5IMOA

Nanobody targeting mouse vsig4 in spacegroup p3221
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
GHPTLKTPESVTGTWKGDVKIQCIYDPLRGYRQVLVKWLVRHGSDSVTIFLRDSTGDHIQQAKYRGRLKVSHKVPGDVSLQINTLQMDDRNHYTCEVTWQTPDGNQVIRDKIIELRVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nanobody
publication title Structural evaluation of a nanobody targeting complement receptor Vsig4 and its cross reactivity
pubmed doi rcsb
source organism Camelidae
molecule tags Immune system
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5imoA00
5DHXB 1L7IL 4PLKC 4KROB 4Q9QH 2W0PA 2Z31C 3QQ9C 3REWA 3BP5B 4ONFH 4L1HA 3QFDB 4PYGA 3RQ3A 2OL3B 3NVQA 5I66A 3EYUL 3MREA 3VXTB 1JGLL 5K59E 2DWDA 3KPQB 4Q9RL 3T2NL 1SY6A 1TFHA 3VFWB 1T03L 1CE6B 3WXVL 3T65A 4QNPE 1A7OH 1WTLA 1CFNB 4K23H 2W65B 4WHCA 2GI7A 3LSOA 3EUUA 5C08B 1IM3A 3AY4C 4PJ5A 2VERN 2DQDL 3GMMA 1NKOA 5DD5L 3ZE2E 3UJJL 3QDGE 1FG2B 4XI5C 3N9GH 4TSBL 3CX5K 4ESKA 1Y6MR 4PY8I 3BEWA 1AGEA 4YHIA 4Z7WB 3LKOA 1JI1A 2UY7A 1WZKA 1DSFL 4I9WD 3NN8A 4OZGB 4QRPE 4JFFD 3LV3A 1SEBB 4FOMA 5ISZE 1M7IA 4PJDB 3F5WA 1IGJA 4BK4A 2QEJA 4XRCB 2W91A 5D1XC 1KB5L 1XR9A 4ODSH 4DN4L 4GQPH 4JM2C 4LSPL 4LLMA 1NGPH 4PTUA 1TETL 3WFBH 3QXAB 3MJGX 4OZIF 1EMTL 4D0DA 3LH2H 5H2BA 1W72L 1GGTA 5JXEC 3U2SA 3GMQB 2PO6A 1FGNL 4OLVH 4LLVA 4K8RD 1QLRA 4NBXB 5HGAA 2VDQH 5FXCH 1C1EH 4ERSL 5KVFL 3P9LA 4N90E 5EBLB 4MJIA 2ICES 2G9HA 1Q9KB 4J1UB 1IKNA 3PWJB 1BQSA 3OGCA 5I8EA 5T1KA 2I9TA 3LEYH 1SYVB 3C8HA 2CKBL 1YDPA 4X9HA 1ZGLP 4G9FE 3P9MB 5DK2B 3TT1H 3FQWA 2AXFB 4J3TA 4M5YL 5FK9A 2JIXB 5KOMC 3S34L 5E8EB 4OUOA 5C7XL 3RTQC 1FZJB 3TA3A 4LLWB 4I0KA 4ODUA 1RFDH 4ZFFB 2WMPA 3ARDC 5J13C 2DD8H 4XCFH 3KS0H 3U4AA 1DBAL 4KHTH 5CJ5A 1KYOK 1MH5A 4ALAL 2RJMA 4WHTB 4AEEA 1QHOA 1YN7B 5C0BA 4LPTA 4X7EC 4HUWA 5DLML 4HIXH 5HDQH 5LBSH 5BS0A 2A77L 1S8DA 3KXFA 3RVUD 5CLWA 4HJJH 4G6JL 4MDJB 4PJ8A 3QB7C 4QTIL 5AD0A 3BW9A 4TRPH 2DDQH 2FECL 4CDHA 4QOKB 4HIEB 2YPLE 4YBQC 1OQXA 1LWRA 2F9BT 2VTFA 5EO0A 2BNRB 2C3XA 5KS9F 1X4XA 3H2WA 1NGZA 1IGYB 1YN6A 1JHKH 3KWWA 3QR2A 4LU5H 2FL5A 3BKJH 2WNGA 1NAKH 2NR6C 4M1GL 4QXUL 5K9QG 2R39A 4HV8B 4BH8A 4ZFOL 4JFHD 2R4SL 3CFIC 3F7QA 1FZKB 1JPSH 1UCBH 4LCCC 2X2YA 4B5EA 4NJ9H 3T4YB 1I9IH 1BLNA 5ESAA 2X4PA 3PQYB 2E7CA 5I2IA 4WUUB 1YMMB 3X3FH 3KLDA 1MCNA 2HFFB 1EFXA 2FGWL 1JMXA 5CEXB 1ND0A 4QT5A 1G7IB 5DJ6B 1F4XL 4XGZB 1V3JA 3IDGA 