5IMOA

Nanobody targeting mouse vsig4 in spacegroup p3221
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
GHPTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nanobody
publication title Structural evaluation of a nanobody targeting complement receptor Vsig4 and its cross reactivity
pubmed doi rcsb
source organism Camelidae
molecule tags Immune system
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5imoA00
3O8XA 4MWFA 1Q94B 2VABB 3LB6D 4ZUVA 1KCRL 1F8TL 1JIBA 1GL4B 3BI9X 4FNLH 3REVB 3D39D 1Q38A 4L8SC 4Z7VA 3GRWL 2RHEA 4Y16B 4YXHL 1MUJA 1U3HB 3QDMA 1S7QA 4MLSA 5IJVA 1CVRA 1E27A 1UWEL 1CLZL 5C0NC 4F7PB 2NY2B 1QHPA 1YEJH 3MRJB 4N0UA 4BQ9A 2NY6C 1J8KA 4CUCA 4Q9CA 4IS6B 1OD9A 5DC9B 5J1AB 2NR6D 2FWOB 3HC4L 5GJTH 1A7PH 3N85L 3UO1L 1KIQB 4DN4H 5DMYA 2F9BT 5BO1H 2H26B 3MCKB 4FQPA 3UYRH 4APQC 3Q3GB 4G6FD 3S35H 2HTLD 4RIRA 4ODTH 1WC7B 5FO9B 3IDGA 2B1HL 5F7EH 4GG6A 2BNRA 4RDQF 2PYEE 5ITBH 4L8DB 4YC2C 1NCWH 3GMLB 4YEEA 2BY3A 3C5JB 2ZSWA 1IGJB 1BFSA 2DLGA 3X17A 2XKNA 4OZFA 3LHPL 1EAJA 1E28A 2D4FA 4GAYB 1MAML 4HIJA 1XGUA 4G42A 2OSLB 4PJEF 4QRQB 5E4EC 2QHRL 4NQCA 4HIEB 1H3UA 1EZVX 1D6EB 5KANI 3TT3L 3WN5A 3T8XA 2DQJL 3MRCB 1FG2B 3KPOA 1AFVH 2J88L 4PTUB 5GRWA 2M8XA 3MRPA 1BQSA 4BSJA 4FQ2H 4TPRH 3QDJB 4I0PB 3MJ7A 4F57L 4X4XA 1RUPH 2Z31B 1IAOA 3WFZA 3S9DB 4F37K 3BWAB 3V4VH 2XRAH 5BV7L 3U48A 5TE7H 1J05A 4XNQB 4JM2D 3GIVB 1T21A 4G6MH 1MRFH 1YEDB 1FORH 2DM3A 4LSTH 3B9VA 2BSRA 4TSCH 2WUBL 5I16A 1H3TA 4G80A 3HE6B 5I1AA 4LEOA 3AREC 4HWEH 4OCWL 4OCXH 1MCBA 5ICZA 4POUB 1CD9B 5FCUH 2IQ9H 5F88A 2P5ED 3DX8A 5E94B 2NXYD 5TQ2L 4CGTA 3FCTA 2IAMD 3OR7B 3PQYE 5CJQL 1FFPA 4HJGB 1CD1B 2CDFB 2X4NB 5I1JH 2HYMA 3FRUA 1VPOH 3S36H 4PRIA 4CW1B 2X4OB 5CHNB 3OZ9L 4MNQA 5IHBA 2H8PB 3B2VL 3REWA 2G75B 2IANE 3B3IA 1RZ7L 1JPTL 2YWZA 4ZO8A 2VH5L 5F1KC 2PN5A 1QFWI 1RZKL 3DI3B 3RIAF 4JY4A 2R69L 5IT2H 4HKZB 5I0ZA 5KS9B 3QEUA 3VWKC 3F58L 1FL3B 3CZJA 5E08L 3T3MF 4J3OC 3OWEA 5FECA 3LN5A 4X5XB 2BHZA 4MQTB 4XNXH 4H1LB 4M1DL 4E5XB 3PF2A 2Z8RA 5BOPA 1QR1B 5F1NA 2A6JA 3MNWA 2C1OB 4NCC1 4TUJB 1MLBA 3SDDB 3MRKB 1KEGL 2W38A 1TPXC 3VXSB 3KYNB 1UKSA 4AL8L 4PFEA 3I50L 1U42A 4HV8B 5EO1B 2NY1B 5IUSA 2BNQB 3ZDXF 1Z9MA 2X1PA 4JCMA 4JRXD 5HGHA 4NC2B 3ROLA 3LPFA 4NUJB 3HI1B 4N8VB 2IADA 3RBSA 5I1HH 5C0ND 5IF0B 3OV6A 3V4UL 3TP4A 2FYYA 3QHTC 1HHIB 4XAWL 2J4WL 3N0PB 3ALXA 2NY6D 1EHNA 3D25A 3O3EB 3S3SA 1EJOH 1AH1A 1NBZB 3WFEL 2XNAA 3W9EA 2QJDA 5IESL 2HRPL 1DQLH 1U3JA 5JXAH 4NO2A 1RZJL 3CCHA 2P8MA 3QUMA 4APQD 1BM3L 1I9RL 4AENB 2NY7L 2W9EH 1FZKB 2Y07H 2DS4A 2E6QA 3UPCA 4GKSA 3DIFA 3DX9B 2ZWLT 1NEZG 3TYFB 3N9GH 1F3JA 3HE7C 3QIBB 5DO2C 1FH5L 1CDCA 4MQ7B 4OD2A 3MV8D 3OPZL 4DW2L 1OAQL 3RVXC 1KCVL 1C1EL 1E4XH 1A6PA 1D5MA 4WO4C 5T3ZE 4XRCB 3FTGB 5ID0A 1UYWL 3Q1SH 3B5GA 3CK0H 2YR3A 3VG0L 4DKAA 5F97E 2M2DA 1B88A 3OAZK 4HWBH 4CVWA 1MELA 4ZOAA 4MX7B 5FKPA 1EPFA 1VGEH 1T83A 3ULVL 2R4RH 3QISA 4WW1A 3L9RB 4XBEH 2ZKHH 4A6YA 3C09B 3S98A 4CAGA 4FZ8L 2R2CA 4AJ0A 4LSUL 5GISL 4CVZA 1QSZA 2KPNA 2J8UB 1JMXA 3THML 4LFHG 5CEZE 3NMEA 4QO1A 3S96B 1JGLL 1DQDH 5TQ0L 5D2NE 3PWLA 2PXYA 4K3DH 3SBWC 4Z8FH 3BUYA 4G7VL 1G7HB 5JR1L 1KCLA 1EMTH 4Z76B 4HC1A 1D9KB 1AQKL 2OTWA 4CDHA 1PSKH 3CDGA 2LU3A 3ARED 3H9SE 3MOAL 4GRLB 4NN7C 1HXYB 4OM0H 4P2RA 1S7VA 4JKKA 4W4OC 5DUPH 5EUOF 2AI0H 1BVKA 3B8YA 3KYMB 4F9PA 2X7LB 1RIUL 3GJFB 1R3JA 4UAOC 3OAZH 4Z77B 3UTTD 1KPVA 3OJ2C 1MY5A 4UTAL 2V5RA 4HBCL 3UPRB 4ZXBB 1UZ6E 2BRRL 4D0DB 1T7VA 4POZC 5C0IA 4AY0A 4Y1AE 1RUML 3NIDE 1VKXA 4LARL 4X0KA 5T5FL 2MKWA 4WV1A 1NCAH 3QWOB 5DVNA 3BP6B 3RIFK 5EN2B 5DGRA 1MHHA 4KPHL 3O6MH 3IF1A 4K2UL 3WUWG 5FYJL 1I8LA 2AEPL 4M48H 2VLKA 5C9JA 4CL7A 2OXHA 1CDIA 2VXSH 1Q9WB 1KEMH 1BFOA 3VWKD 4RNRA 3D85B 5BOZG 1MJ8H 3BH8A 2ADGB 4L1HA 2JIXD 1FZOB 3GB7A 4HCRH 1DLHB 3PWPB 5ILTL 4YK4B 5DDHB 1LHZA 2IWGA 1AD9A 2EIEA 3DX7A 4WFED 1HHGB 2PKDA 5LWYH 2C3HA 2QR0A 3HZMB 1DVFA 1FE8H 1AKJD 3GMNA 5LAXA 3MRGB 4NQDE 5C0CA 1U3YA 2X4TA 3MLXH 3TN0A 5ACZB 3HMWH 3S5LG 2KKQA 4KWUA 1JF6A 2X40A 3IRPX 3AY4C 1U8QA 4PJ8C 3U7WH 2B20A 4PD4J 3MJ9A 4NUGL 5E8EB 3V6FA 1M7IB 1KC5H 1MWAH 1IEHA 1EO5A 1HSAA 4NKIL 2DBLL 5GGVL 5MEPA 1NLBH 4TSAL 2CR3A 1HWHB 2YD6A 4HIIB 4C55A 1AY1L 1I7UB 3DXAE 3BPCB 1U8KB 3X3GL 4NNPL 2Q7YB 2FJGA 3ZL4H 3CLEH 5F7HA 1NMBL 1J7VR 1DN0A 4WU7A 2VQTA 3QUXC 1AXTH 3QIUB 5JIHA 3V2AR 4JZJB 1VACA 2JJTA 4P4KA 3F7YA 5TE6L 4FTVE 1QRND 3KPMA 4XCFH 1RHHB 2YA1A 5I1EL 3HE7D 5DO2D 4FQLH 1JHKL 4P23A 5E5RB 5FA3A 1C12A 4Y2DC 1EFXD 4G8FA 2Y36H 1Z9LA 3RVXD 4GKZB 3MLPA 5HHNA 1RURH 5JOEA 3U79A 3QCVH 4RFNC 4MVBC 4WO4D 4LCWA 2OMNA 2VLJB 2I9LA 5D1ZC 5D7SH 2IQAA 2IPKB 3QUML 2FR4A 4DAGL 1IFHH 5J1SC 5CJ8A 1J0HA 4LMQI 4XNUH 3BGAA 4U1MB 1D5BB 1U2CA 1FZMA 3BKCL 4GMSL 4PJAA 5E7FA 1TIUA 4U7SA 5IMOB 4P2OC 1HK6A 4K3JH 4OGXL 4ODXB 1HEZA 4L3EB 1PBYA 2DWEB 4BK5A 4U0RC 2JJVA 2UZYB 4FFVC 4F3FB 1GC1H 1MJJB 2FX7L 3DBXA 4JFXA 35C8L 4PJ5A 2NXZB 3TF7C 3X13B 5E8PA 3MV7B 3RWEA 2ESVA 3TGXA 2LAAA 2C3XA 4PJDA 2G9HB 4M6OH 5HHVL 4O58H 4A6YL 3QI9B 4OCRH 4EI5B 4OQ1A 5HDQH 2PUQT 4TUKH 7FABL 1G7QA 4Y5XB 3WLBA 4OCMC 5FO8B 