1EMTL

Fab antibody fragment of an c60 antifullerene antibody
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
b'DIQMTQTTSSLSASLGDRVTFSCSASQDISNYLNWYQQKPDGTIKLLIYYTSSLRSGVPSRFSGSGSGTDYSLTINNLEPEDIATYFCQQYSRLPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG ANTIBODY (LIGHT CHAIN)
publication title X-ray crystal structure of an anti-Buckminsterfullerene antibody fab fragment: biomolecular recognition of C(60).
pubmed doi rcsb
molecule tags Immune system
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2000-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1emtL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1emtL01
2N7AA 3VRLE 3GBNL 3UJJL 3MRFA 2ITCA 4KVCL 4YAQB 3FOMB 3O6FC 2VAJA 3SE3A 1T1YA 2CPCA 1HYSD 3SKMB 3WSQL 5GXBB 1MI5A 1H9VA 5HVWA 3QIWB 4P3WA 2B2XL 4Y1AD 4GAFB 4P2OD 4TRPH 1EGJA 4WO4A 1WZLA 4I18C 5E4EC 1B0GA 2F9BT 5H2BB 5DQ9B 5CZKA 3B9VA 1M71A 4KJQC 2H45A 2PYFA 3OB0H 4M7LT 5C0EA 5EBMB 2NXZC 2K9UA 3Q1SL 3Q6GH 2BY3A 3QG6A 3RY6C 4LASH 4BH7A 4YFEA 2R1XB 4NQCE 2DWDA 5CFHA 3T3PF 5CEZH 3QQ4B 2VSCA 2GJ6B 1UXWA 2AEIT 4OCRH 3ZKSD 3ULUC 3P11L 1KB9K 2DQEL 4O2FA 3KPOB 5IMOA 3AXLA 3BGMB 1W8OA 1EHNA 2OI9C 32C2B 2OK0H 1NLBL 5D1ZC 1NJ9B 4CNIA 1S9WA 1EO8H 5C09A 4XZUA 4BH8B 1PVHA 1NKOA 3FJTA 1PBYA 5ISZA 4KDTC 1XF4B 3BH8A 2IH3B 4LIQL 2ZWLT 1NPUA 2IBZX 4RGNE 3NFNA 4EUPH 4I13B 4YE4L 3MRFB 2ITCB 4PJGE 1G1CA 1RQ5A 5ID0A 1T1YB 3HUJE 4G3YL 5T1LA 3SGJC 5J11B 4P3CL 1MI5B 3RWFA 1A7QL 1QSEE 3QEHA 4WO4B 1KB5L 3BOVA 4V1DA 1IAKB 3PL6C 4YWGL 1B0GB 1U8HA 3MCG1 2XIDA 1DJSA 2WSKA 3SO3C 1M71B 2PYFB 5C0EB 5I1LA 3V4VH 3QG6B 1DFBL 5K9QG 4BH7B 3BKML 1SEBA 3RI5K 2DWDB 5KAQG 3QXDA 5IV2A 1UXWB 1KLGA 4U1IA 3VFWA 4O2FB 4MXQD 3AXLB 5ANMA 5GHWL 3P0VH 4EI5A 4MMZC 1INDH 4CNIB 1FIEA 1S9WB 4ONHA 5C09B 4XZUB 2BHZA 5E9DE 4XNUL 3GHBH 1L7IL 5ISZB 4PUBL 3BH8B 2HTLD 4R4FH 1AO7D 5C0NC 4UDTA 3NFNB 4OSUL 3V7AG 3FO9A 5C6PB 4IJ3B 4U4BA 5ID0B 5T1LB 1MJJA 2AI0L 5B8CB 5KN5A 3RWFB 4OJFL 2A6KA 3LDBC 3P0YL 3QEHB 2XT1B 1OW0C 2MCG1 4JDVA 4V1DB 3O2DA 1MIML 1U8HB 3QHZL 4QXUL 4PJDF 2BNRD 3GIZH 3Q3GA 2XXMB 3MLTA 5I1LB 3S8WA 1WVZA 3SEPA 2IANA 4UZGA 1SEBB 3IVKA 4WTZA 2LQRA 5E5UB 3REVA 3NZ8A 3B2UC 3QXDB 5IV2B 2F5BH 4X4YA 1KLGB 3O0RL 2K3TA 4U1IB 3FN9A 3VFWB 5ANMB 1OLZA 1ETZA 1TQCB 2X10A 1CXLA 4EI5B 3MODL 4YUEH 4P2RA 3ZL4L 3NFSH 2KKQA 4ONHB 3SJVE 3SDYL 2Q7YA 5DFVD 3D0VA 4FQ2L 9CGTA 1GXEA 1OAZH 4Y4HC 1HKLL 4UDTB 4V2BA 1MHCA 2NY1B 4OLVL 5D72H 2PXYC 1LEGA 4XAWH 2Q3AA 4HUVA 3CMOL 3ARDD 3HA0A 1RIVL 4U0RC 4KK8D 5EZIH 3LMJH 3FO9B 3MLXH 4M3JA 4PREA 1FZOA 1P5UA 2VDPL 2AEPL 2IJ0C 1MJJB 5CGYC 3UTTE 4PJ9D 1S8DA 25C8H 5KN5B 5DO2D 4OCXH 2A6KB 4KZEL 1JHKL 3U79A 4JDVB 2R0LH 3MV9E 3TC9A 1EHLH 1BVLA 3C6LA 2A74A 1QZ1A 3CVHA 1BZ9A 3CLFH 1CDUA 3Q3GB 3O81A 3WNKA 1NGQL 3MLTB 4P9ML 3KHOA 2IANB 3K74B 3IVKB 3W5MA 3RU8H 3REVB 3NZ8B 3WFBH 2J88L 4X4YB 3TV3L 1UFUA 1SM3L 1ETZB 3H7BA 3CFDA 4R7DA 4P2RB 4QRUB 1H0DA 5DRZA 4M43H 4AG4L 5J6GA 2Q7YB 4D9LH 4WEMB 2Y07H 3QUML 1I1YA 4L4TD 3D0VB 2IGFL 1A1NA 3RTQA 3BKYH 5F9JA 4PGJA 3GI9L 4FZ8H 1MHCB 1HZHH 1U3HC 5F7FA 5JA8B 3N1FC 1LEGB 4HUVB 4IRSC 4NKQB 3EHBC 4PREB 5DUPH 1FZOB 1FFOA 1CDBA 3WNPA 4FQIL 5CP3H 1TZHA 2ZUUA 5EFIA 3NPZB 1S8DB 1KACB 4OV5A 5IMLA 1BVLB 3C6LB 2A74B 3MX0A 3CVHB 1BZ9B 1LWRA 2JCCE 3BP7A 4PGEA 4MNQD 1A6PA 2R2CA 2DQDH 2D7TH 4P46C 5E00A 3IFNH 4JO4H 1B6UA 3ESUF 3IFPA 4RMQA 2CLVA 2A2QT 2VERN 4M1CD 5EWIL 1VFMA 2DD8L 3H7BB 2HMIC 4R7DB 2DKMA 5D1XD 1H0DB 3QISA 5A2IH 5DRZB 4KQ3L 5J6GB 3QI9A 1UA6H 1I1YB 4L8SA 1K3ZA 1A1NB 4J3VA 4X4MA 3RTQB 3O4LE 5F9JB 1V3KA 4GBXD 1G7HA 4H1LH 3SY0A 1LO4L 4HIXH 1IVLA 1L9MA 2LU4A 1MAKA 4TUOA 4O58H 3GB7A 2ZCHL 5KSAA 4FFZH 4G9DA 5FOJA 3ZE1F 4S1QH 3F8UB 5CCKH 2R23A 1FFOB 1QBAA 1RUAH 5FEBA 5E2WL 3HNSH 4RMSA 3QIUD 1TZHB 5EFIB 3RVVC 2XKSA 4K3DH 1EAJA 4H25A 4Z7VE 4L1HA 2X09A 4OV5B 5IMLB 5KZCD 2D4FA 4OZHA 2UVFA 4OFYD 4R9HA 5E8DH 4OFIA 3BP7B 4PGEB 5J1AA 1OTSC 2J8UA 4ZOCA 3KPSE 3U4BL 3NIGF 5E00B 4EDXA 4FFWC 3MBED 2IMMA 5JR1L 4PJ7A 3KXFD 2FX8L 1W8NA 4JCLA 3ZE0F 3QAZB 1JYXA 1I1AA 3IFPB 3MRCA 2CLVB 3BWAA 1QLEH 3V6OC 2EH7L 2HVJA 1JPTH 2YSSA 1B88A 1FGVH 2DBLL 5D70L 1CTNA 1PD6A 2VLRE 3VFPA 2BVYA 5DXWA 2XTJB 4P0DA 1A9EA 5CEXA 3U7WH 3QI9B 1QSFA 2VXTH 4L8SB 5HHXL 2CMRH 4D0DA 3R8QA 4R8WL 5JOEA 1G7HB 3SY0B 1VFOA 4LHUA 1YY9C 3Q2CA 4TUOB 5KSAB 1A3RH 4G9DB 4UIKL 3G6JF 2R23B 1IC4H 1J0JA 4XX1E 2FH6A 5FIEA 2YA1A 4Z7QF 4CRPA 4NN5C 4H25B 2BCKA 4PTUA 4JG1L 1KPVA 1I1FA 4OZHB 4Y88A 3WYRA 4K7PL 4ODSH 3DI3B 3N50A 1YEEL 2FECL 5J1AB 5DD5H 3SGDH 2VDMH 2J8UB 5IVXA 4OM1L 4EDXB 4YHZL 2Q86A 1G7LA 4PJ7B 2AJZA 4JM2A 4DN4L 4G6KL 1I1AB 4QRPE 3MRCB 3BWAB 2HVJB 2KQNA 5E99L 2YSSB 2DJSA 4F58L 1KIUA 3WFDH 1RURL 5MENE 3VFPB 4BA8A 1A9EB 5CEXB 3B83A 4PJ5E 3O9WD 1QSFB 1BFVL 4GMSH 3QEGH 4L4VE 3G5XA 4D0DB 1A8JH 2BNQD 3RJQB 1G84A 4LHUB 3AROA 4U1MA 4E41A 1FZJA 5E1AA 2W38A 3WUWG 4X5WA 1G9MC 1TIUA 4MJIA 1NMAL 2D0FA 1YEIH 3HMXH 4AMKH 2FGWL 4IRZH 1XEDA 3OBAA 3K2MC 4HIHA 2BCKB 1FSKC 12E8L 1GC1L 2C4FU 1KPVB 4I0PD 4PTUB 1GIGH 1QLFA 1I1FB 3LN9A 5E2TL 3MOQA 1S7TA 1IKNC 2Q1EA 3HC4L 1YPZF 3QXTA 3NGBB 1DANU 2MKWA 