQ6H 1CBVL 3BDYL 4M7LH 2FHFA 2BC4A 3QG6B 1WTLA 5IW6A 1QNZH 5JW3L 4XP6L 2L0DA 1NMBH 1NGQL 4NZTL 1I7UA 4KHXL 5EU6E 3RWCA 5TDPB 2HT2D 1JPTL 1RUQH 3OKMA 1RMFL 3E1F1 2P48B 4HWNA 3OPZL 3QUKB 3QDGB 1CXEA 4H1LH 1BQHA 2FJHA 3LEXB 4BA8A 5IW3A 4JM2C 1ADQA 3VFNB 1BM3L 3FFDB 2C3VA 3PHOA 3MJ7A 5IBLC 4HGWB 4GG6F 1SYVB 4M6OH 2EKSB 1R3IH 5T3XL 3WO3B 4PJAA 3ZTNH 2X4RA 1F2QA 5BW7C 1KPUA 1BECA 1DLFH 1VSCA 4PS4H 4MXWL 1JGVH 4L5FL 2FECL 3VXMD 1YC7A 1I1AA 1IL1A 4GMSH 2PYFA 3GSOB 4PJ9A 1INDL 3CDYA 3KPTA 5TH2A 2YR3A 3DO7A 2E7BA 3D0VB 3MTRA 2PTUA 1A6VH 2VLJD 3VXPA 4PJHB 4PPTA 4JZJC 5DZNA 3BE1L 3RPKA 3WFDL 4ZAKD 1M7DB 1A7PH 1WIUA 4PYHA 3MJ6A 4PJGB 3ULSB 3L5IA 3IXTA 3GGWA 3CK0L 1TZIB 2BXZA 3W0WE 5GISH 1V7NH 4LVOB 4R0LB 3BEWA 4AM0A 5C9JA 2VYRE 2X1XR 4I3RL 2G5BA 4DZ8B 3BD4A 1AI1H 2VSCA 4ZSOA 1ZLVH 1WBXB 4WDIB 4OF8A 1CG9A 4JFOA 3U4EB 4Q9QL 1HSAA 2IPTH 1A9BB 2DQDL 1U41A 4K3EH 5D7KD 4BELD 5LGKA 5JIKA 1CLCA 1ETZB 2VXSL 2ZPKL 5ANMA 4U49A 1EV2E 5EBMB 5IMMB 5J3HC 3KJ4C 4YQXL 1RUAH 2E6QA 2PO6B 4OCRH 4F80A 5M94B 3GJEB 4IMKA 3GHEL 1NMCC 1VESA 4KJQD 2QADC 2IQ9H 4M1CC 5ESAA 5CEYA 2YPVH 4OZ4B 4I48A 4GMTH 1XGUB 4LLVA 2A73B 1MCRA 4OLWH 3EDDA 4GW1A 1KIQA 1MJ8L 2EIZB 1JHLH 4POUB 1MJJB 2NW2B 1MPAL 1WCBA 3J7HA 4XCYB 1XGPA 1M6OA 2AJYH 2EXYC 1MVUA 4OLVH 5L8JB 4WHTB 1KIPA 2A6KB 4Y5YA 1R5VA 3SPVB 1ORQB 3PL6B 1ZS8B 2VXUL 4FQCL 5EOCJ 1ED3B 1QO3B 1YECL 1P4IH 1U3YA 2VDLL 4FTVE 4I0CC 5E00B 1FIGL 1JNLH 5E9DE 4C83A 1AD0A 2VDOL 1B88A 4Q9CA 1BQSA 1WFTA 1S9WA 3NTCH 3S34H 3U0WL 2GT9A 3JBG7 5E99L 4HC1L 1XH3B 3MNZA 2QLVB 4JO4H 2GJJA 1RURL 5ABDE 4IRSB 3VWKA 3OKOB 4ORZC 4NO5A 4MWFB 2VAAA 2XZQH 3RZCA 1J0YA 3ZDZE 4YR6A 5CIPH 5D71H 4XMKL 3U7YH 5I17B 5FHBL 1KBGH 1F3JA 2Z91A 5F3BB 2VDPL 3T65B 1UH3A 2Z31A 1YEDA 2B5IC 1TETL 3VG0H 4XMPH 3G5VA 4FNLL 1E4WL 1CT8B 4U7KA 4EKXA 1B4RA 1NEZA 5GGQL 3QRGH 2ADJA 3SCMC 1BBJA 4P4RB 3RY6A 5C0AD 1EMTH 1XIWB 4PRHA 4C56B 2YA2A 4ZUUB 4YWGH 1BEYL 1KENH 1RVFL 2HN7A 3B3IB 5FKAB 5E6IB 1G7LB 2VLKA 1HYSD 1Z9OA 4PV8B 2R0LH 5KSBB 3GM0A 1MI5D 5I8OL 4R26L 3I50L 1N64L 4JKKA 3RI5K 4CN1A 1N3NB 5HYSG 1KJ3H 2F53A 2ZG3A 3FN0L 4D94A 5ERWA 3VXRA 4HJGB 5CBEB 4PRBA 4Z6AT 2XKSA 4HPYH 4U1MB 2QL1A 1AGCA 2EDOA 4G3YL 1QOKA 3TFKD 4YHOH 3QUKA 4YDVA 1ZLSL 5CJOL 3RX5A 3LEXA 1FNFA 1P7HL 3WE6B 3OJ2C 5DI8B 3BEVA 3B9KB 4P9HL 3STZB 3D85A 4PRAA 3F5WA 4OGZA 1K3ZA 4G6JL 3JXAA 4HGWA 3MQIA 5F7MC 1AHWB 3TZVD 1IBGH 4NN5C 1I8IA 1OP3K 4Y16D 1QFUH 1I85C 3QDMB 1NCBH 2Y5TB 4WTWA 4EQ3A 4ODHH 5FAAA 1T2QH 5I0DA 1QNZL 5JNYB 4QTHA 3WUWG 1NMBL 1VEOA 5AG9A 1JPSH 5BW7A 1RUQL 4JJ5A 3ARFA 1EHNA 1S7WA 1QEWA 2X09A 3I6GA 5EA0H 4P2QE 2J8UE 5BJTA 4EN3C 4EDXA 2ZUQC 3KPRB 4QY8A 3SKNA 1QSFB 3MCKB 1TZIA 2CJUH 3QIUA 5GRYA 3TCXA 4JZJA 1PEZA 4M6OL 1U8JB 3MCLH 2W65B 1R3IL 3BP4B 1RJYB 4DZ8A 2BVQB 3ZTNL 4LIQE 2X5PA 1WBXA 4C57C 1DLFL 4O2EA 4PS4L 5FYKD 1H15A 1NC4D 1JGVL 2APTA 1G7IA 4GXVH 4UOW0 3QQ9C 1U8OB 3CVIL 3V6ZA 3ZDZF 3MRBB 4RQQB 5CINH 1V3MA 5EZOH 2HFEA 1A6VL 4G6AC 2A83A 2PO6A 1PZ5B 5J1SC 5I73B 2DM3A 3GJEA 1U8NA 3QCTH 3JUYA 5D2LE 3HZKA 5D1QB 2NNAB 1A7PL 2BSSA 2VAJA 4BUHA 1IQDB 3MLVH 1EAPB 4Y19B 1V7NL 5GISL 4GG6A 3NZ8B 3WUWB 4C58B 4JVWA 4TUJB 5ETUB 1FHGA 3ZKXB 3TP4A 1LE5B 3KXFB 3GUTB 2EIZA 4QRQB 2EDFA 4JO2H 5JUEL 5LJYH 3HI1B 4AIOA 1AI1L 