5DJCB

Fc heterodimer design 8.1 l368v/y407a + t366v/k409f
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
207
structure length
206
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLVCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSFLTVDKSRWQQNVFSCSVMHEALHNAYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 206
sequence length 207
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djcB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djcB01
4L5FL 1Y6KR 2R1XA 4YH6A 3QT2A 3GEWB 1LGVA 2QKIA 1J10A 1DSFH 1RJZA 1EEZB 3RPIA 1A7PL 3BYTA 4OB5L 1XR8A 4M7KL 4M4PA 5JHDD 4Y16C 5KSBE 2GFBB 5C0AD 1KXTB 1QBMH 4R8WL 3REWA 1T89C 4JE4B 1KLGA 3ARBA 4YDLB 3UJIL 1HI6A 3L3OA 3VXTB 3IETB 1IKFH 4CVZA 1EDQA 2BY2A 2FHCA 1U41A 4OZIF 5CP7A 4GBXC 5CSGA 1A7QL 1NLBL 2E9BA 3WUWA 3SE4C 4R96B 3WS3A 2IAMB 4X99B 1SHMA 2ZG1A 1T80A 4L3ED 4OCLC 1XAUA 4GAGH 5ISZD 2ED9A 2PR4H 5D93B 4ODUA 1CS6A 3V0VB 5CJQH 5L2KB 5LVEA 3JWOC 4JFZL 5FYLD 2AV7A 1EUUA 1X7QB 5HGBA 2CDFB 1EH9A 1H9VA 4LIQE 4PP2B 2F9BT 3VFNA 4D9LL 2VUYA 4PV9B 4X7CC 5H37G 4JQIL 5E6IC 4AIXA 2NX5B 2VE6A 3VMNA 4UT6H 2BNUA 1MJ8L 2DQHH 4JO3H 4NP4H 3SDCC 1OM3L 4JG0H 5D2NE 2D7PA 1QSEB 4RWHA 4MJ6A 4FMFA 1U91A 1K6QH 1K8IA 3C09C 4PJXE 2Q7YA 2V5MA 5HPMB 4PRAA 3VFTB 2OJEB 1NGWA 3VI3F 4GRWB 1ONQA 1I3RA 1G7IB 4ZSOB 1TJHL 5D4QA 1UH2A 2OR9L 1U8MB 3BISA 2H2PC 2W0LA 3ZE2E 4OCMC 2BSSB 3ULSB 15C8H 5TDOA 1WISA 2F8XC 4IOSD 3QJFA 3IKCA 2D7OA 1BQHB 3ZKMD 2W1NA 5KVFL 3U82B 3AREB 3TIDA 3DSFL 1KGCE 1BZ9A 4PJGB 4KDVA 2GYSA 4PJ8B 4PB9H 1NKRA 3K2MC 5E5MA 4ZPVA 3QPXL 4Z9KB 4X9GA 1KNOB 2Z35A 1OAYH 3G9VA 4YHPA 2A74B 5F9WB 3MJ9H 4JFOA 2QHRH 3GRWH 3I6GA 4ZXBA 4YBQD 4NKIH 3LN9A 4PJAE 4EDXB 5IG7A 2OJZH 3V8CA 3U2SB 3P0GB 1B3JA 1E4KC 3TBSB 3NTCH 2MSPA 1BX2A 3KS0H 2W9EL 2VXUL 3CNKA 2MPAL 2FR4B 3C8KB 4G80B 3MJ6A 5EU6A 3EDFA 4FFWC 4MVBC 3C9NB 2PTTB 4O4YL 3EYUH 1J88A 4P3DA 2CIIA 4OIBA 4JKLA 3R06B 2Q86A 4I3SH 5TDPA 4FQIL 1X5LA 3R1GH 4HHAB 4OM0H 2R29L 4HMDA 4LCUB 5GISL 3Q2CA 3NZ8A 3FFDB 4IJ3C 5FHAL 1TVBB 5D7LD 1X44A 4G8FB 2A6KB 5KAQG 2H1PH 5I8KH 4MMZC 3OG4B 4P46D 5CD3B 1EEYA 1WGOA 4L9LC 3MFFB 3Q3GB 5DF0A 2UY6A 1G9NL 2X70B 4GMSH 3FQNB 3DMMB 1JV5B 2OXHA 4G7VH 3RA7H 4P49A 1G7HB 5IFJA 3MNZA 4JQXC 3SDDC 3NCMA 1MIEH 3KPSE 4HV8B 1CGTA 3ARYA 2YRPA 2J7LA 2DM3A 2RFXB 2B20A 4MLIA 3ARDD 3AMLA 3PABB 4DN4H 2AV1B 3UEZA 1RUKL 1CFNA 2RBLA 3ULUH 4UV4H 1ORSB 3C5SA 1HH9A 4NO5B 1LO0H 4GKNB 2BSTB 2PXYA 2ZSVB 4JHZA 3FHAA 2B4CH 4R7DB 3NABL 5E1HB 1F58H 3OXSB 2A83B 1JUFB 5C3LD 2AJUH 2XTJD 3LKQB 1FPTL 2DQTL 1BPVA 1ES0A 1UKQA 2BCKA 1EXUB 3IDGB 1RIUH 1AO7E 1CIDA 5J6HB 2VIRA 2AERT 4HZLB 4X98B 3BP5A 1JJUA 2ADIB 1S5IL 1EO8H 2BK8A 4JY6B 4PP1C 1ZLUK 2EYRB 2IF7A 3RWDA 1UT9A 2AK4D 1KJ3L 1QFPA 2AABH 4YGVA 3E6HB 3IJYA 4ZQKB 4BUHA 1WEJH 3BQUB 3MRIA 4AT6B 4YC2B 3QEHA 3M17B 4KJQC 1QLFA 4DKAA 2YPVL 1NMCB 5FKPB 3H0TA 5IT2L 1MQKH 3S37L 3QNYB 1BD2B 1DL7L 1AXTL 3BH8A 5IP4A 3V4VH 2EC8A 5B38B 5E08H 2L4OA 4LCCB 4X5WA 2P8MB 2WUBH 2CKBB 1CU4H 4O51A 1A7NH 1JNHA 3W39A 1YEKL 4HK3N 5LQBH 5B21A 2Y4SA 1YPZB 3IFOB 4N9GB 2OTWA 3QR2A 2F74B 4NKOA 4XMLL 1JYNA 1KF9B 3ECBB 5EU7C 3T2QA 1A21A 4NZRL 1TNNA 3DURB 4PGBA 3LQZA 3PIQA 4HS8H 3WDIA 4H1LB 4APQB 1A14L 3BWUC 2H32H 4NNYB 2WLYA 5JW5A 3EKCA 4RGOL 3BDYH 3V5DA 1JHTB 1QHOA 2DLTA 4L8BA 4J3XA 3DVFA 1J12A 2NTFA 2R4SL 4LEXH 3RHWF 4D0BA 3HZVA 1HHGB 3DUUA 2Z8SA 4IIQB 3I2CH 4U1GB 3MA9L 4GRMB 3DXAA 2X40A 5A2FA 2WMPA 2DQGH 4QGTA 3SE8L 4AL8L 5LGJB 1INEL 1JRHL 1MJUH 4KKCD 5L7XH 4K23H 1MHEA 3DRQB 3PQYE 4G9FD 3WSQL 4HWBH 4I0PC 2DD8H 3OTTA 3QUKB 1J0ZA 4QRSB 4JRXD 1T0PB 2I9TA 1JZ6A 4G8EB 3HLAB 3V4UL 3PP4H 1AD9A 2VRAA 2J5LB 3UTZB 5FYLL 1RURL 1I1YB 2CPCA 4HPYL 2ICWA 3OBAA 2G75A 3ZDYE 4CL7A 4S0SD 5JQHC 4K7PX 2DS4A 3O11B 1BFOA 5AWNH 4FQCH 4GXVL 2LVCA 4WIQA 5GHWH 4WFEE 5E99L 3VI4E 2DMBA 1ZEAH 4OZFG 2MQCA 3RTQB 3DO3A 2OMNA 4M43L 4Z7VF 4Y16D 5FA4A 1P53A 5TQ0L 4HT1L 5E8EA 3UP1A 1QFWM 2Z91A 3G6JF 4HDIB 4OTXL 2UVEA 1T7XA 2EYTB 2D7QA 5D8JH 1DN0B 1MNUH 3RU8H 4OKVA 4TUJB 2P5EB 3SDAB 3CZFA 4F9PC 5LJYH 1QRNB 4K8RH 2CUMA 5T3ZH 4XPHL 1IE5A 2P24B 1MCKA 4N8VG 3L95B 2BVQB 1VACA 3ZDZE 5IHUH 3CU7A 1F4HA 3RX5A 1KBGL 5KS9F 1PQZB 4QO1A 4XBPA 2BHUA 4RQQB 3HG1E 1CICC 4S2SA 2QSTA 4HLZH 3GUTA 5C2BH 4U1MB 2BC4B 1NGXB 4XWGH 3ROOA 3W2DL 1OPGL 1LE9A 5DYOB 3LKNA 3AY4A 4ZUTA 5E6ID 1XGYL 1IC5H 1Q0YL 1IGMH 2UY7A 4LAQL 4ODXB 2J2ZA 5KBNC 3SDCD 1Q1JL 3V5KB 4Y5VC 4NQCB 3PWPA 3A6BH 2DTMH 3VFGL 3GMOA 3MRKB 3MLXH 5I73B 4LSSH 2WINA 3D2UA 3KJ6H 3UDWA 1A6WL 1EVUA 3EYVB 5AD0B 4YHIA 1FN4B 4LMQE 4OLVL 3CXDL 2XKNB 4M6AA 3WS6C 1LQSR 5C6TH 4IDLA 1ZOXA 4F37K 4OGYL 3HC3L 2VTFA 4C54A 2FX8H 1M71A 2GTZB 1CQKA 1T1ZB 2H2PD 4DFIA 2EH8L 1U3YA 4A2LA 3KJ4C 1Q72L 5DJ6B 1WFTA 2GAZB 3GB7A 4RGNC 1IEBB 3KYAA 2Q76A 4RNRB 4HF5H 1UB6A 5DJ0B 3MJ8B 5J4MA 1TJGL 1WZKA 5IROC 5ANMB 3HE6A 2CK0H 1MFBL 2L0DA 1GL4B 2AJZB 4OQTH 3MGTA 2DJUA 2OR7A 2VN7A 1U2CA 1ZGLA 3HZMB 2D9CA 4NHCL 4FXGA 4Y4FB 3GJEB 5HJ3A 2ZJSH 4B41A 2ADGA 3MRRA 4BJLA 1TZIB 2ZUSA 1TQBC 3CSGA 5HHVH 4U6VL 4ZPTA 2DYPB 5HGHB 5DQDL 1JI1A 5F1IB 4X7TB 5I9QB 5E4EB 5E8NB 