3CC5A 5C9JB 3S37H 1KXTB 3O2WH 1KB9J 3SDXA 4HBCL 3JVGC 5ANMA 3QIBB 1MCCA 4UILH 5D6DC 1U2CA 1RIVL 1AJ7H 3WIHL 4MXWL 2PR4H 2CJUL 3ZE1E 3IETA 4FFYH 4NQCA 3BRGC 4OD1H 3PABB 2C3VB 1KLGB 1NFDF 2EICA 4HUVB 3F6IA 1CDBA 4I9WE 4MCZB 4JFFE 1NKRA 1HYSC 4RAVB 4R26L 4JDVA 3DTXB 4Y4HB 5GGQH 1KTDB 2E7HA 5IMOA 3OKEA 1VFBB 3NCJH 5ERWB 1R3KB 2UUDK 2UVEA 1AY1H 1RJYA 5I1HH 3VXRB 2Z92A 4IRJA 4MDIB 4X98B 3UBXI 4F37F 4L3ED 5HYJB 3T09A 3GBLA 4LHQB 1RZJL 2VDPL 4GAJH 4GQ9H 4LHUB 4DZBB 5I1KL 2Z31B 4ZSOE 5SV3A 1V3LA 4G9DA 3AU1B 1MCKA 2EC9T 1UH4A 4WWKC 4CKVX 1BFVH 3UTSD 2VXSL 1MHCA 3GO1H 4OB5H 1JWMA 2J7LA 2CKNA 4PIRF 1OAUH 2VZTA 4W70A 3NACL 1A6WL 4HQQH 3Q6GL 2P5ED 3PWVB 2WBJA 4X6BB 1O0VA 1VKXB 3U4BL 5FKAA 1MJ7H 1IJ9A 5LGJA 5I1JH 2QTEA 1RZJC 4N8CL 5DHVA 1BGXH 3ARQA 3BKYL 3IRZA 5GGVL 1OLZA 2W9DH 4I8DA 4H26A 3HUJB 1OSPH 5T1MA 2MCPL 3BUYA 3TPUB 5HDOA 4LRIA 2PKDA 3O4LD 3KPTA 1WF5A 4KK5C 3BN9D 4P2QB 5D1XB 3FFCE 4LGRB 5H94B 4JM2B 4KHXH 4JG0H 4OSUL 4DFIA 3C8KA 5EUOE 1TJIL 4YJZL 2L7JA 1KENH 5MEQA 3QIWD 1FYHB 5HPOA 3DLQR 4WVRA 4PPTA 5SWSB 2CIKA 1A1MA 1CE1H 4Z7VE 5D5ME 2BOBB 2EH8H 2VXTL 1I3RB 4R4FH 2X09A 3GGWB 4HWUA 2P4AB 4QHUB 5BOPA 1BD2B 2PCPA 4WW2A 4HPOL 4GUPB 1RZ8B 2GTZA 4JFHE 5HI3C 2VR9A 5CJOL 5IQ9B 4XVUD 3QXDB 3I50L 3UTTD 5JQ6H 4F9PC 3CFJA 4L29A 4QF1A 4TQEH 2DLGA 4L3CA 2CDFA 1NAMH 3NBNA 2A0LD 5IEKB 3CZJA 4JFOB 4KPHL 4G8GA 3QEUA 5DR5H 4DKEH 3VCLB 4FFZL 4G42A 4NQTA 2E6JA 3ARDB 1CLOH 5J13B 1RURH 3MZTA 3U0PB 1AFVH 1IM9D 4IRSC 3LKQA 5HI5C 5D7JA 1T7WA 3KG5A 4U0QB 4MD4B 1KPVB 3UYOD 2G5BB 5EBWA 3W39A 2ARJQ 5ICZB 4XNUH 4J8RB 1QD0A 1T5WB 2JF1A 2UWEB 4AENB 5IBLD 5EBMA 3HLAA 5FM4A 5MENA 3B4NA 4H25B 3E3QC 1ZVHA 1TVHB 1MFAH 4JQVC 5GISH 2NY0D 2H26B 3ARBC 4YX2H 1N6QL 4KJPD 3O41B 1GZQB 2VZ3A 1EIBA 2AGJL 1GJIA 5F9WC 1NCWH 2VNCA 1HEZB 4N5ED 4MGXA 4NCC2 4PJHF 2GTWB 4FXKB 1DQJA 5KVMC 4H0GA 4NO3A 3LHPH 1GPOH 3PG2A 4CAGA 5FGCE 5B22A 2ZCKL 2XPGB 1JZ8A 3WHE0 5EOCJ 3TZVD 4XC3H 4L3EE 5T1DL 1ZANH 5CHNA 1CS6A 4LCCB 3ZKMC 5C1MB 3PJSA 4PS4H 3VWJA 4ONFL 1DN0A 4CU8A 1EEQA 3DUUA 4MNGB 2HJFB 4HMEA 3BP6A 3MOAH 1A4KA 3UTSE 4D0CB 3V5HA 2WLYA 1J1XH 3O11A 5DEFA 5IFAL 3S88L 3D69B 1BP3B 1MCSA 1CD8A 2Y07H 4R2GB 3QWRA 3QXWA 4PRIB 4LCUA 1D5ZA 4LSTH 3OKDA 1P53A 2XTJE 5D2NA 2Q7YA 3F12A 4L4VA 4MJ6A 3C5ZD 5F9JA 4Z8FH 3MMEB 2BY0A 3SE3A 4Z7NF 5DZOA 4EXKA 3QCUL 3BDYH 1QBML 3D18A 3PF2A 4N0YL 4MQ7B 5FO9B 4GFTB 