5DJCB

Fc heterodimer design 8.1 l368v/y407a + t366v/k409f
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
207
structure length
206
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLVCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSFLTVDKSRWQQNVFSCSVMHEALHNAYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 31
structure length 206
sequence length 207
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djcB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djcB01
4AQ1B 3S5LB 3UO1L 1I85A 1T80A 1A3LH 3MFGB 3O9WC 3JTSA 2DLHA 3FQTB 3BGAA 4U1LB 1D6VH 2BHZA 2GTZA 3WNNA 1U93B 3D85B 5F97E 1JFQL 5EU7C 1D9KC 1WLHA 2DLFH 2BERA 2I60H 3PL6B 4WFGE 2C4FT 3MRIA 3GKZA 4OF0A 3IDNB 3M17A 4PJBE 4TUKH 3VXTB 1A3RH 5K9OB 3CSBA 5C0DB 1VGKB 3UROR 3O3UN 5CKGA 3BZFB 15C8H 1E6JL 1MFNA 1DL7H 4JAMB 2EH8H 4BM7A 5FGRA 1ONQB 4NQEE 2BY1A 3V6OE 1OSPH 3MV7B 1LO3L 2XWTB 1MCLA 1TETL 3C5JB 3CUPB 3MBEC 4M03A 4ODVH 3MLYH 4NNPL 3PXHA 3G6JA 3QXAA 5C0FA 1MAML 3NFPA 3QEQE 4HZAA 1BQHB 4QRRA 1R3JA 3MJ7A 2CMRH 3KDMB 3SDAD 1P7QB 1GHFL 3G5ZA 3E3QE 4U1IB 3MGTB 3BWAA 1UA6L 3KPRB 1U3HC 3D18B 1C8PA 3S4SB 3TBYA 5E6YA 4G8FB 4U1MB 5C2BL 4BK5A 2AI0L 5TE7L 2J6EL 2EDFA 5CSZB 2M1KA 3ARFC 2YD6A 3BPOB 3AS2A 3RDTA 1KN2H 4WGVB 4MA7H 4Z7VA 3RL2A 4DVBA 1N4XH 3CZFB 4Y4FB 2FD6H 1SMOA 3QCTH 1DVFC 4RFOH 3KYKL 5J9PB 1EEYB 2MWCA 3BT2H 4UINH 5GISL 4OD1L 4ODXA 4OZGF 3KYAA 2F53E 1KGCD 2DBJA 5FECB 1P5UA 2QL1A 4NKDB 5I1IH 1HOCB 2VB5A 1N26A 1NC2D 1S7VA 3HE6D 5FA3B 4LBEB 4Z9KB 4AY0A 4ALAL 3CFKA 3W5NA 2FATL 4Z8FL 1KJVA 2QJDA 5FA3A 4NO0A 4ODTH 1UM6H 1AC0A 4U1JB 3QDAA 5C0RL 3GUTA 5FECA 2ICEB 5IW6A 1OLLA 5B22A 2IH3B 1M4KA 2AJXL 4XBPB 5EC2B 3VFUB 5MHSE 1I9JL 3HZKB 2Z35A 3HE7D 5LAXB 2DYPB 3G6DL 5DWUL 2BXYA 4IRJD 4Y2DB 3UTQA 1CYGA 3GMOA 2ERJB 1V7NL 4UV7L 2I07B 4NM4H 2YRLA 2D31A 1DDHB 2IANA 1LNUB 1V7ML 3MJ7B 3V0WL 5I6XC 4NNXA 5I8CA 3KYMA 4Z7WB 3QG7H 3D3VA 3HAEH 3MREB 3RHWF 1FAKT 4R2GB 1DQQA 4EN3A 5BV7B 2JCCE 3KXFE 2YK1H 4CVZB 3MRHA 1HYRC 3VA2C 1QBLL 1RK0B 3D0LA 4NZUH 1NGWA 5K9OA 4YHYB 1RZIB 4EOWL 1WAAE 3QUZA 5JOEA 1QLRB 5CUSH 4MJ4A 3ULSA 1F4AA 2V7HB 35C8H 3E0GA 3F5WA 4ZTOH 3VRLF 1YY9C 4PB0H 1LHZA 2X44D 4LKCB 4LSPH 1LGVA 5A16B 3CPLA 4JRXD 4U49A 2GUOB 5DYOA 5F7MC 5D9SB 4U1LA 4P2QD 5MENB 4WUKH 5GIRB 1JBJA 3O4OC 4Y1AB 3JWDL 5AWNL 3RVTD 3QUXC 3DYMA 3MOBL 4K8RD 1NGWB 3EO9H 2BVPB 5F1NB 2EIEA 5C0BE 3DARA 2OYPA 5D6DA 2D0FA 3MRCB 4Y0GA 1U36A 1AGCB 1FHGA 4KMQA 3TYFB 3TT1L 4F58L 5CBAA 4JHAH 3JWOC 2AJ3A 4JRYB 4JM4L 4F8QA 1FZKB 4YEFA 5K9JH 3S9DB 1MHPL 4NHCH 2P1YA 4N0UB 1F3RB 3RGHA 5C6TL 2GJ6B 3RFZC 3VRJA 5TQ0H 4P4KD 1DJSA 1MPAL 4IIQB 4L8SA 4Q6IC 2XQBH 1GIGH 3CLFL 3CSGA 1DSFL 5GHWL 5CSGA 1JMXA 5MEQA 5C0NC 1CDJA 5TDOA 2VWEC 4DKFH 4JGJA 5MEPB 1U3JA 5C0JA 1NGQH 3IU4H 2E6QA 4KPHH 3L5XL 3ZDZE 4PJEE 4L5FL 2JB5L 3T3PE 5ACZB 3TBVB 2YD1A 2HVJB 3T8XB 2KH2B 2BVPA 1MF2L 2M2DA 4GQ9L 3UYRH 4LSTH 1U6AL 5EUOA 3SDYH 3J7HA 1FL6A 1S9WB 3QDMD 2RCSH 4PJ9D 5L88L 1A22B 3BKYH 3VFVA 1UWEH 2YC1A 4HHAB 1Z6JT 3X14B 3GMMA 3OKMB 3LCYA 3CPLB 3WL9B 4KKCD 1CD1A 4CVUA 5E2UH 3VA6A 1I8MB 3GMRA 1EGJL 4NSKB 2V5MA 2ARJA 2E9WA 3S88L 5CILH 3WO3B 2DN7A 2VDNH 4H8WL 3HC4L 4R0LC 1XCQB 2PN5A 3TN0A 4Y5YB 4KK8D 3T0EB 1UB5B 2QR0B 4K55A 1TZHA 5SX4I 4QRPE 3UX9B 2OTPA 3QEHB 1S5HB 1WQVT 4P9ML 4D3CH 1U8JB 3QRFM 3G08A 1AO7B 3RAJL 2NX5E 1RZFL 2PO6B 4JQXC 5E08H 2AJSL 2X1PA 1ZLUK 1QRNE 1TTUA 4Z7WE 4GBXA 5CP3A 3RP1A 1QFUL 5CEZH 2VAAA 4PLKD 1KXQE 1RIUL 5EZJA 1Z0NA 5GRJH 3SPVA 2C7UB 5KVMC 4AEHL 3DVFA 1UB5A 4HG4J 4PGBB 4YHIA 1KEML 2H26A 2WP3T 1AGDB 1D5ZB 3K74B 5FKPB 3QR2A 4HUWA 4Z7UE 1OW0A 4WENB 5TQ2H 3HTLX 3EOAA 3I3EA 2QQKL 1J1OH 2NY0B 3GDBA 3C6SA 4XGZA 3L5WB 1FFOB 4JY4B 2CIIA 2X41A 3MRRA 4IS6B 2YPLE 5DMGC 4HUKB 4JKPH 1S78C 2BRRH 1P2CA 2A73B 3RGVB 1LO2L 3W9DB 1PZ5A 3SE3C 5HI5C 4A2LA 4TNWK 3VGAB 3IDUA 5J89A 5BJTB 4XAWH 5FO9B 1KPVB 2OZ4H 1QP1A 2BDNH 2H45A 1E28A 4QHKI 4MJIA 4HWBL 5FYJL 2CGRH 1IQWL 4OLVH 4IHOB 3IFLH 4KVNH 4I0PA 4KQ3L 5CMAB 5D7KD 3QEGL 4ZS7L 1TVHB 1N2RA 3BVNA 1BJMA 5I15H 3QJHB 4YNYA 3DV6A 3LPGA 2PW2A 3CXHJ 1HNGA 4NRYB 3F7VB 4JRWA 5CHNA 1HXYA 4H5SB 1FL5B 4DUXA 4PY8J 1AKJA 2OQJA 3EW3B 1BX2B 3LKOA 4M6ML 3U36B 2WBJC 3CSYA 4ESKA 5DEZA 1QFWI 3ZKNC 1HHIB 3DIFA 4LCCA 4D9RE 1JPGB 1RHHA 3BSZH 3QQ3B 3BWAB 4QRPB 1SMAA 2XXMB 3WFDH 4JRYA 2C4FU 4PTUA 1IGCH 5EO9A 3SDCC 4JFDD 5FYJU 5FOBA 4K9EC 5B39A 1KENL 5DEFB 3VFNA 4PJ5A 4F7MA 1CL7L 1EMTH 1CLCA 4FXKB 4Y7MA 4S2SA 1JWSB 3IS1X 3QDJE 1Z9MA 3QXWA 3BQUC 3H7BB 3P11L 4XMKH 1X6LA 3EOBA 5FYJE 5IB3B 4G8IB 3TO2B 3FQXB 2X1WL 4E42B 4YDLB 1YEJL 3MOAH 4Z77B 2W65B 4P2OC 4WEMB 5I73B 2J88L 5IB5A 1I1AD 4R26L 1RZ8A 3D0LB 4NZDA 4ZOCA 1RZKC 3MLYL 4NNPH 2HWZH 1FDLL 4PBVC 4I4WA 2GT9A 3TC9A 1MVUB 2B0SL 1T22A 4PJAA 4G6FB 3QUZC 4K9EL 4MMZC 2R0LH 4KROD 3RX7A 5B39B 1KNOA 5DXWA 5HHQA 3VXPB 1BECA 2CDEA 4PRHB 4E5XB 3RVXD 5EU6B 2R39A 3C60B 4JHWH 3FOMB 3SJVA 3RVVC 1FJ1A 1UWGH 3OAUH 1EUUA 4R97B 2ZCHL 5BZDA 4OI9A 3QFJB 4HIHB 3T1FB 3RIFK 3DRQA 1T83C 3QQ3A 4YE4H 4L8BB 4HBCH 5CWSA 3TZVC 3B9AA 1P4IL 2W91A 1H3UA 5C0BB 4X6FA 5GJTH 4EN3D 4G6ML 1JHKH 