5DJCB

Fc heterodimer design 8.1 l368v/y407a + t366v/k409f
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
207
structure length
206
Chain Sequence
b'GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLVCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSFLTVDKSRWQQNVFSCSVMHEALHNAYTQKSLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 206
sequence length 207
chains with identical sequence E
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djcB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djcB01
4EDXA 4RFOL 1CR9H 1TETL 4NM4L 5HHPA 2NY7H 4G6FB 3THML 5GS0H 4XZUB 3QI9B 3IVKA 4XNUH 1BQLL 3WIHL 3MRRA 2R2EA 4NKIH 1L0QA 2GEEA 4PJGF 5IFHL 2R4SL 1DJSA 2VL5B 4GSDH 5C6TH 3BD4A 5TDPB 5HTSA 4HLZG 1Z3GL 1RUML 1T1YA 5HYEA 1YEHH 4G8GE 5GXBB 1ZHNA 4PJ7B 4OGYH 1ZTXH 3V7AG 3QIBB 3R06A 5JPMB 2HAZA 4M48H 3VFMA 5KVFL 1LEKB 4K7PH 4MNQB 2EKJA 4P2QB 5I1EL 3EYFA 3IXTA 3VCLA 4O5LL 3VXUB 5F6HJ 3GSRA 1ZWIA 4HK3J 3QO0A 3NIGE 4FQIL 2X05A 1NBZB 1KNOB 3ZTNH 4BQ6A 4W4OA 1G6RL 1IT9H 4KV5F 4I1NB 3F65A 4I3SL 1HH9A 3GJFH 2JK5B 3MACL 3JVGC 1W72B 1FL6A 3JTTA 5T3XE 3DVGA 1B6UA 2YPLA 5A1AA 5JA8B 2H8PA 1J5OL 4OLUL 4K94L 5FYJD 4GG6F 1XAUA 3GK8L 4ELME 4KJYA 4I0PA 1P4BH 5TH2A 3X3FH 5BS0B 3D85A 1S9WB 3ALPA 1S5HA 2WW8A 4JFDD 3HFML 5HHXH 1VKXA 4NGHH 1CFVH 2FWOA 1F58L 3GI8H 5CAYB 3BP4A 1J0ZA 4GKNA 4IRSB 4NQDA 5FO9A 2VABB 3QULA 4NO0B 1M05B 1N64H 5DJAA 5T5NF 1EJOH 5LVEA 5IHZB 4NQCD 5DRNA 5JOEA 3O6FB 3S96B 4U1KA 4D0CA 1GGUA 1KENL 1NJ9A 5GGUA 5DGQA 4FQQA 2HJLA 4OBRA 3QUXB 3QI9D 5E24E 1IMHC 4FQCH 1BVLB 5CJ5A 1IKFH 5E5MA 3MJ7B 2BNRE 1HE7A 1P6AB 1FZKB 2OZ4H 4NHCH 2AJVL 3HPJA 3OAZH 4FZEL 4XNMA 3S35H 4WY7H 3D48R 2CKBA 4PTTA 3OB0H 1VFAB 4PS4L 4OZFB 4XMKL 1KIPA 4PB0L 3QIBD 3U0WL 3VRLF 2AV7B 2Y6SC 3NIFE 4MNQD 4P2QD 2ITCA 5CEYA 4LIQE 1JE6A 4R8WH 4O2CB 4ZUSB 5DRXB 5DQDH 2VN4A 4OLZL 5T33L 4K23H 1IQWH 4L4VA 3QXWA 2DQEL 1LP9E 1I9JH 3CVIL 5J12B 1MIMH 1PDKA 5HI3D 5KSAA 3K8KA 1KB5A 4AL8H 3DGGB 3N0PB 3GMLA 3S36H 3VWKB 1WBYA 4XB8A 4X6FA 3VFWA 2FX9L 3AU1B 4JHZA 5FGCE 3FRPA 1R5VA 1MCOH 2P4AB 2NY4D 3CXDL 3EYVA 1QLEL 5BS0D 4KAQL 4UNUA 1UKQA 25C8H 2GITB 4NN6B 4OT1L 4MA7L 5I71C 3ZTJH 2LVCA 4GBXB 3GIVA 5ENWB 3ARFA 1QFWI 1JNNL 5AZEH 4IRSD 4L1HA 4PBXA 3QFJD 4NO0D 4MB5A 3UPRB 4GRWE 1PY4A 1EGJA 3DVNB 2XXCB 5EZIH 3DV6A 3EJZD 2NXZB 4I77H 4Y4KC 3O6FD 4LKXB 1U8QA 3HHRB 3SOBL 3QUXD 1A4KB 1AR2A 1KIUA 1TMCB 3H9SE 3IB4A 1UQSB 2EDOA 4PRHB 4ERSL 2AS5M 1D5XB 1YEIH 4TUJA 5HPOA 2GAZB 4GKSA 4K3EL 1HZHL 3V6FA 1EUUA 1MFCH 4WI4A 3WYRA 3MYJB 4LSVL 4UOW1 2F9BT 1ZVSB 4U6HA 3ZT6A 3PDOB 3DTXA 1KJMB 3FHQA 5KN5B 3ULVL 2XYCA 4AIZB 3LQAC 4HJ0D 4WW2F 4NSKB 4CJ1A 3NOIA 2FRGP 4KC3B 4PJGE 5CEZL 1ZLVH 1YY9D 3O0RL 4OIIH 4G7VL 1TPXB 5EOQH 4QKXB 4WGVB 3A6BH 4AEHL 4YXKH 2BY0A 4LRNL 3FQXB 3HUJF 2OLDA 3FZUC 3NVQA 4TPRH 3FCTB 4Q2ZB 3MREA 3TN0B 1MCRA 4WWKB 2C3VA 3RJQB 4XP5H 4N0CD 1B3JA 2YPVL 5IGXL 1X7QB 3UTTE 4AK1A 1HKLL 5CBAB 3GSXA 4N8VB 4HBCH 1BFTA 1OHQA 4KV5E 2KZ1B 2KZWA 3UTPD 1IGCH 3VD9A 3ARUA 3NPZB 4XNQA 1S9VB 1BREA 2EYSA 4NQEA 4YXLH 1E4JA 4XCNB 4GG6E 3KLDA 1P9MC 5IK3A 3B9KD 2Z92A 5FHBL 3WNMA 1RMFL 3NAAH 4KY1L 1MCDA 4KVNL 4BUGA 4GXUM 3SE4A 2F8OA 4Z18A 1S5IH 1AXTL 1TIUA 4GW4A 5DD3L 4CVUA 4TULH 4ZAKA 3UPCA 2ENYA 4QYOA 4PRHD 1I85A 2CDEA 3PWLA 2Y4SA 1NGQL 4P5KA 3ABZA 2X4RB 4HT1H 2WBJA 4P59L 4N68A 4MJ4A 1OP5H 5C3TA 1JPGA 3EYQD 4FRWA 4HIIB 3FAWA 4DZBA 2IPTH 3QEGH 4M6AA 2O5XH 4JN2B 5F9JB 2NNAA 3V4PH 1ONQB 1R3IH 1LK3H 4NNXB 1WIUA 2DQDL 3PQYB 2L7JA 2BSSB 4ZUWB 2C4XA 1CFSB 2NX5A 5KTEH 3E0GA 2MMXA 1V05A 1D5ZA 1GAFL 4LSTH 1GGIH 4IDJH 2HKHL 1QVOA 3VRLE 4XVTH 3PWUB 4Z7WA 3P77A 4RIRB 1KC5L 3W11D 4BQBA 2EYTB 3TN0D 1KTKE 4RFNC 4XH2A 5DRWA 3RWJA 3BXNA 4PP1D 2Z8RA 2DLTA 5C92A 1CDIA 3P4OA 3P11L 3MXVH 4FQ2L 5HYJA 1Q1JH 3EIFA 3WNPA 4JFFA 3N9GL 4PY8J 2HWZH 1EEYB 3B9VA 8CGTA 5E94B 5GISL 1IL1A 1MWAB 3WUZA 4YHKH 2GK0B 1DEDA 2V5SA 5GRXG 5KOVC 4WI6A 2CRYA 3RWDB 4JZJC 4M43H 4G43B 3GSUB 5HHOA 1GOHA 4YUEL 3V2AR 3AB0B 3FOLA 3KJ6L 1NCDL 1CQYA 1NUDA 3HLAA 1AQKH 2QR0A 4MX7B 5JIKA 3WIIH 2DN7A 4JQXC 4WW2C 4OZ4B 2HT2D 4PGDB 1ZLUK 1NGWB 4H26A 2J6EH 5BV7L 2DWEB 5ANMA 4GAJH 4OLYH 4Z76B 3HZKA 4F7CB 2GSGB 1L7IH 1N0XH 2YR3A 3O4OB 4RAUA 4ZO9A 3VRIA 4U3CA 3QZWB 4M9OA 5EU6B 2HLFC 5T3XH 1KJ2B 3C5ZA 4IJ3B 4L4TD 4XX1E 5D6DC 2V2TA 1ZT4B 1JGUL 5HY9A 2G5BA 3ZL4L 3OKEA 3FN0L 5IR1A 3LEYH 1UJ3C 3LKNA 5E03A 4QO1A 3OX8B 2FECL 2GCYB 2BXZA 1E4WH 2SEBA 3ARBC 3OJMB 2HT4C 2OL3B 1AC0A 2VOTA 3NCBB 3GEWB 1LO0H 4J6RL 4PJ9A 5ERWB 1EERB 5F7KC 5F9WB 3EYSH 5IB4A 1I7TB 4EVNA 4FFZL 1GGBL 5C0RH 1QRNE 1TNNA 5I8KL 4CMMB 1OLZA 3O6LH 4WV1A 2FR4B 2IEPA 1BFOB 4U1GC 4ZTPH 3EZ8A 4LGSB 3HUJE 4DVBA 1KEGL 5K9JL 1U8NA 3B2VL 5FYLH 1U8KA 1BBJA 3D3VE 2BY2A 5ESQA 1X5KA 1T0MA 1FSKC 3LEVH 4U1LA 2DL9A 5EZJB 5T3ZL 2ZUWA 2EXWC 3WXVH 1I9RL 4G3YL 2Y1VA 4U1SB 3KPRA 4DJMA 4K8RL 4YQXL 1MUJB 2I60H 3ILPA 5F1OB 3OPZL 2AK4E 1IC4H 4Y1AA 5DWUL 3HC4L 2B1AH 3ZHDA 1QBMH 3JV5A 5SWSA 3KJ4B 4LIQH 4L3CA 4YR6A 1OAUH 5CD3B 3V4VL 4JO2H 1V7MH 4P46C 1MHPL 3WLBB 4IRZL 5F6IC 1YNTA 3GDBA 4YE4L 4JREB 1QEWB 4GJTB 1RIHH 2GJ6A 3LHPH 