1Q9WB 3SDAA 5EOCH 3V95A 4F3FB 2A83B 4Z95H 2K9UA 4GKZA 1BQUA 2DM4A 1OTTD 3MACL 1N7MH 1BVLA 1AQKH 2FSEA 3O4LE 3QO0A 1LP9F 2L4OA 4ODSL 2XWBA 2YUVA 1RUPL 1NGPL 2NQCA 3G6AB 1RUML 1SMAA 5CEZE 3WFBL 5FOJA 4MX7A 1KUMA 1ZLVK 2CIIB 3P30L 5J3HC 2Y06H 3UPAA 4D8PB 4GRLA 1ZA3A 2W0FB 2HT2C 4NQEE 1DE4A 2OTUB 5IB1A 3T08A 1NUGA 1N64L 4WI5A 1IL1A 3IAGC 4YQXH 4WWKB 4ZO7A 5IESH 4LEOA 3QWOA 1ZA6A 2M2DA 3TNNA 3PV6A 3DPBA 5A1AA 1VDGA 3HE6D 4RRPA 2XN9D 3LEYL 5J89A 4LLYA 5T5FH 4RFNC 4PTTA 1TTGA 2R29H 4ZAKA 1X5GA 4GJTB 2QQKH 1HK6A 1NBYB 2A9NL 3E8UH 3WJJA 3BPCB 4YNYA 1HXMB 3G9AB 1DLFL 4S0TD 3C2AL 5HVFB 4LLUA 1HSBB 5IQ7H 2R56L 1BJMA 3K4AA 4W68A 5ITFB 2ADGB 4E41A 4JB9H 1KTLB 1I1FA 1XF2B 4PJ5D 5T1LB 3FFDA 1HHKA 5TQ2L 2E7BA 4AEIL 3OKNA 3ZYOA 5JO5A 3EOBB 3D39A 5ALCH 3MO1B 1JYVA 1VFMA 2IQ9H 2OSLB 5DMYA 1UQSB 3B5GA 4P9HH 1AP2A 1ZAGA 3L5IA 1MIML 4D2NA 4RX4D 4TRPL 2QLVB 5I15H 2QADD 3QNXA 5DTFA 3OJMB 3WL9B 2IADA 3X12A 4RZCA 1P9MA 3PWNA 2H8PA 2OI9C 4F7EA 1RVFH 4PJ7E 5F44A 1JHKL 2Z8WC 3KPLA 1LILA 1T22B 1ETZB 3G6DL 1NAKL 5AZ2H 5F7KC 1LK3H 3DV6A 3RWCA 1PKQA 1CXHA 1ZLWH 4N0CD 1JPSL 1KJ2B 4BZ1H 4MHHG 2Y5EA 4WEMB 4I4WB 2D7TH 4NQXA 2JCCE 4NJ9L 4HUXB 1XF1A 2PO6D 4DUWA 1P7KB 3HPLA 4H0HB 5DQJB 3I02B 2P8LB 3X3FL 1IAOB 3FO9A 3OR7B 1J1OH 4UV7H 5B39B 4MJID 4XCEB 1J0KA 2Z91A 5E7BA 4MJ5B 3S37L 4MCYA 3KR3L 4XC1L 4KRPC 3GB7A 5EA0H 1M05B 1BFOA 3GSXB 3K2MC 4IRSB 4M7KL 3VGGA 4YO0B 1GHFH 1XGUB 3LQMA 4HHAA 4PJXF 1A7PL 1G7QB 4L8DB 4JRYA 2Y4SA 3PHQB 4HIIB 1FFNA 2X4NA 1CCZA 2BK8A 2D4FA 1KIPA 4NQVB 2FIKB 3P3YA 4PJ9A 4IM8A 5DC4B 1W0WB 4YUEH 5F6HJ 3C5JA 3BDBA 1Q72L 4QRTB 3TA3D 2QSVA 4OGYL 2A38A 1T04B 5CMAA 3ARBB 4PJBE 5C9KA 1EX0A 1GGCH 5DJXA 4L8SC 3GHBH 4OF0A 4ODTL 1NFIA 3BDXA 5F9WB 1NUNB 4D9RE 1KV3A 1SJHB 2VABA 1MAKA 2VDNL 4R90H 4U4BA 4H5SB 3NCJL 4MA1C 4F9LC 1IKFL 1G6RB 4XP9H 3ISWA 5F89B 1B4JH 4MNQB 1F11A 1FPTH 4LEXH 5E8DL 5BS0D 3KXFD 2RCSH 1XGQA 1UKTA 4C55A 2VLMD 4DGVL 3MYZA 1IVLA 1J1PH 4NO5B 3ZTNL 2CSPA 5HGHA 4YHPB 4GSDL 4D94A 4QYOB 1F90L 1UB5B 3K0WA 2JB5H 4PGCB 5IHZA 2EDLA 2DYPB 2EH7L 4TPRL 3MGOA 2AXGA 5JOPE 1BQLL 2DWEB 2X70A 4NZDA 4OZFG 1Q9OA 5GRYA 5I1DB 5IHUL 1VGEL 1KPUB 3WS6A 2XQBH 5T3XL 2XN9E 2FBOJ 1ORSA 4HQQL 1FAIL 2OM5A 1WJ3A 3MRKB 1MJUL 4JFQA 5F7YC 4TTDD 3BIKA 1A9BB 4QHMB 2IC2A 2OR8A 2NX5A 5DQDH 3IB4A 5I1JL 2HT3D 3R0MA 3H3KA 1G9MC 1BGXL 1EFXD 4KTYA 2DJ4A 3BH8B 4XP5L 3IJHA 4L4TE 