1EMTL

Fab antibody fragment of an c60 antifullerene antibody
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTFSCSASQDISNYLNWYQQKPDGTIKLLIYYTSSLRSGVPSRFSGSGSGTDYSLTINNLEPEDIATYFCQQYSRLPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IGG ANTIBODY (LIGHT CHAIN)
publication title X-ray crystal structure of an anti-Buckminsterfullerene antibody fab fragment: biomolecular recognition of C(60).
pubmed doi rcsb
total genus 53
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2000-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1emtL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1emtL01
2YSSB 1KCKA 2GY5A 5EIIB 5IMKB 2IPUK 2CRYA 3QEHA 4KK6C 4ZOAA 1QBLH 2CH8A 1X6NA 4TTDD 1OP9A 4LSDA 1OSPL 5DMKA 5KG9B 2AGJH 2BVOA 4BSWA 1HIMH 3G6JA 2DM3A 3HC3L 3U2SA 3WIFB 3V6ZB 2FJHB 3HRZA 1AY1L 3DVGA 2DN7A 4FP8H 4QRRE 2OJZH 4ACPA 3SDCC 4FQIL 3RNKB 1P7QA 1KPUB 5FA3B 3T0EA 5BVJA 3QG7L 1VACB 4OQ1A 3LH2H 5EZLA 1RV6X 3NFNB 4NCC2 5JPNA 4N5EC 5FF6A 4EUPA 1CR9L 4XCYB 1I3RB 3K2MC 1I7UB 4X7FC 4N9OB 3WO4B 1DLFH 3N0PB 3X3GL 2IH1A 4PLJD 3O4OB 4PRIA 3MJ9H 1UQSB 1Z9SA 3D39D 4NGHL 2A6JB 4X6FB 4HIHB 3QEUA 2DRUA 1CD0A 1L6ZA 2VERN 3SE4A 3CSBA 5I1GL 3L1OL 1J8KA 2J6EH 3PWPD 3C9NA 4U0RC 5IEHA 3SDDC 5HHMD 1Q0XL 3W0WE 4Z7VB 4A2LA 2EH8L 4S1DD 4RISH 1I4FA 4DGYL 1UA6H 4S0SD 2GSGB 3MRFA 3C87A 3OL2A 1JVKA 3RPKA 2B1AL 3BVNA 3TWCL 4NKDB 3DO7A 4UT9H 5I2IA 4AEHH 2XZAH 4NQDE 5TE6H 2X42A 3EOBB 4H25A 1G7LB 1JNHB 2X4PA 4KGJA 3CH1B 1JNLL 3DXAD 4JPKH 3MROA 3ARRA 2EDNA 4LSTL 2VN7A 4OIBA 1OW0A 4LMQE 4N9GB 1ITBB 3BD4A 5I1JH 1YUHB 1FFQA 3B4NA 2C3XA 4M3KB 5IGXL 3RGVD 1UWGL 4XCEA 3WJJC 4K55A 5CSBA 4AM0A 1BOGA 2C3VA 4PJDF 2YPLD 3P4NA 4OQTH 1T6WA 1YMMA 1MCOL 4P23D 3TT1H 1A6WL 1JRHL 3ULVF 3BD3A 1TVBA 1A7BA 1U8KB 4MJ6B 4ODHH 1FL6A 4RAVB 1X7QB 2GK2A 2YZ8A 5J13C 5F7YC 1BD2B 1FLRL 1TCRB 3V6FA 5J6GA 1K4DA 4G9DB 2VLMD 4GRWF 3VGFA 1ZLVH 3AM8C 2VLRB 5BV7L 3GKZA 4PP2A 4L3EE 4QHMA 2N7BA 3VW3L 3PWJA 4HWZA 5E7BA 5L2JA 1OP3K 3T4YB 5FO9B 2HLFD 3PXJA 5A16A 4DZ8B 1KELH 2OTPA 5TJWK 3UYRL 2HVKB 1WZ1L 1GZQA 5BJTB 1TZHB 5I76B 3GMLA 4X5LA 3BRDA 2IPKA 4OGYL 1RZJL 3C5ZC 4UB0L 1A21A 1N3NA 4BFBD 4CUCA 4BH8A 4EZMA 5FCUL 1M7IA 4HZLB 2MHAB 5ALCL 1CIDA 1R24A 2F58L 1S7XB 3LEVH 4W4OC 3GJEA 2QV2A 4I5BA 2AERT 5K33A 4PJDE 3UO1L 3CDYA 3RJDA 4C57C 1OAQH 2O61A 2MNUA 5E2UH 5SWQB 3EYSL 1J1XH 2FX8H 4OF5A 2CRIA 5LQBL 3QXDB 2BVPB 1U8JB 4GG8A 4K7FA 4KV5F 4LCWE 4QGTA 3BP7B 4OZ4A 1P2CB 5TDNA 3IU3A 4DVBB 4XP4L 5D1XB 3QIUC 4XI5D 4LLWB 4LSVH 5DK2B 4WI7A 3D69A 3VG0H 1Z3GL 3HI5H 4FZ8L 5BZWB 3BKCH 3IKCA 4JO4L 4LNRA 5B39A 4ZUUB 1A0QH 3REVB 1RZGA 1IRAY 4RGND 4R2GC 3IFNL 5HVHB 3O6FD 4LPWA 3DYOA 2YUVA 2JJSC 3Q5TA 1Y6KR 1OAYL 4CMMB 5GQBA 2HTLD 1CGVA 1I1AD 3P4OB 4V1DB 4JFFB 3I75A 5FM8A 2FGZA 3QXWA 4JFQA 5F6HJ 3HI6H 5JDSA 2R1YA 5DVLA 1EA9C 2DYPD 1NLDL 1IM3A 5JXEA 3EOAA 5I1EL 5GGTH 5B38A 4XNMB 5MEND 5F3BB 3WIIH 1QSED 3PJSA 3D85A 1UB5B 2O5YL 3MRDB 4JQXC 4KV5E 4RIRB 4NN6C 3RY5A 1EAPA 4I0PB 2Q86A 3BDBA 4CVZB 5AG8A 5KW9H 4MSWB 4G43B 3LEYH 2Z93B 5JR1L 1I9IL 3T65A 1IGIH 4AH2B 3ZO0A 2VXSH 1JTOA 2PR4L 2X09A 3AS1A 1F11A 3UPCA 5IG7A 2CLZB 3T09A 2ILLA 1QTYT 2BOBB 1OPGH 5DD0L 5GRJH 5T1KD 5IVNA 1AI1H 3EFDH 4M6OH 4XC1H 5ICXA 2R0WL 1NGYA 3ULUL 4HKXA 3V5HB 4Z78A 3B8YA 3VD9A 4PS4H 2ZZUT 2B0SH 3RL1A 1MHPH 4JLRB 3IFPA 5INCA 4WDIB 3G5VB 2QHLA 3C2AL 4Z7OE 4NQDA 2JJTA 4U1KB 4IRJA 3I50H 2F53D 3BE1H 3U46B 3BHBB 4HJJH 4G7VL 4QXGH 3TP4A 4PGJA 1NEZA 1F3JB 2Y06L 5FM4A 5DYOB 3OAYK 4ENEC 5I19L 3WE6A 1G7HA 5IEKB 1YPZF 1QO3A 3ELAT 5E7FA 1A1MB 4GMTH 3GIVB 1QYGL 3QULA 3ARBA 2WIIA 2CQVA 1PX4A 5CJXC 3OR7B 1BWMA 2ENYA 1T3FB 4P9HL 5EOCH 4TUKL 5JOFA 5D6CA 2GAZB 1LO4H 1K4CB 4XVSH 3ZT5A 2XI9A 3CMOH 3RA7H 1X3DA 1CICA 1XGYL 3HE6D 4L3EA 3BN9D 5A3IC 3BPOC 3G6AB 1A1OA 1IEAB 4M6MH 2PTVA 2IPTL 3QDJB 4U0QB 3P0YH 4NQTA 4A6YL 4NJ9H 5C0CB 1PAMA 2EDOA 4NN5B 3DROA 4ZQKA 5TE4H 5CZXD 1FZJA 4G9FA 3HZVB 1M6OB 3WSQH 5HHPB 1GYAA 3O3DA 4XHJC 4G6FD 2DIAA 3BH9A 5T1LA 1R0AH 1A4JB 1KLUB 1N4XL 3QYCA 5DHVA 3PXHA 1FG2A 4BH7B 4HQQL 2R0LH 4M7JL 1J1PH 2ZSWB 2HFTA 2NY7L 3RQ3A 3VWJD 5D71L 3KXFB 3VXSE 3WKML 3IAGC 1QA9B 5KS9B 1EEZB 3RBGA 3V7AE 3VFRA 4LCYB 1H3PL 1T7ZA 2MJWA 2FBJL 2R2HB 3SJVE 5EO9B 4LCWA 4XB7A 3ALPA 1ZA3B 3T8XA 2EXYD 32C2A 1BBJA 1T04A 1CLOL 1YN7A 3MRNB 5DEGB 3U0PB 1N0LA 1RUAH 1Q1JL 4D9RE 1IAIM 2BNRD 5EOCJ 4OLXL 3E2HB 1MOEA 3WS3A 1FNEB 2J4WL 1DTUA 1AD0A 1ZHBA 5ABDE 3OG6B 4G5ZL 1QR1A 1WICA 4LSSH 3BO8B 1G1YA 2X70B 4MNQE 4U7MA 3GMMB 1E4KA 3IDMA 4L4VE 3R0MA 4OF3A 5E2WH 2QEJA 3NZ8B 4IJ3C 3W2DH 1NCCL 4Q2ZA 1A7PL 2APVA 4LFHG 1T80A 1KJ2L 2H9GA 4WNQB 4GSDH 4BKLB 1EHXA 4JZNB 2X05A 3MGOA 1J7VR 2KH2B 2YD5A 1MPAL 4GMSH 1RJYB 2OL3L 4ZSOB 3M1BA 5F6IB 2ZUTA 4GBXD 3EFFA 4HWBL 3F7QA 4LCCC 4UIMB 4C83A 3F12A 5J12C 2ICWB 3W11D 3FT2A 4D2NA 4OUUA 4HUVB 4MAYD 1N64L 3GZKA 4FFVD 4W81A 2X4TB 1IM9D 3BPNB 5BW7A 4P3DB 4JJ5A 1OTSC 4ZD3H 5KSBB 2VAAB 5GRUL 1NC4B 3INUH 1TMCB 3GIZH 5ILTH 3CLFL 4YGVB 4NBXB 4JKLA 2LFGA 5HHOE 5EDXA 1LK3H 3LV3A 3ZDZF 2L4OA 5F7EH 4WW2C 2YC1A 3OB8A 3TO4A 3FTGB 3QDGB 4HIIA 4Z8FL 1DFBH 2ZCLL 4PD4K 1NUDA 4POZC 