5DJCB

Fc heterodimer design 8.1 l368v/y407a + t366v/k409f
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
207
structure length
206
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLVCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSFLTVDKSRWQQNVFSCSVMHEALHNAYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 206
sequence length 207
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djcB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djcB01
3QEGL 2YOCA 2R2HA 2HN7A 3QXWA 4Y1AA 1I8MB 3BVNB 1ZHNA 4XPAL 3QEQE 4YNYB 4AEIH 4Y4KD 1MFBH 3GO1H 5MEND 4LVEA 3O6KH 3BPCB 4NO0B 5C6PB 3FQRB 3HE6C 3KPPB 3BP6A 3MJ7B 4EN3C 2DBLL 3B4NA 2FECI 3TF7C 1XGUA 3QCUL 4ZYKA 3PJSA 5LVEA 1L9NA 1MFDH 4KMQA 4OKVB 3ULVL 4BZ1H 2F9BT 4KDTA 4Z76B 5IOPB 4ZAKD 1ORSB 1IZJA 3B2UD 5IW6B 5C0GA 3VDAA 1VFUA 1PJ9A 1J0ZA 4RGNB 5CAYB 2YD6A 3B9VA 4R2GD 3D39A 1Y6KR 2VL5A 1BFOB 3KXFE 2BVTA 1MQKH 2OQJA 5FGBA 1D5XA 3I9GH 5DD0L 4LNVA 2XNAB 4S1QH 3QWOB 4O2CA 3EBAA 4LSUH 3IDIB 2YA2A 3NTCH 4BFIA 4NIKB 1W0YT 1L6ZA 2EDEA 4NNXB 1NUGA 3QRGL 3UTZA 1OWRM 2GSIA 5EZLA 4YHML 4F58L 2OL3L 5IHLB 1RZKL 4GBXB 3BGFB 4XCCH 1G9EA 3QFJA 4WTWA 5EO1B 3SPVA 2EC8A 3P4OB 1NC4B 5LXGH 3OAUL 3IDUA 4PD4J 2VLMD 3WIFB 5J0BA 2H45A 3MXVL 4H20L 3ULVC 4Q74A 4C4KO 3MLVH 4E41D 5ISZD 1YY9D 1X3DA 2CLZB 1U8NA 1KN4H 4OLZH 3GIVA 3M1BB 5JOEA 1LMKA 3KPOA 4WHYG 1IGYB 4PJ7E 3LB6C 3VGHA 4CVZB 2A6DB 4NQVA 1TVBB 2VDRL 3RKDD 1NSNH 4OLWL 4L9LA 4ALAH 3C8KB 3FB8A 3TN0C 1BIIB 1BOYA 1IARB 5C0BD 1BWWA 1NCDL 1EH9A 3D6GA 1LE5B 1HE7A 1ZE3C 5E56A 4KJWC 4X4XB 4J2XA 3WFCH 2ICEB 3EDDA 2RHEA 1SYVB 4LHJB 4NQEB 3LQAH 4X98B 4P4RB 2X4SA 3KYOB 3SQOH 1RZKC 3MR9A 3HNTL 3U0TA 3UPCA 4PP1D 3P9LB 3ARED 2VAAA 3HZKA 1N0XL 4I8DA 4RFEB 1K2DB 2VLRA 3ARGB 4ZFOL 4NQCA 3QQ4B 4DFHA 2IFFH 3PGFL 1LNUB 4OQTA 4XBEL 1WT5C 3QZWG 2Q1EA 2ZCHL 5AWNH 3RTQC 1MHEB 4U1IB 3ZTJG 1KFAH 4JQVC 2NXZD 1CL7I 5MEOA 2YKLL 4QRSB 2BVYA 2LVCA 4FFZH 1NGYB 1Z0NA 5D9SB 4I0KA 4N0YL 4Z0BH 1V7ML 5EOQH 2NY6D 3BT2H 3BP7B 1KJ2L 2Z4QA 1RIHH 2FHCA 4D9RE 4YHYB 1F4WL 1J87A 1NEZA 3BSZL 2FATH 5K59E 3BKJL 1RZ8A 2IALA 2ZG3A 4PUBL 3RBGA 1S7UA 2DS4A 4YGVA 5FHBL 3HE7B 3VG0L 4QXGH 4KVCH 4BM7A 1NANI 2YD7A 1QACA 1HDMB 3BUTA 1CFNA 2ADJB 1HYSD 2WAHA 1D5ZB 3EYFA 1VPOH 3RIAK 3MMEB 1ZTXL 4GG8B 3MCG1 4JO2H 3GM8A 4QHLA 1NMCC 5F1OB 2FEEL 1CQKA 5EULV 1J1OL 1IBGH 4ZDHA 1KLUA 2VZSA 1IGML 5C0DA 3GSWA 5L8KB 3HG1D 1F11A 1HXYB 2QQNH 1T22A 5JORB 1PG7H 1N5YH 5D1ZC 2C1OB 4PS4H 5E00A 4HT1L 5KVFL 1I1AD 4NHUA 5C0EB 4XPFH 4XPTL 3JTTA 3LN4B 1J0YA 5DURD 2CSPA 4F8QA 2HWZH 5JHDA 1AFVL 2WWKT 3VGGA 1WFTA 1UWEH 5FCUH 5L8LB 5IVXA 1YQ2A 3TO4D 4G6MH 3MV7B 2V2WB 3C60C 5ESVB 3C87A 5IQ9A 2PR4L 4BSJA 4G80B 3L9RA 3WO4C 3SKJH 3SDDA 5CMAA 4UT7H 3HI5H 3RWDA 1VACA 4U1HA 4JHWL 2J7LA 4NZRL 3OKOB 5FO9A 1M05A 2EDOA 3C6SA 3VXPB 3NCFB 5TDOA 2CDFA 2FSEB 5FO7A 4QCIB 35C8L 4GLRH 4ZPTA 5I1IH 4JEGB 4N90E 3TH4T 3NCEB 1G6VK 1UXWA 5BRZE 3MRJA 5GS2D 4WFED 2BFVH 3EOTL 3PWPE 4ZS7H 5EU5B 5T1DH 2UZXB 4HK3J 4NUGL 5HHNA 4OV5B 2CUMA 1OP3K 4S1SL 2A9MH 4XBPB 1M4KA 3PP4H 1AJ7H 4I5BA 1YMHB 3QPQC 2QJDA 3EOBB 1QKZL 3VRIA 2AJUL 3I3DA 4KY1H 4OCNC 5CILH 4F9PA 2GCYB 5FB8B 1NAMB 2F54E 1QLEH 3G6JE 4JPVL 5FYJD 4OUUA 3MTRA 3BPLB 1T4KA 1UQSB 5EG6C 3T0EA 4JR9L 3LS4H 1DLHA 4LP4A 2AK4E 3P11L 4HPYH 5DDHA 4Y2DC 5I6XB 2E9WA 2G75B 3O2VL 3JVGA 3GHBL 4AG4H 2GJ6B 2XZZA 4LMQI 5J6GA 3LVEA 4PRHE 1JMZA 2BRQA 1T1YA 4Z0XB 3FQWA 4UDUA 2XFXB 3PGCA 1IEBB 4G9FA 4O58L 5FEBA 3FQXB 3FOLA 4X6DA 1AGEB 3LSOA 3O3AB 1DJSA 4B50A 2GUOA 3QH3B 4LHUD 5FCSH 4L3CA 3KPQB 3FCTA 5C0CA 1PQZB 2IPKA 4NNYB 5B3NA 3IETA 2NY4D 2Q76B 5JXED 3CFCL 5GGUA 5MEQB 2XIDA 4P4KD 2NY5L 5IFJB 1NAMH 1A6UH 4HWEH 4MXWL 3QEQB 4WGVB 5IGXL 4WI2A 5D1QB 4QHNA 3BKYH 3WBDA 3WDJA 1LDSA 2GITB 1K8DB 1U8IB 4MQSB 1XIWC 3FO2B 4Q58C 5I71C 1FP5A 4D9LL 5KZCD 4PRPD 4YDLC 2VQTA 3STZA 1IM9B 4LIQE 4WUUA 5TQ2L 3VFPB 2R4SL 1VADA 1KIPA 3O41A 2CMRH 1FNHA 1SJHA 3B6SB 3OJDB 1BZ7B 2WMPA 3U0WL 5KSAC 2FGZA 2W60A 1RZIA 2X9WA 4JY5H 5C0IA 4S1DD 5LBSL 1HSBB 1IJ9A 2HH0L 2GW5A 3QNYA 3T1FB 4F7EA 1S3KH 3KXFB 5J3HC 5FYKH 1TZGL 1CU4H 3OKNB 4K2UH 4LQFH 1DBBL 5F3HA 1CS6A 2FX7H 4GMSL 2DAVA 4CDHA 1D9KC 4HS6B 1X5ZA 4ERSH 2FJHB 1ITBB 5IHUH 3KJ4B 3DV6A 4JFEA 4DQOL 2ERJB 1UB5B 4UDTA 4OCSL 4X6FB 3RIFK 1Q0YL 3L3DB 3WL9B 2P48B 3AAZA 5EUOE 3P9MA 4P5KA 3PNWB 3V6FA 4JG0H 3G04B 1VEOA 1IE5A 3DX9B 5DK0A 5J4MA 3S88L 2AV1B 3S5LA 1TJHH 1CICA 3RJQB 3GMMA 1KCRH 2YPKB 4JM2D 4Z7OF 4YIQB 4U6HA 4J3WA 1GGBH 4YHNA 2UZIL 4M6AA 4FQQB 4WI9A 2IJ0C 5DD6A 4L8CB 1N3NB 3BYTA 1SM3H 3LRSA 5D6CB 3RDTA 4DUXA 3BQUC 4PJ7B 3BUYA 4GSDL 4NPYB 2VLKE 2EXYC 5CINL 3OB8A 1S7WB 2CDEA 3BXNB 1OGAA 1XCTB 4Y89A 3O2WL 5I2IA 1OCWL 2BNUA 4YK4C 5FF6B 4HJ0C 3AMKA 3ARUA 5FECA 1P84K 1HKFA 3F7VB 3MRIA 2P5ED 5JXAH 1PKOA 4RNRB 4XAWH 5DEGA 2AW2A 5ALCH 3OB0K 4DOHE 4FABH 3K46A 3TH3T 4NQSB 4ZFZA 3DVGB 1HQ4B 4OFYA 1FO0A 4QNPF 3VA2C 1Y0LA 4LKXB 2W65A 1YPZE 4Y1AD 4XNMA 1FLRH 3UTPE 5F89A 4OGXL 4HG4K 4PV9A 3SCMA 5JR1L 1EMTL 2OTUB 4NCC1 1WCBB 4ZFGH 4ACPA 1F4XH 2W1NA 5DFTA 1CI5A 1DQQB 5GZOD 1Z9OA 4RAUA 5EWIH 5F6IB 5DJ2B 