4CVUA 4JGUA 4Q7DA 4NC1C 3D39A 3BJLA 4PP1C 3EOAA 3EFDH 4W81A 5DEFB 4MCZA 4YFDB 4NQXB 4K23H 4FMFA 4RAVA 5GGSA 4HC1L 3CU7A 2CD0A 2AQ2A 2VDML 1U92A 3EYQC 4POZD 5KVEH 4YGVB 4TVSa 3V6OE 3STLB 5E00A 4F37F 4WI6A 4MJ6A 4ONGH 4X7TB 1ACYL 4X4YB 1TZIB 3TCXA 5F7DB 1A7BA 5DFWH 1IC4L 5AD0A 2SEBA 2F15A 5DHYA 3ZHKA 4MA7H 25C8L 1YYLL 1U8PA 5F9OH 2IBZX 4I77L 5KSUB 2D7NA 1MCKA 4WGVB 1A5FL 3SGKC 1INQA 1FYTD 3MCG1 4LIQE 5HDLA 3W9DB 4PJ9C 1FNEA 4PY7B 5B3JE 3Q48A 4ZD3H 3K8KA 1I8IB 1B0GA 1E6JH 5GJSH 2CXGA 3TM6A 1CFVH 1MIEL 4I5BB 1I9IH 1FIEA 4UT6L 3I75A 1UADC 1QD0A 3VFVB 4GO6B 3GMQA 3RJDA 2DTMH 2OR9H 5E8NB 1KFAL 5EC1A 2NY0B 1Q9OB 3LKPA 4PJ8D 4LPYA 2NZ9C 4R26L 2ZOLB 3V5HB 1I3RB 4XB8A 2GTWB 4LHUA 4X7SL 3QEQB 4JFFA 5IB5B 2VDRL 3DV6A 1YEIH 2XN9B 4Y5YC 1CK0L 3MMEA 4H26A 1U9KA 3EDEA 1Z0NA 1YUHA 1BF2A 2OI9B 4HZLA 1JGVH 4ZOCA 2P1YA 5DQJB 4ZPTA 2VISA 3A0OA 4XB7A 4LVNB 1XZ0B 3L7EA 1BZ7B 2GCYB 3V79C 1LDPL 4WRLA 1XF2B 4HPOH 4M43L 5CMAB 4KXZI 4JM2A 4G8IB 3O3DA 1GGCH 3QUXD 3NFPB 2A6DA 2BSTA 3L5HA 2OJEA 4LSSL 3MJ9L 4NFDA 5JOFA 1U2HA 4G8EB 3U9UA 2N56A 3KYOA 2ZUYA 1FP5A 1NEZB 1T7WA 2B5IB 2Z91B 4XPBL 3QIWC 1KN2H 1D7FA 4JY5L 3K1KC 3OGCA 1NFDE 4HKXA 4Y2DD 5KVFL 1FN4A 2F5BH 3ZKXC 2K9UA 1MNUL 4U6YA 4MVBD 1A3RL 1OAKL 5D1ZD 1ZT1B 1CTNA 4MAYB 2EDNA 4XCCH 3RDTB 1BD2E 1CDBA 1QFOA 2OS7A 2BVUA 3AS1A 1SBSH 3GSNA 3I85A 1KXVC 1TTGA 3D5OF 5DRWA 1AO7E 4F9LA 1NBQA 3IETA 1N64L 2XV6B 2BFVH 2JB5L 3TEUA 3WCYA 1B2WH 3CGTA 4P2OD 2V2XB 4OGZA 5ESVA 3N50A 2H6PA 2AK1H 5KSBE 4M9PA 4X4ME 5TPWH 5EBLA 1HKFA 3EDFA 5TDOB 1JJUA 4FFVD 3MLRL 3RWDB 4HS3A 4ZUWA 4RGMB 2UWEE 1N0XL 4P4RA 5F9AC 5EOQL 4C56E 5MENE 3T4AB 1B6DA 1BHGA 1JWUB 4L4TD 5SWZE 2OXGA 3FFCE 1QFWH 4ZSOE 1IARB 3CPLB 3GUTA 3SPVB 4KAQL 4UI2A 5D6CA 3X12B 4JG1L 1IZJA 5EFIA 1UVQB 1FRGL 3QNXA 3ULSA 3VWJC 3DURB 2VC2H 4MHHG 2AXHA 2EH7L 3DRQA 1P4IL 2EYSB 1HN1A 4PJGE 3BQUA 3LV3B 4EDXB 5JHDA 2YWYA 4ODBD 1VFUA 2YZ8A 4PP1D 1AD0B 1LNUB 1ORSB 4JRXA 5F3HB 4NCC2 1C5BH 4QTHA 3EYQD 3IYLW 4HMEA 3CX5J 4HGKC 3CLFH 5C3LD 1GC1C 5C2BH 1OWWA 2R29H 3MJ8A 2AJ3A 2YBRB 3WUWB 1YNLL 4M7ZB 4Y4KB 3QAZC 4JFED 2F54D 4C83A 2C3VB 4P46A 2ICCA 1KT2B 3L1OL 3ULUE 1P7QB 3NZ8B 1RK0A 4ETQB 5KZCB 3NIFF 1TFHA 5CKGA 1GSMA 5J06A 5DURD 1UM5H 2DAVA 2QQQA 5JW4R 1TJHL 2ITDB 4XGZA 1XF3B 3MRNB 4OLZH 2MQ0A 4PJ9D 4Y4FB 2BVQA 4YE4H 4IOIA 3HHRB 4RFEB 5C09D 1OCWL 2V7HA 3ARRA 4AH2A 3P9WB 2NY2C 3BGMA 4TRPH 3HRPA 1CD8A 4PJFE 1KJMB 4H0GA 4FZEH 3W39A 3CVHA 3AS2A 1LD9B 1UZ6F 1L6XA 3MGTB 4AG4L 1AIFA 1LEGA 3BKYL 4PJ7A 5E03A 3S5LB 5HI3C 1CTOA 3NIDF 5LGHL 1SVCP 2J3SA 3PQYB 1AI1H 3E3QE 4N1EA 3IDYC 1CT8B 5GGQH 1MFAL 4NKMA 4YHPB 3VRIB 2NZ9D 1PQZA 4YHYB 5E9DD 3L5IA 4HS8H 1CIDA 3DUUA 5EU6B 1LK2B 2UY7A 3IU4H 1F4HA 5DTFB 1EXUA 1NCNA 3WFBL 5JA8B 4EUPG 2IANB 4OZGA 2FJFA 3VMOA 1A6UH 1CGTA 1V3KA 4P5TC 3SCMB 1MFDL 2JK5A 3MLUH 3QG7L 5FGRA 2NY3B 3AAZB 2IPTH 1NANI 5CIPB 3CFDA 4NQEE 5HVHB 4R97B 2EKSB 1U93A 4HJJH 2HFFB 1UWXK 4XPFH 3C2SA 3QIWD 4U7MA 1KELL 2VLME 2I9TA 5GPRA 1A8JH 4I0PC 5L7XL 3TNMA 2AXFA 1FIGL 1J1XH 1FC2D 1YEHH 3GO1H 2VR9A 4KKNA 3BEWB 1G9NH 2RGSA 1SHMA 2Z92B 4DKEL 3RWJA 4Q9RL 2OL3A 1GOGA 1YY8B 3RGVC 4QOKD 3GDBA 3HG1B 4UINH 3UTTA 4G9DB 2R2HA 3DSNA 3EOYG 1MHEB 4JZNA 4HLZG 3O45A 3W0WE 4GSDH 3MRIB 2P4AB 3FQRA 1NFIB 3QHFL 5IV2A 3HE6C 3TBVA 3MA9H 1A3LH 1ZVSB 4S1RL 4PJBE 4D9LH 5IMLB 1GH7A 5CP7B 4JO4H 1J1PH 1UH2A 2G2RB 3INUL 5HPMB 1LO0L 1S5IL 1YPZB 1NGPL 5IMMB 5BQ7B 5AYUL 3BKMH 3OKMB 2GHWB 2J8OA 2X4UA 3LN4A 1HZHH 4WFFD 3LKRB 1I9JH 4QYOB 2JIXA 1X4YA 3L3KB 1UWXH 4X7EC 1U8MA 4N9OB 3NACL 3VRJA 1OOAA 3ZE0E 3D18A 3GSNL 3D69B 5CINL 4IRSA 1FLRH 4S1SL 2AGJL 5DJAA 2L7UA 3QXTA 3QDGA 1V3MA 1FBIL 4EVNA 4F33A 1WV7T 3CFIC 4NRYA 3K8MA 1EO7A 4UZGA 3W11C 1IBGL 4MD4A 3RAJH 15C8L 3VWJD 1KJ2B 5KN5A 4NQSB 2J6EA 4LLDA 5F1OB 3WFCL 2O61A 4CMMB 1G6RB 4D9QE 4YDKH 4ZFFA 2ZOKA 3AGVA 5IROC 4M6NL 4M03A 5J89A 1A9BA 4GS7B 4KVNH 3VFNA 5I30L 1UXWB 2VZVA 1UKTA 4XPGH 1S7UA 3LKQB 2BVOB 5JIKA 1M7DB 4N1HB 4R7DA 1PLGH 2E6JA 3TNNA 3U1SH 1FDLL 2F8VA 3HPLA 2YPKA 4JAMA 4LU5H 4J3VA 4HUXA 4TUOB 3IDMB 4JM4L 4XVTH 3RUGE 5I19L 3LKSA 5LQBH 3QEGL 2I60L 2NY1C 1A0QH 1DQQB 3V95A 3IVKA 1S7TA 2P45B 4NQVB 3VXRE 5CS7A 3C5SB 3D0VB 1QO3A 4HK3J 5B8CB 5ISZB 1S9WA 2EDFA 5TF1L 1AR1C 5F6IB 4NKOA 4V2BA 1IEBA 1N5AA 2IFFL 1NC4B 1BBDL 4UOW0 4YR6B 4UTBL 3FMGL 3NH7L 1J9CT 2JJUA 1AGFB 3HE7A 5JO5B 4TQEH 2NY2D 2CLVA 1SBBA 2EE3A 3MNVB 1EEYA 3C5ZB 4XHJC 2P5WD 4QGYA 5E5UB 1X5JA 3IFOB 1QLRA 1Q9KA 5DR5L 4HMDA 1VA9A 4WU5B 1INDL 2UZIL 5HI3D 3CFEA 3QJFA 5DHVB 1N2RB 1OY3B 3CH1B 3O3BA 3BZEB 1MVUB 3DGGB 3MV9A 4LPUA 1XCQB 5IHZB 1T1WA 3VFRA 4JPVL 1UCBL 1FO0B 1T1YB 5E2UH 1GOFA 3LH2H 4M62L 3AMLA 5FOBA 4XI5C 4YXLL 2APXA 1NBYB 3D3VD 1A6TB 1NCDH 1ULVA 2ICES 1KULA 3GMPB 1FNSL 3SDXA 3MZTA 4Y1AB 2OJZL 1UEYA 3CVHL 2ZCKL 3BP7A 1EEUA 2EIZA 3B9EA 4L9LB 5IVXE 3U9PL 1LE5B 3BKJL 3L6FB 1KCUL 5B3JF 3GNMH 4P5TD 5CBEB 2X89D 2HJFA 1RK1A 4M6MH 3C6LB 5GGUA 5ITFB 5H94B 1EO8L 1UC6A 1IGML 5DA0B 3TIDB 6CGTA 5JHLH 5B22A 4P2QE 1EEZB 3QFJA 1MCNA 2EDOA 2DWDB 3UYOD 3QDJD 4I0PD 1VEPA 3C09C 1FFNB 2NLJB 1IT9H 2AJUL 4RX4D 3KNBA 