2OZ4L 4U1MA 2DIJA 2H2SD 5EZOH 5EUKB 4ZUVB 3PP4L 1INDL 1JZ8A 3T1FA 3HI1A 1RZ8A 1U8QA 2JF1A 1KPVB 2MOVA 3DMMB 4KMTH 1ORSA 4N8VG 4X6EB 3DO3A 2R0KL 4BELD 2EYSA 5I9QB 2EIEA 1XGTB 3OKMB 3O4LB 2W9LA 4APQC 5D7LD 1DL7L 3BAEL 3L5XL 4XPHH 1IMHC 3DI3B 3OBAA 1OARH 3VGBA 1S3KH 4F57H 1AP2A 1ZE3C 3LRSA 2OK0H 4L29B 5EC2A 4N0YL 5DO2C 2IBGA 5DGQA 4JZJC 3TN0B 1NMAH 1BBDH 1J88A 1TXKA 4WTWA 5GS1B 1HINL 1PW3A 2HFFA 1A47A 1YQVL 4KK5D 5KTEH 2BMKA 2VKXA 3GSNL 3GHEL 5IKCB 1DQML 2HTKC 3NACH 4I48B 3QUYD 1MCIA 4ERSL 3LEXA 5F9JB 4P2QD 1HOCA 1HSBB 5D5MB 1KTLA 1TZGH 2HFGL 1G7PA 4HLJA 4KRPD 4NUJA 4P2RB 1IFHH 1LE9A 5IHLB 3NH7L 4PJ5B 2FJFA 4AIOA 1KJ2B 5F93C 4ODVL 3O2DL 1MEXL 4FQ1L 3JWOL 4JFYB 3TBWB 5J6HA 3D39E 1ZT7B 2BNQD 5EPMA 4OM0H 4TPRL 5J06A 4PGBB 4KTDL 4M6AA 4YHYB 2QADD 3IJSA 2FLRT 1L9MA 3FO1A 4RNRB 4YXLL 1NFDF 4HZAA 4YK4B 3L7FB 1ZA6A 2X10A 1URLA 4ZPVA 1J5OH 3PWPE 5JXAL 2BHZA 4X5XB 2AKRA 1S7SB 5CEZL 3I2CL 5HHME 3GKWH 1J9CT 4NFCA 4JQIH 5CJOH 5I66B 5IESH 3D2UB 4ZFFA 1BFVL 4JAMB 4X83A 5DFWH 1A1NB 3VXSA 3GSQB 2UVEA 5DQDL 3QJFB 2Q7NA 2UV3A 3MA9H 1KACB 4F2MA 2CK0H 1KCLA 5J9PA 1RIUL 3HC4L 1KXQE 2NY1B 3DGGA 2LU7A 2P1YA 4YO0B 4JM2D 4K94C 1EMTH 3BQUD 5DT1H 3BP4A 2H8PA 1OP5K 4G6KH 4NM8H 4QRQB 5FDWB 3QIWD 4GS7C 5IHZA 1LDPL 1KBGL 2XZQL 3RWIA 2BXZA 4U6XB 1FVCA 1YN6B 5GJSL 2KZWA 2FBOJ 5DQ9B 4MCZA 3FZUD 4K9EL 1LEGA 1UM4H 4MNQA 4DUWA 1A6UH 4L4VA 3O3AA 4AMKH 2YPLE 5GIRA 1NFDE 3ES6A 1YEIL 1YNKH 2YMXH 3AREC 3MLUL 4LLDA 3V8OA 2R2EA 5D1QA 3RDTB 3RY6A 4M8QA 2ED8A 5M94B 4HUUA 4KRLB 1FDLL 1A7QL 5IR1A 5I0ZA 1BZ9B 1RUKL 2VLME 3VRIB 5FEBA 2PCPA 1XMWA 3EO9H 4UMGA 5E00A 5SWSD 4QWWC 2XWBA 5B8CB 2HRLA 4PJ9C 2GHWB 4X6CB 3PP3H 1HEZA 5CWSB 2IFGA 4U1HB 1NH6A 1G7IA 1V7ML 3I6GA 3GSNB 4F9LC 5ESQA 4DZBB 5E8PB 5AYUL 4PD4J 1I9EA 2YPVL 4G8IB 2VSCA 2R2BA 2ZKHL 4H26B 5EIVA 2EDEA 2EE2A 1CFSB 5GGVH 3VFNA 3P77B 3VGDA 2V17L 3C6SB 1HKFA 1XIWD 2X40A 4TSBL 5C09D 4HC1L 5IW1A 1VFMA 5FK9B 2YWYA 3QUZC 2NXZC 3T4AB 3WFHB 4X7SH 4J1UB 3RWHB 1BIIA 3SE3A 3DX7A 1ZWIB 1T1XA 3G5XA 5EU7C 5HYSB 4OCYH 2R1WA 2PXYC 4I1NB 4OB5H 4ZTOL 3U36B 2EYRB 3NPZB 3BPCA 4TUOB 3OKDA 1INQA 2NY3B 4NO0D 2Z31A 4YBQD 4NHCL 3B5TA 3V5KA 2KBGA 4H5SB 3Q3GB 3VFSB 4YPJA 4Q9BA 2APWA 5F9WC 4LKXB 3RU8H 2X7LA 1T1YA 5GHWL 1TQCB 1ADQL 5GGRA 3P0GB 4RGNE 3UBXB 2BNUA 1GHFH 4ZFZA 2IQ9L 2R29H 3B83A 2AJ3B 1VADB 5IIEA 1MJJA 2UYLB 1A4KA 4F7PA 1RHHB 4NWUL 1DVFB 3SBWC 1QRNB 3KJ6H 2FHBA 2CLVA 4OTXH 5C9JA 1YMHA 4JHWH 4L8BA 5C0BB 2XG4A 3BP6B 5MENE 2RHEA 5JW4M 4C56A 2X1XR 4RFOH 1XCQB 4KMLB 4P5TB 3PG2A 3SDXB 3G6DH 1KIQB 1QSEE 4HUWB 3WHE0 4MD0A 4U2YA 1U8IA 1DQLL 1I3GL 3MYZA 4HS3A 2NMSA 1WLHA 1PKOA 4PJCA 3DIFA 5C8JB 2ITDA 2YEZA 3VXQB 4MXWH 3D39A 2VE6A 2CDGB 5K9KA 5E6IC 2EEAA 3TT3L 3EOTL 2H6PB 1LO3H 4NBYB 4AQ1B 3UTZB 1CU4L 5GXBB 4JDZA 1ES0A 1FN4B 2DI7A 5FGRA 4HJ0C 3PWPA 3SKMA 3MV7B 3F7PC 4JY5L 4R90H 2Y6SC 3V5DB 4XP5H 5DHXB 1NEUA 5CZVL 1ZKAA 4PJGB 1C08A 2COQA 3VJ6A 2H3NA 5DD1L 3C08H 1FYTB 1YEHL 2O5ZL 3GK8H 5IFJA 3K4AA 4NYLA 1QHPA 4KXZH 5HYJD 1ACZA 1G7MB 3IB4A 4JFDB 4U1SB 1SJXA 5D8JL 3HUJF 4I3SH 5K9OA 5BQ7B 2I5YL 2Z9TA 5ENWA 4F7MB 4KI5C 3PGCA 4NQSB 2Z4QB 3DXAA 3WIHH 4K94H 3SE8L 2F53E 3HG1B 3O41A 3AU1A 1LE5B 3OGOE 1N5AB 3RTQB 4PJFA 3QO0B 1LO0L 3DETC 2CO7B 1MCWM 3STLB 2RFXB 3TA3C 2WAHA 5DJYB 3HZYB 3BWAB 4XRCB 5B3JF 1EX0A 3SDAB 1GGBL 5DRXA 2VXVL 4KHXH 5HHXH 1FL5B 4PV9B 1MF2H 2P44B 4K71C 1KB5A 1JWUA 3FQWB 3L7EB 3FCTB 4U3HA 3E3QE 1IGML 4OAWB 3LVEA 2IAMC 2YPLA 3KGRA 4V2BA 2FECL 4UAOB 4IHOA 2BDNH 1NFDA 4B53A 3EW3B 1SJEB 3OQ3B 4P23A 1OB1B 4XCNA 4MGXA 1QFWM 2P5EB 2VDKL 3SGDH 3FB6B 4N0UE 4YXHL 2CIKB 3QNXA 4NZJA 3MC0A 5DJ0B 3PQYD 3RVUC 4L4JA 5DJCA 4D0DB 2VLKD 3QHTC 2GTWA 2FRGP 4O2CB 3TO2B 5FUCC 4ODBD 3HUJE 1XZ0B 4BQCA 1BQLH 4XMPL 1AGDB 1EBAA 1J0YA 4HEPG 4KHTH 1F4YH 1X9QA 2NX5A 2Q8BL 3BOVA 3Q1SH 4X7TA 2AEQL 1JPGA 3GRWH 2FIKA 2R0ZH 3MLWL 4PGZA 4LLVA 2ZJSL 3O2WH 4ONGH 4R8WH 4JFZH 3U7WL 3T2OA 5B3JE 2V7HA 4PY7B 4J23A 5FYLL 4MNGB 1A3RH 4KRNA 2YUZA 5GS0L 5F88B 3W5NA 4LSUH 4EJ1C 3LZFH 3KPPA 4Y1AE 3S5LG 1CVRA 2IG2H 3MNWA 1FORH 1IE5A 5E9DA 3M8OL 4HW6A 4PJ8C 4U2ZA 1AC6A 2EC9T 4NM4H 3U7AA 1IT9H 3WUWG 4RZCB 2VLJD 5DK3A 1JJUA 4HIEB 4JFOB 4M1CC 5HBBA 5D7SL 4DW2L 5IROC 5JIHA 4OD1L 3KPMB 1S9XA 4WHTA 1XGQA 4WY7H 4X80H 3MRQA 4OV5A 4UQ2B 4M62L 5DD3H 3RWGB 3MJ9A 4Q7DA 2CUHA 3BW9B 2BNRE 1ZT1B 4KDWA 1J0IA 3VWKD 4GKSB 1B0RA 1CF8L 5IVXA 3VI3F 5IW6A 3L95B 2RCSH 2VDLL 2HFEB 4OLYL 3WXVH 4F7TB 5I71B 2G5BA 4GXVL 3S35X 1KCVL 3LN4B 4MS8C 2A1WL 3VXRB 4ODXA 4RWYH 4ZOEA 2C1OB 4XGZA 3RVWC 4Y4KD 2DYPA 3PIQB 4KUZH 4BQ6A 2UZXB 3DUUA 5JW5A 5DUMH 3CFKA 3JV4A 3LKNB 4OFVA 3HPJB 3IDGB 4HUKB 3TVMC 1R3JB 1G9NL 1I1FB 3MJ6A 3MUY1 1PD6A 1P9MA 5CP3H 4DGIH 3G08A 1QSEA 4LLQA 1BAFL 4P4KB 1IAKA 4FXGA 3RHWK 5DDHA 4IOIB 5J1TC 3AY4C 3NFPA 1NJ9B 2XN9D 3G9AB 1DBAH 4FOMA 1D9KB 5AEAA 1HK6A 4Z7UB 1BF2A 1PGRB 1HILB 1OAXL 1SY6H 4NKOB 3VXPA 1GGCH 1MCRA 2ARJA 3M17B 5KOVC 4KK9D 3VI3E 3UTTD 5HYIA 4HGWA 2AXFA 3HMXA 3IXTA 5GGSY 4DN4H 2FEDD 2BZDA 3ABZA 1G7QA 2A9ML 1BQHA 1U8PA 1Q9KB 1OSPH 3MV9D 4PRPD 5BRZA 5TDOB 1C12B 4WO4B 4FABH 3RKDD 5FYKD 3VGAB 2Q20A 2XA3A 