1EMTL

Fab antibody fragment of an c60 antifullerene antibody
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
b'DIQMTQTTSSLSASLGDRVTFSCSASQDISNYLNWYQQKPDGTIKLLIYYTSSLRSGVPSRFSGSGSGTDYSLTINNLEPEDIATYFCQQYSRLPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG ANTIBODY (LIGHT CHAIN)
molecule tags Immune system
publication title X-ray crystal structure of an anti-Buckminsterfullerene antibody fab fragment: biomolecular recognition of C(60).
pubmed doi rcsb
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2000-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1emtL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1emtL01
5EZLA 4NSKB 1CD9B 5GS0L 1NBZB 3CK0H 2DQGH 2X4SB 1MCCA 5L8KB 5EU4B 1LEGB 1UJ3C 5CINL 3CZJA 1NL0L 4FFYH 1QBAA 4X4XB 5DVOA 2Z8SA 1G6RB 3UDWC 4XC1L 5EG6C 3QA3A 7FABL 1CFTA 5I75B 3BUTA 1NGZA 5F8RC 1VPOL 4ZS7L 2NX5A 4YBLB 3MGTB 4RAVA 4QGYA 5L7XL 3QUZC 5EZIL 4P2RD 2R1WA 4Z7OE 1ORQB 3L3JB 1TVBB 4NQEB 3BHBB 5KOVC 2VRAA 4MNGE 3X14A 4X8JA 4HFWB 4JHWH 4RGNB 4GW5A 1SM3L 3LRSB 1J1OL 2BFVL 4X0KB 3SJVE 2PCPA 5I30L 3O6FC 4HIXH 4NUJB 5HYQB 1NGPH 3RQ3A 5DEGA 3B4NA 1RZJC 1KB5B 5L2KB 4GQ9L 5F7YC 4XH2A 1IM9D 3I9GH 3WHE1 1A4KB 4K7FA 5EZJB 2DWEA 3ILQD 2VITA 1Z6JT 4LLVA 5H94A 1BPVA 2UVFA 5F71A 2PW2B 4P9HC 5HVFB 5DRWA 5HD8D 3C08L 4OM0L 2VLJB 1T4KB 3LH2L 4XGZB 5DHYA 1A2YA 1EEYA 1KIRA 2V2WA 4LPWA 4NQDA 5FYLH 2W0LA 1W72B 2XXCB 2HJLB 1YEGH 3EYQC 2OP4L 4JR9H 1EPFA 1DBKH 3BIBX 3CFKB 4Y1AA 4Y19A 3VXUD 5F1NA 2HLAB 3LN4B 1DBBL 2EE6A 3QXDB 5I1CH 1C12B 5J1SC 4HBCH 5T1KB 3FO2A 1FG2A 2UWEA 1JE6A 4F2MB 5GHWL 5IMKB 3AFLA 3TEUA 2WIIA 4JFXA 2HH0L 2A1WH 4WHTA 1CL7H 5DJDB 3WIHH 1D9KB 5FOJA 1QFWL 3V4PL 1FNEB 1CG9A 3TCXA 1P2CB 3O0RL 1LE5A 1J1PL 2FEDD 3CX2A 1PG7W 2D7OA 4B50A 1ZLUK 25C8L 3VXMD 3QUZB 1MHCB 3MOBH 1ZA6A 1MH5B 4O02L 3BXNA 4OFVA 3TBTA 2CRZA 4LEOA 1ZT4A 5GGTA 4XCCL 3ZE0F 3V5KB 4WFED 5DDHA 2MPAL 2D0GA 4J4PD 1F97A 2AJVH 4XMKL 2PW1A 4NCDA 4GG6F 4M5ZH 2OK0H 1RZGB 4YHPA 2XG5A 3FQWB 3GMPB 4QLRA 4ZG1A 3ARBB 3BP6B 1ZA3B 5ERWB 4PS4L 4ONHA 2H32B 1XF4B 2IANA 3ZDYE 2YXFA 1FLRH 1EFXB 2WQ8A 4X9IA 2DL9A 1KB9J 2OZ4L 4HAFA 4Y2DC 4TSAL 5BVPH 3OJVC 1KNOB 2EC8A 4FNLH 1A3RL 2W38A 4OZIE 4QTHB 1Q94B 1QLRB 3F12A 3WV0A 1JGEB 5J12C 1BVZA 2Y23A 2CK2A 1BEYL 5E2WL 4WY7H 1URLA 3ZO0A 1XIWD 1I9RH 5HVGB 4UT9H 3QEQA 4PJXE 2UY6A 4P2RB 1LDPH 4JJ5B 1I85A 4OZGB 4WFGE 2E6JA 4JGJA 4XP9H 1CU4H 2D4FA 3BQUA 4C83B 4NHUB 2VN4A 1G7HB 1Z9SA 5FCUH 4WI7A 3O4LA 3O8XB 2PXYD 3TH4T 2JTDA 2JJSC 3RIFK 5ID1A 4I48B 4EI5C 4OQ1A 1U3HB 3LSOA 1U6AH 4U33A 3DXAD 2GW5A 2MOVA 5C09D 5F7MC 3N1GC 1JHKL 2L4OA 4DGYH 4NQEA 4LDOB 2KQMA 4QRPA 3I2CL 3WO4B 3ULVE 4M7ZC 1GGYA 4PRNA 1M71B 3OKDA 1N6VA 4S1RL 1RMFL 3BP5B 5LBSH 3B6SA 3BKCL 4I3RL 4E41D 4KXZI 3K4ZA 5EBLA 4EUPA 3RWIA 5FK9B 1TXKA 1NLDH 3EBAA 4FQJL 4CADA 4JZNA 5SWSD 4Q0XH 3DRQB 4IMKA 5CJ5A 2E7HA 2W60A 1WCBB 4ZD3L 1A0QL 4FN0A 2HVJB 3QYCA 5EU6A 5KVFH 3MODL 4KJQD 5HPMB 3KLHD 5C0DA 3WS3A 3J7HA 1IBGL 3BRDA 2NY2C 5F3BB 4ZAKC 2E8YA 4JN1H 1HEZB 1IGYB 3VXUA 3G5XA 2VDQL 3MLXL 5D71L 3STZA 4Y16C 2ESVB 1IAII 3ZYIA 5J11B 5FDWA 1OCWH 2GHWB 3EW3B 3GHBL 2BP3A 4ELME 2EDLA 4PJXB 2XG4A 3QULA 4YO0A 2AXGB 1VCAA 3WFDL 5FHBL 5HI5D 4XC1H 4I0PD 2GITA 3SKNB 3ECBB 4CU7A 1N59A 4HJGA 5LCVL 4EUPG 4N0CC 2F74B 2G9HA 1T7ZA 5ALBH 1F3JB 3MJ9A 3SDCB 4I0KA 1QPXA 4G8IA 4X99B 3T0EA 3TH3T 4JQVA 4DN4L 4G9FB 4NOBA 2J8OA 3LKQA 4FFVC 1XGTA 1I9IL 1RURL 4KRLB 3NTCH 2VXSH 3MXVH 4BYHA 3OKLA 3JV5A 3RL1B 1U3HC 3L5WA 3MOQA 4YUEH 4H8WL 3ROOB 3E6HA 3IB4A 1QSFE 1DEDA 1BIIA 5F1IA 5DK0B 4DKFL 5I76A 1AC0A 3TT3H 4JHZA 4ENED 3MLTA 3TZVD 1GSMA 3SE9H 4MAYC 2VH5H 3LV3B 1KCUH 4P59L 1RUAH 1LNUB 1EBPA 4WV1B 4YXHL 3KPLA 3NCYS 1CVSC 1GOHA 5FYLL 1S7VA 4HUMB 4PGDA 2IMNA 2UVEA 1IE5A 5L2KA 4Q9RH 3F65A 4OM1L 1MAMH 4ZXBA 2Y1VA 4S1SH 4KKBC 1DQMH 3NZ8B 2FD6H 4IRJA 4ODBD 2R8SL 1U93B 5HD8C 1GXEA 4LGPB 3F12B 3NFNA 2MWCA 1BQLL 1OAUL 2BC4B 1MJJB 3MRNA 5F7UA 1YJDC 3CFCL 1NEZG 1MVUB 1I4FB 5E24E 4JDZA 4TPRL 2NY5L 2JIXA 2IALA 1LE9A 1KLFA 3HI5H 1U42A 5I15L 1I9EA 2FHBA 4M4PA 2CK0L 4LNRB 2HTKD 2R4SH 1UZ6F 3KYAA 1EEZA 2ATPB 1RV6X 2VZVA 1HXMA 2FBJL 1ZHLA 4PJAB 4PFEA 3CDGA 4WEBL 3PQYB 1F8TL 3ARYA 1IGML 12E8H 4XPTH 3RKDC 2BNRE 3WNOA 4ETQA 1SJHB 3VWKC 2BOCB 4NIKB 2XXMB 2H26A 4F7EB 3AAZA 3UPAA 4RMTA 4JPKH 4MA1B 5D4QA 1AO7E 1ZE3C 3NCYP 1KPRB 5B21A 1JZ7A 3WLWC 2ZKHL 3KS0H 5HVHB 3IJYB 5JDJA 1CICD 2AABH 2GSIB 1MHCA 5ESQB 3BN3B 1J10A 2C3HA 5MEOA 2JK5A 2A6JA 2VDMH 4U3XA 32C2B 2VL4A 1BVLA 1EVUA 1WK0A 1C8PA 5D70H 1J7VR 4X6BA 1Q9LA 2Q86B 2VB5A 4PLOB 3VWJC 3JWOH 3SE8L 3VA2C 4HV8A 3SY0A 2R0WH 4QHUB 2QR0B 1XGTB 1V3MA 2EDXA 3C6SA 2EIBA 2J6EA 4UINL 2VDKL 2IFGA 3FHAA 1INQA 5TH2A 1CXKA 3MRLA 1NGYB 3ROOA 1R3JB 2IGFL 1ZMYA 2Q20A 3GKWH 4NT6B 4FQXB 3SJVB 2IMMA 3WFCL 1XIWC 2YPLA 4ZO8A 1XF2B 4OI7A 3WFZA 3FQUA 1FZJA 1G84A 1KJVA 3X11B 3PHQB 5KJRL 1JHKH 2VJXA 1IM3A 4XNQB 1DVFB 5B4MD 5FHAL 5KS9F 5DD0H 3VXNB 3QXAB 4K71C 3S36L 3TWCH 1G7IB 2MJWA 4NJAH 3FFDB 3W9DB 1UZ8B 4PRPB 3BKYL 2DI9A 1MHPL 1DEEB 3IDYC 3KPQA 2FB4H 4X6CA 2QHLA 4GG6B 4G6AD 5F6HJ 4KUZL 3WL9B 3CFDA 4Y4KC 3KDMB 1LK3H 