5HYJE 4PP2B 1HDMB 2EDXA 5F7WC 3ARGA 3EKCA 1DLFL 1BLNA 1I1YA 3RGVD 4NQDB 3R1GL 1MAKA 4J6RH 4EIZC 1HH6A 2Q6WB 1LEIB 1KJVA 4IHOA 3NGBC 4U3XA 4P3WA 4WEBH 1D9KC 5LGJB 1JYXA 5D7KD 3HE6D 4TSBL 4U1JB 2A6KA 3NCYS 4GRLC 1MOEA 3UAJC 3ZKQD 1BQLH 4MHHI 5EU5B 1A14L 1RUQH 3VXPB 1A6VH 3QUYA 3QPXL 4AT6A 5T1KB 3AU1A 4Z6AT 4KTEH 2OL3L 3DXAB 4LSQL 1F11A 3TPKA 3I6KA 1NGWB 4LSRH 5IBTH 4DFHA 4GW1A 2DDQH 4GBXB 4YBLB 5IB4A 1NFDF 1WK0A 2CDEB 3HR5B 2D9CA 1CI5A 3B9AA 5HHME 2UYLB 4KZEH 5CILL 3G6JA 1G9NC 4UT7L 5D2LA 3CSYB 1L9NA 4X6BA 1NGXA 1TCRA 2F53A 3RFZC 1R3HA 5C92A 1SY6H 5HHPA 5SWSB 2HT3C 3VD4A 4QCIB 5BW7C 3W11D 1S7WA 3I02B 1JUFA 2FBJH 1A4JB 5C0JB 1DTUA 3KYKL 1DQMH 1NCBL 1WFOA 3B9KB 5BVPH 1K5NB 2F58L 1VENA 2FECL 2HJKB 4JFZH 3WXWL 1A7QL 4PJ8A 2BMKA 5ADOH 1G7PB 1IAKB 1RJLA 2JJSA 3TA3B 1GGIL 1WCBA 3L3HA 3UTSA 2UWEF 2WQRA 4I4WB 1RFDH 5D4QA 4IDJL 4P5MB 2BOCA 2DQDL 5C7XL 5GRVK 3WO4C 2J6EL 3QRGH 2ICEB 4NQTA 1H3PH 4DKDC 2NY1D 4R6UA 1KUMA 3MLYL 1R3LB 2BNQD 3VXTA 2DB8A 1KB5H 2KZ1B 3VFUB 3QUXA 3GGWB 1DJSA 3SOBH 2L7JA 3Q5TA 4H25B 3TZVB 3FO9A 2VYRE 1AR1D 3GMRB 3DVIA 4NHCH 4AIZA 3BH9B 4G5ZH 4JPKL 1IZKA 2HG5B 2YK1H 4CADB 4PJGF 5TDPA 4GAJL 1C8PA 2JTDA 4XHJD 5I1GH 1MCRA 4CBPA 2FGWL 1ZA6A 4YNYB 5HHOD 5DRNB 3ZLQC 1QYGH 3O4LE 3QUZB 4NGHL 1I7ZB 1ZHBA 1J11A 1AQDB 2JKXA 5I1DA 4LSPL 4H0HB 1PJ9A 4Z7OE 2AKRB 5IW6A 1BMGA 1X5ZA 3QIUC 5HYEA 4QWWC 3P9MB 4JZJC 5I8CA 3H3PH 3ULUF 2WLZA 1QQDA 3RKPA 4XI5D 5EZJB 5A2JH 1JRHH 4OB5H 4PLOB 4AEHL 2C1PB 2XQBH 3PGCA 8FABA 1BOGA 4OTXH 5HVFB 1GJIA 4S1QL 2ILLA 3CH8A 4NT6B 4JFQB 3MO1B 2PO6C 4OLVH 3H9HA 1NCUA 3R0MA 3RTQB 3UJJH 4PJFF 3MROA 2Z8SA 3PWNB 4L4TA 1LILA 2FLBT 4WEMB 4XBPB 3AB0B 3OJDA 2BJML 3V9FA 5FIEA 3BP5B 1F90H 2VLRA 4NO5A 3TBTA 5GJTL 1A7PL 3WIFB 5EZIL 1BQHA 1CZ8L 4X6CE 5D7JA 4MXVE 1FZJA 5IM7B 3CXDH 3UBXA 4WCYH 3OKDA 5TFSH 1P4LB 2VMFA 2GYSA 4FHBD 5GSVA 1A1OB 2CDGB 2BNUA 5AAWA 2D31A 4U7KA 2A2QT 5JW5B 3NZHL 3DYPA 1K8DA 1ZAGA 4U6TA 3HAEG 1UEMA 5I15H 5DD6A 1D9KD 1QSFE 1BIIA 4PJHA 3VFMB 3T0AA 3QI9C 4GRLD 4OZ4B 5TDNA 2V2TB 3UAJD 1CFSA 1OW0C 2F54A 3JV5A 4EI5C 4QHUB 1BECA 4Y5XC 3IKKA 3D9AH 2FEDC 4X6DA 2EH8H 2AV1B 3TT1H 4KMLB 1XR9A 1G7LB 3NTCL 4XZUA 4OQTH 3O11B 5CWSB 3VFGL 3BEVB 4MAUL 3LQAH 1H5BB 2XRAL 4ZUSB 3SE9L 2IFGA 4ERSL 3LMJL 1T04B 2HT3D 2ZUTA 3CUPA 5C0RL 4G6ML 1NFDB 2VWEC 2DKUA 4I0CC 1NJ9A 3JTSA 5D1QB 4TSCL 4RWYH 1OP9A 1IGFH 1OF2B 2B2XL 3VXQA 1OAXH 4PJBF 3T09A 5HGBA 4GXVH 1YMMB 3D85D 1QSEE 4U6VL 5I8KL 3TBSA 1EGJA 3P77A 32C2A 1QPPA 1BD2B 1XGPA 3PWPD 3OG4B 3C9NB 4V2CB 1WWBX 2VIRA 3ROOA 1OARL 2XQYK 1ZTXL 1AO7B 3O41A 5I1JL 3ARTA 3QR2A 3RZWA 2BY1A 3CSBA 3BGFB 4IJ3B 5AZEH 1CL7I 3TV3L 4YAQA 5E8DH 3H42L 3ZE0F 4JDVA 1I85A 4MB4A 2ARWA 4CVXB 1YEFH 4YHKH 2NY0C 3MNZA 4DGYH 2VN7A 3ZTNH 2XIDA 1MLCA 5DK0A 4LLMA 4TVPD 4C56B 5MENB 4F7MA 2ZPKH 1UB6B 3TBYA 5E1AA 4ZNEA 4PR5A 4ZSOB 5C0AE 3VG9C 3QIWA 3MXVL 2QSCH 5DQDL 4HKJB 3MXWL 1AP2A 2MCPH 3VJ6A 5HY9B 2OI9C 2A6IB 3A67L 3MCLL 4N68A 2AEIT 5JW4M 1MUJB 3QDMB 1RIHL 4KI5C 4LVNC 3RL1A 4QOKA 3L95A 1T22A 2VDNH 5IWLC 4QGTA 1NGZB 4PJGB 3QIUD 4QWWD 4U1GC 5DRXA 1TQCB 3RUGF 5CCKH 2W59A 3BIKB 5D9SA 3WL9B 5DK2B 2X9WA 3EO9H 4LLYA 3OAUL 3EFFA 3C60B 4OD3L 3CFKA 1FL5A 1HHHA 5DI8B 3D0LA 1NDMB 3RA7L 3IDNA 1T5XB 2IH1A 1BEYH 4HBQA 3QXDA 4RAUA 3IDGB 4BZ2L 2OK0H 1M6OB 3MACL 2PO6D 1RPQA 3NA4A 2ZCHL 2VLJD 4ORGA 4MAYC 4G8GE 1KJ2H 3FQUA 4KKCC 5IOPA 3RDTC 4GQ9H 5LBSL 4X9BA 3QO0A 2HLFC 3VGDA 1G6RH 4PIRF 4LVHB 1INEL 1XGUB 4AM0A 2DQCL 1R24A 1T6VN 2R1WA 4PG9B 2LTQB 4PJFB 1ZT7A 2J12B 5JXAL 2H32A 5F72S 1GIGH 4L3ED 4OLWL 3RI5F 4YHMH 3I3DA 2FX9L 4RQQA 3VXUA 2DQTH 2Y07L 5CFHA 4R8WL 4RGOH 3MJ7B 4F7EA 4DKFL 5HVGB 3T65A 2VITA 4R3SB 5EA0L 5IVXF 4NO0B 2FD6H 1K6QH 5EBMA 2ORBH 3QNZB 3LS5L 4LF3B 3QI9D 4QHMB 3HLAA 1J05B 5DUMH 2BC4B 2R23A 3OB8A 5J56B 4O4YH 1HIMH 1I8MB 4EI5D 4D3CH 3E1F1 4ISVB 3GSUB 1GZPB 2KH2B 1T7XA 4G80B 5I1AB 3U4AA 2FEDD 3P2TA 1VGEL 1QLEH 5ESAA 2ARJB 3BWUC 2ZKHL 3FRPA 3T77B 4Y16A 1U3HA 4QHKI 2N4IA 3T4YB 1FGNL 1JYNA 1LGVA 1EUTA 4F7PA 5JTWA 3OKYA 1KXQE 1NSNH 5E6ZA 1OSPL 1YC8A 3MRJA 4KK5C 3SO3B 4Y4KC 4D2NA 1ZLUK 4IS6A 2CKBB 2GFBB 5J1AA 3I9GH 1YECL 4JFHE 3ZYZA 5D72L 1KIQA 5FYJU 2H26A 3MCKA 4KUCF 4AMKL 5D70L 2ZCLL 4X9HA 4LDEB 3MBXH 4K55A 1WC7A 5FO9A 3W0WB 2GITA 4Y4FC 2DJUA 4Y4HB 5JOPE 3OB0K 1RSFA 4YO0B 4MJ4A 4L8DA 2EIBA 3GMLA 1QFUH 3E8UH 5B39G 3C5JA 2A1WL 1GGBL 1IGJA 1TVHB 3HNSL 3P0VL 4GAYA 4ZOEA 4PS4H 3UYPA 2EEBA 3TBWB 2OSLA 4QRQA 1X3DA 5IB3B 2GK0A 4HIEA 1GGYA 4RA0C 3LQAC 1ZHLB 2DLTA 4MJIE 5DD0L 2NY0D 2YHGA 4NZUH 1W0WB 5E5MB 1EGJL 1M71B 2EDHA 1FG2A 3O6ML 4WDIB 4XP9H 2NX5D 3BZDA 2HFGL 4M48L 4JGMA 1Z0MA 1VB9A 3QDJA 4I0PA 5LXGH 4HEME 1ZLUH 5E8OB 5DSCB 2Z31A 5I17B 4RX4A 4FFWC 1MJ8L 4AIOA 1JGDB 5ADPH 4LLUB 3BWAA 4KI5D 3SCMC 2XOTA 2GW5A 3FOMB 3FT3B 2FATH 1KCSL 1MHPL 5GGTH 4KY1L 4YQXH 2GUOB 1UM4H 5L2KE 2H41A 3AC0A 4XNQA 3GIVA 4Z78B 3I3BA 1YEDA 4LRIC 3K4ZA 5LWYL 3T2NL 3O6KL 3D25B 3OB0H 2BK8A 4HQQH 4NM8L 2P48B 5HYQB 4QRPD 3DHJA 1ZGLP 3WD5L 3HMWL 2ITCB 4WIQA 5EZLB 4C59B 5EZOL 3NFSH 5E94A 5ICXA 1I3VA 4HUWA 5FUZL 4M7JH 3OR7A 3P4NB 4CN4A 4I3RL 