1FV1B 1XZ0A 3VFWA 4KZEL 3JUYA 4P3WA 3QYCA 2CJUL 4X9IA 3BT2L 3FFCD 4GXUN 2WINA 2PUQT 4X5WB 3V9FA 4YHKH 3B4NA 3D0VA 3FT3A 5CEXB 1SYSB 2DQEL 4MYWB 4QXGH 5FK9B 4U1GC 4GG6A 4O02L 5KZCB 1DQDH 1TZGH 3RNQB 3QIUD 4MSWA 2X7LA 3F7PC 3FOLB 5DJ2A 5DI8B 3MV8A 4C54A 4ALAH 1V3KA 2AP2A 3G9VA 3QEUA 1WBXB 2HT3C 4Z7NF 4MNHB 4KXZH 2NTSP 3WS6C 5C86A 5EC1B 1INQA 1M05B 3NH7H 4QHMA 4UT9L 2R1YB 3LDBB 2X9WA 3FZUD 5IBLC 1ED3A 3OPZH 5I66A 5KVGH 3H9SD 2FJFA 4HV8B 4OV6F 4JFED 4YXLL 3MRBA 4R96B 4G7YL 4HPYH 5D1XB 1B4RA 1F42A 5A2KH 4NQUA 5KSBF 3ES6B 1IFHL 4QCIA 4FFWC 5GZND 5ICXA 5I1KL 4PGBA 3ZDXE 3T0ED 2FJHA 4EBQH 1SEBA 2X6MA 2P45B 3GNML 4U2YA 3KXFB 3L3GB 4XCFH 5JQ6H 1TNNA 4RGNC 5F6HJ 3LRGA 5LCVL 3H9SE 1TNMA 1RUAH 2CQVA 4C56A 4U1SA 1IJ9A 2X4SA 2EDEA 5F7DB 5KG9A 2O5YL 1RUMH 3WXVL 5C0GB 2AQ2A 5AD0B 4PRNB 2HT2D 1J0YA 2QADD 4XNQA 3VDBA 1ZWIB 2FX9H 3D39D 9CGTA 3BMVA 3LQAH 2EEAA 5FHBH 3R4DA 3MNWB 3BP7A 2QHRL 4HJ0C 1XIWD 3TPKA 4PY8I 1HINL 1F11A 1OB1B 3BH9A 4N8PA 4CGTA 4MA3A 5LBSL 2MQ3A 2XICA 4HXBL 5B39G 1HQRA 3UTTD 2BVUA 4HUXA 1RZKL 4QLRA 4K94H 4M7ZB 2A9ML 3UTTA 1N3NA 1MJJA 1KEGL 1X4YA 3TIDA 3D0VB 4HKZA 3VE0A 4KI5F 4JHAL 4TVSa 5SX4H 5TDNA 3NZ8B 2VDRH 4S1QL 4OLWH 1VHPA 4Y5VC 3SDXB 5JMRA 3MLWH 5CJ5A 1G0DA 1EFXB 3E6FB 3AVEA 1M7IB 2YD7A 1T0MB 1OY3B 1VFMA 1NFDB 3GKWL 3VXUA 2YZ1A 1Z2KA 1YUHB 3ZL4H 3DLQR 4R9HA 3DURA 3KAAA 4OZGA 1ZT1A 3SKNB 1IE5A 32C2A 4JKKA 4OFVA 3QFJD 5K9QI 4KHTL 4ZFFA 3MRPA 4GKNB 3ARZA 3IB4A 3I85A 5EPMB 1A0QL 3RVWD 4ZO8A 3OKEA 5DJDB 3UTOA 1EUTA 5ESVB 3O45B 5ALBL 5INCA 4P46A 2WMPA 5D93C 3O6FB 3SDYL 5JXAH 5L2KB 4ZPTA 1YQVH 4CVXA 3CFJB 1C08B 4PRIE 4BSVB 1Q0XH 3C87A 4L29B 1ROWA 5ABDE 2Y72A 4D0DB 1A7NL 3KPOB 4LCCC 3UTPD 4D0BB 4FP8L 2E9JA 2CDFA 4P4RA 3ULVL 3WKML 5I8KL 2VXSH 1QSFA 4QXTB 5EZLA 3BPNB 4DKAA 3O9WA 3HUJA 1QPPA 4XRCB 1T1XB 5D7IA 1KTLB 5GRVK 5D7JA 2XOTA 3EBAA 4FQQA 3T77B 3RNKA 2Z91A 1F3JB 3I3DA 4RMRA 2F5AH 3VG9B 2GQHA 4S2SB 3SY0A 5DUBB 4G5ZH 4MLIA 1I9EA 4LCUB 1A6AB 4BQ9A 4YXKH 1RZFH 5C0BD 4EN3B 2V5YA 3PV7A 2X4PA 1WFOA 5J12C 4XWGH 1XR9A 5D1ZC 2C1OB 4KRNA 2MCPH 1CE6B 1XGRA 4QRPA 1A7RL 4OQTA 2VXUH 2FO1A 2A6IB 1MFDH 3GJFB 4Y16D 3UDWA 3ISWA 1OGTA 4P2OA 5A2IH 1BQHG 1HHIA 3DIFB 2YA2A 4WU7A 4N0CD 3IAQA 3JTTB 1CLOH 5C0IB 3PG2A 1XF5B 5IVNA 1LK2A 3ET9F 5C9JB 5CHNB 3U4BL 2AJVH 1OPGL 5HI3D 5JO5B 1QA9A 4F33A 4RRPA 5HVGB 3D25A 4NCDA 4OFIA 1S9YA 4UQ2A 4N5UA 5I19L 2YUZA 3UDWC 4AYFA 4YUEL 3HC0B 5IIEB 1TCRA 4MWFA 5A2JH 4WGWB 4FG6C 3BKCL 3K2UH 4GW4B 3CX5K 4OJFH 4LIQH 3W0WD 5J06A 3CFKB 2EXYD 4JFFA 4PJXA 1Q9LB 3V0VA 4MA8H 5KJRH 5JUEL 4GBXD 3ZE2F 4J7RA 1HWGB 3HNSL 2BVQA 3P30H 4UI2A 1MWAH 5GGVH 4ODWB 5F70A 2Q87A 3VG0H 4GSDH 2DQFA 1RY7B 1S9YB 4TN9A 4UQ2B 4ZSOB 3HZVA 2G5BB 3WN5C 4OZFG 5HY9B 4M1CD 4OZHE 4BUHA 3ZHDA 3EOAB 4P5TB 5C0AD 3IFOB 4OQTH 2XZAL 3MUJA 2DTMH 2DQCL 4JJ5B 2NY0D 4LRNL 3ZDXF 2W0PA 2YBRB 3KJ6L 4TTDC 1IC1A 4Q7DA 1S7XB 1XF2B 2VABA 3MRDB 5CJXC 3ME0A 5EBMB 3TN0D 4DN3H 3I75A 1BZ7B 1CDGA 3DXAB 1URLA 2YSSB 4YHPA 2DLEA 4DVRL 4FN0A 1MJ7L 3BKMH 1RIVL 3QA3A 3T0WA 2R4SH 1T1YB 3WNMA 3VXPA 1KNOB 4PJBF 5FM8A 2ADJA 2R8SL 5E9DD 5C0CA 3ZKMC 3G08B 3BUTA 4Z5RA 1A5FH 1RJYA 1CL7H 5EH1A 3HB3C 4XI5C 2XA3A 3BD5A 4LCUA 5JXEA 2OP4L 4JGMA 2C9AA 2F53A 4HD9A 5I1JL 3VD9A 2CRMA 3TN0B 3QCUL 3WJLC 1TJHH 1Q9OA 3MOQA 4NOBA 5IB5B 3GSVA 3AB0B 2NY4C 1YYLH 5H94A 4ZUVB 3JV5A 3P11H 3T3ME 1G84A 1LMKA 3FTGB 3V6BR 4UTAL 4P3CH 4YDJA 3QQ4B 5DSCA 1NCWL 5BW7A 12E8H 2MFNA 3A67H 8CGTA 3VFRB 1VACA 4G6JL 4KI5D 4KRPD 5ITFB 4R6UA 3P40A 3Q6GL 5GGUA 4PJ7E 5BVPL 4D0BA 3TFKD 1C5BH 2XNAB 4U1KA 1R5VB 3BISA 1VFAA 4YBQC 2ZCLH 3QDMB 3GGWB 3STZB 1EXUA 4X7TA 5T5NG 4LCWA 4GMSL 3TVMD 3UBXB 1NUGA 5GS0H 1FE8L 5DVOA 3B83A 1YQ2A 3B6SB 4I0PD 1JZ7A 3EYVA 3T4AA 1DEEA 3UJTL 1ZEAH 2G2RB 4ZUUB 2A6DA 4Z0XA 3VGEA 4LLQB 1U92B 4I0CC 2G9HB 2BY2A 1D3CA 4OZGB 1CFSB 4PB9H 4MB4A 5E2VL 5C07E 3BKJL 3STLB 2HMID 5H37G 2Q7YB 3U36A 3UO1H 1B0GB 3O6LL 5JDSA 3RTQA 3MFFA 1BLNA 3G6AB 3OX8A 3PDOB 5F1OB 4WW2B 4YHNB 1HHKA 3NZ8A 3R1GH 1M71B 4XP1H 3INUL 5CZKA 2VUYA 1X5XA 1TXKA 4D94A 1NGPL 1IQDA 1YNKH 4HLZG 1A7OL 2A6KA 1YDPA 5GGSY 1PZ5B 4U6YB 5F89A 5JQHC 2DQDL 5ENWA 4PJGE 5HGBA 3LQZA 2LU7A 4FABL 4L8CB 3QXTA 2ZKHL 4HCRA 1TQBC 1UH4A 3MRJA 3DX6B 2BC4B 4H0GA 3BPOC 1QBAA 4Y4KC 1MAMH 1BEYL 1AH1A 3GMQA 1K3IA 1Y0LB 1X9QA 4B41A 3DMMA 5IT2L 3QSKB 4XP4H 5A2LH 4YC2B 2HRPH 5E8EA 3ILQC 4KKAC 5GGQL 5C0GA 2VAAB 2R69H 4LGSB 4WI8A 3LSOA 2J6EH 1FN4B 1BBJA 3REWA 4AK1A 3MXVL 2MMXA 4W4NA 5JIPA 2AV1B 4KY1H 43CAB 4MJ2A 1IQDB 1YZZA 4UDUA 2IANB 1PYWB 4KQ4L 4ZUWA 4D8PA 1A7BA 3WJJC 1U8QB 3TBSB 1NLDH 4X6BA 5ID1A 1SEBB 5I1AB 4KK6C 4Y16B 1CU4L 4PJGB 4Z95L 3Q3GB 1UEYA 4OM0L 5FUZL 4UAOB 5F1IA 4JRXB 3VXRB 5F88B 1PG7X 1OTTD 4FZ8L 3PWVB 2Z4QB 2WUCH 3N06B 4NKMB 4RDQG 5T1LA 4LLWB 1YN7B 3NGBC 2DWDB 3T09A 3FFCE 3EFFA 2VXTL 1JHLH 1ADQL 3PGFL 3FO1B 5DDHA 3VXSD 5BOPA 4N1EA 5IF0B 5J6GB 2OSLA 4FFVC 4S1RL 5FUCC 3WNLA 1NEZB 5IGXH 2WM0A 1F8TL 5HD8D 2P5WE 3QIWC 1Q72H 5IESH 3CVIL 1YEIL 4K07A 4P5TC 3RUGF 3MCG1 5ACZA 2FO4B 4MSWB 1DQML 1HOCA 3BD3A 3MV8D 4APQC 2OX5A 4Z7WF 3L3DA 1JYNA 4KRLB 5DLMH 2ENSA 