2V2TB 5J13C 4Y8AA 3L5HA 4BK4A 4JFPA 1KEGL 3K2UH 4G8GE 3G5ZA 4OZFG 5E9DE 3VCLA 3C09B 4O5LH 1UM5H 3TPKA 1OOAA 1CTNA 3T0AA 4AEIL 5MP6H 4ZOEA 2ZKHH 3S37X 3MJ9L 3TVMA 3D39D 3RVUC 2NY2C 4L8SC 5CCKL 1MCOH 5CIPA 1MJUL 4XZUA 2ZOKB 1NCBL 4OM1H 3O8XB 5GRVK 2VSCA 5L9DH 1R0AH 2HT3C 2ICES 1CXHA 4BH7B 2V9TA 2YUWA 3DURA 2NQCA 4ONGL 4XTRD 3WLWC 5TDPA 3ULVF 3DLQR 3F58H 1NMAH 4WI5A 1Z9MA 4NKMB 3QUXB 3CVIH 5DQJA 2Z31B 3IDXH 1JYWA 4S2SB 2EXWC 4LAQH 3QFJD 1MQKL 3W11D 4GAYA 4MD0B 4QTHB 3VJ6A 3QQ9D 4Z77A 3KDMB 3RUGF 3MLWH 3HUJA 5CSBA 4HK3N 4G42A 4LSUL 4LPXA 4P46A 5IHBA 2CIKB 2NR6C 4OBSA 2UWEE 4KVNL 1QPPA 1FVEB 3QUKB 4EI5C 1L0YA 4RMVA 2C5DC 4XB7A 4XCCL 5CGMA 2PF6A 2R56H 3PDDA 4BZYA 4OZIA 3BPNC 3X11B 2DM3A 1YEGL 1CFTA 2CR3A 3S97C 3QO1A 2I9LA 2HG5A 5EPMA 4BKLB 3MLVL 1KSRA 4WFHE 5HVHC 4NDMB 2EIEA 3H9SA 5HI5C 2Y72A 3KWWB 1KN4L 4OLZL 3UAJD 1QSEA 4TSAH 4DZBB 1NBYA 1V3KA 1ZGLA 4ZFFA 5C0NC 2X10A 4IRJA 4GAGH 2APWA 1FH5L 4R7DB 1VGKB 4UUJA 2B5IC 3T4YB 3P4MA 3WEXB 5BRZB 2ZUQB 3NIDE 5C08A 3GI8H 5IJVA 5T5NF 2VLRD 3PWPB 2EKSA 4NQCD 1NCCL 2X4OA 2UUDK 4OLEA 1QA9B 4OD2A 3I6KA 4UTBL 3TA3A 5EOCH 1XAUA 4U1NA 3ZYIA 4Q9CA 3WFCL 5FM8A 4NYLA 4R4NC 4UIMB 3EO0B 4UQ2B 4C55A 1UACH 3LQAL 3RWIA 3K80A 4YFEA 1MCIA 4L1DA 4R97B 5FYLE 2F54B 1XR8B 3G6JB 3SQOL 3RZCB 1A22B 3WJJA 3DOSA 5KAQG 2PETA 2CXGA 5ELIA 3RVTC 1U3JA 4A2MA 2AK4B 3CPLB 4EVNA 1CFBA 3WJLA 4QF1A 3U0PA 4RGNC 3RWEB 2YXFA 3D18B 3MNZB 5AWNL 4AL8L 1KFAL 1MIEH 1JHTB 4PRHB 4KKCD 3DROB 2FEEI 4FFZL 3WXWL 3AS2A 4U7SA 4XVSH 1HQRB 5DC4B 5C6WH 4NO3B 4OIIL 1CDBA 1IC5H 4Y4FA 3BT2L 3VXRD 1UZ6F 3GBLA 1RIHL 3BH8A 3DI3B 5E2UH 3MLSH 4JZOB 4RAVA 5GSRA 2D7QA 4RMUA 3KPRA 4GBXC 2FATL 3LQAC 4X5XA 1T89A 5J12B 2BVQA 2XN9D 3A6OA 4QXGL 4KVCL 5KSBF 4ZUUA 3PWVB 4FTVE 1C5DB 3VRJA 5JHDD 4LF3A 1VPOL 2ATPA 2YRLA 3B2VH 3GSNL 4C56E 4JFDA 1IBGL 1JNHB 3L3HB 3WKMH 4F9LC 5F7UA 5FA4A 1UYWH 2PO6B 2QQNL 1CVSC 2VDMH 3FQNB 3BRFA 5DS8B 3IGAA 1N5YL 4PS4L 1NDMB 3SDDD 3TV3H 4PG9B 2E7CA 2V7NA 4OQ1A 4XPFL 1FAIH 5KBNC 2HLFC 1NFDE 1Z5LB 3ARBB 3GMOA 2HWZL 3ARDB 3NA4A 4X8JB 1UWEL 2VR4A 3SBWC 5F9JA 4G6ML 3FJTA 4Z7UA 4FZ8H 3G5YA 3WUWB 4P2QA 2R1YA 3CLEL 2R1XB 5DLMH 5EUOB 2BVEA 5FOJA 3BIKA 4HKZA 5ILTL 3SKJL 2BHUA 4UT7L 3HI5L 5I19H 2J8UE 2DIJA 4IS6A 1ADQH 4LIQH 4WCYH 4R96B 5JLZB 3HC4H 5J6HB 4OIBA 4XP6H 1A6AA 1J8HA 2FH6A 4X6CE 2COQA 4U6YB 1CGVA 4L4VA 4MXVF 4BUGA 3T0ED 2ZCKH 1OVZA 4IBLT 5T1DL 1QFWL 2HFFB 4HKJB 1S8DA 2VLKB 2A9ML 3QNXA 3PP4L 1AJ7L 1NGZB 1EBPA 1UZ8A 4LCYB 5E94A 4WY7L 3LV3A 4NKDA 2EIZB 4KY1L 4L8BB 5CILL 3WMSA 2LABA 4YHYC 3R8BB 5KVGH 3T1WA 1ZT1A 1Q1JH 3VRLF 3N1PC 4AENB 43CAB 3S36X 1QLEL 4ZSOA 2BMKA 3T4AB 4G9FD 2BERA 2IQ9H 4PJ8A 1CE1H 2CJUL 1P1ZA 1BJ1H 4DOHB 3QHTC 3D9AH 5I66B 2HMID 3ISWA 5C0CD 3MUY1 3A67L 5DJZB 1T1XB 2B4CH 4NBXB 1RULL 3ME0A 4I48B 3I50L 3OR6A 4AG4L 2R0ZL 1KELH 5D1XA 1YPZB 2AJYH 1TITA 4OFVA 5KVEH 3ZDZF 1W72L 4P3DB 3GDBA 5DJ0B 4PRIA 3BZ4B 1EEZB 5DWUH 1VFAB 3PDGA 1OSPH 1JZ7A 1FG2B 1Q9KA 4JJ5A 4OGAC 4PJDA 3MBEA 3VDBA 3U1SH 4C83B 4D8PA 4H5SA 2ARJQ 4WUUD 3HMWH 3MJ6A 3WN5A 1RPQA 1XCQA 2NW3A 3CFBB 1GZQA 2MQ3A 4KJQD 3KNBA 5EBLB 3VXQA 4G8GB 5E9DB 4HWEL 1U8PA 2NXYB 4DAGH 1E27A 1JGDA 2C3HA 1E28A 3BKYL 2P45B 1NC2D 5IMLB 1U2HA 4P2RA 2ZSWA 4KQ4H 4JY6A 3V7AE 5L0QB 4PJFF 5SX4H 3V6ZA 4G8EA 3RL1A 5HYSG 4PJGF 2K7PA 5F7DB 1X4ZA 4RA3A 3UBXI 2XWBA 3FRUB 1U58B 4R0LB 1NGQH 1K5NB 3MROB 5T1LB 3UDWC 4PJXA 2P8MA 2XTJE 4TN9A 2CMRL 2BHYA 4JB9H 4JFED 4J7RA 4FFYH 3C5JA 3VFWB 1T3FA 1JNNL 3G08A 3VD4A 2VQ1B 2ZUYA 4P5TB 1UH4A 1OTSC 1ND0B 4F3FA 1WTGT 1RI8A 3GFUA 1CICD 1WBZB 5FYKL 3TEUA 1CU4L 1AGDB 3WIHA 5J9PA 4K2UL 3G9AB 5ECJE 4LQFL 5FO8B 3U4BL 1MRCH 3IDYB 2AP2A 2BDNL 3IFOA 1MFAL 4R2GB 5IHUL 2W9LA 3MACH 4AY0A 1FCGA 4J8RA 4X9FA 2JK5B 1NFKA 1R6VA 2UWEB 2I9TA 3MJGX 2XY2A 4EDWL 1JPST 3ARXA 4XX1G 3HPJA 1IT9H 3BPLC 3ZDYF 4JG0L 3QDMA 5D6DA 4M1CD 1YNTB 5SWZE 1OGAD 1FVCB 4LSRH 3MFGB 4K3HA 1EVUA 4ZG1A 2P24A 3C5ZD 1EEQA 4HCRH 5JZ7C 1EEYB 4Y4HB 2BOCB 2XYCA 4F33A 1FC1A 3QEHA 3O3EB 1BREA 1QPXA 4GRMB 4BQ8A 3H7BA 4E0RB 4WHYH 3A0OA 2F53E 3QZWB 2X9YA 3O9WB 1IM3A 2E6QA 3PGDB 4NO5A 4OFYD 1WAAA 1DVFB 3VH8B 3QIBD 4DN4L 1T5WB 4Z7NF 2VABB 1ZWIB 4QRTB 3WDHA 1HHKA 3WUZA 3SCMD 1UCTA 3QI9A 4P9ML 2NTSP 4TVPL 5JXAL 2H32A 4JFYB 4OLXL 3CZFA 1EHLH 1AKJB 5ALCL 5D1QC 1GRWA 3Q48A 4FABL 1P84J 4XP1H 1T0NA 5ERWA 1KIRB 4JG1H 1JUFB 4Y2OA 1X5JA 3PWNB 4BA8A 5KSUB 2DQIH 3BP5A 4WEMB 1EJOH 3GSVB 2P5EE 4W6WB 3PQYA 3U30B 1YEKH 4MSWA 4KKAD 2VKXA 3GNMH 2H2SD 5EC2A 1HYRC 1I8KA 3HZVB 5EU3A 4ZFGL 3SEPA 4XP9L 1AD9A 1UEMA 3L5XL 3KLSA 2GAZA 4PRBA 3EDJA 1F4XL 1JFQH 4HG4J 5C0AA 4I4WA 4U1LA 2FLRT 3ZTJH 3LPGA 4PJEF 3P77A 5F1KC 3ZTNL 3QXAA 1OLLA 1F3JB 4DGIH 3R0NA 3K2UL 4M6MH 5ACZA 5KTEH 1LDPL 1SHMA 4RAHA 2VIRB 4BSWB 4DKAA 3IFPA 5C9JB 5F8QC 4UBDC 3E6FB 1G0DA 2J6EA 3EHBD 2X4TB 1BX2A 1SEQH 5FYLH 4M6OH 4OM1L 4XI5D 5L9DL 3KYKH 3U7AA 1FDLH 1IKNC 3QIUC 5ETUB 2YZ1A 3MRFA 2ZUUA 4MMZC 1Q72H 2HJKA 3MLUH 1NMAL 4ODWB 2ADIA 3DI2B 4FTVB 2BVPB 3ETBF 3CVIL 2FLBT 3IDXL 3DXAE 3QUMA 2IQAA 1RSFA 4JFZL 4LAQL 5DJYA 4C56B 3MXWL 3KR3H 1QVOB 4OAWB 4WW2B 4XPBH 4S11A 