3MBEB 2CDFA 3RUGB 2X4NA 3KLHC 3H7LA 2L4OA 3NCEB 1BAFH 3VXRB 4MAYD 4YZFE 1G6VK 1NLBL 4KKCD 3RDTD 4FXGA 3K4AA 3NAAH 4CW1A 2AK4E 3HCVA 2HLFD 4DGVL 1W72B 3TESA 2GY7B 2H8PA 3MLTB 5GZNC 1MHCB 4HW6A 4Z7OF 2G75A 5ID0B 1F4XH 1R3IL 1S9KC 1U8IB 3CSGA 3ZYOA 5JIIA 1KCRH 3MRQB 4TNVK 3F7QA 4I9WD 4HKZA 4WVRA 4N5UA 3GRWH 4A6YB 3GSVB 2GJ6E 1FL3A 2ED9A 3FJTA 5IROA 4YXHH 3HAEB 4FQLL 1XGTB 2AXJA 1OAZL 3PWUA 5C70A 1IE5A 1UWEH 4H1LA 4HIHA 4E5XA 2Y36L 4FFZL 1QR1A 1KLGB 4Y2OA 3BZ4A 2C1OA 5D96C 3SDDA 3MRKA 3QCVL 2DYPB 1BFTA 3VXSA 1IAMA 1KTDB 3KYNA 4U1SA 2PXYB 3KPSA 3BUYB 1FGVL 4E41D 3GM0A 5E4IA 3WKML 5C07E 5IVXB 4HV8A 5EO1A 2OTWB 3UO1H 3N85H 3ET9F 3EZJB 1PEZA 3GSXB 2WP3O 3RPIB 5C0EB 2D3VA 1AR2A 3MRMB 4P2RB 4X6CF 3WO3B 3L5WB 2B1HH 4GS7C 4MXVF 3T08A 1MI5A 4N8VA 3T0BA 4HF5L 1GC1L 5IF0A 3DLQR 1F02I 4WTXA 2YXFA 1HHIA 4R4BB 4KK5D 3LHPH 4Y4KD 1YNTB 1WIPA 3P3YA 5IVOA 1OGAE 3O3EA 1NBZA 3KHOA 4FRWA 2QHRH 4EDWH 1P7QD 5HYJB 3ARDB 5KZCD 4OZHE 3QZWA 4R2GB 3T2PA 4N1CA 1VKXB 3TT3H 5B8CC 2R0KL 2YD5A 5KSVB 2DQJH 4OCRL 4AENA 4L3CB 5F6IC 2J88H 2AJSH 1FZKA 4DOHE 4Y4FD 4DVRL 3DX9A 3TYFA 4KUZH 4F57H 3RVVC 3QIBA 2YOCA 4XPTL 4MQ7A 5TH2B 3FAWA 4DK3A 3LDBB 4CDGC 3C5ZC 1Z6JT 4YJZL 3BIAX 5BV7H 1AD9B 3PQYD 4XRCA 3FTGA 3SDYL 2A77H 5AG9A 3KXFD 2MHAB 2DQGL 2WUBH 4ZAKB 4GOSA 1T4KB 3GMNB 4MX7A 2OCFD 4PRPE 4NO3B 4OLYH 4OCWH 5HHMB 1AE6H 5EU6D 4LSVL 4PJEA 5TQ2H 4FFWD 4L9LC 4N8PA 5CJQH 2J8UA 3FFDB 1HSAB 2QSVA 3IDUA 3ZZ1A 5KTEL 3SCMD 5HBBA 4OKVB 1VFAB 1A64A 1NCTA 3KDMA 3S96A 1VGKB 3C6LC 3EBAA 5FHAL 4K8RL 5J12B 2E6PA 5FGBA 5CZXC 1G7HA 3OZ9H 4Z76A 1XIWB 1D9KA 1EJ6A 5KOVC 3B2VH 1BBJA 1RZ7H 1K4CB 1JPTH 1FFQA 5MEQA 3L3GB 2VH5H 1QNZL 4R9HA 1T0MB 3DMMC 2R69H 4DN3L 5FYLE 2VDOL 3KYMA 2X7LA 3F58H 4XC3H 3GJFA 5C0BE 3HG1D 4V1DE 3KLHD 3GZKA 4Z77A 4NP4H 1W0YT 5IGXL 1ERNA 2F74B 2CXKA 5F8RC 4M1DH 3WHXA 4ZXBA 2Y5EA 2C4FT 5F3BB 1KEGH 5KBNC 3CDCA 5GZND 4AL8H 5HXMA 2W9DL 3QWOA 1T89C 4OF5A 3BP6A 4BZ1L 5EN2A 3I50H 1MCSA 4B7IA 2OP4H 4HWZA 4FQQB 5M7QA 3H2WA 1Q9WA 1CDGA 3VCLA 1FZMB 4N0UE 4IBLT 3D85A 3O4LB 4GBXC 4ELKB 3TFKC 1KN2L 2A9ML 1D5IL 2ADGA 1N6QL 1FZOA 1DLHA 3PWPA 4ZS6C 5IBUG 4L4VE 3V4UH 3HRZB 4XAWH 4XAKE 1HHGA 2J4WH 3DNKA 5JPNA 4HMCA 3CFCH 3PABB 1DL7L 1AHWB 2ICWJ 3WFEH 2X4QB 3HZMA 5EIIB 4GG6E 1D3CA 3MRGA 4MLIA 2EXYC 3IDXL 5IB2B 4B5EA 1AGEA 1RZJH 1BM3H 1I9RH 2NY7H 5E8EA 1M7IA 4DQOL 3TA3C 3WLBB 5TPWL 2JF1A 1RJCA 1FH5H 5ALCL 4MYWB 1CDHA 3UPAA 3OPZH 1JYVA 1OAQH 4HIIA 3QEHA 3KPLB 1U58B 1C1EH 5I9QB 1U8KA 3MRDB 4X6CB 1QFWL 1U92B 2Q7YA 2FJHB 1A6AB 1UYWH 4XPHL 3VG0H 1F5WA 3IS1X 5ISZD 3VW3L 4PUBH 1H15B 4JZJA 2LU4A 4NJAL 3TZVC 4CN6A 3OKOB 1NBVL 3DSFL 4GMTL 4YFLF 3ULVH 1NC4D 4POYA 1FHGA 1HI6B 5HDOA 1RHHA 4LNVA 4FZ8H 3RVVD 5KG9B 1QSFB 1U8PB 5IW1B 2WQ8A 4LSUH 4OZFH 5GISH 2K3TA 2PW1A 3C5ZD 2Z35B 3THMH 1WZ1L 2XTJB 1OTTC 4GKZA 1VERA 4RRPG 4JJHA 1CU4L 3WJLC 1JGLH 4KTDH 5F7MC 1B0GB 3QUZC 4LASH 5TQ0H 4ZS7L 4ODVL 2IPKA 1KG0B 5JR1H 3KLDA 1ZA3B 3VGAC 1AQKH 4KU1A 4XNZB 3GSOB 2ZUQB 4U1MA 3MOAH 1D5BA 1FSKB 4JKMA 1URLA 4HD9A 1FPTL 4O02H 4Y1AD 4PRIE 4XH2B 4ODXA 4L3EA 2DWEA 5H37G 3HPJB 4LHUB 4OLZL 4F3FA 1MJJA 1RIUH 3RHWK 5EOTB 2O26U 4YE4L 4Z0BL 3O9WB 4UTAH 3C6LD 4HBCH 2W0FB 1SQ2N 1PAMA 1RMFL 4TRPL 4M4PA 3X13A 2BRRH 3MV7A 4Z7WE 2J8HA 3OKNB 5CZXD 1QSEB 2VISB 5I74B 4L3AA 1QBML 1RUMH 2G9HA 5T5FH 3ARUA 4XXCC 3QI9A 4JREC 3TO2B 1ZT4A 4KPHH 4K2UH 3R06B 5FYJH 2IJ0C 5CKAA 1HQ4B 3DMMD 4K71C 4LQFL 4GT7A 5FO8A 1MREL 1IQDA 1UM6H 2JCCF 2GT9A 4DUXA 4Q9BA 2ZUVA 4PJXE 3SDCB 4HH9A 3OGCB 2FX8H 1SYSB 5DEFA 2DQEL 5ILTH 2CIIB 5IBLC 4NQXA 4GW4B 3MRHB 3QPQC 4H8WH 3MQIA 4YGVA 1FAIL 5EUOA 4C4KO 4NKDB 1KIRB 1WBXB 4EN3C 5JDJA 3BPLB 4X7TA 3G9VA 1B0WA 1TZIA 2VUYA 1Z9OA 5DS8B 5DRWB 1F97A 4GLRI 4TNWF 4AEIL 3B9DA 2DIJA 4GBXD 5KSUA 1T5WB 4NUGH 3TFKD 1UQSB 3H9YA 4LKXA 4NKIH 2DBLH 5GGVH 2WK2A 3W9DA 4ZS6D 5EBLB 4EI6B 1G9NL 3UDWC 5DZOA 3SO5A 4PY7A 1UB5B 1MH5A 1H5BC 4PREB 3MRRB 4TSAH 1I8IA 5D1XC 1NMCC 2APVA 3WUZA 4P4RB 2B0SL 4YZFF 3TPUB 5SWSD 4I5BA 4G9FE 4NZRL 4G6KH 3SE4A 3EOBB 3X3GH 4NNPH 5KSAB 4OFYD 4GSDL 3VFVA 1NMBH 3MC0A 5D1QC 4LCCC 2EXYD 5D6CB 4NZTH 5IKCB 4KFZC 3UZVB 1A3LL 4ONFH 1WAAE 4N90D 5HGDB 3ULSB 2ZOLA 1J1PL 1I3RA 5DVMA 3TA3D 2GEEA 2GTWA 1Q8MA 3QEQA 2DTSA 5IB5A 1JWMB 5I1EH 2XN9A 4YDJB 3SJVB 1JHKH 3TWCL 3H7BB 4NYLA 5FO7B 3JUYA 4HK3N 3C08L 4PTTB 3BGFC 4IJ3C 3MR9B 5GRJL 3LEXB 2DF3A 1XZ0A 2GCYA 2VR4A 4HPYL 1Q72L 1MJUL 1XF2A 4YFLI 4I18B 1BVZA 5CMAA 3QUMH 3RVWC 4DAGH 4G8IA 4KH2A 2AJ3B 1IL1A 3G5VB 4TVPL 1S9YB 1CF8L 4G8EA 3TZVD 1J8HB 3O8XC 3BKCH 5BRZB 3ELAT 2Z91A 4GMSH 4F58L 4GAFB 3ZKMC 5T3XH 3BE1H 1NFKA 4OGXH 1BZQK 4JEGB 1DUZB 2NQCA 2FX7H 1OTTD 2BVQB 35C8H 5DC4B 4IOIB 1MCIA 2LVCA 4KHXL 4XPGL 4AH2B 3QUZD 2X9XA 4FQ1L 2D7TL 3QJHB 4E0RB 1ZT1A 4MAYA 1P7HL 3VFTA 3U1SL 3W39B 1BGXL 4LU5L 5BS0B 1LEGB 3KJ6L 5JQ6H 4A6YH 2X1WL 4TTGA 1OPGH 3C60C 4M8VA 5DK3A 4NKMB 7FABH 2V2XA 1CG9B 3IAGC 1ZV5A 4BQ8A 2NY4B 4JRWA 4DTGL 3EGSA 3NOIA 2DLEA 5TDOA 3RWDA 4LGRB 2H1PL 1JHLL 3ULVC 3RWIB 5I8EB 1PY9A 3GBNL 1JWUA 4HC1H 2YPLE 2VDMH 5L0QB 2FJFB 1NAMB 2VLKE 3E6FB 4CJ1A 4LVHC 3CPLA 4N0YL 