4GRLC 1RQ5A 4HH9A 1EHLL 2BXYA 1UQSA 2P8MB 4G80B 4KKBC 4EDWH 3IXAA 3VWJB 4ZQKA 3HN3A 1AGFB 2IPTL 4OT1H 4K3EL 1T5WB 5E5RB 2ADGB 1Y18A 1ROWA 1YPZB 1FNLA 1Z3GH 3MRKB 5D7SL 4JY5H 4YDIH 4NO2B 1QO3A 4QRRD 2DLGA 4N8VG 2D7TH 3T1FB 1RUAL 4OCRL 5B38G 6CGTA 5DJ6B 4NQXB 3QJHB 3F7QA 2OI9B 1EFXD 2IQ9L 4OM1H 2VDQH 2X4NA 4YEFA 4PLOB 2NY0B 3U9PH 2I9TB 4WUUD 1C7TA 2ZUYA 4NC0B 1N4XL 1W72L 4QHUA 3S3PA 1XH3A 1URLA 4GBXB 2YPVL 4GMTL 2V2XA 4OLWL 3KHOA 1QPXA 1RSFA 1C7SA 3GJFA 4PGBB 4TVPE 4HKZA 3PWLA 4MWFA 4NRXB 5EWIH 4OLVL 2HTLC 4LCWE 4OI7A 2NR6C 4OV6F 3BPCB 4M5ZH 4Y4FC 4BZ1H 5LQBH 2EDBA 2YC1B 1FVEB 4X0KB 5IIEA 1MCQA 4JRXD 1P7QA 3ZKMC 43CAA 4U1SA 1SEQH 1RZGB 3G5XB 1NFIA 1KNOA 5GS2D 1V5JA 1GOHA 1AR2A 1CFQB 1A47A 3BRDA 3LB6C 3NTCL 3DURA 2FR4A 4U1NB 3IKKA 4N90E 3RAJH 2EEBA 4LLUA 1NCDH 2HFGH 4JO4L 3V0VB 4OD1H 4WGWB 3WV0A 2H45A 1JV5A 4XB8A 1XIWA 4HWZA 1NBZA 4N8VB 4WFGD 5E08H 2R2HB 3SY0A 4PGEA 5B38B 4MJIA 4R7DB 1S9KC 1P6AB 1MCHA 3SCMA 2GK2A 2XZQL 5CZXD 2R4RH 3X3GH 5D96B 1WJ3A 5D71L 4FQPA 3U7YL 2APVA 1KBGL 4LSQL 5TDNA 3EZ8A 2FWOA 5CD3B 2OZ4A 3VGDA 4Y5XC 2A74B 2NY4D 3OR7B 4IEFB 5IQ9B 3V6FB 2IANB 3VG0L 1H0DB 4HBCL 1OTUD 3JWDC 4IM8A 3KYNB 2V7HA 2BSRA 4JPVH 4OZFH 3C9NA 2VL5A 1E4JA 3OBAA 5B4MD 4MCYB 2BERA 5EU6A 1I4FA 3QRGL 2ZSVB 1EMTL 3V95A 5I8CB 1CTNA 3LKOA 4F7PB 4AEEA 1ZTXH 4P4KB 5EIQA 4YWGL 5D2LF 5INCA 1HIMH 3B9KA 2NTFA 3STZA 3ZSTA 2QQLH 1VERA 5GSVB 1IJ9A 1UWEH 4Z78A 1PSKH 4PTTA 1AHWA 2N7BA 5E94A 5GHWL 4LASH 2R1XA 5GS1B 4ORGA 4L3EE 3NPSC 1OW0C 2K3TA 1H3WM 4LAQL 1U93A 5EPMB 4APQC 3FONB 3KWWA 1JTOA 5HBBA 2PYEE 3RVVC 1KJ3L 5TE6H 4N0CC 1FO0B 1QYGH 2LABA 4LQ1A 5JHDB 4NQSA 3B2UC 4HPYL 1ULVA 4LCIH 5J11B 2WQRA 4MSWB 3P3YA 4HUNB 5F93C 4RMRA 4YHOL 3SGDH 2UUDH 5E0QA 4M43H 4HMDA 4WTZG 1BQLH 4R97C 2NMSA 5LGHH 1SM3L 5AZ2H 4HIHA 3O6FB 3W0WA 1DBAL 1OM3L 4EN3A 1PZUB 4GAYA 1IBGL 5LBSH 1RJYA 1IQWL 1UCTA 4NYLA 2R9HC 3LQAC 1QFUL 1CL7H 1RZJH 2HT3D 1NCBL 3KS0H 3K2MC 2I24N 4G9DA 3RKPA 4ODHL 3Q5OA 1L7IH 1T2QL 3EO1A 3IDNA 5GSRB 1T2JA 4P49A 1QLRB 1IGFL 5F7UA 2HRPH 1JPSL 1CFSA 3MRBA 4Y1AD 3TT1H 3LHPH 5F1NB 1UM5H 2BVOA 2IADA 5F9AC 1PZ5A 2HFFB 4LEOA 3F12B 2CRIA 1EO7A 1ONQB 4F15C 5D1QA 5BRZD 5I1IH 1CN4A 4OQTA 3V6BR 2CJUL 2YSSB 3C6SB 3WKMH 3T2PA 5ETUA 3HZVB 1EGJA 5H2BB 3MCLL 3ARBB 2F8VA 2VMFA 3MCG1 1FL6B 4OGAD 2XFXB 1WWBX 2CDFA 5SWSB 5DTFA 1IAKB 4K2UL 1HOCB 1T6WA 4R2GC 4ZFOA 1FFQA 5CD5D 2P8MA 2JJTC 3DHMA 3H3PH 2R8SL 3FTGB 4IOSD 5KSAD 3EW3B 4MA1B 4RFEB 4UOW1 1KCSH 1OLLA 5CINL 1J12A 5EZOL 4NNYB 4R3SA 3CZFB 3VGHA 1V7MH 3R1GH 4FTVA 5DS8B 2DIBA 4L4VD 2BNQD 1F3DH 1HHJB 5E5MA 1TQCC 2OQJB 5E9DA 2NW3A 4HKBA 3MLVL 1CFTB 5T5NF 3HRZB 1T0MA 3OJVC 2FEEI 2IEPA 4JO2L 1MUJB 1PYWB 4QXUH 3SGEH 2P5WE 3GSVB 4DQOH 2GQHA 2IAMD 3T0EB 3PP4H 4EDWL 5D72H 2CUMA 4OT1L 1QLEH 2JF1A 5EOTB 1KG0A 3SE4C 1Z3GL 3JWOC 4JY5L 2ICWJ 3B4NA 3O2VL 1LDPH 4Y4HC 3CXHK 1C5BL 5CJBA 4LHUD 1L0XA 1CFNA 3MV7E 3MRLB 2OJEB 1P2CA 1A6WH 1AQDA 2VDQL 1JWSA 2IH1B 3U9PL 2G75A 3LN9A 2GJZB 2B1HH 4ODUA 3SKOB 3V0VA 4HUXB 4WW1A 4Z7UE 4XCEB 4QRUB 2E9IA 1NFDE 5EN2B 3H0TB 4P57A 4QKXB 2R2HA 1LILA 3L3GB 2VIRA 4EZMA 1UENA 4DUWA 3REWA 5CFHA 2JELH 1F4YH 4GAGH 5JLZA 5E1HB 4MNHB 1M71B 5C07E 2DS4A 4LVHC 3QZWA 4M5ZL 1UG9A 4BUGA 4BZ1L 4F58H 1QFWM 2EYSB 2DICA 4UBDD 5C0EA 