2K3TA 1CGYA 5DJCB 1KPRA 4OZFA 4C57C 5DK2A 1IZKA 3H9SD 3MO1A 4KJPC 1T21A 5DUBA 5GRUL 1QSED 2NY0D 3FB7B 2UY6A 5ICZA 1O0VA 1WBXB 1G6RA 1NFDB 3KPSA 5HGHB 2HVKB 2PCPA 1Q9LB 2P4AB 5KJRH 4HIIA 3MRBB 4U1MB 2BC4B 2AXFA 4M8QB 3PHOB 3LQZB 4U1KA 4NWUL 5J1AA 5C08D 4ETQA 3U36A 3VI4E 2ZJSH 1P5UA 3S3PA 1LVEA 3TA3D 4IIQC 4LEXH 4MQ7B 5FKPA 3LKOA 5ESQB 4GXUM 2A74B 4H26B 2J8UB 1BVLA 2FIKB 4TSAL 3TO2B 3LIZL 2OSLA 1KNOA 2BCKB 1YUHB 4GAGL 1I1RA 5C2UB 4WU5A 4X6CB 3FT3A 2KPNA 3IFNH 3VXSA 1I3GL 4WU7B 4YBQC 1QLFB 3O6LL 4P3WA 4LLQB 1F8TH 3RHWK 4XVJH 2OR7A 2B39A 3SDAA 4HD9A 3Q5YA 1SEBA 3C09C 5EOCL 3RVWC 3DTXB 2B1AH 5C0FB 4UNUA 4X0KB 1HCVA 1QSVA 5CJXA 3REWA 1ZS8A 2VJXA 15C8H 4U6VL 3O8XC 4PJIE 4HIEA 4PGZA 5EIIA 3MRRA 3NFPA 5KW9H 4Y4FD 4AIZA 1KTLA 1OD9A 2H6PA 1DQDH 4WWKB 4UINL 3CH1A 4F15B 4U4BA 4POZD 2OTPA 1PGRB 1UM6H 4ELKA 2APXA 2X7LB 2Z31C 1MIEL 3U6RA 4UV4H 3RI5K 4FQIH 3KPRD 1BGXH 2KQMA 4H8WH 4NP4H 1RU9L 5C7XL 3V0AC 1RURH 3DWTA 3IXTA 5GXBB 4KAQH 4KK6D 1KYOK 3C6LC 4Q2ZB 4BK5A 3KGRA 4N1HB 1DQTA 4XMLH 3K0WA 3O81A 5MHSE 1IC5L 1PG7W 4NN5C 1HHIB 1FZMA 1I8LA 1NLBH 4F57H 1OB1A 2DRUA 2GSGB 1JE6A 1RJCA 2I27N 1H3XA 4JFDD 3GUTA 1N4XH 3V52L 3MLSL 5IEKA 1ZOXA 2NPLX 3OAZK 1FORH 5CKGA 5GS2H 3S9DB 5GJSL 5B3JF 2EDLA 5A3IC 1NBZA 4PJ9A 2WLYA 2WINA 3CDGB 1OD7A 4LVHB 5AUMA 5M7QA 3SJVE 3OZ9L 4WI4A 1XF3A 1EO5A 4OGZA 4XCNB 4QYOB 2XTJB 4LCWE 4WFGD 5GGTL 3RPKA 3VMOA 2YR3A 5H35B 2V5TA 1UYWL 3RVVD 4E5XB 3BD4A 3TZVB 4P2QD 2VDML 4N8PA 4GLRI 1J11A 3IDNB 5I75B 5C0RH 3TV3L 4PRDA 3E8UH 4YXKH 1FAIL 4JLRA 5IVXE 1R5WB 1QFWI 3O3DA 2HLAA 4APQC 5HYJD 4TSCH 4HUWA 1F6AA 1NCAL 1J8HD 2EE9A 4IOFC 4HF5H 2QADB 5DTFA 2D31A 1FL5A 5DVMA 3UX9B 4L4VD 1IC4H 3GRWH 4R97C 4FZ8L 5CGYD 2NCMA 1GAFH 1N64H 4EQ3A 5DLML 4P2OA 3VMPA 2BOBB 5SWZB 4HV8B 4LIQL 4WCYL 3WV0A 4O2FA 3HC4L 1PAMA 2ILLA 2LQRA 4WFFE 5BVJB 5DMJB 5F9WC 2YPLE 5D2LA 3TNNA 1CZ8H 4PJ8D 2Q20A 3K1DA 3ZL4L 1OAXH 5FDWA 1KTDB 2ZCKL 5D71L 2PN5A 1ETZA 2ARJA 5DSCB 3KYNB 1QSZA 2Q3AA 5H2BB 2F53B 5E1AB 1A1NA 3L7EA 4FQHA 4P99A 4Z7WE 4X7FC 1KIQA 3KLAA 3O4OB 5DRZA 5D1XD 2Z93B 1AGBA 5IB1A 1WK0A 3RWHB 1BQHB 4Y88A 1EDQA 1T2JA 1Q1JL 4ZOBA 1LEGB 3SE8L 1A1OB 4PRID 2CIIA 4YHZL 3AGVA 4UB0H 4A6YB 1CE1L 4JZJB 1NAKH 2O5YL 4O9HH 5TGBB 1A3RH 3MBED 1SBBA 4GRLC 1LWRA 3D9AL 4P57B 5E8PA 5EIQA 1DE4B 1CLZH 1T20A 1JPFA 3QJFA 3MV8E 4LCIL 5EFIB 5GS0H 3OGCA 3PDOB 1F3DH 1KELL 3BMVA 2W9DH 5CLWA 5DF0A 3MRHA 1I1YA 5KVEL 4R7NA 4X6DE 2WSKA 3ABZA 5DJAA 4LRIA 1JRHH 2VC2L 1WC7B 2N7AA 4P2RD 3CLFL 2R2BB 3QEUB 5I1EH 3L3IA 2DQFA 2EIDA 3UTOA 2R2HB 2ICWA 5HGDA 4GO6B 1LD9A 5FAAA 4HS3A 2DQEL 3REVB 1YEDB 3EGSB 2HYMA 2F8XC 2R1WA 4A6YH 4DAGL 3OPZH 2FH8A 1A9BB 1OF2A 2IH1B 1S7QB 3WE6B 2BX5A 1I4FA 3CAFA 1DUYB 1EZVY 5DRWA 5CP7B 5DVNA 5BO1L 3DO3A 5D4QA 4MNQE 5DVOA 4LLMA 1ZHLA 3KYMB 1A3QA 4ODUA 1GGCL 1M6OB 5IW1A 1NGQL 3LKQB 1A7PH 4X6BA 7FABL 1R24B 1HSAB 2X70A 5F7WC 1M7DA 1HHGA 4FFYL 5BJTB 2IBZY 1NBQA 4I0PC 2XOTA 3ARFA 2ESVA 3T04D 4NQXA 4S10A 2Z92B 2ICWJ 3U79A 3KHQA 3DXAB 5ACLA 3QDMD 4CADA 4NQDA 3ZHLA 2KL6A 4O2CB 1P2CA 1N6UA 3DGGA 5DD1H 1FFOA 4JFEE 4KK8D 2Z9TA 4C54A 1FZOB 5C8JA 1MRCL 5EU4B 1DBMH 2HTLC 3BWUC 4EIGB 3MACL 1KGCD 1D7FA 1TZHB 1ZHBA 3SPVB 2CLRA 1IT9L 1X5XA 3NAAH 1HWHB 4WO4C 4KXZH 4ZUWB 1I3VA 4OKDA 3L95A 1ES0A 5GZNC 5FA3B 4OCRH 1JPTL 3EYSH 4YHOH 1M7IB 2HTKD 3FL7A 4R6UA 3QI9D 3KG5A 4HCRL 3MRCB 1JPGB 1S9KC 3TIDB 5IB2B 2H9GA 2JJVA 3PWLA 5H37G 4FQJH 5JDJA 1ZMYA 3WNLA 3MREA 3L7FB 4KMLB 4XXDB 1J86A 2MNUA 1U95A 5E5MA 1VKXA 3DX8B 3VD5A 3GJEA 3PQYD 3IU4H 1CLCA 3L5WB 2C9AA 1XF5A 2O61B 5E8EA 1HINL 5CSZB 1EGJH 1RJYA 2C4FT 3IAGC 5DGRA 3CFIC 4HUVA 3DUSA 5C0AD 3GJFK 4XP1L 4G9DA 3CFDB 3EO9L 2F8VA 5IV2B 3QT2A 2H26B 5F3BA 2YWZA 3CCHA 4OIAA 3HZKB 2DQIL 1EJOL 2C4FU 2CXKA 4PJIB 4R0LC 1YZZA 4HHAA 4RFNC 1BWMA 1KEML 4XNZB 1YEKL 4DGYL 2VDNL 1YYMH 4BYHA 2OK0H 3OXRA 1CGSH 3BFOA 4Q6IA 1JFQL 1S5HA 2G9HA 4GG6E 4MA1B 3DO7B 1JV5B 5SWQB 4QRUA 2AVGA 2RFXA 1CFSA 2VXVL 3GMNA 1G7HA 4TSBH 4TUOA 5JPNB 4PJ7F 1ZLVK 2XV6B 4DGIL 3S7GA 1AXSB 5BXFB 4K8RH 5KTEL 1YEIL 4ZAKC 1YC8A 2HJLB 4I3SL 3IDYC 1TIUA 2EDWA 5BW7A 2AQ2A 1U3HA 2WUBH 4R2GC 2A1WL 4L3EE 1ZLWH 5C9KA 4LLVB 1H0DB 5DQ9A 3P0GB 1GOHA 4N8VA 4Q9BA 4HIJA 1F2QA 32C2A 1B6DA 4HMDA 1RZ8B 1SEQL 1BBJA 3KAAA 4M6OL 3V0VA 4M43H 1KT2B 2F5AH 3KYKL 5BZDA 3EJJX 1FDLL 1MUJA 3MRMA 1I3UA 1IAIL 2RBLA 3KHOA 4ODVL 2VZVA 3EYFB 1A6TA 1Q72L 1A7QH 2R0LH 4ENED 1CXIA 5I9QC 1L0XA 2JCCE 3EOAA 4Y4HC 4YDIH 5E8DH 3KPSD 3T77A 3BJLA 3SJVB 4PV8A 3GSWB 1F11B 5GS1C 4MAYA 4LCWB 3SGKA 2PNDA 5E00B 1OSZB 1JNLH 4ZNCD 4P9HL 4XPBL 1P9MA 1C08A 1QP1A 1UKTA 5D2NA 1OQOA 1CTOA 1YY9C 3TWCL 3ZT5A 5FOBB 3PV7A 2VLLA 4EIZC 4J3TA 1NGPH 5IVXB 3W5MA 3VFMA 1RAMA 1C1EH 3ZE2E 1MHCA 2GJZB 1X4YA 4FQXA 1NGWB 3VXSD 3RKDC 4P23B 4IRSB 3DV4B 1PKQA 1VACB 1B6UA 4UQ3A 1RK0B 3SDAD 2D2OA 2ZJSL 1L7TL 3V9FA 4UTAH 4LEXL 4MDJB 4R4FH 3U30C 1MCWW 4GW4B 2VUYA 5FO7B 1OWWA 3U46A 3RAJH 3UC0H 2JE8A 5T1KA 3HZYB 3BPOC 5JIPA 3TBSB 1DLFH 2YPLB 3IFNL 1RQ5A 3LN5A 3HMXA 3O6FA 3X13A 1JWSA 4G8IA 4PP1C 1X5GA 2WBWB 5SV4A 5H94A 3AREC 1F8TL 4I5BB 1LO3H 4P9HC 4XVJL 3BIBX 1JCKA 