1F42A 4G8FA 2YWZA 3EYUH 4YGVB 3SGDI 4OV6F 1QR1A 1AR2A 1F4YL 1SYSB 2R0KH 3OX8A 5DFWH 5L88H 4ZUWA 1T3FB 2C1OB 3WJJC 3BN9D 4TOYH 5IJVA 4XWGL 3S37H 3M8OL 3RWJB 5I6XB 3ARTA 1I9JL 5F89A 5D1QD 2PO6B 1LO0H 3H3BC 1HSBB 3WHXA 1BAFL 3L3GA 3BMVA 5B3NA 4ZO9A 2OTWA 1A4JA 2NXYD 5FGCE 1FC2D 4NO5A 5TQ2H 3FQTB 3K8LA 5DD5L 4Y4KD 3TF7C 4XPHL 2YUVA 2KZ1B 1D6VH 4P4RA 2XN9D 4D9RD 2DYPD 2H26B 2ZSVA 4F7EA 3MUJA 1V3LA 1Q9WA 1IGFL 1YJDH 5FF6A 1FYTD 4FS0A 1TQCB 2PYEE 5GIRB 3PGCB 3EOAA 2IH3A 1M7IB 4OZFB 4UU9A 2XWTA 3QRGL 3NIDF 1YMMA 4M1CD 2J2ZA 3WNNA 2ARJQ 3MXVL 1JV5B 2X89D 3LIZH 5JUEL 4OCLC 3ZTNH 2IFFH 4KV5F 2EDDA 1CZ8H 2VZ3A 1YEEL 2KZWA 1YPZE 4P3CL 1JHLL 1FO0A 1EMTH 1F6AA 6FABL 2GY7B 5CHNA 4PTUA 5JHLL 4G42A 3VFPB 2VL5A 3HN3A 4X6BB 4GG6E 5E99H 4Z8FL 5DSCA 3I75B 1KEGL 3O81A 2WUCL 1NCNA 1KCUL 1P7QB 2HTLC 4ZMAT 1GGTA 1MFBL 1IJ9A 4NZUH 1N5YH 5IK3A 5D7IA 2OQJB 5FYJL 4TULH 1M6OB 3QO1A 3AROA 5T5FH 3UTTA 4GKZA 1IQWL 1JPSH 3E8UH 3FB6B 3ARGB 1ACZA 1H3PH 2FX8L 4PD4J 2LE9A 1L9MA 5T1MB 1EXUB 1Z0MA 2ICEB 3K7UA 2D7QA 5IQ7H 3R06A 2F74A 1GOGA 1DSFH 1K5NB 2NYYD 4JREB 5CIPB 4ZODA 5HGHA 5I1IL 5ITBH 1EEUA 1E28A 1MCIA 2QADD 4MNQD 4M7LH 1NPUA 1IGTB 5J7CC 2NXYC 3RZWA 3UC0L 2DI8A 4AMKH 1YN7B 4HJJL 2DTMH 4MB4A 3PV6A 5F1KC 3IJHB 3AY4A 4PUBL 1P84J 4PRPA 1BBJB 5EOTB 4Y16B 2GT9B 4L4TB 4P46B 5F9AC 4BFIB 4NQVB 5BJTA 4KMQA 4V1DA 1JPFA 1YUHA 4I5BA 1X7QB 2BVEA 3FRUB 1NGQH 4WDIB 3RU8H 5DJ2A 4OJFH 1BZ7B 3L3KB 3ES6A 4HT1H 5D7JC 1GPOH 4RGMB 4LLAA 4NRXB 2G2RA 4WUUE 4I4WB 5D1ZD 2Q8BH 5HI5C 1ES0B 2E7MA 3ARBC 3FFCE 3K2UH 4XP6L 1EIBA 4HUWA 4JQIH 2J88L 2Y4SA 3N1FC 5C92A 1PZ5B 2EEBA 4Q9QL 1IEBB 4GKNB 1LO5B 3W9DA 3VXRB 5D7KD 2XPGB 3MLWH 4E0RA 5B22A 3CVHA 3GMLA 4H1LB 3MLRL 4E42B 1UXSB 1N8ZA 4KJWC 1Q1JH 4MXWL 2DBJA 1VFAA 1Y6NR 5C0CE 4OV5B 3UJTL 3WDHA 1O7VA 1WLHA 3GIZL 1JWSB 1MFNA 1IM9B 4OCRL 4OLVL 3BDYL 4FMFA 1S7UA 3AU1B 5E2UH 2EDNA 2NR6D 1FP5A 1ZLVK 4JHAL 3QQ4B 5FECB 4NUJA 2GSIA 2IG2L 3MCLH 2IADB 2CIKA 3PWUA 4UT6L 4APQC 5DMIH 4F9LC 2FHFA 2DQUH 5FUCE 4F80A 3O3BB 1L6XA 4JFQB 5KSAB 4ODUA 4JFED 3TPKA 2FYYB 3UTSE 5JHDA 1MWAB 1IQDB 5TF0A 1JNHA 1FO0B 4ONGH 3IU4H 3VFSA 4HJ0D 1CDGA 3BZFA 2PW2A 4JO1L 1H3UA 3MZGB 3VH8A 4NQSB 3EO9L 1CE6A 3GGWB 4CVXA 3EJZC 1P7QA 4FTVB 1QR4A 3HNTL 3GMOA 2Y36H 4PJ9C 3NH7L 1WFNA 4OZIF 1L7TH 4FFWC 1S9VA 3NA4A 5EC1B 3MMEB 5C0BD 4OZFA 4UU9B 3ZL4H 5J1TC 1XH3B 4FZ8H 2RQ8A 3QFDA 4HWUA 1K8DB 3T0AA 4GKOA 1OOAA 5CCKH 2AV7A 4MX7B 4YHNB 5D7LB 2JJTC 3D18B 4NO0A 3FT3A 4YWGL 4CDHA 2HA1A 4RMVA 4GLRH 3MUGB 5DJCB 3HE6B 3RY5A 1FZOB 4YK4B 1LEIA 2BNQA 1D5MA 4OZGE 1E28B 1E4XH 4N0FA 2ZNXA 1MHEB 1I7RA 3HZYA 4J3OC 1MJUL 2BFVH 3WUWB 2VISB 3SDYH 5KSVA 5E8OB 3B9EA 1CXFA 2EH7L 4JZJB 2EXWC 2HRPH 4W4NA 3PNWB 1BREA 3VGAB 4KROC 4JM2D 2HT4C 1ZAGA 5GGSB 1Z5LA 4RFNB 4EIZC 3DVNA 3B9KB 2FJGB 2H3NB 4WGVB 5CLWA 3QQ3A 4LPXA 3VCLB 3OAYK 3D39E 4I1NB 4UV4L 1QR1B 1XGYL 4OD3L 4MCZB 3T0XA 1YZZA 1BX2B 1TNMA 4BSJA 2WWMD 1GC1H 3HPJB 4LLWB 4NNYB 5E1AB 1U91B 2GTWA 4CAGA 5BRZA 3TV3H 4OGXH 5CZXC 3O41A 2V2XB 1UACL 3I9GL 1HYSC 3BQUB 4C83A 4KFZC 2HFTA 1E4XI 2DQIH 3H9ZA 1UM5H 1Z0NA 1DBBH 3O3EA 2V5MA 3LPFA 3W9EB 4Q2ZA 2I07B 5E8EA 1BJ8A 4PJCE 5E8PA 3GNMH 3BRFA 3IFLL 2MSPA 3GHEH 4Z7WB 1EGJL 1YA5A 4DZBA 5JHLH 2CUMA 4Y4HD 4FQXC 1F13A 1KXQE 5LWYL 2XN9E 1YN6A 5T1LB 4K94C 5FYKU 4KK6C 1UEMA 2HWZH 3GMQA 3DUSA 1NMAH 1JWSA 3FHQA 1U58B 4RWYL 3P9MB 3TJEL 1CICC 4P9ML 4XHJC 2QKIB 1X44A 4TULL 5ETUA 4ZNEA 1U8IB 2Z91B 3E8UL 4M8VA 3LRHA 3V95A 2Y9RT 3QPXL 3WHXB 4W68A 3VXRA 3MOBL 3HFML 2E9JA 3L6FA 4HWBL 4M7JH 3OF6D 2DLFH 5CILH 3GEWB 4NQCD 4PJAE 5DJYA 3PGDB 1VSCA 2AK4A 3H7LA 1LVEA 1W0YT 4JM2C 1B6DA 5DRWB 3S96B 4B53A 4N8VB 4KHXL 5J89A 5LGJB 3GSXB 3WFEH 4U49A 3PDDA 2AI0L 3L9RB 4A2LA 3VXUB 3QUZA 4MD4B 1F3DJ 4XBPB 1MFDH 1OAQL 25C8H 5B8CC 1JMZA 3MNZB 4O02H 3TM6A 1KUMA 2I24N 1QFPA 2ITCA 3VRJA 3UTPE 5DMYA 3T1WA 3C2SA 2HVKB 1HINL 4LKXA 5E8NA 1PSKL 5ALCH 5DJXB 3O6FA 4EUPH 5CIPA 5HGHB 3Q5YA 4NBZB 4PJCA 5D1QC 3VD3A 1R3IL 5F6IC 3DECA 3MRQA 5HPMA 2HG5A 4V2CB 1T89C 2OZ4H 4TSAH 5GGRA 1JK8B 3NIFF 1E6JL 4F3FA 2EKJA 1HHJA 1RD6A 3EJZD 3WFHA 4NPYA 2XA3A 1S9VB 5CMAA 5BRZE 1RJLA 5IVXE 5KVEL 4NC1C 4P4KA 4KUCF 3S88H 1VFBB 5D72H 1FFQA 5CS7A 4LCWB 4UZGA 1FCCA 1HYRC 3QPQD 5GISH 2Z0BA 1V7NH 4RGOL 1EO8H 4U1LA 4NKOA 2JJWA 4O4YH 5A16A 2YUWA 2DQCL 5IB4A 4YXLH 4O2FB 1ZGLB 4V1DD 3IDJA 3X3GL 2AEQL 4BSVB 4I0PB 3HLAA 3FB8B 3MRJB 4D0DA 1ZEAL 2H6PB 3EJJX 5E2UL 3V5HA 1QVOA 3BOVA 4S1RH 3DX7A 1AHWC 4KUCD 1S7RA 3C6LD 3RY4A 2LFGA 5DUMH 3TH2T 1U8KA 4OUUA 5AD0B 4OD1L 1N8ZB 1TCRB 5EA0H 1I1YA 4D0CB 2A38A 2QSCH 2CKBL 4KK5D 1CVRA 3FTGB 3QIUB 1Q0YH 1UKSA 2B5IB 4HH8A 2XWJA 3WS6C 4AEIH 4F15B 5I76B 2ZCLL 4N9GB 2CJUH 4JRXA 4JN1L 3FN3A 3T2NH 1PD6A 5DFVD 3MV8B 4PG9B 5CZVH 4H20H 1AR1D 1PZ5A 5HGBB 2BCKB 1T2QL 2W9DH 3OBAA 4FFWD 5EU5B 2DLHA 4HMDA 1ADQL 3B8YA 1EX0A 2DS4A 4AJ0A 3BPLB 3IDYB 3HA0A 1KG0B 1UXSA 3MYJA 3KXFD 4OSUL 2JB5H 1IAIH 1EGJA 4X7EC 5FKPB 4OD2B 1KN4L 1KEML 5CJQH 5KSBE 4UAOC 3UTSA 2ED8A 4XWOD 1FORL 1S7XB 2PXYB 5GJSH 2G60L 3TZVA 2VDQH 3ARDC 4K8RC 2NY3B 1WC7A 4HKXA 1RK0B 4DN4H 1S9WB 2BRRH 4X9BA 3OTTA 2B1HL 2OJZH 3AXLB 