4PY7A 1NBQA 3JTSB 4KUZH 1FVDA 1XH3A 3CFCL 2V7HB 3N85H 4B41A 2Y6SD 1OSPL 3I75B 4NCC1 4HK0A 1QFWM 4NN5C 5ESVA 4XPGH 2W60B 2F5AH 4F7CA 4XPAH 4Z7UF 3OG6B 4FQXA 1YPZB 1DVFA 3BT2H 4CJ1A 4GAYA 2HJKB 3LKSA 5HVHC 1A47A 3MBEC 1PAMA 5F1OB 4ZD3H 4FFWD 3OXSA 3M45A 4ZXBA 4R8WL 3GI9L 2XACC 1RU9L 2FHCA 3DI3B 3QI9A 2UYLB 4ZNCD 2BX5A 4E42A 2IBZY 4LPXA 4JO4L 1XGYL 2EH8L 4QHLA 1UYWL 4R4FL 1EUUA 5J11C 2RAMA 2G5RA 5F7NC 3W0WE 2UZYB 2G2RA 3BN3B 3RNQB 1S3KH 5TPWH 4ONHB 1QRNB 3K1DA 1IQWL 4F80A 4RFNB 4HULB 4I2XB 1NAML 1HNGA 4YFEA 1IBGL 4EIZC 1T5XA 2JLLA 5E7FA 1WK0A 1JN6B 3TIDB 4B50A 4WO4B 5C0ND 3U4EB 4K9EH 5ITBH 1VADA 2VE6B 1OAKH 5CWSA 3G6JA 4RQQB 1U3HA 1X5JA 1PQZA 4OIIL 1AFVL 2YN3A 5BRZB 4M7JH 4KDTC 1UKSA 5JTWA 3H8NA 3BMWA 3K8KA 1CLZH 4YWGL 5EU4B 5J06A 3NCBB 4XNUL 3A6OA 4CADA 1FFPA 1MNUL 2WP3T 5D7LA 3T0AA 3L3IB 2GK0A 2DLFH 3OAUL 3SDCA 2FZ3B 5DJZA 5GISL 4YIQA 3MJ7A 2P5WB 5JPNA 4U6VL 1TPXC 4YX2L 4G8FA 3UPCA 4H1LA 2DQUH 2GT9B 3P0VL 1HZHL 2OJEA 3ULVH 3C9NA 3H9ZA 3SE4C 3QFJA 4RDQG 1CF8H 3IXAA 2KZ1B 3H9HB 4WRLA 1YYMH 1YNKH 4HKJA 2BNQA 2XYCA 1N3NA 4XC3L 4FG6D 2KQNA 1MCHA 4PLJD 3N1PC 3V6FA 3VG0H 3B5TA 5H37H 1RZFH 3C5SA 1WWBX 3BYYA 5IF0A 2OX5A 3D0LB 2X4TB 3GSRB 3RNKB 4TUOB 5EN2B 3JWDL 1IAII 1RZIB 1VHPA 1A9EA 4M6MH 2NW2B 1KG0B 4HGWA 3TFKD 5F7DB 5FECA 5ID1B 4TVPH 3RUGF 4YDIL 5HY9A 1JNNH 4UT7H 4P2RD 4KRPB 5ACMA 1RUQH 2KUTA 5SX4H 4LSTL 5HYSB 4HSQA 2GJ6A 2J5LC 4TNVK 1XMWA 2ZNXA 3Q48A 4ZPTB 3HS0B 3DVNB 1KC5H 1RK1B 2R1WA 3BEVA 4GLRH 5TFSH 4ENEC 3UBXB 3BDYL 1U93A 4ORGA 4WHYH 2Z8RA 4G8GD 4K3JL 1CLYH 1XF3B 4RGOH 4LKCB 4P5TC 3S7GA 1OGAA 1IT9L 5ADPH 4XVJH 3QUXC 1QBLL 4RNRB 1E4KC 1WIPA 2VR5A 3ZKND 1ADQH 5FV1L 4EUPB 5FOBB 1AQKL 2BOCA 1LDSA 3DIFA 3LRGA 4MA1B 4M6NH 5DK0B 1G1YA 1INDH 4PGJA 2X7LA 2D4DA 1J11A 5CP7A 4QCIA 2C5DC 1WZLA 4GS7C 5CBEA 2H9GA 4OV5A 2ICCA 1LDPH 2J8UF 4O5LH 4G6AC 4BKLA 1QSEA 1M6OA 4ODWA 5F7FA 4DCQB 3BD5A 4HG4J 2J4WH 3NIFE 4BQ6A 4WFHD 4YQXL 5IESL 3KDMA 3G5VA 4PB9L 3TM6A 5FYJH 3MNZA 5I30H 3D25B 5DFTA 5E99H 1QYGH 3JTTA 2EDFA 1X5ZA 2MPAH 5B4MD 3IS0X 5AYUH 1XFPA 1T21B 1HHJB 4RMUA 2MFNA 5DYOA 3IDIA 2HLFC 1UACH 5ALBL 2BRRH 1H0DA 4TOYH 1XT5A 1NFDA 2C7UA 1J9CT 4KRNA 2F15A 5GS2H 4A2LA 1S9VB 2D0HA 3HC0B 4WGWB 2Y7QB 2VLJA 4JFEE 2AW2A 5E1HB 1BZ9A 3WFZA 3NABH 5DC0A 1AXTH 2YN5A 3X14B 2ZKHL 2H3NA 1IGMH 5IQ7L 1F4YH 4GKSB 5FUCC 3SCMC 1BAFH 5F7HA 3Q0HA 5CILH 3ZYZA 1LO0L 