1FYHB 4OZGA 1OSZA 5F3HB 4M9OA 5D7LE 1YJDL 2J8UA 4M00A 5C0GB 4PBWD 4M1GL 3VA6A 2NYYC 1X5LA 5TH2A 2YPKA 1YQ2A 1F97A 1X5AA 1GVIA 4TN9A 5I15L 3W9DA 3WLWC 3VFOB 3NABH 5SWZD 3RZWA 4JANA 4KJWD 1CR9H 1QFOA 2VDMH 3X3GH 4F80A 3Q6FA 4HWUA 5C07A 5CCKL 2NZIA 3VXMA 3S88L 1P1ZA 4NGHH 3R8BB 4NO3A 3QEHB 1V8HA 4WUKL 4ZAKD 5DMKB 2DM4A 2HN7A 5FHBL 3B9KD 1NCWL 4XNUL 3U2SB 4FFZH 3HRZB 4P2QE 3DVGB 3HMWH 4N0UA 4O9HL 3NPSB 4M7ZB 1JI1A 3HE6A 3QUMH 5JZ7C 2WUCL 3TV3H 2EH8H 1X44A 1AE6L 3T0EB 2AK1L 5CD5C 2F5BL 1K8DA 2J2ZA 5EZLB 3HUJA 4HUNB 1KTDA 4EUPB 2BNQE 1FBIH 3P9LB 4QNPF 4NP4L 2IH1B 4WHDA 3BP5A 2NW3A 4J8RA 1N6VA 4PRIB 4OCSH 1GGYA 3X3FL 3ZE2F 3P3YA 2AV7B 2FHFA 4MA7H 4YBLB 1ZLUK 4LSTH 5F9DC 3SKNA 3BGFC 1U9KA 3RBSA 3VWJA 3C9NB 1NAML 4L9DA 4Y0GA 5IEHB 2NY4B 1W0VA 1P84J 5CUSL 4F15C 5F7HA 1OGTA 2OXHA 1KCSH 1OD7A 2GTZB 1A14H 3FMGH 1I4FB 1NUGA 4M1DH 4RA0C 5KVDL 3W5MA 2DKUA 3MRFB 1MVUB 3FQUA 2ZUWA 4HFUH 1BECA 3QXAA 1OAZH 3DO7B 5I30H 1FLRH 1FPTL 2BNRA 4H25B 1C5DA 4DWHA 2VQ1B 1FFPA 3FFDA 5ANME 1TIUA 3AMKA 3UPAA 4L8SA 4ZUTA 1XH3B 5IQ7H 4NZTH 3OAUH 4NDMA 2EDWA 1E4JA 3KR3H 4QNPE 3O3BA 2ORBL 4X9GA 1WZ1H 4LK4A 5I73B 2QQLL 4XCEB 1X5GA 1WWCA 1IC4L 2V5RA 3ZE2E 1YA5A 2YK1L 1XF3B 1RZJH 4AM0B 1BOGB 2XYCA 4UOW1 2C3VB 3GSVA 1A3LL 2VLRD 4LP5A 3P4NB 1PZ5A 1CFVL 3VD4A 5ALCH 1AXIB 4KRMB 1YMMB 1OTUC 2I60L 2YZ1A 3DMMC 2JB6A 2AJZB 1UZ6E 1X5JA 4GBXA 1CBVH 2CR6A 4TUJA 1FL6B 3VMPA 3JV6A 3UJIL 1TJHH 5SWSE 3C60C 2R39A 4OBSA 1F58H 3TJHC 3UO1H 2UY7A 4MAYA 4MXQD 2NY6B 1FZOA 1HHJA 4PP2B 1IM9A 1BM3H 4L3AA 1IBGL 5HHNB 3PWJB 1INEL 4HWZB 4ZFGH 5IOPA 5LQBH 3B6SB 2MCG1 1ZAGA 5A16B 1B2WL 1PKQE 2RGSA 1GZQB 2BVYA 1QACA 3P9MB 3TN0C 3QNZA 1I7ZA 2IPKB 4KKCC 5EO0A 4X6DF 1KJMA 3EOYG 4QTIL 5C09E 1H5BA 4OIAA 4LASL 1M7IB 4KWUA 2EIZA 4OLVL 4YHKL 4JO4H 4MA3A 1R24B 1ZEAL 3P4MA 4LGSB 3BJ91 3A6CH 1N6QH 3S5LA 1EJ6A 2I24N 3BN3B 5DJ6A 3AXLB 1B4RA 1OAYH 1BF8A 2OJEA 1CFBA 2D0HA 4DVRL 4FG6D 1VHPA 4ODUA 1UC6A 5DXWA 1QFUH 3MRIA 2VJXA 1ZVSB 4F7EB 3QI9B 3QG6A 2K9UA 2EDBA 4IIQC 3DBXB 4LEXL 3EYUH 4D0CA 4L8CB 4YHYC 5DF0A 4WV1C 2QQNL 3GI8H 1FLTX 5FAAA 3D69B 1MRDL 4YK4C 2A6KA 2YS4A 4PRHB 3V2AR 1G9ML 1EFQA 4LNRB 1T0MB 3MCKA 3LN5A 1RZGB 4XCCL 3JWDL 3NTCH 4BYHA 1TZIB 4K8RC 2BSSB 4RMUA 1ZK9A 2Q6WA 3QFJB 3WDHA 4U1NB 4Z5RA 3S96A 3RFZC 1S8DB 3MLTB 1DN0A 3I75B 5EU5A 1X5YA 1QNZL 3C8KA 4JFQB 3MJ8A 3HNVH 3QUYA 4P2QA 1BMGA 3D18A 4QRRB 3F5WA 3EOAB 1PQZB 3HS0B 5B38B 1WTGT 1CGWA 4KMQA 2R0WH 1OOAA 1J8HA 2CUMA 2D7QA 2ENSA 3O3EB 3U4BH 3PJSB 1NBVL 1RSFA 4JO3H 4U6YA 3EJYD 4JHAL 2BNQA 4IOFC 4LARL 1FAIL 5I1HL 1KYOK 3C2AH 3B2UC 1QSFD 4Z0BH 3TCXA 2A74A 1HI6A 1JZ5A 4ONOA 1YEGH 2MMXA 3C6LD 1AGFB 4PJAF 4UNTA 2J88L 1DANU 4XPAH 2JK5A 3T65B 2W60A 1I8KA 5F7DA 1JHKL 3ULVL 1TETL 1ZS8A 2E9JA 1F11B 3WL9A 3KYNA 4UILL 2Y06H 3F58L 5T3ZL 5DUBA 1MFEH 2FX9L 3A6BL 1R5IA 4R96B 3W0WB 5MEQA 5I1KH 5GGVY 5ICXB 3MXVH 1NGYB 4JR9L 4HKXB 1N5YL 5HYJE 2BP3A 7FABL 2J12B 4R6UA 2A9NL 1R3IH 2XQYK 4PY8I 2QSTA 4FQPA 5GSVA 2NTFA 3RL1B 4LDEB 3K2UH 3IFPB 3NZHL 5INCB 4UT7L 5DVOA 1T89A 5L9DH 4JM2A 5CIPA 3BQUA 1NSNL 4NQDB 4K3JH 4ONFH 5FOBA 2JIXB 1XGYH 4G80B 1ZV5A 2R23B 1YEKL 5ANMA 3QIWA 5IF0B 4IRJB 2AJYL 3LQAL 4OLUH 2ADJA 3QO1A 1C5CL 2X1PA 3LSOA 3TEUA 3QCVL 2CKBL 2HKHL 3H42L 4OSUL 5EU6D 3V0WH 3WE6B 4ZODA 1HHHB 4P59H 2IMNA 2AABH 4MXVF 4PJAE 3MUJA 3DPBA 1ONQA 2ERJC 2VDOL 1MJ8L 2WIIB 4BK5A 3TZVA 1U8MB 4DKAA 4QHNA 4M7JH 5JOFB 3QDJD 4GLRI 3GB7A 1IGJA 3O8XD 2NY7H 3ARDB 4EN3B 3PQYE 1BFOB 2H32A 4AYFA 8CGTA 5DC4B 2GITA 2VLKE 4L3EB 1BFSA 4ZPTB 4HIJB 4R0LA 4ETQA 1A1OB 2FBJH 4XP9H 2YHGA 5ADPH 2V7NA 2ICWJ 4Q6IC 1FE8L 4KJYB 1PKQA 4OLWH 2GT9A 1QPXA 3CMGA 1F3RB 1A7RH 1DVFC 4ZQKB 1FZJB 4KJPC 5C6WH 5C09A 1JZ3A 3MNVA 3ZMRA 5T1LB 1CS6A 4LGRB 4QKXB 1BX2B 4W6YB 1WC7B 2WK2A 5DHVB 3RPIB 1FG2B 3BT2L 4YC2B 3P30L 3QJHA 4R7NA 4JKWA 4NNXA 4PJDB 2P4AB 5E08L 3BZEA 4R7DA 3AS2A 4MXVE 1VERA 2VLJE 1IGYA 3GSOA 3QHZH 3O11B 3ULUD 1KJ2H 1K5NB 3VFRB 3BUYA 1I3UA 3KLHD 2W0LA 4NO0A 1NGZA 4Y2DD 2AP2A 4LCWB 5JOPD 1G0YR 5DD6A 4PGEA 3GI9L 1YN7B 1AGEA 1WV7T 3WCYA 3CDFA 4UBDD 3PV6B 4XHQA 3QWOA 1V5JA 2NCMA 4NHUA 4OJFH 1XAUA 4YFLF 1JPTL 5L6YH 2LTQB 1TPXB 2UUDH 1AD0B 3S6CA 4OFDA 4AEIL 1ZHBB 3QA3A 1QR1B 2DQGH 2FEEI 1EO5A 4H0GA 1S9WA 1E4XL 1MRFH 4K8RH 3IDMB 3BJLA 3QUXC 3MLVL 1RK0B 4Q2ZB 2GCYB 3CLFH 4P46B 4JGMA 2CMRH 2Y72A 4MVBD 5BXFA 3EYQC 1PLGH 2Z8SA 2DQFA 1JHTA 3VDAA 3M1BB 4TVPE 3IDJA 4NO2B 3D25A 1AXSA 1KCRL 2OP4H 4ZUWB 1I85A 3RI5F 4C83B 3F12B 3NA9L 3FT2B 2XN9E 1NC4D 2CGRH 4N5ED 3MLXL 3SCMA 4JJ5B 2XQBH 4NOFA 3UZEA 4K7PH 2I9TA 4LEOA 5BS0D 1UCBH 5JMOC 1UM5H 2QJDA 3PABA 4UAOC 3T0VA 4YR6A 2X4OA 3MCLL 1VENA 5I8EA 3UTTE 4P2YA 5GSRA 4RRPA 3SKJL 1X5ZA 2NY2B 3S36H 5HDOA 2AJSH 5C0AA 2UVFA 3LV3B 2YC1B 1MJ7H 1BQSA 1E6OL 3SDDD 4N0YH 2NY5L 2VRAA 1AD9A 2ZSVB 4C55A 3MV9E 2YA0A 3IDYB 1A2YB 4PRPE 1A6PA 3Q6GL 1YQVH 4PREB 4BFEA 3T1FB 3HI1B 1RZ8B 3GSNH 4NFBA 3MRBA 5FYKE 1HXMA 1ORSB 3GHEH 2KQMA 1DQMH 3BZFA 3CFDA 2W0FA 2ZPKL 1G6VK 1RQ5A 3LRHA 2EYSB 1BEYL 3D3VA 4U6HA 2ATKB 2VO5A 1UM6H 3TH3T 2HFGH 4RAUA 5EZIL 1OF2A 4OV6F 3CIQA 4Y4HC 3T0AA 1B0GA 4ODVH 2NZ9C 5FHAL 5SWZE 3QEGL 