3OG6B 5IVXB 1TJIL 3GSRA 3MV11 4PRBA 1SJVA 3ZKXC 4J3TA 2Q86B 1G7LB 4U7MA 2EIEA 2AJZB 4JM2B 4Y2DD 2DQGL 2GCYA 4UT7H 2DMKA 1FL5A 3RAJH 1FHGA 2W9EH 3NA9L 5DMIL 1ZWIB 2EDEA 3VA6A 3FT3A 5T1DL 4U1GB 1Q72H 4JVWA 2APTA 3G5XB 1WIPA 4UAOC 1FC1A 1BZQK 5K93A 5C0CA 4KHXL 2C3XA 3LPFA 1BQUA 4KK8C 3W0WD 4U1MB 4E41B 5EO1A 4HWEL 1FZJB 1AH1A 5E1AB 1GGYA 1KBGH 4FRWA 4D9RE 1E28A 1F3JA 4PJ9C 4X5WB 5KVDH 3O41A 4MJIB 4ODHL 5FUZL 4EBQL 2BY0A 2IPTH 2WBJA 4HIHB 2FLBT 1QLFB 3T3PE 4HBQA 1FJ1A 3HR6A 1S7TB 1CDIA 3HN3A 4MXWL 3VXMD 1MJ8L 4RDQG 2C3GA 3GSRB 4PRBB 2EDNA 5LBSL 3L3JA 3DTXA 4QRSA 4P5TD 3T65A 3TZVC 2D7PA 4XMLL 4YZFF 1W0YT 2P49B 5EU7E 5FCSH 1YQVH 1OSZA 2GCYB 4Q9RL 1RIHH 1CFBA 2V17L 4GKNA 1FL5B 3MRKA 5IBTH 5T3ZH 1MRFL 4S11A 4YHKH 1Q94A 1QRNA 3RX5A 2H9GA 3FT3B 2FBJH 5TE4L 4GXVL 1JZ5A 2QJDA 2VDLL 3KYKH 1XF5A 5C0CB 3A6CL 3VMOA 1SY6A 1A4JA 1JMXA 1WBYA 5J06A 4PLOB 2R0ZL 3CDFA 4Y5VA 5GJTL 3SDDD 4I9WD 4DGYL 5EO1B 2G75A 1ORQA 3M07A 4TUKL 2DB8A 1E28B 5F7MC 1F3JB 4XBPA 1LK3L 3O41B 1GGCL 2ZPKL 4Y16A 5DMJB 4F9PA 2DL9A 2FX9L 1KN2H 3FKUS 1DQLL 2WBJB 1MJUL 1DBML 3S7GA 4MLIA 4OLUL 5GGRA 1FJ1B 4H0HB 1NKRA 2ZJSL 15C8L 2C1OA 1D6EA 3WNMA 4KV5F 4G6AD 1D7FA 1AE6L 3L3JB 2X9YA 3DTXB 4QRSB 2GJ6D 3T65B 1MQ8A 1RVFL 3R1GL 4I77H 2P24B 1OSZB 1X5YA 3FQRA 4XVJL 3K4AA 4GO6B 4GKNB 3MRKB 5BO1L 5EN2A 5GZND 2PETA 1Q94B 2N4IA 1QRNB 4YDLB 1LP9F 2H9GB 4WEBH 1IGIL 3QDGB 4IBLT 5IMMA 5IVNA 1XF5B 2VLJB 3HR5A 1R3LA 2NYYC 5T3XD 1A4JB 1WBYB 4PRHB 5KJRH 4LSVL 4Y5VB 2G75B 1ORQB 3MLPA 2XZCH 3RVWC 5TQ2L 2V9RA 2R29H 4PJDE 2E5EA 3A6OA 4XBPB 3D25A 5BMFL 1FH5H 1MI5D 5E08H 4Y16B 2Y6SD 1XT5A 1B2WL 5IWLA 4WO4D 4JQXC 4K8RL 1I9JL 1JZ3A 5C0AE 5GGRB 4NHCH 4R97C 2V5RA 2C1OB 1BX2A 1UM4H 3DX8A 1D6EB 4S1DD 4UDUA 4M5YL 3BGAA 3UBXA 4G9FA 5D5MA 2YHGA 4QKXB 1OARL 5IW1A 4PGBA 3LH2H 3ARZA 1IM9D 1JNHA 1U8PA 5C1MB 4ZQKA 3FQRB 1RMFH 1X3DA 3MFGB 3TWCL 3ZTJG 2P4AB 5ESQA 4MB3A 5C09D 5EN2B 4JREC 5AAWA 4UUJA 3WNOA 2JTDA 5ISZD 1A7OL 1A7PH 5IMMB 3AREA 1CQKA 1HIMH 3FOLA 4XAKD 3HR5B 3PABA 3K3QA 1R3LB 1MRCL 3W5NA 4FFYL 5D7IA 3I3BA 4N5UA 1QKZL 4DWHA 3G6DL 2E6PA 3U4EA 1IRAY 1FVEA 3RVXC 2WWMD 5JOPE 5T1LD 1BWWA 3FRPG 1ZLUH 1LO3L 4NCC1 3D25B 2D03H 5IT2H 1ADQH 5D6DA 4ODVL 3EJYC 3K0WA 1RUML 1X5ZA 2UYLA 5HHMB 1RZKC 4G6FB 4OV6F 5L2KA 1MCQA 3D2UA 1BX2B 3DX8B 1MY5A 4UDUB 4C56A 1NFDF 2IBZY 4P99A 1JBJA 4DQOH 3UBXB 5MERA 4G9FB 5D5MB 4XP1L 5IFHL 3P40A 5IW1B 4PGBB 1JNHB 1U8PB 3BX7C 4QOKE 4ZS6D 1SHMA 4ZQKB 1CDGA 4JFEA 3WO3B 1DBAL 4EI5D 1QYGH 1WIOA 5IBLD 2XA3A 5H8DA 1KUMA 2LABA 1EUTA 4ONFL 5F6IB 2Y06H 4OCWL 3BP5A 5GRUH 1CD8A 1ZK9A 3AREB 3FOLB 3PABB 3T0EA 5C2UB 4BZ2H 4NRXA 5D7IB 2VZVA 5D2NC 1AXTL 2X44D 3U4EB 5AWNL 4M6MH 1FVEB 2MHAA 2XOTA 5I76A 2GSIA 5EORH 4Z8FH 3HNTL 3OAYK 1FFNA 4P2QA 4PJXF 4KUZL 1DZBA 3I2CL 3KPRA 3UYRL 1Q0YH 4N1HB 3BKJL 2UYLB 4Z7NF 2F54A 3PWJA 5L2KB 1FNSH 2O5XH 3D2UB 1AY1H 1OB1A 5F7EH 4ZNEE 1ZGLM 4WFFE 4C56B 3O3UN 1KJ2H 3BGFC 5MERB 3BT2H 4LQFH 5C6TL 2ZUWA 2HP4A 1JGLH 3UC0H 4JFEB 1MNUH 1OAUH 4P2RD 5FO8A 5SWZA 3N0PB 3ZE1E 5I6XB 3ILPA 3BP5B 3BZFA 3V8OA 3ZZ1A 3T0EB 5JIHA 4NRXB 1H8OA 1HI6A 4PP2A 1ITCA 4P59L 4PY7A 1QO3A 4YXKL 1YUHA 2EDWA 3JVGA 4Y4KC 2MHAB 1LD9A 5I76B 2GSIB 3ULUH 3NH7H 4JZJC 4UV4H 4PRIA 3E6FA 2OMNA 3E0GA 1FFNB 5K9KA 5AYUL 2YWYA 1DBJL 4P2QB 4NZUH 2R56L 2VUOA 5C92A 3KPRB 3NIGE 4TNVF 1W72A 1LEIA 4YXHH 2GAZA 5D7LE 1ED3A 4K7PX 3ZE0E 5DF0A 2F54B 3PWJB 4KTEL 1NH6A 3RKPA 5AG9A 3TO4C 2CGRH 3HLAA 1OB1B 3X13A 5F72S 2XZZA 3U7AA 2VISA 5DJ2A 3H9SE 4HH8A 4OTXL 2IAMA 2NZIA 1JRHL 4A6YH 1Q8MA 2E8ZA 1FORL 1BGXL 1RHHA 3JUYA 4UTBH 1C7TA 2VDRH 5GGTA 1VSCA 5ADOH 3NMEA 5FO8B 5SWZB 4X7FC 5KAQF 3QUYA 3G6JE 1SVCP 2XQBL 1UCBH 5I16A 3ILPB 3BZFB 2LU3A 2CRYA 3B9DA 3AVEA 4JPKH 4YFLI 5IB5A 5GSRA 4Z7QE 1DBKH 4ZUSA 1HI6B 2VXQL 4PP2B 2QQNH 4PY7B 4FQCH 3QEQE 1QO3B 5T3ZE 1YUHB 1LD9B 3QIWC 4POZD 2GK2A 4PRIB 3DARA 3E6FB 2CRIA 5K9KB 3P4MA 4DUWA 1C5CH 4NBXB 2GUOA 4OGYL 1CBVL 1F3DJ 1W72B 1LEIB 2GAZB 1CDYA 2QKIA 3CFBA 1ED3B 4TVPD 5HVHB 3HLAB 2DQHH 5BS0A 4G6AC 1OGTA 4P9HC 3V5KA 1BM3L 1IC1A 4N8PA 5KVEL 1NMBL 4XWGH 2VISB 5DJ2B 3VFTA 3F65A 2IAMB 4YXLL 3O6MH 1T21A 4LEXL 3P4LA 1RHHB 3ARFC 1JTTA 4U1HA 5GZNC 2KQMA 3RL2A 1EXUA 2XTJD 5CKAA 1Y6NR 2YRLA 1OQXA 3LQAC 1X5JA 5M7QA 5I16B 1B9ZA 3IGAA 1RPQA 4GS7C 5IB5B 4XP5L 5GSRB 4ZUSB 4FP8L 2ZNXA 4JLRA 5KSAD 1YECL 1NCWH 3RA7H 2D2OA 1FL6A 5AZ2H 4HWBL 5FHBL 3QUMA 4WO4C 1YPZE 2FO4A 3P4MB 5HTSA 4WTZG 1E4XL 4ZO6A 2EE3A 4FNLH 2GUOB 2OXGA 4YIQA 4JQIL 1NGXA 2QKIB 3CFBB 1TETH 2MQ0A 4JR9L 4S1DC 1A0QH 1X4XA 1OGTB 1DVFC 5SX4I 3V5KB 1XR9A 3MPCA 1D5IH 4K94C 2E7LA 5DHVH 3MCLL 4MS8D 3L9RA 3VFTB 1I1AD 4R0LA 1T21B 4HLJA 1BD2E 4OCYH 3CVIH 3GMOA 4U1HB 5F1SA 1BAFL 4BQ8A 3RL2B 4NNXA 1EXUB 3VFGH 1K8IA 5IW3A 1QSFD 4FFVD 2X1OA 3WXVL 3IGAB 3H9ZA 2V9TA 3S35H 2A9MH 1WIUA 4L3EE 4FS0A 2GY5A 4LSDA 2F8OA 4YGAB 4LHUD 3BIKA 4JLRB 4IRJD 2WWMC 3MRMA 3PXHA 2VLME 4QXWA 2PTUA 5DZLA 3STZA 4K3EL 1FL6B 3X14A 4B53A 5B8CC 4LNRA 5HHOA 4HUWA 4UV7L 3QUMB 4CU6A 5DZNA 4YX2H 2FO4B 5JQ6L 1UJTA 4XTRD 2ICWI 4ALAH 4XPGH 4YIQB 2CXKA 1NGXB 3C5SA 5BV7H 3IU4L 4YZFE 4XPHH 2EXYD 1A6ZA 5IEHA 4X9HA 4AQOA 