4MD4A 2AK1H 4KJYA 5GZOC 1JP5A 1SEQL 2JB6B 5DK2B 3LKPA 3HS0B 5FO9A 2A74A 3OR7A 4K7PX 4WWKD 5JOPD 3S7GA 3WL9B 3KYNA 2VOTA 2G9HA 3V9FA 4MCYA 1KELH 3RAJL 1GZPB 4WV1B 1NCDL 4Q6YA 3QCUH 2WAHA 2HFGL 3CFBA 1QSVA 4OD1L 1YEGH 3G6JF 4G9FE 1G7QB 4XAKE 5ACZB 2ZUUA 5E7FA 2R39A 5GGRA 5FF6A 3EDKA 5E08L 3DXAB 1ZKAA 3QWQB 4NN7C 1JF5A 1VFAA 1U6AL 3T4AB 2VUYA 5C2UB 2R4RL 1NGZB 4YPGB 3X3GL 2AK4E 1JHKH 3GNML 5KBNC 3L3OB 1GJIA 4X9GA 3RWFB 1R5WA 3FONA 2Z92A 5HPMB 1AGBA 4HHAB 3IU3B 4HS3B 1JNHB 1X4YA 1KJMB 1MCLA 5EC1B 1CLYL 1T5XB 2DB8A 1BIIB 1PAMA 4JGJA 1KN4H 2KQMA 4PY7B 3LKQB 1B4JH 5MENE 3RDTB 1Y0LB 4JPVL 1VDGA 4APQA 4MSWA 1A4KA 5EC2B 2VKXA 3ARXA 2BNRE 3BKJL 2VERN 3SDAB 5H35A 4D9LH 4FZEH 4M61B 4QOKD 1HIML 4UMGA 4J2XA 3LY6A 2QQLL 1UWEL 4LKXA 3ZKSD 4OUOA 2WLYA 4NQCD 4LASL 1E27A 1DSFH 5AUMA 2DYPB 3V5KB 3X17A 3QUXB 1T03H 1VKXB 3DETD 5E70A 4OFYA 1JPGB 4J3OC 5IR1B 4JFPA 5TE6L 1QYGL 3GBLA 1I3RB 4LCIL 1K9TA 2APXA 2DQEH 1UADC 4M93C 4U1KA 5HHME 1MJUH 4KAQH 3O41B 4LLMA 2AXHA 3TBYB 4CNIA 1S7SB 2EDNA 1XGRB 4M43L 5JORA 5HGBB 5D2LA 3KPOB 5HYJE 3HZMA 4M6MH 1BQLL 5LGHL 2YD6A 3I6LE 1ZXQA 2VLME 4YDJB 1P4LA 3BAEL 5DHVA 1ZT4A 2BSTB 3ARBA 1WTGT 1HHGB 3SO3B 5LBSL 4Z7UF 3C09C 1DE4B 2LFGA 4JB9H 3MRDA 4HKJB 4NQTA 1CL7L 1U8KB 1RZJL 1IAKA 2IPKB 3AFLA 2C1PB 3UAJC 5DSCB 2HTKD 1L7IL 2WBJD 2R2BA 1GSMA 2HRPL 3V0WH 2VISA 3RL1B 1X5XA 3LHPL 1UM5L 3CZFA 3X14A 1RK0B 2A6IB 1G7PB 2JJTA 2GTWA 2K1MA 5C0NC 5KS9B 1F13A 4NM8L 1FZMA 1CICC 3G6AA 3RKDC 5TF1H 2Q1EA 3TO2B 1CGSH 4GKNA 4HD9A 4UDUB 3WKML 1TQBC 4U6HB 1JYNA 2ICWB 1CIUA 4E0RB 3OB0H 4GJTB 5DJ0B 1U3HD 3MRQA 2F5BH 3QO0B 3P0VH 3KDMA 3VW3H 3RIFF 4BFEA 1MIMH 3QA3B 5F9WB 3MV8D 3SQOL 3LRSB 5C8JB 4LCWA 3H3PL 5D7JC 1OWWA 5MEQA 1IEAB 5HVWA 3OTTA 4DGYL 1KCSL 3CVHA 3IKCB 5C1MB 1KCVH 1CF8H 4KQ3H 3DYMA 4LPCA 1V7ML 4O4YH 3SDDC 1GGIL 4PJ7F 1OAQH 3D0LA 5DUPH 1GHFH 5MI0B 1CGXA 2QTEA 2OJEA 2W9LA 5CGYC 1DDHB 5F3HA 3SE4A 1IM9D 3BGFC 2GJZA 4NKQB 4Y4HA 1L6XA 3QULB 3DI3B 4MQXC 4P46D 1NFKA 2IG2H 4KTEH 4XNZC 2JIXA 2LU3A 4R96A 5EN2A 4P5KA 4KWUA 1H5BC 3WJJA 5LAXA 3ZT7A 4J6RH 3EJZD 4QXUL 3GO1L 5CCKH 3KPMB 2LE9A 1QHOA 1T1XB 3E6FA 3NH7H 3KYMB 3L3GA 5CSZB 2Q7YB 3MUY1 3DUSA 2DM2A 1NAMB 3UJIH 3UZEA 4DQOL 1D6VH 3FFCA 4J3TA 4MNHA 3BP7A 4M6NH 5D72L 1IKNC 1PJ9A 1RK1B 4P5TC 1F4WH 2G2RA 5K9QI 5C09B 4P23B 4X83A 1QLEL 3LQMA 3V7AG 4KK9D 1RJZB 1RZ8A 4OGYL 1LDPL 3JV4A 1EEQA 5HI3D 1G0XA 4HULB 2LVCA 2AEPH 1A6WL 1NJ9B 1CDUA 1YEFH 2UY7A 4GG8B 4LLQB 4M7JH 3LS4H 3P0YL 5JIHA 1CDGA 2D7MA 4WV1A 3GMNA 2W0FA 2XG5A 5LG1A 3RA7L 3GSQB 4JKWA 2H32H 3TPUA 2D03H 2OL3B 1MAML 1NGPH 2VZTA 3H9HA 3H9SB 5ACZA 4LDEB 2FSEB 1J8HA 1G7JA 4UNUA 3LQZB 3DUUB 2OR9H 2FATH 2NY2C 2PTTB 1F4YL 3D9AH 4GAGL 2ESVB 1MQKH 3T4AA 1KULA 4XP9H 1UJ3C 4F58L 4KRPD 1SY6H 3DSFH 4YUEL 1FZKB 4CAGA 1GGCH 3P73B 2AK1L 2Z4QB 3OG4B 4L3EA 2Z0BA 2BVPA 3UJJH 4GRMB 4PJ7B 1LGVA 2FEDD 4ENEC 3BP6A 3SHSA 5E8OA 1FNAA 1T5XA 1SBSH 4JN2A 2YMXH 4NKDB 2PYEA 4HIJB 5BVPH 3ZT6A 1I1AD 1KELL 4HUWA 3W39A 4PJ9D 4ZTOH 2VQUA 3QCUL 3C5JA 3RVTC 5DMKB 2Z93A 1S7RB 2CUHA 4I0PB 1YEGL 2H2SD 5JDSB 3MRJA 1QBBA 4D0BA 3EYSH 5DD0H 3I3DA 3M17A 4MS8D 4JY6B 1QR1B 1GGTA 4ODBD 4QHNA 5HI4D 3SE8H 2MSPA 2DI8A 5C0JB 1BOGA 4N0UB 1HXYA 2F58H 3TIDA 2L4OA 1ZA3A 5EFIA 1INQA 2VLLB 3IRZA 2DTMH 