2FL5A 1Y0LB 2FATL 2HVJB 1FZKB 4XMKL 1R5VA 2B1HL 5CBEB 3LRSB 4AEEA 4GG6F 5CJQL 1FNHA 2HT4D 5EC2B 4S1RH 3BUTA 1OAKH 4WWKD 4YXLH 2DD8L 1AKJB 2HFFB 5JXAH 3E8UL 1L7TL 2BMKB 1Z6JT 1ZTXL 3HFML 1YY8A 4I18C 5B3NA 1V05A 3LEXB 9CGTA 4P57A 1HOCB 3EYFA 4ZXBD 1KTLB 3PQYA 1FGVH 1G7PB 2VLKA 4LPUA 2OTUA 5DQDH 5A1AA 1WUNT 1MQKL 2HT3C 1KFAL 1DSFH 2R1XA 3FOMA 5I71C 3VXOA 3PDOA 4ZO8A 5HHQA 1U92A 4PJ7A 3O2VH 3CVHA 1JBJA 4ELKA 4UI2A 5J6HB 2YD8A 4KQ3L 1JUFA 2VXTL 5EPMB 4JO1L 3C5ZD 2IBZY 4X6BB 5HXMA 4LQ1A 4LPTA 4K3EL 1S9KC 3CUPA 2AJXL 1ZA6B 2XPGB 1U93B 4ZPVB 2XZQH 1REIA 5GJTH 3OKLB 4FFWC 1YEEH 5F7UA 2AKRB 5JQ6L 3MMEA 1ZGLA 3TBYA 4NO5A 2BOCA 4J12A 4GW4A 1MQ8A 1FFNA 1FNGA 5C3TA 4ZFFB 4JDVA 3I9GH 3MV8D 2VLJA 3VXSB 2D03L 1RZKL 2EZ0D 1NCTA 1RI8A 1RULL 1HSAA 4LSRH 4F2MB 1HQRB 5ICYA 3NIDF 3SJVB 1D9KC 4NQXA 1FDLH 5HHVH 1A7QH 2YD1A 4LRIA 4XX1E 5D2LF 1OGAA 1JWSA 3CXDL 4PY8J 3ILPA 4LP4A 4KROB 2ATPA 4LHUB 3VWKA 2EDHA 5C6PB 3QIUD 2JJWA 1RU9L 2H8PB 1VGEL 2EE6A 2E8ZA 5ACZA 4PB0L 3RWIB 4ZO6A 4JZOB 5F7MC 1XF2B 1ZT4A 4AENA 1OLLA 4MCZB 4QY8A 3LPGA 2GK0A 4MNQB 2GUOA 5HI5D 4DFIA 4L4VB 5AWNH 4HGKC 2VLRE 3OG4B 3ES6B 2V17H 3GMNA 4P5MA 4YHOL 4ZYKA 5IMLA 1X5KA 2X9WA 2VMFA 1WZKA 5F9OH 4WO4C 2PO6C 4NUGH 2EO1A 2RIKA 3RHWF 1NKRA 5FECA 3QQ4A 5HY9B 3DV4A 5DVNA 3DRQB 3WIHA 3U30B 1YY9C 2XWBB 3H8NA 1A7NL 2VC2L 4B7LA 1WWWX 4KFZC 5FKPB 3SQOL 1HEZB 3ZE1E 3BIBX 3NIDE 1G7IB 4LLMA 3I6GB 5ESQB 2WIMA 2ARJQ 1MFAH 3S4SA 4MAUL 3L3JA 5CFHA 3KYMB 1NCDL 1BP3B 1DQJB 3VFNB 1WJ3A 1NUFA 1L0QA 2O26U 2FD6L 4PRAA 5GHWH 1ADQH 4X7EC 5HHOB 3MA7B 5T1MA 2XIDA 5DD5L 1W72L 2C4XA 2IQ9H 5F1NA 4Q0XL 5EULV 2VUOA 4M7ZC 1JF5A 5CEZD 3RWEB 1KSRA 2QR0B 1BIIB 1HH9B 3BIKA 3MV9A 3DX7B 1CXKA 1VEOA 3G5XB 3NGBC 4PRPA 4MJ4A 3V0AC 1F3DH 3KLAA 4JB9L 3QRFM 3FRUA 4FQCL 2YSSA 3BPCB 5EIIA 4U7KA 2Z31B 4XNXH 1CLYL 4R97B 4GRLD 3UX9B 3G04B 3PWUA 2HJLB 2P24A 2HWZL 5KG9A 3ZSTA 2X7LB 1T1YB 5SWZA 3SE4C 1Q94A 3WIFA 2BNUB 2EYTA 1E6JL 2FJHA 4HG4K 5FB8B 3ZT6A 5C0BD 1CT8A 3DJ9A 4QXTB 3MOQA 3S9DB 5DJXB 2J5LC 1EK3A 3PHQB 5FA3A 5LKNA 1A4KB 1VACA 1CU4H 4JQVC 2ZUVA 3B9KA 1EGJL 3BZ4A 1H0DB 3ECBA 3DSFL 3NFNA 2LAAA 2WLZA 3F7VB 3AFLA 1CG9B 4IM8A 3RUGF 5DD1H 2A6JA 1YEHH 2V5MA 1S5IH 4GUPA 4I77H 4JVPA 2ITCA 5A3ID 4L8DB 2JB5L 1CXIA 1OW0C 5D8JH 3DIFB 4NRXA 2ITDB 4XAWH 2ZUXA 1IGFL 1JNNL 1T7WA 3D39B 1QSFE 2VE6B 3FL7A 4K07A 3RWDB 4CU7A 1F3DJ 4JPWH 4EDXB 1DCLA 2RAMA 3BYTA 3A0OA 3W39A 4JDZB 1VFAA 1OAUH 3LPFA 3O6KL 1LO0H 1UT9A 3NBNA 5FM5M 3RX7A 3SKMB 3D5OF 4F58L 5HHMB 3H3PH 4NCC1 15C8L 1M05A 1ZVYA 4NQCD 2R56L 2B4CL 5I1CH 4FQJH 3VJ6B 2H3NB 3MLSH 1G7LA 4ZO9A 4YAQA 1JNHA 4Y5XC 3CH1A 4G7YL 3MBXL 5IFJB 4NYLB 3HNSL 3VMOA 1YECL 3O0RL 3PL6D 3V79C 2VDKH 5HD8D 1YUHA 4MZ3A 3SDAD 1W72B 2EE3A 1OY3B 2VISB 1SYSB 3VGGA 3RUGE 4NKQB 5EFIA 3DECA 2F74B 3O41B 3AU1B 4H1LA 1A6AB 4JFPB 43C9B 1C8PA 3ZL4L 1WZLA 4XH2B 4U33A 4Q9QL 1UH3A 2DQUH 3DSNA 5DRXB 2R9HC 5EU6E 3RGVB 5I18L 1U8KA 4D9LL 1FFOB 4RAVA 1KB5B 3FHAA 1JWUB 2B39A 1BD2A 1TCRA 4NNPL 4KPHL 4WJ5A 1F42A 4ODSL 2VLRA 1A5FH 2YPLB 1M7DA 4H20H 1R3KA 4IHOB 1NFDB 4I9WD 4P23B 2GEEA 5E5MA 4XCNB 5FO9A 5L7XL 2DLGA 1WITA 1DR9A 3QDJE 5EA0H 5GS0H 3MYJA 4RFNC 2HVKA 2MKLC 3PHOB 3QB7C 1TZHA 5I76A 3QNXB 1CTOA 3MZGB 3SN6N 3K81A 1YNLL 2MHAA 3B2VL 1SEQL 3HPLA 4R4BA 5D7SH 4DW2H 1JPFA 3BISA 3PUCA 3HZKB 1S7XA 4OCMC 4WU7A 3HMXL 2CD0A 1FNSL 3GSWA 5EWIL 4OZIF 3LKRA 4M62H 4HK3N 3OSKA 1OCWH 3O6LL 4YXKH 5KOMC 4EIGB 4X7TB 3I6LD 1JPGB 3FO0H 4LL9A 5DEFA 4MQXD 4FQXD 3WFBL 2FIKB 1U3ZA 4LGPB 5KS9E 5MERB 2MQ3A 5F72S 5J11C 3GDBA 5IB4B 2K1MA 5SWQA 4I8DA 1CGUA 2VDLH 5HGHB 1WBYB 3MXWH 5E6ZA 3C5JB 1KV3A 5JXEC 2WM0A 5DMYA 2A1WH 5IT2L 3MNWB 5F89B 1DP0A 2H45A 3T0XA 3LMJH 4LLWA 4POZD 5DK2A 3ULUE 2APFA 3X12B 4HG4J 4HWNA 4EUPH 5C7XH 2WWKT 3REVA 5JOPE 3ZHLA 2IANE 4JY6B 2NLJA 2P8LB 2NW2A 2DQIH 4I3RH 2AEWA 3O6MH 4ZMAT 4HPOL 5I8OH 1T03H 1B0RB 3P4OA 4V1DA 4JFFA 3ILQD 4LMQI 4RGNB 5BVPL 5HGGS 3WHXB 3O6FB 3MJ7A 4OZIE 4ZSOE 4CL7A 5L0QC 1TNMA 4XNMA 5IFHH 2WWKO 3KWWA 4OD3L 1MFDL 4X4ZA 4U1IA 4TYUA 1I1AB 1SBBA 3MRMA 4P4KD 4KDTA 2DYPB 5JW5B 3DUUB 4HBQA 3CFKB 3JV0A 3JV4B 4TULL 3VFMB 5HSFA 5GRZA 1YNTB 2HTKD 3FB5B 4I0PA 5MENB 1D5BA 2JJTC 1MIEH 4L5FH 3JSSA 4LPXA 5I6XB 1RIHL 4IRJC 1QSEB 4DN3L 3B5GA 4FQHB 4LLQB 5KVEL 25C8L 3CD4A 1J10A 3VRLF 1FL3A 3NFPB 1GH7A 5BS0E 2X4SA 5E4EB 4HBCL 3RVXC 5JHLL 2P46B 4OCRH 3C6LA 3N1GC 3V5HA 5DLML 1NKOA 2ARJB 1V7NH 2DTML 4YHZH 3ARBC 1NAKH 4JLRA 5SX5H 5T1KB 4HGWB 5I17B 5FYLD 4LOUD 3G5VA 1CICC 2E9IA 1N8ZA 1NLBH 5GRWA 1II4E 4NQED 3HZMB 5D9SB 5IFAH 1BQHB 3U46A 2YD2A 3BHBA 3H9YA 5KJRL 3BGAA 1LO2H 4PYHA 1NCWH 3U4EB 3WN5B 2WLYA 3WV0A 1F3JA 3ARTA 2DLHA 5DYOA 1OQOA 3D9AH 5FOJA 1CD1B 1DBML 3I85A 4F8QA 3HB3D 1OSZB 3M07A 3NCEB 4OF6A 1YC7A 2F53B 1AE6H 2OR9L 5IHUL 1F6FB 5ITBH 2YPKB 1A1MA 3CLEH 1NPUA 3GIVA 5E03A 1NCAL 3DTXB 4HCRL 5HGDB 4XAKD 3VRLE 2XT1B 1I1RA 3L9RA 43CAA 3OR7A 4JANB 4YC2C 2UWEF 1ERNA 3MLYH 1SEBA 2VWEE 3Q6FB 4NP4H 3N1MC 4WENB 3K8LA 3LS4H 2DDQH 4X98B 4NO3B 1Z2KA 3ARED 4LAQL 2FO4B 3T2NL 1CQKA 4CADA 1IEAA 1UXSA 3QDJA 5HYQA 4N0UB 2E27H 4PJXF 4RDQG 4NZRL 5D93C 1L6XA 3ZHKA 3HE6B 4PUBL 