1XR9B 2J6EL 2X70A 1OAYH 3EYSH 3L9RB 4XC1L 2V5MA 4R0LB 3MUGA 2VWEC 3LV3A 3PWPD 4DOHB 3GMOB 5CJXA 2XXCB 4NNXB 5I75B 3LOWA 3NCMA 1K8IB 4MA8H 4OLYH 5JHLH 3KPNA 4KFZC 2NY1C 3WMSA 1GYAA 3HPLA 4FXKA 4EOWH 3MRQA 1G7IA 1D3CA 4S1RH 4OQTA 4E41D 3BIKB 4W70A 3ZTNH 4JFQA 3MRMB 2DF3A 2RHEA 5LGJA 3T0DA 3STZB 3DI2B 1AGDB 3X14B 4XVSH 4HF5H 3UEZA 4LNRB 3V9FA 5HHOB 4MJID 3MA9L 4HUWB 4NGHH 3TCXA 2R0KL 2L7UA 2DQTL 2WLZA 3DUUA 1OSPH 2HFGH 3QCTL 2ESVA 4KV5E 5JXEC 5I1DA 1CXEA 2IQ9H 3VFNA 1I7ZB 1MQKL 3C5SB 2J1KA 2QSVA 5F9WC 3U9PL 4HCRH 3A67H 5FCUH 1A6ZB 3KJ6L 3C09C 5IEHB 3JV5A 5JPNA 5IB1A 2YD3A 4YDIL 3PV6A 2X70B 4TNVK 1IEHA 3EOYG 4KGJA 1LP9E 4EVNA 2QQQA 4JFHD 3PWUA 2A0LC 3MUGB 3OAZH 3LV3B 3ZT6A 5FYKD 5J57B 2R8SL 5CINL 5GS3A 4WWID 4NQED 3OG4B 3TJHD 4K23H 3KPNB 4XCFL 2JJUA 5C0CD 3HPLB 3LSOA 4FXKB 4WRLA 3ZKMC 3MRQB 1MFAH 1G7IB 3EYQC 3WHXA 4X99B 4UQ3A 1KPUA 1YEFL 4JFQB 5LGJB 4X4ZA 1D9KA 3AC0A 3KPLA 1U8KA 4LLYA 1OAKL 3BSZH 3GJFH 4QTHA 3UBXI 2AJXL 3C6LC 3DUUB 2WBJD 3WFCH 2ESVB 5EB9A 3GNML 2DI9A 1V7MH 4HPOL 4LLVA 5I1DB 5M94B 5E70A 3VFNB 3DXAA 1OGAA 2GY7B 2YPKA 4Z77A 4M3KB 1KN4H 5JPNB 2ERJC 4EN3A 5D7SL 1MCIA 5IB1B 4R4ND 3PV6B 1B4RA 2BHUA 4EVNB 1OTUD 3PWUB 1YEGH 2IC2A 4LHUG 2DQUL 5BOZG 5DVMA 5FA3A 1TVBA 5L0QB 3N1MC 3RTQC 2AK4A 1S7XA 2W0LA 2MFNA 2R1WA 5KVGL 3LSOB 3BN3B 3D3VE 1P1ZA 2FSEA 3UPAA 4KY1L 3WHXB 5I8OH 1J86A 2EDRA 4UQ3B 1KPUB 2DAVA 4H88H 3NACH 2AS5M 2Q20A 2KL6A 5EZLB 4POZC 3MLYL 3M17A 4G8EA 4KKAC 3ULVD 3L3GB 5DQDL 5LG1A 3S6CA 1D9KB 4GKZA 1RUPH 2PKDA 2CIKA 3KPLB 1U8KB 1JFQL 4Y16D 4LLYB 3EOAA 3RNKA 3TJEH 5I1AA 4QTHB 2Y36H 1NFDE 4LLVB 5C07E 3MV7A 4KZDL 2FH8A 4YHNA 3DXAB 4KU1A 1OGAB 3JV6A 3FFCA 3DSFH 1KF9B 1X5AA 2YPKB 1ACZA 2N56A 1G1YA 4Z77B 4ZTOH 1A1MA 2GTWA 2VDNL 4JAMA 1FCGA 1DL7L 3QAZC 4EN3B 5HDLA 3QXVA 1B0WA 3HE6C 4M48H 4GW4A 3P9MA 3X3GH 1G9MH 3QPXH 4J6RL 3ULSA 3BYYA 1VERA 2ILLA 5EC1A 4M6AA 3QI9C 5FA3B 3TT1L 4LFHG 1TVBB 4L8SC 4ETYA 2QHRH 2AK4B 1S7XB 1I8MA 2V5YA 4M7LH 4OF3A 5F6HJ 2R1WB 4XVUC 1P1ZB 3WIFA 1MIEL 2BSRA 2FSEB 2VZSA 4PJXE 4XPTH 3S88H 1CTOA 2NW3A 4KK5D 1RULH 5GS2H 2FEEL 3LRGA 4LCIL 3M17B 4G8EB 4GKZB 1CS6A 1BQLH 2CIKB 2W0PA 4Z7NE 5JW4R 3ES6A 4QRRA 4PJCF 3RNKB 3EOAB 3IDNA 5CJOL 4QYOA 5I1AB 2AJYL 5CJBA 3MO1A 4PRPE 1NCDL 3MV7B 4G6FD 5E94A 3GSNA 3BPNB 2FX7H 4YHNB 3D5OF 3FFCB 3JV6B 1U8LA 2DTSA 2BP3A 1A1MB 2GTWB 4JAMB 3QHFH 4G9FD 1I1AC 4HQQL 4K2UH 3H3PL 3LQMA 5C0BA 4GW4B 3P9MB 4YHYB 3ULSB 4QXGH 3RHWF 2NXYC 5EC1B 4RDQF 2VL5A 4KRPD 1D5MA 3MNZA 4XB8A 1I8MB 1AKJB 2H8PA 3ARED 5FO9A 1KYOK 1XR8A 3L3DA 2BSRB 3WIFB 3TLRA 2NW3B 4JFFE 4F57L 4M4PA 5EOCH 3CMGA 4Z18A 2J4WL 3VGAB 3ES6B 4QRRB 3IDNB 2WIIA 4QYOB 1MH5A 2VXVL 1A6UH 3MO1B 4N5EC 4APQD 5E94B 4HBCL 3GSNB 5L2KD 3M45A 3JWDC 3D2UD 3THML 4FQXA 1U8LB 4M6NL 4JM2C 3STBA 2WBKA 3CDCA 5BZWA 4EIZC 4YHOH 4LK4A 3HI5L 3RGHA 5C2BL 3UJJH 1Z5LA 1J1XL 1MRDL 5C0BB 1I3VA 2DIBA 1S7QA 4Q9QH 4HHAA 4KVCH 4E42A 5HYJD 5LWYL 2CIIA 3UXFA 4JFED 1PDKA 5C3TA 2AXJA 3MV8A 5TF0A 2VXSH 5IHUL 3WSQH 2NX5A 2VL5B 4YPJA 1D5MB 3MNZB 4MB4A 3MRDA 2ED8A 4OF7A 4PS4H 2H8PB 1G6RH 3NFPA 5DC0A 5FO9B 1TZGL 1XR8B 3L3DB 4OUOA 5DRXA 1WZ1L 1WBZA 1YJDC 1WBXA 3Q1SH 1XCTA 2QSTA 5A2KH 3V7AE 2AJ3A 5H37G 4HULB 1CFNA 2YPLE 4DUXA 2VQ1A 1U8JA 2CH8A 1MJ7H 3I6LE 4KKLC 4LSRH 4P2QD 5J7CC 2DQEH 2DRUA 2WIIB 3KPRD 1MH5B 3EDKA 5FUOL 1RJLA 3OPZL 2VR9A 2V5TA 1X7QA 1U42A 5I18L 2F54D 4DKFH 3EZ8A 1OD7A 3Q6GL 2XY2A 2AQ1A 1X5LA 4FQXB 4LASL 3X3FL 1ZGLP 1VA9A 5FHAH 3MZGB 4IMKA 4LIQH 2CSPA 5BZWB 1L6XA 1ZE3C 1Z5LB 1ZOXA 4WFHE 4YE4H 2H41A 1X5HA 1S7QB 4PJAF 1U8IA 4HHAB 4E42B 2CIIB 4JFDA 2P48B 5LAXA 2OK0L 3KNBA 3MV8B 4G3YH 4P3CH 5SWZD 2NX5B 1XF1A 4H26A 5F97E 4NJAL 1A7QH 2W59A 3EYVA 1KB5H 3MRDB 5DVKA 4KUCD 3T1WA 5DMKA 3NFPB 3EO9L 4Y1AE 5DRXB 4BUHA 3ZYOA 1WBZB 5FK9A 3QULA 3BXNA 1WBXB 2C5DC 2XWBA 1DFBH 1XCTB 3BKMH 1I9RL 3I9GL 4LVEA 1UADC 3MROA 2AJ3B 5IFAL 3MJ8A 4PRID 1CFNB 2VQ1B 3FO2A 1U8JB 4WTWA 1SYVA 1SMOA 3UBXG 4KKBD 5GHWH 1RJLB 3QO1A 1MEXL 1X7QB 3DVGA 4XH2A 3MFFA 2F5AL 4MVBD 2O93L 4G7VH 1NUFA 4XNUH 4PBXA 3V4VL 4G6MH 2I5YL 5D7JA 1L7IH 3V6OE 5DHYA 4PUBH 4HFWA 4ZODA 2OS7A 3WDJA 4ZNCD 1E4WH 4LAQL 3HRZA 3BH9A 1MWAA 4AM0A 2CRMA 4X6CA 3SDCC 1U8IB 3QDJA 1P7HL 5JW5A 3PWNA 4GH7B 4JFDB 5LAXB 3KNBB 3NCCB 4YDLC 2AI0H 1INDL 3BO8A 1GGIH 2APBA 4ZD3H 3KLHD 4OJFH 4H26B 1MAJA 1UWXH 3QUYD 3EIFA 2JIXA 3P0YH 4HSQA 2Y5TA 2D9CA 1MIMH 4R4FL 5DMKB 3QHZH 4K7PY 4QRQA 4Z9KB 5FK9B 3ULVC 3QULB 2HJKA 3BXNB 2XWBB 3ARBA 3AM8A 3MROB 2OXHA 3MJ8B 2GJJA 5EG6C 3AS2A 3G04A 3FO2B 5KVFL 1SYVB 4IOFC 5LCVH 4UT6L 3L1OL 4JB9H 3QO1B 1ZMYA 3DVGB 4XH2B 3WO4B 3MFFB 3GIZL 4X7CC 3LS4H 4M1DL 4NSKA 4LSUL 4RGOL 4G8GA 5BS0D 4TSAH 5D7JB 1CK0L 5DHYB 4HFWB 2FEDD 1MCDA 2CJUL 4OLVH 4E0RA 3HRZB 2F5BL 3LRSA 1IAMA 1MWAB 4AM0B 4X6CB 1F6LL 3QDJB 5JW5B 3PWNB 1AO7E 2VDPH 4YHPA 2AEPH 4FHBD 2GW5A 1Z3GL 4YUEL 3MUY1 3IB4A 3BO8B 2RCSL 5DC4B 1IL1A 2JIXB 3QWOA 1JHKH 3ELAT 2Y5TB 1XGYL 2E3VA 4X9GA 3UPCA 2AXGA 1OAZL 4QRQB 1MFCL 4HLZG 1NGQH 2YD7A 4P9MH 3RHWK 3GJEA 3LMJL 2HJKB 4LVOB 1H8NA 1CFSA 3ARBB 1A6WL 4N90E 4AYFA 2BNRE 1GGBL 5IWLC 3G04B 25C8L 4OCXL 4RX4A 2J88H 3VG9B 5JHDA 1VGEL 