4W4OC 5GS0C 2WINB 5T3ZD 3H9ZA 3NOIA 1TJIL 4DUWA 2BCKA 2VR9A 1EHXA 4LMQI 4PP2A 5C09A 5DSCB 4YDJB 5GRUH 2W38A 4P2RA 1PBYA 4O2EA 1ZANL 3PWLB 2F54D 4JO1L 2VDQL 4G42A 5GRYA 5LQBH 5JIHA 2YK1L 4XZUA 1CDYA 4WW2F 5SWSB 3MA7A 3AMKA 4ZTPL 4W4OA 4G43A 1KYOK 4OKVA 1AXSA 1ZT7B 5EU6A 1A0QH 5L8LB 3HNVH 2NW2B 3FFDB 2CIKB 2IADA 3C8KA 4JQIL 1G9NL 1RU9L 1WAAF 2I26N 3KPTA 1J12A 1ZT7A 3X17A 1MVUA 4ONGH 3BE1L 4G43B 1BQLH 1OAKH 4I3SL 1DN0A 3ESUF 5AYUH 4AH2A 1IAIM 3OXRA 1K3ZA 4YZFF 1ZGLA 3G9AB 4NQVB 1X5GA 5K93A 4P23B 3SDDD 3VXTA 1OSZA 5CJQH 3GMLA 3SDDA 3U6RB 4JVWA 4IRZL 4LKCA 3RWGB 4G8IA 4Q6IB 3B5HA 4OFPA 3QPXH 2WZPD 4Y4HB 1GGIH 1JNLL 1DBJH 3ARBD 4C56E 2W60A 3KLDA 3T4YB 4I9WD 3BHBA 2BSTA 2A1WH 3HZVB 4MNGB 1KPUB 3SE9H 1GZPA 4JM4H 2VSDA 3HFMH 3THMH 5DMJB 1L0QA 1W0VB 4Q9RH 5C6TH 2R2EB 3TH3T 2R2HB 2BVQB 3VD3A 3U0TA 1MREH 4ETQB 1U9KA 2P5ED 1YEEH 1ES0A 3C8HA 4OLYH 4Z7WA 3VI3F 5EZOH 5GJSL 4ETYA 1WBZA 3ARGA 1J8HE 4LLMA 3WYRA 3DGGB 2KPNA 5SV3A 4MJ5A 3NCMA 1RJLB 3FN3A 3IJSB 2VXQL 1NGQL 4KPHL 3IVKB 5E9DA 1WT5A 4CNIA 1CE1H 2EECA 5ISZA 1W72L 3I50L 5HHMD 5ESQB 3BEWB 4MXQC 3U0PA 3CSYB 1H8SA 1H5BB 2P24A 5JXED 5LVEA 5TF1L 1U8MA 4P9HC 3MA9L 3O4LA 5J1AB 4ISVB 5JOPD 3S36X 2CKNA 1RUPL 2Q3ZA 1HYSC 2EKSA 4P2OB 2IFFH 2K1MA 2DMKA 5DUPL 4PP1C 3U7YH 5EWIH 2W92A 5IB2B 4JZNA 1NBZB 3LIZH 2GYSA 2LU4A 1UZ6F 3FQWA 1KF9B 4ENEC 4EVNB 4JQXA 5EIVA 5I1DA 5I17A 3H0TB 3TA3D 3AM8A 1JWUA 2VDNL 3TA3A 4Y5VA 1Q0YH 2X4QA 1FYTE 3QHFH 1KCVH 3CLEH 1PD6A 1OAUL 3REVB 1IKFH 4M3JA 2B1HL 5T33H 1I8IA 4PJCA 1WZKA 5HJ3A 3DMMB 2NY7H 3D2UA 1FFOA 5IBTL 1RQ5A 1QSFD 1YPZB 2J5LC 3TNMB 5AUMB 4X6DB 1FORL 2BC4A 2XTJE 3MRLB 4PBXA 3X3GL 2AJSH 3EDEA 1E6JH 4QXWA 2ESVE 5HVHB 1F4WH 2AXFB 3V5HB 2RAMA 4Z7VF 1BFSA 1U95A 3DVGA 4IRSC 3MBXH 2VZUA 3P3YA 3GM8A 4P46C 1IGML 5FO8A 4L3EA 3F8UB 1FYTB 4BFIA 1EEZA 1IAOB 2R9HC 4HQQH 5D8JH 2Q8BL 5C71A 4HIXH 4BELD 2AK4D 3O3AA 4YO0A 3C9NA 2FWOA 3C5ZA 4NQEA 5I16A 4G8EB 1LQSR 3OJDB 2O5ZL 4TSBH 4YFDB 4HX1B 5KSAB 4LOUC 1CXFA 4G9FA 3SKJH 5KS9B 2XZQH 4NHUA 3BZFA 4QRRE 3L3KA 5DHVH 4PR5A 4QXUH 1G0YR 2OZ4L 4X9HA 1N6UA 4P3CL 1EERB 4UIMB 2D4FA 4G80B 4KVNL 1I7RB 2BSSB 3CJJA 3FHAA 5EO1A 4BFBD 1P7HL 4YBLC 4LSSL 3WFCL 1PZUB 3U7AA 1K2DB 3ROLA 1FNAA 2K7QA 2NLJB 3LRHA 1LVEA 3MLUH 4GW5A 1JYVA 4ETQA 3D69B 3HAEB 5H35A 1NFDE 2V17H 5CZXD 4UDTA 4RGNB 4Z0BL 1AGBA 2RIKA 1UM6L 4L3CB 1KC5H 4QRUA 3GI8H 3TNNA 5CBEB 5IV2B 4W6WB 2HKFH 3QULA 3MRNB 4EUPH 2UUDK 3MV9A 1FAIH 4MJ6A 5C0JB 1W0YT 3MV9D 1CDHA 2DL9A 3DTXA 1U3ZA 2AEQL 4KDTC 4M3KB 2YWYA 2VWEE 4PGCA 5TE4H 3RIAF 1F11B 4Q6IA 4JJHA 4JCLA 4PGZA 1DBML 3F7YB 4P2RE 3EDFA 4ZUTB 5E5UB 1MSPA 3O6LH 2H3NA 2D03L 4XVUD 4M8VA 3E6HB 4NM4L 3KLAA 3WEXB 2VDPL 3HR5B 2W59A 7CGTA 3KYOB 3GSXB 5KOMC 2B2XL 2C1PB 3PWPB 1OVZA 2O5XH 3SOBL 3WN5A 1MCEA 3HLAB 2V5RA 1QQDB 2FEEI 4WNQA 4FQXC 1ZK9A 4N8VB 1FVCB 4WFHD 5DF0A 5ACMA 4E41A 3BGFB 1IGIH 4OZIA 1EHAA 2FJHB 3QPQC 4JFEB 4WDIA 2Y06H 2AW2A 3F12A 1I75A 4NGHL 3TZVA 1PSKH 4XPGH 5AEAA 4PP2B 1OD7A 4KUZL 5HYSA 4JM2F 3U2SB 3ALPA 4HPOH 3EO1A 2DQFB 4P5KB 2X40A 3TESA 1LEGB 4CDGC 2PXYA 4Y8DC 5F93C 3QO0A 3OAUL 3G5YB 1ZA6B 5GGQH 3I2CL 3U7WL 4QTIH 4Y19D 1BGXL 2HTKD 5B8CC 4FQJL 2XRAL 4HWEH 4GW4A 3L1OH 5E0QA 2F54A 4XNUL 1NJ9A 3X12B 5GS2D 4PJDE 3BRDA 5KS9E 3CSPA 1P4LB 2OZ4A 3VMOA 5KS9F 3VRLE 4QTHA 1CR9H 1YEFL 4M62L 4O4YL 3OB0H 2A0LD 5I2IB 4U3HA 2XQBL 3HZKA 1WZMA 2LAAA 2HFGL 4N5EC 4QTHB 1MLCA 3BPNC 3VH8B 2H1PH 4FHBD 4LLDA 1OM3L 5I1AA 2FBJH 2ICEA 5IW6B 1C1EL 4OSUL 3X12A 4JY5H 3IU4L 3MMEA 2ZOKB 5BMFL 4X9FA 4LLMB 1MAJA 3GHBL 3HE7B 4S1RH 4AL8L 1WEJH 1Y18B 3U82B 3C60A 2ITDA 4R2GC 3WBDA 2AV1A 2CDEB 1MF2H 4L8SC 4PRHA 4E5XA 4WJ5B 4NZTH 3O3BB 5LGHH 2HVKB 2ICWA 3LSOB 3B3IB 4PD4K 3QXVA 1DCLA 4PGJA 2H6PB 3STBA 3MLRH 4LDOB 5D5MB 1WK0A 5BQ7A 1FFNA 1RSFA 5HVHC 5I1KH 5I74B 1FNEB 2FHFA 3M45A 3UCRA 5C7XL 2NNAA 1ACYH 3HMXH 2VRAA 3TP4A 4OLUH 3NACL 3MROA 1LEGA 4RA0C 1NCDL 1WBYB 1QSFB 1MFAH 2IC2A 4JN2A 1HZHH 5DHYA 4HK3J 2HLAB 5ELIA 3DXAD 1FNGB 4D0DA 1JGUH 3SDDB 3U6RA 3VXSA 3RRQA 2VH5L 3FQRB 3HI6L 4WUUE 1GC1H 4FQ2L 1RAMA 2VNCA 4JDVB 5ICYA 2FIRT 3G5VA 3SBWA 4LDLB 3OR6B 2RFXA 1WAAA 4ZOAA 2VLKE 3ULUF 1CBVL 3LQAL 3LKPA 1JPFA 5FHBL 2NX5B 4R0LA 1RJZB 1UYWL 4KTDH 1M71A 1A6TA 3OKLB 3G6JB 1UM4H 3KLAB 4X83A 5GRJL 3WEXA 1T5XA 2ICCA 5D72H 1JUFB 1NKOA 2X4OA 4WUUA 1INEL 4CDHA 2PW1B 4KMLB 4WUUD 1Q94B 1KEMH 4JG0L 3BFOA 3CFBB 1OAQL 5B3NA 2VZ3A 1B0GA 4YGAB 5DFVD 5E6IB 3L7FA 4ZAKB 4DK6A 1QSEB 4LSUL 5DJYA 1FNLA 3KPQB 4QF1B 4ZXBB 2ATPB 3B2VH 1RFDH 1F4HA 1E4KC 2ZJSH 2VQ1B 3VWJC 1AIFA 5F3BB 3NCJH 1JNNL 1PY4A 2A1WL 1MCFA 3CDFA 3T4AB 4NRYA 1I8KB 4ZFZB 1T89C 4QT5B 3U1SL 1MIEH 4Q9RL 3L3DB 4HF5H 4W6XB 1N3NB 2BDNL 1AP2A 4G6KH 5FO7B 3WKNA 2E8YA 2ZOLA 1BFOA 1OOAA 3O9WD 2EDNA 1JI2A 1ZLVK 4MJIB 3X3FL 3SJVE 4MQXD 2Q3AA 5E8PA 3FB5B 1U8PA 3L95B 5L7XH 4TSCL 3CU7A 5BJTA 2Q8AL 4JY6A 4JDTL 1F2XK 5HHNB 1D9KD 4M6NH 1A4KA 1AIFB 2Y1VA 4L3ED 2VXQH 1JPTH 1VPOL 5CCKH 4M5ZH 4O51B 1W72H 1CQYA 4UIMA 1ZWIA 3PHOB 1XR8A 2H2PD 3HCVB 4C4KO 4PV9A 1X6NA 5KSAA 4R4BA 1FLRH 5DQ9A 1N7ML 4GUPB 1W8NA 2QKIA 2ADFL 1NAKH 3MV01 3MBED 5BS0E 1G1CA 