5CUSH 1HKLH 3HZVA 1M6OA 4PJ9D 2XNAB 3QZWB 1A4JA 1K8DB 5KVDH 4XPFL 3HUJB 1GC1L 3WEXB 4JRXD 1FQ9C 5EU3A 1EEYA 2EDXA 4L4TE 2ZSWA 3OR6B 1E28B 2NW3B 4CDHA 3MOAL 2F5AL 4G6FB 3T2QA 2C3GA 3KXFA 12E8L 4PRNA 2WBJB 5HYSG 5KS9A 3MJGX 1EEZA 5IHBA 4LCYA 4Y5VA 1IZKA 1PVHA 1K6QH 2GJ6D 1RIVL 2J1KA 1TITA 5C0RH 4K7PY 1J87A 2UWEE 3DHMA 3VWJB 3CXHJ 2NXZD 2ORBH 3QUZD 4ESKA 4Y1AB 3MV8E 4Y5YA 3U7YH 3CX5K 4UQ3A 2BC4A 3QH3B 3DUSA 3IJHA 2YD3A 1B9ZA 1OGTB 1A3LH 5BW7C 3VXTA 3UBXG 3H7BA 3FQUB 1R5WB 4O5LL 3K4DA 4AG4L 5I1IL 1KJVA 4PJXE 4Z7WF 3ZKNC 3BO8A 2X70A 3UJIH 5GS3A 3LRGA 2E7MA 2BNRB 3NZ8A 1C5DB 1FFPB 4LF3B 2E7BA 4TTGA 1MWAL 4L8SB 4ZUTB 1DEDA 4NDMB 4OZIA 4ZSOA 3EZJB 3QQ3B 5GRVK 5A2LH 3TO4C 3T2PA 2BCKB 1PY4A 1RD6A 5J3HD 3IDYC 4EOWL 1CDUA 1PZ5B 1P4BL 2X4TA 1KIRB 4P3DA 1F4WL 1DBJL 1ZEAH 4OT1H 1V3JA 4XVJH 4GBXB 5KSBA 4O58L 3CSPA 1FH5H 3H9SD 1S9YA 1NC4A 1JZ2A 1FZOB 1IM9B 4YGVA 2JKXA 4RMVA 4YDKL 1DQDH 5IOPB 5HDQH 2E6PA 3MGAA 5F8RC 1X5HA 4Z7WE 2A77H 4LEXH 3GHBL 4A6YA 3IFLL 3FTGA 3QDGA 1H3GA 3QNZB 4Q58C 5EO0B 5TPWL 5EUKA 2FJGB 4GAJH 3O9WB 1MLCA 2NNAA 3UAJC 1G9MH 2HYMA 4WCYH 2EIZB 1W8NA 4MA3B 3C2SA 3CJJA 5DVKA 3P4MB 3BEVA 3THML 4X6EA 1MJUL 3QI9D 5CEZE 1WSST 2DBLH 1KUMA 2DWDB 1T7XA 4QOKD 2CXKA 3L3HA 1HXYA 1XGTA 3PE9A 3OKMA 3MODH 3V4VH 2OJEB 4O00A 4KKAC 1FRGH 4PRHD 5KVFL 1IAIL 5J57B 5FKAA 4X0KB 4KVCH 1NFKA 3MLRL 4KI5D 4P99A 4D0CB 2V5YA 4L29A 2PW1A 4YWGH 3MUZ1 3WD5L 5D7LB 1Y6NR 3REWA 3S3JA 1FJ1B 1AGCB 3UTSD 5GS1A 3QQNA 1IC7L 3QFJD 3DETD 4KY1L 5SX4H 3TA3D 4JKKA 3BYYA 5DHVH 5C0BE 1JGVL 2W65A 1CE1H 4JHAH 3OTTA 3MCKB 4MWFA 5E2JA 4I48A 1FIGH 5F9JA 4XC3L 5FIEA 2BY1A 1WIPA 4WWKA 2IAMD 2F19L 2Q6WB 3KJ4B 3HN3A 3EDDA 3S96B 5EU5B 4E9LA 4WFFD 1JHKH 3SO3C 3MJ8B 3QUYB 2WBKA 2OL3A 4Z95L 4P2QB 1Y18A 3FQXB 3TBWA 5DR5H 3D18B 4ZXBA 3F5WB 3EHBC 3T3MF 3QPXL 1I8IB 1TJGL 4KROC 4HWBA 4Y19D 4PGBA 1NGXB 5FYJD 4JR9H 4DK3A 4RNRA 1K3ZA 5I75C 1RJLA 1NCUA 3F8UB 4DGVH 5GGQH 5D2NE 3JZ7A 1ZSDA 1S7SA 2BNQB 4OF8A 1AJ7L 1FC2D 4LNVA 3C5ZA 5I66A 2QADB 1WTLA 5JLZB 5LWYH 4JAMA 4MLIA 1A1NA 3GNML 3CK0L 2HA1A 3C09C 3LQAH 5D1QC 3RY6C 1JGUH 2W60B 4XP6L 1A64A 1I8KB 5F7DB 3S37L 1ZS8B 3WL9B 3KYNB 3QCVH 3NFSH 4NQCE 4XT1C 3I3BA 4YZFF 3WLBB 5MP6H 5DUBB 1BIHA 3H42H 4LIQE 4OSUH 4M93C 3V95A 2LU3A 2WP3T 1R5IB 4HDIB 3NVQA 4YO0A 5KAQG 2LABA 4PJ8D 2OZ4A 2VDPL 1KN2L 1NMCB 4HV8B 2IALB 1YYML 1EEUA 4N68A 3RAJH 4KTEH 4M1CD 5GSVB 4K3DL 2NTFB 3KDMB 4U6XA 5BMFL 4PJXA 3T3ME 4KQ4L 5CIPB 3QIUA 3BQUB 5HYFA 1TTUA 1AR2A 5FOBB 1U2CA 2W59A 1C5BL 4QHUB 4FNLH 1PZUB 2IJ0C 3R1GH 5E1AA 5ANMB 3QIWB 4YE4H 2WP3O 3V9FA 3RDTA 5FV1L 1PY9A 3TESA 3DURA 1L9NA 4N1HB 1SMOA 4WW2F 1K85A 4P3WA 1BZ9A 2DJ4A 1W0WB 5T5NF 3SE3C 1OT1A 3KPLA 4I9WE 3ARDD 4HFWA 4EN3D 5AD0B 4X6CA 4KVNH 4HH9B 4FQQA 3PWLA 5CWSA 3UROR 4U1HA 1VPOH 1ONQB 4M9PA 5EZJB 4HXAH 3QIBC 4OGAC 3TGXA 3GSNA 4YZFE 4QYOA 1MRCL 4QHNB 5E8PA 4QGYA 4DZBA 5JW4Q 3TVMD 1Q72H 2X1OA 3P30H 4X8XA 1IGJB 1T21B 4K2UL 5EBWA 2VDQH 5SWSB 4H26A 3SGEI 4H8WC 1U6AH 2W9DL 4TSCH 5E08H 2H32B 2GITB 1QLEH 4H0IA 4M5YL 5I8KH 5F7WC 4FMFA 4UT6L 1RFDH 3O2DA 4R0LB 2DLFL 2EC9U 3NIGF 3BKML 3WFHA 3T4AA 3I6LE 1PKQB 4G8FB 1MHHB 4UTBL 3GI9H 3RWHA 2GT9B 5CMAA 2EDKA 1A7OL 4ZTPL 2PW2A 1XIWB 3TPUA 5HYSA 1KEML 2K7PA 4NC1C 4W6XB 5C09B 3GBML 5GPRA 1B0WA 4LCUB 4C4KT 4Q6YA 1HHGB 1JPTH 4TUOA 4UU9B 3WMSA 2SEBB 5C1MB 3ULVD 5F1IA 3QJHB 4BSVA 2GYSA 4UIKL 4H5SA 4JVUA 4R7NB 1IAOB 4X99A 5T3ZD 1NBYA 2ICCA 4JG1L 5D1ZD 4R7DB 3MCG1 1IGYB 4LKXA 5IB1B 2XTJC 3BUYB 3KLDA 4QRUA 3HNTL 3OMZA 5D7IF 4NO0B 2B7DT 1NGZB 3CFEB 1A3QA 2AJ3A 4C4KO 4GRLA 3FAXA 4WHYG 1KCRH 1AGEB 1EH9A 4MCYA 1VGKB 2LQRA 4HJGA 4NSKA 3TJEH 4BJLA 4PLKD 2ZUQB 3CNKA 3WLWD 5C0BA 2PUQT 4PG9B 1EJOL 3BP6A 4KKLD 4LQFL 4N90D 2DLIA 2H1PH 2DF3A 4U6VH 4BQ9A 4OIIH 4JG0L 2DWEA 4D8PA 3QA3B 5CJ5A 3X14A 1FSKC 2LU4A 1S5HA 3C8DA 1RAMA 3IVKB 5CLWA 4X6DB 3H6JA 5C6TL 1KIQA 3MOBH 4HUWA 2FB4L 4YLQT 4M61A 2JELL 1T2QL 1OM3H 4EUPG 4OFIA 5C8JA 3IETA 1P6AB 5BXFB 3S3SA 4JM4H 1JHTB 5C2UB 2CDGA 1LEKB 1E6OH 2BVQA 1HYSD 4OZHF 2NY5H 5JZ7D 1AXSB 3D25B 4HX1A 4XNZC 5EOTA 3UTZA 1FN4A 2V2WB 2BSED 3Q6GH 3KPTA 5DUPL 5D7IE 5D2NA 3QQ9D 3V5DA 4WUUD 2ZPKH 2OS7A 4LEOB 3QWQB 4R9HA 3F6IA 5ISZD 1MHCA 4IRZL 3WNPA 3ZDXF 5GSRB 3X13B 4WFGD 4U1SA 1BPVA 4HC1A 1LMKA 4IMKA 5FYLE 2O5XH 2MTPA 4F7MA 4NQSA 3BDYH 5CJQH 1L0XA 1MAML 2YA2A 3ETBF 3UMTA 4NQEE 2GSIB 3NA4A 4LVNB 1XF4B 4WTXA 5HYJB 3STBA 2XV6B 3PL6A 4TSAL 1CK0H 5DJYA 1I7TA 3BWAA 3HZYA 4Y16B 3SDAA 4DKEL 3E8UH 2F8OA 2HRPL 1ZTXH 1HXMB 3BZFB 3L7EA 4OZHE 1S7RB 4U6HB 1AGBA 5J4MA 2YXMA 3TF7C 4OAWA 4RAUB 2XZZA 1OF2B 4LSQL 4XAKE 1SJEA 1B0GB 1OB1A 3L5HA 3LN9A 1ADQA 4RX4A 2BK8A 3FB6A 3BESR 4NWTL 3FKUS 4TVPL 1CFTB 4X5WA 4KAQL 5JUEL 3VGEA 5DJ0A 1WAAF 4JDTH 1P4IL 1DBBH 3K8KA 4PJAB 4D0DA 2HG5B 3EDJA 2AJXH 1IQDA 2Q1EA 2XKNB 4OLZL 1UWEL 1AGDA 3U1SH 1YY8B 1ITCA 3DVNA 3ZYIA 5JQ6H 1VESA 2X1QA 3EYFB 2V5TA 3C60D 3PQYB 4LPYA 2VLKB 2OTUB 3K7UA 4DEPB 5FO8A 1TCMA 1MFBL 1RULH 4JRXE 4RGMC 4F8TA 3PDOB 5HHQB 3VH8A 4NZUL 4O02H 1U92B 5F88A 2AJVL 1SYVA 1HNGA 4Z7VF 4FQXA 2QHRH 3OAZH 4LPCA 3TH2T 3T3PE 2WUBH 2HTLC 3N06B 3RY4A 1J05B 4JFOA 