3O4OC 4LAQL 4FOMA 3GSVB 3WFDH 4LSTL 1PY9A 3GK8H 1ZHNA 5IHZB 4W81A 1WWBX 1RY7B 4BH7B 2GITB 4Z77B 4P5MA 3VMOA 2R1YA 4QYOA 1ZHLB 3DI2B 1UH3A 2CRMA 1JMXA 2AV1B 4LCWD 4PV9B 2HVJA 2X4QA 3TCLA 5IVZA 2KKQA 5EO0A 4R0LC 3MFGB 2OM5A 2VAAA 4GBXC 2D7TL 5DC0A 4RFEB 3VFGL 2JJSA 3GMOB 4D9QD 5AWNH 4MYWB 4EI5A 2ZOLA 3EFFB 1QFHA 1EFXD 1ZVSA 3QSKB 4H5SB 3RZCC 3VGEA 5C0GB 1TZIB 5B3JE 3SKMA 4Q9RL 3SCMB 2ORBH 4LRIA 2F5BL 2DQIL 1MLCB 4MQXC 1BFVH 3RY6C 5DQDH 4KDWA 5EIIA 1G9MC 5E6ZA 1R3JA 4OUOA 4TUKL 3FT4B 2CDEB 3LEVH 1G0XA 2CPCA 5KSAC 3T3PF 4G9DA 4HLZH 2XQYG 1BOGB 5C0ND 1UA6H 4V1DE 2J5LC 3INUH 5F3HA 3FB8A 1QLFB 3MRJA 4MXVF 4OF8A 1JVKA 4EDWH 3EYSH 2X40A 4LLDA 4PBXA 1ACYL 2OTUA 1ZOXA 1R5IA 4MDJB 4D2NA 4L4VD 1J18A 4WIQA 2X41A 4KHTL 4NQXB 4RIRA 4MDIB 4NGHH 3DUUA 2XACC 3GSQB 3GBML 4KVNH 5DQJA 2DWDB 4KI1A 5GGTL 4WEBH 1U8LB 1WZ1H 1UB5B 1CFNB 3MGTA 1N6QH 4LF3B 4YE4H 1ZS8A 3BUYA 1A6ZB 4HIIB 2IPUK 5IJKA 2FGWH 1FNSL 2WLZA 4YH6A 2HRLA 5EU7C 2NY3C 3RUGE 3BRGC 3CC5A 1UKTA 2XKSA 3LKNA 5KBNC 1OT2A 4LVNB 2MCPL 4ALAL 1O0VA 4PJ8C 1IKFH 4CJ0A 4WUKL 5EO9A 1VENA 2F53D 4M62L 1AKJA 3C9NB 1WFOA 3O4LD 2RFXB 3CVIH 1RI8A 1I3VA 3CD4A 3L3DA 3VGAC 4ONFH 3QBTB 4D94A 4GG6A 4DN3H 2W65B 5IBTH 4RFNC 3AB0B 1I1YB 2NX5B 2FO1A 2XNAA 3RGVD 3QIBC 4MXVE 3ZHLA 2B4CC 4U6TA 5ABDE 3FZUC 1UM6L 2Q3ZA 5GS2D 5GZOC 4H8WC 3ZYOA 3DMMA 1FE8H 4X98A 5L2KD 5T3ZD 5GSVA 2R69L 1Q0XH 1R3LA 1NCTA 2AJUH 4K9EC 5INDB 4MD4A 4ZUTB 3RNKA 4OLUH 1E6JH 1EEZB 4JKWA 2PYEA 4HX1B 1MJ8H 2N7AA 4MA8H 1AGBB 3BAEH 1A14H 4DGIH 2EC9U 3EHBC 2DLGA 4F2MA 2CKBB 5EZJA 1A6PA 4IM8A 4A6YB 4MJ5A 5KJRH 3LDBC 4RQQB 3DHJA 4GXUN 1D9KA 1MVFA 2DMCA 4S0TD 4ZFGH 5DD0L 3C6SB 3S36H 2FEEL 5F9WC 4DVBA 2GJJA 4GH7B 4U7SA 2R2BA 5EC2B 4BH7A 3CFKA 4Y1AB 3V0WH 3N0PB 1CLYH 5D7LD 2M1KA 3GIVA 3GRWH 1I1AD 2QSCL 5DRXB 4HS3B 3DGCR 2XT1B 3IU3B 1XGPA 3THML 1A6AA 3WEXB 3DJ9A 4X6CE 5FGBA 2E5EA 4J23A 3S37L 1XF3B 2NY2B 4PJ8B 4PLKC 3T2NL 1HILA 4M1DH 4Z7QF 4ZAKB 3RVVC 3HC0A 4AM0A 5EWIH 5CINH 5GGRB 4FQQA 4S2SA 1JZ4A 4NJ9L 3IDNB 1T5WA 1A6VL 4PLJD 4J1UA 3MRIA 2J8UA 4RA0C 3VE0A 1FZMB 3WSQH 3H3PH 1KYOK 1L9NA 4I18A 5IVOA 5IWLA 4XXDA 3MACH 5IB5B 3OQ3B 1FBIL 4HIHA 3PHSA 4UOJA 1YYLL 2XTLA 1KN4H 4XWGH 2C5DC 2H1PL 4PV8A 3LRSA 4FQCL 1ZHBA 3OKEB 1A1MA 3ZHDA 3P4NA 3ULSA 2BRRL 2ENSA 1EAPB 3ARDD 3VW3L 4WO4D 3NIGF 3LQMA 1R3HB 2E6PA 2OR9H 2EC9T 1YPZB 3OGOE 1JPTH 2IFFL 3QA3B 2DKSA 4XCNB 3BO8A 3P0YL 3RNQB 1B0GA 2DWDA 4KVCL 5E2TL 3TO2B 2A6KB 5DFTA 1EUUA 3SGKC 1WBZA 3FTGA 3TESA 4LASL 2ADIB 4MS8C 3HS0A 3CU1A 2D7MA 3MRKA 3AMLA 4L8SB 3VFGH 4L8DA 2YPKB 3KYKL 1R24B 1RAMA 4K3EL 1L0QA 1HCVA 5BV7L 5JW3H 1CI5A 2VZUA 5EO1B 5T5FL 4F37K 3Q5OA 5T1KA 4L4JA 5GS0C 5I1CL 4L4VA 3ZE2F 1AO7A 1IARB 2V5TA 5H37G 4Z76B 4IIQB 3C8KA 2HMIC 5T3ZL 4HWZB 1F6AB 5F7DB 2BNRA 4XXCC 2KBGA 5E99L 4Z8FH 4JFXB 4KMTH 5I1HH 2BHYA 4CGTA 4OI9A 3RKPA 1P1ZB 3E6FB 4NKMA 5F7FA 5JQHC 1Y6KR 5JORA 1JZ3A 4FTVA 1NMBH 4H25A 4E9LA 5A1AA 1FSKB 2PUQT 3RGVC 4AMKL 5FO9B 4X98B 3EOAB 5HGDB 4U1KA 1KCSL 3GSVA 1NEZA 3JVGC 2HT2C 3NCJH 4DVRH 1CXEA 2F5AH 4FQHB 5CP7B 2FX9H 1TENA 2X70B 3QFJA 4PY8J 5CEYA 2IQAA 1MFCH 4NRYB 1O5DT 1BJMA 1N6QL 2FWOB 4WUUD 3BH9B 5H8DA 4ISVA 1C5BH 1MIEH 1WCBA 5FEBA 4WU7A 1KT2B 5C0AE 1BECA 3CH1B 1JGVL 3MUHL 4N0FB 4R7DB 3ZKMD 2GKIA 3QUXB 1YY9D 5TF1L 3TYGL 3CLFH 3KPOA 3QIWB 4XBGB 3B5HA 1H3TA 2ICWI 1KIQA 4ALAH 5BJTB 5JLZA 4ZQKB 3S3JA 2ILLA 4WUKH 3BEVA 1NBVL 3CFJB 1D5IH 1KXTB 2B2XH 5JA8B 1MELA 3DVNB 4PB0L 3CVIL 1BJ1H 3L95A 1EXUA 1K9TA 1TPXC 1BEYH 5E2WH 4NO0B 1A47A 4LL9A 1JWMA 4HUWB 4PJIE 5MEQA 3P4MA 4S1DC 1BM3L 3SDCA 2H8PA 4I4WA 3CFBA 3OR7A 4HK0A 4OLVH 1I1FB 4ONHB 2R69H 5TDNA 5ICYB 4GMTL 1F02I 1T0NB 3KWWA 5FA3B 3PV6B 4AH2A 2AJ3A 4M6ML 4N5ED 1B9ZA 5AAMA 1RZKC 4EIGB 4NQXA 3F8UB 4Y5YB 2YC1B 3VDAA 2GJ6B 4I48A 3MLUH 2VXQH 1V8HA 3CCHA 5J6HA 1MHHB 1UB5A 3C60D 4QRPB 1F4AA 1QPPA 2ZUYA 5AUMA 5IFJB 1AKJD 5D2NC 3LB6C 1M71A 4LSPH 4DZBB 3B9AA 2X4NB 4CW1A 3DBXB 3HMXH 3ARQA 3BH8B 3D0LA 5IMLA 4U2YA 2I60H 3L7EB 4XZUB 4RISH 1KJMB 1OW0C 3K8KA 4KGLA 4X4ZA 3VGGA 2IADA 3PWUB 3BD4A 3BKCH 2J5LB 3QUKB 4LHQB 5ADOL 1WUNT 3G6JF 2F9BT 2XKNB 1KENH 4KTYA 4JZNB 4PJ9D 1U8IA 3VXUE 4PGEA 2V2XA 1J0YA 1KYOJ 3PL6B 2VC2L 4NM8H 1A0QH 3MGAA 1BQHB 4KQ4H 4M9PA 1CE6B 3GGWA 1JYWA 2SEBB 1A02N 4G8GB 3GRWL 4EI6A 1AIFA 2IAMD 2BHUA 2I9TA 1RZIA 1MCDA 1U8HB 2DF3A 2APTA 3RDTB 5I71B 5HJ3B 1VFMA 2BVTA 1HEZA 5KSBB 4DZ8A 2VLME 1KCLA 1KIPB 1D5XB 4JG0H 2P46B 1OCWL 1MCSA 3WIFB 2WBKA 2FCBA 2CLVA 3MXWL 3U9UB 4M8QA 2YD2A 2VWEC 3WN5C 4MX7A 5DF0A 4GRLD 5ISZE 2VABB 4HKZB 4WO4A 5T3XE 1S7QA 1YECH 1MI5B 1TPXB 1WV7T 4OLYL 4QRPE 1DUYA 1MNUL 1IMHC 2Z4QA 3ARBA 4NQEE 4FQXD 3SJVD 5DK3A 1HNFA 3P9LA 4BZ2H 5FAAA 3BSZH 3QCTL 5LGHH 4LLQB 4QWWC 3S34H 3MR9A 1FJ1A 2EXWD 4F58H 5K9QI 5GJTL 5TDPA 1T1XA 4R4FH 3NOIA 2PXYC 3QHZH 4GXVL 4FQLH 5F88A 5DHXB 5M95B 3LKSA 1JZ6A 1WAAE 2EYRA 4ODTL 1MCWM 3H9SE 2N56A 3FT2B 4GW1B 4QO1A 4PJXA 2IQ9L 3QEQE 2W59A 5BV7C 2V9TA 5D2NB 4F8TA 1CGWA 4XPGL 4ZUUB 5ID0B 4X4YB 2VLRA 3IFLH 3VXQB 4PJBB 3GHEL 4ODWB 2ZCKL 4QHMA 4XTRC 3UTSD 1EHAA 2BNRD 3DVFA 4P23A 4OZIA 4WCYH 1DQLH 5I8EA 5F93C 4R7DA 1HIMH 1UACH 4PJIB 4U1GB 