4G9FB 1TVBA 1UKTA 4HWNA 5EZIL 5KS9A 3FO2B 3CFCH 3O3AB 1N6VA 2D7MA 1KCUL 1NAMH 3EJYD 2GY7B 4QHNB 5HYJA 2GEEA 1ND0B 4D8PB 1T03L 3UTSE 4G8EA 2FB4L 3SDAC 4TSAH 2VXVH 4LIQE 1EEQA 3CVHB 4BZ2H 4QRSA 4WTZA 4QNPE 2W1NA 1U3HD 1IAOA 3FT4B 1BZ7A 3I75B 4HAFA 4YHPB 4I18B 1QLFB 5BS0D 4JO3H 1LD9B 3ARFD 2P7TA 3RI5F 4NJ9L 1R24A 2FJFB 3A6CH 4HV8A 2ZSVB 4LARH 3HA0A 4WV1A 4YX2H 3O11A 1DVFD 2P43B 4YDVB 3S34H 5D7LB 1F90L 3HI1B 5B8CB 3BYYA 2YPKB 3O4LD 3GMRB 4LVHC 4LF3A 4AMKH 2W9LA 3AXLB 4L8CA 4N9GB 5HJ3B 5L0QC 4MCYB 3VFVB 1FZMA 3RWDA 1DE4A 1NQBA 3NCBB 3NCYP 5D8JL 2RB8A 5FYKU 4GG6B 3TA3B 1NMBH 5KVDL 4KK9C 5AZ2L 3B9VA 4OD3L 3VMPA 4GAGL 3V5DB 1NANI 1T2QH 4NUGL 1UZ8B 1OP3H 4XVJH 1IGYB 3FB6B 3QJFB 4HXAL 4X9BA 4ZYKA 3EO0B 3OX8B 3PDOA 4LEOA 4W68A 3NABL 1KN4H 1J86A 3ARRA 1OHQA 4QXUL 2XTJB 4XPHH 5DFWH 1NC4B 4LIQL 3HE7C 5C08D 5IKCB 2AJYH 5C0CD 3TLRA 1ODAA 4WO4B 4KZEH 5I2IA 1KTDA 5HHME 4IRJC 5DD0L 1JF6A 3VXME 3UTSB 5JUEH 1MJ8L 4HUUA 1MCHA 3TBWB 1RZJL 2AQ1A 4U0RC 1KCLA 4LLQA 2ZG2A 3ZHKA 4G9FE 1DQLL 4JPIA 3HI5L 2F58H 5T1KB 1A8JH 3MTRA 3OV6A 3OKOA 4YC2C 4W6YB 1E27A 3UBXG 3X11B 4XP9H 1LEIB 5DEGB 5FV2A 1RZGB 2HN7B 1PKQE 1FL3A 4TUKL 2AK4A 1FNSH 5D7JC 1SJHA 4C55A 2GJZA 5JPNB 1N59B 5FO7A 4OCLC 2ICWI 1HILA 1BP3B 2I25N 3GI8L 4K7PH 4OTXH 2HKFL 3O4OB 3X13B 4ZFZA 3RWFB 3DO7B 1JTTA 1J05A 4L9LC 3NVQA 4G7VH 1JCKA 4NQCB 3ZO0A 4NN5C 2R4SL 3P9MB 4QF1A 2OJZL 4PJ5D 1ZS8A 3CFDB 2FYYA 1CCZA 3BEVB 5E6ZA 5I8EA 1Q94A 3RVTC 3QUXD 3OG6B 2AI0H 4M8QB 3RX8A 1RK0A 2CLVB 3FFDA 5DK0A 2WBJB 2CR3A 4Q97A 4LPCA 4YFLI 3GSRB 2AKRB 5DHVB 4KJWD 4ZNEA 3GSNB 4P2QE 1QLEL 2GSGB 1JZ8A 2WAHA 3MA7B 4CU6A 3KYOA 1KELL 1F5WA 1U8OA 2JF1A 4F7TB 4MNGE 1CGVA 4OKVB 1FYHB 1JN6A 4KV5F 2D31B 3SKNA 3VFGL 4P4KC 3PP4L 5F7LB 4Z7OF 4DCQB 2IEPA 4PRHD 1U8KB 1JWMB 5ETUA 2ZCLL 3AS1A 2VABB 1KLFA 3MRDA 3LRSB 5KANI 2WUBH 4KUZH 1QSED 4JFXB 4FTVE 2AAVA 5ESAB 5C0ND 2N7AA 4RGOL 4PJCE 2BCKB 1D9KB 4S1DC 1DLFH 4QGYA 2EE3A 5J0BA 2IG2L 3M8OH 4MAUL 5FM5M 3U7WH 1P9MC 3BQUB 2DM7A 3CK0H 3B9EA 1RZKH 2DQTH 5IOPB 4M48H 3K7UA 3SGEH 4M1GL 1SJEA 2MQ0A 2KUTA 1FBIH 3WUZA 5CP7A 4FTVD 5KSUA 2QHLA 4FQCL 1AD0A 5DDHB 5ECJE 4KJPD 4PRPA 1BZ9B 4TPRL 4YHML 2OSLB 5T1DH 2EEDA 4KKCC 5IF0A 2ZUVA 5J6GA 4PFEA 1KIPA 3KHOA 3O41B 3VD7A 2NCMA 1JK8A 4XNMB 3PABB 4O5LH 1BM3L 1TCMA 4QOKB 1YN7A 3S37X 1YNKL 2H26B 3ARYA 5IK3B 3ETBF 2VLJD 4KK8C 5HHXH 4EI5B 2EZ0C 4YQXL 4WI6A 2WQRA 3I6KB 5IFHL 5J13C 1UXSA 1T7YA 1QHOA 1MQKL 4R97C 3QI9A 1QFHA 3GJFA 5C0RH 3QI9D 3C9NB 4YO0B 4AL8H 1ORQB 2DMBA 2AS5M 1WF5A 3S3JA 4TRPL 5FF6B 3G5ZB 4JLRB 1XF4A 2VZOA 4LSPL 3QDGD 4AEFA 5EN2A 1NMCC 1YQVL 3HRZB 3K8KA 3N9GL 3KS0H 3GBNL 4ERSH 2BSRA 3VXNA 3WIHH 2NR6C 3RWDB 4FXLA 4ZFOL 3SY0B 4NKQB 5CS7A 3SKOB 2YUVA 3BAEL 25C8H 1ACYL 4MXVE 4R7DB 4W81A 5F44A 1T5WA 4JZOB 1G9MC 1P53A 2D7OA 5AUMA 3C08L 3HUJF 3WL9A 4PJIE 5J3HD 1HZHL 3P9WB 5DMGD 1B90A 3BI9X 1T04A 3SDAA 3RTQD 1NLDL 3EYFA 5HI5D 5CGYC 4NHCL 5IWLC 2BXZA 4N8VA 2X05A 1JWUB 5ACLA 4L29A 3TWCH 4U6YA 3TBVA 2YD5A 4J12A 3RUGB 35C8L 1X5HA 1BD2E 4XPHL 1T7VA 1UGNA 3CVHA 4QY8A 4JZNB 4NRXA 1DSFH 5GHWH 3HPLA 1A7RH 1XMWA 5D2NB 4KAQL 3EYQD 1A4JB 1JHLL 4NPYB 1UXWB 4RDQF 3GZKA 4QRTA 3RTQB 1ERNA 3CMOH 3NA9L 2V5TA 5CJOL 4NQSB 2DI9A 1OAQH 1AJ7L 1MFCH 1XGYH 2AEWA 1D5IH 3P4OA 4M5YL 4WW2A 2VLLA 5ANMB 4KRMB 3MGOA 3SDXF 3VXUB 3LKNB 1G7PB 1U6AH 1I9IH 5EUOE 3H3BC 4WHTB 5D7KE 3IDYC 5ANME 2MPAH 2EO9A 1R3IL 1J10A 3DGGA 1EFXA 4NO3B 3GSQA 4OT1L 4HDIA 3SDCD 4GKZA 5K9JL 2VIRA 4PPTA 5IUSA 4F2MB 1NGYA 3NCYS 2FGZA 2CRIA 4LAJH 4ZO9A 3NFNB 1S7RB 4HWZA 5IFAL 1GIGL 2EDXA 1FPTH 4PD4J 3CX2A 3KPLB 3HZMB 1A6VL 5D2LB 4GSDL 5I30H 3BQUD 5TPWH 2VLRB 1BOYA 2QQLL 2ARJQ 4LQ1A 3ZE0E 4Y4HA 3T2NL 2BSSA 3MJ9H 5EO1B 4Y4HD 1O0VA 4WTWA 5CCKL 4NO5A 3NTCL 5JW4Q 1I4FB 4GQ9H 1CTNA 4E9LA 1AXTH 2FIKB 1RIHH 2KQMA 1NGZB 5AD0A 4JREB 4WVRA 3DX7B 3QUKB 3FFCB 4JFQB 4UU9A 1PKQA 5KW9H 4RISL 3V5KB 3NPSB 1R3KA 5FYJD 3D9AL 3QUZD 2VLJB 4HS6A 5I8CB 1F6AA 2CLVA 3U4AA 3RVXC 4EIGB 4ZFGH 1FG2B 1JNLH 1B3JA 1IGTA 2RJMA 1F2QA 2ARWA 1U41A 1CFNA 3ZDZF 3SE9L 1XF2A 4AENA 2BNQA 3HG1D 4X4YB 4X0KA 4QCIB 2Y6SD 4D3CL 3MJ6A 4XT1C 1WUNT 1YNLH 4GRWE 1N6QH 1K8IB 1F90H 2G5BA 2ZPKL 4OI7A 5IB4B 2EC8A 3T0AA 3F7VA 1J05B 5I15L 4TOYH 5FUCE 3H7LA 1HHHB 1KCSL 2IAMB 4ZSOA 4JFPB 4ORGA 2P42B 1N59A 3QIUC 1IGJA 1QD0A 4Y2DC 1XF3A 2PYFA 4YHZH 4LVOC 1WIPA 2HFFA 4HCRL 4TYUA 3A6OA 1MRCH 4NO2B 4PG9A 4XVTH 1U3HA 4GS7C 5IIEA 3LKQB 5FA4A 5D71L 1ZEAL 5IVXB 2P49B 1U8NB 4N9OB 1B4JL 4XPFH 3V2AR 5BZWA 1GPOH 4XNXL 3FZUC 5IBLD 3U7YL 4GRMB 5FHAL 4XXDA 5IVZB 5DD1L 3BEWA 1PW3A 4GRWB 4X98B 2CGRL 4OLVL 5GZNC 5C0IA 5MERA 4KQ3H 3RWHA 4OAWA 1ZE3C 3S36L 1U91A 3H42H 2ZCKH 1IKFL 1U8QA 1QFWH 5KVEH 4XP1L 3MNVB 4PJEF 4WWKD 4RGND 4ELMF 1R3JB 1GYAA 5IBTH 2OL3H 5EA0L 1A1MB 2PF6A 3OF6D 4G8GD 1FNSL 2EIBA 3MLPA 5HGHB 3WV0A 5FGBC 5IR1B 4UU9B 5SWQB 1E4KA 1HKFA 1GXEA 2YXMA 4RBPK 2QSCH 5KSAC 3SE8H 2ZKHH 4GLRH 4LVNC 4S1SL 4G7VL 1Q9KA 5DRNA 2BSTB 2DQGH 3BHBB 2FIKA 3T77A 1IGMH 3QO0B 1SJXA 2HG5B 5IHZB 2J8UB 1KB9K 2WANA 2DL2A 5DURD 1JNHA 4NN7C 5E2TL 4KHXH 5C2UB 5I1GL 1XIWC 2X2YA 1NCTA 2ZSVA 4V2CB 1ZOXA 