2LVCA 2GJ6E 1VGEH 2VR5A 4W70A 5D4QA 5L2KD 1XF1A 1P6FA 3OJDA 4PGDB 3KPMA 1ZLWH 1A8JH 4FMKA 4KJQC 5FUOL 2XY2A 4FQ2L 4UQ2A 2JCCE 3MMEB 4B7IA 3RWGA 4NO5B 2BOCB 4LKCB 4GW4B 4LCIL 1WAAE 4J3WA 3V4UH 3SDYL 5EU7E 1FFNB 1DJSA 5B4MC 3V6BR 1ZT1A 2VLJB 4N0FA 4FQLL 4MD5A 2C1PA 1CGSL 3SGKC 1HSAB 2HFEA 2I9LB 2NQCA 4F7TA 4QTHA 5CJBA 1DQQB 4NQXB 2VDNH 5D72H 5SV4A 1PG7L 3V0VB 2BX5A 1SM3H 5F6HI 1JWSB 3ILPB 3OF6D 4WGVB 2ATPB 3VWKB 4KZEH 1RZFH 2C1OA 3TYGL 2DLTA 4GKOA 5MI0B 3SQOH 1MHEB 1TJIL 3IGAA 4JGUA 2F15A 3HPJA 1WIOA 1DBKH 1U95B 1ZT4B 4AENB 1R3JA 3CU1A 5B38G 4NKIH 4QY8B 1I1FA 4OF7A 1ND0B 1NCDH 1IGCH 1YC8A 4Y4KB 3N9GH 4P4KA 2R15A 5E2VL 4Y4FD 3GMNB 4P5MB 1HZHH 2FD6H 5JIKA 5IMLB 3RIFK 1NJ9A 2A0LD 1XGUA 1W72H 5DC0A 4Z7UA 4KI5F 3MO1B 4Q0XH 1RUML 1HWHB 1CXEA 4NKOA 3H9SE 3DV4B 1NGQH 3OZ9H 3EBAA 4NPYA 2N7AA 1R3HB 2XN9B 1T66C 1XR8A 4LLMB 4LLUA 3ULSA 4YHLH 4IOFD 1KB5H 3ARFD 3S4SB 2PETA 2UZIL 4FXKB 3L3JB 3LHPH 1FGNH 3B2UD 1Q38A 2DS4A 2JE8A 1Q9KA 3UTTB 5IB5A 4PRAB 3UTPD 2XA8L 2YD7A 1SQ2N 1EEQA 4R26H 3UC0L 2VXUL 2DAVA 4AL8H 1RVFH 4QOKE 3SPVA 5J7CC 3MFGB 3NIFF 3HE6C 1M1SA 3GMOB 4D0BA 3MV9B 5JIIA 5D7JD 5DJDA 2Z35A 4PRHE 4AIXA 4MDJB 1KB9K 4YQXL 3VFOA 3KLAB 3SE9L 4N8CL 4KI5E 4BUHA 2GJZA 1SJVA 2YRLA 5DQJB 1AQKH 3NOIA 3UTSE 4WI2A 6FABL 4HKZA 3PWUB 3QFJE 4BM7A 1S7QA 2P24B 5SWZB 3E6HB 2CUIA 1Q94B 3NN8B 3V4PL 4JN1H 2DMKA 2KZ1B 4XPTL 2EYTB 2KQNA 3VWJC 1CT8B 3VG9B 1A6VL 1VFOA 4XPBL 4ELMF 4ZAKB 3AREA 3MTRA 4HULB 1RZIB 4OD2A 1QBML 3B9KB 5CINL 3O6KH 3BZ4B 4WFFE 1MFCH 3ECBB 1NMBH 4HAFA 1YZZA 2C26A 1CL7L 3TFKD 4JRWA 4KI1A 2AW2A 2ZUSA 3RX5A 3P9LA 4OM1L 3NIFE 15C8H 4Y19E 2HH0L 2R56H 5FYJE 4L1HA 4PJ9A 3OGCA 4XPGL 1U58A 3CVIL 1I1YA 2R69H 2AV7A 3IDIA 1GCFA 4G7YH 4GUPB 3MBXH 3ME0A 1CTNA 5K9JL 5FUCE 2ITCB 4L8SC 4TOYL 4F9LA 3O0RH 4UDUA 4X4YA 5C70A 4NRXB 1N0XH 3U6RA 5DRZB 3HR5B 2NXYD 2Q8AL 4LRNL 4D3CH 1EVTC 1F2XK 2AXGB 3W39B 2GTZA 1VFAB 2GJ6A 3RZCD 2H2PC 5K9QI 4UZGA 1AHWB 4Q9QH 1MVUA 5I18H 3AB0C 1QKZL 2JCCA 4Z0XB 3RL2B 1M05B 3MV01 1KPRB 4HUXB 4NNPH 4KPHH 4ELME 4XVUC 4KK8D 5JORB 4MAYC 5JIPA 4YIQB 2AXHA 3NAAH 2VQ1A 2FO1A 4YAQB 1IZJA 1PFCA 5IB3A 2VKWA 3DOSA 3OB0K 2L0DA 4J6RH 1XH3A 3ARXA 3K4ZA 4RBPH 2OTWA 3EO0B 5CZKA 4PTTB 1T7VA 4GFTB 1MCJA 1QBLL 1XF3A 4FN0A 2AGJL 5EFIB 2FYYA 2DQTH 3CX2A 4H1LB 1H5BC 2DI8A 1A9BA 3B2VH 1SEQH 4FHBD 1Z9MA 2MPAH 4FP8L 3RVVC 2OJZL 2AJZA 3HMXH 3NCCB 1FNSH 3FFCD 4XNYH 5DZOA 4LBEA 4WJ5B 5I74C 4XBEH 3LH2L 1F00I 3QUXD 1M7DB 1R3KB 4G6JH 5KSAC 5DJ2B 5E5MB 5HHNA 1CN4A 1GAFL 1DLFL 1ZMYA 2QQKH 3B6SA 3EYQD 3MYJB 3IF1B 5GRYA 2AK4D 1FP5A 3H9SA 3P9MA 4HIXH 1JGLH 3I02A 4PV8A 5BO1H 1EO8L 4GAGH 1MELA 1MIMH 4PGCB 1NL0H 3HPLB 3AS3A 4R4BB 1BHGA 2HMID 4N8VB 1JPFB 3MBEC 4LU5L 2R4SH 4WU7B 4DUXA 3GSWB 1PBYA 4DKFL 3LKRB 3MRKA 1MCLA 4HWEH 4IS6A 2YBRA 3AXLA 5JHDD 5DK0A 1F2QA 5DEFB 2APBA 3ARGC 1UA6L 3ROLA 4J4PA 3L3DA 1ZVSA 2Q7YA 3QUYC 3QI9A 4F7EA 3I84A 4HKJB 3ULVE 3H7LA 4H88H 4AEHL 2XZAL 3DBXA 1KEGL 1R3LA 1W0YT 4QOKA 5T3ZE 1NAMA 4KRPC 4L8CA 3KYOB 4GH7B 1MCHA 4GRWE 5I1LB 3MLZH 3VFGH 3VFUB 4PRHA 1Q9LB 5I1JL 3FT3A 1FVDA 1LO5B 1QG3A 3OHXA 4X9BA 5A43C 1T0MA 2G9HA 5CHNB 2OI9B 5DI8A 5K59F 5CD3A 2CDEA 1T2JA 4X4ME 4RFEA 2NLJB 2NW2B 2QADC 1X4YA 1TZIA 2BSSA 3UTSA 1RIHH 4OQTL 2YN5A 3QFJA 2ADFL 2DL9A 4DN3H 5KVEH 4U1NA 5LBSH 3RWCA 5AUMA 5IWLA 3TT1L 1O0VA 1F8TH 1S8DA 3MLTA 4N90E 1WBZB 3CSGA 4ODHL 2DKSA 4OGXH 4WRLA 3MJ7B 3GSRA 1AQDB 4QRRA 3FN0H 1XGPB 5HGAA 1PQZA 3HS0A 2IAMA 2DQJH 2EDLA 2X4NA 3KWWB 4JCLA 1QQDA 5SX5K 4U1IB 2AI0H 1WT5A 6CGTA 3O3EA 3MRMB 1T5XA 4LAJH 2GJJA 3QXVA 3W9EA 5IMMB 1OP3H 1T89C 4Y19A 4JM2C 3CC5B 3E6FA 1D5BB 1F4AA 5TF0A 4P2OD 1HN1A 4NJAH 5FUZL 4IOSD 2K7QA 4B41A 3QIWC 1BWWA 3BWUC 1CE6A 5BV7B 1AGFA 3UDWA 2HT3D 5JMRA 3LEVL 5KJRH 1FL3B 4M7KL 1NDMA 4WUUE 2MCPL 2NY0D 2X4SB 1MUJB 1QSFB 3FRPG 4R96A 4HT1H 3W0WA 5ISZE 3C6LB 3N1PC 2OR9H 5IHUH 3IAPA 5T1DH 4WFGE 1EHLL 3V7AG 1J1XL 4HMEA 1NCAH 5E8EA 2DL2A 3TZVC 5HPMA 1NGPL 3CCHB 4O4YL 3CFCH 5E94B 4LSVL 4ELMA 4LHUG 4PJ8A 3VG0L 1N8ZB 2JIXA 3HI5L 4G80A 3BKCL 2R23A 5IF0A 2B2XL 2CSPA 2BY2A 3ZKMD 4LAQH 1A6TB 1A0QL 4R0LC 4LVHC 3LQMA 4OFPA 3JWNC 4JKMA 4ALAH 4PJHF 1YYLL 2VXQL 4GAYA 5BOPA 3RUGB 4UTAH 5L88L 1HHHA 2HP4A 2F54B 4R3SA 3HI6L 2G60H 1HCFX 4J3OC 1GL4B 3BMWA 3MRLA 3ZKQD 2LAGB 3L9RB 43CAB 1U8MA 5GGTL 3LY6A 5EU6B 2PF6A 3QHFL 1SEBB 4HKBA 4X8JA 3ARDA 3WIIL 4EN3A 2EKSB 4K3HA 2W07A 1BFOA 2OX5A 12E8H 2IH3B 4RWHA 3P0VH 4ZPTA 1T22A 4B0MM 4HIJA 1TLKA 1MI5D 4LVEA 4CADB 4YDVA 1RIVH 1SBSL 1UXSB 4YBQC 3TVMA 2PO6D 4YUEH 5A40E 5HYQB 4KJYA 3O8XB 1LNUA 5KW9L 4M7LL 1ZHKB 3LEYL 1YY9D 1IGIL 1U91B 2VXSL 2WBJD 5DA4A 1LHZA 4YFDB 1EZVX 2EICA 1BX2A 4EVNA 1WC7A 1OPGL 3RPIA 5GRJL 1AI1L 4PJHE 1P7KB 5EU3B 4G6MH 4M6OL 1EEYB 1KIPB 5F8QC 4Y1AD 4PJDA 2B0SL 1YPZE 4PRNB 3HE7C 3O11A 1RMFH 1MHPL 1KJ3H 1K5NA 5L2KE 1FNAA 1T1ZB 4Y5VB 5JDJA 2EH7H 3ZT7A 3QFDA 5IJKA 2Y07H 2DQCL 5D1ZA 1P7QD 4FFYH 4Y5YB 5TF1H 3I50L 1I85C 3BE1L 2BC4B 4UQ3B 3DUSB 3IJHB 3PV6A 1K8IA 4QXGL 1ETZA 1PX3A 1P4BH 1XCTA 4Y2DB 3VXTB 3SCMC 3H7BB 3NMEA 5I1DB 3MRHA 1CZ8H 2IANB 1KJVB 1OQXA 5CGTA 1S9VB 1QVOB 4KDVA 4TNWF 3OAYH 5C0JA 1RK0A 