4HD9A 2YMXH 3VXSB 1MAML 3VXNA 4S2SB 1Y18A 1N64H 5C6PB 1VADB 2IANE 4YZFE 2NY6B 3RHWK 2R2HB 3NA9L 5DHVB 3QXTA 2Z93B 1AXTL 4Z7UF 3ZTJH 3WIHA 4JFYA 3UXFA 4Z7UA 2BNQD 1BQLH 4JY6B 2YBRB 4DW2L 2UUDK 4DCQB 1U8JA 5GXBB 1YN6B 4MHHI 2BXZA 2NW2B 2ESVE 3LCYA 5D5MF 4Y4FA 4CW1B 5JMRA 1PX3A 1SMAA 3N85L 3KPSD 1RJYA 2WAHA 3GSRB 4RCAA 2M8XA 3BKML 3TGXA 2H8PB 2HFGH 2AI0H 2DQHH 3DURA 2H6PA 3PDOB 4FZEL 3QAZB 1FIEA 4WTXA 2AJ3B 1XR8A 5MHSD 4N8VG 5I16B 3UTZB 2WWKT 2F54A 4Y5VA 4LCIL 1ETZB 5F7WC 5HHOB 3R1GH 4MLIA 1F2QA 4GQPH 1UVQA 1N5AA 4POUB 4KHXH 1ORQA 1JGLL 2A9NL 1X5AA 1U8NB 2VKXA 5D7JB 3LB6D 3T8XB 4Y1AE 3L9RA 4CMMA 1BGXH 1OAKH 2P4AB 3ZMRA 1YPZF 1QBMH 1RK0A 4M6OL 2O5YL 3NN8A 2DQJL 4R4NC 1JGUL 1W0VB 2ITCB 5IHLB 2P5WD 3FN0L 3X3FL 4PJFE 4Q58C 3QEQD 4G6JL 4X9FA 3UO1L 2A6JB 2AGJH 4M48H 3DOSA 3I02B 4PB0H 5FYKD 5D72L 4O51A 3H9SD 4F7CA 2HTLD 1KG0A 5I66B 4R7NB 4DKEH 1XCQB 1GZQA 2J3SA 5IEKB 4JGUA 5IW1B 1K3ZA 4UDUB 4QRSB 3AB0C 2R29H 4ORGB 5ILTL 3DROA 3JWOL 3O45A 3SE8H 2VQ1B 4HKJB 4R96B 1G6RL 5TDOB 4ZO6A 1WIOA 2J8UF 3HC3H 1OARL 3WFBH 3BD5A 4QHUA 1ZVYA 3HI1A 3TO4D 1S5IH 5JW4M 3CFJA 4FQXA 3SJVA 2HT4D 2B8OT 3MRLB 5DUML 1NDMB 1PYWA 1DQJB 1G0YR 2X70A 2K7QA 3TJHC 1V7NL 2V7HB 3W0WB 1F11B 2Z4QB 4GRLC 1I1RA 3FO2B 2VE6B 4M7LT 1MF2H 1PEZA 3R0MA 1ZEAH 3VXPA 4Z7WF 4TSBL 4LLMB 1DVFA 4D9LH 4EXKA 2Q86A 2CJUL 4NQUA 3FMGH 3UJJL 5HHQA 3ZE1E 2X09A 1KSRA 5C0JB 4Z78B 3RHWF 3O9WB 1UH4A 4M7ZB 2GJZA 1I8LC 1KF9B 1OF2A 2ZOLB 2Z92A 2NMSA 4H20L 5DC4B 1B90A 8FABA 4OFPA 5IROC 1M6OA 4JM2A 4OUUB 3HCVA 3L3IA 4F7TB 3O6KL 3CCHB 5J6HB 3EJYD 3M45A 4JANA 1WSST 1OP5H 4X7DC 2QHRH 5E5UB 5IKCB 1H8OA 4ZUUA 3TJHD 4AEIL 4JFDE 3IDIA 3ZZ1A 4C56B 1HYSD 1P53A 1KEMH 5CJQL 2VZTA 4I0PA 2F19L 4OZHA 5JO5B 2WQRA 3MOAH 2UZXB 4HK0B 4Z7VF 5CZVL 2D3VA 4LSQL 1T1YB 4MB5A 4OLEA 3V7MA 4Y2OA 1CS6A 2VDNL 3N1QC 5JOPE 3IXTB 3TIDB 3DX7B 1T21B 2X9YA 1FVCB 1ADQH 3WXVH 3IJHA 3PXHA 1TETH 1PG7L 4LCUB 3K2MC 4R90H 5C09B 3C2AH 3DXAB 4QRRA 4JFFD 4NCC1 4IOFC 5DD5H 4OLYH 4HXBL 1E4JA 3RKDD 1FNHA 1MCPH 1WCQA 5IGXH 4BZ2L 4YGVA 3GI9H 4WRLA 1ZXQA 1INDL 3EDKA 5CJOL 2BOBA 3S98A 4P9HH 3KLDA 4J3XA 2VLJE 5GJTH 5J0BA 4LAQH 3WIFA 1IKNA 1I8MA 3CSPA 2IAMA 1JCKA 4MCYB 5GGSY 3L3HB 4LSTH 5CJXA 4K3GA 1RSFA 5D1ZB 5DD6B 1I1AB 3QISA 3ESVF 2FJFA 1VERA 1X9QA 5SX4I 4Y1AD 5E03A 4FXKB 1AI1L 1BFVL 3MUY1 5DQDL 2A83A 3ULUE 4UI2A 3EDJA 4GBXD 2BX5A 3OKKA 4O2CB 2KL6A 5GGQH 5FKPA 4JPVH 2AK4D 2VL5B 3QDAA 4PJEE 1AHWA 4P46D 3VFUA 1V5JA 3S3SA 4L4TD 3R4DA 1G7QB 4W4OA 4J3SA 4KK6D 5DK2B 4M3JA 5BVJA 1VEMA 5C0GA 4QXTA 3CUPB 4JPWL 4TSCH 1J87A 1JNJA 1FN4B 5FECA 1G9ML 1YNTA 1AGBA 4MJ6B 1IM3B 4KPHL 5F9JA 2FYYA 1OPGH 5F3HB 1WEJH 4PV9A 5KSBF 1IGIH 1FAIL 1IC4H 2ADJB 4PJDE 4GSDH 3ARGD 4UILL 1HI6B 1SMOA 4J6RL 1B88A 2VDLH 5C6TL 4K9EL 2NR6C 4HK3N 2FATL 5D7JD 4QHNB 5FKAA 4I13B 5K59F 3I3EA 1VADA 4LDEB 3N9GL 2IBBA 4Q97A 5J6GB 5EPMA 2NX5D 2Z92B 3ARZA 3PWVA 4QTHA 4XVSH 5IVXF 4WW2A 5CBEA 1LD9A 4ZTOH 1QQDA 3LEXA 1QRND 5GGTH 5C8JA 3RWEB 2NY4D 4TTGA 3TZVC 5C08A 5ACLA 4N5UA 3VCLA 2V17L 4EVNB 3SDAD 2APVA 4B0MM 1N59B 1BQUA 1DJSA 2X05A 3SOBL 5TPWH 1E6OL 4YHPB 3HRZB 2PO6A 4PJDA 1A7RH 3NCMA 1KB5A 1I1AC 3MRDA 2C1PA 4G5ZH 4TTDC 4WFEE 3P4NB 3KR3L 4KV5E 2O5YH 5IESL 2ZUUA 3NFPA 2R15A 2X4OB 1XFPA 1L7IL 4D0BB 2XPGA 2W65A 4ONFL 5EOTA 1JJUA 4G80B 5J3HD 4OF5A 2VR5A 3U0TB 3ISWA 2DQDH 1RHFA 4NFDA 2LU7A 4F37F 4B41A 1A7OH 4DGIL 2HP4A 4I18B 4QF1B 4TNWK 4X6DE 4IDJL 3BGFC 3M17A 4GRMB 2BDNH 4PLKD 5SX5H 4NO2B 4LQFH 2NY7H 4LRIC 4PJHB 4A2MA 3MV9B 1DFBH 4Z5RB 4IBLT 5KVDL 5FYLE 3GZKA 4PREA 3B6SB 4MQ7B 1TJHH 4MAYD 5KSAA 2KQNA 4L8BA 4LLYA 4MA8L 4Q9CA 2J1KA 2IAND 2NY1C 1FYHB 2NXZD 4G42B 3O2VH 4NZDA 1RIHH 2XKUA 3IU4L 4NC0B 5MEND 4TUOB 5E08L 4WHCA 4P2YA 5E8PB 2VLJA 3DTXA 5D2LA 1J05B 2N1KA 4GKZB 3U7WL 5T1LA 3NH7H 1NGXA 3Q2CA 5I1JL 3GMQB 3QFDB 1XR9B 1BIHA 3MJ7B 3MV8E 2FO4B 1FN4A 5F97E 3KJ4B 4QOKE 3HZVA 1DQJA 4ZOBA 1CLYL 5H35B 5E8DH 3UPRA 3WNKA 3P77B 1XZ0B 5EUOB 3NCCB 2BVPA 3SDXB 3MNWA 4R8WL 3FFCB 3O6FB 1D5BB 1Z9LA 3WIIL 3V4UL 1MHEA 1YEJH 1XF4A 4HAGA 1E4XL 4OZHE 1VFUA 3W39A 4G9FA 2R4RH 3IVKA 5DURB 2J6EL 3MLPA 3PNWA 4J8RA 4XP1H 4XAWH 4JFDA 5DK2A 3KPOB 4NJ9H 3TBVB 2ZPKH 2VDNH 3EJYC 3NGBC 4YBLC 3OKLB 4NPYB 3O4OB 4CNIA 3H3PL 1KCKA 5J1AB 2DQEL 3L3KA 4ZYKB 2FJGA 1JPTL 2H3NA 3MACL 4HIHB 4WFHE 2EH8H 1N0XH 1AD9A 3DMMC 1TQCC 5GS1A 1TDQA 3L95B 5IV2A 4MCZA 5E2TH 3MV7D 3CZFB 4N1EA 5DJXA 3IU3A 3W2DL 5DRZB 5L6YH 4F33B 5HDQL 4KQ3H 1CGUA 3MRDB 1NJ9A 1K4DA 5TGBB 1EAPA 2NY5C 1GGUA 3M07A 4MJID 5DLMH 1FO0H 3LSOB 4KI5D 5F9DC 3RNQA 3C60B 4P5TA 1AQKL 3CK0L 4KVCH 5C0AD 4JZOA 4O00A 5IB5A 1HQ4A 5TQ0L 2BSRA 4FFYL 4LKCB 1GC1C 4Y5XC 4OF6A 5A3IC 3MV7E 2UZIL 3KNBA 3HKFA 4O58L 1FNLA 4ZS7H 2DKUA 1T1ZB 4Y0GA 5L7XH 1I7UA 1AXSA 2APFA 4WWKB 4RA3A 4UTAL 4LCCC 4MNHB 1DTUA 2C3XA 4J3UA 3H0TA 3WKNA 5FO8B 1TJIL 3WE6B 4RMWA 4GAJH 2Z91A 3FB5A 4FHBD 2VSCA 1SM3H 4LCUA 5DJYB 4DVRL 4JFOA 4PJFA 3U2SA 4ELKA 1PW3A 2A83B 4ZOAA 3OJDA 3U83A 1MRCL 2ZG2A 4AIZA 2Q7YA 5AD0A 3U4EA 3P4LA 4KPHH 3U30C 1M05B 2QL1A 1OPGL 2DJSA 5DUPL 4Z7VB 3ROLB 4EI6B 4P57A 3BI9X 4LMQI 4ZS6D 3QIUA 1Q9OA 3HS0B 1JWUA 4KZDL 1GIGH 