4EIGB 4GH7B 4D8PB 4QNPE 3X12A 1MY7A 1UVQA 3CFDB 2LTQC 2MSPA 4KMQA 1ACYH 3WN5C 5F96L 3DURA 2W91A 4YHLL 5DUBB 3ILQC 4WUUB 1IC4H 1PY4A 5FK9B 5E2UL 25C8H 1YYLH 4XP1L 4EOWL 4GRMB 2EYSA 3N06B 4I77H 3LV3A 3RJQB 3UJTL 2QSTA 4EDXA 1A5FH 3ARFB 4DJMA 4MJIB 5IBLD 4BH8B 5F3HA 3RWJB 5F7NC 2OX5A 5F70A 3QPQD 2IEPA 4F2MB 1DANU 1MIEH 2JCCB 2R2HB 4UT6H 4EN3D 4LLVB 2YBRA 3WUWA 4HULB 5FUOL 4KRLB 3MOBL 1AGDB 2VRAA 3KG5A 2C3VA 1KT2A 5JA9A 3NZ8A 5DZNA 4ETQA 5JHLL 1KFAH 3Q5OA 4XWOC 3AVEA 2I26N 1ZSDB 4QHLB 2W0KA 4XMLL 5ACMA 4M7KL 2QQNL 2BXYA 4R26H 5IBUB 1JP5A 2ITDA 4KQ3L 1WWWX 5C6PB 5L2KB 1XF3A 3MRNA 5DJZB 4X7SH 4KHTL 4UDUB 2VDRH 1HYSC 5FUCE 3BVNB 4RFEA 4HDIB 5D1XD 3P30L 4OUUB 4UNVA 2FIRT 4NWUL 4G3YL 3S97C 4ZODA 2GY5A 3ESVF 1LD9A 4MB3A 4LCUB 3MGTA 1MIML 3RX7A 1P7KB 4R0LA 2VTFA 5JMRA 5D1QD 3PQYA 4F33B 4LSSH 5DYOB 3MJ9H 4H8WC 5ID1B 1YMMD 1A6ZB 2HTKC 3PDGA 4YHPA 3VRIA 3U0TB 1A6VL 4XPBH 4GUPB 5KN5B 2G5RA 2YD3A 4KTEL 4J8RA 3KPRB 2OBGA 3RZCA 5DTFA 4RMWA 5KVFH 5FYKL 5KVGL 2IANA 1MNUH 5HYSA 4IIQB 1JTOA 2V9RA 3OKLB 4YHNB 3OKKA 4W68A 4B0MM 4Z7NE 4U1KB 4YDVB 3OX8A 1A3RH 1CQKA 1KTLA 1RQ5A 1OAKH 1TMCB 3AAZA 3RVWD 5HJ3B 5CIPA 2GJ6B 3T0EB 2QBWA 5MEND 5F1SA 4QHNA 4GG6F 3O8XD 5I8OL 2EKSA 2D7OA 4XNMB 2HFFA 4PJ5E 2JB5H 2VXTL 3ZKMD 4NN5B 1N6UA 4KDTA 1MCEA 1I1AA 2ESVE 2Z92A 4Q58C 1HCFX 8CGTA 1N5AB 3FQXB 3QDMD 5C08E 1OAYL 1UACL 3J7HA 4E9LA 1N0XH 5D7IE 4KC3B 5C07B 5EOQH 3HG1A 4W6WB 2V5MA 1MHEA 3VE0B 1BJMA 2I27N 2LVEA 5KAQG 5EU4B 3BYTA 3MRIA 1NFIA 4KAQH 4P3CL 1A2YB 1F45A 3STZA 1H3PL 4JG1H 3D39E 1FRGH 1ZVSA 3MV9B 3C60D 3ARZA 5CP7A 3D48R 2BSSB 1T1WB 2G2RA 1JHTA 2EH7H 2VLLB 4HUKB 5HPMA 3JWOH 2IBZY 5IMMA 1P4IH 3OKMA 3B43A 3PGFL 1PKOA 2BNRD 4LAQL 3ULVD 2O93L 5JORB 2DI8A 2AJYL 3LKRA 4QYOA 2QSQA 2P7TB 1CCZA 4HAGA 3D69A 1PG7L 3JWDC 4FQCL 2HJFB 5EO0B 4NQCD 5GGUB 3NCMA 3ZSSA 1YNLH 5IFHL 5MI0B 3WBDA 2FEEI 4S2SB 3L1OH 3RU8L 4U05A 4NQSA 7CGTA 3ILQD 4ZOBA 5DJ8B 1AGBB 2CRIA 3BDBA 4WHDA 4FQJL 1VSCA 2W60A 3HZVB 2CH8A 1T83C 1N0LA 4RFOL 3KPPB 1TJHH 1GGTA 5M94B 2XZZA 4MQSB 2R56L 4NO0D 1PYWB 4P59L 2YUXA 5AWNL 1OCWH 1UXWA 3LKQA 4LCIH 2BVOA 5DWUL 1M7DA 2I25N 1R3KA 2Q8BL 4ZMAT 3M45A 1N8ZB 1A7NL 1DDHA 4L29A 4TUOA 3IDMA 2ED8A 4AG4H 4Z7WF 2PXYC 4MMXC 4N9GB 3BKYH 5FM5M 4WTWA 2BSED 4OI9A 4OV6F 3VD7A 1X7QA 2W92A 1DQQA 4XWOD 1MFAH 3C5SA 3D0VA 2JB6B 1F3RB 5ANMB 5ISZA 3VD9A 1GYAA 3V0WL 1XR8B 3C8HA 1HYSD 3SHSA 4YR6A 2IG2L 3CXDL 3A6BH 5EORL 4PJXF 5INCB 5IR1B 5KVMC 4F9PC 5TFSL 1AGFA 5JO5A 4HAFA 4NHUA 3WFBH 5EU7E 3H9SA 4P2YA 3MNVA 4QHKJ 3C5ZA 4M61A 4MDJB 3IFOA 2VDPL 4WUKL 1WGOA 3QG7H 3ARDC 4MNQD 5DHVA 4R2GC 1N2RA 2BVYA 4KRMB 3CH1A 5I15L 2KL6A 1MVUA 4WV1C 1C16B 1X5GA 5C0BB 1XCQA 1MRCL 2HTKD 2ADIB 2P5EE 1FO0A 4U31A 1M05B 1KELH 43CAB 2RAMA 1NBYA 1PEWA 3LQZA 5L7XH 5JIPA 2AW2A 1S5HA 3GMPA 1FG9C 4BQCA 1FIGH 4Y1AA 2EH8L 4DKEH 1TVDA 5DJYB 3TT1L 3LDBC 4Q9RH 4L9LA 3GSWB 3L6FA 5CBEA 4O2CB 1B4JL 1WCBB 2HRLA 3L3HB 2Z93B 3OG6B 3C6LA 5ITFA 5H94A 2BOCB 3TIDA 1DVFC 2HMIC 1EEZA 1S3KL 1V8HA 4L4VB 4S1RH 3VXTB 5E0QA 1IGFL 1WAAF 1FFNA 2NLJA 3INUH 4M93B 1LO0H 5I1CH 1NGPH 1HHJA 1KYOK 1MRDL 4ODWA 4PP2A 5CSZB 1HDMA 5AYUH 2J7LA 4ZUUA 5DJXA 3U2SB 2DQHL 1YDPB 4C58B 4NQDA 5TDPB 5J12C 4PYHA 3CX2A 3CMOH 4Y19E 5DEGB 3NACH 1LEIA 2Q6WA 3U30B 3GSNH 5CINH 2KUTA 4S1SH 4PG2C 1FAKT 3ARPA 3UJIH 1HILA 1XIWC 5DC0A 5LGJA 2W1NA 1FBIH 4X80H 3PDOA 2YPVL 5I1DB 1IBGH 3BHBA 5DJ2B 15C8H 1JV5B 5IW6B 1ED3B 5EU5A 3VXPA 4JRXE 2RFXB 3GI9L 4GRWH 5T1KA 3WFCH 1JI1A 3J8F7 5SWQB 5IJKA 3DXAA 4P4KC 1QQDB 3OL2A 3QCUL 3BRDA 2EE9A 1NGWA 4WI8A 2QSCL 4J3SA 5MERB 1WFUA 4M6NH 2PTUA 3PGCB 4P23C 2CDEA 1I1FB 4NBZB 5T3XD 3HR5A 5I30H 1I4FB 4GLRH 4YLQT 2UYLA 1F58L 3RRQA 2R0ZL 3V7AE 1FDLH 3LQMA 1Q0XL 3LS4L 4P48A 1S9XB 1X5HA 4P5KB 1QTYT 5SWSA 3CIQA 4QCIA 2YSSB 3I02A 5I19H 4MNGE 2R8SL 4K94L 3QEGH 2I60H 5C0JA 1NDGB 1T03L 5ESQB 4NWTL 2ZUXA 3OXRB 3QRFM 3B9KA 3HC3L 1K5NA 5BXFB 3EO9L 5TF1H 3MV8E 4JJ5B 2VLRB 3U7YL 2HJKA 5IIEA 2AV7B 5F71A 1BBDH 5D7JB 1G7PA 3TA3A 4UTBH 3FMGH 1XH3B 1BEYL 1HH9B 1RZGB 3L3JB 3JWOC 4MD0B 4F15B 4I4WA 4EZMA 2VL5B 4HIXH 2ZSVB 2DYPD 4P5MA 4JHBA 3BOVA 2PXYD 5DR5H 1INDH 2UZIH 4MD5B 2ICEA 2EEDA 3F7VB 4PJHB 1R3LA 4QNPF 1BZ9B 5T3ZL 4JPVH 3VFUA 1UCBH 4DZ8B 4P2RD 4M62H 1ROWA 1QBLL 2E7BA 3GMRA 4YXLH 5KJRL 4Z7WB 4ZPVB 4BFGA 3BH9A 2FO4B 2CUMA 2X2YA 3WS6A 1FNSH 4OI8A 4CADA 4U6HB 4X6DB 2BCKA 3C8DA 3RL2B 2OJZH 1ZVHA 3CVHH 2P44B 2ZCKH 4EXPX 1WTLA 3U9PH 3MLSH 5GS1A 1BREA 3CU1A 4WHYH 3LRSA 1KCUH 4B50A 4DEPC 1VFMA 3FN9A 4YNYA 5JW4N 5DRNA 1O0VA 3ARDD 3IJYB 3QUZA 4R2GD 1I7ZA 1EO8H 3WSQL 1AQDA 5CP3A 4ACPA 4FFYL 4PJXB 3VXME 2J2ZA 1BWWA 1JPGA 3P9MA 4NDMB 4HXAH 4U3CA 1MCDA 4O4YL 1LO3L 5EZJA 1JZ7A 2NY5L 4YHZL 5EH1A 2DBJA 2AVGA 1CGSL 4BK4A 4KJYA 2C1PA 4EUPA 1DP0A 1JN6B 2AJUH 4LVOB 2CK0L 1L9MA 3V6OA 4FOMA 3PXHA 4MNHA 2XTJC 1ADQA 2BY0A 3B5HA 2VIRB 4KUCD 4NT6A 4JFQA 3MO1A 1ZS8B 1V7ML 3R1GH 4DZBB 4HUUA 3RTQA 3PWNA 1Y0LB 1FO0L 1J1OL 1DVFD 5T33L 2YN5A 2HMID 4XNZC 3VH8G 1J0JA 5HI5C 4TSBH 4XBPA 3O0RH 5C0CD 2ZUQC 5EBWA 4PV8B 4LBEA 1A14H 3BP5A 1XF4B 1CE6B 3A6CL 3QPXH 4X7FC 3WIFA 2OL3H 4JGJA 