3TV3H 1ZSDA 4G43A 1SM3H 5GGSY 1UB5A 7FABL 4HC1A 3CZJA 1PX4A 4MJ2A 4U3HA 4NSKB 4LNVA 3D85B 4G8GB 4DKEL 1ZVHA 2YZ1A 1DTUA 4MZ2A 3CDYA 1N64L 5SV3A 3M8OL 3GI9H 1XH3A 2R39A 3D18A 4OGAD 4E0RB 3LRSB 4MA1B 3L6FA 4JEGB 2R9HC 2H2PC 4PJEA 4RA3A 1ZLWK 2X89A 2C9AA 4EDWL 4YHPB 1CR9L 4FQIH 4GLRI 5I0DA 4M43L 2MOVA 4JGJA 2ZSVA 4D9LL 1IL1B 2Y07L 3QWOB 1VFAA 1FNFA 4XPAH 2PYEA 4B41A 5CZVL 4GSDL 2AXGB 1I1CA 4JKKA 4FZ8L 1HZHL 4DGIL 3GJEB 1CFSB 5DUPL 3PNWA 4DZBA 1KCRL 1CZ8L 5HHOD 2GIYA 1RK0A 5I8KL 5D6DC 1EO5A 1N4XH 1RFDH 4WI2A 5JHDB 1ES0A 3TYGL 5DVOA 1ZSDB 3OL2A 4G43B 4ZFZA 2DD8H 1UB5B 3CXHK 3G08A 1CGXA 1HINL 4J4PA 3IAGC 1G9EA 2PN5A 5JO5A 3CPLA 2UVEA 1X5IA 3KYOA 1XH3B 3D18B 3IFNL 2ZCHH 1XIWD 4BFEA 4L4TE 2JJVA 3L6FB 3QA3A 2J12B 4PJEB 3RUGA 4RGNC 5J89A 5E2WH 2VDQL 3ROOA 4YBQC 1S78D 3RY4A 2ZSVB 1UA6L 1VFAB 2PYEB 3T0EC 4DJMA 1A7RH 4LRIA 3ALXA 4HIXL 4NN6B 4MQ7A 1OQOA 4O58L 4FFZL 5TF1H 1U92A 4S1QL 5I1EL 2BSSA 4I3GA 3PNWB 4DZBB 2WAHA 3U4BH 5IMKB 4JGUA 1RUAL 4N0UE 2FX8H 1RK0B 1RZIA 4K3DL 4MNQE 5MEPA 3B8YA 1ES0B 4X8JA 1N6VA 1CG9A 4U6YA 1YMME 2AQ3A 2NY5L 4ZFZB 4HV8A 2KZ1B 3RVTD 3WJLA 2BHYA 3G08B 2DBLH 5D70H 1YNKH 2NY2C 1IGYA 3LQAH 4MXVF 5JO5B 5FYJH 4P2YA 2YD8A 3CPLB 3WIIL 5HHXH 1V3LA 2H32A 4GRMA 3BZ4A 4D0BA 3VU2A 4R8WH 3KYOB 3F7RA 7CGTA 3VXUD 4Z7WA 5CSZA 1QHOA 3PF2A 4UIKH 3QA3B 3RUGB 1MCFA 1EGJH 3S37L 3VXNA 3ARSA 4AIZA 1DBBL 1BQHA 1I3UA 3ROOB 3P4OA 3TVMD 1J0ZA 2FATL 5E6IA 3T4AA 2Q87A 3B5HA 3GUTA 1MHPL 4JG1H 2CMRL 3QNXA 3SE8H 4ZFOL 4FQJL 1K4CA 4AY0A 4NYLA 4PJCE 1O5DT 3NCYS 4KK9D 4MQ7B 4U49A 3BD4A 1R5IA 1U92B 3CSBA 2BSSB 4I0CC 4JO3H 2K1MA 1OPGL 5J12B 1D9KD 1LQSR 4YHZH 1CLZL 5HBBA 1II4E 4XP4L 2FRGP 4DN4H 4KKBC 1JGDA 4RAHA 4G6KH 1RZIB 5MEPB 2AK1L 1CG9B 4U6YB 5E99H 2BDNL 4HV8B 4MVBC 1JF5A 2IWGA 3SOBL 1HCFX 3KXFE 4F58H 4NQSA 2GFBA 4ODSL 1RURH 3F12A 1IGYB 3WIHA 3DXAD 4S2SA 5FECA 1F11B 2VDML 4Y5YA 4MAYD 2H32B 4GRMB 4EN3D 3QRGL 2IAMC 3BZ4B 4D0BB 3WLWC 1QFUL 1DQML 2HT3C 5EU6A 5CSZB 4Z7WB 4BELD 3VXNB 4AIZB 3LY6A 3T0XA 3WFDL 3ZE2F 1NMAH 4XI5C 3V5DA 3P4OB 5JW4M 2AK4D 2DLGA 2FGWH 3VJ6A 5E6IB 3T4AB 1F4AA 3QEGL 4NRZA 3GUTB 12E8H 3QNXB 4ZUUA 1K4CB 2HFTA 3QJHA 5E2TH 5DTFA 1EA9C 4HJ0D 4NYLB 4R2GD 3HC4H 3H3KA 3GRWA 1R5IB 3TF7C 2MKLC 1YYMH 3LKPA 3CFJA 1XAUA 2NW2A 4NKOA 4RCAA 2OL3A 3H6JA 5CIPH 4OF6A 1JGDB 1YEIL 2DQGH 4JDTL 3TN0A 2LVCA 3TA3D 1GIGL 4ODTL 5LJYH 3ARYA 1S7RA 2JJTC 3NA9H 4NQSB 2GFBB 1NGWA 3B6SA 3F12B 4Q74A 3VXSD 4PTTB 3FFCD 4S2SB 2OP4H 5FECB 1I9IL 4HFUH 1UZ6F 5T1DH 1NUDA 3TIEA 4Y5YB 3RJDA 6CGTA 4KHXH 4NFDA 4K9EL 1UWEL 2I07A 3VE0A 5EU6B 3PQYA 4HWEH 3C6SA 4UT7L 5LGHL 4Q58C 1GOHA 4XX1G 2BNQE 4NC2B 3BIAX 3O2DH 4L5FL 3RAJL 2W9EL 4ODHH 2AKRA 3V5DB 1RK1A 5FUZH 4EBQH 3C8KA 4QTIL 5D2NE 3VJ6B 4LF3A 4HWNA 4NRZB 2V2WA 5TDNB 3V6BR 4ZUUB 1P69B 3QJHB 4JHAL 1EFQA 2IMNA 5GS0C 3EJZC 5DTFB 3TNMA 2CUMA 1XGPA 2F53E 4LHJB 1KBGL 2VLKE 3LKPB 3RIFF 3CFJB 4GRLA 2NW2B 4NKOB 4RBPH 2OL3B 4ZUWA 1NC2A 4M1GL 4XMLH 5I73B 3UAJD 4Q9RH 4UTAH 2VDKL 1VADA 3TN0B 4OZHF 2V17H 1A14H 4J3UA 1S7RB 1P4LA 1MRFH 4KPHL 1NGWB 4U05A 1QFWL 1F02I 3B6SB 4OIIH 4PG9A 5C08A 4PJAE 2J8UF 5F3BA 1YEJL 1FN4A 4KXZI 2DQFA 5TE4H 2D7MA 3TIEB 2DBJA 2E7LC 2BVQA 3QDMA 2WUBL 3A6CH 4PJ7F 3BISA 1WWCA 1DLHA 1Z0NA 2I07B 2R0ZH 3VE0B 2X9WA 4EXPX 1FO0A 3L5XL 3PQYB 4Q6IA 3C6SB 1E6OL 4TUKH 3QWRA 5IBTL 5T3ZL 3DMMD 3VFSA 4HAFA 1LK3H 2KDGA 3W0WE 2OQJA 4NUGH 1GGCH 2AKRB 2ZPKH 1RK1B 2FX9H 2FBJL 5D93C 3C8KB 5TPWL 4LF3B 4PY8J 4P23C 4CUCA 1CXFA 2DI8A 1MJUH 2E7CA 4JY4A 2V2WB 2VZ3A 1DLFL 1DBMH 2CKNA 4G5ZL 1K6QL 4OLUH 3RWHA 2HH0L 1I7RA 3TNMB 5AUMA 1XGPB 5F7YC 3RGVD 4LDLB 4WI3A 3BI9X 3QXWA 1U58A 4GRLB 1MCSA 4ZUWB 2VZTA 3OAUL 1NC2B 2J8HA 3VXME 2I9LA 1KN2L 3H0TA 1VADB 4XVJH 1A7NH 1TTFA 5BO1H 1P4LB 2AJVL 3S3PA 1MREH 2YD9A 4PG9B 5C08B 4FQXD 5F3BB 1FN4B 4LDOB 5IVXF 2DQFB 2Z4QB 5EH1A 2BVQB 3QDMB 3MJ6A 4FTVA 4JM2F 4K8RD 1DLHB 4OD3H 3QB7C 4I77L 2FBOJ 3CK0L 4U0QB 5T1MA 1FO0B 4Q6IB 3MV8D 5TQ2H 3VFSB 2NTSP 2NX5D 5BMFH 2OQJB 5I15H 4RZCA 2ZZUT 1JK8A 1U41A 5LXGH 1HE7A 1B2WH 4WEBL 1I9JH 2A73A 3ZDXF 4JY4B 2DQCL 5E2JA 3SQOH 3INUL 1BIHA 1ZKAA 4MD4A 3RWHB 3UP1A 5KJRL 1I7RB 5AUMB 5DZOA 3U30B 2XG5A 2NY3D 2XZCL 3G6AA 4M5YH 2HJLA 1U58B 3SDAA 1FH5L 1OARH 2I9LB 1QFWI 3JWOL 5DD3H 1I9EA 3TWCH 2GJ6E 1ZANL 3GFUA 1QBML 4GW5A 4JFZH 3G9AB 4F15B 1UM4L 1A7OH 1ND0A 4FG6D 4LBEA 1QRKA 4FTVB 4GRWB 1MRCH 1RJCA 4FFYH 3DIFA 3O6LL 3T2NH 1C1EL 3KAAA 3UJTL 5TJWK 4LPTA 4JHWL 5T1MB 3ARWA 2JJSC 1JYNA 4JFDD 5T3XE 4RAVA 5FYJE 4RZCB 1JK8B 2IF7A 4XPBL 5I1KL 5C9JA 3DUHA 3BEVA 4ODVH 2A73B 1J9CT 1MI5E 2F19L 3LD8B 3MJGX 4MD4B 1W2KT 5E2VH 2KPNA 4X7SL 3F7PC 2RR3A 1D9KC 5I71B 4PJHA 2EXWD 3G6AB 4X6DA 2HJLB 2ZCLL 2YUWA 3SDAB 2H26B 4XP1H 5IFHH 1D5ZA 1JVKA 3HE7C 2WWKO 4HGKC 5DVLA 3EO1A 3W81A 2DJ4A 2AVGA 3HFML 4GW5B 1Q9WA 4OCMC 4ONFH 2O5ZL 3HRPA 5D7JD 4EN3C 2V2TA 2P43B 4OCWH 3L3IA 1ROWA 4WFED 1ND0B 3HMWL 4LBEB 1FE8L 5C09E 2QR0A 3DIFB 2DM2A 1ZT1A 5ISZE 4W4OC 3QDJD 1JNLL 5AWNH 5DMYA 2R69H 1L0QA 4RAVB 2KUTA 2RJMA 1C12A 4WWKA 3TBWA 3ZYJA 2JIXD 1S5HA 1KEGL 5C9JB 4HJGA 5E03A 3BEVB 5GRUL 3UYRH 3BKJH 3JWDH 3T1FA 1N2RA 4S1SL 3MLZL 4JFXA 