5GRUH 3IJYA 5HHPA 3W5NA 3RWDB 1MCEA 3HG1D 5AZEH 4LVHC 4P49A 4XNMA 3T3ME 3JV6B 4YHLL 1U8QB 1HQRB 4UTBH 3TLRA 2F54E 4LKXB 3QAZC 1NBVH 1IAMA 4G6KL 1AO7B 2LQRA 3VRJB 1LEIB 3KLAA 4J2XA 4LP5A 2WWKO 4F9PC 4BQ8A 3BZDA 5EOCJ 1C5BL 1MIEL 4A6YL 5I75C 4HGWA 1FPTL 1JGVH 2X1PA 5I18H 5EO0B 1CL7I 3UBXB 2DD8L 4PJ7E 5DMJB 2ESVA 1E27B 4IRJC 4L8CA 2YXMA 3VD5A 3TVMA 4BFEA 3V6OE 4MQXD 1HH9A 1NCAH 2NY4B 3KR3H 4Z7UE 4EI5B 2HH0H 3OB8A 4X7TA 4PTTA 4YNYB 1CL7L 2IH3B 1QQDB 3B2VL 4P0DA 1C08A 1L7IH 4XNXL 1JL8A 2NYYC 3QNYB 3QG7L 2VLKE 1TVHB 5GISL 2VLKD 3OB0K 5MI0B 2FX7H 3VRLF 2FWOA 3K4AA 3BPNC 4HF5H 3P9LB 3HRZA 1MCBA 4FG6C 4TVPD 3JUYA 3EZ8A 2BDNL 1JTTA 2OL3H 4JY4A 5DUBB 2VLRE 4YXKH 2D03H 4WFFD 1IAIM 3VFTA 1UM4H 3TBVA 3KPRD 1A6UL 3UZVB 1N7ML 4OCWL 1TZIA 2X1QA 3SKOA 5EA0L 4RIRB 2IBZY 3I50H 2VC2H 5JPMB 1EHLL 2Z93A 5ICZA 3H9SA 5AG9A 5I1DA 1WAAA 1RPQA 1ZANH 1CFNA 1FLTX 5JIKA 3VXOA 3FQUB 3T04D 1U2CA 1Z3GH 4Y8DC 2W9EL 4JVUA 4IRSB 2OR8A 4U6VH 4PGDB 3U7WH 1QA9A 2ZCHH 1WWAX 3U4AA 4PRHE 3RVWD 4XTRD 3LDBB 3MBEA 3HZKA 4MSWA 4XH2B 2G5BA 1T2QH 2W9DL 4OIAA 3WE6A 4PJ7B 4TYUA 1U93A 3UAJC 3VXSA 5I1GH 3NIFE 1XR8B 2YWYA 4LVEA 5ISZA 4D3CL 3L1OH 1LDPL 4ELMF 3V6FA 3BDBA 3AREB 2HJKA 2CIIA 3QH3B 3GSWA 4R26L 1C5DA 1CDUA 2XZCL 3LS4L 4JZOB 1CCZA 4NBYB 3V4UH 1IAKB 1KB9K 5GJSL 2XWBB 5I0DA 2ICCA 2NW2A 1MREL 1NGXB 1QSZA 5H37H 1EERB 5IBUB 4MAUL 3FO1A 3MXWH 5INDA 2P5WE 4MVBC 2IBGA 3MBXH 4ZUTA 1YEFL 4P3DA 4ODSL 3RX8A 3OR6B 5DEGB 1F90L 3D25B 3M1BB 4P5MB 5KAQF 4YX2H 2DQEH 1P4BL 3L3GB 5E95B 1SJVA 3FAWA 4JRYE 4L3CA 3MYJB 4NZTL 1RIVH 3VGFA 3F7QA 3ZE1F 2DLEA 4IRSD 2WV3A 2OI9B 4PJDF 4GXUM 4R4FL 2I5YH 3OHXA 2K7PA 4AEHH 4Y4FD 5L0QC 2VIRA 4O2EB 4PRHB 5B39A 1AJ7H 3VI4E 2PETA 4L8CB 1A7PL 1S7WB 3UYRH 2ORBL 2ATKA 5D2NA 1ZTXH 1DBJL 3V5DA 3ARSA 3AUVA 3WJJA 3O9WD 2Y06L 3ARRA 3MLXH 4NKDA 5D71H 5KS9E 4UIMB 3MNWB 2YZ8A 1BZ9B 2EDJA 3ZDZF 3A6OA 1PLGL 3MR9B 4KXZH 4PJIA 1FRGH 2EDFA 3WEXA 3NACH 3RVXD 1A6TB 2E3VA 2Y07L 2HFGL 3RGVB 4B5EA 3MRHA 2PTVA 2WSKA 4XP5H 5C0EB 3F7VB 3SDXF 4M9OA 3G6JB 1UZ6E 4RNRA 3DUUB 2YBRA 2VXVL 3RX5A 1FFOB 3K81A 2XWJB 1LO3H 2Z8RA 4AL8L 3LKPB 3VG0H 2YEZA 1DDHA 3MRBA 1RURH 4JY6A 2P43B 2H2PC 1RIUH 3F7YA 1TIUA 1NAMB 4C54A 4GS7C 5DUPH 3VGBA 1JI2A 3I85A 1MY7A 1A8JH 1ZGLP 4JFFA 5C0AA 5E5MB 1R6VA 5JXEC 1JF1A 4KZDH 1H5BC 2GTZB 3FONB 1H3VA 4M43L 4BKLA 4M7KH 1MRDL 3MNVB 5DTFA 3ILPB 4HS6B 3QFJE 1U9KA 5F6HI 1TVDA 4TQEL 2RFXA 3R8QA 3OV6A 1GHFL 3VWKB 1HHGA 4BFIA 1N6UA 2X7LA 5IBTL 3MYZA 3NABH 4OCYL 4X8JB 3QHTC 4KKAD 4FTVE 1CLCA 1LWRA 4H26A 5I73C 1WWCA 4QOKB 5ILTH 1Q38A 4NNPL 1Q0XL 1MEXH 5CGMA 2X89A 4LSDA 4L8DB 4OLUL 2D9QB 1CD1A 1NCAL 3OKMA 1C5CH 5BRZB 1HQRA 1QKZL 1FGVH 1Q9KA 1QBLL 1KJ2H 3KYMA 2A6IB 4G6JH 2GFBA 3RAJL 4L4VE 5EBWB 2VLMD 1EJOH 2X4RB 1KC5L 5I15H 4KKLD 4MWFA 4UDUA 2BSSB 2E7CA 4L3CB 2XTJC 1J8HD 1XCQA 4H1LG 1ZT7B 4NQSA 4CVXB 1QOKA 2FX7L 3TBYA 3ULVH 4Z7VA 4LEXH 3H7BA 4OFYA 1FNFA 4PBVC 3RVWC 1P7QD 1JYVA 1ND0A 1JTPA 4NYLB 2OMNA 4Y19B 4WWKC 1ZT4B 2D0FA 2GYSA 1FH5H 2F15A 1A9BB 1OWRM 1B4JH 2D31A 1AH1A 3GIVB 2R2BB 3RBGA 3FJTA 3VXSD 4MJIB 3ULUL 5CEXB 2YPLD 4LRNL 1F11A 3MGOA 1KTRL 4L3EA 5HXMA 4ZTPL 4G8GE 3HG1A 4N90D 3MTRA 2BNRB 1T0PB 3RRQA 4LLUB 5IK3B 4K55A 2FRGP 1G7QA 3PP4H 5DUBA 1KPUA 1T80A 1UCBL 5EWIL 2FIKB 5DVNA 2GJZB 5DJ8B 3GMMB 1QBBA 4XNZB 4QHLA 1NBYA 1QSED 2VXUH 4Y4KB 3S5LG 3E6HB 3CUPA 2A9MH 2O61B 2A77H 2J8UE 4LIQL 5F72S 3GMNA 4M3KB 5BXFB 4RNRB 4D3CH 1KBGH 3BPOB 4LSRH 1TVHA 3ZDYF 3S4SA 3AM8C 1GGIH 1UEYA 3KPSE 4NKDB 2BVQB 1R5VB 3LS4H 2KUTA 5SWZB 1NAMA 3HPJA 2AJZB 4YIQA 3LS5L 5DEFB 2F19H 3MLYH 5ITFB 4IRSA 4WU5B 5CJOH 2OSLB 5F9OL 4F9LA 1OAXH 4C56D 1G7HA 4UAOB 2VISA 5KSVB 3WXVL 1WTGT 3MBXL 3AS2A 5I1AB 1Q94A 3QR2A 4PJGA 5DEZA 1EV2E 4QRRB 2A6KA 4ZOEA 3KLHC 1B6UA 2XV6B 5DJ2B 1P4BH 1RJLB 2B1AL 3MRGB 2YKLH 5IGXL 3KPRB 4DTGL 2V9QA 1P69B 1JZ2A 3A6BH 1INDH 2XI9A 4JQXA 1CLOH 4LPCA 1UYWL 4RX4A 2IAMB 3RNKB 4HLJA 4XCEB 5EBMA 4XHJD 5C0IB 4JJHA 5FK9A 5EZIH 4K2UH 1AJ7L 5BV7H 3N06B 3MJ8A 5KOMC 1MWAL 4C4KT 3FL7A 4F8QA 2JJTA 5I1KL 3TBSB 3MRFB 5IEHB 4U1GC 3L6FB 2AKRB 3I6GA 4FABH 1BD2D 1AI1H 4LPUA 1R3HA 1NCCH 4W6XB 3BZFB 5T3ZH 3SDDB 2Y06H 1DE4A 1DVFC 1X5LA 2VUOA 2VYRE 3GSWB 2V5YA 5GGUA 2QQKL 3PGDA 4Q2ZB 5LKNA 3MV9D 2O93L 4XGZA 1X6LA 3HC4H 4N0UA 5DXWA 5CD5D 3SDAA 2EIZA 4ZXBD 1GYAA 1KTDA 1P7KA 4U1KB 2VTFA 3SO5A 3QQ4A 5TQ2L 1CQYA 1KCSH 4EUPB 1OQOA 3MV9E 5HGDA 1WBYB 3ARVA 4BELD 4NYLA 4U3CA 3K0WA 3HR6A 2HT3C 3BP4A 5I30H 2CLZA 4K3JL 2AXJA 4WVRA 1IC7L 1A7BA 1LO3L 5I74C 4AL8H 5KZCB 3OAZH 3L3OA 5I8CA 3TFKD 2A6DB 1DN0B 5F7DA 1BQHA 3MLSL 2AVGA 4LVNC 3QEUB 1JNNL 1AE6H 3HG1B 5JQ6L 4XP4H 3MUZ1 1EAJA 2DLIA 3SOBH 5AYQA 3RUGA 3TYGH 2B5IC 4QRQA 1S9XB 2NW3A 4HBCL 1MAKA 4Y2DB 1JHLH 1P4LA 1X4XA 2DYPA 3P11H 3C08H 5F88B 2OX5A 1H3XA 5GS3A 3TBTB 3K8MA 1YNKH 3BEVB 1TQBC 4LQ1A 3V5DB 3PQYD 4IS6A 4PJXF 5E9DB 5DJ6A 2YEZB 1T2XA 3LPGA 5EUKB 1RZGA 1JN6A 4MJIA 1CR9H 1EDQA 3QUXD 4MZ2A 1IKNC 2DIBA 2ID5A 2RCSH 4JCMA 2IAMC 4YHKL 1FAKT 3OKEA 1ZHBB 2GJ6E 1IQWH 1JPSL 4Z7WE 3H42H 1I7RB 3HZYB 4Q6YA 1A7RL 2EYSB 4ETYA 5DRZA 4RMQA 5KZCD 4GMTH 4D9RE 1I8IB 2QSTA 3C6LC 3RI5F 5IQ7L 1BQHG 