3S4SA 1W8OA 3H7BA 3MRBA 4JHWH 5IV2B 1GJIA 5A2KH 5EZJB 3MSPA 1G1CA 3IFPB 1ZLSL 4Q9QL 1YECH 2W9DH 4J8RB 3B9DA 3NAAL 2VZTA 1HOCA 1VESA 2WBJB 3GBLA 4LSDA 3CMOL 4FFWD 4MVBD 4OLWH 3IDJB 1D5ZA 4MA3A 1I9EA 3OHXA 5T1MA 2EEAA 2VJXA 1T1WB 4MA8H 4I9WD 3BKJL 4XP9H 4XVUC 2XWTB 2R2BB 3RUGB 4B7LA 4DGIL 1C5BL 2PF6A 4U1NB 5BV7C 4Z0BH 5HHXL 5CEYA 3HCVA 4BM7A 2VISB 4LEOB 4R97C 4NQED 2XKUA 3MLZL 2GK0A 3MYZA 3WD5H 4YBLB 4XH2B 2WANA 2IH1B 4WGVB 2V2WB 4R90L 5DJAB 3BJ91 1OP5H 1CTOA 4ZOAA 2O61A 5JUEL 3MUZ1 2PW1B 4MJ4A 4RFNB 2A9ML 4DOHB 5KG9B 2PO6C 5MEOB 1UEMA 3OR6B 3DIFA 5L0QB 1MF2L 4D94A 1PKQB 1HKLL 1J8HA 4TQEL 4XRCB 5J1AB 1T5XB 1A4JA 2P5WB 1UQSB 4WDIB 3SDDD 1KLFA 1F90L 1MAKA 3P0VL 5ILTH 2XFXA 3ULVC 4JCMA 2ZCKL 3HC4L 3MLYL 3H3PL 1DQQB 1BVLA 4HXAH 3GSUA 5F7EL 3O6ML 3WL9B 3INUL 1HXMB 4DZ8A 4RBPH 1R5VB 3JBG7 5EOQL 4KUCD 4M7LH 4UILL 3WFHB 3DXAE 3QUYA 1ORQB 4KROC 1FO0H 1VFAB 4EIGB 1RHHA 2B2XL 2PYFB 3RUGF 3NCBB 1U8HA 2YBRA 2GT9B 1N5YH 3OKNB 3KYOA 5E95B 4I8DA 2IMNA 3G5VB 4OZGF 4XNMB 3JZ7A 4MXQC 5GGVL 3W0WA 4F3FA 3O3DA 1GZPB 1XR9B 3NFSH 1TMCB 4NCC2 3EYFB 1XGUB 3X3FL 3OR7A 5C0FA 4NQSA 4OCXH 2IQAA 3GSOA 4EN3D 3LPWA 3RQ3A 4A2MA 1JYVA 4WHYH 3ARGC 5BJTB 1P4BL 4YR6A 1SJXA 3S36H 4L5FH 4U1SB 5I8EB 4KJQD 4KWUA 3HE7C 5DD5L 4UT9L 1A47A 4JAMA 1A7PH 1QO3A 4OB5H 4M7KH 5J12B 3MREB 1KJVA 1FL3A 4R8WH 5FO8B 3ZDXF 4WI8A 5JNYA 1RZ8B 3BP4B 4ZAKD 1DVFB 1F6LL 5GGUB 5T33L 3HNVL 3D18B 1CDBA 3O3EB 4BELD 3UJIH 2H9GA 4U3CA 4XNQB 3BD3A 2BOBA 3PG2A 2BY0A 3K8MA 1P6FA 2ED7A 5F88A 5GGSB 1A7QH 1NLBH 5F7DB 3P9WB 3VXSB 4F2MB 4YUEL 1CBVL 3G9AB 3VD5A 1OW0C 3FT2B 4RAVA 3UTQA 4QHLB 5D2NC 3RL2B 1Z3GL 5JO5A 4JFZH 2KH2B 3VGAB 4IEFB 4FQXB 1KN4L 1MUJA 1XF3A 3BMVA 5D1QC 3ET9F 3RNQA 3MO1B 4D9LH 4AK1A 4PJBF 2XY2A 4HIEB 4JQIH 1S7SA 3DYOA 3MRQB 5CWSA 4HBCL 3QWOB 1OARL 1OM3H 2LE9A 3HAEH 3IJSA 3CFCL 2VWEC 1ED3A 2J6EA 3O2DL 5KSUA 2EDNA 1JPGA 4I0PD 2LTQB 2VB5A 1N26A 4YZFE 2JIXA 4LVNB 1XEDA 3OJVC 3CDYA 1LE5B 2N56A 5ALBL 1ZANL 3EFDL 1S5HB 1IGYA 4HWZB 2LU3A 2J12B 3JWOL 3QDGD 2NTSP 4PYHA 2V2XA 1UA6L 4ZUVA 1TJHH 2OR9H 5SWSA 1X4ZA 4GSDL 3RWHB 3N1PC 1X5ZA 3WLBA 1FLRL 2D7TL 1FNFA 2ID5A 3Q5YA 5KVFH 2YD3A 5FM5O 3DSFH 4NC0B 4HC1L 4XB7A 35C8L 3BW9A 2NXYC 3DYMA 4PGEA 3CX5K 4JHAL 1AD0B 1CXIA 4JPKL 3QPXH 4Y2DC 3QIUD 5ABDE 1K8DB 2QQLL 5E8PA 2CLRB 5GJTL 5CGYC 3QNXB 2D2OA 1RQ5A 4NO0B 2JB6A 1A22B 2AJ3B 3DBXA 1CE1L 2D0FA 3FB8B 1EBAA 1PX3A 5ENWB 2NY0C 4NQUA 4QRUA 4X6CF 1TXKA 4ZTPL 4HKJB 4XZUA 4P23C 1FORL 4OFIA 4Z18A 2X42A 2WSKA 5C0CD 2W9EH 2VXUH 4MSWA 4LLVB 2GITA 4YPGA 2V5TA 2C9AA 2MPAH 4WJ5A 2XN9A 3JVGC 5EUKB 3VGEA 3U48A 3MOQA 1LDPL 1Q0XL 4O4YH 2CKNA 4UQ2A 3HS0B 4NRZB 2VLRD 4PFEA 1JZ5A 4FQIH 5DJCB 1IFHL 2R29H 5GISH 3L7FA 5D5MA 2NY3C 1CT8B 1PZ5A 5FHAH 4P2OB 4Y5YB 1IL1B 5D7KD 3OGCA 4TUOB 2NY1C 2YRZA 3ZSTA 1CCZA 2H3NB 3DX6B 4F15B 3WIFA 4PJ7A 4FFZL 4OF8A 4HS6A 4WO4C 5AG8A 3MUHL 1G9NH 4U33A 3NZHL 4G8IA 5DR5L 1J8HE 4MX7B 3LAFA 1TVHB 3OB0H 4Y19B 5A16B 1NFIA 3NIGE 4WWKA 3BEVA 4TTDC 5GZNC 1OY3B 4PRDB 2ZUXA 5MEPA 4F7CB 1HWGB 4Y5XB 4LLQB 2PCPB 3IDMB 3VXUA 2FLRT 4LRIA 3DWTA 2BNRD 4LKCB 1LO5B 2VLKD 4B5EA 4NQDA 1MCCA 3T1WA 3MV9B 2WBKA 1T04B 2VR5A 1RUKH 3MLTA 4LGRB 1I85C 2V9TA 1S7VB 4Q58C 4ETQB 5KOVC 4IDJL 1V3LA 1NC4D 4JY5L 2FEEI 1A6VL 1HH6A 4XXDB 3EOBA 3QDJA 3KS0J 5DI8B 3JUYA 4ZNEA 5C09D 2WIIB 1INQB 5JDSA 4I4WA 4HMEA 3NABH 4JFEA 2Z93A 5C3TA 1T5WB 1O0VA 4KUZL 1FPTH 2DQTH 1BEYL 2HJFA 3MRFB 3W0WE 4IRJA 4GS7B 4O5LL 5C9KA 1E4XI 1S5IH 3STLB 3D39D 3GHEL 4V1DA 4FQPA 4W4OC 4XVUD 1KJ3H 4ZO9A 4K7PY 1S9XA 1CTNA 2MHAB 3BPLB 3ARBC 2ZUWA 4JR9L 2CIKA 4TVPE 2X89A 3MLVL 1Q9OA 2UYLA 5F6HI 1OD7A 4X6DF 2YPVH 3Q6GL 2P7TB 4JFDD 1LHZA 4G43A 5IT2H 5BS0A 3KAAA 2GQHA 3S37H 1IKNA 1DL7H 4Z76B 1GYAA 1I7TA 1U0QA 3OAZH 1AXTH 4MCYA 4HK0A 4NDMB 5J11B 2AVGA 5EO9B 1ZK9A 5GRZA 1SBSL 1TCRA 2MKWA 2PO6D 1EGJA 4WU5A 2V7NA 1FAKT 1YEKH 2CGRL 4ZFFA 4LCYA 3AS3A 5EUOB 3WUWG 3KG5A 4N1CA 4XMLH 2BNQD 4KC3B 1SYSA 3D87B 3FRUB 4OSUL 4NZRH 4OZHF 5ICZA 3CFDB 3ULVD 1BIIB 1A14H 1E28A 4HWEH 4LVOC 4E41B 1HWHB 3CUPB 5JPMA 1H3TA 3I75B 4PY7B 4RGOH 3WIHL 5KTEL 1FNHA 1KIRB 4PJHA 4LQ1A 2XI9A 2ZUQC 5IVXA 4X6FB 5SV4A 2R4SH 1RSFA 1P9MA 1GCFA 4FG6D 4Z7UB 4KROD 3WDHA 3KYNB 1MHCB 3U0PB 3MA9H 3MV7B 5TGBB 1HHIA 4U7KA 4M4RA 1D9KC 4KDTA 1FNGA 4YHYC 3SE8H 4AL8H 1KYOJ 2NXZC 1INEH 1JRHH 4XP5L 3FQRB 2XNAB 2VLLB 1MWAL 3K4ZA 1XZ0A 1QSFB 1CL7I 4MXQD 3BXNB 4X9FA 3B9KB 4LLUB 3WSQH 4ZDHB 3MRLA 4F33A 1OAZL 3GSRA 4OGZA 5C0BB 5FO7B 4PD4K 5F6IB 5F9DC 1FVEA 2Q6WA 3N85L 3V4UH 5SWSE 1MELA 1YDPB 4JM2A 2QSQA 1WICA 2AQ3A 5FYLH 3ARGD 1RURH 4HPYH 3I85A 4KVNL 1A1NA 3HE7D 1KPRB 1R3LA 3FOMA 1S7WB 4GXVH 5C08D 3GMLB 1FH5L 5E99H 2HKFL 4WNQA 3FCTB 5ITFB 2R23B 4M43H 5TQ0H 4RAUA 4Z7NF 4HT1H 5EZOL 1J1XL 4OTXH 2PETA 4PRHD 4GH7B 2JCCF 4OV5A 1KJMA 2DDQL 2F19L 2C3VA 1FFNA 1LEIB 4R7NA 5IW1A 4NZJA 3X13B 4GXUM 1S7XB 1C7TA 5F3HB 1U2HA 3RPKA 3EDKA 4XPHH 1AXSB 1EEZA 5I1DA 1FNEB 3RZCB 3WDJA 5C9JA 1KBGH 1ZKAA 2AQ2A 2GFBA 2XZQL 3H9SB 4Y4KC 2XN9E 3KR3L 1X5KA 1YEEL 4YEEA 4PLKD 3V5HB 1JGUL 1J0HA 5B39B 3V8OA 1W2KT 1VEPA 5E0QA 5D1QD 3SDYL 3IETA 3W2DH 