3QUXA 1K5NA 4Z0XA 2V5MA 4TSAH 3AXLA 4KY1H 1KN4L 3T0WA 1B4JL 4OLYH 3LN4A 4WW2B 2AJXH 4ZPVA 5I1LA 4MQSB 1HH6A 1JE6A 5KOVC 4GUPB 3G6JA 1CZ8H 3MJ8A 3UTTB 1S7SA 2XN9E 4D9LL 1KLUA 4HWEH 4FZEL 3TCLB 3FO1B 1R6VA 4UINH 4U6YB 3RHWK 4PLNC 3VXNA 3FRUA 5E1AA 1GCFA 4LL9A 4RFOH 1NBYB 4RGND 1JFQH 2ITCB 2DQTH 2FHCA 2BK8A 2P8PB 1DE4A 1WZMA 3UYPA 4HKJA 1MFEL 4CGTA 2DI7A 2R29H 1T03L 4DCQA 1FG2B 1MCKA 1S9XB 3FO9B 4F37K 3KG5A 2ARJB 1A7OH 1BJ1H 1I1YA 3X11A 5HHNA 1LO3L 2NY3C 3GSNH 1BZ9B 4PGDA 5KSBE 5D1ZC 1XCTA 3T4YB 3ILPB 4K9EC 4PRIE 1MJUL 4KAQL 2WLZA 2ED7A 3QI9C 2OSLA 3OXRA 4AL8H 3F62A 3PP3H 1DUYB 2CO6B 4DAGH 5ICXA 3RWDB 5IFJA 5D93B 1DBKH 1KPRB 2EDEA 4CVZB 5JW4M 4MNQE 3SQBA 4NFCA 3IDIB 4U31A 1CICA 1J0JA 2OMNA 5DJ0A 5BS0E 3MR9B 4JB9L 5KJRH 3RQ3A 3QO0A 3VWKD 2N1KA 4OSUH 3BGMB 1WEJH 2P5WA 4KUCD 5ADPL 4WU7A 2NY1C 5EBLB 3BN3B 5I30L 1DLHA 3ZL4H 3RZCD 2O5YH 3HNSH 2B20A 1FSKC 3QDME 4L3CB 3DNKA 4MGXA 5D7JA 3QNXA 3LN5A 1DDHA 2H41A 4M7ZC 3VRLE 1HE7A 3LPGA 3ARYA 3MV7A 5CILH 1FZJB 2Z31D 5TF1L 1K2DB 2YPLD 1CGSL 1NUFA 3MGOA 3QULA 1KIRB 4LLYA 4IOIA 4Z7UA 3K2UH 1NFDA 3KPMA 5CSZA 2VR9A 3KYMA 3F7VA 3GB7A 2F5BL 4OFVA 4R90H 3VW3L 4PRHD 4ZUVB 3MREA 1MIML 3FAWA 4P2RB 5C07A 1H5BA 4X5LA 1Z0MA 1KCVL 1XCQB 2VLKD 5JMOC 3H2WA 1CF8L 4KQ3L 3Q6GH 4W81A 3CXHJ 4O4YL 5FM4A 1OAQL 1JVKA 1T1YB 1GHFL 4P5TA 4JGUA 5SWQA 3HRPA 3UTPD 3OV6A 4GG8A 1O5DT 3ET9F 4WFEE 3ARUA 4GFTB 1P53A 4XNYL 2F53D 3QXDA 3MXWL 2YD8A 3VXRD 3L7EB 2IG2L 4KTEL 2OTWA 3H9SA 1D5ZB 2ZCLH 4J6RL 1VA9A 4G9FA 5CCKL 1V8HA 3LQZA 5E8NB 5IHUL 2IALA 1RZKL 3QDGD 1D6VL 5K9OA 3HZYB 2RAMA 4D3CH 4UILH 4X8JB 4M6NL 3QH3B 4K3GA 3MFGB 4WCYH 1F4WL 3D85D 2WWMD 5IVNA 2AK4A 1U8QA 1BQUA 3L3KA 1K4DA 4XXCC 3V4VH 4TULH 3PL6C 3EOAB 1HQ4A 3KPLB 4KKAC 1EIBA 1UJ3A 4YPJA 2AEPL 1YEFL 5IBLD 3ZHKA 3LS4L 2B2XL 3M1BB 4DGIH 4OCSH 3DMMC 3HE7C 4HMCA 2F8XC 1YMME 2D03L 3EOYG 5I1AB 3ARFD 1A1MA 4TQEH 2BNRA 3ARVA 5B39A 4DZBA 3L5HA 4OAWA 2FATL 4IRSC 4YHYC 3D9AL 3ZSSA 1EEZA 1MQKL 3O3EA 3VH8A 3U2SB 5DMIH 1X5HA 4BH7A 5ELIA 4J4PC 4XP9L 4FQHA 4BKLB 4LMQI 1SY6L 3DSFL 3QIUD 3KR3H 2BDNH 1GGCL 1VENA 5KN5B 5TGBB 2CLVA 3QUMA 5D7LB 2IGFH 1T1ZA 4XVUC 4YGVB 3UJJL 2XKNB 4JPWH 4TSBH 3VFUB 1SBSL 2YMXL 1TJHH 1ERNA 3EO0B 5BVPL 1EXUB 4YBHA 4Z77B 1ZHKB 1JF6A 4EQ2A 4CADA 1IGMH 4BQ9A 3MBEA 4ZTOL 1IAII 4Z5RB 5B21A 5GZND 4DOHE 4R6UA 4HUVB 4J8RA 2YN3A 5I66A 2PO6D 1B0RA 3EYSL 1WWAX 2D4DA 5DD0L 1LK2A 4MX7B 5HVHC 4HLJA 5HYJA 5ID1B 1U58A 4HK0B 3WFHB 3SE8L 1NDGB 2JLLA 3DX8B 4NKOA 5J3HD 2F58L 3W5NA 2W91A 4L8BA 2DTML 4YFLF 4KUZH 4TSAL 5JOFB 4XP1H 4CMHC 1K6QL 1TXKA 2NZ9D 3LKNB 4HX1A 4M1CD 3U7WH 1DVFC 3MROA 4OBRA 2FBOJ 2Y6SC 4UU9B 4OLYL 1BZ9A 2AJXL 2BY1A 4MA3B 4H1LB 2AGJH 4EBQH 2AJ3A 4ISVA 4NJAL 5MERB 3HAEA 3KNBB 4XPTH 4HDIB 4TYUA 4V1DB 3ULUD 4XNQA 4K8RH 4HWEL 2VC2H 3KYKH 1U8HB 5D1ZA 2H6PB 4UINL 1DZBA 1FJ1A 4XWGH 3OSKA 2OS7A 3U30C 4RFOL 1W0YT 9CGTA 3QI9A 3NPZB 1JFQL 1HEZA 2DQTL 3RVWD 4HUMB 3CSYB 5MP6H 2CR6A 3GMRB 5F6IC 4CN4A 3NCMA 5INDB 3VG9C 3VXSE 3BP5B 5LGJB 4OJFL 5IWLC 2XQYK 3MOBH 4W4NA 2Z8WC 1JWUB 5H37H 5TDOA 4Z95H 2HKFH 1VEPA 3VGFA 1TZGH 3UDWC 4RFNB 4XH2A 2I9LB 3BDBA 4X6DE 1P7QD 2J1KA 3QHFL 5GS0H 3CSPA 3FL7A 4RMSA 3V5DA 4AL8L 2KH2B 3D69B 3WMSA 1K2DA 3ZMRA 4DAGL 2WSKA 4AQ1B 4JFFB 4PJDE 5C0RH 