3GBLA 2GCYA 3O45A 1F13A 1JV5A 3STZA 4P46A 4YDKH 4QXWA 3RJQB 4XMLH 5EOCL 1AO7E 3NCYP 1IEBA 4OZIB 1I9RL 1DLHB 3CMOL 3KPQA 5E8DH 1IEHA 3RIAF 2CKBA 5D70L 4F9PA 4NO2A 4ZUWA 4PJEF 3K80A 5TPWH 4G3YH 4JFED 4UV4L 4M6ML 3VD7A 3MV11 3UZVB 1P4LA 3P0YL 2Z8RA 5GISL 3B5HA 4RGOH 3U9PH 4BQBA 3SDCB 4RDQF 1IC1A 1MJUH 5F7NC 2P49B 5TE4L 5CIPH 3WSQL 4S1SH 1T2XA 5GS2D 1R0AL 3BKJL 1S9YB 1IL1A 1FFRA 3TLRA 4MMXC 1J0HA 4WW1B 3O9WD 1ORQB 2R0LL 2ZCHH 5KVFH 2QKIB 4W68A 5BS0B 2QSCL 4XWOD 4A6YB 4JREC 5ISZA 2BY0A 2ZSVA 1L7IL 4M43H 3UTPE 5GGRY 1FNLA 1A2YA 1QR4A 1MLCB 2NNAB 3LKQA 1CDIA 4PREA 4U0RB 5B21A 2APTA 2D7PA 3BEVB 1U41A 3SDDB 5IV2A 5EOQL 1RUAL 2IGFH 4XC3H 2ATKA 4PJEE 1B3JA 1CDGA 2HT2D 2D9CA 1HXYB 2H32H 3L3HB 2R8SH 2PTTB 1IQWH 3L3OB 4DEPC 1XEDA 2R4RH 1YEJL 4M4RA 1Y0LA 5IK3B 2HVJA 2PYED 3ZLQC 1W8OA 4JO2H 4WIQA 1FZKA 5FKAB 1MCKA 3HLAB 5CBEA 1UADC 3LDBC 5E2WL 3T0BA 5E8NB 2PW1B 3A67L 1TJGH 2VZUA 3W2DL 3REWB 5E1HB 1MCDA 2H26B 3L3KA 3DUHA 3L3IA 1KULA 5TFSH 3U82B 1AKJA 4GMSL 1JPSH 5AZ2L 2W65B 3LB6C 3ZDZE 4MWFB 5D96C 3SDXF 4EBQH 2CJUH 3HCVA 4WWKB 2D31B 5C92A 2G5RA 3CK0H 1OLZA 4KXZI 4IBLT 4ZO7A 5DS8A 4XP6H 3S37H 1DDHB 3KHOA 5C2BL 5J13B 2OL3B 4DQOH 1Y18B 4LRIC 4ZXBB 4M5ZL 3C60A 2IWGA 3VWKC 3GIZL 4IRSD 1FNFA 5ILTL 4X6BA 4I2XE 5MI0C 1LK3L 1RJLB 1MY5A 2XPGA 5F7EL 1U93A 1MCEA 3OKLA 1KF9B 3BKYH 5BMFH 5GGSB 1ZSDB 3UJTH 1GOHA 4PJGF 4L4TB 3BSZL 4KQ4H 3NCJH 3FRPA 3C5ZB 4U1JA 5EZOL 3TYFA 1YPZA 2Y25A 5L2KA 1TDQA 5HJ3A 4KMTL 1KENH 4U1LB 5FV2A 1HQRA 1JWMA 1FO0A 1UYWH 3SJVA 3SGDI 2UWEB 1U3HD 4XXCA 3MV8B 4NC2B 4LHUA 1Y6MR 2V9TA 3ZSSA 4J3XA 1LK2A 3H2WA 4XPHL 1KN4H 1RJZA 2Z91B 1Q0YH 2Q3AA 5EORH 1S3KL 4F57L 3IJYA 1GGIH 4MYWB 1UXWB 4WHCA 4XWGH 2OK0L 4PJIF 4JZOA 1MRCH 3J8F7 4PJXB 1XF2A 3OF6A 2J8OA 1BBDL 3QIUB 4K2UH 1IC5L 1ROWA 4XVTH 4OI9A 2MSPA 2A6IA 4L1DA 5E1AB 5KTEL 1C16B 4UOJA 4UT6H 2W9EH 3IU4L 5F21B 3NACL 1FG9C 2DLFH 3FFCE 3BXNB 3DURB 2FEDC 4R2GB 1TZGL 3BKMH 4HF5H 5HY9A 3RIFF 1IFHL 2J7LA 4HS8H 4PP1C 3DRQA 2BFVH 3J7HA 4Y4FA 3KPLB 4MA8L 4HFWB 4FQQB 5FKPA 3PWLB 3PNWB 1YDPA 3S37X 3QEQD 3MRGB 2FSEB 2AK4E 4QYOB 1S7UB 4UINH 3PWVA 3KYMA 4QRPD 2AV1B 5EBWB 4OFKA 2IPUG 2WINB 1DQJA 2HKFL 3OKNB 5E95B 1J5OL 4LLAA 1TVDA 3TC9A 5HHOA 3MA7A 1V3KA 4PJIE 4WVRA 3ARFA 4JQIL 4Z7WB 4LIQL 3RVXD 5JHDE 3KVQA 2DOCA 5CMAB 3RWEA 2QR0A 3QDMD 1HH9A 2FX7L 2PW2B 3MA9L 1RUQH 1BQHG 2Y5TB 5F7KC 5T33H 3TPUB 2CK0L 3B9KC 1MFNA 5JW3H 3ARBD 3GJFK 2AQ1A 4HXBH 3WO4C 4CVUA 3O4OC 3ZHDA 5F1IB 5LGHL 5M7QA 1EMTL 4XB8A 5DT1L 4PJEA 4BSVB 3L5WB 4NM8L 4X99B 5D7JA 1NBYB 1RZ7H 5C6TH 3G04A 2HJLA 1Z9LA 1ZHLA 2DQDL 3MRJB 2NTSP 3R8QA 2BJMH 2VITB 4I4WB 1OP5H 4QRUB 3WJLC 4DAGL 3CVHH 3MR9A 4U31A 5FB8A 1UM4L 4QXTA 1A6UL 1S7TA 4AMKL 5DJXA 4M03A 4GRLB 1QEWA 1MCPH 3PHQA 2YMXL 2VB5A 5HVGB 4G9FD 4MCYB 5FGBA 4HJGB 4NSKB 3HC0A 2Z92B 1H0DA 4BA8A 4UV7H 4HGMA 3IKKA 4QXUH 4D8PB 2DWEB 1HHIB 2EEBA 3F7VA 3EO9L 4NOBA 3X14B 1CG9A 3EGSB 1QLFA 1S5HB 1M4KA 1WFUA 4FA8A 3H9ZA 5F1KC 1U8OA 1H3VA 1YEFH 4M61B 3QZWG 4L8DA 3P11H 3MREA 2D0FA 2N4IA 1QLRA 3IETB 3WO3B 1EHNA 1H8OA 3RI5K 5IBTL 4Y2OA 4HMCA 2BVQB 5GGVL 3RWDA 1CXLA 2OMNA 1CQYA 4HX1B 4EDXA 5EOTB 4I2XA 2VIRB 3BPOB 4OFYD 4OLEA 5TGBB 5D2NB 4X7SL 1T5WB 2HRPH 2VL5B 2W0PA 2C3WA 4OCYL 1CDHA 4BFGA 1C1EH 1CXHA 3LKPB 2P45B 1MHCB 4OB5L 3RZCA 4MD4B 4KZDH 4U6TA 2P5WD 3HA0A 5A2JH 4Y16D 1W72A 4NQCB 3VFWB 1NFIB 4JPVL 4ZS7H 2VISA 1SYSA 3V6OC 5JPMA 3SKUD 4KAQH 5JUEH 3FO2A 3RU8L 3WFEH 1DUYB 2YKLH 2F74A 3VFPA 1T83A 1A6AA 4JFPA 4HLZH 43C9A 2Y23A 2OR8A 3PL6B 4XH2A 4GW5B 1GHFL 1EERB 1GZPA 2ZG3A 4OLZH 1I7TB 3S35H 1HYRC 4Z77B 2R29L 2XWTB 1A6ZB 5I8CB 4J2XA 3RGVA 1DN2A 1SJHB 3CPLB 2A2QT 1FFOA 3ZKND 2WANA 4PPTA 3KJ6L 1AGBB 2M1KA 5KANG 5F7LB 5CGYC 4OTXL 5LJYH 4ZFOL 1TNNA 1N7MH 2X9YA 4NQVA 3LQZB 4PLOB 3G6JF 3FFCA 5IW3A 5T3XD 4RFOL 1RHFA 4HK0A 2M2DA 3TO4D 3G6DL 3PHOA 4N0CC 4X5WB 5KN5B 1RK1B 3QUXA 4GKZA 4IJ3B 5D1XC 4P48A 1RURH 1MI5E 1KOAA 2Y9RT 1EGJA 1MCBA 1IQDB 3HZKA 5FYKH 3RVTC 2C7UB 2AK4A 1D6EB 1JRHI 5HVHC 3DVNB 4PFEA 4EI6A 1LO3L 1WZMA 4LCCB 3GBNH 5J12B 4P3CH 3X17A 4TQEH 3D87B 1S7WA 4FQLH 5MERA 5FO8B 3S8WA 4R90L 5IB4A 5HGHA 5K9QG 3RKPA 1WBYA 2VYRE 4YHMH 5IJVA 4PJIA 3VH8B 3C5JA 1F02I 4OCXH 1VFUA 3PWNB 1SYVB 5CEXA 1PG7H 5JHDA 1L4IA 3C08L 4FQXB 3GK8L 5F89A 4OZFA 3EIFA 3VXNA 1Q9WA 3LCYA 3G6JE 3X12A 4KDTC 5KSUB 4I3SL 3C8HA 3GMRB 3WXWH 4DK6A 4WW2B 3OJDB 1IKFH 4EEEA 2XRAH 4I0PC 4AIZB 5FYJU 4JVWA 4JY6A 1ZOXA 2P8LA 1QFWH 2VQUA 4K94L 4YX2L 3HAEA 1ZLSL 1CDYA 5BV7C 1NCBH 1DEEA 4N0FB 2VZVA 4MD5B 1X6LA 2C1PB 4KHXL 5HHXL 1AXTH 2N1KA 5I1AA 4QTHB 1MH5A 3WHXA 3O6FA 1F4XH 4S0TD 4XZUA 2BDNL 2PYFB 3DX9B 4APQB 2WW8A 5ITFA 1RZJC 2V9QA 4Q9RH 3GUTA 1VFBB 4Y8DC 1I1AA 3K74B 1CYGA 2QQQA 1A02N 3TM6A 3U0WL 3IGAB 4POYA 3VFMA 5ADOH 4QT5A 2QSVA 1YNTA 3FB5A 5MENA 4D94A 1ED3B 1CD9B 4YHNB 1CLCA 4JZJB 3RRQA 4TVPD 5H35B 4JFEE 4FQHA 2E8YA 4ZFOB 4R4FH 1BQLL 1D6VL 2ADGA 1JYNA 2XA8H 4ZDHA 4JY4A 1F4YL 1XGUB 1JFQH 4Q74A 3FHQA 3Q1SL 3UP1A 3EHBD 1Z5LB 4P2OA 2R0ZL 4QHLB 1D5IH 3QDHA 3EZ8A 4ONGL 4R8WL 4JFZL 4IDJH 4NPYB 4H1LH 4OF0A 1A3RL 3QDAA 5D7IB 3LZFL 1XR8B 3PGDB 1XT5A 5T1KA 3MLPA 2IG2L 5I17A 