1OPGH 1DQML 1XGYH 1Q0YH 1YEFL 4ZO6A 3EYQC 4LARL 4R96A 4X9IA 2IAMA 2NQCA 4ISVB 1Q1JH 3MODL 4X99A 5D5ME 3SCMB 4TYUA 3VFGH 5IEKB 1JK8B 3AXLB 3VXPB 4UV7L 3EO9L 3DNKA 5L2KA 3V0VA 3QI9C 1A6WH 4PJ7E 2MQ3A 1X7QA 4OLVH 2CDFA 3CXDH 4PS4L 1TVDA 4XBGB 4PGDB 5CINL 2FRGP 4AIOA 4PP2A 3FL7A 3PE9A 4PV9A 2OTUB 4HJ0C 3PGCB 3CH1A 4OGYH 2OYPA 5FGCB 4MDIB 3HC3H 4L3CB 4I18B 1S7RB 1A3LL 2EH8H 3D0LB 1Q72H 3QG7L 2PXYC 1QSEA 1KTRL 2F53D 2RCSL 3DARA 4OF0A 4PJ5B 3JTSB 3L7EB 1FL6B 3VXUE 1FFOB 3OF6A 2FO1A 4XCNB 5HPMA 2GUOA 4J3OC 1JPTL 4WCYL 5DRXB 1TJGH 2D03L 2NXYD 1PG7L 2OJEA 4NQDE 3VFTA 1U58A 5ITBL 1MFBH 4Z77B 1P84J 1E6OL 4BFBD 2KBGA 1G7IA 4Y2DD 4ZSOA 3EJZC 5JPNA 1U8MA 5CGYD 4NHCH 3DV4B 3MRMB 2BSSA 3QDJE 3U0TA 3E3QE 3H3KA 3ULSA 5IMMB 2CRYA 2IQ9L 5T1KD 1A9EB 4ZNEE 2W60B 4U6VH 5DQDH 1BQHA 2NY0D 4JFEE 4F9LC 1MHHB 2E9WA 3AREA 3CK0L 5KAQF 1GGUA 2UZYB 3NMEA 1NGPL 4PJGA 1ZLSH 1WF5A 4Q9QH 4GQPH 4PJ8A 2GKIA 3ZT5A 4P4KC 4PRPB 3NAAH 1KNOA 2C1PB 3P9MB 5GGQL 4NM8L 2A74A 4WHDA 1V8HA 3IDUA 3W9DB 3CMOH 4V1DE 5DFWH 4MAYC 4EDXA 2FECL 1JMXA 4P0DA 3U2SA 4R3SA 3BKJH 4QRRB 1L7IL 4I5BB 3TO4B 3TBSA 1H3PL 4DGIH 1C5BH 1R5WB 3ZKXC 3EO1B 2NY3D 5ECJE 5HHXH 3BN3B 4FMKA 5BS0E 1F2XK 1J7VR 1PKOA 2QJDA 3C8KA 1KTDB 4G80A 3O4OC 3MLZH 1KOAA 1QEWB 5E6YA 5DURD 3C9NA 1CDCA 3ALXA 2PTTA 3GI9L 3KPSD 4LMQI 1XIWC 4R90H 4PUBL 5JUEH 2WM0A 3R06A 2A9MH 5MHSE 4KRMB 4HHAA 4P9ML 4LCUA 1MF2H 3T4AB 4NN5C 1HKLH 3FFDA 4TQEH 1TVBA 4MXWL 4G8FA 4TTDD 5GZND 2A6KA 4LLWB 3UX9B 2Q87A 5EO0B 4WU7B 5BV7L 1F90H 5CD3A 1LP9F 3P0VH 3MFFA 3Q3GA 3HC4H 2ZCKH 2VQUA 3MLYH 4PJHE 2X4QA 3H3PH 5IVXE 2EIEA 4J6RL 3O6MH 5F7EH 1RU9L 1OF2B 5HYFA 2X70A 3KLAB 4U6HB 3INUH 3FQNA 3DMMA 5B22A 3MFGB 5EOQH 1JV5A 1OWWA 1T2JA 1QPPA 2YD7A 4UILH 3MMEB 1G7HA 2IANB 3I6LD 2DJ4A 2IBBA 2A6DB 4QHNB 1PEWA 2YUVA 4HV8A 3LDBC 3LQAC 3GMNB 5IM7B 2NY6B 2B2XH 5D1ZA 2RFXA 3FQTB 4UZGA 5DS8B 3PABA 2QSVA 2AV1A 1S7QA 3D5OF 2DBJA 2XA3A 5GGVH 2PYED 3D85A 1XGRB 4G8GD 1JWUB 4Y88A 1ORSA 3ULVL 4NO5A 5IWLC 4ELMF 1YY8B 4GKNA 2BSTA 2VOTA 3X3FH 3VRIB 3FFCB 2ZSVA 1Z2KA 4PV8B 3TV3L 3BGAA 1X6LA 1KJ2B 3OXSA 3ARBD 2A83A 1JUFA 2YD6A 1FCCA 4GG8B 1P4BH 2HFEB 4WY7L 3N1FC 3LKQA 1G7PB 3BD5A 2JKXA 2UUDH 2CD0A 3FO1B 3IDGA 4MDJB 5DD5H 4WW2A 2COQA 4UT9H 4C58B 5J6HA 3F7YB 1ZSDB 4HZLA 2EDFA 1LO3L 4X98A 2ADIA 5DK2B 3V6FB 2EICA 5E2JA 4JY6A 2EYRA 3T0XA 4TSCL 2ITCB 1MLCB 3O9WD 5FKAB 1FNLA 3W9EB 3E6HA 4ZQKA 5IHZB 4L1DA 3MACL 3O0RL 1OAUL 3BQUA 3HNVH 5T33H 1UWEL 2D4DA 3WV0A 3QUXC 3VFVB 2I24N 3M17A 1HHKB 1FO0B 3MV01 5FKPA 5DUML 4YDKL 3QNYA 1BD2A 5J9PB 3DX7B 4YUEH 5B38A 2D31B 1CBVH 4DTGL 2P8MA 3CXHK 3WLWC 5F7FA 1Z3GH 3WBDA 3IFOA 1YPZA 3PQYD 4JJ5B 4N9GA 2VZ3A 1KN4H 2YPLB 3LV3A 1U8IB 1MI5D 3ECBA 5DRZB 5I74B 4U3XA 4NQXB 1UZ6F 3DURA 4ZUWB 1RUQL 4H1LA 3FN3A 1D9KD 4APQA 4HBCH 4NNYA 2NXZD 1OARH 5C07D 5L2KE 1EVTC 3KYKL 5SWZB 4LIQL 3LH2L 3CFCH 1JHTA 4H0IA 4OLYL 3O2DH 2H8PB 4WFED 4KK9C 1HHGA 1ZT1B 4YIQB 3BGFC 4U6TA 5GRWA 5H37H 1W0VB 4PRNA 4KTDL 4IIQA 5ALBH 3AROA 3PDOB 2BRRH 1ZANH 2BSED 2NX5E 3EFDH 4GRMA 5BVJB 3JWOH 5D1XC 1FG9C 1UA6H 1ZA6B 2ICWI 2RR3A 4HQQL 3S3JA 1QSEE 5LGJA 2FGWL 3SGEH 4EQ3A 4GSDH 4EUPH 3DRQA 1QSZA 3S3PA 1RJYB 3CD4A 1FLRH 2D7TH 4OZ4B 3OJ2C 4P99A 4HC1H 4GRWE 2ERJB 2W07A 35C8H 4QRSA 4ZSOE 1U3ZA 5E9DD 4JHAH 4JPKH 4FP8L 4G8EA 3HLAA 1KN2L 3UTZA 1KT2B 2QQLH 1I1YA 3HG1D 5GJTH 4HSQA 1F00I 3S4SG 1FYTB 4C56B 1IAIM 3O11A 4M62L 1CE1H 2R39A 2HT4C 1JWSB 2CLZB 4M6ML 7CGTA 1AP2A 3RTQA 4PJGE 4ZTPH 1P7QB 2K7PA 2V5SA 4KQ3L 1FORH 2VDQL 2KL6A 1M6OB 4MHHG 5FV1L 4HDIA 1WT5C 4Y4KD 1PDKA 3HRZB 1EEQA 2EYTA 3IDNB 4TUJA 2P5EA 3PNWB 1QRNA 1LDPH 1DTUA 1Q0XH 3MGOB 4ONOA 2P24A 4Q6YA 2Z92B 2VQ1B 3L95A 2BVQA 2W0PA 3EYQD 3Q5OA 4WFFD 3SE3A 4PIRF 3MBEC 1Q8MA 2R1WB 2FBOJ 1PQZA 1QPXA 1H3XA 1IFHH 2AI0H 3LB6C 1VPOL 1IZJA 4RQQA 3NACL 3TN0D 3QI9D 2JELL 3U79A 4U1MA 4AJ0A 2BC4A 1IM9B 1NGXA 4JRWA 4QXGL 4JZJB 4FFZH 2V9RA 4XXCA 1OP9A 5DYOA 4HJ0D 4HUKB 4L4TB 4EI5C 2WK2A 3NZHH 5DR5H 3LMJL 5GZOC 2C3XA 1T1XA 4I77L 4HGMA 1MCDA 3V5KA 2YD2A 4NQCA 3MRKA 5EC1B 3MV8B 2PXYD 3E2HB 4WWID 3EYVA 4BFEA 5AD0A 5JW4M 3SO3C 1FN4A 1PBYA 5HYJB 2XKNA 5EBLB 4LL9A 3BUTA 3RP1A 5INCB 2IALA 3EJZD 5IW3A 3GSNL 3BOVA 2GTZA 1T1ZA 2CRMA 4CN4A 4IDJH 4JJHA 2OK0L 5DJ6A 4JY5H 2FHBA 1A6VH 2GAZA 1HHHB 3VXMB 4QHMB 2E7MA 4JRYB 1MLBB 4RNRA 2Y7QB 1N2RB 2CO7B 5DJ0A 3MJ8A 1KUMA 3B8YA 4EJ1C 2VZ1A 4U6YB 5ANMA 1ZLVH 3UTSD 4RIRB 4KUZH 3LKPB 4P4KD 1LILA 2CMRL 4K2UL 2AJZA 5CBAB 1PJ9A 2VXVL 5IKCB 1EJ6A 3HZMA 4O5LH 4Y4FA 4MHHI 3GJEA 2Y23A 4JFPB 1W8NA 2X1QA 4KJPC 4UTBL 1TZIA 3K80A 3I50L 3NH7L 4MAYD 2DYPA 5HGHA 5IMOB 4XHJC 2H45A 1INDL 3GHEH 4X7TA 5E8NA 5IV2A 2C26A 5EZJA 3O3AA 3IFPA 4E0RB 1VGEL 4JR9H 1OAKL 4J8RA 2XQBL 2WBJA 3MLVH 3W11C 3Q6GH 1YY9C 2BVEA 3U30B 1QACA 1S9VB 3X17A 1QLEL 4MZ2A 3T2OA 3IDJA 1YA5A 2CJUL 3ARRA 1XIWD 1T1WA 2APBA 1SBSH 2QADC 2J4WL 1H3WM 5F7LB 2XWTA 2R2BA 3RUGA 2CGRH 3KHOA 5D96B 1WITA 3D0VB 4U1NA 5TF0A 3V6ZB 3L1OL 4BUGA 2VISA 1QFUL 4L4VB 1Z9OA 4LEOA 3LZFL 1BD2E 4HK3J 4MA1B 4OSUH 3PGDB 2JLLA 3UPRB 4XH2A 2IH1A 4PJDF 4JDVB 2V2WA 5DJAA 3VFSB 4MJIB 3VG9C 2GHWB 3WKML 