4ZUSA 2J3SA 1ND0A 1DBKL 3B8SA 3RIAK 3D1MC 1LO2L 3ZZ1A 4P99A 2Z8RA 1CS6A 2KL6A 3ARRA 1R3KA 1OVZA 1E28B 2HG5B 1FDLL 5KJRL 1KT2B 1KXQE 1XIWD 4X4XB 4OSUL 4C56D 4P2YA 1WEJL 3V5HB 3C8KA 5T3ZD 4MJID 2EDLA 4QEGA 1OSZB 3FQXB 1DANU 1P9MA 3SCMD 5IROA 4UAOC 3BPOB 5E6ID 5C0CB 1FH5H 1XCQA 1HHKB 1BD2E 3HNSL 5ITBL 2BHZA 4G5ZH 2Q3ZA 3UTSB 4HC1A 3AS0A 4NC1E 4OQ1A 1GRWA 5CILL 4XVJH 5AEAA 3RU8H 3SDCC 3V4PH 4MA8H 4KROB 4ACPA 1JWMB 5JIIA 4LOUD 1RFDH 5FGBA 1D5ZA 3EFFB 4JM4H 4X9BA 5EU6D 5HDLA 3D5OF 3K2UL 5HY9A 5C6TH 3MODH 4MA7H 1ZOXA 3RWHA 5FGCE 1W8OA 5L88H 4DVRH 1TFHA 3BW9B 2J6EL 4R90L 3TN0B 1OF2B 1A7NH 2AERT 3C5SB 3U9UB 3LV3B 4B7IA 3B9KD 2OR8A 4KQ4H 1HSBB 1FPTL 4ODXB 3U4BH 3GSWA 3BPNC 1XF3A 1I7TB 1IGCL 4D8PB 4FA8A 1KLGA 3KPLA 3Q6GL 1EEUA 2V6HA 3O4LB 5C86A 1Q38A 4KTDH 2OK0H 4XXCA 3C08H 5A16A 1EJ6A 4JAMB 3GIVB 4EIZC 3MLWL 5GQBA 2AXGA 2ZCLL 5I74C 5CUSL 3S4SG 4NHCL 1BGXH 4PJEE 1I8LA 2VXVH 4RAHA 5TJWK 4ZO9A 5I75C 3KPRD 1RHHA 3HE7A 4O58H 3V0AC 4QTIH 4Y8DC 4D3CL 4YIQA 3SJVB 1U8MB 3TO4A 4ZMAT 3HPLB 2P5EB 3QFJB 2QHRH 4WCYL 3HG1B 3NFNB 3UTOA 3W0WD 1T7YA 3V4VL 4TULL 2IFGA 4EN3D 4IJ3B 1G84A 1YUHB 4IOFD 4MB3A 5T5FH 1J86A 1HHIA 5FM5O 5KW9H 5L6YL 3P9LB 2GJ6B 1EXUA 1DCLA 1ZHKA 4OCSL 1FIEA 4ODWA 4DGIL 2E7LA 2MKLC 4B0MM 5EO1B 4I8DA 4ETQA 2RQ8A 5GGUA 1MFDH 1DJSA 1EVTC 4JFQA 4TQEL 4X6DF 2XN9A 3WXWH 3MRRB 2XT1B 1XR9B 1EHXA 3QQ9D 1PVHA 1LEGB 4OCYH 5D1QD 1W0VA 4ELKB 1MWAA 2XY2A 1N8ZB 3E2HB 5DURD 5CBAA 4PJDF 4Y19D 3KR3L 5AD0B 3GSUB 5CP7A 2IGFL 1CK0L 4UIKH 4LSSH 2LTQB 5FV2A 4JPWL 4TSBL 3LKNA 3UMTA 1TJHL 4ODSL 4O51A 3PIQA 4D9RE 1KJVB 2NLJB 4UQ2A 3G9VA 1EO5A 3EDFA 1IGML 3DX9B 3STBA 1ZWIA 2GAZB 1FFPB 2VLRB 3BH9A 4PRIA 4OF3A 4CW1B 5IEHB 4UTBL 1DVFA 1JTTA 2A6DA 3BT2H 4QHKJ 1TIUA 3FB5B 4FTVD 2EYRA 1GIGH 4MAUH 4R8WH 4I5BB 4XGZA 1JYVA 1IGTB 4OZGE 2C4FU 5E9DD 4Q58C 2NY0D 4RDQG 2Q8BH 3VFRA 4L1DA 4YAQA 5D9SA 3G04B 4GBXD 4F57H 2FGWH 5DQJA 5LGJA 5BS0A 2DBJA 1A9EB 5GS1C 1SBBA 1KGCD 4XP1L 1K4CB 5F89B 2NXYC 4JO3H 1E6OH 4M3KB 4YHIA 3U7WL 3MRHA 3HCVA 4ERSL 1K8DB 4BFIA 1FFNB 2AGJL 3WJLA 4EBQL 4ZS7H 1YYMH 4LK4A 3BFOA 3LDBC 4XPTL 2GSGA 3B5TA 1KPVB 3FT4A 2OYPA 4DN4L 4K8RL 2VC2L 3QXUA 1LP9E 3KYKL 2X4UB 1QFPA 1I9IH 3UDWA 2CRMA 2HT4D 3QUZB 1V3LA 3BWAA 4JFFA 4XWGL 4HFUL 2EIDA 3ZKMD 4X4ZA 4HLZH 3U1SH 3P0GB 3MLUH 5KVDH 1QRNE 5DK0B 3DRQA 4KK6C 3W9EB 1FP5A 3ROLA 5MP6L 4EEEA 1MHCB 1ZA6A 4PJEF 1MH5A 3LB6D 3DBXA 3MOBL 4HV8B 3BPLB 5HYSA 4WHYH 1TCRA 1OSZA 3D25B 3BN9D 1TJGL 2HKFL 4KK5C 5HJ3B 5K9JH 1TDQA 3KS0J 4NC1C 1TZGL 5BV7L 4LSTH 4YK4C 4PLJC 3VXMB 4PRPE 2YD9A 3NFSH 2BHYA 3IGAB 1HHHB 2PETA 5DVKA 1OP5H 1UB5A 4Y2DA 3FOLA 5F21B 2GIYA 1JPFA 3GJFH 3IFLL 3QXVA 5IW1B 1W72A 3UTSA 5GS0L 1B0GA 3AU1A 2VLJB 4UQ3B 2IMNA 5FYLD 5C0RL 5IFHH 2W59A 4HGMA 3OX8B 1WISA 4XC1H 5DA0B 4WNQA 3BZEA 2X1OA 4KI1A 1IC1A 2BZDA 3TVMA 5IK3B 3SDCA 3BW9A 4E42B 5J8OA 1P84J 2IFFH 4P59H 3JZ7A 4HMEA 1UM6L 3KGRA 3NA4A 5DC9B 4U3CA 3OWEA 3OJDB 4KTYA 2W9EL 4ZDHB 2J12B 1FH5L 1AY1L 1S78C 1CFBA 3C6LC 5IG7A 2BHUA 1CGUA 3IFOB 5E56A 3TF7C 2XNAB 4AQOA 5DHYB 4JKLA 4U7SA 3O8XC 2WNGA 5EU3B 4HZAA 5T3ZH 3N1FC 1D5XB 4E5XA 4XVJL 1KEMH 3V4PL 4MA8L 2X4OB 4QWWD 2RFXB 1F3DJ 3MNVB 1RFDL 2W60B 1I3GH 1Q0YL 5KAQF 4JM4L 1YMMA 1DTUA 4OZFG 2P8LB 4YHNA 5C6TL 3MODL 2KBGA 4MA7L 