3BD5A 4V1DE 2BFVL 3VWKD 4KK6D 4M6ML 3ULVF 3L95A 3LZFL 4BZ1L 4PJHB 3GM0A 1H8SA 4OF0A 4OM0L 3L5JA 4X6DB 2BK8A 5EORL 4WW1A 5ITFA 3K4DA 4FQLL 4YDJA 1GAFL 4IOSD 1D5ZB 3SBWA 1JPGA 4P5MA 1BFTA 4EUPA 1EMTL 3BPNC 1WT5A 1ERNA 3EO1B 2DIAA 5J13B 3RIFK 1Q9WB 5ANME 2O5XL 1KXVC 1CFVL 1AY1L 3KG5A 2V2TB 3L3IB 2ARJQ 1N0XL 1KJ2L 1KCUL 1PQZA 2BOCA 2J2ZA 2VWEE 3L5IA 5SWSA 1TMCB 4QNPF 3BT2L 1Z9OA 1Q9LA 5CD3A 2QR0B 3AS1A 2DYPA 1JN6A 3W82A 4POUB 1ZT1B 4BKLA 1T22A 1CLOL 1ZXQA 4ACPA 1FYTD 3TH2T 5FOBA 3UC0L 4JG0L 1OL0A 4OF5A 3RY5A 3C2AL 1C12B 3EYFA 4WWKB 3TBWB 5AYUH 2E9JA 1KJ3L 1S5HB 4J7RA 4HJGB 1UVQA 1EEUA 1PX3A 3T1FB 2MJWA 1N2RB 2Q76A 4KTEH 4JFXB 4JFOA 1TENA 3V52L 1IBGL 1AC0A 1J8HA 4WU7A 3L95B 4UV4L 3VGAC 5ITFB 4WW1B 3NBNA 4MXVE 4YDJB 3VD7A 5CLTA 3FHAA 4NZUL 1F8TH 2IANE 2EYSA 1JPGB 4P5MB 1NCTA 1R5WA 1X5KA 4EUPB 5D1QD 4EIGB 2ZUVA 5H35A 3LKRA 5JZ7D 4KTYA 3W11C 3B43A 4XMPL 3MRPA 1R3HA 2AEWA 2XQBH 1AHWC 1HN1A 1PQZB 4P2RE 2BOCB 5D5MF 5SWSB 5DEGA 5K59F 5FGSA 5F1OB 3JTTA 1Q9LB 5CD3B 35C8L 3CFKA 2DYPB 2VXQH 4A6YL 1JN6B 5KANI 4BKLB 3F7VA 1T22B 4NUJA 5FOBB 2X89D 3U0WL 1U8OA 3EYFB 1KGCD 1IAII 4P4RA 2PYED 1OTTD 4LLMA 1UCBL 4OGYH 1UVQB 1CBVH 1Q0XL 4JPKL 1J5OH 5D7IF 2QSCH 1FPTL 5ICZA 1DBKL 2Q76B 3DBXA 2QQNL 3MSPA 4N1CA 4NNPL 4JFOB 5GZOC 3HZKA 2F15A 1J8HB 4NWTH 4WU7B 4TPRL 4ZFFA 1CGWA 1BM3H 1BJ1H 2FHBA 4R96A 4LCYA 1F5WA 1MCHA 4FXGA 4GXUM 4G8FA 1NEZA 4OLEA 2EYSB 1K85A 4LEXH 4JPWH 1R5WB 3HB3C 4J4PD 5H35B 2NY5C 3LKRB 4FQXC 1SY6H 1JZ7A 2JKXA 4LGRB 1KLUA 3MRPB 2HAZA 1R3HB 2DQHL 3TT3L 1DSFH 4XWGL 3ZE2E 5DEGB 2H2SC 1CD9B 4XP5H 3JTTB 3CFKB 3LB6D 4FP8H 1WZMA 5DK0A 1YECH 3F7VB 3AGVA 1NMCB 3H3BC 3QIBC 4NUJB 5B21A 3PDOA 4WU5A 1U8OB 3UO1L 1U91A 4CN4A 1WTLA 1CL7L 2VZOA 1E4XH 4P4RB 5H37H 4LLMB 3QQ9D 3RVUC 4JQIH 5ICZB 2ZKHH 3C60A 3DBXB 1RY7B 2VJXA 3HZKB 3DYOA 2EC9U 1AGFA 4ZFFB 4CW1A 4DAGL 5AZ2L 1EHXA 4AH2A 1HH6A 4LDEB 4MQXC 4R96B 4LCYB 1UZ6E 4FXGB 3SCMA 3V8CA 4G8FB 1NEZB 4GAGH 4Q0XL 5J3HC 4XHJD 1H3PL 3F7YA 1EEQA 1A0QL 1QLRA 1KLUB 5FKAA 4KI5C 1AQKL 4WGWB 5CP3A 3OKMA 3WXVH 1WAAA 4O5LL 3N9GH 2XTJE 2EEBA 4MJ4A 4RMUA 4O2EA 2BVPA 4KROC 4NO3A 2AAVA 1QA9A 5DK0B 4X4ME 1BJMA 3JTSA 4K3EH 4HZLA 4OI9A 2YN3A 3PDOB 4WU5B 1K8DA 1U91B 5D8JL 4UV7H 3EDFA 1UM5H 5E6ID 2JELH 5JQ6H 2EC8A 5C0RH 1VACA 3S35L 4WENB 1P6FA 4C55A 3Q48A 3IU4H 5ICXA 3C60B 4X80H 1IAOA 4OZHE 1PY9A 4QHLA 4CW1B 4XXDA 2OTWA 4AH2B 3TPKA 1HH6B 1PZ5A 2ZUTA 2BXZA 4XC1H 4YBHA 2J8UE 3SCMB 6FABL 3WO4C 4H1LA 4HS6A 3KPMA 4ALAL 1T6VN 4QF1A 3W9EA 4PJ7E 1AP2A 4I1NB 4OZ4A 3HZVA 5D1XA 1ZHBA 1ZT7A 3F7YB 4CBPA 4TN9A 4N8CH 5HI5C 4Y4FC 1QLRB 4Q9CA 5FKAB 3FRUA 3BZEA 1SEQH 3OKMB 3OWEA 4YPGA 5C71A 4O2EB 1AJ7L 2BVPB 5DURD 4NO3B 1QSFE 1QA9B 2E6JA 2UUDH 1XFPA 4K9EC 3P9WB 3JTSB 4HZLB 3AY4A 3AMLA 1K8DB 2YS4A 5KW9L 3MA9H 4LVHC 5TE6L 2R0KH 4AEHH 4MA8L 2DQTH 3VWJA 2NY6B 4LKCA 1VACB 1RIUH 1JI1A 5JORB 1MQKH 4LVOC 5FKPA 5ICXB 3ARBC 2A6DA 3AM8C 3QPQD 4LOUD 1IAOB 3KYNA 3KJ6H 4I48A 5CD5D 1EV2E 2B5IC 3MBEA 4QHLB 4XVSL 4XXDB 2OTWB 4NGHL 1SBSL 4YDIH 2ED9A 1JHTA 1PZ5B 1OCWH 1YEKH 4Z7OF 4X9FA 1OSPL 2HFGL 5IVXE 3TN0D 1MFEH 4H1LB 4HS6B 4NFCA 3KPMB 4N9GA 4QF1B 4WFGD 3W9EB 1AP2B 2C3WA 4OZ4B 3HZVB 3P30L 5D1XB 2R8SH 5CINH 1ZHBB 1ZT7B 5GS1A 2M26A 3SGKC 1R0AL 2FB4L 3FRUB 3BZEB 2NZ9D 4NHUA 4KHTL 4YPGB 2IBGA 4YHLH 3LEYL 3KR3H 5CLWA 4YJZL 5DD1L 3PQYD 3AAZA 1TVDA 1VESA 3NPSC 5B3JF 1EPFA 3ZDXE 5HI3C 2WK2A 1J1PH 2CKBL 4E41E 3QIUB 1OAKH 2R4SL 3PDGA 5E9DD 3VWJB 5JA9A 2XKUA 2DMCA 3O11A 4LKCB 2UWEA 1VPOL 2EECA 4HPOH 2CD0A 4MJIE 1MFAL 2D0HA 4EJ1C 1YNLL 3VW3L 1ZHNA 1QG3A 5FKPB 2EZ0D 2A6DB 3IKKA 1Y18A 3KYNB 4I48B 4HXBL 1N7MH 1KPRA 4GRLD 3MBEB 5D7SH 3GM8A 1JHTB 3RFZC 1DN0A 3WFCL 4LLWA 2DLIA 3VXQA 2B1AH 2DQUH 3MOBL 5C08D 5GS1B 4YEEA 3O9WA 1F90L 1KN4L 3MMEA 5FYKE 3QDMD 3HMXA 3TFKD 2VMFA 4NHUB 2F58L 1BBDL 4HS3A 5KANG 1O0VA 2HLFC 3BP6A 4HS8L 3N85H 1YEGL 3AAZB 1LILA 3BJ91 3MLYH 5C0CE 5B39A 5DQDH 5F9AC 2XNAA 3WFEH 3CDGA 1MF2L 1JFQH 1MOEA 5EOCJ 5L6YL 3O11B 3ZKND 4KMTL 1FL3A 2UWEB 4NZTH 1JNNL 2AJUL 1ZHNB 3RZCD 3ZMRA 3NACL 5IROA 1Y18B 3NN8A 2VDNH 1KPRB 4Y19A 3QRFM 2VO5A 4U33A 5T5FL 1HQ4A 3TJEL 5GGTH 5F6HI 5C86A 3S3JA 1TJGH 4U7SA 4TSBH 3AS3A 4J6RH 1DN0B 2Y36L 4J4PC 2VIRA 4LLWB 4OZGA 5HGHA 3VXQB 2EDJA 3GMPA 5JDJA 3PWVA 2BERA 4DVRH 3TT1H 3DSFL 4J3OC 3DO3A 3LHPL 3O9WB 4HK3J 4ZTOL 5CMAA 2G5BA 4FTVD 4JE4B 1MIEH 1QRNE 1T80A 1N26A 4M48L 1IEAA 3IDJA 4HS3B 2OZ4L 1G9ML 3BP6B 3QDGE 3QPXL 4LCIH 3MYZA 2VLJE 3IKCA 5B39B 1YMHA 4KAQL 2XNAB 1A5FL 4PRHE 3CDGB 1IE5A 2DM4A 1YN6A 5CJOH 3TH3T 1ACYH 2EO9A 3ULVE 4LRIC 4JM4L 1FL3B 1I3GH 4WUKL 3IXAA 2SEBA 5DA0B 4NZDA 4XNYH 1LO0H 3LPGA 1NCAH 3PV7A 1NCDH 4PP1C 1QQDA 4XVTH 3NN8B 1LDPL 4Y19B 3SDAD 4HQQH 4P5TA 3H3PH 5E8EA 1HQ4B 1U8NA 5D96B 3WJLC 2GKIA 4JY6A 2HT2D 1A9BA 2VIRB 4OZGB 5HGHB 2JB6A 4QNPE 3GMPB 3P73A 1ZV5A 3PWVB 1QACA 5H94A 2X4RA 2FX7L 3VG0L 2OR7A 2C1PA 4U2YA 3RRQA 5GS0H 5CMAB 2G5BB 4WEUD 3CNKA 1FZKA 1IEAB 3IDJB 3SDDA 4KVNH 3IKCB 5AG8A 1YMHB 4QXGL 4TUJA 5A1AA 4NKDA 3TBVA 4WV1A 5JXAH 1YN6B 4GG6B 4NM4H 4Y5XC 2BVTA 2X40A 2XWJA 4HAGA 4F9LA 3QG7L 3O4LD 3EO0A 2BVOA 2SEBB 3IXAB 5SX5H 3X11A 4ESKA 