2FH6A 4P4RB 2EDTA 4O2FA 5J6HB 2X4RB 5GSVA 1NUDA 5IFJA 1P84K 1XGQA 4I5BA 2JJTA 4ZPTB 5L2KA 1B2WH 1G7QB 1SY6A 4WW1A 4KK5D 4WU5A 2ZWLT 3JV6A 4OLXL 1P4IH 3CCHB 1EGJA 4POUB 3D39B 3MRQB 2VYRE 3P73B 3ROOA 4DKEL 1DN2A 1ZLWK 5IMKA 3FO2A 4RAVA 3ARVA 3IJHB 5C70A 3LD8B 3VXOB 1FO0L 1TJGH 3P4MB 3E2HC 2EYRB 2FH8A 3TJHC 2W0KA 4DZ8B 3KPMA 3BIKA 5KOVC 1FDLH 2VZVA 5K9QG 4UNVA 1CTOA 1D7FA 4P2RB 2VLLB 5ANMA 2AK1L 1T1WB 3VRJB 2V17L 4OUUB 1X5FA 2WSKA 2VXTH 4P49A 1ADQH 4Z0XB 3J8F7 2H32B 3UPAA 1JP5A 2Z31B 2XA8H 3GIZL 3QUXB 5MP6L 5ICZB 4WI4A 5DFTA 1VFOA 2NXZB 1EIBA 3CZJA 5KANG 3RVWC 3S37L 3O8XD 3QJHA 4KTYA 5TE4L 4X6CA 5F7WC 1EK3A 2Y23A 4H1LA 1BFOB 3BPLC 4YDLC 1JL8A 2DDQL 4UDTB 3D87B 5GJTL 4YK4C 3OXSB 1JTPA 3CXDL 3PV6A 1RMFH 1MJJB 4PTTB 4PLNC 1NPUA 1QPXA 1TQBB 1R6VA 4BYHA 1FIGH 5DGQA 3LPWA 3VFRA 1BZQK 3S3SA 2F8OA 5GGVY 4HKBB 4LDEB 4QWWD 3TM6A 1CK0H 2ATKB 4G80A 3FTGA 3SOBH 5B3JF 2W0LA 4I77L 4JR9L 3CFBA 1A3RL 3OTTA 1KLUA 1R5IB 1SBBA 5IHZA 1TMCB 1BREA 4X4ZA 3LEYL 1WTLA 4NJAL 3FT2A 1JZ5A 1DL7L 1PX3A 2GSIA 2BSRB 4Q9BA 3OKLA 5LGJB 4MB5A 1IGIL 1UM5H 4C56B 3IGAB 4HX1A 3T0VA 2C3XA 1RJYB 1MFEL 2GHWB 4ZO7A 3FB7B 4C57C 1CT8A 1PSKL 4XPGL 3HR6A 1A1MA 5DMIH 2AXJA 5DUMH 5DJZB 1VFUA 2R2BA 1BQLL 4HPOL 1OAKL 1GH7A 1VERA 3DJ9A 1FNHA 4G7YH 4I3SH 4Y16C 1CT8B 1IM9A 2XQYG 1UXSB 1FVDA 1S9VA 5BS0B 1CDBA 3L5JA 4KMTL 2DWEB 3VRIA 1MCQA 1OD9A 3BAEH 2GSIB 3ZE1E 2Z35B 1BGXH 4IRZH 4Y4FD 2ERJC 3MACH 2BJML 2YOCA 4UZGA 4ODSH 1DBJL 3Q2CA 4H26B 1UENA 1PLGL 4FG6D 4WV1C 5EULV 5ENWB 2ICWB 5DI8A 5KTEL 4PG9B 1Q9LA 3O6MH 1RUQH 2R0ZL 4GBXC 4POYA 4LHQB 3SGJC 1PDKA 1CWVA 1PX4A 4JG1H 1I9RL 3MLSH 1BFVH 1JRHI 4HIIB 4FTVA 1DFBL 4JQVA 3T0XA 1S9XB 1RPQA 4HIJA 2DD8H 4PRPD 5JO5A 5BMFH 2PYEB 5MEQB 2H32H 1FGNH 1WC7A 5JDSB 3GMNA 2H32A 2NY0C 3I50H 4K94L 1MNUL 1WVZA 3DRQB 3FRPG 5CEZE 5JXAL 1OAXL 3JV4A 2N7BA 2QEJA 2RBLA 3TN0C 1I3RB 2VDLL 2BNQB 3T65B 1PAMA 1WWWX 2A6IA 2UWEB 4X4MA 2VDRL 5EWIL 2EYRA 1S5IH 5JPMB 2WBWB 4DTGH 3GSNA 3B6SA 2F54B 3ZKSD 2NX5D 4CL7A 3BIBX 4OGZA 1U58A 3TYFA 4KJYA 1AGCA 1FLTX 3QG7L 1QR1B 2A83B 2AEIT 5DK0B 3W9EA 4G8GB 4UBDC 3H9SA 3ZL4L 4RBPH 2E6JA 2NY5H 4JCMA 3U4EB 4XHJC 2NYYC 4QGTA 5JW5B 1MELA 2NY4D 1EZVY 2VH5H 2WQ8A 3FQXA 1H8OA 1DUYB 3C09C 5D9SA 3ZZ1A 2CLZB 5GSVB 4AEIL 4Z78B 1CFBA 4ZXBC 5I75C 3I02A 2MCPL 4KRPC 1QYGH 1R3LA 3SGKC 1FC1A 5FYLD 2YPLD 4E41B 5H94B 4MDJA 3TFKC 1JWSA 2J3SA 3RWFA 5D72L 2B5IB 3GMLB 4MXWH 3MQIA 4WHYH 4K8RL 5F96H 4KGJA 4C4KT 1EZVX 4H25A 4X7SL 4RISH 5BCAA 1J0ZA 4HWZB 4K7PX 1MI5A 3IFPB 3DX9B 1EA9C 1T0NB 4GRLA 5L2JB 5D7SL 1MHCA 4UOJA 3SGKA 1TQCC 4APQA 4NNXB 4XCEA 3S5LG 3I9GH 3NIDF 1Z3GL 3GK8L 3LS5L 4BSWB 4RGMB 5GRZA 1R5WA 3JV4B 1U8LB 3GMOB 4G5ZL 2DIJA 3MNZA 4OAWB 3F7RA 4RMVA 4G6KL 3PNWB 1RHHB 3TVMA 4F7PB 2GAZB 3FQUA 1G7JA 4JJ5A 1CZ8H 3NBNA 2F74B 2W0FA 4XBPA 5EC2A 4LASH 1S9KC 4ACPA 3MV7D 3EYUH 4RMUA 3QFDB 4I0PB 2ZUQB 1IL1A 4UT6H 3LS4L 3BW9B 3VCLB 3RJDA 1SY6L 2PW2B 4IMLB 1JPTL 1VEMA 4TNVK 3WIFB 5IROA 3VFSB 5ISZD 2JB5H 4GW5B 2R15A 4Z0BH 1E4XL 2ZG1A 1E28B 1VADB 4K3EL 1JZ2A 5I1HL 3BX7C 3Q6FA 4OZHB 5DD6A 4RMQA 1J87A 3DMMC 3MRRB 1B4JH 1VFBB 3BKYL 4XPFL 4JRYD 1QFOA 3MODH 4Y4KD 1YA5A 4GQPH 2JJSA 2A77L 4N90D 3MJ8A 4UT7L 4NNYB 2FB4H 3WS3B 5JW3L 3E1F1 3WXWL 3L3KB 5D7LE 3S88H 4JVUA 3IDGA 2EC9U 3IJYB 3DUSB 2NY3D 4PRNA 1JV5B 3HNSH 1HQ4B 4UAOC 2I5YH 1OGTB 3H42L 2ZCKL 3QHZL 5E94A 1BAFL 1MH5A 3R8QA 5L0QB 3HE6A 2ESVB 1Y6KR 4NBXB 1OP5H 3QDGB 4PJAE 4G3YH 3N85L 2PO6D 5CIPH 1HHJA 5E2JA 1LEKB 2XN9A 2N4IA 3VGHA 4HJJL 3L3GA 3DUUB 1YMMB 4OCYH 4HK0A 5D6CA 1EAJA 5DUBA 1FN4A 3REWB 5ICXB 4DN3L 1V05A 1X5IA 1HHGA 2BVOB 2XWTA 4M9PA 2CUHA 1OTTC 1HQ4A 1FSKC 2IGFH 1T89A 4P57B 2HP4A 1M6OA 5B4MD 3HG1E 3TH2T 1H0DA 3HCVA 4NSKA 4CU7A 2R8SH 1I8MA 1UVQA 1OP3K 2C26A 2ATKA 5I1LB 3TV3L 1B6DA 3TEUA 1OAZL 3D2UB 4FZEL 1T1XA 4PV8A 2Y7QA 1HIML 1FIEA 4NQXB 4B5EA 1INQB 5AZEL 1T2QL 5JTWA 1GOFA 4NUGH 4FFVD 2HTLD 3KPOA 3V7AE 3BRGC 4O9HL 1CFQA 2ICES 1J5OL 3OXSA 5HD8C 1YYLL 5SWZE 1V8HA 5E2VH 3HZMA 1N4XL 1OF2A 5BO1H 4RFOL 2DKUA 1GCFA 4WHCA 4KKBD 5DS8A 3NFNA 1PG7W 3WIIL 4IMLA 3T8XA 3VXSE 4F57L 3QEGH 4LCYB 4ZS7H 4Y1AE 5GS0D 1DBBH 4GRWH 2E9BA 1FO0H 5B38G 1EBPA 4UMGA 5CD3B 4NN5B 2DM3A 4OD2B 1T3FA 3U0PB 1S8DB 3K1KC 5DQDL 2Z8WC 2OTUA 5KSBB 5F6IC 1ZHKB 3PNWA 4PJDA 4ODHL 1G7MA 4OF6A 5F1KC 1T0MA 3PIQB 4DCQA 4XNZB 2X4UB 5EBLB 3WE6B 4BQ8A 1L0XA 3QQ9D 5E5MB 4EJ1C 3GHBH 3P4LA 3ARDB 3OR7B 2EYTB 1NDMA 4XCYA 1MWAB 3MRCA 4AT6B 1DEEB 1MCOH 3FRUB 1S7TA 1GGTA 2XG5A 4B53A 1JIBA 3DX9A 1MI5B 1Q9WB 5L6YL 3C6LD 4P3DB 1EO8H 1T7ZA 3QXDA 2H9GA 1G7QA 4PJBA 2JJVA 4PREB 4R4NC 1EMTL 3OHXA 1IEAA 5F1NA 2XZCL 4Q9CA 2DAVA 3FQRA 5BRZD 4FOMA 1AC6A 3PUCA 1D6EB 3SGDH 3GMPA 1RZJC 3EYFB 2Z92A 3V7AG 3BP7B 3N1QC 1NGPH 3GEWB 1IC5H 3PWJB 3OWEA 2YMXH 4NQVA 3QCVH 4NWUL 1G7IA 4NJAH 3K80A 4U31A 4FNLL 2J88H 3QG6A 2FL5A 3QUMB 1NFKA 2XKUA 3VFGH 1JGDB 5KG9B 2VKWA 1OAYL 3OB0K 5GS1C 2AVGA 1YECH 4OGAC 5I76A 1H5BC 4CAGA 1CICB 1I3VA 1BEYH 5J11C 4BJLA 4RMWA 2ITDB 2JB6B 3L5IA 3MNVA 2Q6WA 3KPSD 5J8OA 4A2MA 2DF3A 4XAKD 4XZUB 2AXGA 2DJSA 2MSPA 3IDMA 1U3YA 4FA8A 2Q7NA 3BXNA 5JHLL 