5T1LD 4S0SD 3BW9B 3WIHL 4XCNA 1JHTA 4MLSA 3NFPB 5EPMB 4F3FB 1Z9MA 5ITBL 1NGZB 3KYOB 3HNVL 4IMLB 2EO9A 5DJ0A 1KTKE 3LEYL 4FXGB 5JW5A 4ACPA 3CPLB 1R5WA 3W0WE 3X14B 3I6LE 5E08H 3RIAF 5I8OL 4Y4HC 1E0OB 4OLWH 1UB6B 2I60L 4Z95H 3GB7B 4LNRA 3DO7A 2X4PA 1I3UA 3O2DH 5TE7L 4D8PB 1X4YA 2C1PB 3JV0A 1XT5A 2VQTA 4WI4A 4Z76A 3CDGB 5I9QB 5HGBA 4RZCA 1QFWI 2WBJB 3IRPX 1BFSA 4JREC 1S8DB 2OTUB 3FRPA 1QLEL 1BOYA 1UZ8A 4MA7L 1FLRL 4YK4C 4IRZL 5DR5L 2J88H 4DFHA 5F9WB 3NAAL 4OCSH 2Q7YB 3GSQA 4XP9L 4IHOA 4TNWF 4PRNB 4AZ8A 3KDMA 1Q9WB 4H25B 1NC4D 4Z7UB 3U4BH 3D6GA 2R56H 4CN1A 1T6WA 1H9VA 5FCUL 3C5ZD 2R4RL 3OAYH 3WD5L 2XRAH 5KSBA 4JG0L 3MO1A 2AJXH 5IW6B 1U8PA 1S7SA 1ZHNB 5IHZA 3GSOA 4XAWL 1AXSB 1A1NA 2OJEB 3LVEA 43C9B 4I3SL 3BP4B 3QDJE 5IHUL 5INCB 3PV7A 4H88H 5HYFA 3SDDA 3MRQB 3WIIH 1V7MH 2A6DA 5LGHL 4I3RH 1QO3B 2K9UA 4L3AA 4X5WB 3ARFA 3MCKB 1XGRB 1JFQH 4JRXE 4OIBA 4LU5L 3MLYL 1OSPL 4N0UB 1JK8A 1B2WH 1UJ3A 2XQBH 2VZOA 3RL2B 5IOPB 4FTVD 4LARH 1U8NA 2JELH 1DBAH 1TNNA 2EYRB 3ZE2E 4NN7B 3T0VA 4J3TA 3VFVA 4NN6B 1QSEB 3IJSB 2ZG3A 5F7EH 5B39G 2EH8L 3HNTH 4NRZA 4DUWA 4XPGH 2X9XA 4P2OC 1OSZA 2BY2A 1NGWA 5ADPL 4MAYB 5LXGL 1VACB 1H0DB 4JM4H 2IH1A 3RWHA 2HYMA 1WWWX 1T0NA 3KWWB 1DQLL 2R0LL 4ZD3H 3WUZA 1G7IA 1CBVH 2C7UB 2Q7NA 2E9WA 1GCFA 2VN7A 5E00B 2YMXL 2YRLA 1KB5L 2I9LB 1BBJA 2C3VA 1HCFX 3VFMA 3PWLB 2MHAB 2GIYA 1HH9B 3MCG1 1OF2B 8FABB 3AVEA 2V7NB 4GW1A 1YUHB 1KN2H 5IVXA 2HKFH 5J1AA 4IMLA 5B38A 3PHQA 5IB2A 3GHBH 1JP5A 5EIIB 1HOCB 2GQHA 3ZSSA 4O2FA 4LF3A 5LJYH 4MJ2A 4JRXB 5TFSH 2VLLA 1AGEB 2FNBA 2I25N 1UXWB 4HEME 3UMTA 4JJ5A 2B4CL 4M1CC 2FR4B 1JUFA 1XGPB 3EGSB 2JIXD 5ALBL 1GIGL 5GRUL 4EKXA 4G6FB 4XB7A 2P8MB 1YQ2A 1W72L 3G6DH 3OZ9L 3PL6A 3WKML 3IS0X 3EDEA 3H0TB 3FQXB 2XA8H 3MV11 2GCYB 2DL2A 3PABA 3O2DA 1Y18B 1B0RA 3MJ6A 3CVHB 3GMLB 4H1LA 2DDQH 5AEAA 1KACB 4LLVB 5H94B 1RUAL 2ICWJ 2VDRH 4AENA 3VFWA 1RVFL 3OJDB 3UBXG 5DHVA 2MNUA 5LAXB 3MLVL 3B2UC 3CIQA 1T03H 1FYTA 1HQ4B 1YEHL 5EUOF 2DRUA 1NC2B 2YA2A 3CX5J 2ZSWA 2HN7A 1F2XK 4OCXH 4ZFOL 5J11C 1UM5L 4LFHG 1IGCL 1P6FA 3O3AB 3IFNL 4POYA 3LKOB 1FL6B 2P42B 1T1ZA 4KJQC 3T0BA 2AK4E 4YDVB 3NCEB 1CFBA 2C9AA 1CYGA 2VH5L 3TN0C 3P11L 4PJAA 4P5TD 1N3NA 4LHUA 4OIIL 3ALXA 4G6KH 3VXRE 4YAQA 1G1CA 2HWZL 2AKRA 4U6HB 4R7NA 2C3GA 4RWYH 3PHOB 3BP7A 4ZNEE 4OM1H 1NSNL 2CK0H 4P4RB 1FPTH 1ZLSH 3BWAB 4OGAC 5FM4A 3UJIH 2R8SH 4QRSA 1QHPA 4IRJD 5EIVA 4TUJB 5CSZB 3CLEH 5GIRA 1CD0A 1ZT1A 1NCDL 5HY9A 4EDXA 3K4DA 4HWBH 1P7KB 3AXLA 1E27A 2XN9A 3IDXL 4P5TC 4TVPH 5E4IA 1D9KD 2VIRB 4O2EA 4WHDA 4U4BA 2EO1A 3HR5B 2J12B 4PTTB 3VXME 5ICXA 2EYTA 2NY5H 3Q0HA 5HYJB 5HYEA 5FGSA 5CEZD 1A7NL 3X13A 1N7MH 4WI6A 5DDHB 1FG2B 5JW4Q 5INCA 4K8RH 5T3ZE 1WQVT 1MCKA 5JNYA 1X5XA 3PG2A 4JCLA 2FBJH 4OI8A 5BOZG 2PYFA 5HYSB 3REVB 1LP9E 4BJLA 1QRNA 1F8TH 2OTPA 1AD0B 4PJ8A 4D9LL 3EYFA 4C55A 4NDMB 3IS1X 2XY1A 4HULB 1J0JA 5IMOA 3VH8B 4L9LB 1Y6MR 3O2DL 1RZ7H 2R2HA 1MQKL 5BZDA 2DYPB 1VFOA 3D39A 15C8L 5DVLA 5EU6D 3KPMA 3B3IA 4P3WA 1RZ8A 1U8JB 3LEXB 3QIUC 3ARWA 5J06A 4FQHA 3BKJH 1FFNA 3FO0L 1RJYB 3NAAH 2CLRB 3QZWG 4X80L 4X7SL 3EFDH 3MOAL 4OZGA 1F00I 5MEPA 2EE2A 2BNQE 2ZUWA 3VI3F 1JUFB 3BIKA 1U8OA 3K80A 2F53A 1RZFL 1YNLL 1YEDB 5SWQB 1FC1A 1YDPA 4RGOH 4DAGH 4IMKC 1YEIH 4O4YL 1BWMA 5I1GL 4JZJA 1UC6A 3VFMB 1NCBL 4W6WB 1YEFH 4KJPC 1IEHA 4D0BA 4UIKH 3HCVB 3HUJA 4OKVB 5FHAH 1SVZA 5IVXB 4BFBD 5JPMA 3B9KA 5B38B 4PIRF 4NJAL 3DMMB 3LN5B 7CGTA 3UTQB 1ES0A 3PWPE 2FL5B 1U36A 3SCMC 2XQBL 4PV8B 3I6KA 1DLFL 3P4MB 3FOMA 1U91A 2JELL 5I17A 3O3DA 1FG9C 5D1ZA 5DD6A 2OL3A 1Q0YL 1FGNL 2CO7B 4JFEA 5DC9B 5JHDE 3OR6A 2OTWB 1GJIA 3LAFA 1CFQB 4AH2B 1DBJH 1P6AB 2DQGL 3BP7B 3C8HA 1Y0LA 3P73B 3TO4B 4JFZL 3EOYG 3VWJB 2FB4L 5IBUG 4JM4L 4N8VA 3LQAC 1A22B 4KRPC 3PDGA 5DGRA 1WBZB 1RUQL 4QHKI 3MBED 2R0LH 2BOBB 3EZJB 5FYKH 2BRQA 2MQ0A 4LK4A 4OSUH 4QRPD 3QHFH 5C0CA 4HH9B 1YC8A 3LKOA 4M02A 4PJHA 4XPHH 4TOYL 3UTTD 2OJEA 1OGAB 1X6NA 1N3NB 4LHUB 3TA3C 3ECBA 4YHZH 3QQNA 2IQAB 1YMHB 5I9QC 1NGPL 2VXVH 5CKAA 3P0VH 5CEYB 3IKKA 1AY1L 4EQ2A 5I6XC 3BVNB 1FNEA 1SVCP 5HHQB 3S8WA 3B43A 3FFCA 3KHQA 4WUUA 1HE7A 5T5NF 3ZE0E 4JN2A 5BS0D 3FQNA 3DIFB 4LLUA 4ZXBC 2I9TB 2YD6A 1V05A 1OTSD 3RIFF 5DJAB 1A1OB 3FB6A 5E9DD 4BQBA 3S35L 2B0SL 1HXYA 3MROB 4JANB 1EO7A 4XPAH 2RAMA 3DGGA 1FNAA 4KKLC 2DLTA 3R06B 1HDMB 5FYJU 2EICA 3QPQC 4PRPE 1GHFH 4N5EC 5AWNL 1TFHA 3QIWD 4U1LB 1N5YL 3D2UA 4N1CA 3T65B 5H35A 3F7YB 3NABL 4NNYA 4OCYH 3L5XH 3ULUF 1PG7X 4G8EA 2XTJE 1E6OH 4D0DB 3L5IA 3U30B 1GGBL 3O41B 1QSFD 4NWTL 5GHWH 4G5ZL 1RHHA 2EDEA 3KPPB 3OB0H 1RZKH 3RDTC 2P45B 1WF5A 4OLXL 1G6RA 4WENB 4OIIH 5GGSA 5E2VH 3T77B 1FGVL 2F8OA 1OAYH 1QLRA 4CVUA 1QBLH 3INUL 4AENB 1AFVH 5DQ9B 3B3IB 5FYJH 4RAVB 5B3JF 4U7MA 5DO2D 1EJOL 3UTTE 1I75A 4ZUVA 3RI5K 4KH2A 2BSTA 4NRXA 1TMCB 2LV4A 5D7IE 4Z7NF 4PUBH 2EIEA 2HT3D 1LO4L 2IALB 2MMXA 4DFIA 3KVQA 4YHMH 4KDTC 1UXWA 1NAML 4PREB 1JWMB 1CDCA 3GBMH 4FMKA 2PF6A 4FQ2L 3MX0A 4KVNL 3VGDA 1FFRA 3RTQB 3DV4B 1Q9KB 4PJDB 3ZSTA 5D6CB 2XZQH 3O3DB 3MRPA 1YPZA 2FGWL 3UC0H 3NFSH 8CGTA 1NDGA 2X4RA 2Q8BL 4WWKD 3FQTA 4U1JB 4R4BB 1C7TA 1YMME 3ULUH 2CO6B 3O11A 3FRPG 3VWJA 