1AD9A 5CIPA 2IF7A 1RJCA 3DWTA 1MQ8A 2JCCB 4WJ5A 4DVRL 5J89A 5L88L 2XACC 4LSPL 3TBSA 1A7NL 3S37H 1PX3A 3SJVA 1AGEB 1U8MA 4LPYA 5D6DC 5EO9B 3U4BL 4AENB 4EUPH 4LKCB 4NFBA 8CGTA 3Q1SH 5L2JB 1UEMA 3F7PC 1FAIH 3HA0A 3AAZA 4L8SC 2DBLH 4KTDL 4U2ZA 2OK0L 1INEH 3GMPB 3C08L 3LCYA 4G8FA 4RMUA 3MGTB 1YMHB 4ZYKB 2R1WB 3VXOB 4LVNC 3GSRB 2X4PA 3QXAA 1IE5A 2W1NA 1BGXL 1VFBA 4F3FB 3MRRA 2VXVL 1XR9A 3WNMA 1LEGA 5EIVA 4O58L 4XTRC 4QTIL 2AJVH 1WWCA 4RGOH 5DDHB 2QHRL 1CXKA 1W0WA 3N85H 4N0FA 4D9QD 5HI5C 2B1AH 3C60C 4IIQB 3ARBD 5J13C 4P9MH 4OZFB 2J88H 4XNXH 3SKMB 3P2TA 3U0TB 5T5FL 2VXTH 2IH3B 3CSBA 5SWSD 5L9DH 2FX7H 3B9DA 3WDIA 1T6VN 1YEIH 4M8QA 1FE8H 5FHAH 3SKJH 5JR1L 1FFPA 4LLAA 5I9QC 5IEHA 4RAUB 2CLZB 3O2WH 4NZRL 4R2GD 3JTTB 4P2CG 3WXWL 1OGAE 3L3JB 5C0AB 3CLEH 3LIZL 2XWBA 4OCYL 1ZLUK 2C1OA 4K3JH 5C0IA 3IETA 2DIAA 1FZOA 2ZCKH 4BSVB 3CFCH 4KGLA 1DQJA 4UIKL 4QF1B 3EOTH 4LFHD 4LSSL 3WFBH 3VXSA 1M1SA 2BCKA 2DWDA 1JGEA 4FOMA 1YZZA 4RIRA 4R7NB 1UXSA 1KB5L 4ZO6A 2R15A 5HHQB 1J10A 1KEGL 4BJLA 3OZ9H 1WIPA 3GMMB 5DYOB 1QQDA 4X9HA 4C59B 2PR4H 3LEVH 3L5WB 2DQIL 3UROR 4X6DA 5ID0B 1MCDA 5DJZA 2YUZA 5SV3A 1G6RH 3DECA 1GIGL 1T20B 4R8WL 3ME0A 2A1WH 2PXYB 2FJGA 4JFDE 5I76A 3N1GC 3K1KC 4U2YA 4PJDA 1JZ7A 5DJAB 5BZWB 3D6GA 4Y4HD 1A4JA 4N90D 1I7ZB 2FGWL 1OTSC 2DDQH 3EYFB 1DBBH 5C0BE 3TZVB 5MEOB 1PLGH 1A3LH 3L7FB 4JO3L 1E6OL 3LSOB 3D25A 4D2NA 4OIBA 3FFCD 5C08E 3KVQA 5DJ2B 1FNGB 3RGVC 1EEYB 3WFEH 2ITDA 3IJSA 3WNLA 3HE6C 3ZHLA 3CFJA 4P3CH 3RX7A 3RWJB 1YYML 1N2RB 1BD2A 4P5MB 4YHMH 3KYAA 4BQCA 3BWUC 2JTDA 2VL4A 1Q1JL 1FNHA 4UQ3A 1I9IL 1ZVSA 1QG3A 4XBGB 4KRLB 1UCBH 4GW4B 5SX5K 1FYTE 2C3XA 5KVDL 4B5EA 5FKPB 4LARH 3PWUA 1MAKA 5KTEH 1M05B 2X4SA 2FIKB 4IHOB 4DEPC 4XZUB 4O02H 4FFYH 3CUPB 1J8HD 3DXAD 5K59E 3PWPE 1YNLH 5SWZE 2E8YA 4BSWA 5F7EH 3W11C 3RBGA 2IBBA 5K9JL 1NC4B 4LSTL 3FCTA 3NFSL 4R4ND 5FIEA 3UPRA 1DBJH 4N0YH 1OARH 1R3JA 4X4ME 3DROA 5HVGB 4L3ED 3B6SA 3QEGH 1I1RA 1JYXA 3HFMH 4W70A 3C6LA 1UYWH 4QHLB 2F54E 2PYED 1CDBA 3TEUA 3RDTD 4XC1L 1OY3B 3QP3A 3O8XA 2WUCH 2PW1B 2AJSH 4PJEA 2X05A 2P44B 4NQDE 3SDAD 2IFFL 3R06A 2WINA 4P59L 4KXZI 1XF2B 1U42A 3S3SA 4LEXL 5JDJA 2VE6B 3FB8A 4WFHD 5IMOA 5DJYB 2VZ3A 3JWDH 1NKOA 2PN5A 1S7TB 3QUXD 3EYVA 1PKQB 1KEML 5MI0C 3DX6A 3MGTA 1YMHA 1H3UA 3DV4B 2R1WA 4L8SA 1I3GL 2XQBH 3MLPA 2FYYB 4F3FA 4PR5A 1MSPA 4NUJB 3VI3E 5DJDB 3S37L 1CGYA 4NN6B 5HPOA 3SDXB 5F8QC 4ZFFA 3GBNL 5FDWA 3OKKB 4G42B 4Y5VB 3Q1SL 1A64A 3NOIA 1FAIL 2NX5E 1JZ8A 4JG0H 4JRXB 2X70B 1A6ZA 2DBLL 2FX9H 2XKUA 5HDBF 1INEL 3C60A 5T1LA 4CN6A 1D6EB 3TGXA 4OB5H 2NQCA 5DK3A 4DJMA 4K23H 3CCHB 3I02B 4FXGA 4PREB 4LIQH 3VXTB 1FFRA 3OJMB 3TBWA 3TJHC 3HLAB 5B22A 5IOPA 5AAWA 2H2PD 2FHBA 4RGOL 5KVEH 3WN5C 4DVBA 3WHXA 3LQAH 3N85L 4K3HA 2B1AL 1JZ2A 1F4XH 5C0ND 5ISZE 2DKUA 2NY6D 3S8WA 3SE3A 1IT9H 2EH8H 2J88L 4XNXL 2VXTL 1PBYA 2GITB 3O6LH 3Q3GB 5L9DL 2FX7L 4Q2ZB 1UT9A 4R7NA 2ZOKB 5EZJA 5K59F 5L2KA 3UYRH 1FE8L 4UT6H 4XI5C 5FHAL 3SKJL 2GSIA 1OAKH 5IB1B 3S5LG 2WP3O 3VXUE 5A1AA 3GSXA 1T4KA 4I18C 2DQHH 4MNGE 2AV1B 3RNKA 1IRAY 3FO2B 2ZSWA 3O2WL 4JN1L 1FVDA 1RD6A 1I9EA 5D7JD 5F6HI 3CLEL 1N6QH 4LNVA 2Q86A 4K3JL 5A40E 1MHEB 3EJYD 4MLSA 2BOCA 1I7RB 2XTJE 2XWTA 5DJCA 4F33A 1F11A 2ZCKL 1AP2A 3GI9H 1LQSR 1QRNA 1I7ZA 5HYQA 