4X6BA 3UROR 1QQDB 2VABA 3THMH 2PW1A 3SKOA 1WFUA 4M6NH 1C5DA 2VKXA 2X1PA 3QP3A 5HHME 3QUXA 3MUJA 2ARWA 3TNNA 4R7NA 4P5TB 5E8EB 4ZPTA 1IGCL 1J1XH 5CSBA 1MRDH 3SGEH 4NOFA 1U8NB 4X9IA 1BZ7A 4ZUTA 3DUSA 3E2HB 4JY6B 1A9BB 4G9FE 5D5ME 5K59E 2JB6B 1A6VL 1EAPA 4F3FA 5IHUH 5DJZA 3B2VH 3P73B 2QEJA 5H94B 1AIFA 1XF3A 2X4RB 3RWIA 4Y5YC 4KRNA 2C1PB 1XGRA 4U3CA 3KPSD 4QWWD 5EBGA 1R5VA 2VQTA 2YD4A 3RZWA 2NQCA 4TVSa 1WZ1H 5IG7A 1FZKB 1DQJA 4U6XB 3SDDB 3ZYZA 4Q9QL 4D3CL 4TUJB 5DYOA 2VXSL 2AABL 4NKDB 5D7IE 3TBVB 4LVNB 3VGBA 4KJPD 4WWKD 2VLRD 2LAAA 4WV1B 3C9NA 2WP3T 5CEZD 4M93B 3ARGA 5FUOH 2XWJB 3OPZH 4PS4L 3V0AC 1G6RL 4CGTA 4LSTL 3EO0B 2BVOB 3HI6L 4O02L 4X6EA 3X11B 1RSFA 5I18H 4X6BB 4MJ6B 1UXSA 3KLSA 3OKYA 1JV5A 5B4MD 5CD5C 2VABB 2PW1B 3SKOB 3X3FH 1C5DB 5HDBF 3FHQA 3K81A 2NY4B 1WC7A 3QUXB 2MQCA 5L2KE 5I73C 3TNNB 1MJ7L 4LSRL 4U6TA 4Y8DC 4ZPTB 1OP5K 1IM9A 2FHCA 2N7BA 4C56E 1BZ7B 1FNEA 2P45B 4ZUTB 1MFNA 3DUSB 3TIDA 2QQLL 2VE6A 3C8DA 3LIZL 1EAPB 4F3FB 2YKLL 5DJZB 4DKFL 1JE6A 4QHMA 1AIFB 1XF3B 3I50H 3RWIB 1JJUA 4HX1A 4NJAH 4OQTH 1XGRB 3K1DA 5FHAL 2LVEA 4JFEE 1R5VB 1T2JA 1XGTA 2DIJA 5SWSD 1T4KA 4WI8A 2DDQL 1ADQA 2UV3A 5LVEA 2DYPD 3EO9H 5IG7B 2OTPA 5KSVA 1JUFA 1DQJB 2VC2H 2IFGA 4XT1C 3UDWA 1I9RH 3I9GH 2Q3ZA 3D39A 4HGWA 3T0EE 1IGMH 5DYOB 5IFAH 3B8SA 2VKWA 3C9NB 3MXVH 1VEMA 1NAML 5SV4A 2OLDA 3ARGB 3GHEL 1MEXH 3QT2A 1OM3L 4I2XA 2F5AH 3S35X 4P2QE 4X6EB 4DFHA 4U2ZA 3VXTA 2YUXA 1UXSB 1JV5B 3KPRE 4BM7A 1J8HD 2I5YH 4P4KD 4DGVH 4MSWA 1WC7B 2YPVL 2F54E 2NY7L 4LAQH 1MCLA 3WDIA 1IM9B 1T0MA 1Y6MR 5IMOB 5CJQL 1FNEB 5HI4D 3TIDB 2VE6B 3BJLA 4ZG1A 4JPVL 2LAGB 1M7XA 4G7VL 3RX7A 1FBIL 3ILQC 4HX1B 4N68A 4G6ML 1Z6JT 3QCVH 3GEWB 4ZOEA 3MXWH 1JCKA 1XGTB 1T4KB 4GXUN 5SWZE 3V4PH 4XBGA 1E4WL 3O8XA 5F44A 2P8MA 4W6XB 1JUFB 4R26L 2L0DA 4UB0L 4M7ZB 1DQTA 1V8HA 3D39B 4HGWB 1SVZA 4OZIA 5L9DH 2P5WA 2BVEA 1GGIL 3AB0B 4ZD3L 3ZKNC 5KVFH 4UT6H 3DETC 1RZKL 3L1OH 3O6FA 1ZA6A 1R6VA 3BN9C 4PRIE 5HYEA 4I2XB 4LU5L 3PDDA 3VXTB 4M1DH 4LSUH 2ZSWA 4RGOH 5GGVL 1OAQH 1CK0H 3QHTC 2NR6C 4D9RD 1G9NC 4MSWB 3SQBA 1NANH 2CJUH 1ZT4A 4NQTA 2AXFA 2OR9L 2ZG1A 4G80A 1U0QA 3QEUA 4UQ2A 5LCVL 4AENA 1T0MB 5CP7A 4YBLC 3HKFA 5JPMA 4JB9L 3RBGA 2YZ8A 2W92A 1Z3GH 4F15C 3LS4L 2RCSH 3HG1A 2E9BA 4HKJA 2VLLA 4ENEC 2BY1A 3I6GA 1F4YH 4TSAL 1XGYH 4NCDA 3P0GB 2YUZA 1MFCH 4XBGB 1YC7A 3O8XB 1A02N 2HVKA 3JUZA 2P8MB 3KYMA 2VITA 5DEZA 4JRYA 4OZFH 1KJVA 2X9XA 5CGMA 5LKNA 2WWKT 1WGOA 5IJVA 1A6WH 4KDTA 1JP5A 3DPBA 4OZIB 1GGBH 2P5WB 1VGEH 3BUTA 3RQ3A 4F80A 3O6FB 1ZA6B 4HUKB 7FABH 1QFHA 3C60D 4EUPG 4Z7OE 2ZSWB 4IS6A 4HUMB 4DKEH 3CZFA 3PWLA 3D48R 3PL6A 3SDAC 1N64H 4LPYA 4U6VL 3M8OH 3QUZA 2AXFB 1V3JA 1WITA 3SCMD 3ET9F 4G80B 4E5XA 4PIRF 4AENB 5CP7B 5F7NC 5JPMB 3BE1H 4EDWH 1CR9H 4D94A 3WN5A 2Q8BL 5SWQA 3BYTA 2QL1A 3HG1B 5F8RC 4HKJB 5TDOA 1N5YH 2VLLB 1BFOA 1M7DA 1CLCA 3V4UH 3I6GB 1YN7A 5B3JE 5CZVH 4GSDH 4M62L 5F9DC 4KI5F 2E7BA 1RZ7H 2IG2L 2OI9B 3OTTA 1ODAA 4HMEA 2HVKB 1G7PA 1UZ8A 3KYMB 1BOGA 2VITB 4JRYB 4DGIH 1KJVB 1CXKA 2KH2B 5C7XL 3UTPD 5IJVB 1KCRH 4AQ1B 1CZ8H 2YRZA 2FLRT 1I85A 1ZGLA 5I8KH 4O2CA 3QUKA 2AV1A 3EFDH 3EYUL 3GSNH 2NY6D 3TYGH 2CK2A 2ICES 4XPAL 1C5BH 1NAKL 2DKUA 4L9LC 2HKHH 2YD1A 1HINH 2EDYA 1BLNA 2X1QA 2X4NA 1WUNT 2YUVA 4GMTL 4IS6B 1SJXA 3CZFB 1OW0A 3MJ9L 2PO6C 3PL6B 2VN4A 3GMRA 3QUZB 1E27A 1N4XL 2IPKA 3SO3B 1RFDL 2MCPH 2DTML 1OP9A 1RV6X 1WQVT 4E5XB 4UINL 1TQBC 3NCFB 1U3ZA 1B4JH 5J13C 5HPOA 1KJMA 3CFDB 3BWUC 1CE1L 5C0AD 3WN5B 2VDQH 5SWQB 4ZOBA 4DN3L 1MAML 4FQPA 4X4XA 1BFOB 1M7DB 3HCVA 5JNYA 1YN7B 4DOHE 1U93A 2IADA 1P4BL 2DS4A 1G7PB 1UZ8B 1BOGB 4X6CF 1FLRL 5I1EH 1HYSC 4WWKC 1F4HA 1ZGLB 4P2OC 1FQ9C 4O2CB 5FGBC 2ITDA 3QUKB 2AV1B 3VWJD 3U83A 2CXGA 2NY5H 2H1PL 2HYMA 2EDBA 5DHVA 1A7RL 5HHOE 1NEZG 4C54A 1LVEA 3TPUA 5B4MC 1BLNB 2X4NB 4P9HL 4FN0A 2OR8A 4B7LA 1R3IL 5TF1L 4ZPVA 1ZA3A 2RAMA 3LDBB 3WIIH 2IEPA 5BOPA 5JOPD 4JVPA 4XNXL 3PHQA 3GMRB 3U2SA 1E27B 3SBWC 3PP3K 2IPKB 2NY0D 1WT5C 3S37H 1KJMB 3LVEA 1DBBH 4JJ5A 1YNKL 3LQAL 4HG4K 5T3XL 4XNQA 5FYJL 2FATH 5ERWA 4X4XB 4PLJD 5E6ZA 5JNYB 3HCVB 2QQKH 1MHPH 3MUZ1 3UJIH 3VGHA 3WE6A 1U93B 2IADB 4M61A 1N8ZA 4FQJH 2AERT 1IFHL 3NCEB 4JFYA 3GB7B 4IRJA 2EYRA 1EGJL 2YXFA 2WZPD 1OPGH 5IEKA 4OD1L 2XZQL 1CLZH 4F7MA 4XP4H 5ICYA 1U3HA 2ITDB 5CBEA 2AK1H 4IIQA 2BDNH 3SE8L 5DHVB 3SOBH 3UMTA 3ECBA 3TPUB 4F7CA 2B1HL 4JQVA 1OF2A 4ZPVB 1QFWM 1ZA3B 2ESVE 4K94L 4JO3L 3OKDA 4KQ4L 1CGUA 4HG4J 3QRGH 3PHQB 4JDZA 1UH4A 3S3SA 3U2SB 1QFUH 2BNUA 5CBAA 1DQMH 4MXQC 4QO1A 5GISL 3W39A 3PWPA 2EICA 4CVZA 4P46A 4H20H 2ENSA 1IT9L 4JJ5B 1FG2A 3VH8A 5I0ZA 4XNQB 3KJ4C 3O6KL 5ERWB 2HTLC 1NC4A 1IM3A 4WFFD 4WTXA 3WE6B 4M61B 1N8ZB 5B38A 5IESH 3QJFA 1LO2L 4JFYB 4U1NA 3RPIA 1NMCC 5A40E 4NBZB 4IRJB 2EYRB 4CMHB 4PJEF 5HJ3A 4BFBD 4X7TA 1UQSA 3WL9A 5IEKB 5BV7B 4XGZA 4HCRA 4F7MB 3V6ZA 5ICYB 1U3HB 1TVHA 5CBEB 3P2TA 4JDTH 4IIQB 3MRNA 4ODTH 3LN4A 2D7OA 3ECBB 4H1LG 4F7CB 3AFLA 1I9IH 1OF2B 2HLAA 4OGXL 3VI4F 3OKDB 1G7MA 3F58H 4JKLA 1YYML 4WIQA 4Y19D 2GQHA 3KHQA 4JDZB 4K9EH 4LRNH 3DXAE 1OGAE 5FGCB 1UWEH 3NZHL 3EJJX 2BNUB 5CBAB 4O9HH 5LGHH 1BF2A 3W39B 3PWPB 4LP5A 