4QT5A 4D0CA 1S5HA 5GSRA 3DUSB 3OJMB 4M62H 1S3KL 4GAFB 5MI0C 4Y4HB 1JZ5A 4TNVF 3UTQA 3ZYZA 4N9GA 1PDKA 3RWDA 5ETUB 1P84K 1Q1JL 1KIPA 5CP7A 3IXAB 3AC0A 4KK8C 3SDCD 1VDGA 3G04B 4WW2F 4H0HB 3G5VA 1UM6H 1CXHA 5FO8A 4RGMC 4HKZA 2WBJC 2BVPB 4WO4B 3O9WC 3EO0B 3RFZC 3PUCA 2HJFA 5JXEA 1H5BA 5LQBL 3V7AE 4QWWD 4BK5A 4ELKB 3U2SB 4PBWD 4ZTPH 5DSCB 2IG2H 5D1XB 5C09E 3KPNB 5JOFA 3KHOA 3W39B 3MRRA 3ROLA 5C0RH 4HS8H 4RRPA 4LHUD 4NQCE 4DEPB 1OGAD 1S7TB 2JJUA 2ADGB 1RZFH 5EB9A 4ONGL 3T2QA 5C07A 4Y4KA 2A77L 3SBWA 3BDYH 1NCBH 1RZ8B 4JDVB 4B7LA 1RUKL 5CWSA 3L5JA 2CKNA 1KBGL 4X6DB 1TZGH 4LSRL 4NN5C 5SWSB 1BLNA 1PY4A 5IB4B 4FA8A 3ZKSD 3VWJD 2B1AH 2YKLL 2DQUL 3ZDZE 2A0LD 5L6YL 1WGOA 1UYWH 2OBGA 1KIQB 4LIQE 5IBLD 1NKRA 4KC3B 4YFEA 2NXZC 2P8PA 3WFHB 1ITCA 4D9QE 1U92A 1BF2A 5CZKA 5EFIA 2OZ4A 2YPLE 1H8SA 3LHPL 1MWAH 5K33A 1RUPH 2EECA 4P46A 1IC5L 3D85A 4JG1H 3C60A 3ARUA 4NN6C 4ZPVB 4S1DD 1JTOA 3SKOB 1C08B 4LKCA 1CDHA 4LCWE 4ENEC 4FZ8L 5TQ0H 3UCRA 2E9IA 3ZKQD 3D69B 4G7VL 3FOLB 3U0PA 2E7LC 1X5FA 1TTGA 5ANMA 3ULVF 5C9JB 4NSKA 5D93B 2NPLX 4XRCA 3I6KB 2DAVA 5MENB 2OSLA 1A5FH 1ZHKB 4QEGA 4NZRH 3BPCB 4HWEH 4JFEB 4OF7A 3QDJD 4L9DA 3KPQB 4Z7QE 2YN3A 4YDIL 3T3MF 5GRWA 1OP3H 3LN9A 2AEPL 2D7PA 3P0VL 1K8IB 4AG4L 3HC4L 2PXYA 2AXHA 5J9PB 4HCRA 3LQZB 1A2YB 3EO1B 1JNNH 5KVMC 3IDIB 1JWUB 4GS7B 1WBYA 3ET9F 3W81A 4OD3H 3GSRA 2D2OA 1JBJA 2IPUG 4ZDHA 3SE9L 3GSOB 3UPRB 1CDJA 1G7JA 1GC1L 2B0SH 3PDOA 1II4E 3O3BA 3QWRA 2CLZB 4NHCH 3FB5B 5EULV 2AJSH 3U82B 1NDGB 2NLJB 3KYKH 5KG9A 1DE4B 4ZFZB 4K3EH 4N9OB 1RZIB 4P9MH 1OP3K 2EDOA 4YHKH 1T2JA 2FD6L 2EXYD 1S5HB 2EE9A 3AY4C 1A6WH 3SDAB 1WC7B 3WLWD 5HYJD 1EGJH 4MNGB 2YSSB 4K7PX 1W2KT 5ESQA 1MLCA 4KMTL 5I1HL 1NMAL 3B2VH 3HI1B 3I84A 3PGFL 1T5XB 4HWBA 3V6OC 5IIEA 4WTZA 2HVKA 2VLRD 4KKBD 3TYFA 3EDDA 1SY6L 3TJEH 5E5RB 4UT7H 2ZUXA 3BMWA 4U6XA 5L2KE 4JKPL 1KTLA 3FQWA 4WTZG 3E3QE 4NCC2 1FVDA 3QPXH 4CRPA 3U1SH 5MERB 4PGBB 1NJ9B 2UZYB 4QXUH 1EK3A 5IG7A 5I8OH 1CGSH 2DLFL 5CILL 1OP9A 3VDCA 1A7QL 1WIUA 5DA4A 4KKCD 3SQOH 2VOTA 4CJ1A 1HINH 4HKJA 4R96A 5FA4A 1PSKH 4DK3A 5J56B 1KLGB 2GK0B 4KY1L 4MDIA 5CJ8A 1KNOA 1DUZB 3TPUA 3MRCB 4GW4A 5DRNB 1F58H 4QY8A 1R3IH 3AS0A 1QSFA 1MFEH 3D85B 2QQLL 4UB0H 2ZKHH 4LEOB 4ZPVA 1FZJB 5JR1H 4X4YA 3BUYB 1LQSR 4HCRH 1HSAA 1HDMA 1L0XA 1TZHA 4OBRA 4P2QE 1ZANL 3CSGA 4P2QD 4Y4FB 1PKQB 4OCNC 2X2YA 3HPLA 3DETD 4PG2A 5CGYC 1CF8L 1I3GL 5D9SA 2VDML 5B4MC 3E2HB 3T0EE 2XZZA 2YUXA 2EYSA 4WW1B 5ALCL 3WN5B 1DBMH 5E5MA 5FM5M 3Q3GA 1LILA 2E8ZA 3QI9A 3QXWA 1OT1A 1KJ3L 4G6FD 2DI7A 1X5KA 2LU4A 4BZYA 3A0OA 2WANA 3G08B 4JFYB 3PWVB 4ELMA 3U0WL 1OVZA 1JI1A 3KXFA 2X7LB 1FFOA 3GSUB 1MY5A 5C0FA 1FYTB 1HOCA 2ERJB 4PJ8D 5DT1L 4X0KA 1JFQL 5IW6A 3DSFL 4JAMB 2O5XH 3WFCH 5C2BH 4LU5H 5F70A 1NCUA 4OD1H 4MAUH 4G6MH 4XCYB 2CIKB 5EU6E 3VXTB 4ZDHB 3X3GH 1ZHKA 2AEQH 2GTZA 1A1NB 4WJ5A 1DBAL 5DJZA 3QUXC 5IHUH 3QUML 1F3DH 3HMXL 4E0RB 1FZKA 3GUTA 4E42A 4K7PL 1HHIB 3EYOA 5IB3B 1Q72L 1V7ML 5EH1A 2GEEA 4R0LB 3D3VD 4HMCA 5C0BB 5K9KB 4OV5A 1J8KA 3WS3B 5C0DB 3BKYH 5DZNA 5ADPH 3U6RB 2M2DA 5LXGH 1EUTA 4JVPA 4U6YB 1VESA 1ONQA 1QNZH 4YQXL 3MA7B 1LK3L 3QIUD 1S7WA 5AZ2L 4KZEH 3QUMA 4IDLA 4OQTL 2IPKA 2CKBH 1A7PH 4KQ4L 3QJFB 2AXGA 1I8MB 1ZTXL 4Z77A 2ZCLH 3B83A 5IT2L 3LHPH 4OZ4B 4EQ3A 1CD1B 1FORH 2HKHL 5K9OB 2LAAA 3O4LE 2NZIA 2Q76A 2EE3A 1BZQK 3KYNB 1E4KC 4I0PC 3VFNB 4ISVB 1D5MB 2AEWA 2NTFA 1PQZB 1I3RA 2ADFL 3Q1SH 4G7VH 3GK8L 3T3PE 3TO4C 2YR3A 2E7BA 4X9HA 5E8OA 1CBVL 2NQCA 1YECL 3S6CA 3BGFB 1VHPA 3STZB 5J6GA 3PWNB 1OAZL 4EDXB 5HY9B 1IL1A 2ZUQB 4AQOA 5B39B 1BHGA 3L3IB 2E27H 2ZNWA 4NWUH 4LMQE 2HKFL 1LD9B 4PLJC 4YC2C 4XNYH 2AERT 4JDVA 3QEHB 3GFUA 4YDIH 5DK0A 2OJZL 2R9HC 1SBBA 3QWRD 4C56A 3U79A 3QHZL 3LKPA 1NC4B 3NCFB 4U1IA 1OY3B 2ERJC 2CDGA 3MLZL 4EVNA 1IFHH 2CR6A 3IDJB 4N90E 4WEMB 4Z7NE 5JO5A 5EUOA 1CQKA 4JM2F 1T04B 2ZOKA 1BBDH 3IF1A 5ITFA 4Z78A 1HI6A 6FABH 2A73B 1BQSA 4LVOC 3CSYA 3LEVL 1YEDA 3HZMB 1HHHB 1B0RB 3ZT6A 3CAFA 5BZWB 5EU3B 1BP3B 2VR4A 1WAAF 1MHHA 5E94A 4K94L 3QIBB 4KRMB 5GS2H 3T0DA 1NLBH 2VNCA 3P9WB 3DVGB 3B9DA 2F5BH 2WINA 2FX8H 5I74B 3QI9D 3UJIL 5KSUB 4NNPH 43CAB 1UJTA 4MNQB 3QUKA 1H8NA 1NCDH 1ZLWH 5JW4R 4HBQA 4KTDL 4GKNA 4K7PY 5DYOB 4P2OA 1UA6L 1C5CL 5I1IH 3RZCD 2A1WL 1IEAB 1I7TB 2UWEE 1FNSH 4UBDC 3L3DB 4GRWH 4L1HA 4LFHD 1A7NH 4YBQC 4HJJH 4Y19E 4Q7DA 1CXLA 1ZT7A 5D1QA 4POZD 4C57C 3LRGA 4ETQB 3IKCA 2YC1A 5CGYD 3BEWA 4PR5A 3NMEA 4KHTH 3WXWH 4NQDE 1XGUB 2C26A 5J9PA 5D7KE 2JF1A 4QF1A 3RZCB 1TCMA 3EOTH 4HPYL 1UT9A 2VDPL 3BP5A 3SKJH 1OB1B 3IAQA 4K23H 3PWPB 2FJHB 3V0VA 4AQ1B 2R2CA 1T5XA 3PJSA 3ZDXE 2VABA 15C8H 4KU1A 1DQDH 3MJ8B 2CH8A 3ZKND 1P9MC 5GGVH 1MWAA 4OBSA 4XBEL 1G7MB 5F7KC 3VH8G 1KCRH 1T7XA 4HCRL 4LRNH 1ZVHA 2DQJH 3P30H 3SGDH 3BKJL 1JGUH 5BVPL 2WP3O 4LSUL 1JF6A 4PGBA 5IG7B 5EOQH 3S96A 4U1SA 1FVEB 1ONQB 2VZSA 3BAEL 1XMWA 3PP4L 3ZLQC 5IBLC 3SGEI 4MNGA 4MVBD 5HJ3A 2IPKB 5DJAA 5BO1L 3UTTB 2YD4A 2VXUL 2ZUVA 2Y5TA 2NX5E 1FE8L 2VZ1A 3GMNB 5BXFA 1CFVH 4HPOH 5JTWA 2ZG1A 3WS6A 1NCWL 2CLRA 3BT2L 2JCCF 3H8NA 4N0CD 1CGVA 5FYJE 1SJEB 1M4KA 3RVXC 5HVWA 4U6XB 1U2HA 5C70A 1T20B 5K9QG 3T65A 1T7WA 