4LPWA 2O5XL 5GSVB 4L4VD 3DX8A 3V79C 4NN5B 1S9XA 4P46D 2BVOB 4P5MB 4QGTA 1E4JA 5ALCL 2YPVH 4J3WA 2IQ9L 1ZLSH 1J8HA 5GRXG 1OB1A 3VGEA 2CGRH 4KUCF 5HVHB 3NCCB 3N1MC 3MBEB 3TJEH 4ZG1A 2Q76A 2DIJA 5DMKB 4AIXA 5HHQB 3FAWA 5I15L 3AC0A 5E6IA 3QIWC 2DKSA 3HZVA 5GJTH 3DSNA 1AO7E 3T8XA 2HWZL 3AXLA 4XP6H 2BY2A 2IH1A 2XG4A 5D93C 5J11B 3HI6L 1LK3L 5FCUH 5T33H 2Z93B 2OLDA 1TVBA 3QDMD 4HS3B 4D3CH 2XKSA 5E2VH 3NFSL 3WIIH 4X4YA 4BFEA 4GRLD 1P4BH 1JP5A 3P4LA 4V1DB 3QUYA 3FT4A 4JFDA 1T89A 5D2LF 4JY6A 3VXNA 3AREA 5EZJB 2E27H 4DTGL 3SO3C 1NCDH 1JWSA 4XWGH 1B0RB 3JWOH 4LBEA 3P4NA 3D48R 1I8LA 3BYTA 3C6LA 3QO1B 4P2RE 4Y2DA 4Z0XA 5IB2B 3HPJA 1GHFL 5DHYA 1K2DA 3E6HA 4MQSB 1E6OH 2V5RA 2Z35A 3RRQA 3HMWL 3MV8B 4ZAKD 5JNYA 1WT5C 1QA9B 3TBSA 1NSNL 2EYRA 3HRZB 1CFQB 4P2OA 1U8NB 2VZVA 5EUOB 3SGEI 2HAZA 4PJIB 1VGKA 4O58H 4GRWF 5EU3A 2VAAB 4KJPC 3D0VA 3RPIA 3QYCA 3B3IB 4QKXB 3DV4A 4E41D 3IDNA 3N1QC 1XIWC 3MRFB 1A6AA 3SKUD 1MVUA 5FYLH 3LDBC 4CVXA 5M95B 3SKNB 2ZOLA 1JF1A 4OM0L 1B4JL 3D39D 5HHNB 1FPTL 4MA8H 4QXWA 3UJTH 3BSZH 3EGSA 3NZ8B 4P59H 2A6KB 5IR1A 2AVGA 1J1PL 4KJQC 3QHFH 4I0CC 5TH2A 5DMIH 2OK0H 4W4OC 3U46B 4PR5A 1CG9B 1CDUA 4ZO8A 3CGTA 1D5XB 1D5IL 2W92A 4WFHE 4P23A 5FA3A 3STBA 2Z4QB 1ZWIA 5EZLB 2P47B 4WI7A 4P57A 1H5BB 1DANT 4RBPK 3WIFA 2H1PH 4NGHH 4NNPH 4WW1B 3QUZA 3U9PH 2HVKA 4JY4A 5CZKA 1BREA 2J5LB 1WCQA 2GAZA 4XNMA 4RGNC 1FORL 3D6GA 4KQ4H 4KAQL 4HWEL 3GMPB 4RA3A 1BOGB 3HR5B 4F7PB 1T0MB 1JCKA 3MA9L 5DUBB 5HJ3B 4FQHA 2DRUA 2J8HA 4KUZL 4P5TB 2DQHH 3FB6A 5EBGA 3QUXB 5AWNL 3N85L 4Y5VC 2IH3A 3QCTL 5TDPA 4MZ3A 4BSVA 1B6UA 4M5ZL 1OARH 2FB4L 1OTTC 1Q1JH 5C8JA 2B1HH 3L3KB 2F74B 4L9LA 1WAAF 4TN9A 4FQPA 1U41A 4JLRB 5F9OH 4PJ9D 3V6OC 1DN2A 1NQBA 3IJSA 3VA2C 4XCNB 4QTHB 3BO8B 3MRRA 1ZHNA 4OLWH 3UC0H 1MY7A 2FGZA 3NZHL 1X4ZA 1DBKH 4GS7B 1VENA 4ZD3L 3VD9A 1AKJA 3IKCB 5E2TH 1T4KB 1KCRL 4LHUG 4APQD 1HHIB 4PJFF 5GSRA 2CLVB 2EDTA 1DFBH 3WDHA 4U31A 1WBXA 3A6BH 1O5DT 3FRUB 4N1EA 3MRGA 3FT2B 4OQ1A 4UINH 3CVHH 2CXKA 2DTMH 1R5IB 3SKMA 1NEUA 4I3RH 1B2WH 4HJGB 1FDLH 5FUOL 3QDME 1W0YT 3CSYA 4JR9L 4H8WH 1HH6A 1S3KL 4S2SB 3KJ4C 3HE6C 3O45B 5L8JB 1WCBA 3JV0A 1K8DB 3MNWB 3EYSH 3NIDE 4UT9H 2ID5A 1UM4L 4O9HL 4KXZI 4XAWH 1RZKH 3TBYA 2P5EB 1LEKB 4PRPB 4UTBH 2HKHL 2IANA 5E5MA 3ILPB 3BFOA 3DECA 4N8VB 2PUQT 1ADQA 4M43H 4WEBL 2RR3A 1KCLA 4LNVA 2ITCA 4XNXH 5C3TA 4NDMA 3HB3C 1DUZA 4LVOB 4M7JL 