3MOBH 3S96B 5IBUB 5IGXL 2ZUQC 4IJ3B 1QRNB 2DQTL 4LSUH 4MXQD 4EI5D 3MRBB 4R96A 3UJJL 1AY1L 5JXEC 5FDYA 3IDGB 4KJQC 1UCBH 1NBYA 4KY1L 2GK2A 2P5EB 2JELL 3VGBA 1KACB 3O2DL 1HYSD 3R0MA 2V9TA 4PP1D 1IGYA 3QJFA 4XH2A 3VD4A 1N2RB 3BVNB 5EU5B 1S9XA 5F7EH 2DQJH 2CLRB 4ZQKB 4HC1H 5GGRY 2PTTA 4MNHA 4HC1A 2VMFA 4RAUA 4XVSL 1MPAH 4J4PC 5DJ2B 3WSQH 4OZFB 2VLME 2CLRA 2VDQH 2HKHL 2A73A 1P2CB 4JDTH 2XKSA 5IOPA 3QUMH 4RAUB 1H15A 5FGSA 2D0GA 2K3TA 3CFIC 3U9UA 4X5WA 1MAKA 4DGYL 1UJ3C 1UVQB 4UOW1 2RHEA 4XGZB 1N5AB 5DZNA 4ODXB 2Z4QA 5D7LA 5KVGL 1AGDA 5EIQA 2P47B 1MHHB 4X0KB 1FLRL 1NBYB 1A7QH 1FH5H 5SWZB 3V6FB 5FB8A 4IDJL 5ID1B 2E7CA 4HIHA 3KPRD 3T1FA 3LMJH 4NFBA 2VERN 3CFCL 3QUYB 2MOVA 4KVCH 3GSNL 1GAFL 3L9RA 4XBGB 4NN6C 5DJXA 2E27L 4OB5L 3NFPB 1IT9H 1DEDA 3QIUB 4OZIF 4AQOA 3LQAC 1LO4L 3C2SA 5MHSD 3MV7A 2GT9B 1T66C 5IQ9A 4KTEL 4BQBA 1NAMB 1NGZA 4NM8L 5IEHA 2W9EL 4XMLL 3FMGH 4I3RL 5IM7A 1RUML 4ZDHB 3WXVH 3GRWH 1I7ZB 4PJFB 4P9MH 2H3NB 3GRWA 1T1ZB 3K4ZA 4R4BB 3QT2A 3IDNA 5ILTH 3C6LB 3MJ8B 1QVOA 5KVFL 4AEIH 4YEEA 5CIPB 1HI6B 3U46B 1F3JA 3TF7C 3GHEL 4C59B 5EZOL 5GJSH 3ZT5A 4A6YL 5I9QB 4JPWH 4WFEE 2VITA 1A4KB 4U6XB 2ZUUA 3JTSB 3GMPB 3NA9H 1D6EA 2GK0A 5CZVL 3DO7A 3X13A 2V2TB 3LKSA 3P77A 4X8XA 3HAEA 2E3VA 3CFJA 1KJ2B 4CVXB 1ZVSB 2E7BA 4WEBH 1EAPB 3BW9A 1IL1B 3MA9H 4MX7A 5F72S 3RWEB 1U58B 4LHUD 5EPMA 5TDOB 2NY4B 2ORBL 3ALWA 4LHUA 5GGTL 3ARDD 3KPPB 3S6CA 4JN1L 1UWXK 3OKKA 3LIZL 5MI0C 3VG9C 3T65A 4XAWL 2AJYL 5F9DC 4P99A 4OF5A 2OXHA 1T6VN 2XN9E 2LAGB 4L4VD 4HWBH 5FYJH 5IMMA 4LU5H 4XVUC 4NQSA 1ZHKA 1I1CA 4N1HB 3ZE2E 2ED9A 2VL5B 3LEXB 4J3UA 1AR1D 1DQLH 2Q76A 1NH6A 4BZYA 4UT6L 4R90H 4KHTH 3OMZA 4JO4L 1MCBA 1ACZA 4RAVB 2Q86A 3T2NH 4V1DE 1LDPH 4XC1H 3V52L 1EXUB 4X7TB 1FORH 4FQ1H 3MCKB 3LKPB 3RZCA 1VGEH 2H41A 4L4VE 4FQXD 4Y19B 4K3EH 4WW1B 4TNVF 5JLZB 2EXWC 1Z5LB 1P6AB 3DETC 1AGEB 4LRIC 3I3BA 5MENA 1HKLH 1T04B 2ZNWA 1A7NH 5BRZB 1CFQB 5IVXE 1PEWA 5GZOD 1U8HB 4WIQA 3F5WB 2V7HA 4M7JH 4PJHA 4XP5H 2BMKB 4ZUVA 5B8CA 3BOVA 4P57A 2IAMD 3UZEA 4KI5E 4GO6B 2GCYA 3WMSA 5D6CB 5CAYB 3EGSA 3DX8A 3OAZH 5D70L 1BVKA 2C7UA 2X4QB 3EDKA 1XGTB 2R56L 3FL7A 4AIZA 2E5EA 3CH1B 1EHLH 5EN2B 1A64A 1QO3A 2NY7L 2O26U 4Y8AA 1DVFA 2DKSA 4FQIH 3VFOB 4EVNA 4GKSA 1OL0A 3LPFA 2HA1A 4HJJH 3R06B 4ZUSA 2YD3A 2IQ9L 2B1AH 3MMEB 1K4CB 1BQUA 3WLBB 1UZ6E 4ELKA 3FO0L 3OGCA 4PGEA 2HWZL 4A6YA 1QSZA 1XCQA 2YBRA 5ALCH 3UPRA 3PABA 1CLOL 4HCRH 1T0PB 3BH8A 1QR4A 2BOBA 2EDKA 5DVLA 5I66B 4Y88A 4JHWL 1RJLA 4PG2C 1ED3B 1DLFL 4HIIA 3MV7E 2O5ZH 2IG2H 4DQOH 2CUMA 3ARGD 4R2GD 4KI1A 1VFBA 4FFZL 4HBCL 3MSPA 1J11A 4Q0XH 2X4NA 4HKJA 4Z7UA 5DA4A 2HFFB 1JGEB 5GGTA 3VFSA 2R2HA 4LL9A 2E9IA 2LFGA 1EJ6A 5DJAA 1K4DB 2V7NA 4XPAH 3BGMA 4MA8L 3QNYB 2D03H 2NY6D 1VKXB 2A6JB 3U30B 1MWAL 4LPWA 4MNGA 2V2WB 1NUNB 2IALA 1YC7A 5DRXB 5ESAA 5JW4R 1G0XA 4O02H 5DQDH 1G7JB 4Z7VE 4O5LL 4NN7B 4PJDF 1ZLSH 2V2XB 2OL3L 1CFTA 1P6FA 2X4TB 3QZWB 3TJEH 3RDTB 5HYSB 5LXGH 2DTML 3R8BB 3QIBB 3T0DA 3O8XB 4P23A 1LO5A 4XC3H 1EBAA 3IDMB 3BIKB 4DZ8A 4ZD3L 3MGTA 1TETH 3K46A 3NH7L 4DVRH 4GRLB 2JB6A 1HCVA 3FOMA 1QQDA 3SJVB 2BVTA 4L4VB 3IJHA 5EIIA 4APQB 2OJEB 3DSFL 3W0WB 4NC1E 4YFLF 4GG6F 1K8DA 3IFPA 4M8QA 3V8CA 4ZMAT 4BH8A 5IB1A 1UA6H 3QISA 5DFVC 3QCUH 2X1XR 1RZ8B 4OUOA 3WFBH 4F15B 4H0HB 2GUOA 5DYOB 2IBBA 4PUBH 5LCVH 3UJIH 1GL4B 5IMOA 1P7KA 2G60H 5EU3A 1CFTB 2X4TA 3VWJD 4JHZA 1KJ3H 2YMXL 2JKXA 5IMLB 4RWHA 1JF1B 3CDGA 2NXZC 2BFVL 1FNEA 5D2LA 1ZSDB 3MRHB 4UQ3B 1OAYH 4UV4H 5CGMA 1YECL 2Z93B 2XFXB 3OB8A 3BPLB 1NBVL 4NGHH 4MQXC 2R1XA 4MNQE 5KBNC 2QHRH 4TVPD 4AT6A 3TYGL 3OR7A 1C1EH 3UC0L 1Y18A 1PY9A 4Y1AD 5GS2H 2XA8L 3CMOL 3GIZH 4MGXA 5MP6H 2I07A 2X4UA 3DURB 1U91B 3MX0A 4GOSA 3MRFA 4M7LT 5F9AC 2H2PC 4NZTL 2OCFD 1WC7B 2R0KH 1RULH 4N1CA 3VDAA 1UH2A 3EO0A 4LEOB 1F4XL 2CSPA 2JELH 3D85D 3O2DA 5FGBA 1J1PL 3O2DH 5CJXA 4HIJB 2EDWA 1FL5A 5E56A 1EJOL 3KWWA 3O0RH 5F9OL 1HXYB 3EJYC 3EZ8A 5F7EL 3D39A 3MRQA 4DJMA 2ZNXA 43CAA 3VFPB 4XVSH 4PLJC 3LKQA 3HNTL 5F6HI 3LN4A 1X4XA 2XYCA 1ZXQA 3P9LA 1KBGH 2HFGH 4JR9H 5T3XE 2YR3A 1G9EA 1YEDB 2ZZUT 5GQBA 1U2HA 2F5BH 5FO9A 4X4ME 5I30L 2KDGA 3AXLA 3NMEA 1H8NA 3HI6H 2FECL 3BPCB 2BOCA 1QACA 1UM5L 1W0WB 5EOCH 4OIIH 2Y7QB 5CD5C 3HI1A 5TH2A 2HJFA 3VXMB 4OZ4B 3JVGA 2A2QT 4P0DA 4YHLL 4N0FB 1NLBL 4LCWE 1K8IA 1ADQA 1KSRA 5EDXA 1YN6A 3SKOA 4CW1B 4WTZG 5JZ7D 1FVDB 1S9VB 5BS0A 4U1MA 3MLVH 3QH3A 1GAFH 3VRIB 3RWJB 1YNTB 2VXSL 3LN5A 4B50A 5H37H 5HHVH 1BVLB 1IT9L 4GBXB 2OS7A 2XN9B 1LEKA 5GXBB 5I1DB 5K59E 3DVIA 4KK9D 2OM5A 1N0XL 1MFAL 5FF6A 5INDA 3WN5B 3QXUA 1YNTA 4TQEH 4KQ4H 4J8RA 3EJJX 3ZTNL 1MH5B 3T0EE 4LSQH 1CG9A 2NY2C 3HZYA 1X5LA 1C5DA 3DUSA 1SBSL 5TQ0L 1OCWL 2P24B 3FT2B 1Z0MA 4M7LL 3RY6A 5GGSA 2R0ZH 1IBGL 4OZ4A 1UEMA 3H2WA 3ECBB 3H6JA 5JOPE 2NY1B 4LQFH 4TOYL 4EXPX 1UM4L 4ZFOB 3O2VL 1PVHA 2VQTA 5LKNA 1U93A 3T08A 3BP6B 5GPRA 3L5XH 4HHAA 4MAYB 4UTBL 5LWYH 4N8VG 5E8PB 3V7MA 3QULB 5D7JD 1WITA 1WCQA 3K4DA 2WK2A 3GGWA 4HBQA 3STZA 1MNUH 1Q72L 1KTRL 1G9NC 5BOZG 2IAMA 1OARL 1G6RB 3LV3B 5BW7C 1A2YA 2IPKB 2WP3O 2PNDA 4TTGA 2XNAA 1EFXD 2EDRA 3VCLA 5I19H 1KIQB 3SDCA 5DTFB 