1TXKA 4KKNA 5D5MA 5DEFA 4UU9A 1ZA6B 3FO9B 4EKXA 1A2YB 1AXIB 4Z7WB 5AD0A 2B1AL 5D7LE 1FFRA 4OZHF 3D0LA 2NXZC 4OM0H 1T4KB 4CRPA 4U6XB 5CEZD 1DLHB 2VKWA 3DMMB 4WJ5A 4ZXBB 5INCA 3ZYZA 2BSED 4XNQA 5K9KA 5J06A 4X5WA 5KW9L 2ADGA 3O2DA 2NY6C 3JBG7 4DW2L 4YX2H 3WNKA 4QRQB 5EH1A 3MV8B 1YNKL 1NUDA 4D9QD 1G7LB 3LKSA 5DEZA 4ISVB 5ADOL 4LGRB 4UV4L 4FQIL 4WEUD 3PABA 4Z5RA 2HFEB 4X6DB 1BGXL 4H8WL 4NP4L 5ITFA 4JDZA 4RMRA 3ILQD 4PJ9D 3T8XA 2C3VB 3V2AR 4DFIA 1K6QL 3ROLA 4WW2C 1MJJA 5HDOA 4TRPL 4XMLL 2AJVL 2HFTA 4MX7A 4PJCF 5AZEH 1K4CA 1QNZL 1HYSC 1MELA 1I8IA 4F7TB 5GGQH 1KYOJ 3S35H 2AS5M 2X6MA 4IJ3C 1HOCB 1N4XL 5ID1A 4FXLA 1C5BL 2A77H 3TBWA 3GSXA 1FORL 1KJ3H 4YJZL 2R29H 4WHTB 3WIIH 5FFLA 3WXVH 2MSPA 4JDVB 5HYQB 3R1GL 3STZB 3TFKD 5IEHA 3G6JF 2GY7B 3U4AA 4MNGA 5I8CB 4MNQB 4M9OA 3O41B 4NKIH 4FQLH 2DLIA 1NFIA 3QA3A 4YHLH 2VYRE 4FZEH 2QQKH 2GK0B 3FO0H 1QFUH 1HXMA 2YUXA 4FHBD 4M03A 3TO4C 4ONHA 1S9YA 4GW1B 2ITDB 4HIXH 1ZSDB 4FXGA 1IVLA 2WUCL 3AXLA 4H8WC 4XP5L 5C0RL 4P2OD 3HAEA 2DQDL 1CD0A 4PGBA 1NMBH 3RVXD 4WV1C 4YXKL 1CFQB 3T0BA 4GKSB 1V7NL 2X4QA 4IOIA 3VGEA 4DN3H 3DSNA 4I18A 4HF5L 4UDTB 3B83A 4DVBA 1T0MA 4HGWA 5IMMA 3AAZB 3C2AH 4XVTH 4PRAB 1B4RA 1PZ5B 1IC4L 2R2EB 3GRWL 4XB8A 4N0UE 4LSDA 5CEXA 1AQDA 4OCWL 3H7LA 3TM6A 1A6PA 4M61A 1MHHA 1GAFL 1N64L 4JE4B 3GMMB 1MI5D 1XGQB 3IRZA 4NC1C 1MF2L 1I1FB 4XWGH 2HT4D 2XZCH 1MPAH 3QBTB 5LAXA 4B5EA 2OMBA 4GW5A 4KROD 3SGJC 3IDJA 4UT9L 1RVFL 3HI1A 2OJEB 5KSVB 1JN6B 3J7HA 4OLVL 3RDTB 4HQQL 3BKCH 1ACYL 3VFUA 4JVUA 3DRQB 2IAMB 3BUYB 3RU8H 1OAXL 1RK1A 2J88L 2VH5L 4OSUL 3E0GA 5DI8A 5KS9F 1GOFA 1C16B 1Q9WA 4H25A 3RWFB 1JNJA 1SY6A 2G2RB 1CD1B 3JXAA 5KG9B 4K7FA 1NL0L 3VWJB 1XGTA 5TH2A 3PV6A 2EEAA 5TF0A 1ZVYA 5DHVB 4ZSOE 1FJ1A 1G7IA 3MRIB 2G60L 2UZYB 4X80H 2FR4A 4RMWA 5HGAA 2VZ1A 2F74A 5IK3A 4O9HL 3GMPB 4ZFZB 2BJML 3GGWB 1IGIH 4JPIB 1FO0B 1KPUA 1YN6A 4XXCA 5HBBA 5DYOA 4ODSL 5K9QG 5CEYA 3LS5H 5SX4I 5GS0L 1NGXB 2Y9RT 4K3EL 4O00A 4PV9B 4KPHL 2DMBA 5JNYA 1TENA 2W9DL 4P4KC 2V5SA 3MRKA 2WQ8A 3B5GA 4HEPG 1BVKA 5EN2A 5FYJU 1LK2B 3LCYA 4K94H 4PJDE 4DTGH 4QOKE 3PWJA 3RY6A 1MWAL 2XTJC 2FX8H 1JRHL 1R3JB 1Z2KA 4RAUB 4MXQD 3FB5A 4Z7VF 1RUKH 3MOAH 1N6QH 3NFNA 3F6LA 3VXOA 4GG6B 1R3LA 4QY8B 5DHVH 4OB5H 5JQHC 4JQXC 5J11B 4GT7A 5F7EH 4ZQKA 3VFNA 1VFBA 3TVMB 2WBKA 4OF8A 2QADC 5ANMA 3VXNB 3OPZL 4F7CA 3UBXG 3ARFD 2ESVD 4L3EB 4KK9D 4X83A 4S1DC 3DRTB 1LP9F 1WIOA 1FO0H 4MWFB 4TUKL 1BVZA 4NQDD 3L6FA 1JGLH 5IHZA 1KB5L 3DURB 5EO9B 4X99A 2YD3A 4JFHE 3ZSSA 3UTSE 5MERA 1A7PL 3FT2A 4U6TA 1S7VB 1VHPA 2YD2A 3L5IA 3IJHB 2Q86A 5GS0C 1AD0B 1WBYB 3FOMA 2GYSA 4DKFH 4NFBA 5D7IA 2JCCB 2JB6A 5C09A 4J3VA 5GGSB 1HH6B 1BD2E 1IAOB 4EUPA 2PW1A 5DUML 5DMIH 5DD1L 3I6GA 4P46B 3U7YH 2EH8L 4JM2C 4MCYB 3UXFA 5GS3A 3CDFA 3MZGB 3RX8A 3VFGH 1G7PA 3L3JB 3H3PH 1DBML 2P8LB 4Q0XH 1MNUL 1ULVA 1I9RH 3QJHA 3C8DA 1EIBA 4HLZG 4HUNB 2VISA 2H8PA 4TYUA 3B9KA 1P4LB 4GAJL 3NAAL 5I1GH 1P7KA 4X9IA 1CFTB 3QO1B 4N5UA 5DJ8A 4YHPA 1I85A 1M7XA 4OCRL 1T03L 3NOIA 5JQ6H 2KKQA 3EYSL 1LE9B 4NZTH 2H2PC 2WBJA 3GJFA 4IRJB 2W9EH 5T3ZD 3UROR 1B2WH 3PIQA 1QEWA 2AGJH 5GGRY 3E2HB 3I02A 5E4EC 4ZUTA 4Y5XA 5IJVB 3CSBA 1AO7A 3OWEA 2VDPH 4F2MA 3SQBA 5ESAB 4U1NB 2FZ3B 3EYOB 5HHOA 3TT3H 1Q9OB 5D7JB 3SDYL 3INUL 1N8ZB 5D7LB 2VLJE 3QG6A 4PY7A 1B4JL 1T7WA 2FD6H 5GZOC 1D5BA 3HRZB 1DUZB 4NN6B 2UWEF 2F15A 2Y07L 1CE6A 1KUMA 1PFCA 3IT8D 4EVNB 3LKRA 1UXSA 1QFWM 3ZT7A 3QNZB 1U3HD 2EICA 3LKNA 5AYQA 5JW5A 1O7SA 1V5JA 1YYML 4YDKL 5E2TH 2OK0L 1QBLH 2PW2A 1ZHKB 4PJAF 2DD8H 5L7XH 3VFSB 5IBTL 4I1NB 1KJVA 4ZUVB 2DWDB 4NHCH 5FGBC 4P3CL 5I1AA 1N7MH 4CW1A 1LO0L 1XGPA 3WHXA 1P4IH 4PJBF 4HAGA 4G8FB 4LLUA 3TNMA 3X12A 1OM3H 4QHUA 4K7PX 3P0VH 2EZ0D 4KKBD 4R26H 5A2FA 4LNRB 1TETH 3BO8A 5EZIH 4D0DB 3BH8B 3GBMH 3NIGF 4DKEH 4RAVB 1U3YA 1FCCA 2LTQB 5I1HH 4MAYD 1D6VH 4X5XB 3K81A 3D3VD 3W11C 2AJZA 2Y36L 3IB4A 4NN7C 3RGVA 4M43L 3QXDA 3QQ9C 4YO0A 2F5AL 4NM8L 4M4RA 4OQTL 4M8VA 4LF3B 1IGFH 1A7QL 1JWMA 4XH2B 1WISA 5I17A 3RUGA 4YDIL 5E8DL 2YRPA 2YA0A 3O45A 3KPTA 1AHWA 4PGDB 4OFPA 2B8OT 3BWAB 5I1CH 4FQXD 1HZHL 3SKNA 5HVGB 1C12A 1XF4B 2LE9A 1JNLL 1HILA 5IBUB 1UZ6E 2HRLA 4L9LC 1E4KA 4JM4H 2HJFB 1MLCB 3GMOB 3TIEB 5GRZA 5FM5O 1H5BA 3NACH 3ZKXB 4NWTH 5C1MB 4XAKD 1C1EL 1JP5A 5T1KD 1RUQH 3UJJL 3KPNB 3G5YB 4X4ME 2WANA 5KSBE 3O6FD 2R1YB 1H3UA 3OX8B 4XMPH 5AYUH 3BIKB 3BAEH 4N0UB 3CVHB 2FX9H 1FLTX 5KVDL 1EK3A 4FQ1L 4R4BA 3LEXA 3QQ3B 2FJGA 3QIWD 3HKFA 4G6AD 4XNZC 1QR1A 2K1MA 2I07A 1S9XB 3RAJL 5KOVC 2QR0A 2KDGA 3P30H 4MLSA 4NRXB 3THMH 4EI6B 2X4RA 1BFVH 3GSUB 4LDOB 3QUYB 1DLFL 3X14A 5FUZH 1A5FH 4YQXH 3V5HB 1TTUA 3BHBA 3GMQB 1WEJH 5I8KH 1LO3L 4X4YA 4WW2F 5E94B 3RPIA 2PYEA 1A1MA 4WEBH 5IB5B 4L8DA 1ZT1B 4PB9H 2EDHA 4ZSOB 1TCMA 4PJ8B 3G5VB 3QCTH 4AEHH 4OM0L 1H8OA 1FHGA 4MJ6B 1NFDF 5B38G 2MHAB 3CMOH 4J12A 4RZCA 4ZFOA 3CVHH 2PXYA 3B5HA 1F58H 4X7TB 4KH2A 1R3KB 4YX2L 4MXVE 4QGTA 3T65B 3AS3A 3LD8C 5D1ZA 2RB8A 3S36L 3D85A 3LH2L 2J8UF 1QZ1A 3UTTA 4JJ5B 4PJDB 3AB0B 4QOKB 3VGAC 3MBEB 1QR4A 4BELD 3P4NB 2CLVA 4MA3A 4JO3H 3T3MF 4OGYH 2P7TB 3MLYL 4X6CF 1KJ2A 3N1FC 3WN5B 1FVDB 