3MUJA 2PW2B 4GKNA 1GH7A 4BELD 3GSWA 1T7YA 5SX5K 1HWHB 3OHXB 1WIOA 5DUML 1QHPA 5EOTA 1EHAA 3SQOH 3O3DA 1CN4A 4PFEA 4LP5A 2YRZA 1AC0A 1R6VA 3OX8B 1MWAB 4PJGA 1FL3B 4DGYH 1LNUA 4X5XB 2DQUL 1X6NA 4NNXB 2GCYA 5GIRA 4CVZB 5IVXE 1E4XH 3QIWB 3TIEA 4UB0L 3WFDH 1ERNA 4JPWL 2QR0A 4IOFC 5K9KA 2XKNB 1XF4B 1AGFB 3V8CA 4JGUA 1YNKL 1LEIB 1L4IA 5D93B 4FQXD 4FNLL 1YEDB 1MCFA 2Y1VA 1DVFD 2ZG1A 1AGDB 4M6OH 1KF9B 1H8SA 5INDA 4X5WA 5CZVH 1SEQL 2UUDH 2X4UB 3MRBA 1U91B 4NO2B 5FA4A 3UTTB 4C83A 4ETYA 1EHXA 2BY1A 5ID0B 1YNTB 3KJ6H 3QI9D 4M6ML 5B38B 3KPRB 1PGRB 3HI1A 1MUJA 4JQXA 5JXAH 1RD6A 1S7XB 5L2KE 3GUTB 3P9WB 3FL7A 4TVPL 2CRIA 1IKNC 2EEAA 3HCVB 2PXYA 1WC7A 4MVBC 2NY5L 1I4FB 2LAGB 1IM9B 4ODHL 1JK8A 3ULUF 1INEH 2V5MA 3BKMH 1BQHB 5DD6A 3W2DH 3Q3GB 1A6TA 4XCCH 1NLDL 5TF1H 4ZNEA 5F7EH 2E9WA 1DQQB 5D9SB 3UO1H 5DD0H 1CLYL 2QQLL 3V0AC 4C56E 4NPYA 1U3HD 1KIRB 2DICA 3MV7B 5ADPL 3U36A 1GZPA 3H3PH 4GG6B 1IFHL 3VFSA 4LSVL 3IVKA 5CJBA 1A0QL 4PGZA 1QSZA 4DW2H 1ONQA 4GXVL 2EDJA 4Y4KA 4M6NL 4BSWB 3LDBB 2NY5C 5L6YH 2A9ML 4K55A 3HHRB 3QEGH 5LWYH 1N8ZA 1DBBH 2K7QA 4K71C 2XNAA 3P4OB 3DO3A 4PRAA 1MAML 3KLAB 4LSSH 1C08A 1ODAA 3LQAH 1LDPL 3LMJH 1FYTB 4PJ8C 2VOTA 3MRCB 4OT1H 4NWTL 2HFGH 4NT6B 3HE7C 3EAKA 1G9EA 2BVUA 12E8H 3GSNB 3QFJD 2J4WL 3CPLA 2NYYC 2R1XB 5E2JA 4KY1L 3JBG7 1G7PB 1A2YA 3KHQA 2IMMA 2BNQD 4AIZB 5D1ZA 3ECBA 3MCKA 1LO3L 4U1KB 4RWHA 4X6CB 1FNLA 3PL6A 4I3GA 2QQQA 1UACL 3ESVF 5EB9A 4N0FA 5BVPH 2FX9H 2NW3A 3QISA 3O3EA 1BPVA 2DI9A 4RGNB 2Q6WA 4HUUB 1AXSB 2Y23A 3AB0C 4WU7B 3L3GB 5IB4B 3DVGB 1AXTL 4X6EB 2DIAA 4N9OB 3QXUA 4LSQL 3QQ4B 1U95B 5BXFA 3SE8H 2EYSA 1KJ3H 4Y5VB 3D5OF 2CLRB 2LAAA 5E24E 1KJMA 3QH3A 4Y2OA 2A6IB 4LSUL 4X7FC 5FYJU 3OKLB 2GJ6D 2PYEA 4MXQC 5CP3H 3V9FA 2YPKA 4M93B 2YPVL 2JB6A 1MFBL 2FJFA 4U1SB 4OZHB 5F1IA 3UEZA 1QLFB 4OD3L 1IAMA 4Z6AT 4NQDB 1NMAL 2FJGB 4GBXC 1U3YA 2EO9A 5GS3A 5EIIB 1G7HB 1JRHI 2J3SA 1KGCD 4PREA 5IMKA 4UDUB 1U58B 2EE9A 4JPIB 1LE9B 4FFWC 5D7IB 4OGZA 4ZFZB 1CICD 5GJTL 2KL6A 3EHBC 1X6LA 1P4IH 2FJHB 3CDFA 3TNMA 4X7TA 4NM4L 4UAOC 1CXKA 3G5YA 4RAUB 5B21A 4PRBA 4NQSB 4OF3A 1D9KA 3PWLA 1ZHLA 1BIHA 5SWQA 1PZUB 1DLHA 5T33L 3O3BA 1EO5A 3WDIA 3VD7A 4D3CL 1HXYA 2I27N 4ZUUA 2ICEB 4IRJC 1UWXH 4QRQA 5E2VL 5EDXA 3WDJA 1RIHL 2ICWJ 3HE6B 4H20H 3RVTC 3FRPA 3IJYB 4XPBL 1T3FA 5C0EA 3BXNB 1MHHA 3PIQA 4JAMA 1QSED 3D9AL 4ZOCA 5FGBC 4OI7A 4YEFA 2BHZA 5HDBF 