4P2CG 2HFFA 4CVZB 5A3ID 4L5FH 3K8KA 4OBRA 4P46B 5F7LB 5HSFA 5F96L 5DFVC 4ODUA 1FG2B 3VH8B 2OP4L 4HFUL 3MRRA 4NQEA 4QTIH 4OCSL 1AR2A 5I9QC 3I3EA 1NC4B 5CUSL 1IM3B 3OJ2C 2WQ8A 5B38B 3GJFA 3ARDC 1JPSH 1QFPA 4JHAH 4PV9A 3H9SD 3QJFB 5LQBL 4U1NB 3RPIB 2AK4E 2Z31D 1J10A 2X42A 1W0VA 2HRPH 5D2LA 5HJ3B 3RUGF 4X7TB 1FP5A 1UQSB 1CIDA 3RX8A 3WL9B 4XGZB 3O2DL 4HUXA 1TZIA 5DO2C 1JYVA 1TNMA 4M1GH 4U31A 3V6ZB 1JHLL 1TVHB 2RB8A 5HDBE 2VDKH 5CZXD 3CLEL 3MRNB 1KEML 1H3WM 4M6OL 4MHHI 3LN4B 1BEYL 4KPHH 1DEEA 1QFWH 2DM3A 4DK6A 3ZO0A 1KOAA 5T3ZD 1YEJH 2HLAB 3KWWA 1G7MB 4Y8AA 3MV7E 2WUBH 2BSED 4KJWD 5DJCA 1CGYA 3BFOA 4NM8L 4N9OB 3FFCE 3O45A 3L5XH 4I5BA 4UTAL 1OP3K 1E6OH 5F21B 1A14L 3BPLC 2HFFB 3GO1L 3VA2C 1ZAGA 1ITBB 4OIIL 4G8IA 4ODUB 4UU9A 5GQBA 3MRRB 4NQEB 4WNQA 3A0OA 5TPWH 3OKNA 1BWMA 1EJ6A 1A7BA 1DLFH 1LEKA 3GJFB 4PV9B 3GMNA 3MRHA 4PGZA 4G5ZH 1K6QH 3AMKA 4Z7WF 2ADGA 1NUNB 2HH0H 3VXRA 1RHFA 1UH2A 1W0VB 4UOJA 1OVZA 2C7UA 1VEOA 2WLYA 5D2LB 4PJIA 2YK1L 3GSUA 1REIA 1PKQA 1ZTXH 5JMOC 4QXTA 4HUXB 1TZIB 3CVHL 4NUGL 3OAUH 3VFRA 2HWZH 1P84J 1U8MA 4XXCC 5D7KD 2P8LA 3VRLF 4HW6A 4XNZB 3SE4C 4QRRE 1KV3A 4B5EA 2AJVH 2X4PA 4PJBA 1DEEB 1Z9LA 4C57C 1L6ZA 3HC0A 1BMGA 3KWWB 2NY4D 3QUXD 4MQSB 1NGZA 3DGGA 5DJCB 3V0VA 2D9QB 3BRDA 4M1CC 5I66A 1IKNA 3O45B 2C3VA 3CK0H 5K9OA 4I5BB 5D1XC 1A7NL 2OYPA 3OKKA 5EA0L 4Z7UA 1ZLVK 4JZOA 5B39G 1MREL 5C0BE 3TYFA 4G8IB 4UU9B 1I8LA 3L5WA 4RNRA 1U3JA 2UZXB 4WNQB 4GBXC 3EUUA 3KVQA 3OKNB 3DRTA 4UNTA 1CDHA 1LEKB 2DQCH 2J3SA 1UKTA 3INUH 3GMNB 3MRHB 2PUQT 3KPQA 4OD3L 5KBNC 2ADGB 1IAIM 1F97A 5ADPL 3VXRB 2C7UB 4PJIB 3GSUB 4XWOD 4RFEA 1T04A 1PKQB 3QIUC 1VHPA 4QXTB 3V95A 3VWJC 2ZG3A 5I15L 5IB4A 3VFRB 5LXGL 2UZYB 3FT4A 3JWOH 2M2DA 2MPAL 2EYTA 1U8MB 1JGUL 3ARGD 3I85A 4OCNC 2DM7A 1UT9A 3NIDF 4FQ1L 3VD9A 1UCTA 2P8LB 3OAYH 1ZANH 3SQOL 1YYLH 1QBMH 3O2VH 2X4PB 4PJBB 2QTEA 3HC0B 3MBEC 2GITA 4MA3A 3IJSA 1NGZB 3DGGB 3DV4A 3V0VB 4XP6L 3MBXL 3O6LH 1C1EH 3UJTH 3PP4H 5I66B 4DCQA 5E8NA 2C3VB 4L8DA 4JHWH 5K9OB 1JNJA 2M8XA 5DD3L 2Z8RA 3OKKB 4Z7UB 3ETBF 3MYJA 4JZOB 5GS1C 4Z5RA 4PLJC 4OLXH 3TYFB 3TZVA 43C9A 4JFZL 1R3KA 3L5WB 4XPBH 4WI7A 5I1KH 4RNRB 3TEUA 1ZLSH 1T89A 2AJSL 4YDKL 3MV8E 3DOSA 3DRTB 3ZSSA 2NX5E 3W9DA 2F19H 3T2NL 3KPQB 3FTGA 4RGMB 4X7SH 5HPMA 1MCWW 4K71C 4HH9A 3MC0A 3SPVA 5FV2A 3D39D 4RFEB 1T04B 4UAOB 5F7KC 1XZ0A 2ZCLH 5HGBA 1GHFL 5IB4B 2EDXA 5FYLH 3VD5A 3FT4B 1UKQA 2EYTB 4XHQA 5C0IA 5IBUB 1KXTB 4XCEA 1X5FA 4M8QA 2H32H 4APQA 3ARRA 2FIKA 3HFMH 5ACMA 4OQ1A 5E2VL 1HHKA 4PB0H 2O5ZH 4PD4J 4ZTPL 2GITB 4MA3B 4OLWH 4PRDA 3IJSB 3HMWH 5CJ8A 3DV4B 1FE8H 5E4IA 1U2HA 2G60L 4HK0A 2XRAH 4DCQB 3GMQA 5HYJA 5E8NB 4OI7A 4L8DB 1JNLH 4KI5E 1C7SA 1JZ4A 1MCPL 2FJFA 4Z5RB 3MYJB 5ESQB 3O9WC 4KRPB 3TZVB 43C9B 1R3KB 4UUJB 4JFDE 1KEGH 1QVOA 5DK3A 3VMPA 1MCKA 4AIOA 1IAIH 3W9DB 3O8XD 4OBSA 4S1SH 3MLZH 3FTGB 5HPMB 1QPPA 2BFVH 1MCOH 4NN7B 1JGEA 4HH9B 4PBWD 5DI8A 2R69L 4WCYL 3LZFH 3SPVB 4BZ1H 4OM0H 1YDPA 2P5WD 1IGTA 1CIUA 2ICWJ 4FQLH 5HGBB 5I1IH 5T33L 1GAFH 4D9QD 4I0PC 5IVZA 3HAEA 1BJ1J 4GUPA 5C0IB 3O6FD 4PYGA 3JWDL 4XCEB 3SE9L 1EMTH 4M8QB 4L8CA 5EO9A 2FO1A 4APQB 5DC9B 2EDQA 4ZSOA 2FIKB 5IROC 1HHKB 1CFVH 4Q97A 1GJIA 2I26N 1N0XH 1L7TH 1KCUH 3H7LA 4PRDB 3NTCL 4Y2DC 5IP4A 4M7JL 5FA4A 5D96C 1JGVL 1KB5A 1HSBA 3S34H 3OHXA 4KJQD 4HK0B 2VAAA 1CLOH 2NXZD 3GMQB 5HYJB 4RFNB 4JG0H 4FA8A 3HHRB 1T1XA 1YEDA 3C2AH 4EZMA 2FJFB 3RWDA 4YK4B 4FQQA 3HG1D 4X6CE 5GGQH 3ULUD 3QDJE 3OJDA 1KJ3H 2E27L 3PHOA 3GRWH 1QVOB 4MDJA 1YJDL 4GRWF 1RJYA 2OL3H 3P3YA 4JRYD 2Y7QA 3V52H 1VDGA 1IBGH 5DI8B 1YDPB 1IGTB 4OFKA 5T5NG 1HDMA 5CZXC 5IVZB 3HAEB 4GUPB 3AUVA 2YR3A 3D3VD 4L8CB 1LK2A 5EO9B 4MHHG 1F3RB 5AZEL 3OXSA 4ZSOB 1EEZA 3E8UL 4YLQT 4XMPH 1CD0A 5IHZA 4HWZA 4M00A 3B5GA 1WSST 3IDYB 3PL6D 2X4OA 4P5TC 3QUZD 3VRJA 3OR7A 5FA4B 1P4IL 5FYKL 35C8H 1KB5B 4KWUA 1HSBB 4G8GE 2K7QA 1F8TL 3OHXB 1TJHL 2VDOL 2VAAB 1Q1JL 2CDFA 3U0WH 1WCBA 4NQDA 3U1SH 1J88A 1T1XB 1YEDB 4RFOH 5GJSH 3RWDB 4TULH 4FQQB 4CU7A 3ESVF 5IKCA 3OJDB 3PHOB 2V2XA 2D4DA 4MDJB 5F7WC 1Q0XH 5BVPL 5IVOA 3SDDC 1FPTH 1RJYB 2J8OA 2DJUA 5C0FA 4OGZA 2Y7QB 4NNPH 2I60L 4LVNC 5HVGB 1QSZA 3E3QE 4TPRH 3P4NA 4WV1C 5F8QC 4M93C 1MFDL 4YGVA 1HDMB 2KBGA 1L0XA 3HTLX 3T4YA 1T03L 1MPAH 2AP2A 4F37F 5DJDA 3MTRA 1J5OL 1LK2B 4GW1A 2QSCL 4PBVC 3OXSB 5JHDE 1EEZB 4U1LA 2WINA 4HZAA 1PG7L 5IHZB 4Z95H 4HWZB 4K3JH 2NY4C 3QFJE 2Q7NA 3X13B 4PJHF 3TT3H 4NWTL 1QNZL 2JK5A 1FO0H 4X6DF 5C0DA 2X4OB 3F6IA 5E2UH 2Y72A 3VRJB 5L8LB 2BJMH 3OR7B 2B7DT 1CF8L 4JPWL 2FJHA 1BHGA 5E56A 2CDFB 3D0LA 3PGCA 1WCBB 4KH2A 4NQDB 3UO1H 4JN1H 2IBBA 1G7JA 4RMWA 1SY6L 5C6WH 5I19L 2V7HA 3B2UD 5GRZA 3QUYB 1CL7H 4PJEE 5IKCB 3JV4A 3C08H 4MNGA 1NFIA 1C16A 2V2XB 5IB2A 1DSFL 5ALCL 3ULVL 3QXAA 1AGBA 3SE3C 1G9NH 5C0FB 2PYEE 3WKML 4W4NA 1TLKA 4NKIH 5J11C 3P4NB 4DAGH 1JTPA 2Y6SC 4Y4HD 4UT9H 3GI8L 1PFCA 2PXYD 3DX7A 4YGVB 3CSYA 5I8EA 3VI4E 4Q0XH 2BOBA 3CX5J 5HHVH 3T4YB 3PJSA 1H3PH 1ZS8A 1RUQL 3QCUL 3VFUA 5DJDB 1NBVL 2JB5H 4GW1B 4OB5L 5CGYD 5DD0L 2ZKHL 2ICCA 2OTUA 4KRLB 2WINB 4U1LB 1XGUA 2ZCKL 3SKNA 5BS0B 1AQKH 2JK5B 5C0DB 4O5LH 1U6AL 5D6CA 3FRPA 4R90L 