4U1GB 4N0FB 5AZEL 2NW3B 2PUQT 1JGUL 1NLDH 2A83A 4CMMA 1P4BH 1YDPA 3IYLW 5E03A 1E28B 3JWDH 5I15H 2YEZA 2A77L 1XZ0B 3HNVL 1GPOH 3V4VH 5ID0A 1KJ3L 5F1IB 3HE6B 4EN3B 1QQDA 4ORGA 3V6ZB 3WIIL 1UGNA 5D8JH 1UCBH 2D9QB 3SDDC 2NY7L 3QDGA 1N6VA 4YR6B 3Q6FA 4JFOA 2BNRD 5JW4M 4NKIL 2J1KA 4FQLL 3G5XA 4NT6A 1G7JA 4YHLL 2ZOLA 4JGMA 4FZEL 4KJYB 1YMME 1MCCA 3UTSB 2Z91A 3FO0L 2DM4A 1WTLA 4K71C 1EUUA 1LK3H 4BQCA 3W5NA 5A16B 4PJHA 3EOYG 4HIXL 1IQDA 3NN8A 2IWGA 5GGVL 1X5IA 3O11B 1BFSA 2DIBA 3WFHB 3HZMB 3QUZA 1BD2B 1QFPA 1NMBL 4QLRA 5JOPE 1J0HA 3MLXL 2WWMD 4DZ8A 4JY4A 4F9PC 2XQYK 2AJSH 4G6KH 4PJFE 5EUKB 4PJGE 1ZT4A 5DR5L 1HH9A 2I9TB 3KPMA 4TTDD 1YYLH 4LRNL 2X5PA 5HHVH 2NY3D 3T0EC 5HHME 1T83A 4WNQB 3QG7H 4J4PA 5HYFA 1KLGA 3JV0A 1OAKH 5I18L 2DL9A 2MQ0A 3JV6A 4OJFL 5T5FH 3JVGC 2AJ3A 1MCJA 3RWGA 4ELMF 5CUSH 3VE0A 4EDXB 2DQJH 1CK0H 1IRAY 2CO6B 5ICXB 2P5WA 4NRZB 4AZ8A 3VG9C 4IOSD 4JKLA 1T04A 1WFOA 4OZGF 3RU8L 5EBGA 4HH9A 1U8MA 5HPOA 1T2QL 1JRHI 3OKEB 5GGVY 3OKKA 3UTQA 3A6BH 2HMIC 5A2JH 5IG7A 3GEWB 2C4XA 3O4LE 5HHPA 1CLYH 2AKRA 1XIWA 2NNAA 5I1JH 5HY9A 5IBLC 3ZDYE 4X80L 5IMOB 4QHKI 2APBA 2OI9C 4I2XE 2C3XA 2JJWA 4F37K 3IF1A 1ORQA 2SEBB 5IB3B 3QCUH 2VLJB 4OT1L 5C92A 3BH9A 8CGTA 3MNWB 2QHLA 3BP5B 2G5BB 4MS8D 3CFKB 2DTMH 3IDMB 3I75B 3JUYA 3LS5L 3NZHL 5IVOA 4MSWB 2GFBA 3FHQA 4KJQC 2VTFA 3GHEL 4IMKA 4Y4KA 3DBXB 3RTQB 4X6EA 1EO8L 3FQUA 4Z7NE 4LPYA 4WTZG 5ACMA 3W81A 1OQXA 2J2ZA 5HGBA 4HWZB 1FNSH 5EA0L 3P77B 3R06A 5EZOH 4LGPB 3MOAL 1N6QL 1HWGB 3RRQA 1U93A 1TQCC 1T1ZA 3BD3A 4OB5L 3GSRB 1MCWM 3CU7A 5F7EL 4JM2F 2NYYC 3WS3A 5CWSA 4LDLB 4PP2A 1UVQA 1TVHA 4HMCA 4WRLA 5C09D 2X1PA 4OCXH 4F58H 3D25A 2BSTA 2M2DA 4HJJH 1FO0L 4UAOC 1H8SA 2YBRB 3OAUH 4HZLA 1A4KA 1B0GA 3IKCB 4KXZI 3MXVH 3P2TA 1S7RB 4BH8B 4U7MA 4URTB 3TBYA 4MDIB 5DFVD 1AR1D 4PJEE 5E4IA 3RDTC 4DKFL 3BKMH 1FFPA 4UNVA 3GIZL 3B9KD 4HWBA 4U1JA 3RL2A 3MLTB 3PWUA 4M1CC 2X4NB 4YHKH 1KPRB 3MRGA 4OLWH 3U7YL 1JHLL 5BZWB 3VWJC 1IEAA 3N9GH 4MD4A 4NOFA 1U92B 5I76A 5ICYB 1A8JH 3MV9E 4NKOB 2WBJD 3AM8A 4Q0XL 2C1PB 2J6EH 2PCPB 1I9RL 4DVRH 3UBXA 3MNVA 5I1KL 4V1DA 4HUUB 2OTWB 3C60B 1G9NH 2ZZUT 4U1KB 4JHBA 5J1AB 5KSBB 3T3PF 4ETQB 1AO7D 2R23B 3HNTH 3CFJA 3PHQA 3HPLA 5IROA 2ED8A 1N0XH 1Z0MA 3DYMA 4JRXE 1NUNB 3SCMC 5HHOD 5EB9A 4HDIA 1KNOB 4JAMB 1YN7A 4XBEH 4GQ9H 1X5LA 2DM2A 1FFNB 2EE3A 1B2WL 4WU5B 2R69H 3FT3B 5B39G 4NKQB 2AGJL 3TBTB 2EDQA 2YKLH 2GK2A 1BOGA 4LPVA 3RNQA 4Q6YA 1MCPH 1TJIL 1GZPB 4N0YH 4WW1B 1JZ5A 1BJ8A 4KRPD 1SEBB 4EXPX 3Q3GA 1G6RH 5IM7B 1RHHA 1RZFH 3MUGA 4KKAC 3K7UA 3RBSA 3TT3L 3TVMC 2H2SC 2EDTA 4QXWA 5JDSB 1IGTB 4YXLH 2J8OA 4JFXB 4UV7L 2EDXA 5L2JB 3TYFA 5CD3B 4NO2A 4TVSa 3OJMB 1A9EA 4HIEB 3BOVA 3MGOB 2D7TL 2GEEA 3NFPB 1UB6A 3GMRB 4Y2DB 1KCUH 2O5XL 4U1SA 2ZUSA 2DJ4A 5K9OB 4ELKB 5E2TL 4FA8A 5I8EA 4FQ2L 2DD8L 5L7XL 3OBAA 1ZA3A 1NDGB 1UC6A 3EHBC 4PPTA 1N7ML 3CUPB 4YC2C 2X05A 3H2WA 3RGVD 1FPTH 1F90H 4XI5C 2NX5A 4HT1H 5KVFH 1OM3L 4F7PA 4P46C 3HS0B 1XMWA 4LARL 1TETL 3MUHL 3V0WL 2C3GA 3WYRA 3DSFH 5EZIL 3GBML 1A6WH 1AFVH 4DKEL 2Y5TA 5I1HL 4HBCH 3TN0D 3VWKB 5DRXA 1D6VL 2UYLA 3BX7C 4RQQB 3BZFA 4XPGH 1KOAA 3S4SA 2FNBA 4NFCA 2BVOB 2PR4H 4QRRD 3V5KB 4YDLB 3SDCA 1I1AA 1IGFL 3HI6H 2VR5A 3DUUA 2VITA 4NZRH 4ZOAA 2VUOA 4FS0A 4NQUA 2HVJB 4IRJC 3BZEB 2AQ1A 4XCFH 1YMMB 4Y16A 4YFDB 3V7MA 5I1CL 2DN7A 1JTOA 5D2NE 1MVUB 4PG2A 3E2HC 1I8MA 3BVNA 3IAQA 4YNYA 1XF2B 1DCLA 3EOTH 1ROWA 3G6AB 4NUGH 3NPSC 3O3DB 3W0WE 4CNIA 3FQRA 3TA3C 3KPPA 1PY4A 4HUWB 1QKZH 5INDB 3NACL 5DTFB 2LU3A 2XZAL 4NWTL 4OKVA 4MYWB 3HCVA 2VZTA 1I7UA 2ZG1A 4Z76A 4PJFB 4PJGB 4FQPA 3WJJC 2VAJA 5DA4A 5E8OB 1OLZA 5BS0E 3BAEL 3OL2A 4KQ3H 5HHMB 1RY7B 2FX9L 2C26A 1INQB 1UKSA 1BFOA 4X4ZA 3WJLC 3O2VH 3ESVF 2E7LA 2CD0A 3PUCA 2L4OA 2M8XA 4LEOB 1MRFL 4OLUH 3HLAB 3P30L 3THML 2XNAA 3TPUB 5BQ7B 5FDWB 1BFVL 1N2RB 3QWOA 1VGEL 2VR9A 4O58H 3BQUB 1A5FL 4YQXL 1N59B 3ULUD 2PXYD 1SYSB 4XHQA 4I9WD 1A1NB 3H9ZA 3Q0HA 4NNXA 3RWJB 1WEJL 1BIHA 4PTUB 4Y4FC 5CGTA 4I0CC 4D94A 4HH8A 3PF2A 2X41A 5EIVA 3T2PA 5IB1B 3CFCH 3O4LB 3H9HB 1B9ZA 1KCKA 3S34L 4POZC 5IFAL 2X89A 5D1ZD 2VDKH 1NC4A 3D85D 5JO5A 3UTTD 2LTQC 3QCTL 5IGXH 1ITCA 1U8QB 4AEHL 1I7RB 5IVXF 2PYFA 2DQUH 3MYJB 1T89C 2HFGL 5E8PB 4I2XB 1T20B 4KK6C 3O6ML 4Z9KB 1JF1B 2WNGA 3M1BA 3VFTB 3VXUE 3QJFB 4D9LH 1IGYA 4PLKD 5TQ2H 3BGMB 4CVZA 2A6DA 3I85A 4R7NB 5JXEA 1TVBA 1MOEA 5DJAB 3MA7B 3U0WH 3I2CH 2QBWA 3C8KA 3TJEH 1BIIA 1LE5A 3L3IB 1FYTE 1X7QB 4X4XA 1A7NH 1VB9A 3QDGD 5DC9B 1WWAX 2ICEA 3SBWA 1TZGH 1T5XB 3FN9A 4X98A 4NSKB 4P4RA 3WO3B 3FN0L 4GMSH 1B0RB 3KYOA 3ZKXC 5DT1L 3JWDL 2OJZH 4DQOH 3P9LA 1I4FB 1IL1A 1GPOL 1SVCP 4OCSH 3V4VL 2NY2B 3NMEA 4RFEA 1K2DA 3ARGA 2ADFH 1Q0YH 3QQ4A 1BHGA 4HAFA 3FMGH 1LNUA 3QUZD 9CGTA 3S88H 1X6LA 1MHEA 3E6HB 4U1IA 4XVUD 2X70B 1Q94B 1F45A 5F7MC 2E27H 5JPMB 4QRSA 3T0XA 3C2SA 2UZIH 1NGYA 1BLNB 5E08H 5D9SA 4NQXB 4PJEB 3FTGB 5CGYC 4CADB 4GSDH 3BP7A 4X6DF 3DGGB 1FFOB 4NZDA 1JK8B 3MRLB 3GKWH 3O2WH 1OCWH 4MJIE 4HPOH 4A2LA 4NZJA 2P5WD 2AJSL 3DHMA 3WUWG 3HE7A 3MV9B 1ZHBB 2G5RA 4PJ8C 4EI5B 1J9CT 1HDMA 3JWDC 4K07A 2GY5A 4KDWA 2ADJA 3BPNB 4HLZH 