1Q8MA 3REWB 3LZFH 3K1KC 1OTUC 1WVZA 2N7BA 3CUPA 5I66B 4BFBD 3MREB 4PGEA 3DJ9A 1XCTA 2WZPD 4C58B 2DWDB 1KTKE 4Z7UA 3T65B 3BGMA 3EO9H 3VFTA 3BVNA 2BVPA 1DL7H 3MQIA 4HLZH 3AVEA 4GAGL 1IM3B 3GBMH 4PJ5B 2WBJC 3H0TA 3H9YA 3TO4A 3HZKA 3NCYP 1YEGH 3GMMB 2EXYC 3SE9H 2X4RA 1OQOA 4TNVF 3R06A 5F7WC 5E2WL 4OFVA 3CVHA 3UJIH 2AK1H 2V6HA 1UZ8A 3BEWB 3T0WA 1AGEB 4O58L 5CGYD 3MLVH 3TCLA 4YHIB 4U33A 3LKOB 3NN8B 4GRWH 4UIMA 4PG2C 4R4BA 2F8VA 3LV3B 4OZIE 5KG9B 2AJUH 1M7IB 2JJUA 5FYLL 4Y5XA 3F5WB 1IGJB 4LRIC 5GZOD 2D2OA 4LL9A 3ESUF 3EOTL 5E00B 1XR9B 4YHKH 1MCIA 1OD9A 4LLMB 3I84A 1DZBA 4XB7A 1J8HD 4HPYL 2ZSVA 3D2UA 1OAQH 2VLRE 4FG6C 5HHOA 3SGKC 4MSWB 5B8CA 3U2SB 1K9TA 4YAQB 2OQJA 3MRHA 5E6ID 5KANI 5BJTA 2OZ4A 4M48L 3DBXA 3QFJE 4LLVB 3S35L 3SY0A 1QLRB 2AJVL 4OLUL 5HGAB 5B39G 3U9UA 3TFKC 4HCRL 4MJIB 5DFVD 3S4SA 4WW2C 2BRQA 1I3UA 2G9HB 3CDCA 4YFLI 4BA8A 4QHNA 4PBXA 3EDFA 3SGDI 1IMHC 4NGHL 3NH7H 3OGCB 5I8EB 4NSKA 3LRHA 4NNPL 4HGMA 5T1KB 2I9TB 5IFHL 2PN5A 3VXQA 3KPSA 4ZQKA 4XT1C 1ACYH 4PRNA 1RIUH 4KK9C 5HPMA 4KH2A 4JFDD 2VXVL 2CQVA 3FQWB 3GKWL 4DUXA 5FK9B 3RVXC 1DQDH 5DD1H 3ARED 1XGRB 2XZCL 4J3VA 3S35X 5K93A 4QY8A 3ZDXE 4Z7WF 2DQHL 4ODUB 4E5XA 3MC0A 4OZGF 3C6LD 4QRRB 5D7JC 1WICA 2NY3D 4PJDF 3ZKNC 2GJ6E 4EBQL 1Q1JL 2B1HL 3SGJC 1MH5B 5C2UB 5F9OL 3AS3A 3O6ML 3KPPA 5C0BB 3C60A 3MFGB 4HUWB 5KS9E 1UVQA 4K71B 5EC1A 3WEXA 5BS0B 1S8DB 3KXFB 4EI6B 5E2TL 4HH9A 1KGCE 3BJLA 2IG2H 4PJ8B 4P2CG 3BW9B 1DFBL 1MHPH 2VRAA 5GGTL 3HE7B 3MRLA 4I77L 3A6BL 4LDOB 1QQDA 3RAJL 1F2QA 1E28A 4EN3C 5F1SA 1CT8A 4M8VA 2VL5B 1T1ZB 4KMTL 4G8IA 1NGZB 4P0DA 2W9EH 3KWWB 3ROOA 1F4AA 2HH0H 3AAZB 1B0GA 4KVCL 4I3RL 2BZDA 3D3VD 3L5WA 5LQBH 1IEAA 1FDLL 3RBSA 4NP4L 3MV9E 5B4MC 5E56A 4BH8B 2ESVD 1EVTC 3OAZK 4M62L 4O2FA 4UTBL 1JYNA 3VWJC 1BLNB 5ESAB 2X4PB 3VFRA 3AB0B 5I2IB 4NZUL 1HSAB 5CINH 5FO7A 4W6XB 3IRPX 4P23D 4YXHH 2FATH 3FQTB 4CMHB 4YHLH 3CC5B 3SDXB 1T66D 4IHOA 5DZLA 1TNNA 2VQ1A 3F58H 1A14H 1IEBA 5DXWA 5IJKC 5ANMB 2BVTA 3V0WL 5D2NC 3Q5OA 1NFDE 1QEWB 3ULVD 2J8UA 4I1NB 1U8JA 4UOW0 3UAJD 4GH7B 1Z5LA 3SE3C 3VJ6B 3IETB 4NQCB 2DQGH 5JW4N 1M7DB 1JGDB 3RIFK 5C0RH 4U6YB 2H2SC 3SDAC 4XBEH 1IGFL 3VD5A 5D1QA 3CU7A 1O7SA 3UTOA 1J86A 4JDVB 1UXWA 3SOBL 1EBAA 3OB0H 1HCFX 3NGBB 4OI8A 4UAOB 3O9WA 4QRUA 3RDTA 5IMOB 4O4YL 3OKEB 4S0SD 4GG8A 4L5FL 4P2YA 2FWOA 4F33A 4PUBL 4M6OL 5FHBH 2JK5A 1J8HE 4WUKH 4DUVA 5ADOH 