4HK0B 5EU6D 1B0WA 3BP6B 1EDQA 1R3HA 4MNGB 1W0VB 1Z9SA 3IDJB 2VH5L 3SY0A 1A9EB 1QLFA 3FO2B 3N50A 2CIKA 3SE3C 1QSFE 1KIRB 5SX5H 5I76A 4N90D 1RZ8A 4X4ME 4DFIA 1PSKL 1EAJA 1P7QB 2XTJB 3D0VB 3NZHH 2N7BA 4LK4A 2EXYD 3H9HB 1NGXA 3GMOA 1LNUB 3PL6A 1TQBB 3MRDA 4HGWA 3QXVA 1CGYA 2ZOLB 4GRWH 1DQJB 5GS1C 2XN9D 1J0YA 5ALCH 1MF2H 2WQ8A 1VFBB 4G9DA 1RJLA 4XVSH 3DVIA 1CGVA 5JQ6H 1KXTB 5EFIB 4L5FL 4P23B 4CMHC 3IS1X 4EUPH 3VWJB 1OTUC 3HE6C 2O26U 4G7YH 5EZOL 2CUMA 4KKCC 4R0LC 3JWDL 3SO5A 5AYQA 1VGKB 4MZ3A 5I16A 5J3HC 5HVGB 3QHFH 3MA9L 1RZ7L 2ZKHL 5C7XH 1YPZA 2VLJB 3ARGB 1D5IH 3WNKA 2D9CA 2DIAA 4PJBB 4WI9A 2BY1A 2CLVA 4P5MA 3FONA 3RY4A 1PQZB 5C08B 3W0WE 5JW5B 3GBNL 3X13B 1RQ5A 4KHTL 4L29B 4Z5RA 4QRPB 1VPOH 3KLAA 4POUB 2YK1H 5DI8A 2DBLL 5F7YC 2D7OA 3ZKND 4A6YA 4JCLA 1CT8A 3RAJL 1RZGB 1T6WA 2EIEA 3SCMB 5T1LD 3U7YL 1KXVC 1GZPA 4PJ8B 4PJHA 4WFEE 3C6SB 3IDMB 2Z31A 3MOBH 2LU3A 1BQHG 1SYSB 4O9HH 3DSNA 5DC4B 4AG4L 1UYWL 4U6TA 1HH6A 3GIZL 4F80A 4PRNB 2ZWLT 1IEBA 3LQAH 5GGVY 3UYRH 2YMXH 3WIHA 2XTJD 4ELKA 2KBGA 4N0YH 2R9HC 1M7IB 3T1FA 4UB0H 5AWNH 4EI6A 4PLOB 4I4WB 4HWBH 4OCNC 2DQFA 3KNBA 3Q2CA 4XNZC 2VUOA 2DJUA 2XXMB 3MRRB 3D87B 1U6AH 3S4SB 1MRCL 5CKAA 4OCMC 4P2OC 2ADJB 4TSAL 2OM5A 3BAEH 5FUCC 4U6VH 3KPSE 1OWRM 4LARH 4MAUH 32C2B 3VWJD 1SJHB 3B5HA 4Z7UA 4ZNEE 4GQ9L 1G6RA 4HDIA 2VN7A 1XF4A 4AEIL 1FFNB 2C3XA 5C07B 4NQXA 2HT3D 3QA3B 1YEDA 4YHIB 3WO4C 3C6LC 2X9YA 2A6JA 2PETA 5D1XA 2XWBB 3DYOA 2FD6L 4I9WE 5ID1B 2A6IB 4LNRA 1FFPA 2F5BH 3T2NH 4FNLH 4HUMB 5C08D 4LVNC 4IMKC 2H8PB 1RFDH 3AS0A 4LU5H 4QRPD 4K71C 1NBYA 3CVHH 1J1XH 3BDYH 4KJYB 2WIIA 3MA7B 4OSUH 1OW0C 5FUCE 2RIKA 3ARWA 3SCMD 3MRMA 3F7YB 4IIQC 1S5HB 5DHXB 3D18A 1VKXB 2NY1B 5TGBA 5J4MA 5E2WH 4AM0A 4Q9RL 2C3WA 4NN5B 4M8QA 3ZKMC 4XPTH 1P84J 2W9EL 5JOFB 4NQDB 1T7WA 5T1MA 1J1PL 4JPIB 4HUUA 2F53B 3IJYA 3MLVL 5DT1L 1R3KB 3K1DA 1G7HA 5GGUB 3V6ZA 1MAML 4PJ5B 2OTUA 1XCTB 1N4XH 1MRFH 5LAXA 1A22B 4WTZG 3DETC 2N7AA 2OR9H 1I8LA 1YEEH 1LO2H 1ZLSL 1TZHA 2BRRH 3T0DA 4L4JA 4KHXL 3O8XA 1NH6A 3OGCA 3ETBF 3DVFA 1VB9A 4OD1L 3T0WA 3IU3A 1Q72H 3O9WA 4PRPB 1D5BA 5E8OB 4XC3H 4CKVX 3LRSB 4HMCA 1CGXA 4R7DB 1YEFH 2X4SB 1HQRA 2ITCB 4HMEA 4DEPB 5CEYB 5CP3A 3K0WA 4Q9QH 1I7ZA 3VA6A 4OIAA 2PW2A 3SGKA 5F1NA 3L6FB 3FFCA 1MCIA 2H2SD 1DQQB 1PX3A 3AFLA 5DA4A 5KVGH 1Y18B 4YBQC 3GMLB 5IWLA 4OZHA 2YD3A 3ARVA 4DN3H 3VFWB 2J1KA 5FEBA 4ONFH 2YPLD 4PYGA 2PXYA 3ROOA 3SDDC 1UFUA 5BCAA 1FLTX 1G7MB 5L7XH 1KELL 2VR5A 2BZDA 2ADGA 2ID5A 3D85D 4QXWA 3TVMA 3O6KH 4FFYL 1ZEAH 5M7QA 3D9AL 4TQEH 2NY1D 1U95B 2I5YH 1H8SA 1MI5B 4XXCC 1A6VH 3NCMA 1SBSL 4K55A 1Y0LB 3D39B 5IMKA 3SDYH 3GSOB 3C60A 4Q0XH 1JNJA 4NQDD 2ZUQB 3E8UH 3SGJA 1RI8A 4XVJH 1AR1D 2Z4QA 3TESA 4XP9H 1Q9LB 1I9IH 3L3JA 4FZ8L 5F8RC 4OB5H 2YSSA 2EE9A 3TBTA 1CICC 1I8IA 1U8QB 2UZIH 5D6CA 4PJ5D 3SKUD 2GSIA 1IC7L 1GC1C 3Q6GL 4NNPL 4ORGA 3LQZA 5I1IL 2BOCB 3TH4T 2FJFA 1OCWL 3H8NA 3RRQA 4H1LH 1INQB 1TFHA 2VJXA 3CFJA 2CLZA 4L8SB 4XMLH 4X5WB 5TQ2L 4EBQL 4PRPD 8FABB 4O51A 3W39A 3CX5K 3CDFA 2PYEB 4XRCA 5ADPH 5JXEC 1ZSDA 4WVRA 1ZLWK 2VLMD 5TF1H 4JY4A 2AJYL 5TE7L 3DI2B 2IBBA 4L4VD 1J86A 4S11A 4Y5XC 2IQ9L 4FXGB 1AY1H 3QDJA 1KCUL 4LP4A 1WITA 4X6CF 1AGEB 5D72L 2R2HB 5T5FL 4HX1A 4OKDA 3V0VB 4JHWH 1IE5A 4CL7A 5A3ID 3LY6A 2D31A 4QCIB 1I8KB 4XTRC 5I1AA 1FNSH 4J3VA 5KBNC 3IRZA 1JHKH 5ACMA 5DFTA 3SQBA 3QUZB 5KOMC 4UIKH 4UT7H 2EYSB 1DBKL 3D69A 1CD1B 4IMLA 3KDMB 5ESAB 4GT7A 4D2NA 1AFVL 1OPGH 2V2XB 1GPOH 3VXNA 5BMFH 4TTDD 3BEWA 4JJ5A 4UIMA 3G6JF 4FQHB 1AHWC 1BLNB 3STZA 5EULV 3QQ3A 4ZAKB 5CEXA 2FJHB 2CDEB 4G8IB 3QDGE 3TT1H 1K9TA 4JG1H 4LVOC 3RGVB 4OFIA 4DKEL 4M1GL 1XH3A 5D7IA 1FGVL 4RWYH 2A0LC 3TFKC 5A2FA 5LQBH 2Q86A 4HXAL 4ZOEA 1MJUL 2LAGB 1KGCE 2EIZA 1CE6A 4K7FA 1CIUA 4HS8L 5F1IA 1JWSA 5IHBA 1EEZA 3A6CL 2VKWA 1TVHB 2A1WL 1UT9A 3U4EB 4DGIL 3SKJL 1A7QH 3P2TA 5HVWA 3DO7A 4KRLB 5DK0A 4HW6A 4NJAL 2YWYA 2GW5A 5MP6H 1NFDA 3X3GH 5D2NC 1JZ6A 1EHLL 3TZVB 2P8MA 5DMIL 4Z7WB 1S7SB 3OG6B 3K8MA 1F13A 4N9GA 3N85H 2V17H 4QRRE 5HDLA 4NFCA 1F3JA 3GNML 3IKCA 4KZDH 4HC1L 3OXRB 1I75A 3QJHA 1BQHA 3SGDH 2VDLL 4NWTL 5HGHB 5J13C 3F7RA 5EOCH 3VGDA 4G9FE 3TH2T 2AABL 2Q3ZA 3EUUA 4YFLF 2Z9TA 3FO0L 3B3IA 3ZHLA 1JP5A 3SDAC 1DTUA 1P7KB 4NQED 3NA9L 4DUXA 2BNUB 4XBEH 3QPXL 1XR9B 1S78D 2WK2A 2W1NA 5D2NE 4BH7A 3G5XB 1EEQA 1ETZA 4PJ7F 4XPAL 2EDKA 3UTSB 2JJSA 5I2IB 3KYKH 3MFGB 2QKIB 2QR0B 5B38G 3KPNB 5DLML 2PW1B 2AJUH 2ATKB 3CFBA 2YKLH 3HAEH 4YC2C 4ZAKD 3C8KA 5I1GL 4JFYA 2BMKA 3QEQE 4KTEL 1ND0B 3RGVD 2WBJD 1A6UL 1IFHL 1C5BL 6FABL 4KKLC 4QRQA 5D1QB 4MGXA 5FV2A 4MAYB 1S9KC 1DQDH 1PW3A 3CPLB 1N2RA 3QPQD 1A7NH 3MCKB 3KXFB 4X8JA 4OIBA 1CIDA 1F4WH 3QXTA 1K3IA 4KROB 2ZUXA 2H1PL 3M07A 1RU9H 3ARDB 1RULL 2VXVH 4OGAD 1MOEA 2YOCA 4ETQA 3C9NB 3LKNB 2NX5D 5FCSH 1FV1B 3H3PH 4XAWH 1OGTB 5DJ2B 3BPNC 3WL9A 5L2JB 1C5DA 1B4JH 1K4CA 1WEJH 4Z0BH 4PV8B 2DQTH 4PJ9B 5F7FA 5K9QI 4UV4H 3FO1A 5CLTA 5HYJD 5BVJB 1JPFA 3FB6A 4MCZA 4Z95L 4ZSOE 1XCQB 4DVBB 2APFA 1YQVH 4X6CE 5E6YA 3TT3H 1QNZL 1BQUA 4LHUB 5ILTL 4KJPD 3ULSA 5IVZB 6CGTA 5GJTH 5I8CA 4CW1A 3JSSA 1ORSA 4G8EA 1U8MB 4X4ZA 3G08B 4WTZA 