2PW1A 5FUOL 3SE9L 1YPZE 1LDSA 5KG9A 3WIHH 5JOFA 2DI9A 5KTEH 5MEOA 3N1MC 3OR6A 4LHUB 1PKQA 1NGZB 5J1AA 4XRCA 1T5XA 2P5WA 1UQSA 4WDIA 3JV6B 1DN2A 4N1HB 4CDHA 5KSBF 5B8CB 5D7JC 1DQQA 4YHML 4XP5H 5DUBB 1MWAH 5C70A 3WL9A 4NT6B 1S9YB 1HXMA 3MRDB 4OI9A 3MV11 1R5VA 3S96B 3C2SA 1MCNA 3OX8B 1OAZH 2X4UB 1HDMB 3WFHA 1SMOA 3ZT7A 1ORQA 5DJ2B 2GJ6B 4Q7DA 3N85H 2VR9A 3PV7A 4JKMA 1U8OB 2G5BB 3EZ8A 2B5IC 2HLAB 1SY6L 5DSCB 3MROB 4KVNH 2GT9A 3OKNA 2FJHB 1ULVA 3G5VA 4XNMA 5JR1L 5GRJL 3SJVB 4WI7A 1FH5H 2HKFH 2Q7NA 2E7HA 3U4AA 4OUOA 1GZPA 1HE7A 1XR9A 3EYFA 1XGUA 1AXIB 3BGMB 3VXRD 3CGTA 1J1XH 1QFWL 4OV6F 4X9BA 5EZOH 1P7HL 4TULL 4Z6AT 1U42A 2DDQH 2F19H 3FAWA 5C0AB 5BJTA 5M7QA 4XPBL 5H2BA 4Q6IC 5DHYB 3QUXD 4U1SA 1ZT7B 5I8EA 2ED8A 3WKNA 4OZFH 2AEPL 3VFPB 2V9QA 4AH2B 4CVXB 4A6YL 2VDML 1H3GA 4N0YL 1WIPA 3MREA 3GM8A 3TZVB 2XZQH 3O45B 2CXKA 3S3SA 2O5YL 5FO8A 2P5EE 2X7LB 1WZLA 5HSFA 1RZ8A 3KR3H 3WLWD 1YEEH 3BP4A 1DVFA 1QRNE 4HFWB 1JGUH 3ZE2F 1U3JA 5DJ8B 5GGUA 1EIBA 3F58L 3D18A 1IGJB 3O3EA 3SDYH 4XNQA 5ISZB 2PTUA 1BBJB 1IGCL 1DQMH 4P5TC 1YEFH 4QT5B 5GGSA 5F7DA 4LARH 1JPST 2ORBL 3VXSA 4F2MA 3MODH 1WFUA 1U8LB 2B8OT 3NA4A 3U9PL 4M00A 4UV7H 3EO9H 2DN7A 1CWVA 3FT2A 1UM5L 3OKLB 4G6KL 3RL2A 4CU8A 4KK9D 2DLGA 4FQXA 4PLNC 4PS4H 2HP4A 5CINH 4MQ7B 1IBGL 4PJAF 1FHGA 1AH1A 3T0EC 1TNMA 3MO1A 4LRIC 4XB8A 1A7RL 4I0CC 4HIEA 5D1XD 4ESKA 4NQCE 1BFVL 5F7MC 3MRQA 4ZO7A 5I76B 3QWOA 1A3LH 1T7ZA 3T3ME 4AEIL 3KPRB 2GJJA 3QG7H 4WFGD 4CAGA 2RCSH 3E3QC 4E5XB 1BOGB 1FSKC 4KK6C 5IJVA 3S6CA 1JPTH 4WCYH 1LE5A 2D03H 4KV5E 1PG7H 2LU4A 1CXHA 4NHUB 1AR2A 5ITBH 4P3WA 1JYWA 1RD6A 2YZ8A 4HWZA 4PJEB 1E6OH 2AQ1A 1AHWC 3RWFB 5F7WC 5CJOL 1ZTXL 4Z8FL 3RWHA 1FIEA 2YPKB 1GGBL 2E8ZA 3NFNB 2IQ9H 1CE6B 3M8OL 2HT4D 3BPOB 1VKXB 5ANME 4ODSL 3CK0H 3L9RB 2JJSA 3STZB 1NGPH 1EO7A 3QDAA 1AD0A 1VDGA 3ILPB 2OSLB 4M8QB 1SYVB 1K8DA 1KTKE 5GGQH 2OL3L 2CLRA 2QKIB 3QNXA 4NM8H 5JLZB 4NO0A 3RI5F 1IKNC 2AJ3A 2DWEB 3R8BB 1OP3H 3FB8A 3EIFA 3BEWB 5ENWA 3FKUS 3QULB 1MVFA 1RJCA 3MBED 1I1CA 4HKJA 4URTB 1L7IH 3TC9A 4NFBA 5DQJB 1H3PH 2H26B 2YS4A 3LB6D 2YA0A 3VFRB 5JZ7C 5DHVH 4LLVA 1JN6B 3F5WA 4J3TA 5EUKA 3IB4A 3WFBL 4LPUA 1T66C 4D0CB 1ZT4B 3GI9H 5D7LB 3TT1L 4PUBH 3HS0A 3RUGE 4EI5D 5MERB 4PJEF 4XMPL 4NRZA 3UYRL 5GZOD 5L6YL 1DE4A 4N0FB 2QV2A 3O3UN 1G6RH 4P9MH 5DJCA 5C71A 2NY2C 4UT7L 2ZG3A 4JFHE 4OGAD 1CT8A 4QKXB 5J56B 4Y5YA 1IL1A 1F13A 4TUOA 4MXWH 3VFNB 5HHOB 5DEGB 3BRDA 5CJ5A 3DX6A 2DTSA 5BV7H 3GI8L 2JK5B 2EDTA 5DC9B 1EERB 4DOHE 1IGIL 1BJ1J 5JA8B 2HKHL 4OFKA 1UC6A 4J6RH 3MJ9A 3JUZA 1RU9H 5CJBA 1PKQE 3GRWA 5CBEB 1U8QB 3GMPA 3QAZC 4MX7A 1TVHA 2P5WE 4Y19A 5IVNA 3TNMB 4L8SB 5A16A 1JTPA 4W4NA 5HVWA 5D2LB 3HC0A 4F7CA 1FP5A 1ONQB 4Y5XA 4LLQA 3ZTJH 2PCPA 5GSRB 3IDMA 3ZDXE 4ELKB 4IHOB 2LAGB 1XGQB 3IDIB 3SGDH 4LKCA 1LO5A 3S8WA 1JBJA 3MV9A 1HQ4B 1T04A 2ATPB 1IMHC 1S7VA 3DUHA 3RWEB 4ETQA 3ULVH 1H8SA 1B6DA 5T1LA 4XHJD 4XXDA 3UJTL 2Y5EA 5FYKE 1LEGB 5DI8A 4KJWC 3TV3H 1INQA 4F57L 1G7QB 5I2IB 3QEUB 5E1AB 4MB5A 1T5WA 7FABL 1EAPB 4RGMC 4WY7H 1VB9A 3MRFA 2AK4B 5F3BB 3U6RB 3W11D 3VA6A 2XQYG 4Q74A 5HVHB 3LQAL 4W81A 2UZIL 1XH3A 1LO3H 5DVMA 4FFVD 3STLA 4PRBB 1GHFL 2QADD 2EE9A 1L0XA 4TSCH 4JO4L 5HXMA 2MHAA 5FUCE 5MEND 3CSPA 3QEQA 4YDLC 3GSWB 3MACH 5EU6B 3O0RH 1OAUH 5DRWB 4YXKL 1UWEH 3SKNB 3IF1A 2P7TA 3QFJD 1ZLWK 1J05B 1R24B 1KC5L 5DUMH 5DD3L 4YDKH 4Z76A 2IAMC 4NDMA 3Q1SL 1CG9B 5EO9A 3TFKC 1U3HA 3BN9D 1IAOB 2XZAL 4DTGH 2A2QT 4OD2B 4GMTL 3QXVA 5EUOA 4L8CB 5A2LH 2JIXD 4NOFA 1EEYB 3VI4F 1I9JL 3FRUA 1V7NL 3CFDA 3VXSE 1RUQH 3MCG1 2WP3T 2IPUG 1BIIA 5D7JD 4ZMAT 3HUJB 5IEHB 4KAQL 3CUPA 3KYKH 3I75A 4PY7A 4LNVA 1KIRA 4LIQH 3LH2H 4OLYH 4G3YL 3H8NA 4WUUB 4X6FA 4Z7UA 5CZKA 4KTDH 4G5ZL 4G9FB 3KYNA 4K7FB 1MHCA 3U0PA 4K07A 3MV7A 4K3EL 5TGBA 2GK2A 4QLRA 3PHQB 4JRXB 3OPZL 1Q38A 4TNVK 4HQQH 2FGWH 4PJCA 2XNAA 2VLLA 4LK4A 1QR1B 2UZXB 1QSFA 3RDTC 3BXNA 3G08B 3W82A 2YN5A 5HI4C 4LLUA 3AREC 4ZDHA 4XNZC 5GQBA 2R0KL 2XKSA 1TFHA 1YC8A 1NC2B 4MLSA 5C0BA 3BIBX 5FO7A 1XFPA 4PJ8C 3AS2A 3L3DB 4BFGA 4FP8H 1YDPA 4R6UA 5GSVB 1F4XL 1KN2H 4NRYB 1BQHG 5DD6B 4NZUL 4M1DL 1KPRA 4M62H 3ZT6A 1S7WA 3GMLA 4DUVA 4M6MH 3FCTA 2AEIT 5ITFA 2R23A 5GJSL 4KQ3H 2VDQH 1LEKB 4TUKL 1T4KB 1KXVC 4OKDA 3HB3C 5CGTA 2FL5B 4LAJH 2Q3ZA 4MJ2A 5C0DB 3S5LB 3QEHB 3UZQA 5KANG 3HMXL 1GIGL 1LEIA 1UXSB 1PW3A 3IU3B 1WAAA 2Y25A 3X13A 1S7XA 2G2RA 5F3HA 5C8JB 5K9JL 4LSUL 4P5TD 1AXSA 1FNEA 3RZCA 1WBXB 4O51B 4EUPB 4LPCA 1VPOH 2XWJB 3NACH 4HWBA 3V5HA 2KKQA 4K9EC 3SDCB 4KKBC 1A6TB 1ZVSB 2JELH 5B39A 5C1MB 2CQVA 3LRSB 1FCGA 5L8LB 4C83B 5FGRA 4K3JL 3T0ED 1AIFB 1YNTB 4NQDD 5AZ2L 4ZS7L 2HRLA 4CGTA 1AC6A 5CGMA 3LMJH 4I77H 4ISVA 3DMMC 3KGRA 3VFUB 3SCMA 1QD0A 1RZ7L 1QBLL 4GQ9L 5IEKA 1JK8A 3AXLA 4D0BB 5DK0B 5JOEA 3RVVC 4AY0A 4FTVD 3FO0H 5JW4Q 4C4KT 4XBGA 5D7IB 4PGDA 3S35L 2AXHA 3ALPA 4KMTL 4OFYA 2OTUA 4XGZA 3PGCA 1FIGL 1IAII 4MDIA 4JFYB 4Y19E 4L3CA 4I18A 3GSNH 3CLFL 5AG9A 1S7RA 5CS7A 3RBGA 4YGAB 2YOCA 3D0LA 4WI5A 2OK0H 3QFDA 4HZAA 2IADB 1CD8A 4YHNB 4PJ5A 5F1KC 3RRQA 3JTSA 4FNLL 1IAKB 3L7EA 1FL6A 1FFOA 1DBJL 5CHNB 3LEYL 4XCNA 4OI8A 