3CFCL 4X4YA 3EYFA 3EOTL 2W38A 5CGYD 5DZOA 3WFBL 1YNTA 2E6PA 5C92A 4IMLB 5CAYB 5DJ2A 1A6TA 4MQXD 2IBGA 2FECI 3G08B 4LCUB 5ALBL 5JO5B 3NBNA 4O2FA 2PCPA 1R3HA 4CVXB 4P23D 4WW2C 4PRPA 1NMAH 2PR4L 3LEVL 4KI5E 2E8ZA 4U7MA 3MNWB 3LKSB 2RIKA 3RGVA 2PW2A 4TVPH 5C7XH 1G6RL 4ZFOL 2DQGH 3KLHD 2A1WL 4P5TD 4XPFH 4EXPX 1IM3B 1BVKA 3O3AA 1F58H 5FKPA 1GC1C 4YBQC 3S5LB 4WI2A 3OKDA 2YK1H 4H25B 1T1WB 2YWZA 2DDQL 4QHMA 1JMZA 5IVXE 5IMKB 2DQUH 3H9SD 4AY0A 3PJSB 3U7AA 5E2TH 3CUPA 3BXNB 1PLGL 2VSDA 4G9FD 1A3LL 3IRPX 4YXLH 4MD5A 3O9WB 4KJWD 5KSUB 3VI3F 3F7RA 3JWOH 3WFEL 4PRNB 5DUBA 4UV4H 5IB5B 4P3CL 4TRPH 1SJEB 4YHML 4Y1AB 1BJ1J 5DQ9A 1GOFA 4NBZB 4L9LB 3IFPB 5D5MF 5DEFB 3TIEA 4J1UB 2G60H 1UCBL 5JZ7D 1GL4B 3TPKA 5HHOE 3RVUC 3PGCA 2WIIB 2XA3A 3QPXH 4YXHL 4NWUH 3GIZH 4LARL 3D2UA 5KTEL 4V1DE 4ENED 2VABA 3ZE0F 2E27L 3WEXB 3KPPA 4O02L 3C2SA 4FFYL 2BNRD 2J5LC 2ZOLA 1QSEE 1YNLL 1H3TA 1ZT7B 3HPJB 5F7EL 4WVRA 1RAMA 2Q6WA 1JYWA 2FBJL 4ZXBB 3WLBB 3UCRA 4Z7WF 4ESKA 1HH9A 1T2XA 5KSAB 4X6BB 1DBJL 1RZKC 1Q9LA 4XPBH 1NH6A 4FQXC 4Y8AA 4DK3A 3QEGL 5IJKC 3HFML 1OPGH 3F8UB 5J6GA 4L4VB 1UYWL 3PQYB 1HQRA 2BNQB 4WI9A 3ARDB 3I84A 4W68A 1EO8L 3WNNA 5J6HB 5DRZB 4YGAB 2FYYA 2Q20A 3MBED 3Q2CA 4BFBD 1J18A 2AJSL 3VXQA 3O3BB 1AR1C 4KV5E 4TSCH 3O6ML 5T3XD 4BH8B 5HYJD 3W9DA 4J3SA 2FD6H 2IAMB 3TESA 3I6LD 1MLBA 3BX7C 3MOAH 4KZEH 5D6CB 4GRWH 3U79A 1IGJA 2X70A 3VFWA 3JWDL 5H94B 3S35H 1S3KH 2W0KA 5D5MB 5F44A 3I75B 2OJZH 3D18A 2OMBA 3F65A 1G0DA 2CLRB 4AH2B 2XQBL 1UWXH 1IEBB 2RBLA 1I8MA 5K9KB 3FB6A 2FX8H 1ES0A 3B5HA 5DD1H 4JG1H 3S36H 4Q0XH 1OGAA 1UZ6E 5CEZE 4D0DA 2QSCL 1CLOH 3BH8B 1KSRA 3CMGA 3QNYB 5D1ZD 1T7WA 3MSPA 1R5IA 2IPUG 3RY4A 1J0KA 4Z7WB 4NQEE 3L95B 4QT5A 3D3VA 1EZVY 5FB8B 5I18H 2V9QA 4HIIB 4JG0L 4NOFA 3A6BH 3WN5A 2FX9L 4V2BA 1UACH 2ED8A 4XNMB 3NA9H 4C4KO 4OB5L 5FOJA 2HRLA 4K23L 1U8LB 1FV1B 8FABB 3IDYC 4LIQL 5E6YA 4HJ0C 1IAOA 4KMQA 3MV9E 2NY1D 3WS6A 3AVEA 4I18A 1VACA 1GH7A 1QVOA 5KVEL 3ZLQC 5I8EB 1P5UA 2Q8AH 4JHWH 1CU4L 3LQAL 3VRJA 4I2XB 5GRJL 3QWOB 1F4XL 5I2IA 3TNMB 1Z2KA 5C0BA 1IT9L 2EH8L 2R23B 2K7QA 4LLDB 5IHZA 1XF4B 3O6LL 1RUPH 4P48A 3Q6FB 4KI5C 1SJHB 4YNYA 3UYRL 3HUJF 5C08A 1OAKL 3ORJA 5CS7A 1EBPA 1WC7A 3PDOA 3CU1A 2DQHL 4F2MA 4MD0B 4OFKA 1S9YB 3LKSA 3BUYA 5EZLB 1UXWB 1XGQB 2ATPB 1A02N 4OUUB 1AGDB 4XMLL 1N6QL 3L5XH 3PV7A 3PDDA 3P4MB 1C5DA 4JZNB 4YC2B 4JFXB 1FYTA 4QOKB 3MLZH 3GI9L 2NXZB 1ZLWH 4HFWB 2VQ1B 4RAVA 1MREH 3I9GH 5HDOA 3D39E 4XPGH 5IMKA 3NCFB 3GSNB 3RWGB 4KZDH 4X5WA 3ARPA 3C87A 1HDMB 5SWZA 2GYSA 4M9OA 4PRNA 4JFHD 1A3QA 2AJUH 4RBPK 1ZEAH 3QEUB 4X7TB 5FA4A 2XZAH 1EH9A 2MWCA 3OGCA 1NMAL 4X98B 4UIMA 4MJ6A 4E41E 4X4MA 3MA7B 4TVPL 5IF0B 2FJFB 1HKLH 1VGKB 1MNUL 4LCCA 2XRAH 4XPFL 1WQVT 1LEIB 2F54A 1F58L 1XR8A 4UUJB 5AYUH 1YY8B 3DTXA 2VN7A 4KKAD 2YK1L 4KHTH 1AJ7H 1M7IB 2Z35A 1J0ZA 2D31B 2DQUL 2X1PA 3KPQB 2O26U 5E2TL 2Y36H 1F6AB 5DGRA 5IV2B 4NQDA 4A6YH 4U1GC 2I07B 1UZ6F 4NZJA 3JWOL 3HE7D 3IF1A 5ESQA 3WLBA 2VKWA 4UV4L 1UA6H 3TO4D 2WBJB 2XTLA 4Y4KC 5BCAA 1AXTH 4TRPL 1A2YA 1HI6B 2AW2A 3IJYB 3SGJC 2HLFD 3QQ4B 2YBRB 4QCIB 1HWGB 2EXWC 2G60L 4X6CE 3SO5A 1BX2B 5F7WC 1SVCP 3PQYA 3ARDA 1A1NA 3MRGA 3K4DA 1DQQB 4FQXA 4HAFA 4NWUL 3G5ZB 3GIZL 5IJKA 2GFBA 3R8QA 2R4SH 3QG7H 1OCWH 3GK8L 2C7UA 