1LO5B 3KPRB 1QP1A 5HHOD 3UTSD 5TDNB 4CVXA 1U8OB 1CGSH 3CH1B 3UZVB 1FVEB 4M3JA 1UACH 3BZFB 4Y1AB 2LVEA 4P9HL 1MJ8H 4AENA 4HFUL 1X5HA 4K7PX 1TVBA 2NW3B 4U2YA 4HFWA 5B22A 2YUVA 4JKPL 5IV2B 5D1QD 3K80A 3G6JE 1OSZB 2BOBB 4MAYD 3V7MA 1NLDL 2AKRA 1MCHA 1AO7A 2GJ6B 1L7TH 4NNYA 2CO7B 2CMRH 1PKQE 5DHYA 5E8NA 2VDKH 5H2BB 3MC0A 1F11A 1QLFB 3EOAA 5IROC 3WSQL 3T77A 4CVZB 5IOPB 2QSQA 4PB9H 1GIGL 2C5DC 2CIKB 2ICWA 4OGXH 3I75A 2VUYA 4MD0B 1OQOA 4E0RA 2F58H 4LKCA 1GGTA 3QI9C 5GGRY 4B5EA 3DURB 4RGND 1AIFA 4NJ9L 3QG7L 5FYJE 2DDQH 4PJ9D 2XA3A 4MDIB 3DLQR 1F4XH 3CLFL 4BFIB 3OKMB 2R29L 2VR4A 2P1YA 3B8YA 2AEQH 2OSLB 3GMOB 4HGWB 4HUWA 4JFDE 4RMWA 3HR6A 3F5WA 4HHAA 4G80A 5CZVL 5BZWA 3QIBC 3D2UA 3QUYB 2BC4B 5BQ7A 3K81A 4ZTOL 1ZHKA 5D2LA 1DE4B 5E2VL 2VAAA 4D0BB 3X17A 4LCWA 1AXSA 2MCPH 4NQCE 3LKRB 4ZUTA 3TBYB 3FRUB 2L4OA 3DRTB 5HI3C 2R0KL 4XCYB 3D25A 3KPRD 4C54A 5HHQA 3TJEH 3I2CL 3T1WA 1YPZB 4CU7A 3IETB 2AQ2A 1K4DB 4Y1AD 1CU4L 3BEVB 2ZCLL 4NO3B 1DL7L 2HVJA 2QQLH 1G0DA 3MODL 2NY4C 1MY7A 4Z8FL 1MJ7L 5FO8A 1I7UA 5E1AB 1KB9J 4Z5RB 4PJ7E 2R56L 2ZUUA 1E4XH 4P3WA 4GO6B 1KG0B 5FKAA 3BWAB 1MY5A 3IDXH 1UC6A 1IAIM 3MV8A 4MNQE 4P2QE 3X12B 2VITA 4A6YB 4N5EC 1CT8B 4WNQA 3O2VH 5EU7C 2ARJA 3FKUS 1K3ZA 5GGRB 3LN4A 2CRIA 2GJ6D 4NT6B 4IRSC 1XGTB 2Z31B 4NP4L 1FL5B 4N0UE 5I0ZA 2IQAA 4PR5A 4FS0A 5D9SA 5DUBB 4RGOH 1X5XA 3WEXA 3NACL 4XMPL 3SE9H 3DX9B 3TIDB 3EJZC 3I50H 4XNXL 2ZUVA 3Q6FA 5SV4A 3O6FC 3CDGB 4WW1B 2EZ0D 5HHNA 4HUVB 1II4E 3QUXC 1I1AA 3I3BA 5I1KL 3RKPA 4PJDA 1JNHB 4ELKB 2UUDK 2FGWH 4U6XB 5EORH 3VE0A 1YZZA 3MRNA 1CTOA 4EI6B 5BS0E 5F3HA 4F7EB 4JLRA 1OAYL 4YPGA 3QNZA 5DJCB 5KSBB 3H3KA 3CU1A 3MUZ1 5EU7E 4HJ0C 5L6YL 3QUYD 1UA6L 5DD6A 2UWEF 4OJFL 2OR8A 1B0RA 3M17A 5EUOB 4D8PA 5JTWA 3QFJE 5CBEA 1LD9A 3W2DH 3QNYB 4LVEA 1CR9L 1YY9C 1RUQH 2IBZX 4E41B 3OR7A 4XPHH 5GRVK 3DX7B 4Z7UB 4GRLA 3T0AA 2IAMA 1MCPH 5J12C 3EBAA 5EU3A 4PTUA 1RZKC 1DQMH 1UVQB 4FXLA 2Q6WB 4PGBA 2BVPA 3VWKC 4NQXB 4GSDL 5C6TL 5GRUH 4TN9A 3F12B 1HXMA 4JVUA 4N0CC 3WIFA 1KT2A 1NQBA 2A6JB 3MJGX 1YEHL 3QR2A 4KI5D 1FFPB 3JWOC 1ZTXL 2WM0A 2ZSWA 3H7LA 1GHFL 3V4UH 2JJWA 3MR9A 2CDGB 4JPWL 4NN6C 1PVHA 4GBXC 1QYGH 1MHCA 4HZLB 1TXKA 3MO1B 1SEQL 3SKNA 4AH2B 3P40A 4YEFA 3ZTNL 3D18B 2Z31D 4JM2A 4M8QB 5HBBA 4DKFH 4FABH 3T0BA 4EN3A 5BW7C 2VRAA 1WFNA 2NXZC 3T8XA 5DQ9A 1N3NA 3BOVA 5BVPL 3KS0J 4L9LA 3MRLB 3VJ6B 3EKCA 1BD2A 4LDLB 4HUUB 5DMKA 1A6PA 2E7MA 2LE9A 2D0FA 12E8H 1J87A 4RMRA 4WU7A 3MOAL 2OTUB 3ZKSD 3QFDB 2MWCA 4DUWA 5CJXA 3UTPE 5D8JH 1DANT 3L3OA 5ID0B 3EYQC 1CFVL 3S3JA 1CZ8H 2P49B 4O2EA 4PGZA 1TZHB 1VESA 1RD6A 3T65A 5J6HA 2DLHA 1WZ1L 4WCYH 3W9DA 3RVXC 5IW1A 2QL1A 4PLKC 3QWRA 5C0IB 2NYYD 4M3KB 1EJOL 5F89B 4JN1H 3TM6A 4NRYA 3QXDB 1TPXC 2EEBA 2J8OA 1U9KA 1HQRB 3BKCH 1UM4L 5ACZB 3RVVC 3EFFA 5B38A 3E2HB 4FQCL 5HYSB 4J3SA 4GXVL 4Z77A 1KTDA 4YWGH 4OZGA 3BP7A 4MXVF 3FFCB 1TZGH 1IKFL 4R3SA 3W11C 1AD0B 5D96B 3TN0C 1BFVH 4PRHE 4WWKC 4YLQT 2OZ4L 3NGBC 3DV4A 3ELAT 3GHBL 5D1XD 1KJVA 4WY7L 2AEIT 1YEJH 3VFTA 5EOTB 3V6OA 3LH2L 2X5PA 2RR3A 4X7FC 1EBPA 4N0FB 1UH2A 1IGMH 2EO9A 3PXHA 5F7LB 2DQCL 1IQWL 2ADGB 2IADB 2CLRA 4O2FB 4ZD3H 3JTSA 2NY2B 3T3PF 1HEZB 3GSWA 3DWTA 2PCPA 4Q97A 3QRGL 5L9DL 1CXEA 1Z9LA 3SPVA 5DFVD 1JV5A 5IMKB 1MHHA 2KQNA 1SY6H 3D5OF 2Q7NA 3HMXH 2P48B 3JUYA 2JB5L 5ALBH 3HR5B 4JQIH 1QO3A 2FECI 4PBVC 3U9PL 5EO9B 4OM1H 4ODHH 2AXJA 2LFGA 1HYSD 1SYVB 2ARJQ 3L3JB 1YY8B 2HT2C 4D3CL 3KR3L 4X7SH 2D0HA 2F54A 3VA2C 4R4BA 4BK4A 1BAFH 5HD8C 4LPCA 2WAHA 2NY0B 3GJFK 5EBMA 1KIQA 1CFTB 1ZGLP 3V5KB 2FJFB 1P5VA 3O8XD 2Q1EA 3NTCL 3QDAA 3TH3T 4QY8B 1WC7B 3FQUA 3BGMA 4O51B 3Q0HA 5EZIL 5HGDB 4PPTA 1ZOXA 3I85A 4FP8H 5F9OL 3BPCA 4ODWA 2GTZA 3QHTC 4R4ND 3WFBH 4F7TB 2P5EA 2W92A 4QTHA 1P4LA 1E28A 4G6KL 4KUZL 5DJYB 3MCLL 4V2BA 5CIPA 3BE1L 1FL3A 2EH8H 3GSNH 1PGRB 2KDGA 3FFCD 2UWEE 5B8CB 1FNLA 1RHFA 4S0TD 4LSUL 3U30B 4O4YH 1A6ZB 1IGYA 2HKFH 3DROA 4YDKL 3EGSB 1RPQA 3L3IA 4L8CA 1H3WM 3BZ4A 2F19H 1A7RL 1X9QA 4HX1B 4PUBH 1WV7T 4JFXB 5EH1A 3WBDA 2PXYD 3IFPA 4BK5A 1E4KC 3AREA 3D1MC 2OX5A 1ZVHA 3G5ZB 3UC0L 4L4TE 5F1SA 3H42H 1OVZA 4MA3B 5FYJH 2FATH 1FO0B 3TVMD 2VO5A 3T0EB 3OAZK 4YXKL 3C09B 1YN6A 5EO1B 3OB0K 3RA7H 3LMJH 2FNBA 3C60D 4IMLB 5EPMA 5F7WC 3AB0C 5CSGA 1NAMH 4EI5A 2GFBA 2XKNA 5CFHA 2NZ9D 3P73B 3VXNB 2XQBH 4C56A 4UIMB 4HBCL 5MEPA 2ICWI 1QLRB 1YYMH 1JN6B 1GOFA 3CK0L 3IJSA 1IGCL 2XPGA 3QQ3B 3KWWA 5DK2B 3VFVA 3CSYA 3VMNA 5CEXB 5JPNB 3VFOB 1UKTA 2NY0D 4OUUA 1G7JA 1CK0L 1VGEL 2J8UA 2DS4A 3O4OC 4GS7B 4ZS7H 4LCYA 1XH3B 4S2SA 3ULVD 5E2UL 1MFDL 2AJ3A 1FH5L 1Q0YH 2WLZA 4RMTA 4IOSD 1INEH 4PJBF 1HHIB 2D0GA 5L8KB 1RUKH 1M71A 4IJ3C 4KU1A 1BWMA 4BELD 1JWSB 4QHUA 5CEZD 3BZEA 5D71H 1UWEL 2MFNA 4I3RL 1S5IL 4U1NA 3B5TA 3HA0A 1XF5B 3DO7B 3ZKXB 3BHBB 4JHAH 2VDQL 5FF6A 3QCUL 5F9WC 3T4AA 2EXYC 3GZKA 3QCTH 4HJGB 4PRIA 2PTUA 2GUOA 2P8MB 4HC1A 5BXFB 5F3BB 2IPTL 3QEGL 1HNFA 3OKKA 1YQ2A 2VE6B 5FB8A 5KVEH 4MXVE 4KMTH 1FZOB 1YMMA 5IBTL 1SQ2N 1NGZA 4DGYH 5EU6E 1AD9A 4KKAD 1BQHB 4HXBH 1A9BA 4YBLB 5CZXD 1QR4A 3S88H 5AYUH 3LKSA 2GT9A 1FNGB 4KFZC 3MBXL 1HXYA 1T5WA 1WZMA 4D94A 4PYHA 4LSTL 