2C3GA 4LSQH 4F7MB 4BSWB 4RDQG 5IM7A 3VD5A 4PR5B 2AP2A 2Q8AL 4WFEE 1OB1B 4XXDB 5IMKB 1A6WL 1BIHA 1A1OA 3UROR 1J0IA 4KDVA 2OMBA 2CDGA 5JW5A 1CGYA 1U95B 5CILH 4PGEB 1KIUA 2G5BB 4KRPB 3NCCB 1GOHA 1XIWD 3QULB 3MOQA 3UC0H 3VFMA 3DARA 4OZ4A 2V2TA 2YD7A 1K8IB 4WW2B 3UP1A 5F9DC 3KYKH 5E2VL 2R1YA 2A83B 4P4KD 4PY8J 5D9SB 1NCBH 2F58H 1CFBA 2AV1A 1IM9B 2DI7A 3SDCC 3WXWH 1PX3A 3HZYB 3CFKB 3H0TB 1G7LA 2V5SA 4P23D 3O11A 2AEQH 5CWSA 1GGIH 3BEVA 1PFCA 3UDWA 2I24N 1H5BA 5D7IF 2DIBA 2YC1B 2A73B 4IDJH 4ZUSA 4FP8H 2WBKA 2FATL 5FHBL 4ORGB 1A1MA 1T04A 5C7XH 2XZQL 2J6EH 4OI7A 2X5PA 3QO0B 1NFDA 4GG8B 4HFWB 4FS0A 1QRNE 1S9VB 3MLYH 4F9LC 1OF2A 1R24B 4Z7UE 5F8QC 3DOSA 2R1WB 4FQXB 3F7RA 1G1YA 3C8KB 4OKDA 2DMKA 1ZT7B 3BPOC 1CE1L 1BD2A 4JPKH 3C9NA 5H2BB 4GAJH 1AO7A 3ZMRA 4ZQKB 5I18L 2FGWH 3ZE2E 1Q9LB 4ALAL 4JLRB 4ZDHB 1CGVA 3OAYK 1M1SA 4NGHH 4CVXA 4LSPH 4RGNB 4RAHA 1F4AA 4C56A 5MENA 1A7RH 1UB6A 2YPLB 1A4KB 1H8NA 4ZSOA 5DEZA 4AEHH 2Q3ZA 4HKJA 1FNLA 3BQUC 4G43B 5D93B 3QT2A 5ESAB 3DO7A 5HY9A 4Z95L 2OLDA 5IVNA 2A6IA 3V7AG 4S1QH 2FDBP 2RJMA 4JG0L 4RWHA 4I18C 3ARBB 1S78C 3ZYJA 1NGZA 4PJGA 5MHSE 1I9EA 3DX6B 3JV6B 4P46C 2WZPD 1MQKL 3EHBC 3BIKA 1VFBB 3WL9A 2BJMH 5DK2A 3VGHA 3OXSB 3KPNB 1I3GL 5EZIH 1MPAL 1CZ8H 3C60A 1YNKH 2IPUK 5DI8A 3SGJA 3OAYH 1NDMA 4WI4A 1MFNA 1WVZA 2YA0A 4MXQC 1T5XA 1L6ZA 2XTJD 1VFOA 2GITB 4BJLA 1M6OA 5I0DA 3DV4B 4XPAL 4JM2F 5BVJB 4U1IB 2HVJB 3ARWA 4OF8A 3DVGB 3NZHH 4M6AA 4X5WA 4NFCA 4YBHA 1U0QA 2FIKB 5EIVA 5HI5D 3RNKB 1CQYA 4KRNA 4EDWL 2GK0B 3BD3A 3PHQB 5HI4C 4OLEA 4PG9A 1FYTE 2FHFA 4ODUB 1DEEB 4PJFA 3W81A 3JXAA 3Q6GL 1EUUA 1V7NL 1ADQL 5E2JA 1OHQA 1QFHA 4LHUD 2AJSL 4JFFD 3JV4B 4S10A 1MEXL 2ZUUA 3NBNA 4KUZL 3NTCH 4F7CB 4R3SA 2D7QA 3VFGH 1DBML 4JE4B 4IMKA 4MAUH 4NO0A 5L0QC 3BUTA 1EBPA 4LIQL 1NGQL 3FN0L 5GRUL 3SE9H 4ERSH 4X4ZA 3Q5YA 4WY7L 3LMJH 3QNZA 4LF3A 4TYUA 2DN7A 4QHMA 3U83A 5C0RH 2BC4A 2A77L 1I8MA 3FAXA 4OZIB 3FQTB 4ISVA 3GSUA 1GZPA 2B2XH 5CLWA 4OLYL 3T1FB 5K9JL 3SDCD 3QQNA 1AE6L 4U6VH 5I8KH 3ARFC 1AXSB 1W8NA 2ARJA 2E7MA 4O2FB 3T77A 2ZJSH 5ERWB 5ICXB 1OARH 3QWQB 4HUWB 3FO1A 3T4YA 1ZTXH 4X6EA 4HHAB 5FB8B 3QDHA 3TV3H 3E2HB 3H42H 3LOWA 4XNYL 4FXGB 3HCVB 2CRZA 2CKBA 2GFBA 1IJ9A 1G9ML 4PYGA 2IMNA 2V9TA 3BMVA 5D7IB 4PGCA 5FKAB 4D0BB 3I6GB 3TIEB 4R96B 3G08B 3MXVH 5HHXL 3W0WA 5DQDH 2XXCB 4Y4HA 3F62A 3MXWH 5D7LB 3U6RB 3BDYL 2LV4A 4YFEA 1IAIM 4YO0A 2VO5A 1FC1A 3A67H 1KYOJ 3MCLH 4XC3L 2X41A 3T0VA 4LDOB 4NP4L 1RIHH 3TC9A 1TVHA 3PWUB 4HIHB 4IRSC 3T2QA 3EW3B 3TBWA 5IB3A 3BZ4B 1F6AA 1ZHLA 2XA3A 2P42B 4JZOB 2DLFL 1W0WA 4U1SB 3KPSB 5E5MA 1M71A 3PHOA 2DQFB 3V5KB 2R15A 3OAUH 2OP4L 4WDIA 1UA6L 2OQJB 2F5AL 3SJVD 4OD3H 3TH3T 3BQUD 5JHDD 5DSCA 5E8OA 3RA7H 3VXOB 5I17A 1RIVL 3K2UL 4BZ2H 4PV9B 2ERJC 3M1BB 4G6FB 2X09A 1JGDA 5CD3B 3MACH 4LLUA 3GJEB 1MI5B 4DK6A 3FOMA 3FT3A 2ZCHH 3P11L 1K2DB 2XYCA 2GUOA 5IEHB 5LBSH 1S78D 4HXBL 4Z78A 1YMHB 5A43C 5E24E 1LQSR 4ZO7A 3CFCL 4MA1B 2NMSA 3T0EC 1J8HD 1INEH 4P46D 3O3AB 3EHBD 2DQCH 4O51B 5GS3A 4UQ3A 3C2AL 5BRZD 4F80A 5HYQA 1T1XB 1X5KA 3QZWB 3S34L 4NC1E 5J13C 4NN5C 4Z5RB 4GAGL 1CL7L 2ITCA 3P9LB 4OLWH 5EZLA 4YWGL 4MXQD 2FX9H 3LSOB 5T5NF 5F6HI 3P4NA 3GSRB 2EC9T 1B6UA 3MBEA 4R8WH 5DT1L 3RUGA 4DKFH 3MX0A 3U4BL 5LJYH 5EA0H 2UVEA 3EYOB 3VXRA 4JFEE 2F54E 4FQHA 3CX5K 5INDB 1W0VB 3VH8B 1BX2A 3JTTB 5BS0D 3MYJB 5FDWB 1W72A 5I6XB 1YEKL 3ZO0A 1UJTA 3LS5H 2I07A 2YA2A 3MLTA 1MHCA 2FNBA 4HLJA 1XGRB 5HI4D 5D8JL 1F2QA 4AK1A 4XMKL 1U8IA 1PKQE 4PUBL 2BXZA 2VAAB 5K9QG 2CMRL 5C09E 1ZHNB 3MRQA 4X8JB 1U8JB 3ULUL 3TVMA 2D9QB 2ZUSA 2MPAL 3GSVA 3CXHJ 4PJEB 3QQ3B 2E27L 3HAEA 4O00A 4QRTA 2V9QA 2Q86B 1CIUA 1XGTA 4QEGA 1FGNH 1IGTB 2P5EB 4OJFL 4BUGA 3EAKA 1A9EB 2IAMB 5HYIA 1JNJA 1KLGA 1OSPH 3ARVA 3MRBA 3KDMB 4LK4A 1CDJA 4KTDL 3ILPA 2DYPA 4QRRB 2DQIL 4LASL 5CGYC 1KTDA 5DJCA 2EYTB 5E9DE 4U33A 2GTZA 1MQ8A 1YECH 2DIAA 5IVXA 4WUUD 5KW9L 5D72H 1BBJB 3EYVA 3GSXA 3RPIA 2Z0BA 4W4NA 5C0EA 4U4BA 4AMKH 3MRMA 3OF6A 2ZCLH 5D70H 3ARFD 3BRFA 5ELIA 5EU3B 4O02L 5AZ2L 5MEQB 4MJID 2XKUA 3L5WA 2FL5A 1BVLB 4K9EL 2W9LA 3EOTL 3ARGC 4BKLA 4P2QA 2BVEA 5C6WH 4TULH 1DR9A 2X4RB 2A1WH 1ZK9A 1GGBH 5GIRA 4R4BA 1OQXA 3VXNB 3HNSH 1YNTA 3P0VH 4JO2H 3ZTJH 3WHXB 3OHXB 2NW2A 5HYJA 3ARDA 5FXCH 5DD0H 2P8LA 3MSPA 1L0XA 1EGJH 5I75B 5KSVA 4OIIL 3QUYC 4KK8C 4L3CA 4Y19B 3HZKB 4HWZB 2HFGH 5F21B 4QOKE 1JPSL 4YX2L 3VCLB 2FB4H 5HGAB 4Z0XB 1UM6L 3KAAA 3IXTB 5TH2A 5HVWA 5F7LB 5JDSB 2HLAB 2CKBL 2FX8L 2NYYC 1LO4L 1KCSH 1MHPH 4KY1H 4IRSD 2AXGB 3KWWB 5K9KB 3QDGD 5JPNB 4H8WL 2HFTA 1ZLWK 2MHAA 3T2NH 3O6KH 3V4PL 5EIQA 2NY6B 4ZAKA 4NM8H 2ATKA 1T4KA 4WI9A 4NO3A 4M3JA 3O2VL 3DRTA 4Z7UF 4KKLC 4ONOA 3KPRD 3WD5H 4WFFE 1JYWA 1AGEB 3WLWC 2BRQA 4W70A 5EZOH 4M8QB 4YDIL 5FUZH 4APQB 1ZLVK 4I3RH 2JJSC 3FFDA 3WIHA 1GXEA 4Y5VB 3S88L 4OKVA 1VFAA 1VGKA 5J6GA 4LCYB 3T0DA 3ZE2F 1RJYA 1FVCA 3MV8B 3QEHB 4DGVH 4QF1B 2F8XC 3T0ED 3HA0A 4PG2A 1YQVH 1XIWA 2MTPA 1QLFB 4G6KL 5HYSG 1EHXA 3H8NA 1R3IH 1GZQB 5FA4B 1K4CA 5E99H 1P84K 1TNMA 1II4E 4M93C 4NZTL 2R2EB 1KENH 5DMIL 3L3GA 4ONFL 5C0DB 2K7QA 3F6LA 1T0MA 2Y1VA 1ZLWH 4X9GA 1G0DA 4NN6C 