5DRXA 2XY1A 2YUXA 5I17A 3IAGC 3MV9E 4RSVA 3D3VD 3H7LA 3O8XB 5AYQA 2RHEA 2CMRH 3RIAK 4K2UH 5CEXB 1MCOL 2YXMA 2VXVH 4KU1A 3VA2C 1Z6JT 4GUPB 1KCLA 5K9QG 3DV4A 3MRMA 1AFVL 4S1SL 4WTWA 5I0DA 3MRNB 4P4RA 4UTBH 5IMMA 1A9EA 3I50H 3NH7H 3T8XB 2W60A 5KANI 5KZCD 5E8EB 1INDH 2G9HB 1MHHA 3MCLL 4QCIB 5J6GB 4XVTL 5DEZA 3ZL4L 4M7ZB 4JG1L 1VGEH 5JZ7D 1OAKH 2YD5A 4YC2C 4PRPA 2XQBH 4S1DC 3P9MA 1KSRA 4JQVA 4HGKC 1QLEH 3VWJB 2CJUH 2X4RB 5C86A 4NNPL 4Q2ZB 4NQEB 4LCCC 3OKDB 2J4WH 1PVHA 4L9LB 4QRRA 3OJDB 4I5BA 3TO4A 1NBYB 2HJKA 4CVUA 2NY2D 3C87A 1JGDB 1R5WA 3EFFA 3EO1A 3L1OH 4R2GD 1QFUH 3ROLB 3LZFH 5B38G 1N0LA 1KTDA 5GXBB 4M1CC 1QEWA 2A77L 2X4SB 3ULUE 3U4BL 3SDDB 3PWPB 4OQTA 1QQDB 1R3KB 3GMQB 3WKMH 5FUOH 3SE9H 5EUOE 2GW5A 1FZMB 1I75A 4YHIB 3T4AA 4H1LG 1U8JB 4IIQC 2DWDB 4U1GC 4W6WB 3RBSA 4M9OA 4EXPX 4LLWA 1N8ZB 2VDKL 2EKSB 5EO0A 4WU7A 4E41E 2ENSA 5C0JB 4N8CL 3BJLA 4MXVF 5CFHA 4YHMH 2OM5A 4BYHA 1M7IB 5HI3C 1OF2A 3EOAB 3KLAA 4U6HA 4HG4J 4Z7UE 1YZZA 4O58L 4IRSD 3RAJL 3MV7E 3MMEA 2IANA 4IS6B 2HYMA 4KJWD 4HCRA 2IPTL 2J6EL 1CGUA 4QHNA 5K9QI 1VGKB 2J5LC 5T3ZD 5IM7A 1I8LA 3VH8A 1JNJA 3FQTA 5DS8A 1SY6H 1T22B 1QSFE 4DK3A 3MRRB 4EN3B 4LCWD 4D9QD 2FH8A 3BP6B 1AGDA 5BRZD 3V4PL 5JR1H 5GRJH 1IT9L 1XGRA 2Z8VC 4ZFZB 5C0BE 4D3CL 1I7RB 5I1GL 2DF3A 3H7BB 1YY8A 5BZWB 4F8TA 3DETC 3EGSB 3FFCA 1DEDA 4BFIB 4PV8A 3GO1L 1QFWH 2NY5C 4GRLC 1KJ2A 3ZSSA 4TULH 3SDAC 1AQDB 4GG8A 2HFEA 1T83A 4XPBH 4QTIL 1G7PA 3FO1A 1OGAD 4ZAKB 3F7YA 3KPMB 2WP3O 1ZSDA 2AEPH 3SE3C 4RFOL 4YZFF 4A6YH 4U1HB 2VDMH 3WMSA 2IAMD 1VENA 1MH5A 1RJLB 4N0YH 5DK2A 3V6FA 3TFKD 4ZG1A 1QBBA 4KI1A 5SWQB 4ZOCA 2O5YH 2IH3B 1WAAE 4DAGL 1FVCA 1MLCA 2WWKT 5FKAA 1NANI 3W9EA 5HD8D 5IHZA 1VEMA 3F58H 2NLJB 2IG2L 4HIHA 3VFVA 5A43C 1HHKA 1FO0A 1UZ8B 1IGCH 1ZVYA 4K55A 2F5BL 3EHBC 3L3IB 2NX5D 4N5UA 4S1RL 3H9SE 4KRPB 3DX7A 4KGLA 5E03A 1JMZA 4LSPL 1ZHNB 2ORBH 1MCPL 2D31A 4M61B 4YFDB 1R0AL 1CLZL 3U9PH 1UKSA 3WNPA 1UM5H 4G6KH 1TJIL 4FOMA 4JJ5A 5F7NC 4KXZH 4ZFOL 2YPLA 3SN6N 1IBGH 1U8IA 4RRPA 4IBLT 2NR6C 1A7RH 5DRZA 1Z9SA 4NQXA 4I0PB 4ZUWA 1BFVH 4JHBA 5KSVA 4D9RE 3V52L 3RNKB 4LGSB 1A6AB 4AEIH 5SWZA 3RDTD 2X5PA 3QDGB 1MEXL 5HI4D 4OCYL 4DGVL 3ARED 4QRPD 2H8PA 1BGXL 3IVKB 1ZT1A 4YIQA 3C5ZC 1TENA 4GXUN 1W0VA 3B6SA 4PJ8D 5IHBA 5FGCE 5IQ9B 3PDOA 1D6EB 2O5XL 5BVJA 5GGSY 3IAPA 3QDMB 3OWEA 4QXUL 1SBBA 1ZA6A 2IFFL 2EDWA 5CJOH 1ZTXH 1D5MB 1CIUA 4Z8FH 4PJ5E 1WBYB 1GGBH 3BUYB 1K2DB 1NFDB 3M8OH 3QIUB 2DKUA 5EBWB 3T3PE 5I9QC 3VG0L 4OZ4A 5IBLC 3T09A 4ODSH 5ESQB 3HB3D 2EO9A 2EECA 4RMUA 5K33A 2WBJC 1KT2A 1P5UA 2OL3H 3FO9A 2JE8A 5GRYA 1FYTA 4C56A 3N1GC 1RULL 3NIGF 1QO3B 1JZ3A 2FX7L 1Q9KB 4UMGA 1JWSA 2CLZA 1FL3B 1W0YT 3G6AA 1LMKA 1P7QA 1T20A 3DLQR 1V7ML 4PRPE 5E8OB 1M6OA 2YK1L 3HRZA 1AJ7L 5JDJA 2VLRB 4LASL 1OD9A 4C4KO 5A3IC 2KUTA 2ZNWA 3PNWA 3WFBH 3BVNA 3UTOA 3MGOA 3OKMB 3TT1H 4QRRE 5DMYA 1WQVT 3QIWC 2Z92A 2VQ1A 3RY6C 1R3HB 2EDBA 2VABB 4XMPH 3SDXB 3UYRH 3TVMD 2R1WA 5L6YH 4TNWK 4NZDA 3ARFC 5L0QC 3MLPA 4UT7H 4M7JL 4NKMB 3MUGB 3OAYH 4MD0B 1OAXL 1EGJL 5GS3A 1ZHBB 2OI9B 3KJ4B 4DJMA 1IM9A 1OGTB 4JZJA 4QEGA 4FA8A 1IM3B 1IGIH 2GY7B 2PN5A 3BYYA 2FJGB 2P46B 4KZDL 3QNZB 4WV1C 4L4TA 2VMFA 2HKHH 2ITDB 4M8VA 3BDYL 2ZNXA 2APFA 3EDDA 5EC1A 3MV8A 2OS7A 2YWZA 5DZLA 4X0KB 2X4PB 5HYIA 1JHKL 1IGYB 5HYJA 1NC4B 2Q20A 4XCYB 3NCCB 5EBLA 5K59E 5DHVB 3BFOA 2QTEA 4NFDA 4LGPB 2EDEA 4RMSA 5C09B 5INCA 3E8UL 1PYWB 2W9LA 4XCCL 4Y1AD 3HPJB 4XPTL 2YMXL 5FYJE 2IANE 2FJFB 4TVSa 4UOJA 3S36X 4GJTB 4RX4D 4D8PB 3V7MA 1N6VA 2DD8L 4XNXL 5AZEL 5FB8B 5F8RC 4ZUUB 3DSNA 1HHHA 1AI1L 2YXFA 4W70A 4QHMA 3UJTH 4JRYA 1MLBA 3UZVB 2Y7QA 1N2RA 4XC1L 5CZXC 4F57H 3IXTB 3WJLA 3PL6D 4GW1B 4U6YA 7FABH 3D39B 3FQWB 3LKPA 3RVUC 4JKKA 5FUCC 1XF1A 4S1DD 5CBAA 2QHLA 2OX5A 5IKCA 3LQAH 2UZIH 3RKDC 5JORB 3L5XL 4JFPA 4UIKL 3UROR 3E1F1 3FFCE 3WNLA 5J12C 1GGIL 2P48B 4R97B 5E5UB 2ZG2A 5GRUL 3NGBB 2ZZUT 1GHFH 1YJDC 5E2TL 2H6PB 1DVFC 4JO4H 4YLQT 4E0RA 1RZIB 2ESVB 1RIHL 1MVUB 4RZCB 4YXKH 2ZKHL 3K8KA 2ICCA 4HIJB 1WWBX 4M1CD 5L9DL 1KC5H 1S9VA 2JJUA 5IJKC 5DD3H 3Q1SH 3V6OC 2DI7A 2BNQB 5FO9B 4PBXA 4OT1L 2XZAH 1IJ9A 5GRVK 4I3RL 5B3NA 4GMTH 4QXTB 5FF6B 3VGAC 2XYCA 3D0VA 5HPOA 3V6ZA 1WCBB 3QUZB 1BLNB 3OB8A 1A0QL 5IFAL 5I0ZA 3CDCA 1EK3A 3KLDA 1I9JH 5EOCL 1V7NH 5ID1B 3PGDA 5EPMA 3LHPL 3UPRA 4F7MA 1J1OL 2AXJA 8FABB 3VFSA 5KSAC 4KAQH 2VERN 1PG7W 5HI3D 4LDEB 4CADB 1FL5B 5HYEA 4G3YH 4WWKB 1QSVA 2YPLE 2C3HA 2LTQC 3A6OA 4LHUA 1UH4A 3QUML 5ID0B 1KEGL 1NGZA 4LVNC 4HXBL 4AM0B 5HHQB 4G5ZH 3JV6A 2JJWA 2YSSB 4U2YA 5HDBE 5CLWA 4K3EH 3VDCA 5JOPD 4ERSL 1AQKL 3KNBB 2EIDA 3OPZH 5SWZE 3RJQB 2Q8BL 3HN3A 3LSOB 1CN4A 5ELIA 4M5ZL 1FG2B 3LN4B 5DUBA 4HUUB 4NT6A 1S9YA 3ARGB 3MRDA 2E7CA 5DJYB 1N7ML 3S96A 2R0KH 2JJSC 3OX8A 4I4WB 4LF3B 2X4UA 4KI5E 1HDMA 1NJ9B 3DETD 1U8NB 3N50A 5HVFB 5C08B 1JZ8A 4U1JB 3OG6B 3EO0B 5DJ2A 2GJ6A 5LCVL 2WWKO 2WUCL 4GOSA 4GRLD 2VL5A 1U8OA 1F4XH 2G5BA 2P5ED 5D5MF 3SDAD 4EQ2A 5ICXB 5DSCA 5A2IH 4NZUH 2VAJA 4M1DH 3CDGB 4PRHB 1IAIL 4PJ7F 3SJVA 1G0XA 5GJSH 3T0DA 3B9EA 3BZ4B 4TUKH 1ZMYA 3J8F7 2VITB 1YECL 3BGMA 5EU3B 1S7UA 1QOKA 4AIZB 