1GPOL 4XNXH 1GGBL 1UJTA 2HT4C 2VQ1A 4QHKJ 4AJ0A 3QQ4A 1AE6L 5C0BA 5E2UL 2F74A 2XQYK 3ZKXB 4HS8H 3NIFF 3GO1L 5BV7H 5GRUL 5KJRL 4XB7A 4H8WH 5ETUB 5L7XL 2NZ9C 5FM4A 1OSZB 3LVEA 4F3FB 1KIRB 1F4YL 1NAMA 5IEHB 2AJ3B 1ETZA 3V52H 2R1XB 2AKRA 1GJIA 4KJWC 2AK4E 3JV6B 4QNPF 4I4WB 3RUGE 3T1WA 4F37K 2J8HA 5E4EB 3EYOA 1P84J 5I1CH 4ELMA 1RIUH 3K4AA 3CDGB 4LLVB 3DXAA 2QSVA 1QEWB 1BJ1J 1REIA 2HYMA 4X99A 1FC2D 5EZIH 1I4FA 3I84A 3OAZK 5F96L 4PRIB 3WUWA 1U95B 1NANH 2P8PB 1T21A 5E4IA 3QP3A 4HH8A 4Z78A 4P48A 1CIUA 2VC2L 2XTJD 3ABZA 3QEQB 1DBAL 3MCLH 4WO4D 3IF1A 5AZ2H 1NMAH 4S1DD 2ESVD 1OTSD 1AO7E 4P9HL 3HS0B 1UH3A 4XNYL 1QLRA 4ZSOE 4XVJL 4JQVC 3IKCB 5EORH 4NQDB 1B2WL 5SWQA 1F58L 4JO3L 3HFML 2C3HA 1EHLL 1CLYH 2HVKA 4M6OL 3VXNB 3GBLA 4DGIH 2Y07L 3PE9A 4YX2L 2OJEA 2DIAA 1X44A 4ZPVB 2PYED 1IM3A 1IQWH 3NCCB 4TUOA 4KJPC 4JLRA 4LASL 4FQHB 4WCYH 3PL6D 5HDBE 4Z18A 4UUJB 3D25B 1S7UB 2PTUA 3FO1A 1GGCL 3FO0H 3QAZB 3L3JB 2KL6A 4OV5A 2JK5B 1CE1L 3W0WE 2EE2A 2EZ0D 4C83A 1BQSA 4X7CC 2GJJA 3L6FA 3AS3A 5D4QA 4X98A 5CP3H 3TO4A 1FE8H 4K7PL 4Z7OE 5BZWB 4NRZB 1MQ8A 4GAGH 3V6OA 3OJMB 2AXGB 3QI9C 1RUPH 4HZLA 1G6RH 1KLGA 2Z8VC 2XWBB 1A3QA 3IJSA 2IFFL 1F45A 4IHOA 2CKBB 2A77H 3QIBD 3VFMB 4J23A 4Q0XL 3ZE1F 2Y5EA 3OKYA 5E8OB 4PRBA 5E8DL 2ADIB 4D2NA 4XPAL 1C5CH 1CICC 2NR6D 1P4BH 1X5KA 2C3VA 4GRLD 4IS6A 4N9GA 1W0VA 1OAUH 1QBBA 4J3SA 4BUGA 1G7IB 3IDXL 4XPBL 3TBTA 1MY5A 4UNTA 4JFOA 1HEZB 1XCTA 1NFIB 2HRLA 2XPGA 2N56A 3GM0A 3V6ZB 43C9A 1KTLA 5J3HC 4I77H 1JYWA 5FKPA 3GMQB 4LLAA 1A7OH 4Y5XA 2VSCA 3RTQC 4NT6B 2I27N 5CGYD 3WLBA 3LKRA 2DQDH 1E0OB 4K3HA 1QKZH 1D5XB 5E2WH 4B0MM 4ZUSB 4X4YA 3MBXL 5J1SC 3LHPL 1NSNH 2BHUA 2EICA 3MYJB 4P2QB 2YN3A 3QXDB 2X89A 2Q8BH 5ID0B 5JOFB 4GG8B 4K9EH 1OAZH 3ZKQD 1ETZB 4N8CH 3EYQC 4GKNA 4XP4L 4MA1C 3IGAA 4ORZC 5I74C 1MWAA 3QXAB 2KBGA 2WLZA 4KMTH 3M8OL 2ZSWA 4YH6A 1VCAA 3EDDA 4AIXA 1R5IA 3BUYA 5I8EB 1NCCH 1JK8B 1K6QH 4XXCC 5L8JB 4M1GH 3RDTD 4ELMB 1CD1B 2XACC 1ZS8B 3CFDA 1CFSA 4S0TD 5C09B 2IPUG 4X7EC 5J57B 2ZG3A 1CU4H 5DJ8B 4NQCA 4Z95H 4YHKL 1CF8H 1JMZA 3DVNB 4UV4L 3LV3A 1S7RA 1C12A 5C07D 2NXYC 1RI8A 1WZ1L 4JFZL 4OGXL 5IG7A 5DJ8A 4LVEA 5DRZA 1DFBH 5F7NC 1IEHA 1DQJB 4GAYB 3PGFH 2EDJA 2EE9A 5HI4C 5E6IC 4BKLB 3G5XA 4Y4HC 4RZCB 4CU8A 3O6FD 3CK0L 5FUOL 2YHGA 3EAKA 5IESL 1DBMH 1RULL 4HPYL 1TPXC 2APVA 4DW2H 3LKNA 1FFQA 3GJFK 3PDGA 4RQQA 2R29L 3PDDA 5DD5H 3P0GB 1A4JA 1S5IL 1FNFA 3RJQB 4Q9QL 5I16B 4XCFL 4X6BB 3TBSA 5J1TC 3C08H 4XCCL 1BM3H 5TE6L 1MEXH 4RCAA 4OKDA 2V2TA 4OCMC 5FGCB 3HMWL 1XH3B 4ODUA 2IBZX 2Y6SC 1HCFX 3AAZA 4MD5A 4I48B 4M61A 2UYLB 5D1XA 3RU8L 2RR3A 3HNVL 1NFIA 2DQIH 2V5SA 1BJ1H 4MXVF 3RPKA 4ZAKD 1AXIB 3MO1B 3QUZB 4ONGL 3OSKA 4X4XB 2CK0L 2R1YA 3ARWA 1HINH 5HHPA 4WV1B 2C3VB 4D9LL 2BOCB 1LO0L 4YGVB 1CVRA 3DX6A 3VWKC 4K8RH 4IRJB 4Y2DD 4PJXF 1CVSC 1QLFA 5CJQL 4QTIL 3VFMA 2WWKO 4R7NA 4NBYB 4NYLA 1P1ZB 1I9IL 3RNQA 1YYML 3L9RB 1DDHA 5EFIB 4I18C 1AD9A 3ZTNH 2YUXA 4JEGB 5E99L 3N1PC 4S1QH 4WTXA 2VISA 1CS6A 3BJLA 2H2SD 3L3OB 4YDKH 3LQMA 4QYOB 1TZIB 2NPLX 4G9DB 1QRKA 1W2KT 1FV1A 1Q8MA 1XZ0B 3VFWB 4O4YH 1ZVHA 4AM0A 2VR5A 5EOQL 4FXGB 3MRFB 2Q7YA 3GIVA 5JR1H 4O51A 1U8LA 2HLFC 4GRMA 3LN9A 1AQDB 4KAQH 1WBZB 3ARGB 3K0WA 4HKXA 3O2VH 4WWKC 3KJ4B 3SQOH 5KSUB 3LY6A 1INDH 5CJOH 2I24N 3WCYA 1BZ9A 3W39B 5LG1A 2A74A 4N0YH 3C5ZD 4ZPVA 2GFBA 3BP4A 4RNRA 3NIDE 2MPAL 4UQ3A 5KSAD 3QDMA 1Q0XL 1RD6A 1ZA6A 1YEHH 3PJSB 3KPSA 3NPZB 1CXKA 1RUKH 4OT1H 3QEQA 3ULVH 4KVCL 5C7XH 5ITFA 2P5EA 1BMGA 2YKLH 1H3VA 3AS0A 5JW3H 3OQ3B 4O58L 2P7TB 3DI3B 4I48A 3Q1SL 4JANA 4M61B 2K7PA 4NC2B 5IFAH 2JJTC 4NP4L 3B8SA 1KCVL 1V5JA 3QHFL 4KUCD 3S4SA 1JRHH 3TBYB 4Z7NE 5IHUL 1JGUL 2AEPH 1JWMA 3BZDA 3CAFA 5HHOD 4AH2B 3TPUB 3BUYB 1GC1L 4FQ2H 4KK5C 5IJKC 3T04D 3ZMRA 3SKMA 1C08A 1A6ZB 3N1MC 4HEPG 4JZJA 1FG2A 4PJEA 3PWUB 3WHE1 5EU7E 2FJGA 3KGRA 3W0WA 5C0FB 4PJ8D 4JFFD 1H3GA 2FECI 3OAYH 3GHEH 3NZHH 2FX8L 1F4WL 2HJLB 5ID0A 4NQCE 3MUZ1 2VXUL 3QUMA 3RZWA 2ADJB 2NY5C 1E6OH 2EDOA 4JAMA 2VLRE 3TJHD 1INEH 1T4KB 3MR9B 1FZOA 5DJ6A 3PWLA 1D5XA 5D1QD 4ZUTA 1NKRA 1UB6A 3D9AH 2DQHH 4NUJA 1MCJA 3RZCD 1U0QA 1EFQA 5KSVB 1NMAL 4CMHC 5J4MA 1BWWA 5F7FA 4WI7A 3SDXA 3TCLB 1IGFH 2VLRA 1JNNH 2NNAB 3O8XC 5EORL 4XCNB 5HYEA 1RK1A 2VLRD 2A6JA 1J5OH 3VDCA 2XV6B 4I1NB 5CMAA 1MJUL 1KFAL 2UZIL 2VN4A 4WWID 3RQ3A 1CLYL 1CXIA 2AQ3A 3TIDB 1LP9F 4MJID 1NL0L 2QQNH 3RIAK 3X11A 2AJUL 1E27B 2N1KA 2I9LB 4LU5L 4DN4H 5BV7C 3P30L 4JREC 1PG7H 1EO5A 1FL3B 2P46B 4F2MA 5CJBA 4I2XE 4PRDA 1QG3A 2X70A 4NOFA 2IPTL 3BMWA 2MNUA 4M6NL 4MA3B 4QWWC 1UKSA 3KYNA 1OP5K 1I1FB 5JHDE 3O2WH 1GGYA 2X89D 4JPIB 5I0DA 1LDPL 2UV3A 3AY4C 2VLKA 3GSOB 3UTSA 5F88A 4JPVL 3JXAA 4OD2A 3EFDH 3KR3H 1C5DB 1NCAH 3MBEB 1YEGH 1NCUA 4G9FD 2ADFH 5C0EB 1G6RL 3I6LE 2CRYA 3L3JA 2L0DA 3UP1A 4Z7UF 1MCOL 4GG8A 3PGDB 4YJZL 1HSBA 5FHAH 1NAML 4J8RB 5JHDD 1F6LL 1SHMA 5K9KB 2P8MB 3MLTB 1EO8L 1AHWC 4MQSB 1MCCA 5DD1H 3KXFD 1FRGH 1FZMB 4LKXA 4UB0L 2GY5A 3KXFA 4CRPA 5E8EB 2HLAA 3TGXA 3C5SA 4H20L 3DVGB 1KYOJ 3PQYE 3KLSA 4JFYB 1UJ3A 3S8WA 1NC2A 4Y4FC 1NDGA 5TH2B 4G6AC 1IC5L 2WBKA 4ONFL 4U7MA 5EA0H 3WNPA 