4OCYL 5C07D 4KJQC 2RQ8A 3U4EB 1EK3A 4BFIB 4OFIA 1HOCA 2HN7A 1OAZH 2F74A 2PW1B 3U30C 3DECA 1RZIB 2WUCL 4FFZH 1P5VA 3EIFA 3KPQB 5GGRB 3PHSA 5F3BA 5SX4I 3G6DL 1ZLVH 2H32H 3MV9D 4OLUL 2E9WA 1FGVH 5TJWK 3WKMH 2EC9U 5CEXB 2OTUA 4FQQA 2E7HA 1IAII 4DCQB 3AREB 3O4LA 4ELKA 2P5WE 5T3XL 3BE1L 3FB5A 5GHWL 2AERT 3SDAB 4AQOA 4PRBA 3VXMB 1KB9K 1OGTB 4JRYB 4ZO9A 1W72L 4DWHA 4HF5H 3JWDL 4CRPA 5ALBL 1G1CA 3KR3L 3P73B 3HRZA 3PABA 5CGYD 1I75A 4D9RD 1F6LL 1AHWA 3UZEA 3VFOA 2X4QA 3CZFB 5EIIA 4PJIE 2VL4A 2FLRT 3D3VE 1ODAA 5I1LA 3QFJD 5IB2A 5CZVL 5JQ6L 3B5TA 2R0KH 3SGDH 4LLWA 1ZT4B 3G5XB 4S1DC 4OV5B 1PVHA 1OPGL 3ARQA 5D7JC 4DVRH 3GIZL 1IQDB 5I1IH 2ZG1A 2GT9B 3ARGD 4F15C 4XPTH 3ARSA 5IQ7L 4NSKA 3WHE0 3NIGE 4HH9B 3F7PC 3S6CA 3VWKB 1UXSA 1UH4A 1IC7L 3KPLA 1U58A 2APTA 1OLZA 5DJ0B 3MRDA 5DJ6B 4X6CA 4D94A 4HUVB 3SDYH 3VGBA 3QDJE 2FJHA 1A6AA 5EUOB 3IFNL 3WJJA 3N1PC 5ICYB 2DQGH 1U91B 1TPXB 1H15A 3QUYD 4KK8D 5BJTB 2DD8L 2WINB 1P69B 5CSBA 4ODSH 3OKOA 1AKJB 4UV7L 4LSVH 4UV4L 4JDZA 4RISL 1TVBB 1HI6A 5B39A 2MOVA 5KG9A 1QSFA 1X5IA 1IKNC 2DM2A 4S0SD 5IW1A 3SQOL 1BPVA 4LKXB 1NAKL 2Z35A 1CR9H 3FT2B 5KTEH 3DUSB 2NYYD 4HK0B 5D7KE 5TE4L 4NOFA 1MH5B 2YZ1A 5FHAH 3BYYA 2ID5A 3HB3C 4K8RH 4XMPL 2F53D 2A9NL 4QY8B 1KG0A 5C0BD 2VAJA 1ZA3A 2X70B 4Q0XL 4JN2B 3GSOA 3ZSTA 4RCAA 1ORQB 1PD6A 3N1MC 4KKLD 4LNRB 2FSEB 1K4DA 4RMRA 3WLWD 4WNQB 2EZ0C 4YXKL 1QNZH 2C3WA 2VZ1A 4LVOC 4XH2A 2WAHA 1QHOA 4UOW1 4DN3H 1JZ5A 1JL8A 5JLZA 2VDOH 3HPJA 2PCPB 4X5LA 3UTSD 5FYKU 5EOTA 1QRNB 3O9WA 4NYLB 5IGXH 4Z7UB 5GS0H 2W0FA 1DCLA 5A2IH 1H3XA 3OKNA 1EFXB 1QSEA 5MEOA 3FQNB 5GQBA 2C4XA 2Q20A 1I85C 2Q7NA 4PLNC 5KS9E 2W9DH 4WO4B 5FM5O 3FT4B 2R0WL 5CJXC 3TO2A 4BZ1H 5F7YC 3SKUD 1IL1B 1SEBB 5K9QI 3R06A 1HQ4A 1QVOB 3WIHL 3SN6N 2OR8A 1RI8A 1J0YA 5LGKA 1E4WL 2PTVA 1IM3A 3SDCA 2A9MH 5DXWA 1D5IH 4KJQD 4LHJB 1N6QH 4ZTPL 2O5YL 3LPWA 3NA9L 5T1MB 5C0FB 5CJBA 4PPTA 4OCLC 1SYSA 2CIIA 4MCYB 4GW4A 4KRPC 3MRHA 5DD3L 3VMNA 3MGOA 2KZWA 1Q0YL 2BNQE 4GQPH 1JNLL 3VMPA 1DL7H 1JTTA 1KIRA 4NKDA 5C0AA 4Z7QE 1WBXA 2IF7A 2E3VA 4WW2C 3VFTB 5FGCE 3G6AB 3STBA 1ITCA 5JXEC 4L8CB 5DS8A 3IDXH 3LD8C 3MGAA 5KVDL 5CLTA 1RVFL 1H3GA 3IJHA 1T5WA 4NN7B 1UQSA 4DQOH 1GHFL 3F8UB 4H1LH 3DROA 1ES0B 1C5DB 3EGSB 5HHOE 4EI6A 4M7LL 1UB5A 4PREA 5ALCH 3MRRA 4PJCE 3QCTL 4P0DA 1QBBA 5D71L 4NNYB 3X11B 1J87A 3WFHB 4Q97A 3B6SB 1FJ1B 2HFEB 1ONQB 3TPUA 1OAUL 4YDLB 1V5JA 3EOBA 5KSAA 4RZCB 4TOYL 4JHWL 1LVEA 4XPHH 4J4PA 1JGUL 4XCYB 3VW3H 5IKCA 4HS6B 4OGYL 4NJAH 2VLRD 2PYEB 4U6XB 2Y6SC 4Y89A 5HGDA 4S1DD 1NBVH 3DSFH 4GMTH 2UZXB 5D7JD 3GHBL 3EZ8A 3NVQA 3EUUA 1B3JA 1JWMA 3JWOL 4UDTA 4U1LA 2PYFA 4X6FB 1EBAA 1KTRL 3M17B 1VHPA 4YDJA 3SJVA 3H7BA 5FO7A 4W6XB 2DLIA 1LO5B 1DFBL 1TZGL 4PTTA 1TJIH 3MR9A 1WZ1H 4PLKC 1CU4H 3LEXA 4J3WA 4HH8A 2IGFL 2XACC 3GK8L 4NCDA 2X4SB 4ZS7H 1RHFA 4ODVH 1S7SB 4I18A 1F4WL 4RGNC 2VXUL 3G5VA 5DVOA 1S9YA 2ARJQ 2QADB 2XA8L 1PG7X 1J8HA 2J8UE 4J1UB 1KLUB 4ZFOA 2XT1B 2R0LL 5BRZA 1FPTH 1YEEL 4IMLB 2WNGA 4XC1L 2GK2A 5D93C 1RD6A 1AC0A 1T0PB 1DUZA 1GPOL 1LP9E 4Y16C 1I7TA 1U3HC 2EDBA 3B2UC 4Z0BH 1Z3GL 3ZHDA 4KTYA 3HB3D 1K3IA 5HDBE 4X99A 3GJFK 1RMFH 3QJHA 4LCIL 4E0RA 3ARBC 3ZYIA 3U36B 1WTGT 1KBGL 1QBMH 5BS0A 1T1ZA 1XF1A 2QQLH 4TTDC 2WANA 4IOFC 4NM4L 4R0LB 1BF8A 1TJGL 3WYRA 5C8JB 1SJVA 5BZDA 1GVIA 1JF1B 1U8OB 3S37L 1WISA 1Z5LB 2EZ0D 1CG9A 4UNUA 1RUKL 4LQFH 1MREH 3WFDL 1EHLL 5LG1A 4J8RB 3RWIA 4OF3A 4R4FL 5I8EA 3A6BL 2Y72A 3RIFF 3RZCB 1IRAY 1BFVL 1Q1JL 2BZDA 2DQEH 3L3OA 3X3FL 4Y2DB 5HYSB 1NAMA 1F3DH 3E6FA 3OKKB 1FAIH 1GCFA 4RMUA 3HI5L 3OX8B 1KTLB 5FUCC 5IFAL 4YIQA 4RFNB 4D8PA 4KQ4L 1QUNA 4K8RC 2ZP0T 3RIAK 4QLRA 3WS3B 4EBQL 1GRWA 5JZ7C 4EQ3A 2W0PA 1CLCA 3L3IB 4QHNB 5DUBA 4WUUA 2N1KA 3GJFH 5FK9A 1DQJB 4AEIH 1UG9A 4GRMA 4OAWB 3UEZA 1E4XI 3ARFA 5GSRA 1P4BL 2Z31C 4MJIA 1I1AB 4BH8A 4KRPD 4U0RB 4JQXC 2B0SH 4F2MA 3OGOE 2JCCA 2WWKO 4LLVA 3ZKSD 4NZRH 4TVPE 1AGDA 5GS0C 1U8NB 5JXED 2EO9A 4RMTA 1D5ZB 2Y7QB 5I73B 1N7ML 3STZB 1EEQA 1ZSDA 1YA5A 1IM9D 4QHLA 5L2KA 5DJZA 1JHTB 1HNFA 4PB9L 5CJOL 3HMXA 4UDUA 3QH3B 4MMZC 5I1CL 3TWCH 3BVNA 4HDIA 1FCGA 1WIUA 4UNTA 3C08H 4OUUA 5L9DL 2ADFH 5GRJH 4WI3A 1W2KT 4XCNB 4C57C 3CMOL 4LCUA 3O2DA 1P7KA 4HPYH 1Q72H 1MJUH 1P9MC 1P1ZB 3UJIL 4X80L 4TVPH 5DYOA 1CF8H 5ID1A 2Y6SD 1A6ZA 1ZWIB 2VZUA 4JFEB 3U0TA 2COQA 4F58H 4GUPA 3S4SG 2AK4A 1JZ6A 1T2QL 2W60B 4WFGD 1P84J 3KPRA 3VXUD 4UOJA 2VLJE 2CJUL 4OGAC 1WT5A 3HUJE 1YC7A 5DURB 4LDLB 3O4OB 1NH6A 4IIQA 3ZHLA 3OKLA 4PLKD 4YHNA 1TXKA 4KHXH 1PKQB 4PJ9B 4U1KA 4YDVA 2GSGB 4FQ1H 2D7TH 5C09B 1R3KB 1J88A 4RGND 4F7TB 3SDDC 1BGXH 1DDHB 4L29B 5HJ3A 4L3EE 2GJ6A 3T0EA 4PJIF 4ENEC 2Z8VC 3KJ6H 4F8QA 4XNMA 1NPUA 2EYRB 1X7QB 3V52L 2VERN 5A2KH 3HI6L 3MV01 3BX7C 4DTGH 3BMWA 4RRPA 5D2NB 4Y16D 1I7RB 2H1PH 1JHLH 3FQXA 4XP4L 1U3HD 1LK3H 3B2UD 5DMJB 3GBNH 5C07A 3NIGF 4NHUB 1QFWM 1KB9J 2IBGA 3AM8A 3ARBD 3VE0A 5JW4Q 3H9SB 4HIXL 4CNIB 3GMOB 4M61B 4MA1C 5EU4A 4CU7A 2A0LC 4GXUM 4ZFOL 3BISA 4N0YH 1WFNA 4TTDD 1A2YA 3KJ4B 4IOFD 3P4OB 4KDWA 4BH7A 1V3JA 1EH9A 1MCPL 2XG5A 3FKUS 5L88H 2BVPB 5F96H 1DE4B 2BSSA 2VLLA 4YHLH 4H88L 5IW3A 