1FYTE 1F3DH 4C56E 4W6YB 4DUXA 3AM8C 3QXDB 3TO2B 3HMXH 1KTLB 1GIGH 1YMMD 5FK9B 5C0AA 3T0WA 4F7EB 5DHYA 1ZT7A 5IQ7L 5K9JH 2DICA 4LSUH 3V95A 3EHBD 3VFPA 4AH2A 4CVXA 4WU5B 4NQCD 3L5HA 2G60L 4U49A 3TZVA 3KXFD 3O45A 1A6ZB 2X7LA 4P2OC 3BX7C 4HFWA 4YFLF 5GGTL 1SYSB 4ZYKB 4CN6A 4G42B 3PV6B 4PJFB 2X41A 4UU9B 5DJ8A 2Z8RA 5C0NC 1IGJA 1YEDB 5ISZA 4WI4A 4K3JH 1BBJA 2B1AL 2ZUTA 1L6XA 5AZ2H 4ZS7H 4YHKL 2BDNL 5DJDB 3Q6FB 1U8LA 2BFVL 2CR3A 1QBLH 4GQ9H 3QA3B 4KK8C 4OM1L 3OKLA 1O5DT 5EZLB 4DKFL 1NUNB 2WQ8A 2HT3C 2X44D 1I9RL 3C5ZD 4P3CL 4KRLB 3S35H 4L4TE 4MQ7A 2F53B 2IMMA 4KMTH 4EDWL 4K9EL 1FIGH 2HG5B 1SM3L 1RIVL 1NAKL 1GC1L 5I76A 2NXYB 3MV8E 1HSBB 3CLFH 4QWWC 3H9ZA 2VAAB 3KPRA 2DYPD 4Y2DB 1BWMA 3TYFB 5HYJE 4E5XA 4FNLH 5IBLD 2VH5L 1BOGA 1DBJH 2HMIC 1KYOK 4J3VA 5T1KB 4I48B 5FCSH 5IMKB 2NY0B 2IBGA 3CVHL 4ZOEA 3RWFA 1MCOH 3UCRA 2HVKB 2OR8A 1AFVH 4S1SH 3VXME 6CGTA 4JRYE 3NFNA 3IDXL 1CE6A 1BZ7B 1EHXA 1VKXA 2R1YB 3MCLH 2PW2B 3EDJA 2M26A 3S37X 3L9RA 3BPLC 4XVTH 1LO4L 3STZA 3ZL4H 4PJHF 4Q9RH 2Y07L 2WWMC 4JG1H 5IVXF 1JPSL 2OTPA 3ILPA 2OSLA 4MNHB 4M8QA 1SYVA 1NPUA 5A3ID 3C60D 5JLZA 5I1DB 5CP3A 2NY3B 3MLRL 5J11C 2X05A 2DWEA 5C9JB 2EDKA 2IGFL 4NNPH 4TVPH 3QIWD 3RX7A 1A1OB 1WWWX 3BEWA 4EKXA 5JW4N 4IMKC 3GSNB 3QULA 5DURB 5TFSL 3ZLQC 4P48A 3ARFD 5DQJA 1HYRC 2H26A 2EC9U 1UFUA 1OHQA 3VFRA 1EHNA 4GAJL 1JN6A 3RWIB 3HKFA 4UNUA 4AENB 1JF5A 5CD5C 4HH8A 5DFVC 1OTUC 3PXJA 5SX5H 2OZ4A 3NIDE 2A77H 4D0CA 4JM2F 3MRCB 1ZT4A 4KK5C 5D7LA 3U4BH 2E9IA 5DGRA 4FQLL 5MERA 4NPYB 5LWYL 5HI5C 2MWCA 4N0FA 3G5ZB 1KENL 4L4VE 1GXEA 4XC3L 3CX5J 1A4KB 2CKBL 5E8DL 3GNML 3QQ3B 2YR3A 5D6CA 5HHOA 5DEGA 2VDKH 3CH1B 4MJIE 4YO0B 4H5SB 4O02L 1F2QA 2JK5A 2VZUA 4UNVA 4N8CH 2KZ1B 5EN2A 3PF2A 3TA3B 2VNCA 3B9KC 4UDUB 5CBEA 1U8QA 4O58H 3TNMA 4L8SA 4P2QD 2HRPL 3RAJH 2GUOB 4TSBL 5F6IC 1NMAL 3LS5L 2PYEB 1U58B 4G8GB 5D2LA 2IPTH 2J6EH 5GSRA 5JTWA 5JPNB 4LLMB 4KZEL 4R26L 4ELKA 5I1JL 3NVQA 4IHOA 4J3WA 1XGQA 3IDIA 3RVUD 32C2B 2EKJA 1WTGT 4QXWA 3U0TB 1HQ4A 2ATPA 4WI3A 4PJ9C 3V4PH 2LFGA 1IT9H 4MD5B 3RKDD 3RWEA 2A6IB 4DFHA 5EU5B 4D3CH 1MCBA 5I1GH 5CUSL 2GJ6E 3VWKC 4M93B 5JQ6L 2A9NL 1G7MB 1LEGA 4QHKI 3GO1H 4BQ8A 5FFLA 2HLFC 1G7QA 1DVFD 5MP6L 5I2IA 4YNYB 2CLVB 3O41A 3QEUA 5E1AA 1EAPA 2ZOLB 4QTIH 3SJVE 2AEWA 1TCMA 2AK4A 3U6RA 5F3BA 3O9WB 2NCMA 4W6XB 3BI9X 4RFOH 2WAHA 4ZO8A 4R3SB 2IPKB 5EB9A 3VXSD 3ES6B 1X5AA 4YHZL 4N9OB 4PRBA 1R3JB 2ENYA 4JVPA 5C0AE 5KN5B 1RK0B 4DAGH 3DI2B 4LFHG 3KLHC 2VLJD 3C08L 3GSWA 4HUXB 1HHJB 3EYSL 1V5JA 1YN6B 5DRWA 5EFIB 1K9TA 2IG2H 3SKNA 5I1EL 2AS5M 1U8KB 5T3XE 2KQNA 2NY5L 1KV3A 5I16B 2F5BH 3EJJX 1J05A 1R24A 1X5XA 4GRWF 1J11A 3DO7B 3P4MB 4S1RH 3PWLB 4MAUL 1CG9A 1MI5B 4LSPH 5KSAD 5B39G 3VXQB 1MCPH 1IAOA 1R0AH 1CLZH 3B8SA 3MLWL 4PREB 1D9KB 4CU6A 4OD2A 4YHYB 2FHFA 4RMVA 1TJIH 5ISZE 5C07B 4L8CA 3LQMA 1YMHA 5IVOA 1AKJD 5DZOA 4LVHB 5FYLE 3QDHA 5ADPL 4ODTL 4PJGF 2X4QB 4LDOB 2YZ1A 4AEHL 2QSCL 2CR6A 4JVUA 4I18C 1DDHB 3HUJA 4Y4HD 5IEHA 3V52H 1FRGL 5CJXC 2LVEA 3TBTA 3GM0A 3SKUD 1WC7B 1MEXH 1P7KB 4A6YB 4OCYH 4WUUA 4DGVH 4DGYL 3S9DB 1BGXH 1YQVL 3P11L 4JANB 5D1ZB 4BSJA 4G9FA 4PTUB 4WW1B 3T65B 4K7FA 1KCUL 4AG4L 2O5XH 3QRFM 3PHQA 1I3VA 1S7QB 3QB7C 4JRXA 4QXUH 3KPRE 2IFFH 5LG1A 1OSZB 3D85B 2DKMA 5E9DB 5FA3B 1JHLL 3W5MA 4XP1L 1UJTA 1QR1A 2XV6B 3M1BB 1MCJA 3G08A 4OIAA 1CQYA 1CGSL 1Y18B 3F6IA 4HLZG 3HZKB 3VG0H 1N4XL 3DJ9A 1NC2A 4PJEE 3Q48A 1PY4A 4NBZB 3L3DA 1H0DB 3MLSL 4CMMB 3QCVL 5FM5M 4J4PD 5GSVA 3CFKB 4NRYA 1TETL 4WW2B 3EJYC 4LLYB 5DD6A 5B4MD 3TGXA 4TNVF 1RULH 2DIAA 1YNLL 4WEMB 1T89A 2FX7H 3GHBL 2F8VA 5D9SB 4MCZB 1LEKA 1T4KA 1V7MH 2FL5A 1C5CL 2YK1H 4EIZC 5C0DA 1OP5K 4P2OD 3S5LA 1AJ7H 1U9KA 4YHLL 5KVMC 4LASH 3P2TA 1UXSA 5C0ND 1NFKA 3IU3A 2VZSA 3GJFH 3KPQB 2Y6SC 5C8JA 3RGVC 3TN0B 3MOAL 1RAMA 4LDLB 3QI9B 2HFTA 5DGQA 3O6FD 1XCQB 1QFHA 3SGJC 5JXEC 1WBXA 1A5FL 2BHYA 3QWQB 4EUPA 4Y19D 2ARWA 1XF4B 5AYUL 2BSRB 3VFOB 3MNWB 1MRFL 3PJSB 4JPVH 4JFFD 4M7JH 5E6IA 2XWJA 4KK8D 4H8WC 4HULB 1OAXH 3LV3B 1CDJA 1EGJH 3SDCA 1A6TA 1ZVSA 4HC1A 2HT3D 5D7LE 4RBPK 3FB5A 3LRSA 1UWGL 4C83A 3J7HA 1AIFA 4Y8DC 4MMXC 1YNTA 3BP7B 3CCHB 1KFAL 4HWEL 3RX8A 4KZDH 3MV9D 4LPWA 4RMTA 2OL3B 5CSBA 1GVIA 1GGTA 4QWWD 2F15A 5E5RB 3VFUA 4WW2F 1FYHB 3QZWB 2QQKL 2I5YL 5DK0A 5HHOE 4UDTB 3ZYZA 4PRNB 1FNSL 4XCFL 2VXTL 5LBSL 2HMID 1JHKH 1DP0A 5D7IA 3CSBA 4HS3B 2R9HC 3TCXA 5C0IB 3E8UH 3JSSA 4JFYA 3ILQD 4XCCH 3TBVB 3DECA 4XPTH 2YMXH 5HVGB 3UO1L 1NEZB 5BZDB 3UTSB 4P4KB 3BPNB 5D2LE 2IADA 3VH8G 4YHNA 5IB1B 4XNXH 5H94B 1PAMA 5AZEH 4GFTB 4M3KB 1AI1H 2P8PB 1IAKA 4XC1H 5CHNA 2NW3B 3ZZ1A 3DGGB 4LSVL 2YHGA 1T83C 3C6LD 1IZKA 4ORZC 1YPZF 3O8XA 3QXAB 3RHWK 2ZPKL 4S0TD 5CEXA 1E4KA 4UOW1 2E6PA 2X4OB 4GUPA 1X5IA 1AP2B 3L5XH 4UIKH 3MRNA 1TQCB 1GGIH 2FCBA 3T8XA 5GRUH 1GH7A 3MRGB 2G9HA 3QJHB 3O4OB 4NN7B 4Y89A 4QCIA 3X14A 5E2TH 5J6GA 1XIWB 2AK4E 1RIHH 3K74B 2ZKHH 3NFPB 1QLRB 3RIAF 2E6QA 5CD5D 3BH9B 5L9DH 4GBXD 4GKSB 1OTUD 3LIZL 5D70L 3VWJA 4KK5D 2X4RA 2YC1B 4Q2ZA 2Y06L 4E41D 1LK2B 4NQEA 4RWYL 3OKDA 4OT1H 5HI5D 5F89B 4L9LA 3OJDA 3WEXA 5EU6E 1NBYA 4I3RH 1EFXD 4U1KB 1JGDA 