4PP2A 4UT9H 3FMGH 5I15L 1ERNA 4XVTL 4N90E 4IRJB 2FDBP 2O5ZH 2VXUH 5H35B 1TENA 5L88L 3U7WH 1B9ZA 4MHHI 4F9LA 3AS1A 1U92A 2NQCA 3S3PA 4NHUB 1ZLVK 3MXVL 1A6WH 3WCYA 1Q1JL 4ONHA 3T3PE 3GMNB 3KJ4C 15C8H 2XN9E 2ICEA 3P0YL 2FYYA 3QG6B 3QSKB 3ZLQC 1I1YB 3ZKNC 5ICZB 3MUJA 4WHYG 2QHRH 1IKNA 3AM8C 3HZYA 5TPWH 1DDHB 1CFQA 1N2RB 4PRBA 1UM5H 4MD4B 4J23A 1ZGLB 9CGTA 1D9KB 4Z7VA 3IJHA 4AEFA 3NA4A 3HN3A 5DS8B 2BSRA 4OZFH 1J1OL 3U0TA 1BX2A 1L0XA 4MLSA 1TQCB 2XTJC 3IU4H 4OF0A 4NRZB 2ZOKB 3HCVB 3VFPB 1BVZA 2P5WA 3BX7C 3MRKB 3V0WH 1PZUB 3X14B 1H5BB 1TQBC 1GXEA 2JLLA 4BSWB 3AVEA 3K1KC 2CJUH 4HKXA 4MLIA 3V95A 1RZKH 4NC1C 1KPVB 2H2PC 2VIRA 3PF2A 2WINB 5F71A 2FL5B 3CD4A 1NCCH 3EOTL 3ZTJG 4P23C 4MNGE 3S37H 3QT2A 3LS5H 5FXCH 1WF5A 5GS2D 2VXSL 4LL9A 3VWJC 3WHE1 2MHAA 4Y4HA 4APQB 3DMMB 5DGRA 2A9ML 3JWOH 2AJXL 2VWEC 4H0IA 4H0GA 4M6OH 2IANA 4JO3L 2D03H 4Y4FA 4IRJD 3O3BB 3DARA 4F7PB 5IFAL 3EYSL 2HT3C 3AMLA 2Y7QA 5IHUH 4G8EB 3ARGC 4X4XB 2UY6A 5F88B 3RX5A 5HGAA 3O6LL 2HRPH 3OJ2C 3BRGC 5M95B 3RWFA 3WN5A 3C8DA 4RNRA 1Q9OA 4NC1E 4TSCH 4MD5B 5FYLL 4OI9A 1EAPB 4GKOA 4TOYH 1F3DJ 2P45B 4TSBH 5E6ZA 4ZNCD 1W8OA 4EDWH 4Y88A 3SCMC 4NYLA 2QLVB 4LEOA 1UZ8A 1CXKA 3FB5B 1FDLH 4PJ8C 5J1AA 5A2KH 4YHOL 2YC1B 4U1JA 3O3EA 3VW3L 2FBJL 4G8GB 3WXVL 5TE6L 1CBVH 3M1BA 1D9KD 5EO0B 2I60L 2Z35B 4QXGH 2VXTL 3BKML 1W8NA 3MV9A 3RWIB 1GYAA 1A1NB 1F11B 3EOAB 2ZUSA 2O5YH 3EO9L 1UG9A 4PJBE 2YD5A 3MNVB 5E99L 5J7CC 1WTGT 1NMAL 3AMKA 5C08E 3LKOA 4MB3A 4OLWL 1V7ML 1X5GA 3NCCB 3UPAA 3WKNA 4ESKA 1OQXA 4QRPE 1T1ZA 2F74A 4RGMB 3MLXH 2FO4A 4X8XA 3OBAA 4HUWB 3EYUH 4S10A 5I1HL 2D7PA 4PIRF 4OD3H 5D7JB 4HS6A 5DD1L 3ZE2F 3D2UB 5E8DH 5ISZA 3LOWA 4OCSL 1U93A 5T3ZD 4UNVA 5MEOB 2OMNA 3QYCA 2C3HA 2DTMH 1FYTA 2VAAB 3SO3B 4LCWB 3UO1H 3NZHL 3RVWD 2ZNWA 4K8RD 3OMZA 1IEAB 2VQUA 3BZDA 1GJIA 1NCAL 4U6YA 1K8IB 1ZA6A 3FQRB 3EJJX 3R1GH 4JCMA 1DUZB 3D25B 5DD5L 3EFDH 3MOQA 4R96A 3PGFL 4MA8L 4K9EC 4M02A 1A1OB 2R8SH 1MF2L 5A40E 5AD0B 2A73A 4XVSL 3MNZA 5JDSA 3JV0A 2H32A 1RK0A 1MCNA 3HPLB 2EDJA 4CJ0A 4I3GA 4NBZB 3GGWB 1OT2A 2JELL 5FCUH 5KSUA 1I7UB 3RWEA 4ZOCA 3T08A 2V5MA 1LEGA 4X5XA 3I3DA 2VITB 2NY1C 4QRSA 2WQRA 4BH8A 3CXHK 4NN5C 4M4RA 2GTWA 2X7LB 1AO7D 3NCEB 1EH9A 3JV4A 1DVFB 2P47B 3KYOB 1D5IL 3BT2H 4V1DA 5D9SB 1AR1C 2GHWB 4LSSL 1N8ZA 1YDPA 3Q6FB 4PJCA 2XZCL 2VC2H 4K3JL 5HHNB 1LP9B 1VPOL 3HC0A 3IFOB 4JANA 4JG0L 4LSRL 5F72S 2YPLE 4OF7A 1EFQA 2YK1L 3TBSA 3QDMA 2YD1A 1NFIB 4NZUL 4BQCA 1T89A 5MERA 3S8WA 4UTBL 5FGCB 3SE8H 4Y5YA 3OKNA 3L5WB 1T66D 1RK1A 3Q3GB 1WBXB 2Z91A 4KVCL 1JGLL 5D7JD 4W6YB 3D2UD 3A67L 3CSPA 4QT5B 3ROLA 4NQDE 4D8PB 4DEPC 1UJTA 3LQAL 2NPLX 3BKJH 2YMXL 1MWAH 4LCWD 5ADOH 2BFVL 5DHVH 2HMID 1V5JA 2OJEA 5LGHH 3UTQB 2AXFB 5AWNL 1MQKL 1E6OH 1C08B 4HWBL 1PLGL 4GRWB 4PJ5E 4JQVC 1S7RA 2ITDB 1DBMH 3G9AB 4PGBB 4UQ3B 3B2UD 2WMPA 1U6AL 4LLQB 2JCCA 5HHVL 1I1CA 4GRMA 5SX5K 2J7LA 3RDTB 4WJ5B 1QR1B 5IJKA 3GRWH 1AGCA 4EUPB 2YBRB 4U6VL 4LARL 3QQ4A 4R26H 4PRPE 1E27B 2ZSWB 3O6MH 1MCFA 3CX5J 1JWMB 3MV8D 4Z7WF 3QXAA 2VLME 3NPSC 1MHCB 2W60B 5GQBA 1WTLA 4J4PC 4JDVA 4L4VE 1RUAH 4M1CD 2EKSA 1R24A 3ECBA 3PV6A 3RPIA 2ZUQC 4HWUA 1QFWH 4PJGB 3Q48A 5JIHA 2I9LB 2O61B 5DURB 4TTDC 1KJ2H 2F5BL 1JMZA 1YMHA 5JHLH 3T2QA 3C08H 4O58L 5DMKB 1I1AD 3ALXA 1J1XL 1ZVYA 2DOCA 3K2MC 4QWWD 1RZFH 4JE4B 1FC2D 1KN2L 4XGZB 1ULVA 4HK3N 3BO8A 5EIIB 1N59A 4EIZC 2OL3H 4RMVA 4O2EB 3U9UA 4L8SC 3S6CA 4XPTL 1I7RA 5TFSL 4Q6IA 4JDZB 2DTSA 1A5FL 2Y07L 4YDVA 1MCLA 3QQNA 4QHKI 4LLDA 4NRYB 1NBVL 1EPFA 4GMTH 3LN9A 2IPKB 4GG6B 4P3DA 2X4UA 1CDUA 4X5LA 3PXJA 4GRLD 2IAMD 3L7EB 4Z77B 3ZE2E 2OZ4A 4WI2A 4OZGB 4U3HA 1BZ9A 4R3SB 1LO2L 5E56A 4AJ0A 4S1DC 4ZDHA 5ELIA 3DV4B 2DI7A 3WFHB 1KCSH 5C86A 1G9MC 4OZIA 3C5JB 4NPYB 3CFDB 1J9CT 4WDIB 1BEYL 3VDAA 1IGTA 1HHJB 4XP1L 4WEUD 2AXGA 2OCFD 4BM7A 2CLRB 4N1HB 1G0XA 1WT5A 2XY1A 3JTSB 3E6HA 4C83A 3GSWB 4PRAB 2PCPB 1KV3A 4U1IB 1T2QH 3IDIA 3T4YA 4B0MM 4DGVH 1MHHB 5JHDA 2RGSA 5DURD 4KK5C 4WUUA 2AV1A 2ZG1A 1WLHA 1PX4A 4OCYL 4XBPA 5IG7B 5JUEL 3CVHB 5GZND 1BD2D 1JPSL 4IOIB 3PHQB 4ZAKC 2QHLA 5L7XL 4WO4B 3U1SL 2F5AL 3HE7A 1I85C 1A4JA 1JHLH 4NQVB 3RGVC 2WBJC 1B90A 3O6KL 3F8UB 5CGYD 1ZEAL 4M5ZH 4CVWA 1NPUA 5EBMB 4X0KA 3QPQC 3SDYL 1YECL 3CMOL 1RZIA 1XMWA 1A7OH 4NQEE 1D6EA 4QGTA 1P4IL 3E8UL 4C4KO 1EO7A 5I1LB 3FQUB 3QWRD 4FXKB 5LGJA 1NL0L 2C1PB 4OGAC 2GI7A 3GMRB 3TYGH 2P43B 2GTZB 4ODWB 2EC8A 4PY7B 4XCFL 2CKNA 3P9MB 3PP4L 1P4LB 5DTFA 3VXQB 1X5LA 2V9TA 5EU4B 3TZVC 2CDFB 2M8XA 1P7HL 3L5JA 2RQ8A 4P4KB 4QRUB 1NEZA 3MLSL 2X10A 3SGDI 3SJVB 3MRCA 1X5IA 3MRQA 2IFGA 2W0FA 1XIWA 1WJ3A 4F58L 5IESH 4N9OB 1QHPA 1DUYB 4Z9KB 4TRPH 4XCEB 5TF1L 4KJPC 5CJOL 3T2OA 4X7CC 1V8HA 3WS6A 5A16A 2CK0L 1W0WA 2NX5E 1VACA 4GG8B 1PG7H 2VDMH 4Y16A 5D7KD 3MZTA 5F44A 2BRQA 3MLTA 1NAKH 3CDCA 1Q9KB 1VEPA 5E00A 1LK2A 43CAA 1A6TA 1OSPL 2NLJA 4EKXA 4Z7WE 4F2MB 1HSBA 3CCHA 5ICXA 4EI5B 2XKNB 2E7CA 4QRTB 5HYJE 3KVQA 1FNSL 3KLSA 2F54D 3IJSB 5F9AC 4JFFE 2VQTA 3REVB 1NC4A 2XPGB 2VLKA 1XGPA 4QGYA 5C9JA 3KWWB 2BCKB 1TZIB 3CSYB 4ODXB 4UIKL 4GAGH 4NM8H 5D1QC 4OUUB 4MAYC 2XT1B 2J8UB 1V7NH 5E5UB 1YPZF 3MNWB 