4GAGL 2FJHB 5DFWH 5HHNA 4WI4A 3D0LB 3PGCB 3FFDA 3BGFB 5D8JH 2NLJA 5FB8A 3AS0A 1G7JB 2V7HB 2FHFA 2I9TA 2W60A 3RUGE 4J3WA 3JV4B 4MNGB 1NFIB 1C16B 5IB2B 3FN0H 3N9GL 2D7NA 3FB8A 3QXAB 4PRNA 2N1KA 2ZOLA 4M7ZC 5IOPA 3H42H 4IJ3C 1AGBB 3PGFL 2YC1A 3WBDA 4YQXL 1U3YA 3GK8L 2VOTA 4HKXA 3DX9A 3MNWA 2A9NL 1UM5L 1U3HD 3MA7A 3DX7B 2JELL 6FABH 3VD3A 3CSYB 5I8EB 4IRSD 3EHBD 2BOBB 5C0RL 4D0CA 3PJSB 1ZS8B 3VFUB 1LHZA 5HDQL 3QIWA 5F88A 4U1KA 5EIQA 4ZOAA 4X80L 5HVFB 2OTUB 4HIJA 1XGUB 3ZT5A 3SKNB 3MLWL 1X44A 4QGYA 5FYLE 4MB5A 1B6DA 3K2UL 1QOKA 1AJ7H 3I6LD 4ZS6C 1TQCC 5D6CB 1VEPA 1XIWA 1AI1L 4EI5C 4LCWA 1DR9A 1KIQA 5IBLC 5HHNB 3QQ4A 4IDJH 4P46D 3FFDB 2DOCA 4JGMA 5KW9H 2NLJB 5FB8B 4Z7WE 2GSGA 5TE6H 1FNHA 3CCHA 4N8CL 3UTSA 2I9TB 2W60B 3IF1A 2F8VA 1NC4D 4PJ8A 2WIMA 3VGEA 1SEQL 3LKOA 2XA8L 3ARFA 2HMID 1V05A 4PRNB 2BY2A 2ZOLB 1D5BA 4RMRA 2FJGA 5IOPB 1L4IA 1INEH 5DD6A 5KTEH 2B8OT 4AEIL 2YC1B 2P5EA 4JN2A 4HKXB 3PE9A 3DX9B 1CGSL 1R24A 4PYHA 3MNWB 5DWUL 1SBSH 3V0WH 1TTUA 4AEHL 3MA7B 2JF1A 2ORBL 5FFLA 5KG9A 1HYRC 1RIUL 4GQ9L 4D0CB 4R4BA 3P30H 3T0VA 1J1OH 5F88B 4U1KB 5ALBH 3RVVD 1IAKA 4HIJB 1R0AH 2FB4H 3IETA 1FFQA 3W2DH 1E6JL 5J1TC 4ODXA 2DN7A 4KHTH 1FIGH 3LEYH 2XKNA 1F58L 1OCWL 2PW2A 3VXUA 1YEKL 2W9DL 4PV8A 4IDLA 1XIWB 5DD1H 1OTSD 1NCCH 4LCWB 1KIQB 1MFEL 1DVFA 1P9MA 4FFWD 1KCVL 2MTPA 4XBEL 2CKBH 5FF6A 5EU6E 2GSGB 4DUVA 1BPVA 3CCHB 3TVMA 3BD3A 2R4SH 2MMXA 1WTGT 3UTSB 4UNVA 3IF1B 4PJ8B 3ZHLA 4B7IA 3LKOB 1VPOH 3ARXA 3ARFB 4YHLL 2MNUA 5FYJU 5KSBA 1YNLH 3VW3H 1D5BB 3KR3L 2FJGB 5DD6B 3QDHA 3NIDE 2P5EB 4JN2B 4XP9H 4HXBH 3TBYA 1UJ3A 1R24B 3VGFA 1J1PL 4GS7B 2FD6L 4JO1L 1YY9D 5EUOA 2H6PA 5KG9B 4HKZA 2RFXA 5SX5K 4R4BB 1F4XL 5B8CA 3MOBH 5JMRA 5EBWA 1F90H 3IETB 3QUZC 4WFGE 5L8KB 1N7ML 4YDVA 4MAYA 1KB9J 3S9DB 4ODXB 3QXUA 2F58H 2XKNB 4F37K 1BBDH 4KTDL 2XICA 3VXUB 2PW2B 4JKPL 4PV8B 4TOYH 4HS8H 1FGNH 1LO5A 3WN5C 5EULV 1DVFB 2B1AL 4QHKI 1X4YA 3RDTA 5I30H 4ELKA 1MF2H 3DX6A 5FF6B 5GRYA 3PQYE 4GAJH 1NBQA 4M03A 3TVMB 5L6YH 1A3QA 2CO7B 5JIPA 5F3HA 4KMTH 1WAAF 5CIPA 1JNNH 5HGDA 5KSBB 2AJUH 2LTQB 3VXRD 4PB9L 4MCZA 2B4CC 3N85L 5GGSA 4Z76A 1I85C 3TBYB 4NC0B 3WFEL 1UJ3B 1W72L 5T5FH 4WUUA 2HT4D 5KS9A 2FNBA 1M1SA 4HGMA 5EUOB 2H6PB 1HCVA 2APWA 2O61A 1HEZA 4ORZC 3TA3A 1IEBA 4HKZB 2RFXB 4NZTL 2YD6A 2EDFA 3OB0K 3VXSA 4OD2A 2ATKA 5EBWB 3LHPH 4Q9BA 3QQ3A 4N90D 3VH8G 5CJ5A 4NBYB 4YDVB 4MAYB 4F7EA 5JXEA 5C08E 4J8RA 1PKOA 5GGTL 5IQ9A 1KCLA 5B38G 1TJGL 2OZ4H 4TSBL 1LO5B 4G6JL 2UY6A 3QDME 1F00I 4H8WL 2EE9A 4KAQH 5IGXL 2XTJC 1A5FH 3RDTB 5IJKA 5GS2D 4ELKB 4DVRL 2V5SA 3DX6B 1IQWL 3HZMA 5L7XH 5IW6A 4HMCA 1EVTC 4XMKH 5F3HB 4JM4H 1RZJC 5GRVL 5CIPB 4WUKH 4QRUA 5KSAC 5HGDB 3CIQA 3NCBB 4R2GB 2RBLA 2VH5L 4WW2A 5GGVY 4MCZB 3DYPA 5GGSB 2Y9RT 5MI0B 4Z76B 1X5XA 3I84A 3LRHA 4O4YL 1DQDH 1LDPH 1Q9OA 3CFIC 3ZHKA 4WUUB 1F2XK 5F7UA 5KS9B 4ETQA 1ACYL 5FUCC 5HYSA 2O61B 5IB3A 1HEZB 4ORGA 3P9LA 2C3HA 1I3GL 1IEBB 1EIBA 3TA3B 1EERB 1LO0L 4XNYL 1NCAL 4P3DA 5E95B 5BRZA 5IR1A 3VG0H 4QT5A 3VXSB 3PGDA 2G2RA 4OD2B 2ATKB 4XVTL 1FVDA 3QQ3B 1NBYA 1JF1A 4MS8C 4F7EB 3OV6A 1LGVA 4AJ0A 4J8RB 5IQ9B 4RMTA 1M05A 1WWBX 3BAEH 4ZUVA 5F9WB 5DVNA 3C09B 1IKFH 4FTVE 4GRWE 2QBWA 3DMMA 4DFIA 4FFVC 3TZVD 3HZMB 1HWGB 4LLQA 1QP1A 5IW6B 5GS0L 1KT2A 3QG7H 1KC5L 3GKWH 3T2OA 2A77L 4IRJC 4CMHC 3EFFA 3T2QA 4WW2B 2NNAA 3RGVA 5BV7C 4KVNL 1K2DA 1DE4A 1Q9OB 5I1GH 3BMVA 5JXAL 5IUSA 1BJ8A 1IGCH 4IIQC 1S9VA 1A1OA 4XTRC 4ETQB 4NM4L 3MLUL 5HYSB 1EDQA 5IB3B 4AZ8A 3S36L 2UWEF 5JIKA 4ORGB 3P9LB 1A6VH 4JQVC 1WCQA 3NGBC 4LPXA 2OJZH 3U36A 2EXYC 4P3DB 5BRZB 5IR1B 4X7DC 4QT5B 2EO1A 3PGDB 2G2RB 3IYLW 3EZJB 1FDLH 1PG7X 5ENWA 4R6UA 1FVDB 1NBYB 2GYSA 1JF1B 5BW7A 4C83A 3Q5TA 3HS0A 3DV6A 1NDMA 5IHLB 2VQUA 1QSVA 1M05B 1YMMD 4ZUVB 4D3CH 3LN5A 1RZGA 2AABH 2BRRL 3R06A 2ERJB 3DMMB 2AV7A 3B2VL 4U1GC 1T5XA 1NFKA 3HE6A 1I4FA 5KSUA 4LLQB 1MLCA 2V7NA 1EHAA 1KT2B 4LSTH 1FYHB 3HI6H 4O02H 3O3AA 2X41A 1RI8A 3EFFB 3U48A 2EKJA 2NNAB 3RGVB 3GZKA 2FR4A 1K2DB 1DE4B 2CR3A 2NYYD 3R0NA 1S9VB 4LP4A 1A1OB 4MMXC 4PJHE 3ALWA 4X6DE 4U1JA 2E7MA 3RVWD 2QQLH 3LIZH 4BYHA 1N5AA 2WV3A 2YKLH 3U36B 1UYWL 2B20A 4X8XA 2CUHA 5ENWB 4JJHA 3UZEA 3FB7A 3IDXL 2DQJL 3IS0X 2JLLA 4C83B 5ACLA 3HS0B 2DDQH 3IFLL 3DV6B 3OZ9H 1J12A 1NDMB 3BRGC 1NQBA 1UH3A 4ZS7L 4OZGF 3LN5B 2COQA 1RZGB 4ODWA 1F4WL 3R06B 4LSPL 3MCKA 2AV7B 3T08A 1T5XB 3TJHC 5MHSD 3I50L 3HE6B 1I4FB 4OQTL 5KSUB 1MLCB 1KXQE 1NAMH 2V7NB 1P7QD 3GHEH 5EPMA 3WKNA 1EZVX 5DT1H 1OM3H 3MACL 5IBUG 3O3AB 3SDXA 4M02A 5CEZE 2VC2L 2ID5A 4R3SA 1SYSA 2NY3B 1IGML 2FR4B 1PEZA 2YPVH 1YEHH 2NY7H 2ZUYA 4GG6F 2WBJC 3MXVL 3S5LA 5EBLA 2VYRE 5CJQH 4XNZC 3RVXD 4U1JB 3D6GA 4XPFL 3GIVA 5JDSA 1JIBA 4JPVH 1N5AB 1FBIH 3GSOA 3K46A 4BQ9A 4PJFA 2W91A 4DGVL 4R4NC 3EJYD 3FB7B 1G0DA 1HWHB 4ODBD 3EBAA 3FO0L 4JRXA 1OTUC 2R0WH 4WDIA 2HTKD 4R26H 4UB0H 2ZP0T 5F9OL 3OB8A 4PRAA 5SWSE 4NQDD 2XN9A 3ARQA 1KTLA 1EBAA 4ODWB 1TXKA 3MCKB 4ZDHA 4IOIA 5ID1A 1HSAA 3I02A 3EYVB 3OMZA 1ZLWH 3QCVL 1RZKH 1T7ZA 3MXWL 4V2CB 5EPMB 5C70A 1ZWIA 1KENH 4Y5VC 1T2QH 4I3SL 3V4PL 2W0FA 4LU5H 2NXYB 1OT2A 3SDXB 4ZXBA 1Z0MA 1WK0A 4HT1H 5GGVH 3VWKA 3B9E