3HR6A 1YJDL 4NIKB 4L4JA 1A0QH 5IFAH 3QIBC 3ROLA 2W59A 3T08A 3UTPD 4WHTB 3M07A 5EOCH 2NMSA 3LHPH 1UH3A 4OF7A 4LKXB 1J1OH 1T1XB 2X4SA 4JQXA 3SDDA 3QXUA 1Z5LB 1QQDA 1R3KA 2VR4A 3GMQA 1QSFD 3HPLB 1UVQB 3FB6B 3LDBB 3B9KD 4RRPG 4HKZB 1FZMA 5FGSA 3RY4A 3QUMH 2DLIA 1KEGH 4YXHL 1U8JA 4JZNB 4HXBH 4ZFGL 2DWDA 3UTTD 3DX9B 4QYOB 1N8ZA 2YUWA 2EKSA 3HUJE 4XPGL 1CGWA 2J8UA 2IALB 5C0JA 2X1PA 4ERSH 1AQKH 1T0NB 4LPYA 1J1PL 2ICWJ 2Q8BH 5CIPH 4WUUE 1E6JL 4M5ZH 5E56A 1M7IA 1N5AB 4PJ9D 1RZKC 2I27N 3EOAA 2VSCA 3NPSC 2ZOKB 1HYSC 1NCWL 1N7MH 4G9FE 1T7WA 2ERJC 3VWKD 5HYSB 3KLSA 1CFVL 3B2VL 4IS6A 3KVQA 4JRXE 5LCVH 2HLFD 2WUCH 1VGKA 1RHFA 3SBWC 1IEAB 2X9YA 4JPIB 2Z31B 1E27B 2A73A 1F45A 1T22A 1F4YL 3DTXA 3VXRB 2W0KA 3ESVF 4GRWH 4EN3A 3M45A 1J86A 3PGFL 1IAIH 1F42A 25C8L 3BP6A 4IRZL 4LFHD 2YUZA 4ZFZA 2E6JA 1CD9B 1I7RA 3QUXB 3VDAA 5EZIL 5BZWA 1TPXB 4L1HA 3EGSA 2C7UB 3H9SD 4UUJB 1ERNA 3O3AB 4BFIA 2NW2B 1YYML 5CSZB 3D9AL 3KLHD 1AQDA 4X5LA 3T3MF 3CU1A 5FYJU 3QRGL 5IQ7H 2BJML 4ZAKA 3KPMA 1Y6NR 4B50A 3IU4L 4U1HA 4EEEA 4KV5F 1RJLA 5I30L 1MRDL 2A38A 4PRID 4OCSL 4YXLL 2G60H 1CXFA 1T3FB 5BMFL 5SWQA 3SKMB 2IH3A 2EH7L 5J89A 5LGKA 4GKZB 1UENA 2E9JA 5GGTH 1JF6A 2NLJA 3OB0K 5F7HA 4JZJC 5HY9B 3TNNB 1UZ8A 4GO6B 2B1AH 1NBZB 3OKYA 3L3IA 3BGFB 4RAHA 4YHKH 2BDNH 1R6VA 5JOFB 2BXYA 1ZHNA 1M4KA 4QOKB 3T77B 2BFVH 4M61A 4MNQD 3QWRD 5D1XB 3WO4B 2BXZA 4PJ5D 4OM1H 3E2HC 1G7JB 5JMRA 4DKFH 1Q94B 1I9RH 3MZTA 4P3CH 2C5DC 4EDWH 3VFWB 4I0PA 4K9EH 4HUNB 1SM3H 4HBQA 1KELL 1RIVH 4FQHB 1NAKH 1GC1H 2MQ0A 1UCBL 1NUDA 1NEUA 3IFNL 4HIXL 3RNKA 5IHLB 1KCVL 3O4LB 1A6AA 3OSKA 3QDGA 4ZS6C 4J3UA 2KDGA 5E2VL 5D7IE 1A8JH 2V6HA 2VH5H 3IVKA 1F3DJ 4EI6B 1BQLL 4QRQB 5IQ9A 1D6EA 4HWUA 3NCFB 1C12B 1CLYL 3OQ3B 2EE2A 1MCWM 1G84A 3CVHH 3QDMA 4HAFA 3EJYD 5DEFB 1D5MA 2BY1A 3QG6B 4POZC 4MWFB 3TT3L 1WBYA 4MB3A 4R0LC 2W92A 3ZKSD 3PWUB 3BUYA 3IDXH 1K2DA 1NFDA 3CXHJ 1RK1B 1YEGL 2BMKB 3QIUA 5EC2B 4PP1D 1BIHA 5EBWA 4F9PA 2VXQL 3K0WA 1F6FB 5ESQA 1LO4H 1QTYT 5EBMB 2Y07H 3OAZK 5H2BB 4U7SA 1JPSH 3MBEB 3P40A 3L5JA 3MUJA 3FQUB 1I1AC 4B0MM 2DQFB 1DBML 2Y6SD 2LAAA 3MLRH 3RGVD 1Q9KA 2IGFH 3OKKB 5GIRB 4DVRL 3QO1B 1ITBB 1KPVB 5JXED 4MXVE 5TFSH 3DVIA 4I9WE 5D96C 2K9UA 5E8OA 1KB9K 2VUOA 4EI5B 3HNTL 5IGXL 2VL4A 2VLRA 4GAJH 4MA1C 4NFCA 5TF1L 5DC4B 1HZHL 4NQEE 3B5HA 1T7VA 4KPHL 5FDWB 3OKMA 3HRPA 3SO3B 3T1FB 4FQLH 12E8L 1R3HA 2VABA 3SDXA 5LWYH 5SX4I 3ZKNC 1T0MB 3BZEB 1KENH 3N1QC 4NKMA 4XC3H 5FYJD 5L8KB 3MUGA 4MD0A 4BZ1L 2UWEB 2CKBH 5DTFB 5E8DH 3GNMH 1NAML 1JPFB 1ZHBA 5L2JB 5I1LB 1JCKA 3GBNL 4KHTL 3PWPE 4O02H 5B8CC 1LWRA 1OGTA 1IM3A 2RJMA 4LHUG 1NBVL 3DX8B 2R9HD 2FJGA 2EZ0C 3QNZA 1HKFA 2ITDA 4G7YL 1KCRL 2EDJA 4M6OL 5IROA 5DDHB 4H1LH 1C08B 2NYYC 2ILLA 2Z8WC 2VLKA 5IJVB 4XAKD 3U0WL 2HRPH 4X7SL 4OIIL 4TSBH 1NMAH 3LS5H 3VMPA 4X0KA 3QO0A 1FZOA 5LKNA 4ODVL 2BRRL 1L7TL 2X4PA 1H3UA 1NC4A 4XCYA 4NN6B 3MJ7B 1NGQL 5DHVA 5C0GB 1D5XB 4R26H 5I1JH 4KZEH 4OFDA 5C09A 1PYWA 3D25B 3HPJA 3CFBB 4Z7QF 2E7LA 4RFEB 1WFOA 2FJFA 4D8PA 4RDQG 5CUSH 3AU1B 5DMIL 5FB8A 1YNKL 2YD8A 4ZUUA 5JQ6H 2A9NH 1FFRA 2FIKB 2BRQA 2Z9TA 3IXTA 3Q0HA 3QYCA 5MP6H 3QISA 4GW1A 1RFDL 5HDLA 4FFYL 4P59L 1I3UA 1CZ8L 3D39A 3FQWA 2QADB 4KHXL 5IF0B 4HUWB 5JW3L 2OLDA 5DUPL 1F3RB 1ZGLM 3HNSL 1F5WA 2P45B 4ZUSB 5MENB 5JORA 3G5XB 3TZVC 4YHZH 2P4AB 4KY1L 3ARWA 5HHMD 3QFJB 5TE6L 2BOCB 2H6PA 1Y0LB 1CICD 3F5WB 4HEPG 3VG9B 3LKOB 3C08H 1RZIA 1T2QL 2ESVA 1MVUA 3EYSH 4RZCA 5I1EH 3QIBD 4HIJA 2NY5H 1BFTA 3JTTB 2AGJL 3UMTA 1MFDL 4NO2B 5EU7E 1T6VN 1VFMA 1XMWA 1I8KB 1DE4B 2BNQA 4MAUH 5FO9A 4U0RC 2AI0L 2K1MA 1CFTB 2VLMD 3CLEL 3MLWH 4O2FB 5JIKA 3PDDA 5D7JB 4QXTA 1J0KA 5FF6A 2DLFL 1WJ3A 3QQ4B 2BVTA 1WCBA 3QUZA 1BLNA 2KPNA 5I6XC 2O5ZL 4PBWD 3GMMB 2N4IA 4DCQB 5ADPH 5FEBA 4ODTH 5ID1A 4FQ1L 4AEHH 2QSCH 3WFCL 4X4XB 3P77B 3V0AC 8FABA 5ACZB 1PG7X 3GMPB 1ROWA 1U93B 1JNLL 1FRGH 4CADA 1FL5A 3K8LA 3GKZA 4LP5A 4RGND 4DGYH 1L0YA 3HFML 3HC0B 5ID0A 5DT1L 3GSXA 4P2CG 3V7AE 1YQVH 3P11H 4JY4B 4AM0A 4QTHB 5HHQA 2YSSA 1KCUH 4AG4H 3VGGA 2JJVA 3KNBA 4YK4B 1GOGA 4C56D 3FZUC 3QDGE 4WTZA 3LSOA 1JHLH 4KJYB 5GGVY 1FG2A 4XP1H 1C5DB 1GZQB 2VDOL 3LN4A 5TE4L 5T1LB 4ENEC 3BPOC 5C0RL 4HUUA 3ARGA 5DJYA 1CGSH 4Q6IB 1L9NA 1N4XH 5CEZD 3CDFA 4LF3A 3HE7A 4YBQC 2FNBA 1NJ9A 3CX2A 3N9GL 2WBWB 1U8NA 5C08A 3KHQA 3QDME 1TIUA 3EO0A 4U1JA 1H15B 3MLSH 3QCVH 3RZWA 3B2UC 1TETH 4ZFOB 5ICXA 1NFDE 1XH3B 3CDGA 4PRHA 1YNLH 1RZFL 3GHBH 1WUNT 3ZE0E 1U92B 1BVZA 1TDQA 3BZ4A 1F8TL 4P5TB 2VITA 1C5CH 1MIML 3QEQB 5EU3A 1BAFL 1EPFA 5FGBA 4AIZA 5ESAA 4YHLH 3IF1B 4K71B 3QXDA 3TO2A 1KTLA 4AQ1B 5FK9A 4F7EA 3BRFA 4MNGB 1NCAL 1OW0A 5F1NB 2FBJL 2FB4L 5LXGL 2R2HB 3PWNB 3MOAH 4NRXB 1U3HB 4PJXA 1A5FH 4GAYB 3T0EB 1NUGA 4M02A 5AYUH 2VLRE 1A6ZA 1MRFH 4RISL 4ZNCD 1JGEB 3U7WL 8CGTA 3IT8D 3LD8B 1P2CB 4ZYKA 4G42A 3PV6A 4PJFA 4UU9A 5D7KE 1SVCP 1PX4A 2JB5L 1YEDA 1OOAA 1UWGH 2M1KA 1YYLL 1NL0L 4GW4B 4FTVB 4YX2L 3SDXE 3OKEB 1KFAH 3PP3H 3VD7A 3T0VA 5C2UB 5DJDA 2F54D 3Q6FA 2X9WA 3QA3A 1AHWB 1ZVHA 4ZS6D 2QQKH 2I5YH 3OXRB 2FZ3B 1RVFL 3VXMD 3WXVL 1ZS8B 4UTAL 1F11B 1FNSH 2MMXA 4JREB 4CKVX 4XCFH 