3L95B 1ES0B 3QG7L 2DQCH 1OAKL 3MMEA 4GG8A 4BQBA 1WQVT 3EYVB 5SWSE 2DMKA 5HVHB 4AJ0A 1XIWD 1CK0L 1HXYA 5CSGA 5DVLA 5JORA 2KBGA 4JRXB 4U7KA 4XCEB 5D7KD 5KOMC 2C1OA 4DWHA 3PWLB 3MREB 2R0WL 5C0EA 3B3IB 5J1SC 3AB0C 3MBEC 1OW0A 3WIHL 4OI8A 3LN4A 4LSPL 2IPUK 3A6BL 4KI5D 5KSAD 4MA7H 1EAPA 3GJEB 1CLYL 3WN5C 1J1XH 2R4RH 5JTWA 1KEGH 1JL8A 1N5AB 4HK0A 4HLJA 1RFDL 5E8EB 5HDQL 3MV7A 1WV7T 5ESVA 5I1JL 3H0TA 5J3HD 5C71A 3NCCB 1TPXC 3MJ9H 4G80A 5FV1L 5GJTL 4CMHB 1D9KD 3NCMA 3QULB 5CCKH 3CCHB 3OKOA 1MJUH 2FO1A 4XBGB 1BP3B 1NCBH 3VXPA 1INDL 3VD9A 2FSEA 2PTVA 4QCIA 2DTML 3FFCE 3VGFA 4ONGH 4HMEA 4M1GH 1FBIL 2AI0H 4L4TE 4ZMAT 5EU5A 4ODHH 4OV5A 4LFHG 4P2YA 4XBPA 1LEKB 1YMHA 1FNSL 1CFSB 4TUOB 5EZOL 1EHAA 2GTZB 2GCYA 1Y6NR 5FB8A 1NAMA 1JI2A 2FYYB 1U3HB 4G6FD 5I0DA 1S7XB 1UQSA 4TVPE 3B8SA 2QL1A 3DIFB 4KVNH 32C2B 2YUZA 1R3HB 4M1DH 1PYWB 4OCXL 4ZNEA 1CF8L 1PEZA 4HJJL 2J3SA 3FT4A 5D6DC 3WFEL 2GJ6A 5BZDB 1MUJB 3MRMB 1YEGH 1U8LA 1LO2H 4POYA 3VU2A 1WIPA 4KRLB 4KK8C 1QFOA 2MCPL 5EBWB 1RUPL 5D7IE 3OKMA 3EOAB 3FQXA 3EYQD 1AGCA 1AGEA 1KJMB 2DYPB 5GRVL 2HT2C 3QH3A 2Y4SA 2XRAL 3KPQA 4WTZA 3BKML 1PQZA 4RISL 4JN1L 4NNYA 4V1DD 2Q76A 1XH3B 1FH5H 5HPMB 3GSQB 5MEQA 5D2NB 5IFJA 3GZKA 4YHKL 4IMLB 3BN9D 4RFOH 1FN4A 3T2NH 1CGWA 1H3TA 3N9GL 4XHJD 1NCCH 1FZKA 2HTKC 2GITA 3QI9C 4I3GA 4GG6F 1JZ2A 1K8DA 4UTBH 1U8IA 4HJGA 1ZVSB 2D7MA 3FO2A 4HC1A 3W0WB 2FEDD 1U8HA 1DBJH 3C5SB 3P0YL 2ATKB 1BQUA 2J6EL 4JKMA 4DVRL 3JV4B 5BV7L 5IR1B 1IM9A 3FAWA 2D0FA 2EDDA 3DVIA 1G9NL 1QRNA 4CVXB 1MEXL 3B6SA 3OJDA 3R0MA 1BZ7A 4U2ZA 3CK0L 5B38B 3C8HA 2UVEA 5BS0B 3Q1SH 4OD1H 2DTSA 4KZEL 2BRRL 1JF5A 1HSBA 4WTXA 2AXJA 3T1FA 3QDJE 3FFDB 5IIEB 2HT3D 3KXFA 5T1KB 5IMKB 4GQ9L 3HA0A 1UT9A 3H6JA 3UP1A 2FL5A 3VH8G 2R69L 3QB7C 2AEIT 3OKNA 4AL8H 3GSNB 3WLWD 5MI0C 1JWSB 3W2DH 1DQLL 2A0LD 4HS6A 3D69B 4HS8L 2FJHA 2JCCF 1XR9B 2BNQD 3U9PL 4JN2A 3VXME 4KC3B 3WXWH 1MCPL 5JA8B 3C9NA 3SOBH 3CFEB 4IDLA 1UB5A 4LPTA 2EXWD 4OIIH 4X6FA 5BVPH 1UH2A 1G6RL 3HUJF 3L3DA 4FMKA 3WL9A 1RZFL 4KKLD 4Q7DA 3PNWA 4YPJA 1TZIB 4NGHL 4HBQA 3AVEA 3IVKB 3G04A 4ZO9A 4YXLL 3DX9A 4YLQT 1WVZA 3WHE1 4HUMB 1MSPA 2OBGA 3LAFA 2YPKA 5EU6A 5BV7C 1ZT7B 4YIQA 2NR6D 1E4JA 4WJ5B 2NX5D 4MVBD 4OZIF 1G9NC 2LU7A 4FQQA 4X5WB 3ZE2F 4ZTOL 1YNLH 2IH3A 4P59H 2IANE 1KCUL 3ZYJA 3VXUB 4XWOD 1F13A 1U41A 4NPYA 4KGLA 3VXRA 1SJEA 1S7WA 3EJZC 1S9VB 3BXNA 3GSNH 1XCTA 1WZKA 5FF6A 2YHGA 5I30H 5DD5H 1FPTL 1F90L 1KIUA 5L2KE 3F7VA 3BISA 5B8CB 4KZDL 4MA8L 1FYTB 2XN9A 4RNRA 3SDCD 4OZHE 4JDTH 1MCEA 1ZLSL 2DM7A 4TNWK 1K3ZA 3DSFL 1QD0A 2WQRA 5TF1H 4NQSA 2JIXA 1A6WL 2APTA 3DVGA 5FHAH 3TBWB 1HQ4A 4Y16D 4HBCL 3IJYB 2P1YA 1ACZA 3HRPA 4LHQB 5LQBL 4LKXA 5IUSA 1W8NA 3BYYA 4L1HA 4XPGL 5SX5K 4CVUA 5D7SH 2DOCA 3DX7A 2OTUA 3CLEH 1WCBA 4ZTPH 4NO0D 5ILTH 3BP4B 3I6LD 3OAZH 1NFIB 3HI6L 1DQQA 2MTPA 1HXMB 2V2TA 4FOMA 2ZPKH 4LSTL 2Q3ZA 4PGCB 3RVTD 4XCFL 1CXLA 5CEZL 4AM0B 2B1HH 1AC6A 1W72B 4PJCE 1PVHA 4RGND 4MD5B 1QFWH 2DL2A 3SDAC 5A43C 5IKCB 3WFBH 3RNKA 4HWUA 3FO1B 3BZDA 1OTTD 3RIAF 1Z9SA 2R2CA 1TNNA 2ZOKA 4WY7H 1WZ1H 3V4UH 1XF1A 4DVBB 3O8XA 5DHYB 4MJIB 2R9HD 1KG0B 4W70A 2VWEE 1QYGL 5CJQH 5CJXC 4BH7A 5CEXB 2CJUH 3HC0B 4HGMA 1T0PB 3FHAA 4NKMA 3QUXA 4KQ3L 4AT6A 3A67H 2BXYA 1RULH 1NBVH 4S2SA 4GBXD 3U2SB 4LQ1A 3FAXA 3I50H 3IDJB 4HKBB 2X89D 2R0ZH 2W92A 3HI1B 3IFLL 4MD0A 3DYPA 5SWSB 1NC4D 4OLUL 1WZMA 4KTYA 4LBEB 4LLYB 1MFNA 1JPSH 4WDIB 1W72H 1MH5B 1TTGA 5I1LB 1E4XH 5IJKC 2EYSB 5DFWH 2CIKA 2PYEE 1JI1A 4JZNB 2IADB 1XGTB 3QUKA 1G7IB 4LKCB 4MCZB 5IVZB 1QSFE 3GKZA 3B9EA 7CGTA 2VDKL 2E7MA 3VFOA 5IT2L 2EYRB 3WNMA 3VWKC 5T1MB 4BKLA 1FL6B 1CDJA 2DQUL 1CDUA 3ZHDA 2Q7YB 3ILQC 4NDMA 4GOSA 4PJ9C 1VEPA 1S78D 3MJ8B 1KXVC 4DZBA 1X5FA 4NQED 5GIRB 1EHXA 4M4PA 1XGRB 3MRKB 3DNKA 1UFUA 3UTTE 1HK6A 4YWGH 4R7DA 1EFXB 5KS9E 1YECH 5EN2B 5L88H 1VGKA 3FFCB 5FUOL 3PWJB 3T4YA 1JNNH 2ZUVA 3WEXA 5BRZA 3ZMRA 3CIQA 3I2CL 4L4TB 3TJEL 5HJ3B 1SY6H 3ARGD 4D0CB 3TH2T 3EJYD 4LSVL 4XT1C 1NC2A 3NGBC 1T7ZA 3X3FL 5F96L 4JPKH 4EXKA 3TFKC 1A7NL 4QRPE 4UIMA 3EO0A 2VZUA 2MKLC 1CXKA 3OJVC 3U4BH 5DJ6B 2CH8A 4H0IA 1XR8A 3G6JA 2BDNH 3RZCA 4OF6A 4W4OA 1HN1A 1MFAH 4ONOA 3MODL 2VDQL 2OJZL 4LHUG 3H42L 1J5OH 3V7AG 2ADFL 2AK4A 3CPLA 2LU4A 4EDWH 4HXAH 3FMGL 4HWNA 4Y5YA 4OI9A 5A2KH 3DECA 4X99B 2A6JB 3RWEA 1CGTA 5MERB 3D18A 3MNZA 1DN0B 4EJ1C 3QIUB 1JHTA 4PRHA 2E27L 3ARSA 1I9JL 3DROA 4PGEB 4Z7VE 3FB6B 3HE7D 5CS7A 2IMMA 5D7IB 5C0JB 1P7QB 5E08L 1HQRA 2JB6B 3K4AA 4NO3A 5DJDB 4PYHA 4I77H 3X17A 3HHRB 4PJDF 5C07E 3WSQL 4DN4H 4MJ2A 2HT4C 1M1SA 5DGQA 4TOYH 5B39B 1VESA 3GKWL 2AV7B 4JZOA 4CDGC 3H9YA 1GGIL 3V6OA 4OGAD 1W0VB 2KZ1B 4HPOL 1LP9E 3C5ZA 3SDXE 1PG7X 4P9MH 4PJ5A 4TVPH 2IG2L 2VISB 4OLXH 5IB4B 2HKFH 4LLAA 1L4IA 3B9KB 1MJ7H 3PWVA 1BZ9B 4J3XA 3BEVB 1C5DA 2FJFB 3JTSB 1ADQA 2DQCL 5AG8A 4DUVA 3QIBA 4RRPA 3SE3A 1JNHA 3L3HA 5ITBL 1CGUA 3NCBB 3MV7D 4IIQB 3IJSB 4Y19E 1MCDA 2PO6A 4BZ2H 1UJ3A 3FQNA 4MNHB 5DS8A 5DHXB 3RIFF 3CXHK 2XPGB 4K3DH 4L9DA 1NDMA 3RZWA 4PG9A 4XP9H 3L5XH 2IF7A 4Y5VB 3QDJB 4UMGA 3EIFA 4MB3A 1QUNA 3ARBA 5TFSH 3ARDA 4YPGA 4X8JA 4MA7L 1WFUA 2VL4A 2DQTL 