1F8TH 3G5YA 2XN9D 3EHBC 4XXDB 5DT1H 4ELMF 1FCGA 1U3HB 1DQTA 3BUTA 3MLSH 5HDQH 4D0CA 3ULVL 3MV8B 4XP4H 3QEQE 2Y07L 3TBTB 5F1KC 3AB0B 5D6CA 2NX5A 2Y72A 1SQ2N 5IHBA 4XPBL 5DR5H 3B9AA 5CEXB 5D5MA 5BXFB 3MGAA 3K4AA 1OPGL 4JDTL 2H32A 1YYLH 3C5ZA 4JEGB 4YX2H 1XZ0B 1U95A 3HR5A 3CU7A 5E5UB 1UVQB 2EYTB 1BQHG 2FO4B 2VITB 4HKXB 5HGDA 1IM9B 1G7MA 3KPSA 4HT1L 4KROC 4L4TE 5D4QA 3QUMH 4NDMB 5I1CH 4PRID 4P46B 4KHXH 5EDXA 2VLJE 2B8OT 4PJFE 2CIKB 3NZHH 2OTUA 2V7NB 1I1FA 3QNYA 3WLWD 4Z8FH 3OPZH 3QFDA 4Z7WA 3V52H 3FT3B 4HZLA 2ATKB 5D1XB 3MOAL 3RTQC 4KZEL 2XI9A 4WI4A 4NRYA 3CH1A 1OTTD 5ISZA 4CU6A 5GGSB 2JK5B 1OB1A 3S35L 1S3KL 2JB5L 2WP3T 2O61B 2EZ0D 3VJ6A 4Z7VB 5F7DB 2XICA 1T66C 4N9GB 1I8KA 2QR0A 2OJZL 3UZVB 3VXUA 3E0GA 4MXWH 2BNUA 2BC4B 5D7KE 4L5FH 4MNGA 5IW6B 1RI8A 1A14H 2FX8L 5DD1L 3AUVA 1BPVA 1I7UB 2MOVA 2QQNH 4ZFZB 5GGSY 3RWCB 3S36L 4Q0XL 4FFVC 3OKMB 4PTUA 1CLOL 6FABH 2N4IA 3T77B 1V3JA 4JFFD 3HI5H 3WFDH 5ITFA 3TWCH 1BQHB 1TTFA 3CK0H 2C3VB 3PHOB 3MJ7B 4JY4A 3A6BL 2I26N 3WIHH 1ZGLP 3AM8C 4K9EH 1UACL 3NA9L 2X4RB 3V7MA 1HILA 1FGNH 4MAYA 1KPUB 3FQTA 4JFEB 1YN7A 5H37G 3SN6N 1CD0A 5EZLA 1IL1B 2PYFB 5EU7E 2BP3A 2VXSH 1QBMH 4Y2DD 5TH2B 3UTSD 5K9QG 3VDAA 5DRWA 2M1KA 3S37X 3VXPB 4OKVA 1BFSA 3O6KH 2C26A 4JHWL 5B8CC 4WFED 3RP1A 4U33A 3CC5B 3IXTB 3GGWB 1RZFH 3ECBA 3IDGA 3BEWB 3TVMD 1NLBH 5J1TC 1RUPL 3NCBB 4IRJA 3SDCD 5C9JB 4LPVA 4OF7A 2X7LA 1S8DA 5J0BA 1A22B 4HQQH 5HHVL 5DGQA 4ZSOB 1MF2H 2EEDA 3H9YA 4X98A 1CG9B 4JFOB 3MUGA 4GLRH 4NRZA 1HSAB 5GXBB 4X6FA 1BZ7A 2FJFA 5T1DH 4FQCH 1B6DA 5ANMB 1WAAF 3L5XL 4OI9A 4GAJL 2VDLH 5BV7C 5HHOA 4WEMB 3MLZL 1C08A 1FL5A 1JMXA 2P4AB 4OD2A 2FH8A 1R0AH 4QRTB 3NVQA 4JLRB 3JVGC 1MREL 3I9GL 2D31A 4XPGL 1RY7B 3FJTA 3DIFA 3KPQA 1YMMD 4RGNB 4M5YH 2YD4A 1TENA 5CEYB 1OD7A 1X44A 3HC4H 4PJFF 4I48B 1VFUA 1SYSB 1QSEA 4LLVB 5EO0A 3HUJA 4GW1B 1KIQB 2AJUL 2KUTA 1ZEAL 3EOBA 5DFWH 3SJVD 5IESH 3VFOA 1WCBB 3VCLA 3HG1D 2XZAL 1XGPB 1NC2B 1TZHA 1MVUB 2XXMB 1MRFL 1HI6A 3UTZB 4QO1A 1MI5E 1NEZG 1S7UA 1KIPB 4Y5YB 3QQ4A 1NCUA 2ED9A 5HGHA 2HT2C 2XRAL 4Y4KA 3NIDF 1NANH 1BREA 5D2NE 2AEQH 3NCJH 3QUYC 4EI6A 3A67H 2J6EA 4OGXH 5AYUL 4C83B 1AD0B 4KHTL 4FNLH 1DP0A 1AJ7L 32C2A 4FABH 4JDZA 1XGYH 4XC3H 1BOYA 1T83C 3L5JA 4U0RC 2GT9B 2Y36L 4JPIA 1S7VA 4A6YL 3MNZB 3RUGE 4S1DC 1YY9C 2XY1A 3PWNA 3MZTA 1L4IA 3M07A 1Q0XL 1UA6L 1NCCH 4NO5B 5IBTH 1GGYA 3VA2C 1RIVH 2VAAB 1AXTL 4U3XA 5C0DB 1U91A 3QJFA 3RZCB 4YR6B 3VI4E 3O3DB 1C1EH 5I8OH 1F6LL 1F3JB 2X42A 4JM2F 3FRPG 3H6JA 1EK3A 2Z91B 2A9NL 2DKSA 3NCEB 4Q6IC 3P4NB 2Z31B 2BMKA 1YEDB 2VDKH 4JRYE 4HEPG 4ZAKC 3FN0H 2VH5L 1YEHH 2R4SL 3MRMA 3CFKA 1T89C 3G5VB 3QG7L 1OCWL 2EDXA 3MLRH 1ZGLA 1NEZB 3FQUB 2ADJB 1BBJB 2EDYA 5DT1L 3REVA 4U1LA 4GH7B 5HDQL 4PRHB 3FT3A 2C3GA 4XP4L 5BOZG 4QGYA 2HN7B 4G6JH 5LKNA 3MMEA 2VLKB 2CGRH 2A0LC 5DR5L 4C4KT 2O61A 1YEEH 1YYLL 5D7IE 3VE0A 3VXSD 1MWAH 4N9GA 4YX2L 5FYKE 3RTQA 3NIGE 1DR9A 3QNZA 1YQVH 3VRIA 1T7ZA 3QUML 5LXGH 4Q97A 2F53B 3P4OA 1HKFA 3LKRA 3CX5J 2EDTA 4WEUD 1OL0A 5I1CL 2EIBA 5ERWB 3VXRB 4PRBB 4ZFZA 3C2AH 4JDVA 4RGMC 3MV9A 3NZHL 1AGCB 4ELMA 4F8QA 3VFSA 2UZXB 3RHWF 4CUCA 3QUZD 3T77A 4Z8FL 3P77A 3N50A 5F7LB 4YDVB 3V52L 3BEVB 3D85B 4PRAB 1FFOA 3F5WB 4M8VA 2UZIH 3QIBC 2QJDA 5JIPA 3QB7C 1I8IB 5EU7C 1X7QA</