5EZLA 2CK2A 2VXTH 5LBSH 4LOUC 3KPNB 4AEEA 2F53A 3UYOD 1F4WH 4H8WL 3LRHA 2KQMA 1C7SA 1NKOA 3NCEB 2CUHA 1FGNL 1QFOA 2L7UA 4LHJB 2HG5A 4PJCB 4X4YB 5C7XL 3WCYA 1HSBA 4X80H 3GJFB 3UO1H 4POZD 3D3VB 5JHLL 1BREA 2VAAA 1PLGL 4Y2DA 3TYFA 2X4NB 3ZHKA 2UUDK 5J0BA 2UVFA 5TQ2L 4YJZL 2EDYA 4R4NC 3ULUF 4LSVH 5T1KA 5C09E 5KZCB 4I48A 5FYJL 5IMKA 3BIKB 4HCRL 2F58L 5EUOF 1N6UA 4FQQB 4ZXBC 5CAYB 1X5GA 4Z7WB 2ZPKH 5HVHC 3QXWA 1UYWL 1I1AD 2HVKA 1K4DA 4KKNA 3GIVB 2LQRA 5GGRB 5GS0C 2H32B 2L7JA 2MTPA 4TRPH 2Y5TB 1BZ7A 3OMZA 1V05A 2R1YA 2PW2A 1AC0A 1DCLA 2DAVA 5ADOL 3D39E 2PNDA 1UM4L 4BQ9A 1OCWL 4L4VD 4U1IB 2C4FT 4G6ML 2DOCA 2LABA 2G2RB 4MNHA 4Z7UF 1KJ2L 1YEHL 4C55A 2NY2B 1MFNA 4J1UB 3LIZH 4R2GB 5D70H 4XBEL 4MJID 4ACPA 2Y06H 1A1OA 5F1SA 4RWYH 3GSNA 3K1DA 2EIBA 4OD3L 2ESVE 4PJCF 3ZKND 4LHUD 1IEHA 3KDMB 1SEBB 3PDGA 1YJDH 4RA0C 4X4MA 3RWIA 2DLHA 1TLKA 5E2WL 4DQOL 4AENA 1A7BA 2BNQE 2APVA 3MRCA 4X8JB 4OZIB 2EZ0D 3S34L 3TJHC 4KGJA 4YBHA 4Q0XL 4NPYA 4AMKL 1VADB 1JZ7A 2NYYD 3G5ZA 2FEDC 3U46A 4LCIL 3SQOL 4KKCC 2DLEA 1P4LB 1KLUB 1A4KA 4YXHH 4ZFGH 2HAZA 2GJ6D 3QQ3A 1KGCD 4XPGH 4IRSB 1H8OA 4XGZB 1DQDL 4YO0A 4H5SA 5TH2B 4Z95L 3D6GA 2BVPB 4EBQH 1W72L 3SY0B 3THML 1VFBB 1J1PH 3TA3A 3WNKA 1E6JH 1WAAF 3QFDB 2FSEB 4FHBD 1QNZL 2R69L 1FNAA 4UDUA 3S7GA 1ZHKB 4HPOH 9CGTA 2EEDA 4RGMB 4PLJC 1NCWH 4DVBB 5I75C 1MY7A 5H35B 4LCWB 1GOHA 4ZTOL 1CFVH 3B2VH 5BRZB 5I17B 2PYEA 4G8GA 4JZOB 3SOBL 3GZKA 2FH6A 4JDTL 4LLMA 2ZWLT 1F4YH 32C2A 4W4OA 1FZKB 1BJ1H 4P4RB 3PGFH 25C8H 3DROB 4IRZH 2GSGB 5T3XD 3U83A 1EAJA 4MD5A 2A6IA 5EU5A 5C08E 1RZJC 3R0NA 1AGBB 4P23D 5EZIH 1YN7B 3TZVD 1OGAB 4DN3L 1G7MA 1RZKL 3REVA 3ZO0A 4GKOA 1YYMH 1HQRB 2CLVA 2GSIB 4YNYA 1S9KC 3D9AH 3QUMB 4PRHE 5EOCJ 2ZOLA 1K85A 2BZDA 2NZIA 1F3JA 2BVOB 3QRGH 2BJMH 3O9WA 5EIIA 4HD9A 5FOJA 3WJJA 3IU4H 3QH3B 3S5LG 2IPKA 3ES6A 5I30H 1MRDH 5CIPB 2ARJB 4OCSH 1R3JA 4YXLH 4POUB 2HJKB 4P9HC 3TJEL 5BMFH 5HTSA 3EFFB 2DKSA 1NMBL 3FQXB 5KN5A 1J0IA 1RK0A 2EH7H 2J88L 4KFZC 1U6AL 5AUMB 3QHTC 5CEZL 1KG0B 1JVKA 2NY1D 1BWWA 4HUXA 1HHJA 1YN6A 5EFIA 3IYLW 4EUPG 1U8KA 3R4DA 4OBSA 3T3PF 5FOBB 5I16A 2R0LL 3D69B 3PQYA 4WO4D 1SY6A 3DO7A 3P4MA 4JN2B 3PWLA 1MI5A 1XGTB 1G6RL 3VXQA 3P9LB 3KPRD 3WXWL 1OSPL 4PJFE 4ODBD 2YWYA 4PREA 1D9KA 1IAMA 2VO5A 2VWEE 3OZ9L 5C07A 3E0GA 3RDTB 5DFTA 4BZ2L 5HDOA 1MCIA 3OKOB 1BM3L 3AAZB 4XNZB 4QRPB 1ETZB 4QNPF 3P4LA 1WIOA 1MJJB 1DDHA 1KELH 1ZWIB 4M9PA 3FZUD 1UCBH 3VDBA 5E7BA 1M05B 1U36A 3IFNH 4HIXH 1R3IL 1AO7D 1KCVH 4JPWL 1ZLVK 4ENED 4EVNB 1KB5L 1CXLA 1P7KA 1WC7A 5E2VH 4A6YA 5HGAB 2X1WL 2F53E 3VCLB 3BRGC 1BQLH 4JANA 3VH8B 3TPKA 4PTUA 4WW1A 3T0BA 3O8XC 3T65A 2XG4A 2OQJB 5ERWB 6FABL 4HW6A 1CLYH 4HG4K 3B2UD 5DJZB 1AGDB 1OSZA 2X2YA 5E9DA 5FA3A 1IGTB 2AXFB 1T21A 4NWTL 3TT3H 1RUML 1D6VL 3M1BA 3GGWA 1RZGB 1YEGH 1JZ4A 1OT2A 5EORL 3HG1A 2VXQH 5CILL 4CUCA 1Y18A 3WHXB 3HZKA 5IR1B 4POYA 4ONHB 4ORGB 2RB8A 5F7KC 4HEME 4M7ZC 2FWOB 1RUAL 1H0DA 4CMMA 1AR1C 5IIEB 2EO1A 3CFKA 1PZUB 2APXA 4YDJA 5F93C 4LLYA 4Y4KA 1N0XL 3VWJC 1DBMH 2MJWA 1NCDL 2R2EB 1MH5B 1G9EA 3IAQA 4DVRH 2QQQA 5D9SA 1LNUB 5K59F 4WI9A 1WBZB 3SGEI 5BOPA 4MCZA 4JFQB 1FVCB 1E4WL 1UWXH 4WEBL 3HNTH 3NCYS 5IGXH 4HIHB 3TVMB 1JFQL 5HHOD 3AY4C 3QHFL 4RMQA 1NUFA 5TF1H 1GPOL 5KW9L 4AQOA 1CFQB 1HZHH 3KPQA 2P43B 5J13B 4KPHH 1D3CA 3MC0A 3TN0A 5F7UA 3QI9A 2WW8A 3CVHB 1XCQA 4PY8J 12E8H 3C8HA 4NKDB 3RJDA 1XF4A 4X4ME 2BSRA 3MNVB 3MNWA 3PJSA 3VFOA 4O2CB 1MAJA 4BZ1H 3GMRB 4YAQB 1JP5A 1NAMH 5HGDB 4LOUD 5DHXB 4NCDA 3GBNH 3CC5B 4KHTH 5KSVB 2P47B 1NBVH 3BP7A 3CCHA 4JEGB 2OL3A 4G7YH 1KCRH 2BVYA 4M6OH 5IB2B 1TTGA 5BW7A 2W65B 43CAB 5I66B 1EO5A 1CYGA 3DI3B 5EG6C 3V2AR 3SPVB 3QZWA 3E6FB 3U0WH 4UDTA 4X7SH 2WQRA 4Y1AB 3B6SB 4OIIH 1TTFA 2BERA 2NY4B 1DLFH 2ZCLL 3HE6C 5DMJB 4ODVH 1L7TH 3I6LE 1F97A 4R4ND 3LPFA 5MI0C 1G9MC 1NGQH 4HS3A 4QY8B 4BH8B 4F9LA 4ZXBD 4EN3C 5C0IA 3TBVA 3PL6B 1IQDB 1V3MA 2GI7A 3O2VL 4OBRA 1NEZA 4FABL 5BZDA 5GS0D 3UTSA 4P4KA 2PYEE 1CFSB 4G8GE 5IB1A 5DMIH 5H94A 2AKRB 5DVKA 1AGCA 1YNKH 2P8PA 1BZQK 3NN8B 3DRTB 3U7YL 2NW3A 3WFDH 5F9OL 3DGGA 1XF2B 1RFDH 4MAYA 4FFYH 4P59H 1B9ZA 5EU6D 3FO9B 1CZ8H 1KPUB 2OP4L 4KHXH 3QXAA 5JW3H 1P4IL 4G6FD 1EJOL 4ZAKC 1EHAA 1QVOB 5DUPH 2X4OA 3HNSH 3G6AB 1HEZB 1T20B 3NCJL 5HDBF 2FEEL 1CR9L 3MRGA 3QJHA 4KY1H 1EFQA 3HAEB 4Z7VB 5TE6H 1SEQL 4PG2A 3AFLA 1I8IB 3G6JB 1BF8A 1XIWA 3G04B 1ODAA 4X5XB 1T2QH 3BVNB 3NFPA 1QLRA 2WLZA 5D6DA 1UCTA 3BH9A 3UBXB 3ETBF 4GKSA 2AGJH 3CFJA 1MFDH 4KRPC 3U36B 4KI5F 1E4XL 1I1FB 5IB4B 4PGCB 1EX0A 3SKOB 2YC1A 1A3RL 1LK2A 3TJHD 5KS9B 3LOWA 5F89A 2FX9L 5T3XL 3CLEH 2MCPL 4WUUD 3B3IB 2FEDD 4WEUD 4JCLA 4U1KA 2DLFH 2DQEL 1I7UB 2ICES 5KVGL 1ADQA 2C3GA 2O5ZH 2CO6B 4WHTA 1MI5E 3RVTC 4FQ1H 3WFCH 4XNUL 4LKXA 4N0RA 3BO8B 2XG5A 3H3BC 1Z5LA 1JNLH 3HPLA 1UVQA 1ZE3C 3FB6A 5C07E 3V7AG 4HKZA 3QUYC 3VGBA 3FO0L 4PLJD 1NC2D 3HFMH 3BD4A 1HCFX 3H9HB 5DT1H 4P5MB 3GDBA 4JZNA 2DMKA 3DX9A 4E42B 4QYOA 1LD9B 3F7PC 4N0UB 1HNFA 5EU4B 5IWLA 3HR5B 1T0NA 3QCTL 2VDLL 4QF1A 1MREL 4M6NL 4GRLB 1N5AA 3QIUC 1HCVA 2VDOH 5IBUB 3UDWC 5TE4H 5C0RH 2ZOKA 2LU7A 5BXFB 2BP3A 5HYSA 3N9GH