4H5SB 1U3ZA 4XP1H 1CXHA 4EOWH 1OL0A 5KOMC 3LQZB 3TCLB 3UJTH 1VEOA 1NKOA 3MRFB 1S5HB 3QIBC 1MFEL 2VDQL 5JORA 4RMQA 2P7TA 2VWEE 4HT1L 1U6AL 1UFUA 3MLSL 4YUEL 3EDDA 5IFJB 3NPSB 3KVQA 4O9HL 3FB7B 5J4MA 3PWJB 5EO0A 2EDKA 1MWAB 5FUOH 4U0QB 3MOBH 4K8RD 2A74A 4UB0L 4BA8A 4LKCB 4JKPL 5JZ7D 4S2SA 1QOKA 1CLOL 4HXAL 4LOUC 5DJ8A 1AGBA 3WE6B 3HZVA 4XMLH 4M7KH 3QXVA 2QQNH 3KPPA 5TGBB 4KQ3H 5LCVL 5E2WH 4KHTH 4HUMB 2Z31D 1JFQH 1HHJB 1NAML 1PYWA 4ODWB 4ZUUB 5DJXB 4BSVB 4QXTA 3P30H 3NABL 4PRPA 4NWUH 3RX8A 4G3YH 1N8ZA 3OSKA 3GI8L 5FGBC 1MIMH 1T2XA 4N9GA 5E70A 3LZFL 1RAMA 2EIDA 5GS0D 1KPUB 2NX5E 2YEZB 1HILB 3DTXA 3IGAB 1EVTC 3IFPB 5KS9F 3PDOB 3O0RL 2Z8WC 4O5LL 1QKZL 5ANMA 2JB6A 3BHBB 4NRXB 1XR8A 1L7IL 1LDSA 3VWJB 1TTUA 2Z9TA 4KI5E 4PRNB 5INCA 5IR1A 1IC5L 4YHIB 3AFLA 1QZ1A 5FYKH 2IH3B 5KVGH 3Q0HA 3FN3A 4MDJA 3SKNB 4ZXBC 5EBGA 4QRPE 4DFIA 4NZDA 1KXTB 4Z7QF 1DBBL 3UC0L 2D0GA 1ZMYA 4FTVB 3PJSB 1C16A 5C0BA 1R5VA 1F2XK 2ADIA 2CLRB 5I8OH 3HMXL 2P43B 1M05A 3QWRD 1YJDL 43CAA 2VXTH 5D7LD 2V6HA 1MAJA 3MFGB 3PUCA 1PG7W 1NC2B 4OGAD 2QQKL 3FONB 5J6HB 5IIEB 5DJYA 4KKBC 4EQ2A 3O2DL 4K7PY 5KSBF 1OAYH 2K7PA 1UACH 3GSWA 4YK4C 2AEQL 4O2CA 3IFLL 4PJCF 3WKNA 2Z93A 1ZGLM 3PE9A 43C9A 3TO4B 3SDDD 3QXAB 4FP8L 3VXSD 5DLML 4P3CH 3KPSD 2P5WB 5J11B 4ENED 1IQWL 1FNGB 4X7CC 4I9WE 1T80A 4JFDE 1DBJH 4FN0A 4L4VA 4PB0L 2D03L 1QACA 2GKIA 1NCCL 3IDYB 2VE6B 4B41A 3CFBB 5CSZA 4QXGL 1MI5D 1F13A 3U2SA 3PGFH 1YDPA 4KXZH 4LAQH 4MGXA 4PJIB 4Y5VC 3D3VB 4BQ6A 3ORJA 2AJYH 2BCKB 4LGPB 3X14B 6FABL 2Z4QB 1TZHB 5DEGA 5C6TH 4Y88A 1CWVA 1KIPB 4E41E 5GS1B 3LRSB 1PG7H 2A0LD 1WQVT 5LVEA 4FQCH 1EAPB 4GJTB 5BCAA 4P5TB 4P9HL 3C6SB 5IFHH 3HNVL 2ZG2A 2NW3B 3K8LA 5DJ2A 1JV5A 5C0GB 1ED3A 4GW5B 3RU8H 4X98B 1JPGB 2RFXA 2J8UF 4UIKH 1CFTB 5SWQA 4FQJH 5DZLA 3H3KA 4RFOH 1A7RL 3LIZL 2CLZA 5F7KC 3EYUL 4URTB 5MERA 4EUPB 3QIBD 4KJYB 2R56H 4M1CC 3ABZA 1KLFA 1I1FA 5F6HJ 2W65B 1LP9F 1JE6A 4P59H 4MNHB 5AWNH 1I4FA 4JO1L 4UIMB 5DWUH 4PRHE 4K7FB 2Q8BH 3VDCA 5GGRY 5HDBF 1A7NH 5B38G 4HUUB 3RGVB 1S9XA 5L2JB 4P5KA 5K9OA 2XG4A 1JMZA 3GM8A 2YSSA 3O6FA 4A2MA 1KJ3L 1WEJL 2C5DC 1NDGA 5ESQA 1AJ7L 3BO8B 4LOUD 5EBWB 2BHUA 3OXRA 4CU8A 5BXFA 4LBEB 2EEAA 3BPNB 3DWTA 3V0WH 2AEWA 4JJ5A 3TJEL 2AV7A 4I0KA 3SDAC 4JQVC 1YNKL 2IG2H 1E4KA 3QNYB 1F3DJ 2QKIB 5EORH 1XH3A 3MPCA 1TETL 1HH9A 1RZGA 3L3JA 3QA3B 4MD0A 3ZKNC 1UGNA 2VL5A 3ZDZE 3KXFE 2ZSVA 4QRRD 2AJZB 2NXZC 3VFPB 3P4MB 3UTPD 2VDPH 3MFFB 4P2CG 4WUKH 3IB4A 2HT2C 4MD5A 2ATPB 3BIBX 4Q74A 3VFSB 1A1NB 5EU6E 4OM1L 3F7VA 4WWKA 2AABH 4I13B 1BZ9A 4KVCL 1MRCH 5GS2H 4XBGA 4DZ8A 1CICB 4W6YB 3LEVL 1KSRA 4YPGB 2R1YB 1T20B 4Z7WA 2G60L 4ZPVA 4JDTL 2FO4A 3NN8B 4WTZG 1NLDL 4U6HA 3RL2A 1X6NA 1IKNA 3W82A 2FEEL 2CIKB 4ZFGL 2LU7A 2KQMA 4ZXBD 1B4JH 3G5ZB 1JPST 3CVIL 1SJHA 4TN9A 1BP3B 3IJYA 2JELH 2DM4A 3SKOA 1A1MB 4PJXA 4NBYB 1P2CA 3S4SB 4NDMA 4Y19D 5I2IA 2DJ4A 2VSDA 1S3KH 3ZDYE 2E9JA 3RWFB 2J5LB 3HG1E 2VQUA 1FVEB 1G7IB 3UXFA 1JGEA 1WUNT 1JN6A 2LABA 1MRDH 1KGCD 4KKBD 1RY7B 2DQHH 2ZJSL 3QUKB 5FGCB 2XZCL 1ZS8A 4DZBA 3ECBB 1YEGL 5FYLL 5CIPH 1IILE 3VA6A 1A7OL 3FO2A 1RULL 1FFRA 1Y0LA 2YMXL 1YPZE 3SE4C 1L4IA 1WZMA 3T04D 5IVZB 5IEKB 5CGMA 2Y06L 4E42A 5KSBB 2YPVH 5HHOB 4PV8A 3PV6A 5E6IB 2H45A 5CJXA 4PJCB 5ETUB 3K80A 1XF4A 1TQBB 1CE6A 2UWEB 3GI9H 1ZLSL 2HKHL 3MUHL 1IGYA 4BSWA 12E8L 3QCUH 4G9FA 5SWZB 1X5LA 3FFCB 3MRLA 2HJLA 1OB1A 4XXDA 5IMKA 4U2YA 3RVUC 1NANH 2EDQA 3HUJF 3I84A 3DO7B 5IQ9B 4PRDB 4LPVA 4XCEB 2E7CA 1O7SA 1U95A 4IRZL 5EC2B 1F58H 1WAAA 2P49B 4PGEA 2G5BA 2R0ZH 4EEEA 3QG6B 3QULA 4XVSL 1Q0XH 3FOLB 3LS4H 4F8TA 1CXFA 1JTPA 3PXJA 4G7YL 4XP6H 3MLVL 2R8SH 1K8IA 4K94H 4WW2A 3BFOA 3MA7B 1T03H 5JXEA 3SKJL 2BERA 4ELME 1Z2KA 3BSZL 2A83A 4ZFZB 4NWTH 3ALPA 4Q6IA 3HC3H 2B5IC 4WJ5B 3U7YH 1UJ3B 1IM9A 3ETBF 1T0NB 3HZYA 1OM3L 4NRZB 4LRNL 3DVNB 1HKLL 3H0TA 4M1CD 5AG8A 4XP5H 1OTUC 4MSWB 5SX5K 4FXLA 2KDGA 2YC1A 2A73A 1WZKA 1CFQB 5ISZE 1J0ZA 4NJ9L 4R90L 4X5WB 3PL6B 1CBVL 4GG8A 4HFWA 4HJ0C 3T2OA 3NGBB 1LP9B 2X6MA 1S9VA 3IS0X 3QSKB 1VESA 4NFBA 5T3ZH 2B39A 3NIFE 1J10A 4I48A 4FQXA 4BELD 5DJDB 1QBLH 4X7DC 3C8KA 5KJRH 3D1MC 2HKFL 3SDAD 3VXMD 1A22B 4HGMA 2NNAA 4JRYD 4NC0B 4WFHD 5H2BA 4XVJL 4PBVC 1IC1A 3ZKND 4RGMC 1DEDA 1U36A 1ZANL 2I5YL 4ZQKA 4ONHB 4XTRC 4YHOL 2NXZD 1Q9LA 3MV7D 4JLRA 4ZDHA 4YDLC 3VFWB 3GKZA 2HT2D 3M07A 1XGQA 1OP5K 3R4DA 5CEZH 3WSQH 3I6LD 4FFYH 5HGGS 3W2DL 4C54A 1JVKA 3DO3A 1LO3H 3PGDB 5SX5H 2BDNL 4CKVX 5EWIL 1UH3A 3OTTA 2YPLA 3GMMB 1ZGLB 2NY5H 1HCVA 1A4KA 4YHZH 2CO6B 1CGSH 5F44A 1JBJA 1WCQA 2BHYA 2CK0H 4G43A 3L5JA 5I66B 4NQEB 1V7MH 3FO1B 5DHVH 3LVEA 4X6EB 5T1LA 3LEYL 3PV7A 3ARBA 1FO0H 2DOCA 4FABL 1X44A 1J1OH 2VB5A 2QADC 4M7ZC 5T33H 3DX6A 3JV6A 1K9TA 1VFBA 2MQCA 1HXMB 3WO4B 3TYGL 5IK3B 2OZ4H 3OXSA 3A6CH 4PGCB 3KPNA 2B4CL 3V5DB 1N3NB 1FNFA 1OP5H 4LLQA 4KI5F 2Q8AH 4RMSA 3RWHB 1A6WH 1IEAB 4Z18A 3DV4A 1R6VA 3MUGB 5BVJA 4LPCA 1YN6B 2HVJA 2VXVL 4G6JL 4U1IA 2VUOA 3DVGA 4TULL 4PJBB 2BOBB 3CFJB 5FYKD 2EDDA 2GAZA 2X05A 1SM3L 4JO2L 2FIKA 2HH0L 4R0LC 4FMKA 3RNKA 4BZYA 5CEYB 3PHQA 1F6AB 2V5TA 2R4SL 3OR6B 4UT9L 4ODUA 1DEEA 5E2VH