2AQ3A 4LLUB 3ULSB 2EXWD 4X4XB 1ZGLP 1PG7X 2YXFA 1WK0A 4NM4L 5D6DC 3HZMA 5D9SA 5IB5B 4E41D 4WY7L 4X80L 3U4EA 3WN5A 3HC3H 3F7RA 3TCLA 1AY1H 5ERWB 4JJHA 3SPVB 1A6VH 1DUZA 1CD1A 2IEPA 1PSKL 4FQIH 4NN5C 2VLLA 4U4BA 5DSCB 5DURD 4NQEB 4XPBH 4D0BB 2F53A 3QG7H 3KPRD 5E99L 3WXVL 4BFIB 1QBMH 5DJDB 2Z35B 3DTXA 5CINH 2PYEE 5HGDA 3ZYZA 3JBG7 4WU5B 4RWYL 2GJZB 2NR6C 1SVZA 4OZHB 1SMAA 4G8EB 4X98A 3CVIH 4HKZB 1S7QB 2EDQA 2NPLX 4KUZL 5DUML 2FO4A 4TOYH 1XR9B 2ED9A 2EECA 5I1GH 3L1OH 3MRCA 3QR2A 2P48B 5HI4C 2GIYA 2ZUUA 4GJTB 4UNUA 2DTSA 5ID0A 1WWAX 4Y5YC 3EAKA 1Q0XH 5FCSH 3ULUC 2ICWI 3AREB 2D7MA 2APXA 4OD2B 3KLHC 1BFTA 1DBAL 3VU2A 2XNAA 2Z8WC 3E2HC 3QZWA 4DGYH 1H8SA 1GRWA 1QPPA 3QIBD 3WEXA 1QD0A 4OGAD 2WWMC 5LAXB 2B1AH 1SY6L 4J3UA 3TWCH 4BQ8A 3OKOA 4S1QL 3OR6A 1E28A 4UBDC 2OSLA 4PJ9B 3OGCB 4RBPK 1U58B 1I1YB 2ADIA 2WBJA 3IDIB 4CN4A 1JNLH 1BGXL 1RUPL 4JRXB 2D7TL 4DN4L 4UDUB 4X4YB 3U6RB 3GSXA 4NCDA 5F6IC 1IKNC 2EDYA 5IGXH 4Y1AA 5CAYB 1UWGH 4NRZB 2ED7A 3QH3A 1KLGA 3RWFA 4LFHD 2DLEA 2GJ6B 3BPNC 4MVBC 3U9UA 4FABL 1MCOH 1R5WA 3QUZB 2NXZB 1A6WH 4KKNA 1ZLVK 1JGEA 1JRHH 2DIBA 4P9HC 3BH8A 2JCCB 4C56D 5BV7H 4LF3A 2PXYB 3NABL 5IB3B 1FHGA 2XTJD 3VW3H 2VDML 1GAFH 2OTWB 1EUTA 5F70A 3UYRH 3QQ3A 3X11A 2BCKA 4Y88A 4NNYA 5KVGL 4YEFA 1EO8H 4OGYH 5F9WB 2OMBA 2FYYB 4UB0H 5FCUH 1A9BB 1CD8A 4FFZL 4HCRA 1KIRA 3HMWL 1GIGL 2F58H 4LU5H 4ZUSA 3QUML 1UEMA 3G5ZB 3TV3L 4DKFH 5I9QC 4LBEB 5FYJL 5ECJE 1U8LB 4EI5D 4JQVA 4L9LA 4JFEA 2XKUA 4WI5A 3QEQE 3EYSH 2EE9A 1FBIL 3FAWA 1KEGH 4OCSL 4QRPE 5CP7A 3QUKB 3H9SB 4PV8B 3I02B 3DARA 1J12A 4MA7L 4XP4H 2IBBA 5GS1C 2FJGA 1Z3GH 3O9WA 3D0VB 4FZ8H 4RRPG 2KUTA 1NGWA 3RP1A 1UJ3A 4O2EA 3B8SA 3ISWA 5IM7A 1ZLUH 2ESVB 2HT4C 5E6IB 4M3JA 1KTRL 2VWEC 3IFNH 3KS0H 2DWDA 3MRKB 3QDME 4YHPB 4IS6B 1KCSL 2YBRB 4WWKC 1JP5A 1A14L 1PEWA 3FMGL 5DK0B 3LPWA 4M1DL 4PG2A 2ADFH 4QRSA 3ROLB 5IB2B 4HFUL 1I8LA 3L3DB 1OAZL 2Q7YB 3ARSA 1ZHNA 1NLDH 4X0KA 4YDJA 5I30L 3BRFA 3ALXA 4ZXBC 4CAGA 1R3LB 4QOKB 3WNNA 5I1EH 1NAMB 1D5ZA 2AEPL 3EO1B 4Y5XA 5D7LA 1G9EA 1LD9B 2Y7QB 1FJ1A 1AGCA 5IQ7L 4NZTL 3S97C 3MNZB 1I9JL 3OAUL 2PYEA 3PDGA 3F6LA 3FT3B 3KR3L 1FVDB 1EFXD 2O5YH 2ICEB 1S7VB 3OHXB 2EDRA 2G9HB 5DI8B 3TIEB 5CD3B 2D7OA 2Z8VC 2CDEB 2NX5D 1UCTA 4RFEB 4G9FE 3SY0A 4EDWL 3CFJB 4X6DE 5E8OB 3UTSB 5FUZH 3ZDYF 1YEDA 4FTVD 1C7TA 3TA3B 3RWCB 5AUMB 5C0IA 5JR1H 1I9IH 1MWAA 2C4FT 4P5KA 1CBVL 2PR4H 4K71B 4M7KH 2MCPH 4WI3A 2NY1C 3FQXA 1TJHL 3GSRB 1S78D 5DD0H 1F58L 5HGAB 1I8IA 2IAMB 5E9DD 2EZ0C 1BM3L 5C0DA 1LVEA 1NGXA 2X4NB 1WCQA 3ULUH 1M7XA 1QQDB 4ZFGL 1EHLH 2WSKA 3KS0J 1T5XB 1KG0B 3HKFA 1EPFA 1NGPH 1NANI 4O4YH 4W4NA 3TNMA 1MAKA 3W9EB 3QUMB 4Y19B 4IRSA 3E6FB 1I75A 5GRVL 2X4RB 5JLZA 2B2XH 1TVHB 1CE6B 4ZS6D 5AAWA 1OL0A 1VKXB 3RDTC 4G7VH 4XP1L 2QL1A 3A6CL 3TBVB 1N6QL 1NDMB 3OX8A 3WLBA 1FC1A 3QCUL 4S2SB 5HI5C 1YYLH 2VXQH 1T1WA 3FB8A 1GJIA 5I19H 3FN9A 2F9BT 4GKNB 4HDIA 3ZDYE 5L88H 4E5XA 1MAJA 5B8CC 4WTZA 5J89A 4YGAB 3MRPB 4HV8A 1QFUL 2I07A 2IALA 2P5WE 4OI7A 3UYOD 1QYGH 4PR5B 5E8EB 3VA2C 1U3HA 5J1SC 3KDMA 3EYUL 1WVZA 5HPMB 4KJQD 4RMSA 3QHFH 4P9HH 4TUKH 4Z7OF 3GI8L 4ELMB 4PJ8B 4QHUA 5B4MD 1EDQA 3N50A 2F54D 1WCBB 4JHBA 4HSQA 3UBXI 1SBSH 3NTCL 2IPTH 3JWOC 4XXDB 4A6YH 1D7FA 2VOTA 4OI8A 1KGCD 4RMTA 3SQBA 1W0WA 2EDFA 4GAYB 4M7LH 1WF5A 3P9WB 3GGWB 5JW4R 3OKKB 5AD0A 1U8NA 2X4UB 4HH9A 4R3SB 5LVEA 3HNVL 4O51A 2Q3ZA 5E0QA 2OQJB 4P9ML 2FH8A 4U1GB 5T3XE 1EXUA 1N4XH 3MRLB 5EZJA 1E0OB 2EEDA 2NY3C 1U3JA 4HQQH 4J7RA 2VABA 4HKBB 3DRTB 1JTPA 1T21A 4X8JB 5SWSA 5D71H 5MHSE 1VCAA 1AH1A 3U4BL 3WKMH 3BEWB 4HLZG 4Z7NF 4YH6A 1T22B 1IGTB 1TQCC 1EUUA 1H3PH 4JO3L 5C0ND 3QEQA 5BRZD 4YDVB 2V2XA 1BZQK 3TVMB 1ZANL 3S4SG 4QRPA 1A22B 4Z0BL 4G8FA 4U49A 1LNUB 1MHHA 4GRLC 2DQCH 4XCFL 1CLOH 1YEGL 4JFHD 4PTUA 4JRYD 1XIWA 4XPAL 3AS0A 1Q1JH 4DUVA 3DNKA 3CDGA 4OLXH 4LCUA 4JKPL 4EVNB 1T66D 1HHGA 2J4WH 5ACMA 4UU9A 3N85L 1MFEL 2SEBA 1HCVA 4G5ZH 5I1KL 5ESAA 2FLBT 3MXVL 5C07D 3T77A 3QDMA 3VXMD 4P5TC 2OLDA 4K9EC 5E24E 1IAOA 1JI2A 1H3UA 1R3IL 1NCCH 1A7PH 5IB1A 3WHE1 4O2FB 3K2UL 1MPAH 5L9DL 2OL3H 1I9RH 3CFEA 4ONFL 4K3JL 4F33B 5M95B 3QFDB 2IAND 2QTEA 4GRWB 4HWBH 5D1ZB 5D70H 4FZEL 4XTRD 5I0DA 1VGKA 4Z7NE 4OLUL 3V52L 4FS0A 1K8IB 1N64H 4UV4H 5ID1A 1ETZB 5LGJA 4BK4A 1BOYA 5D2NC 1XCTB 3FQRA 4HPYL 4PG9A 5GISH 2E7LC 3V0WL 1MVFA 3MRHB 4P59L 2AABL 3IVKA 4X6DA 3AMLA 5GRUH 4KK6D 5C0JB 3BKJH 3SHSA 5BCAA 3O45B 1JV5B 2Y4SA 3STZB 1AFVL 1HQ4A 4IMKC 1FAKT 1IEBB 1BVLA 4R4NC 1KYOJ 2P8PA 3KPQB 2QSCH 5FO7A 4ONHB 1LEKA 2CKBB 5E5UB 3SDCD 1LP9F 3Q48A 4Z8FH 2ZCLH 2OZ4H 3RTQC 1L7IH 4L3CA 4KKBC 4XP9L 4PJBF 3PL6C 2V2WA 3PP4H 5HD8C 1INDH 1N2RB 3DYPA 5ADPL 1JYWA 3SDAC 1P4LB 1I8MA 4OLWL 1IAMA 2E5EA 3H0TA 2R0KH 1A7RL 5EOQH 4JCMA 4WI4A 4OFYA 3JUZA 2A83B 1IL1B 3L6FA 1SVCP 1DL7H 1YEJH 4GO6B 4WFHD 3X13A 3BAEH 3L5XH 1FO0L 5AYQA 4WUUB 5ISZB 3A67H 3QHZL 4B50A 2GSIA 1XF4A 2D3VA 3CU7A 5HYJA 3DI2B 4E41E 2P5WA 2AVGA 2WNGA 1HINH 2H2PD 4MJID 1FZMA 3LKQB 3BGFB 4IMLA 5AZ2H 4Y16A 8FABA 3NCBB 4XX1G 1NANH 1QBBA 5IV2B 4ERSH 4ORGB 4UUJA 1S7RA 1LP9E 4F15B 4XVUD 3KPRE 2YD9A 4H1LG 4PJBE 4TNVF 4OJFL 3NH7H 5L6YL 3O2