3PGDB 2AJ3B 4P48A 4DCQB 1OPGL 4KI5F 3RL1A 4KROC 1CLYL 5KZCB 3RFZC 1Z5LB 3BZEB 3BN9D 3ARDC 3D3VB 1F4AA 2W0KA 3ULUD 1P69B 5DR5H 1F2QA 4M7ZB 5HHOE 3WFCL 1JGVH 3I6LD 1AQDA 2VQ1A 4LQFL 4OAWB 5F7EL 5HPMB 4PJHF 3JV6A 3L3KA 4PJ9C 4JG1L 1JPTL 3T04D 1G9NC 5LQBL 3V7AE 2EDTA 2E6QA 4P4KD 3SJVD 1U3HA 1OOAA 4GXUN 3ALWA 1N5YH 3DI3B 3MXWL 1B0GB 2B4CH 5FB8B 2VZSA 3P4LA 2OK0H 2FBOJ 4K9EH 1ES0B 3RNQA 2ZZUT 4P5TB 1AD9B 3UTOA 5D7LA 1FQ9C 1QZ1A 3C2AH 1MLCA 1MCCA 35C8H 1KJ3H 2GT9B 3CIQA 4G42B 4NC0B 5E2TH 4JFEA 3JXAA 1CTNA 5KSBF 4QTIH 1IBGH 3HI1B 2HFFA 3ESVF 5GGVH 4ZO6A 1PZ5B 3OHXB 1U8IB 3KHOA 4IEFB 4RGNE 5GHWH 2Y36H 1I8MA 3QIWA 4EI5D 3G5YA 5DJDA 4OCRL 2E8YA 5C0AB 4HUXB 1TDQA 2XQYK 4LLUB 2W0PA 2BNQA 5BJTB 1MVFA 4Z7UF 1P2CB 2XA8H 2FYYB 5JLZA 3RUGA 1FIGH 5K9KB 3MRPB 4XBGA 4KPHH 4BKLA 3QO1B 1KLGB 2DRUA 4P46B 1A1MA 3HI5H 2D7TH 2GKIA 4K2UH 5DEZA 4XBEL 3O2DH 3UCRA 4JFHD 3L9RA 2EDBA 1WAAA 1W0YT 1U8HA 4OFDA 2Z93A 1RUPH 5KZCD 1AH1A 3IS0X 1J0KA 3O11A 4Z7VB 2E9JA 1U91A 1FFQA 5C2BL 3KPRE 3KYKL 2J5LB 1N6QL 3QUMB 5JW4R 2EZ0C 4LCUA 1BQSA 4K3HA 3U0TB 1BX2B 2BVEA 2J3SA 4Y1AE 5EWIH 4DAGH 5JORB 1HILA 2IC2A 1TCRB 4YXHL 5DJ6B 4PRID 2WANA 1RURH 1HSAB 1DQDL 1FFRA 3MRJA 5B3NA 5GGSB 3MBEB 4FTVA 1N7ML 4MJ5A 1A7PH 1AKJA 4HKXB 5I1JH 1FVCB 1Z2KA 5GS1B 3GUTB 1KB5H 2VIRB 1YMMD 5TDOB 2GJ6E 3QUYC 5CP7A 2Q8BH 4P5TD 1BF2A 5HGBA 3LSOB 2E6JA 2AJZA 2F8XC 2G75B 1JI2A 5C0JA 1CD9B 4XAWL 5AZ2H 5FK9A 1B4JL 3CUPB 1JWUB 4Z0BL 1F6FB 2IANB 5E8PA 4YIQB 4Y4FB 5E9DA 5BO1L 4ZMAT 1UWGH 3F6IA 3LKQB 2X70A 4U1MA 1MCWW 3JVGA 4KI5C 5AUMA 5C0AD 2D4FA 4F7MB 1E4XI 5GIRA 1EGJH 3TT3L 5JZ7D 1T1XA 4ZS6D 1H3XA 1AGDA 2BNRA 3C5SB 1D5MA 4QXTB 5FHAL 2OJZL 4U1HB 3O3DA 3IDGA 4PJEB 1X5YA 3UX9B 2XNAA 2RAMA 4NYLB 5HI4D 5HDBF 4XB7A 3B4NA 4XPGH 4U1JB 2X6MA 2Z31C 2VLLA 4ZFOL 5DQJB 3U6RB 2P7TA 4Z6AT 4JRYB 3KPSB 1KOAA 5IB1A 3M1BB 3B6SB 1CGSL 3KPLA 1ED3A 4I0KA 2YUWA 1UACL 5LBSL 5L8LB 1FN4B 1UEYA 3G6DH 4LAQL 3IGAB 1YPZE 1MJ8L 2FSEB 4JZOA 5I66A 4A2LA 2YRPA 5D7SH 3QH3A 5IVXA 4KI5E 1XZ0A 3ARQA 3VG0L 4LLYA 5E08H 3WFZA 1FBIH 3FFDB 4QHLB 1T1ZB 3QRFM 3Q5YA 3Q5OA 3DOSA 3MBED 4ZOBA 2NXYB 4RWHA 1D7FA 5FUOL 2CMRL 4PJHE 1GGCH 2MTPA 3QHZL 1RJZA 2AK1L 2ZG3A 3TBWB 3PHOA 2P46B 1AI1L 2BVQB 1FNHA 4NQUA 3S98A 2X1XR 5F7MC 2IAND 5GZOC 4Y4FD 3ULVF 1CL7L 4BA8A 1F42A 1IAKB 1ZHLB 1ZA6B 4FFVC 5IFJA 2AEQL 4K94C 2AXHA 2HTKD 3MX0A 3ZDXF 1P5UA 5C0CA 4I0CC 5KSBE 3H9SA 4XI5C 5EUKA 4NKMA 2ZJSL 1C16B 5JDSB 3PWJA 4WIQA 2H32B 3RTQB 1RK0B 1J12A 4PJIA 4HKJA 4C57C 3MRGB 1BOGA 1QKZL 2GJZA 1HI6B 2VB5A 5DRZA 2WIMA 4Q6YA 5DJ8A 4IIQB 4YGVA 3F7PC 4Z7UE 2X4OB 2IH1B 5DFVC 4JRYD 3O45A 5T1DL 3GMPA 2GTWB 1MREL 2Y25A 3TYFB 3U36B 2L7UA 1FJ1B 4BJLA 3MV9D 1FGNH 4P57B 5TQ0H 1HYSC 3MLYH 4M7LH 4Y4KA 3INUL 1YDPB 1U8LA 3EDKA 4NZTH 3S5LG 1NUFA 5FA3A 4YX2L 3UDWC 1I4FB 1FLRH 1S9YB 5GS3A 3IDXL 4OCXH 3MJ9L 3TBSB 3O2VL 1T22B 3UTTA 4JFQA 1GC1L 5HJ3A 2NXYD 1FE8L 1FZJA 2Z8WC 2PTTA 1JUFB 2WP3T 3I02A 2P24A 3OKNB 5FYKU 3U7AA 4ZUVA 2R1YA 4LEXH 4KZEH 2KL6A 4JRXA 5TE4H 1TJIL 4M61A 3RU8H 1A0QH 3I50L 1QSEA 2EYRA 5ISZD 2FGZA 2UV3A 4R4NC 5CCKH 4FMKA 3E2HC 3FL7A 4HWBA 2ESVA 4WEBL 4HWEL 4G6JH 1MRDH 4RQQB 1URLA 5D96C 2ZCKL 1QRKA 2WBKA 1Q0XL 2EE6A 4PREA 3L7FB 4J3UA 5IWLC 2V5TA 4EXKA 1JTTA 1YNKL 1WCBB 1JGEB 4UV7L 2JCCB 4GRMB 3VGAB 1M7DB 1AGCB 1RZJC 5ICYB 5LJYH 2BY3A 3QQ4B 4WTWA 4JGUA 4G5ZH 3RQ3A 1NFDF 1OGAA 4XPHL 3WD5H 5J57B 1ADQH 2WZPD 4YHPA 2NY2C 4NQTA 4D9RD 4TUOA 1MCPL 5CMAA 1IZKA 4MVBD 1ZT1A 5JO5A 1C12B 1P9MA 4MQXD 3MV11 1N5AA 3ET9F 3FFCE 2EKSB 1R24B 2P42B 5GRUL 3PIQA 4V1DD 3AXLB 2GK2A 2NZ9C 5HDBE 3JBG7 3MUGA 1I9EA 2CO6B 3H0TB 1R5IA 2Y5TB 5I30L 4E5XA 3EJYD 3V4UL 5IEHB 1TJGH 1T4KA 3L3DB 4NWUL 5F21B 2QSCH 2DLFH 2QQNH 3BMVA 1WZLA 2NY0C 3QDMD 1QYGL 1G7PB 2DQJH 2AEPL 5KJRH 3BI9X 1J0HA 5IB2B 4IS6B 3HZVB 3ULVC 1HQ4A 3L3HA 2ICES 2ZSVA 4HPOL 1G9NH 3GSVB 2DKSA 2VISA 3DSFL 2BDNH 4OKVA 3ZSTA 1OARH 3VD3A 4G8FB 1IM9B 2I27N 4LLDB 5SWQB 1BHGA 1GRWA 5BRZA 2XWTA 5ITBL 5FKPA 3DIFB 4JZNB 5B8CC 3U2SA 1I3RB 3VXOA 3U30C 1KBGH 5KS9B 4LLWA 1FHGA 2HG5B 3H3BC 1OP3H 1I1FA 3LS4H 3EYOA 4ZPVB 4ONOA 4S1RH 4HEPG 4F9PC 4WCYL 3ULVE 3MUHL 4HSQA 4KKAC 5DF0A 5CZXC 3MRBB 3QDGB 5LG1A 5CEZE 3QEHB 5IM7A 2DQUH 5ITFA 1CD8A 3GMMB 3SBWA 1IGTB 1B2WL 3ZDXE 2BK8A 3C09C 3EDEA 4YWGL 4HKZB 4HULB 1TZGL 3T3MF 3VXSA 2YD2A 5DZLA 1BFVL 3GJEA 5EC1A 1PJ9A 3VGFA 3NCYS 1F90L 3NFSH 4D0DB 2APTA 5JHDB 4E42A 3QDJE 4EQ2A 3OJVC 5DYOA 1YEJL 4WUUB 2OTWA 1G84A 2X4NB 3I6GB 1UCBL 4JQXA 1HHHA 4M00A 4OLXL 4L8BB 4WW2A 1IGML 1EFXB 5DUML 4S1QH 4HQQL 5C0GA 1H3VA 1S7VB 4JPKH 4YFLI 1P1ZA 4P3CL 3OAYH 4JPVH 4FQXB 4ZD3L 1CE1H 4GS7C 4QHNB 2R0WH 2ZCHL 4OGZA 3O4LB 2H9GA 3B9DA 3FRPG 4PGCB 4DN4H 5CLWA 3HUJA 4X0KB 2D7NA 3RVUD 3TNMA 4H88H 4F33A 1SY6L 3NFPA 1G7LA 4O02H 1CD0A 1RZIB 5ALBL 5D6DA 2X4QA 2D7MA 2B5IC 4ODHL 4P0DA 2WV3A 5DEGB 1UJ3A 3PGCA 3WS3B 3L5XL 1M6OA 1U8JA 2NY6D 1DLFL 3ZKXC 3FQNA 4X7SL 4UQ2A 2OP4H 3ARBA 3DBXB 4H1LA 5D2NB 2ADIA 3FB7A 4JVPA 4QOKA 1R5WA 1XF1A 1CI5A 2XZQH 3BQUB 5SWZA 1BZ7A 4AMKH 4BFGA 1EJ6A 2HH0H 1IGIH 2W0FB 4ODVH 1BIIB 5D5MB 3QEQB 3UYPA 3NCJH 3TPKA 3UJJH 3NIGF 