3ZTNH 1BQHG 2IMNA 5DMKB 1J1XL 2R4RL 3VXMB 5IESH 3D2UB 2Q8BH 1LDPH 3WUWA 2AERT 2QHRH 3CJJA 3CSYA 2R1XA 1I9IH 5EUOA 3V6BR 3MFFB 1A6ZB 3N1QC 4KI5E 4R96A 5JLZA 4KK5D 1JYVA 2R8SH 5J6HA 3HFMH 4JQIH 1EXUB 1TNMA 5GRYA 4U6YA 1K8IB 5IF0B 1F42A 5J56B 5F44A 5I74B 5JW5B 5MENE 4M1GL 2IANB 3N1MC 2AI0L 1P53A 4OCYL 4OZ4B 1LHZA 3VXTB 1JGEB 4ODHL 2HFFA 5JW4N 4K55A 1G84A 3ARFC 4KK9C 1QRKA 4JFZH 1NGZA 4X9HA 5IQ7H 3V8CA 3UPRB 3QQNA 2GJ6D 3MXWH 4JPWL 4LCYA 4AH2B 5JZ7D 3C6LB 2IFGA 1U8OB 2EIZA 4L8BA 4QHUB 1WAAF 1FNGA 4AENA 43CAA 3L3OB 5L2KB 4KFZC 3T4AA 4NN5B 2ZP0T 1URLA 3GB7B 4YAQB 1HKLH 2RJMA 5GRUH 4OZHB 2YSSB 4KUCF 1JTPA 4AMKH 1BF2A 5DJZA 1T1XA 1TQBC 5EO0B 4M1DL 5FYKD 1RZJH 3BDBA 4I48A 5ADPL 3QXDB 1YPZA 4W6XB 3MGTB 3U48A 1FE8L 1PZUB 4NWUH 1LO2L 1VFOA 3QEQD 1CDYA 2QSTA 4PJAE 5D1QD 1DQMH 1UG9A 5DJ0A 3HTLX 1EEZA 1IEHA 1ZEAH 1VFAA 4HX1B 3HC3H 4PJBE 3LIZH 2Y25A 1GCFA 4C83A 1D5MB 5AAWA 2GTWB 1IM9D 3SKNB 3F8UB 5CP3H 1QRND 3OKDB 2VLME 2VN7A 4ODTH 4Q9RH 5J7CC 3CFBA 4PLJC 1I3GH 3QO0B 4PJCB 4QXTB 5EBLA 1OY3B 1U3ZA 1BMGA 1BQLL 4E41E 5ISZE 3NIGE 1BQSA 4RFOL 3O6LH 4XGZB 3T2NL 3OAYK 3ZE0E 2A73B 1OAZH 1JHKH 3AFLA 4APQB 1FNAA 3KXFD 4JKPL 1DBJL 4TQEH 4U0RB 5F7DA 2MCG1 1O7VA 2XXCB 4H88H 4CMHC 4OF0A 1ZLUK 3FRUA 1U58A 3GK8L 3MROA 1IGCL 5T1LA 1MCKA 4XC1H 3AMLA 1A21A 3EZ8A 4C59B 4YBLB 5C0BE 4U6VH 2EC9T 4B0MM 1F97A 2V2XB 4K7PY 2VQ1A 3Q6GH 4P5TA 3Q1SL 4OD1L 4UZGA 1QR1B 4UINH 1UEYA 1KCVL 1EFQA 2GKIA 2PTUA 1ND0A 4XRCB 1TTFA 5F9WB 1V3LA 6FABH 1FNEA 1AIFA 1WBZA 2JLLA 4Q6IC 1AGDA 5EU6D 3FONB 5FO8A 2EC9U 4NM4L 3W2DL 1RU9H 5C7XH 3BHBB 3SOBL 2PYEB 2JK5A 5BVPL 5TPWL 5F88B 2UWEA 1H3VA 3BJ91 5BW7C 1U3HC 3CC5B 4P5MB 3TESA 3N1GC 1YNTA 1QSFB 1AGFA 1FVCA 3V52H 3QR2A 5CZVH 5F9OH 2XKNB 4RZCB 2ORBL 5HDBF 3KJ6L 2EDKA 5GJSH 3BE1H 4GRLB 1EEYA 2BOCA 1MCFA 1OP9A 1YNLL 4P59L 4WHDA 3O3EA 1OPGL 2EZ0C 4KKBC 4KV5F 4GRMA 2ZG2A 2EYTB 4E0RA 5CZXD 4QTIL 2JIXD 5C3LD 3QZWA 2J5LC 3OZ9H 3O9WA 3PGDA 1MJ8L 1DVFA 5KS9B 1TCRB 3HMXL 1A3LL 1T5WA 4PGJA 4NRYB 4MAYC 5GGTH 1FIGL 2VABA 4J23A 1ZWIA 1KCSL 3CMGA 1W0WB 3SGKC 4MA3B 5I30L 5DD5L 1P9MC 5D2NC 2VXQL 2WIIA 4JFYA 5GRXG 4Z78A 2J8HA 4JDTL 4XNXL 5FGCE 4QRPB 3S96A 5TF1L 1CR9L 5GHWH 1NCAH 5FHAL 1E6OH 4KTEH 4OCMC 1KIRA 3HG1E 2DQGH 4Q9QH 3PWNA 4FQXC 2AEQL 1Y18B 3GSVA 5CJOL 1J7VR 1RHFA 4OFIA 43C9B 2OR9L 4M7LT 3EYUL 5D7SL 3AY4A 4G5ZL 5FXCH 3HZVA 4ZTPL 3W39B 1EV2E 1T7XA 2Z8RA 4WI6A 2ZCLH 3O8XD 1ZLWK 5HYJA 2ZPKL 3T3ME 3MPCA 3BGAA 1F3JA 1FQ9C 1ZANH 4Z7VB 2B1HL 3OXSB 4I0PB 4HFWB 3QCVL 3O6FC 3ZL4H 2Z0BA 4NNPL 2L7JA 2VNCA 3AU1A 5D71H 2VIRA 4BSWA 4HSQA 4J6RH 4JHZA 3QUXD 4DGVH 1G7QB 3E6FA 3WFBL 1FZJB 3VFVB 1P69B 5ENWA 4U05A 5C07B 4LK4A 4G6AC 2P8PB 2X4TA 3BW9A 1VERA 2J12B 1OTUD 3V4UL 1WZ1L 1LO4H 3SKOB 3T2OA 2Z8VC 1DBAH 5CJQL 1LP9B 3SDXB 3SE8H 4WFEE 4YHZH 5ETUA 1T7YA 4N8CH 1UA6L 5I16B 3RY5A 2O5YH 4FFWC 3DX6B 4NC1E 4WO4B 3RA7L 4GH7B 5KAQF 4NZUL 4ODWA 2BVPA 5EZJA 1OP5H 1AP2B 4KDVA 3ORJA 1FV1B 2XT1B 1RUAH 2GT9B 3VE0B 5CBAB 1NBVL 1IKFL 2FHBA 4LCIH 5HXMA 2CPCA 4C56A 1QVOA 4GMTH 5FYJE 1JPSL 4Y19B 3V5DA 5K9QI 5DVKA 2AAVA 2VC2H 3DVNA 1E4XL 3CLFH 3LMJH 1EVTC 1WBXA 5B8CC 1NFDA 4D3CL 2BSRB 2AKRB 2HVKA 3F5WB 5HGHA 3BRDA 1KXTB 2Y7QB 5HY9B 3MRBA 2QKIA 1RIVL 2BC4A 2DQEH 4U1MA 4N90D 5JOFA 4M8QA 1X5HA 3PHOA 3LQZA 2QQLH 5BRZD 1CQYA 5EOTB 3PWPD 5DMGC 4RGOH 2OCFD 4RDQF 4FP8L 3U83A 3ILPB 4MQ7A 4ELME 5BO1H 4YXHH 5ESQA 2A74A 4H26A 4N0RA 3TO2A 1RZGB 4V2CB 1WJ3A 2BCKA 5HDLA 1GGCH 1YUHA 5T33H 2EDBA 3ZKND 4OZGE 4RFNB 2OYPA 7FABH 5F93C 4YWGL 3RZCD 2VE6B 1YECL 5L88L 3L3KA 4Y4KB 3ZDXF 3K8KA 4KHXL 4WU7A 5MENB 4X6EB 1QLFA 2YRZA 2H3NB 4OFDA 4LLQA 1SY6L 4I3RH 2AK4D 2BSSB 3OF6A 4PRPE 3WS6A 3KS0H 3DTXA 2IGFH 4JPKL 4X0KA 4M6NL 3MLZL 5GISH 3W82A 4PRHD 2CRIA 4GUPB 4ZAKB 2AEPH 2EDYA 4I18C 3ZYOA 4FG6C 1LILA 3VI3F 3F12B 1J5OL 3D25B 2BSTB 2DLHA 1ODAA 4X9BA 1M71B 4AK1A 4PBXA 4WWKA 4HXAL 5GPRA 3BDYH 3MRNB 4DEPB 3L5JA 2IBGA 4LOUD 4JVWA 2X7LA 3LZFH 3ULSB 2WWMC 1JPTH 4PJAB 2IPTH 5I9QB 4PJ5D 5CBEA 5HYEA 4R8WL 1FFPB 4JGUA 3SHSA 2NY3C 4ZO8A 4PJBB 5GS1B 1WUNT 3PWUB 4PRNA 2WZPD 3X3GL 5HGGS 4HZAA 3NABL 4NBZB 1CBVL 4I77L 1VA9A 3VA6A 1D6EB 1H15B 4TOYL 3MGAA 2J4WH 4E41B 5ISZB 4PB0H 3TYGL 2PO6D 1CFVL 5AEAA 1S7TB 3UJTH 4Z7QE 3EFDL 1A4JB 1HINH 4H0GA 3S5LG 2HKFL 1T1WB 1MJ7L 1V3MA 25C8H 1D5IH 4HUXB 3ARBD 4K9EL 3EO9H 3ARDD 3CFJB 3HPLB 2CDGB 3WD5H 4XXCC 4KRMB 2RCSH 2V5YA 4XCNA 4QYOA 4UOJA 1LGVA 3T0VA 5C0BB 1J0JA 5H35A 4P2CG 4ZS6D 4LPWA 3IS1X 3P73B 4E5XA 1KEMH 1YN7B 3TZVA 4DGYH 4BZ2L 4DK3A 4IHOB 4TUJA 2VDNH 3D87B 4R90H 4HWBH 2XA8H 1NQBA 3IDNA 4K3DL 5K33A 2XKUA 3RY6C 3W9EB 4OF5A 3ES6B 4PIRF 3BPOB 5E70A 1CN4A 1R5WA 1YEFH 3CXHJ 5TFSL 2VXVH 4H1LB 1PLGH 1MRDH 4Y1AE 5DRNB 3AREB 3LQMA 4EEEA 1OGTB 5IESL 1YEIH 2Q8BL 3HR5B 5TDNA 2L7UA 3M17B 4LSQL 3U4EB 4I3SH 1YQVL 2NTFB 1GHFH 4PREA 3UJIH 1MCQA 3DUHA 2QHRL 2A1WH 4WENB 3T3PE 1I9IL 2VLKD 4NO2B 2NXZB 5SWZA 4HV8A 2IBBA 3QFDB 2R8SL 5D96B 4OI7A 3HFML 4JQIL 4K9EC 5BVJA 2X4PB 4MQXC 2Z35B 1IAIH 2NY6B 2XWJA 4XNYH 4ODVH 3D39E 1II4E 1KTDA 5DJXB 2VDLH 2ITCB 1UKQA 3GMLA 5DSCA 3KYNA 3WFZA 5H2BA 2F53A 2ZSVA 