4UTAH 1KCRH 3ALXA 3U2SA 1NCWH 3QCVL 1FFNB 4CJ1A 2DIBA 4NWUH 4XRCA 2CH8A 1AO7D 2AJZB 1I8IB 2HH0L 3FT4A 1FYTD 1OGAE 4ZOBA 2QSCL 2Z31D 4CN6A 5B3JE 4WJ5A 2Y06L 2A6KB 3LHPH 1HH9B 1NSNL 5JLZA 3V4UH 3DUUA 2DS4A 3ULUH 5F21B 1XF4B 3B5TA 3HE7A 4X6CF 1MRDL 1N64L 2B4CH 5D93B 2XTLA 3SGJA 2CMRL 4QRSB 4P46B 5GS0L 1FFPB 1NBZA 4X8JB 5CJ8A 4OD3H 3CU1A 5MEND 3IDJB 3D3VD 2VE6A 3E6HA 4EZMA 4PRHE 2ZP0T 4PJ8B 4OFYD 2XRAH 4F3FA 3LEVL 1CI5A 2FD6L 3QCTL 3VI4E 4HSQA 1FGVH 3NCEB 4URTB 4GAFB 3K3QA 3L3HB 4UINL 5HGAA 3EOTH 5D1QB 1FJ1B 2OMBA 1ZA3B 4HC1L 5SX5H 3UBXA 3INUH 4PRAB 5DTFA 5TDNB 4QRRD 4UBDD 5CEZD 4IIQC 2CUIA 5D96C 4ZOEA 1QNZL 4P4KB 4XHJD 2NYYD 2IBGA 1ZVYA 4NQDA 1A6WL 2FZ3B 1I8KA 2ZUWA 5GIRA 4HUXB 3UTTB 4OCWL 1X5YA 5HDBF 3EO1B 2IMMA 1P7KB 3DECA 4U6TA 3KPQA 4ZXBA 2W65A 5A43C 3PXJA 4ZXBD 1YJDH 4WFFD 4JFEA 2FSEB 3FONB 2C5DC 1A1NB 3V0AC 1RZIA 2VDMH 4DW2L 4IBLT 4M7KH 3MLRL 3EKCA 1Q9OB 4LFHD 3MRMB 3DBXA 3SCMA 4CADB 1FZOB 2OMNA 4UV7H 5I71C 1FIGL 2JIXB 4XNQB 1O5DT 3WDHA 3G04A 2PTVA 4K7FB 4Q9QH 3KLHD 4GT7A 5FGCE 2E27H 4OB5H 3WFBL 5F7DA 1IAKA 4ZG1A 2HJLA 1T0NA 2FEDC 4GW1B 3IFNL 2GJ6D 4R0LB 2AERT 3HR5A 1H3TA 3WLWD 4UNUA 3T2PA 1AFVH 1JI1A 4XNZC 3FMGL 4H88L 4M6AA 3QB7C 4L3EB 1JGLH 1L7IL 3ZDYF 1HK6A 3SE3A 4M9OA 3G5VB 3FN9A 3CDCA 3QH3B 4EOWH 5GRWA 5ILTL 5L2KD 1LO5B 3BYTA 3HPJA 5AYQA 1H3WM 1RUQL 1YMHA 2DQIL 2X42A 4JANB 2IALB 3IFOA 4XHQA 1XIWA 2C4XA 2D7TL 1I9RH 2CK0H 3K2MC 2GJ6E 1EVUA 4JFOB 4A6YH 3TYGH 4BK4A 6CGTA 3GUTB 4J1UB 2IF7A 3TNNB 3VXMA 3BGMB 2CXGA 2IPKA 4JFHE 5JW5A 5D2NE 1NMCB 4WFHE 4WY7L 4KZDH 1FGNL 1KOAA 4PJ9B 3C2AL 2D7NA 1YMME 5EU6D 2ED8A 3ROLB 5BQ7B 5F8QC 1G7HA 1S7SB 2BP3A 1OAXH 4DOHE 3M1BA 1ZA3A 2ED7A 5DEGA 1XF3B 2PYFB 3DMMD 3O3BA 2VDLH 1TVDA 2D4DA 3NCJL 4ZFOA 5GGTH 3ARFA 5IB2A 4JN1H 5F9OH 1MHPH 3RGVC 5D1XD 3O6KL 2DWDA 2NQCA 2NTFA 3IU3A 4NFDA 2XZZA 3C6SB 1MCRA 4PJ8A 3O4LB 4KKNA 4JM2D 1U8MB 3X3FH 4LLDB 2NY3C 2WIIB 2FGWH 1QRNA 4WU7B 1JF5A 4TSCH 3P0YH 5T5FH 5HHXL 1HH6B 5LQBL 4ZYKB 5I73C 4UUJA 3D5OF 3QFJA 5T3XH 1NJ9B 1P7QA 2PO6C 1M1SA 3ARSA 4HFWA 1QFPA 3BN3B 4TULL 4M5ZL 3LN5B 4XP6H 4F8TA 5HHQB 3IDIB 1R3KB 5H2BB 3V5KA 1DE4B 2FCBA 2RCSL 5FIEA 1U8JA 4HGMA 5L88H 5AYUL 1BBDH 3NAAL 1D5BA 1NAKL 2P8LB 3W2DL 1IEBA 1JJUA 1JZ4A 4UOW0 5B4MC 3BWUC 1GZPB 1KCUH 4X7SH 1TFHA 4NZRH 4F9PC 3G6JF 4NCC2 3PF2A 1ZLUH 4U7KA 2JJUA 3TZVB 4XP5L 1NDGB 1WWCA 4JO2H 2FHBA 2BMKA 3O11B 4QOKD 5CEYB 1ZHBA 4BZ2L 2UY7A 1ZLWH 1N0XH 2APFA 4NKIL 4LSVH 5I18H 1ZMYA 2HTLC 5I8OH 3EUUA 2IH1A 1JRHL 3D85A 3GMMB 5FYLH 3BESR 4WI3A 1IM9B 1XH3A 4MMXC 2DYPD 1IAIL 4FQLL 3OHXB 1Z5LA 5FEBA 2CKBL 2GW5A 5EOTA 4FQIL 5K9KA 4HGKC 3TWCL 2OLDA 4KKBC 4FXKA 4GW1A 1QSVA 1CZ8L 4DZBA 1IBGH 5T3ZH 5DD3H 5DEFA 1IAKB 3VFNB 3MRGA 1YPZE 1S7TB 2FDBP 4QHNA 5HYJB 2FX8H 3AU1A 4YLQT 3LEXA 3EYUL 4U6VL 3MBEA 1UACH 3TH4T 3DXAE 4JDZB 3MLXL 5E5MA 5EO9B 1HHKB 3RPIB 5JIKA 3QHTC 3FRPA 1F3DH 5DQ9B 4UTBH 5ALCL 3HAEG 4GRWF 1WFUA 1AJ7H 1XGYL 1O7SA 2D9CA 4E0RB 3ZSSA 2BNUB 3QIWB 5HBBA 1A6UL 5ADPH 2JCCF 3E6FA 3HC3H 2G9HA 1DR9A 3QQ9C 4I8DA 1BX2A 4LPYA 3QO1A 3KG5A 1HWHB 1WSST 3SDCB 1TIUA 5HHOB 4K71C 5DUPH 3PGCB 3N1FC 1EAPA 1H3PH 4UT7H 5GSRA 3C6LC 4LHJB 3ULVE 4G8GE 5I75B 4OFDA 5IV2A 4QRUB 4R4ND 5CBEA 1J0JA 2E7MA 2V7NB 4JVPA 4GG6E 2R0WH 4P2YA 1BVZA 1S7WA 4NQED 1YC8A 3MXWL 1RZJH 3MV8E 3TCLA 5HDOA 2FNBA 2Z31A 4NQDE 3W9DA 1ZHLA 1I7RA 1J8HB 2B1HH 5T33L 2V9QA 3QO1B 1LE9B 1MLBB 4XP9L 2EDQA 3QEQD 1SY6H 3EZJB 3ECBA 4M6MH 3C6LA 1GC1C 3TJEL 2DRUA 3L5WA 3GSWA 5IVOA 4LLYB 2BNUA 3QIWA 3HMXA 1E4XH 5E6IA 4WI9A 5IJVA 2CPCA 4OTXL 3GSVB 4OCXL 5IB1B 1G9ML 3WFDL 3OJDA 4EI6A 1WWAX 2X4OB 1L6ZA 1JUFA 4WUUB 1V3JA 1KT2B 2IGFL 4OGAD 4PGEB 5HHOE 4CVZA 5SX5K 2J2ZA 3H3PL 5EZJB 4HFUH 5IQ9B 3ARBB 4LNRA 2YA0A 4HIXL 1A6ZA 1IVLA 3QUYA 2H8PA 2VOTA 4WU5B 1V3LA 1HH9A 2F53D 3UTZA 5LJYH 1BJ8A 4XNYH 4DAGL 1Q1JH 4PJFE 1QO3B 3ES6A 1N0LA 1U8IB 3SKJL 4PBWD 4EEEA 3UZVB 3QEHA 4EI5C 3B2UC 5H35B 2CK2A 4KJQD 3UZQA 1SEQL 3V5HA 4G3YL 2GCYB 4M4PA 3WNKA 1N6QL 3TO4C 1W0WA 4OCYL 4IEFB 1W72B 2F19H 4X6DA 1DBBL 3TNMA 4WCYL 4RNRB 2GFBB 4PJCB 1AD0B 5C09E 5HGHA 4YWGH 4J4PD 3RWIA 3FQWB 2X5PA 3LN4B 1N64H 2B4CL 5DURB 4MJIE 4LBEA 3VW3L 1UFUA 4LMQE 3DWTA 5DK3A 3VXQA 1MCKA 2EKSB 8FABB 4OCSL 3PQYB 1FAIL 5AZEH 4M00A 2VJXA 2BX5A 1KLGB 3JZ7A 5C3TA 4GAJH 1HH6A 3P2TA 4DGVH 1BLNB 3G6AA 5ESQA 5J9PA 3MC0A 1MLCB 4LP5A 4M7ZC 1LK3H 4JFXA 2VL5A 5L6YH 3S96A 3Q3GA 5BO1L 5E8DH 2P5WB 4FQCH 3FCTA 5FDWB 4CKVX 1EJOH 3O0RL 4CMMA 4ZUWB 5JDJA 1CD0A 2PXYD 1MRFL 1MCNA 3ARFB 4XBEL 4XPBH 2G2RA 4QXGL 4MJ5B 3VWKB 4Q58C 2EYSB 4TUOB 1DVFB 4U0RB 1ULVA 5JHDA 3ULUE 1KG0B 4M1DL 3U0TB 4ONHA 3MRKB 4O2CB 1S7SA 4MNQA 5J7CC 1T66D 1LE5A 4PJ5E 3RA7L 4YHYC 2WBJA 2QADB 4PRID 2FL5B 2F5BL 4KKLD 2C3GA 3UTPE 5IFHH 3ORJA 3VXRD 5D5ME 4F15C 5HHPB 2PXYB 2GK0B 1Y0LA 1MCIA 2VKXA 2IJ0C 5JIIA 4XMPH 3AMLA 3RWGA 3VXUE 5EU3B 5C8JA 5IMOB 2O93L 3MPCA 3ULUC 4RRPG 1QSFE 5I1GH 3HUJB 1O7VA 1X7QA 3PWPE 1Z9SA 3GBNH 4ERSL 4V2BA 4BQCA 4OZIB 4X99B 1CFNB 4YK4B 1OGAD 3WUWG 4EQ2A 5CLWA 1A9EB 5JQ6L 4J3VA 1K8DB 3FRUA 2CRZA 1QTYT 3EYOB 1WIUA 3O6FA 2FJGB 1UCBL 2A83A 3O45A 2VLJA 3VWJA