3VXPA 1QFOA 5K59F 3WFBL 4PGEA 3KPOA 5IB3B 3E6FB 4JAMB 4KTDL 3OG4B 4NKDB 3RL2B 1HHGA 2W9LA 5A16B 2BJML 4IRJC 4ODBD 1T1WB 2ZPKL 1IGJB 1VACB 4PJXA 4A6YH 4O4YL 2HKFL 3MLTB 1NFDE 2R1WB 1LK2B 1EV2E 1A6TB 5JHDD 3IAGC 3IKKA 4YFEA 1RJYB 4WUUD 3BUYA 2JJSC 4PUBL 2ARWA 4X4MA 3W9EA 1HSBB 2IGFL 2QEJA 3PJSB 5BV7C 4RBPK 4GUPB 5EBLA 5D2LF 1EFXD 4RFOH 1TETH 4ZUUA 1E6JL 4BFBD 4YC2B 3HE7D 5ABDE 4UINL 2W65B 1KPRA 4FQXD 1G0YR 3PWPA 3TV3L 3DX6A 3FT2B 1ZGLM 3QWOB 4KWUA 4FQ1H 3O4LD 1HKFA 4JRWA 4GAFB 2R4SH 3P0VH 2XTLA 4ZSOB 4JO1H 1D9KC 1RUMH 4PV9B 1NAML 1QSZA 1BVKA 3RL1B 2WUBH 3GHEL 4DQOL 5KVFH 1TQCC 1YYML 4LBEA 4LSPL 3MJ8B 5I1EH 1ZA3B 4WHCA 1Y6MR 3MV01 3IT8D 1JF5A 5EIQA 4KMQA 4TYUA 1H5BC 4FQIH 1HWGB 1UB6A 1G6RH 4I18B 1VERA 3CU7A 5E8EA 4I3SH 1A3LH 1INEL 1S7WA 4UI2A 1U3HB 3W0WA 3MACH 3TA3B 3FTGA 1R3JA 2WWKT 2JIXA 3UJIH 4RAVA 4PJFB 3MV7A 1XIWD 4LSQL 1DR9A 1J5OH 1H3TA 4APQC 4K94H 4PJDF 3DMMC 1ZS8B 3GSNB 3FQTB 2CGRL 3CZFB 2HFGH 4B7LA 4JHAL 1CG9A 5DEFA 3VFGL 1JGDB 1UH3A 3HFMH 3S5LA 1CXHA 3QCTL 3MRFB 1PKQB 3GB7A 4Y16D 2H6PA 3T0XA 2OTPA 2ED7A 3MFFB 3ARRA 2DMCA 3BN3B 5KVEL 3BIKA 4ZFZA 4RMQA 5BOPA 3T3ME 2BHZA 4DGYL 1W72L 1XFPA 4YHNA 4HXBL 3WV0A 2LV4A 3BPLB 1KENH 1U58B 4KKBD 2BVTA 2HRLA 2V2WA 1EA9C 2CH8A 1A14L 2FHBA 5JLZB 1WSST 4WEMB 3RUGB 4GW5A 4MYWB 3FMGL 2RB8A 1S3KL 4JFDB 5T3ZE 2O5ZL 1DQLL 1DBBL 4HWZA 1XR8B 4KJWD 4FZEH 5DVLA 5ESVA 3N1QC 2Z93B 4XMKH 3U0WH 5EB9A 1NDMA 5GSRA 15C8L 4NQCB 5K33A 4OI7A 5E6IA 4HG4K 3HNVL 3P30L 4PG9A 4OLZH 1HYRC 1DBAL 2CR3A 4G6AC 4OF3A 4RGMC 5IMOA 2DQEH 3CVIH 5CP3H 2QHRL 3FN3A 1RHHA 2C4FU 1DLHB 4XCCL 2FIRT 1U3HD 3MRJB 3TA3D 1UM5L 1T66C 3R8QA 4DOHB 2FX9H 4P2OA 5F8QC 5D7JC 3RIAF 1XF2B 4JFZL 2V5RA 2AJSL 1AO7E 5EN2A 5LWYL 3CXHJ 3CXDH 3BD5A 3QJFA 5IBLC 3PV7A 4KAQH 3SO3C 3IF1A 4F37K 1RZJH 4BSVB 5C0JB 2HMIC 4OT1H 4MA7H 4JFED 5CSZA 5GSVB 1LE9B 2YS4A 4N0UB 4UUJB 5K59E 1JNNH 3KPMB 1SEBA 4YK4B 4GLRI 3B2UC 1RZKL 4NKQB 2AW2A 2XG4A 3WUWG 4B53A 1VADB 1EMTH 5IT2H 1JRHI 3EO0A 4UZGA 1Q94B 4RRPA 5AUMB 3BVNA 3TPUB 3EO1B 4FHBD 3TO4A 2BNQD 2NY4B 3SOBH 2C7UA 4N0RA 4KDVA 5IMMB 2V9RA 2EDEA 4ISVB 4OZGF 3CFKA 4ERSH 1FNEB 4ZFOA 5D2LE 4U05A 2D03L 5CINL 4K3EH 5LCVH 1HZHH 4LCWE 4H20L 2PNDA 1DVFC 1LEIB 4M1CC 4D9LL 1FVDA 5IHUL 2FX7L 3QFJB 4I8DA 5DSCB 5IB1B 3ULVH 1K6QL 4ZQKA 5IQ9A 2B1HL 4I48B 5T1KA 3ORJA 5B39G 2BVOA 3DYPA 5CEZH 4LNVA 4F8QA 5IBUB 3O0RH 3DRQB 2J4WL 4OV6F 4IHOB 5MENA 1Z0MA 5I66B 4TOYL 1MFEL 4PG2A 4TSBL 1B4RA 4HIEB 4EDWL 2Q7YB 4JKLA 4LRNH 1FDLL 1TNMA 4AT6A 5C8JB 5EZLA 3IFLL 3UP1A 1HNGA 2AQ1A 4FTVD 1KB9K 1CBVL 3MV8E 1F5WA 2YPVH 5IGXH 4ZFGL 1T80A 3H7BB 1HKLH 2G9HB 1ZHBA 5GGQH 2EDHA 2WNGA 1JMXA 4HH9B 1OY3B 3RWHB 1JNLL 4MDJA 2IALB 1U8PB 3SKOA 3WFEH 1S8DA 1T0NA 4ODUB 3K8LA 3UYOD 1J8HA 4NBXB 4DVRL 4P2RA 3AY4A 4ZFFA 1FO0H 1UXWA 5E9DD 4PJDE 3QISA 2NW2A 3VXMA 5FHBH 5F96L 3U4AA 3RY6C 1RMFH 3RDTC 2CXGA 4KY1H 5FYLD 3LEXA 3ULUF 4KVNH 3PNWA 4JY5L 1AXTH 5DD3H 1IAMA 5EUKB 4JFPA 4P9ML 1BOGB 5FOBA 2YRLA 2GJZB 5DRZB 1Z6JT 4M6NL 2DD8L 3B9KB 3PWVA 4NDMB 1PD6A 2XFXA 4I5BB 4OD2A 3BW9A 3WHXB 2FX8H 4ONGH 4L3EA 1WWAX 5HDQL 2AGJL 4JDTL 5C9KA 3SKMA 2DQDH 5GZNC 4S1SL 1MNUL 1EHNA 1CICA 1DEEA 3MJ9A 2Y9RT 4HH8A 2ED9A 1FYHB 4V2CB 3TJHC 1J10A 1R0AL 3AS3A 3MLZL 2A74B 1YUHA 1DN0A 3N1PC 4HCRL 4Y5VB 4NBYB 2JJVA 4TTGA 4MZ2A 2UYLA 4JFQB 1CF8L 3U0PA 1XGUA 2PTTB 3RI5F 3RBGA 3P11H 3L3GA 3GKWL 3NABH 5E95B 5I9QB 1KCLA 1OAZH 3OL2A 4JRXB 1JHTA 1BGXH 3BRDA 7FABL 5JW4M 5JXEA 5F1KC 4Z0XA 5FDWA 4OTXL 1NDGA 4X99B 1FZMA 1UB5A 2FH8A 3ES6B 1OP9A 5GS2H 1FG2A 1BD2E 2J8UF 1CDGA 1HHKB 1F4HA 2B20A 4Y5XA 4LRIA 2GJJA 1X6NA 2I25N 4QF1A 2UVEA 1JYVA 1KTLA 4PREB 5AG8A 1T04B 3NGBB 3ZZ1A 3KJ6H 5IEKA 1NCDH 4PRDA 2OI9B 5C0CD 5HSFA 4YO0A 1LO3H 3CFEA 5H8DA 4OF8A 1NC2A 1CFNA 4HS3A 4AIXA 1NGYA 5BV7H 3KYMB 3BKJL 2XWJA 5ADOL 3QEUA 3V52H 3GSQA 5AEAA 1INDH 2W0LA 4MMZC 5FGBC 3UJTL 1HIML 1OTTD 1WBZA 5A2IH 4OZGE 2XICA 5GJSL 3LN5A 5D4QA 3ZL4H 3G6AA 3MLPA 2PO6A 3FN0H 4HIXH 4AYFA 3MUGB 4H25B 4R26L 4YDJB 3S34L 2UWEB 4WO4C 3SDCA 1R5IB 4E5XB 4XP6L 1V3LA 2K7QA 3O6ML 3IDYB 2PYFA 3HMWL 3WNNA 4QRRA 1SVZA 3RVTC 4J6RH 4POYA 2VDPL 2G5RA 3U48A 1GGBH 4X9HA 5I8KH 3L3HB 4FQLL 2HJKA 1EO5A 2NTFB 1XF3B 2YD7A 4G9FA 4M8VA 4LMQI 4MS8D 4JRXD 5D7KE 4L4TB 3BN9C 4YPJA 1QSED 1KEGH 4GW1A 1T5XB 4WHDA 5IIEA 5K93A 3ULUC 4ENED 5IW6A 3BJLA 2HYMA 5DDHA 1R3LA 2Q8AL 2ESVD 2XWTB 5C71A 2EDWA 2R0LL 3FT3A 5T3ZH 2P8LA 4JEGB 3VXOB 1KLUA 1I9RH 2F54E 4R2GB 4HKBA 3BSZH 4P4KC 4K8RH 1MVUA 4YQXH 3GKZA 4Z7VF 3EYOB 4K3DH 2B0SL 4NZJA 1EVTC 1ZT7A 3CNKA 5DWUH 2H26A 4YHZH 2AI0H 4WRLA 5DHVB 3D0LA 5CS7A 3V4VH 5ITFB 1MHPH 3ULUE 4CNIA 5DVMA 2R23A 4IRZH 3SDAA 3RY5A 3OXSB 1QA9B 4YE4H 4LCIL 3I6LE 3GJEB 4OLEA 5MI0B 1BM3H 4EI5C 1PG7W 2I9TB 4HEME 1IQDB 3MSPA 3SJVE 2OTWB 5IF0A 4XWOD 1EHXA 3ARXA 4MA1B 2YUZA 4OQTL 2Q76A 2LU4A 4MQSB 1SY6A 4HIJB 2QQQA 3OKOA 3HRZB 2KKQA 2R1XA 4XNYH 3NH7L 3NFNB 5GRWA 5J11B 3NFPB 5EU5A 1J88A 3FB8B 5C0EA 5FOJA 2X4QB 2JB6B 5FYKD 4M7ZC 4L5FH 5KSVA 2ATPA 1YC7A 4MCYB 5ETUA 3WUWA 2FHFA 1L0YA 3HNTL 5FO7A 2Q3AA 5BRZD 4PJEF 1ZK9A 2A77H 5CUSL 3OZ9L 5EZOH 4ZPTA 5J6GA 2H3NA 