4PYGA 4GKNA 3CX5K 5IQ7L 4ODXA 4H1LH 4UILH 2Z93A 1CT8B 2Q8AL 1IGJB 4P9HH 3RWHA 3UTPD 3OHXA 4F7PB 1RJZB 1LEGA 1A1OA 4A6YA 4JZJA 4M62H 1HKLL 3TWCH 3B9AA 1GOGA 2DI8A 5DFVC 1NCWL 4GRWF 5JIKA 4GQPH 5FGCB 4P57A 3QFJE 4IJ3B 1DE4A 4AMKL 5DUPH 2Q6WB 1F3DJ 5JA9A 1RZJL 2MJWA 3B9KC 5L8JB 5EFIA 3HG1B 3PDOA 2F5BL 3EFFB 1YEHL 2W38A 5E9DD 1I85C 5JIIA 1I1AB 2NXYD 2NW2B 1OL0A 4HEME 1DQML 3IDGB 4OBRA 2VITB 2WP3O 1WC7A 1L7TH 1NCUA 3MV01 1ZEAL 5DURB 2WBJC 4PY8I 2RIKA 3HC3L 2AABH 3QEUA 3KYAA 2E6PA 2CK0L 3OR7B 3VFRB 2W0FB 3TO4B 2XWTA 4Y5VC 5T1LD 1EUTA 1IAKB 2EO1A 4ODTL 4Q9RL 3FRPG 4Y5XC 1T6VN 1BEYL 5F1NB 2NMSA 1YEDA 3REVA 3RQ3A 4RIRB 3EGSA 2CRYA 1U42A 1KLFA 4CNIB 4P5TD 3N85H 4WV1B 1A9BA 2IH1A 3SY0B 1S7QA 3WE6A 1OAZL 4N5ED 1DUYA 5CP7A 1JHKL 5E1HB 5HD8C 3HCVB 4TQEL 1QRNE 2JF1A 5L6YL 1I7UB 1R5VB 1HEZB 2Y1VA 4H88L 3KYMA 4BJLA 5DC0A 2EECA 3MRQA 1M6OA 5CHNA 3LKQA 4XC1L 1R24A 1RZJC 5FIEA 1CG9B 3H3BC 1HSAA 4MJ5B 2VLRE 4NQCE 2IC2A 2C7UB 3F7PC 1SJVA 2X4UB 3HB3C 5BJTA 4M7JH 3MRPB 2P42B 2XG4A 4KRPC 3Q6GL 1U8JA 4FMFA 4L29A 5F6HJ 5I74C 3SKMB 4DW2H 5E8NB 2Z92A 1G1YA 4LGSB 5LGJB 3DXAA 1HI6B 1CYGA 1YNKH 4OF7A 6FABL 4M7ZC 3ESUF 3MOBL 1Q0XL 5D70H 5ADOH 4N9GB 5I0ZA 2NZ9D 1FZOA 3B8YA 2JB5H 2VZ3A 5EU4A 4Y4HD 4WFHD 1TZHA 1K6QH 1LO5B 4TRPH 1EGJA 2AJVH 1MCRA 4G7VH 1G7MB 1QNZH 3TGXA 4FXKB 5EU6E 3O9WD 4ZUWA 2D7PA 3RY4A 1DVFD 5JO5B 5CZVL 1C5BH 2PYFB 5F9OL 1OT2A 5FA3A 5A40E 1M7IA 1RUMH 3RGVC 5D72H 3BE1L 1JIBA 3MRCA 4LHUB 3RHWF 3R1GH 1HNGA 1JPGA 1AKJD 4ELMB 3TIDA 5IB2A 3VXRE 5I8OH 2NY4B 4OTXH 1KACB 5M95B 4P4KB 3L7FA 4RBPH 2Y5EA 4GJTB 1AHWC 4LCCA 4XXDA 4OZGB 1QO3B 3EKCA 4HKXB 5FYLD 5LGKA 5FYJH 5J1TC 2FO4A 5F97E 3FQTA 3DX8A 4H0HB 2XN9E 3TCXA 3L5WA 3DPBA 2QV2A 2O61A 2WUCH 1E4KC 4GFTB 4XP5H 3W9DA 4O51B 1ED3A 5CSZA 2E9IA 5KZCB 4XCYB 1RZ7H 2DQDH 4PRPB 5JHDE 3SKUD 3BEWA 3QISA 1H5BC 5D5MF 1V7NH 4YHIB 3CFDA 5MEPB 5EBMB 5IV2A 5GHWL 2I25N 2H26A 1IL1B 1I7TA 3ZKMD 1E6OL 4U0RC 4KTEL 3RI5F 4Q9QL 2DQGL 1S9WA 3M07A 1F4AA 2CRZA 3KPLA 3ULUL 2X9XA 4F8TA 4UNTA 4PJIA 2VWEC 4HIHB 3SGEH 4OCWH 4YBLC 2VDOL 4DCQB 5KN5A 5EC1A 1MF2H 4D0BB 2EH7L 2A2QT 1FL3A 2NLJA 3MV11 1JGVL 4KI1A 5A1AA 2O5ZH 2ZCLL 3DO7A 1JV5A 5SWQA 4O2EB 2DLGA 1RVFH 4UT9H 5JPNA 5IBUG 5HHQA 4OLVH 4HQQH 3JZ7A 1ACYH 1ZANL 1AXSA 1U6AH 4YUEL 5BXFA 1MWAB 2J88H 1DN2A 2VH5H 1B3JA 1H3GA 4OSUH 2HJLA 4FTVD 4J6RL 4R9HA 5TJWK 4DGVL 1E4XI 1NL0H 4LLVA 1MI5A 1H0DA 4JM2B 3IAPA 3U9UB 4C56D 4O02L 4GAFB 4RCAA 1LO4L 3LEYH 2G60H 1DBAL 1KT2A 2DKMA 1MFEL 3T0EE 2JJSA 4JREB 5IWLA 4N8CL 1DEEB 3ULUC 1UENA 2PXYC 2BJMH 3PP3K 1BPVA 5F7HA 2BY2A 3AS1A 3MA9H 2XG5A 2Q87A 1NCNA 3SJVA 1RUAL 1U8KA 3EO1B 4ODSH 1KB5B 3STLA 4K3EH 2CO7B 4KPHH 4LCWA 4FQCL 4GMTL 4XMKL 2APFA 4G9FE 1OSZA 2P5EB 4JFFA 3NCJH 5JW3H 4LLWB 2MPAL 1MWAH 2HKHH 5C0CE 5FOBA 1NKOA 3FN3A 4RX4A 5GGRB 3LMJL 5E4EB 1EAPB 2AXGA 4JO1H 2DLFL 4HXBL 4ZUSB 2DF3A 5HI4D 4HK0B 2HN7B 2GJZA 4PLKC 4Y1AB 2FBJH 1ZHNB 3H0TB 3TJHD 1BAFH 1NGWA 3H3KA 3C08H 1FNLA 3V4PH 2QQLL 4P23A 4IRSA 3DV4A 3QRFM 3BP6B 1RK0A 1XGUB 4RGOL 1QBAA 4ZYKB 3OF6D 3PJSB 2JTDA 4GS7B 4MDJA 4XPHL 4TUKH 4YXHL 4GW4A 4WUUE 1AI1H 3NH7H 1KB5H 4G3YH 1W2KT 5C3TA 3HZYA 5T33L 3TBSA 5C0GB 2YPLA 8FABA 2BY3A 4W6YB 3S37H 2YC1A 3D39B 2VL5B 5BCAA 4I3RL 1G0XA 1INEL 5I1DA 2OQJB 4WWKD 3QHFH 5TE4L 1D5XB 1ZA6A 3FO9A 3VW3L 1A2YA 1AE6L 2EDJA 2IGFL 3QUZC 3ZE1F 4Z7WA 2CKBA 1DBKL 3VD3A 4DUWA 5DUMH 5ALBH 5GISL 4XVUC 2YWYA 2EH8H 4BFIB 2AEPL 4PBWD 4U6XA 2FCBA 3DMMA 3UTZB 2GSIB 1MNUH 4ZXBA 5EZLB 3OG6B 4Z18A 1AXTH 3QFJB 3FT4B 1T83C 4JJHA 4J4PC 5HYSA 4GAJH 1U8LB 4HW6A 4NN7B 4QRQA 5FM5M 3MV8A 1GGUA 2EDFA 3BDYL 1IMHC 1G7LA 4ISVA 3ELAT 3LZFL 3SGDH 3OKMB 1AGCB 2HFEA 1T03H 1U8NB 2IPTL 1DEDA 3GIVB 1U9KA 1SMOA 3GI9H 3KPOB 3LRHA 5J8OA 4M5ZH 2C3VA 2BZDA 4R3SA 3TP4A 1OGAE 4NQVB 1F4HA 5F7LB 4F7TA 4OUOA 1FN4B 3V6OE 4L9LB 3FB8B 1A7OL 2V7HA 1HOCA 2N4IA 2XTJD 1FAKT 4PJ5E 3RX5A 2J4WL 1FZKB 5DQDL 2X44D 3EAKA 4PB0L 4HJGB 3TZVD 1U8HB 4WHTA 3UJTL 3DARA 3NZ8A 1YEJL 1JJUA 3UYOD 4W4NA 4JDVA 5HYQA 3MBXH 2A6KA 3SDYH 3INUH 4RWYH 4TULL 2X4SB 1QRNB 2VXUL 4MNQA 5I8CA 1B4JH 1P6FA 25C8L 1D5IL 4U31A 4YE4H 3MR9B 3B5TA 3WD5L 3U0TB 1EO7A 4KI5C 2QADD 2GK0A 2VAAB 2RCSL 3F7QA 2Y07H 4CGTA 2VLRB 2EIBA 2GHWB 4FNLH 4NQCB 1J8KA 1N26A 2MOVA 4GW1A 2ITDA 1ZSDA 4LSSL 2X2YA 4IMKC 1O5DT 4Y4KC 4YDKH 3MRDA 2FL5B 4R90L 4HWBL 2XA8L 5IBTH 2FWOA 5MEOB 5SWZD 1F4YH 1CFQA 5D7IF 4GKSA 5ABDE 4P3CH 5GS0D 4JN2B 2FDBP 1LO0H 5E6ZA 3SO5A 1YEFL 5DD3L 4WI7A 3C9NB 1PLGL 1MRDL 2NY5C 4JFQA 4HC1H 5E6IA 4PRAA 1PZ5A 2R2EA 3B2UC 4X7SH 2Z4QB 2CR6A 1GHFL 3UJIL 3LKPA 4AEEA 1KULA 2F53D 1NEZB 1MREL 1XGQA 5EU6B 1I1FA 3ARZA 2IALB 5LG1A 1S7UB 4Z95H 4YGVB 2Y36H 5LGHL 2IH3B 4MZ2A 5AZ2H 5TQ0H 4DEPC 2OJEA 4NM8H 1JN6A 5KSVA 1J12A 4OQTH 1CFNB 3DRQA 2IAMA 2DWEA 4XNYL 3VXRB 4KUZH 2VDLL 1C16A 1SJEB 3RWFA 4QHLB 2E9BA 2G2RA 3LD8B 3CNKA 1CD1A 4ZDHB 5KG9A 2LAAA 5T5NG 1KLUB 4L5FH 5C0DB 3U82B 3VWJA 3G6DH 1K4DA 1T22B 5DHVA 4JANA 1HZHH 4UILL 3HUJE 3VGAB 3D3VA 3I3BA 2H2PD 3QXUA 2DMCA 2XN9B 2JELH 4NHUB 3F7YA 3CX5J 3JTTB 3S3JA 4M62L 3GMPA 2JIXB 3AM8C 1I3RA 3EYQC 5JHDB 3GGWA 3UMTA