3RWGA 5MEPB 3FONA 4G8IB 5I8CB 1A14L 3FQRA 3VRIB 1D5BA 3AREC 3ULUC 3G6AB 3O6FD 5TJWK 5FKAB 1BD2B 3C8DA 3RVTC 1ROWA 4HQQL 2H32A 4G6ML 2BVOB 4GG8B 1J0KA 4QNPE 3RUGB 3AMKA 1DLFH 3TPUB 3ME0A 1ULVA 5DJ8A 5DI8A 4P4KB 5EU3A 2OXHA 2QTEA 3LZFH 3MSPA 2EEAA 1ZWIA 5IFJA 3HI6L 4NT6A 4K7PH 1K4CA 2DQFB 1VKXB 4M6NH 4PRPD 5EN2A 4M1DL 1KIUA 2A2QT 5A3ID 3QJHB 3QDMD 1A3LL 5IVNA 4YPGA 5DA0B 4PB9H 3UPCA 1KJMA 4URTB 3UTOA 5M7QA 1NFDE 5IV2B 4ZSOA 4JGMA 3V0WL 2EDHA 3U46A 1QZ1A 3QUYC 4QHMB 1T04A 3O6KH 1SJXA 3D39D 4M93C 3V0AC 2A6IA 3WO3B 4X6EA 3JSSA 2DB8A 4YZFF 4RMUA 1YYLH 3MRPB 4YPJA 3UTZA 5IT2H 3UTPD 2R9HD 4RZCB 2X1XR 2CUIA 4R0LA 1FNGB 4OD2A 1UVQB 4GBXA 5SWZD 4E5XA 3IDGB 3CVHH 3FZUD 1T3FA 2C1OA 3Q6GH 5KN5B 4HGMA 1MI5E 1SEQL 2DMKA 4GW5B 3T8XA 2IPTH 3RZCA 5JIHA 5E6IB 3ZKXC 1CE1H 4M8QB 1AC6A 5DMKA 3TNMB 1W0VA 1U3HD 2ATPA 3HZVB 2BCKA 2RIKA 5DYOA 1DP0A 5JXAH 1S7QB 1SY6A 5GS1C 2DQTH 4BUGA 1U8QA 1LEKB 4LASH 5JOPD 1I7ZB 4XPAL 3TC9A 2E6QA 4F57L 1ED3A 1F6FB 1NAKH 4MA3B 5I16A 3VW3H 3D3VE 2FECL 2SEBA 1I9IH 4M5YH 4RDQG 5DHVH 3RX7A 2OR9L 3MLSH 3D5OF 5HHOA 4PR5B 3QH3A 3QEUA 3KAAA 3DARA 5GRXG 4JZJC 3UBXA 1GRWA 2XIDA 3GNML 1IAKA 5BMFL 1FFPB 4Y2DA 4DWHA 4YHYB 4BK4A 5C9KA 3HB3D 3CJJA 2HJLA 3PWPD 5GGQL 4X8XA 3ETBF 1MCQA 3Q5TA 3DX8B 1JV5A 4OLXH 3QDGE 4YBQD 3RWCA 4TRPH 1QUNA 4Y5XA 1D6EA 4K3DL 2V2TA 3SDXA 5JW3L 2ZP0T 4K94H 2CDGB 5EOCH 2VE6A 1IRAY 2G9HB 3BGMB 5IVZB 1D3CA 5HHXH 1PBYA 4HFUH 5FUZH 3H42L 5D1ZC 5ERWA 3EOBB 1MRFH 4MA1C 1KGCD 1UWEH 3FQNB 3ARDA 3G9AB 3DI3B 1ZV5A 1B0WA 4JY4B 5CMAB 1DQQA 3VG9C 4P5TB 1OAUH 1ERNA 4L4TA 2XZQL 1OAYL 1INQB 5TH2B 3KPRA 1YYML 3D9AH 1LK2A 5DQ9A 3OGCB 3CPLA 5AG8A 3NFSL 3HI5L 3C5JA 2FATH 2I26N 4M1GL 3GSNB 3VXQA 3A67H 4XCEA 4DOHE 3S5LA 1PFCA 2ZWLT 3GBNL 4G7YH 2FX9L 1PZUB 5EZLB 3VWKD 5D6CA 4FQ2H 5E1AA 4NZJA 3A6CH 4HPYH 4RWHA 2VDPH 3SKJL 4N68A 3TT1L 1IGMH 4XPTL 2DIJA 1LEGA 4RMRA 2V17H 1IEAA 5F96L 5T1KD 4J12A 5FXCH 4OTXL 2QQNL 4M00A 3RVTD 1CFTB 3B2UD 5EFIB 2ZUQC 4MA7H 5TF1H 1HKLL 4IRZH 1BM3H 6CGTA 5HHNA 1NEUA 4JM2B 3HB3C 5JIIA 5LQBH 1XGUA 3C5ZC 3DVGA 3ALPA 5IJVB 3QJHA 4Q74A 5CEZE 2ICWA 3TVMC 2R0ZL 5K9JH 3S88L 1X3DA 1P4IL 2AK1H 3ZT7A 1G7LB 1REIA 2R23A 5D5MB 4ZFFA 1LE9B 4MNHA 2Z9TA 1J0IA 2AJXL 3QWOB 1CTNA 4JFFB 3DV4A 1U8PB 3HE6D 3G5VB 5EBLB 4FRWA 5D70L 2P48B 4CDGC 5BO1H 3G04A 2HFFA 4I3SH 5FYJD 3MNVA 4ODUB 5DTFB 1DN0A 2W60B 4RISL 3GMRB 5D1QB 4MMXC 1TZGL 3VFSB 4RAHA 4X5WA 5KVDH 2FSEA 1VA9A 2NLJA 5FGBC 3VFUB 3T0EC 5LAXA 4RQQA 2ZUTA 1VGKA 2P5EA 2L7JA 1T4KA 3MRRB 2C4XA 4K8RD 1B2WL 2VXQL 2ENYA 4HG4K 5LG1A 4ZPTA 3GKWL 1KOAA 1KPRA 1R3LB 3OKDB 5BVJB 2XWTB 3IFOA 4HQQH 1I1CA 3MZTA 4LSPL 2MKWA 1V3KA 4OAWA 2Y5TB 2IWGA 5IW3A 3IAPA 4I18C 1PX4A 1J1XL 4MD0B 5HHMB 3EAKA 2F8VA 1S9YB 4PRID 3LZFL 4KDTA 1OHQA 5IFAH 5ADOH 3UEZA 4PTUB 1X5IA 4WFFE 2HJFB 4M6NL 4MAYA 3AS3A 3GO1L 4PYHA 1J12A 1DVFD 4X6FA 3NVQA 1KT2A 5MENE 4U1SB 4U7KA 3KJ6H 7FABH 4BA8A 2HG5B 3E3QC 3DYOA 5E8DL 1JHTB 4NDMA 4TUJA 3FT2A 4HZLA 5FIEA 4YNYA 2Q8AL 2I9LA 4YDJA 4R8WH 4NZRL 1PAMA 3V79C 1IC5H 2J8UB 3BSZL 3L5WB 5GS0H 2YS4A 3QP3A 1KN2L 1MH5A 5IB2B 4UV7H 2P1YA 1K4CB 1VKXA 3QEGH 3C5ZB 4KRNA 2LU3A 4Y7MA 3X13B 4RSVA 3GSNA 2DICA 3S35X 2ZPKL 1MAJA 1QFWM 3MUGA 4HIEA 4HUUB 4ZSOB 1UGNA 2YA1A 2B4CH 1I1FA 1D9KC 3QDMA 1HILB 1JF1B 4ZAKA 1BFTA 2GK2A 4X6EB 2WBJD 5JPNA 4FQQB 2H9GB 4PRBB 5JW4N 5JXAL 4F58L 4GAGL 2UWEF 3MRIB 2DQTL 3GDBA 3O3EB 5HYJE 1JPFB 4X6CB 5HDQH 1XF5A 4QHLB 4KQ3L 4WW2B 4WCYL 3MLVH 3VA6A 3KPMB 4ODTH 1NAKL 3VWKA 3AGVA 5EN2B 3KJ4C 2HN7B 2UY7A 4O5LL 4P2QB 4CN4A 1C1EL 1DBKL 3RUGF 3EO1A 4H26B 5LVEA 4XMLL 3NA9H 5HDBF 1YQVL 5SWZA 4EN3B 1CFSB 4PPTA 4P3CH 1OM3L 1K6QH 4YFDB 3GI8L 4OM0H 3AS1A 4U6HA 5E1HB 4PGEB 3JXAA 3DX9B 1YDPB 1ADQA 3V4PH 4K7FB 2Y6SD 4EDWL 1U3HA 1BFOA 5E7FA 1UFUA 3BKMH 3EYOB 1NSNH 4PP2A 4JR9L 4NO5B 5IWLC 3GJFH 4DK6A 4X6DF 2VDOH 3U0TA 3HUJB 1X5GA 3D0VA 3H7BB 4I2XE 4AYFA 1MLBA 3QXUA 2IF7A 2BK8A 5EZOH 4QXUL 5FF6B 2G75A 4ONOA 3QB7C 4ZPTB 2WBWB 2W9LA 4XCCH 1N0LA 4MCYA 4H0IA 4YE4L 3T4AA 3STLA 1ND0B 2HMID 2OK0L 2Y7QA 5ICXB 2D31B 2OR7A 5A2JH 3QZWB 4O9HH 5KW9H 4C59B 4Y2DD 3QT2A 1YYMH 2A74B 4HK3J 4I2XA 2DTML 2AV1A 2EDTA 1OL0A 2IH1B 2MCPH 4FZEH 4HSQA 3BD3A 4UNTA 4L3EB 5IEHA 2W92A 4XB8A 4R97B 1KFAL 4HUVA 4M6OH 3X12B 4H0GA 4B7IA 3REVA 3AAZB 1I3RB 4FNLL 4BH8B 3FN0H 4MS8D 4Z18A 3T4YA 3F58H 3TBYB 1T1XB 2F58H 5F7LB 1IGYA 4NP4L 3SQOL 1P2CA 5BZDB 4XMKH 4XX1G 1ZT1B 3A6CL 1J88A 1RJZB 1NGQL 4ZQKA 1QSFB 2XN9B 5J3HC 4JKLA 4PS4H 3RVUD 3SE3C 3CH8A 3V8OA 1KJ3H 4ZYKA 1DDHB 1HKLH 1AD9B 3QNXB 3D18A 1HNGA 4QHKJ 4MJ6A 5GRJH 4R9HA 3ZKMC 2VXTH 3BH9A 1FZOA 1OW0A 2PO6D 5A2IH 3SPVA 2PTTA 1N2RB 4LDLB 1UQSA 1WZMA 4WU5A 1MCNA 3OKOA 2QADC 2W0KA 4XNQA 2AGJL 3EFDL 3QUYD 5GRZA 3TIEA 5DT1H 4CKVX 3EOBA 1X5JA 1QVOB 1Z9OA 3DSFH 5C2BL 1YNLH 3SGJA 3IVKB 4WY7L 1T5WB 4W6YB 1R5IB 1RHHB 3DIFA 5BS0B 1KPUB 3UJTH 1RQ5A 4DGYL 2W91A 3D39B 5GRYA 3RVUC 4LSSL 2V9RA 2OI9C 4M61A 3MROA 3OGCA 4J3VA 3N1PC 3MREA 4MHHG 2O61A 2YHGA 4ZFGL 4PRIA 1A64A 5GQBA 3HAEB 5I0ZA 3BH8A 4NN5B 4F7PA 4JFDD 4TN9A 1KJ2B 4BQ6A 2FGZA 3LV3A 5C0AB 5DMIL 3JWDL 3HE6C 4QRUB 4PGZA 2G2RB 3VXTA 3CXDH 4WWKA 4JO3