4QHKJ 5E7FA 4R2GD 4HIHB 3FT4B 2FJGB 4EOWH 3MA9H 1RZ7H 2ZKHH 1R5WB 5GRJL 2FHCA 2IFFL 5H94B 2J8UE 3A6OA 1A7OL 2XN9B 3KPPB 1RY7B 3MMEA 3MGTA 4JFHE 4P5TC 3RP1A 3GBNH 4KHTH 3X11A 3VXPB 3TYGL 4KQ3L 4PGEB 3KLHD 3RZWA 1JZ2A 4OM0L 5B39A 2DBLH 3HG1A 4YNYA 4ODTL 4NKOA 1F4YH 3PABA 1HHGB 3U7YH 2XZAH 3VFUB 1OF2A 3B9EA 4NRXA 3K74B 1LO4L 4PJXB 5IJVB 4AG4H 1WWWX 3V5HB 4PRIE 3BUYB 1NMBL 2G60L 2I07B 1PY9A 1FFOA 4ZS6C 2A83A 3G9VA 4TVPL 3IXAB 1YMME 3TO2B 2YEZA 4H8WL 1BFSA 1KPRB 2IH3B 1GSMA 3RWGB 5HI4C 3MROB 5T1LB 4JFOA 5M94B 3Q1SH 3GMQA 1NAMA 5SX4I 4ACPA 1NAKL 4R90H 5D1ZB 1MRCH 3FOMB 4XXDA 5I17B 3JZ7A 5JNYA 2J5LC 5IROA 1Q9WA 4Q9BA 4JKKA 5DJ0A 5JW3L 4M1DH 4XZUA 1CL7I 2V6HA 3QI9A 5C0AE 1JZ5A 4RZCB 1HINL 2HT4D 4GAGL 3MLRL 4AEIH 4QOKD 3MBEC 2VL5A 5TDPA 5SWZD 4KJQC 2RCSL 1I1RA 2FD6H 2EE3A 2ORBH 3BH8A 2JIXB 2F15A 4PJCF 5JPMA 1LEKA 2R39A 4MNQA 4P2QA 3F7VA 4Z7VE 5C0DA 5EOCJ 5J1SC 3VXUA 2OQJB 5KVMC 4B50A 3QZWG 1L6ZA 1OM3H 3BPOC 1CG9B 4Y4FC 1NBZA 4PFEA 2EXWD 3S9DB 3MRIA 1MSPA 2JK5A 4PJAB 1W72A 2W9EH 1N5YL 4M7KL 4UU9A 2ADFL 4BZ1L 4GQPH 4R7NA 5INDB 3LPGA 2F8VA 2YD9A 1YJDL 3NZ8B 3MLVH 5DT1H 4QNPF 1X3DA 4XVUD 5HXMA 3C2AL 35C8L 1KJ3L 3R4DA 1S9WA 4KRNA 5EBWB 3PWPD 5E2TL 5HHMD 5F7UA 4OFKA 2B7DT 2X4PB 5HYQB 5D1ZD 2X4TB 4HV8B 2JCCF 2IANE 1AGBB 4OD1H 4NO0A 2V7NB 4KI1A 5IHZA 1QBBA 1ORQB 1MHEB 5DA0B 1MAKA 4EDXB 5E6IB 3QUXA 2XA8L 3BP5A 5HHPB 2Z8SA 2QQKL 1BVLA 1FIGL 4PG9B 1NCBL 4KPHL 4Y7MA 3IVKB 1XGQA 3MJ7A 4WENB 3F6LA 3I3EA 2NXYC 4K2UL 2R2EB 2WUCL 3O2DL 4PJEE 1U2HA 2QV2A 1VFAA 4OZFA 2JIXD 4LCCA 1T1YB 1BBDL 3MV7D 2AV7A 4JRYE 1LE5A 1ZHNB 3K2UL 1LGVA 4K3GA 4UAOC 1F6LL 3R06B 2EH7L 3VFMB 4ZUSA 5DRXA 1KELH 3NMEA 4HJJL 5EDXA 3MV9E 2FCBA 3SEPA 3IF1B 3EYFB 3IXTB 3VCLB 3IAPA 4DAGL 3K4ZA 1MIEL 3GSRB 1ZWIB 3ZE0F 3D9AH 3P4MA 3MCG1 3QO0B 5I1CH 1RURL 3DGGA 4HWNA 1SBSH 3VWKA 5J06A 4XAKD 1HH9B 1OD7A 4OQ1A 3AU1A 4NZRL 1FL6B 3JTTB 3DVGB 2Q8BL 5HYIA 2YPLB 4FZ8H 3RTQC 4J8RA 1L6XA 2XI9A 4IBLT 5IUSA 4I0PB 2D2OA 2GITA 5AZ2L 5TH2B 3D85B 5KS9F 4GBXA 5ISZE 5I1IH 2DQGL 4ZFOB 5MHSD 4MQXC 2FWOB 3BKYL 3BP4B 5DMGC 4GKNB 5I1DA 1WFUA 1JZ7A 3DVNA 5FO9B 5KAQG 5BW7A 2IPUK 3QULB 4FQJL 4YDIL 5DJAB 3WDHA 1G7QA 5DRNB 5E6ID 1A4KA 3EJYC 4U1KB 1NJ9B 4D0CB 2AJYH 4FQQB 1UQSA 3SQOL 2B2XL 5TE7H 2HJLB 4PRHA 5MENB 3VD7A 3ULUH 4F15B 4MXWH 4ZYKA 5CD5C 2GAZA 4LPXA 2IQ9H 5E5MB 1KCUH 1QFHA 1T89C 2XRAL 1PKOA 1ZVSA 4Y5YC 1KYOK 3PDOA 3HPJB 4D9RE 4XNMB 5KN5A 4BUHA 4AIZA 2CKBB 4PTTB 1KIPB 1LQSR 1QFUL 2EDFA 3G6DL 3L5IA 43C9A 4V1DE 1L9NA 5DUPL 4MDJB 2E7HA 1Z9OA 2H41A 3NCFB 5E08L 2VMFA 4UT6L 4L4VB 4PJCE 4WUKL 4XC1H 1FBIL 1DBKH 1J8HB 3FQXA 4P2RB 4ZFFB 2WSKA 5KSAB 3FCTA 3G04A 1UXWB 4WWKA 1KB5B 3QDME 1RVFL 1WBYB 1X7QA 4X6FB 3LPFA 3VGAC 1VCAA 5CBAA 1MCWM 3RKDD 4JM4L 4N8VA 1GGCL 3AGVA 5DVOA 1R5VB 2X09A 5MEQA 3TO4D 2R15A 5EC2A 3EYVB 4I0PD 1G9ML 3CLEL 1CLZL 3O81A 2DIJA 2NR6D 4MJ6A 1K85A 1S9VA 5DVNA 5JIPA 4GMSL 5FOBB 2HFEA 3S4SG 3TIEA 3SN6N 4DKEH 3W5MA 3NPSB 1PYWA 3GIVB 5FUZL 2OYPA 3ARFB 3JWNC 4HXAH 4PGJA 1C1EL 2CUIA 4QNPE 3WE6A 1KN4L 5I74B 2DM3A 1QOKA 5D5MF 5FECA 2ERJB 3A6CH 2EC9U 4L3EB 2VSCA 5T1KD 3DV6B 4F8TA 1H3PH 3SKJH 4LOUD 2JCCE 2RJMA 3BYTA 5MEND 5F7NC 1DEEB 4NJAH 4HCRA 2X4RA 2DICA 1EHLH 1FIEA 4TUJB 2AEWA 4HIIA 4CBPA 1GGYA 4GKSB 4P2CG 2EE2A 3PHSA 3V6FB 3RVUC 2UYLB 3GNMH 4JN2A 4U6HB 3N1MC 4KK6D 1KXQE 5F9JA 3K46A 3DTXB 1ONQA 1NLBH 4Q6IC 3PQYA 3WFDH 4XWGL 1JHTB 3MLYL 1RSFA 4M7LL 4LDOB 4ZUWA 5KW9H 1CFSA 3WO3B 5FDWB 3CX2A 3EHBD 2NY6C 1DFBL 1FZMB 1TCMA 1IJ9A 1FLRL 1J8HD 2YA0A 4P2RD 4RIRA 5KSAD 1IGFL 2EYTA 1KEML 1KFAL 2MQCA 3QPXH 3VXMD 2FIKA 3MREB 2C3VB 1KTLB 3H6JA 4XPAH 2AP2A 1F2XK 3ZE0E 4LEXL 4NUGL 3OAUL 4YHMH 3UAJD 4KZEL 1KCRL 3RU8L 3GSXB 4ZXBA 2GK0A 4YHLL 5E4IA 5HDOA 2XWJB 4G6JL 4YDLB 4XNQB 1A6UH 1IFHH 3GSQB 4HAFA 6FABH 3ARFD 4U49A 4NQEB 5IK3B 4U0QB 2Z92B 4PJFF 3ARSA 5I6XB 5KS9E 4L3ED 4MX7A 3KYNA 1RULH 3G6AB 4OZ4A 3OTTA 1CICD 1G1CA 4GW4B 3TP4A 1NGWA 3QUMH 3SDCB 4QYOB 4G5ZL 4IDLA 2PN5A 4Z76A 2GY5A 4FQXC 1ADQL 1WFTA 3PWLB 5CILL 5C0BA 4P5KB 2X1WL 5HYFA 2PYFB 1J7VR 2GSGA 2WBJB 3GBMH 5IB5A 3QXUA 4LLVA 5H37H 4LAJH 1JPGB 1DBJH 3QZWA 4DZBB 2Y06L 5DO2D 2RHEA 1PAMA 1ZT4A 1WK0A 3K3QA 1HK6A 2NNAB 5JXED 3QNXA 3OX8A 1JYXA 5JHDE 1QNZH 1E0OB 3RUGF 2GCYA 4JB9L 4WUUE 2NX5B 5ILTH 1SM3L 1EO8L 1D5ZB 2QQNL 2V7HA 1QVOB 5ERWA 5KJRL 2DQIH 3ZYZA 1JFQH 4QLRA 3P77B 1WAAF 4EZMA 2K7PA 1I7TA 3RWJB 5DRWB 4XH2B 3QQ9D 3BQUC 4RDQG 1F6AA 3BXNB 4P2YA 4CMMA 2FR4A 1MVUB 3LZFL 2VXQH 4DW2L 1G9NL 3P4OB 1CFBA 5HYJB 3O4LE 4DTGL 2JJUA 4BQ8A 1ZT7B 1Z9MA 1XIWC 3OGOE 2RFXA 4JFFB 4P9HH 5CSBA 4M6ML 1IL1B 4HFUH 1NC2D 2B39A 1OARL 4X9GA 4LHJB 4F37F 2CSPA 2CRZA 5C0ND 3VD4A 3WMSA 5EZJA 3WS6C 4JKPH 1QFPA 1OAQL 4CNIB 1UENA 1NLDH 4FG6D 3U82B 4U1SA 1MUJA 1IAII 5KANG 2APXA 3B9AA 4X6EA 4CDGC 5HHOB 3FOLB 4LPVA 5KG9A 2PO6D 3HLAB 4N8CL 4OQTA 1EZVY 1JTPA 5D70L 1GIGH 1J18A 3SDCD 5CD3A 3ARTA 5D5ME 4H26B 2Q76B 4NJ9H 5ANMB 1QD0A 3WLBA 3HZKB 4S0SD 1BJ8A 3ZT5A 3MLWH 3AM8A 1QEWA 3CLFH 2R29H 3BP6A 4RAUB 3VRIB 4KJWC 1W0VA 5JQHC 2R1XB 3IDJA 1H15A 3C5ZB 3NFSL 3QIUA 2V2TB 1CGTA 3FO2A 5EU5B 1WIPA 5HY9B 2G5BB 3D6GA 3OKEB 4TUKH 4M62H 5IR1B 1KIRA 4ZTOH 5ETUB 1YEGH 5E2VH 1P7QA 3D0VA 2ENSA 3RZCA 4JPKL 4RGNB 2SEBB 1H9VA 4MQ7A 1CE1L 2R0WL 3H9HA 3VG9B 2R0KH 4I18C 1LNUA 3PUCA 5IB4B 2ZOLA 1U3HC 4EVNB 1DQJA 5F7DA 1QBLH 3TA3C 3R0MA 4IOFD 3I2CH 5DK3A 4WV1B 1VFBA 1CU4H 2NY3B 4JFFD 3VXRA 2ZCLH 4RISH 5EFIA 1DL7H 4P23A 3MODH 5IKCA 1KULA 1U8NB 5IVXF 3VWJA 4Z7OF 1MJ7H 4Z8FH 4F57H 1U8KB 1BBJB 2R56H 2H32H 5ESQB 1T0MB 2DBJA 4NKOB 3SDAD 1VGKA 4U1LB 3PABB 1CDHA 1OAKL 4HG4J 1C5CL 2XZQL 2VLJA 4NP4H 1S7QA 4NO5A 3ARGA 4RMUA 4MJIA 4AMKL 3ILPB 5E2JA 4XMPH 2HH0L 1PQZA 4XNXH 5C08A 4NN7B 3BPLC 3UJJL 4L29A 5JDJA 5SWSB 4CN1A 4L3CB 4YR6B 5I1KH 2VLRA 3LDBB 4PJFE 2J88L 2D3VA 3P9LA 1U2CA 1JVKA 1OP3K 2YEZB 4DFHA 1ROWA 1NSNL 3QWQB 4OFYA 4PJ8A 5CGTA 2XZZA 5D7LE 3C6SA 1YNTB 3IDMA 1KCVL 3U46A 1SYSA 3GMQB 1R3HB 1MCEA 3GM0A 4JFEE 4POZD 3C5ZD 1JZ4A 1CQKA 4KXZI 3SY0B 2AAVA 1A21A 2PF6A 1V3JA 5L6YH 1UA6H 4OJFH 1SJVA 3SDXA 4PJIF 1EK3A 4PRNA 5E1HB 5IQ7H 1Q9WB 5I8OL 3TCXA 5I76B 5DJ0B 1RZ8B 5EA0H 1TTUA 1M7IA 1AJ7L 4I4WA 2BNQE 1MPAL 4M5YH 3VGEA 4FQ1L 5GRVL 3RUGE 4I13B 1NGXB 3S4SA 3PL6B 3MRDB 3P0VL 4UILL 4JO1L 2ADJA 1WCQA 4L8DA 2AERT 2NY3D 3GI9H 4M7JH 3TWCL 3BH8B 4G9DB 1RJLB 4N5UA 1WAAE 2WUBL 4HPYH 32C2A 3OAYK 3T2PA 1SJHA 1GHFH 2MOVA 3F7VB 3O2WL 4PD4K 4JPWH 5J8OA 5C0DB 3FO9A 3HG1D 5FGRA 2K3TA 1YEKL 1FFNA 1SEQH 1X5JA 5C07A 2E5EA 4YK4C 5I16B 3QA3A 3U4BH 4YHIA 2YPKA 3LB6D 2VDOH 5ID1A 1A3LL 2XWBA 4JR9L 3MRIB 2A6IA 3S35X 1DQTA 3UJIL 2NMSA 5CJQL 2CLVB 5BVPH 4P5MB 4UU9B 3FONB 2E9WA 2W91A 4FTVE 5SWSD 4R7NB 4DOHE 4X7DC 1Y6NR 3MA7A 1U36A 5INCA 3KLAB 2HFGL 1X5AA 5DI8B 4UOW0 3F58L 3MOAH 3F7YA 1PEWA 1GZPB 4PJHB 3C8HA 5JOFA 3S36X 1WZ1H 2EIBA 5E9DE 3WXWL 2YD4A 4LHUG 4JPIA 2F53A 3WKML 1HH6B 1BOYA 4WU5A 1RIVL 1XGRA 1R3KA 2PR4H 4G6FD 1HN1A 1IEBB 5FYLE 1UM4H 4PJ5A 1I3GL 1XCTA 4X6DA 3BP5B 3VH8G 4GXVH 3O2DA 3T1FB 1XGQB 2DQFB 3KNBB 1P6FA 1F8TH 3WDIA 3PL6D 3GHBH 1MCJA 3WLWD 4PRPA 5E8OA 4WHYH 3LRSA 2J12B 4LCCB 2P44B 3TF7C 3LH2H 4XP4L 1LE5B 4R7DA 4YGAB 2X4SA 2DQCH 2NY7L 5C0FA 4X80H 3VXUD 5GS0L 3L6FA 2RBLA 4XNUL 1NBQA 1G6RB 4HDIB 1DQQA 2KUTA 3P4MB 1XF4B 3QRGH 5IVXE 4Z7OE 5L9DH 4NKIL 4JQVA 1Y18A 3V5DA 1YEDB 3ZYIA 1M4KA 2JB5H 5D1XB 3U9PH 4LNRB 4OGYL 4M48L 1G7MA 4J8RB 4K7PL 4GAYA 4D3CH 3V9FA 3KR3H 1NBYB 2WIIB 1RZJL 3WJJC 1H8OA 5LGKA 5BZDA 1GL4B 1I3VA 3MRMB 1U95A 4N5ED 3ZYOA 1MI5A 3B9KC 1F97A 1Y0LA 3D39A 4J4PA 5TGBB 3GSOA 1OTTC 3GM8A 4AM0B 1IT9L 2BVUA 4KK9D 3NTCH 1ZANH 5I1DB 1EMTL 1Q9LA 5T1MB 2VYRE 5IT2L 4FFWD 5F9OH 4WI7A 4AEEA 5I18H 1G7QB 3IJYB 4G6KH 4MB4A 4KUZH 3MCLH 1G7HB 1P4BL 5C0CE 3X3FL 3V6ZB 3BE1H 4BZ2H 1OAXH 4JO4H 4J2XA 3AROA 2BOCA 3ZO0A 1K5NA 5LAXB 4PJIE 4Y5VC 5HHXL 4ZYKB 1FCGA 3BJ91 4LSUH 4NGHL 5LCVL 3GI8L 4YDKH 1INQA 3OV6A 4L8SA 3O8XB 4X5WA 8FABA 1A7RH 2YHGA 5I9QC 4RSVA 3OGCB 4MS8C 3IU3B 1N64L 3O9WB 1D5BB 2PYEA 4Z7NF 4IM8A 4LDEB 4XPBH 4ENEC 3UC0H 2DYPA 43C9B 4LLMA 1N6UA 4TNWF 4RBPH 1I7ZB 2PW2B 5A2JH 5E7BA 5F1NB 3RJDA 3A0OA 5CHNA 4FXGA 1BJ1H 1AGEA 3U83A 4CN6A 4PP1C 3G04B 2DLIA 4KK8D 1SJXA 2R2HA 3TCLA 2COQA 4NHCL 3VWKD 3S35L 3V0VA 2OI9C 1QUNA 4OZHB 5GGQL 4CN4A 4QCIA 1I8KA 2PXYB 3ROOB 3V6BR 3ZKQD 1WVZA 3CK0H 5MEQB 4R97B 1ZE3C 4R8WL 5JOPD 4JRXE 3AAZA 3QUZA 5DQDL 5EC2B 3WFEL 4K23L 1QSEE 3LPWA 1A3QA 4MJ6B 3CZJA 1A6AA 4GBXD 1CK0H 1VGEH 3TVMB 2HFEB 3TIEB 1I9JL 1CD1A 1MIML 1FO0L 2VZOA 4Q74A 4X6BA 4X9IA 1PYWB 1MFDH 2ESVE 1FH5H 3KDMA 2C3GA 5E2UH 1Z0NA 5ESAA 4AL8L 4BZYA 1OTSD 2EDDA 3S36L 3WE6B 3C60B 2V2XA 1BPVA 5FECB 2NXZD 1UWEH 2Z4QB 4FQHA 4I3RH 1MCOL 1BLNA 4XWOC 1NGPH 2YSSB 3TBTB 1I8IB 5D6CB 2FJHA 3IDYC 25C8L 2DM2A 4G8IA 2GSIB 2VDQH 2ED8A 5K9QG 4Y19A 1ACZA 3QCUH 3RGVA 4ORGB 3LQZB 4PJXF 3DECA 5AZEL 1OGAE 1HCVA 4WI3A 3MQIA 1FAIH 3CFJB 2CLZB 3O9WD 2FX8L 3RVXD 4LQ1A 4ONGL 1TVHA 5IBTH 4XT1C 3W39B 4PLKD 3U4EA 2JF1A 4I77L 4XRCB 1BF8A 1ZSDB 2JE8A 3MBXH 4JY4B 3OB8A 1TVDA 1QTYT 3RVVD 5JXAH 2HN7A 3CC5A 3TZVA 5I15H 1YEIL 4R2GC 1S7SA 4MNHA 5L88H 2CPCA 4WWKD 3QDJB 4OCWH 2X89A 1MFCL 2FIKB 5B21A 1HCFX 3PP3H 2NZIA 5I75B 2X9WA 3OXRA 3NABL 5IW3A 1OAZL 3KG5A 2VERN 5HGHA 1BGXL 2D31B 3P0YH 5I1AB 4OIIL 4ZXBB 3KLHC 5EOQL 3SBWC 4JVWA 2R69H 5FYKE 4UTAH 1P7KA 3E1F1 3A6BL 5JR1H 2QBWA 2BNUA 5BRZE 4RX4A 1QPXA 1CXLA 1XR9A 4TPRL 2WWMD 3D69B 2VL4A 2D4DA 5MI0C 1A3RH 3G5XA 4XP5L 3UTSA 1JIBA 5I2IA 3EOBA 2QKIA 5DC9B 3BEWB 3KPNA 2PW1A 3KYNB 4JJ5B 2ATKA 5HYSG 1J1OH 1ADQA 1LO3L 4MA1C 3UEZA 1DSFH 3CAFA 3STZB 4U33A 1QFWM 1ND0A 3V52L 2DIBA 3L1OH 4KQ4H 5HD8D 5C0BB 5D1QA 4YXLL 5LXGH 1INDL 4MAYA 1QPPA 5D7IB 3CPLA 4PJAF 5IB5B 2Q86B 4LLVB 4HGKC 4K7FB 2EIZB 1CE6B 3MCKA 3KXFA 5J11C 5F1IB 3VXSE 3NAAL 1EEZB 3IAQA 3ARDA 3EOTH 4YBHA 2B5IB 3PQYD 2Y23A 4HIXL 4R4FH 2VXSH 3C9NA 3N1GC 5KVDH 5JA9A 4TULL 3QNXB 1FV1A 2A9MH 1OGTA 5DJ2A 2AJXH 4U3XA 5DK0B 2YZ8A 5L2JA 2VKXA 4HT1L 4Z7NE 1NFDB 2V7HB 4PV8A 4JO3H 3QDJD 5IFAH 1T21A 2O5XL 4N9GB 1F6AB 3WDJA 3V79C 1CS6A 1F3JB 5BVJA 3MYZA 3IKCB 3QJHB 3V4PL 1PBYA 1R3IL 1XCQA 1LK3L 2RFXB 4ZXBD 4DK6A 3BIAX 4LHUA 5KTEL 1YYLH 5IVZA 3B3IB 1GGIL 4IDJL 4OF5A 4YHOH 3VH8A 4N1CA 3VW3H 2FBJH 4OV5A 1U8MA 3G08A 5TE6H 3BSZL 3S3SA 1LO5A 3NIDF