4BUHA 2Z92B 4IRJB 4JHZA 2YUWA 3EZ8A 5CZVL 4MD0B 4OZ4A 1U42A 1AKJD 4BFGA 3RWFA 4TVPD 2DBLH 3QDJD 5I1GH 1QNZL 3ARGA 3UZQA 5DO2D 3R8QA 4CMMB 3MLUL 5JXAL 5E6YA 4MMZC 4G9DB 4NKMA 5BO1H 3SPVA 5EPMB 3LKRA 1AE6L 4QWWD 3IS1X 3B8YA 1MHCB 5CUSL 1HI6A 1JWMB 2FLRT 4NHUA 2OP4L 3TBWA 2EDNA 5HHMB 2ZUXA 1JFQL 1HHHA 1KNOA 1W8NA 4RWYH 5IROC 3ZYIA 3ULUH 3ORJA 1KOAA 1I1AA 1T1WA 5IMLA 2NMSA 4KK8D 4NC1C 4PJCB 4JN2B 5TF1L 3FOLA 2WBJB 2HRPH 5F7EL 8FABA 4TNWK 1CXEA 3UO1L 4ZAKC 5SV4A 4X7DC 4ELMA 3WJJC 1UGNA 5DHVB 1BMGA 4PRHB 3X13A 4X6FA 3H3PL 2EZ0C 2NXZC 3HAEH 2VDRH 1NUFA 4P3WA 5LG1A 4H26B 4DW2L 3EJYD 1AGBA 4HC1L 5T1MB 1HQ4A 3BUYB 2B4CH 1RMFL 3QEGL 5LWYL 2VIRA 4ZDHA 1N5AA 4Q9CA 1UB6A 4ZPVA 4LSSL 4YGAB 3I9GL 4B53A 5FYJD 1FIGH 3LMJL 5F96L 4NFBA 5IVNA 4YDVA 2VDOH 4UQ3A 4P5KA 3F7PC 3QEQA 1RV6X 5DVLA 3IGAB 1ROWA 2CIKB 3E6FB 2VO5A 1A1MB 3K3QA 4PB0H 1BECA 4OCNC 3HC3H 5GS2D 2CMRL 3D3VE 3FZUC 1MCPL 3PGFH 2VXQL 2ATPA 4WW2B 2PCPB 4Y7MA 2LABA 1HIMH 3LB6D 4JRXA 4HMCA 5HYSG 4XNYH 1U2HA 2ESVE 2GTZB 3V6ZA 3PNWB 3CXHK 2ZUSA 3O2DL 4HZLA 4PRDA 2ADJA 3CFJB 2ICWA 4QF1B 3ARZA 5KSVB 2F19H 3UBXG 5F6HI 5C09D 1N0XL 2CDFB 3BZDA 5EZIL 4JJ5A 5DA0B 3VG9B 4EDWL 3HA0A 5C07D 3ZHDA 4G8GB 4LASL 4YXLL 4FQCH 4G42B 4YC2C 2PXYD 3QDAA 3GRWH 3NIGF 3LKQB 4EUPG 5D7JB 3HUJF 2VH5H 3PV7A 4HAGA 3V5DA 1KPRA 3OF6D 1MFDH 3A6CH 5EBWB 4JM2F 4PJ9C 4F7TA 3WJLA 2ZSWA 3R0NA 5EBMB 3HLAB 5L7XL 5MENB 2ARWA 4PJHE 3WYRA 3TBTB 3U0TA 4PP1C 3TWCL 2VLLA 4MXVF 4KQ3H 2BJMH 5DRXA 2D7PA 5IEHA 4B0MM 3W11D 3OKKB 1P4IL 1T1YA 4OM1H 3S8WA 4EN3B 2BVYA 4Y4KD 4KK6D 1L7TL 1LQSR 1QR1A 5CJXA 5F3BA 4NO3B 4KDVA 4JPVL 5HTSA 4HX1A 1C5CH 4H20L 3B9KD 3DO7A 4KKCC 1FFRA 5CHNB 1D5MA 3ARUA 4TVPE 2UZIH 4L8BB 4IS6A 3IF1B 3QDJE 1QFPA 3OJDA 4KKBD 3PJSB 3LZFL 3VWJB 1DN0B 1NUDA 3DUUB 2GKIA 4R0LA 3OJVC 5IV2A 1E6JL 3BP6B 1A4KB 1FG9C 3V5HB 1L6XA 2A6DB 1FZOA 2AJXL 1ZKAA 3PL6D 1JMZA 4Z7NE 3EO9L 2ADIB 1GGIH 4QXTA 2XG5A 1V3KA 1YQVL 1D5ZB 1KFAL 3L5JA 3OKDB 2F8XC 4NZTL 3MRNA 5D2NB 4MJ6B 4L4VB 2YA1A 1ITBB 2Q7YB 1YJDH 5C0AE 5F9JB 4PJFA 2UWEF 3OPZH 5MP6H 3MGAA 4C4KO 5FYLD 3T2QA 1I1YA 3D18B 3UJIL 2EE2A 1LP9E 2R4RL 3MLVL 1IC5L 1T1XA 3SDAB 4LDEB 2BDNH 1MFCH 4OD2A 4GKZB 1ZT7A 1UM6L 2O5ZH 2AJUL 5BVJA 4PJAA 3F6LA 1NMBL 3EYQC 3RZCC 1BVLB 1S9YA 3QO0B 5DMGD 4YHKL 2XWBB 3U7AA 4FQXC 1EEZB 4M7LH 1DVFC 1OAQL 1XGPA 3BOVA 4MX7B 4ZS7L 1KLFA 5FYJE 4ISVA 3VFGH 1YEFL 5EU6D 3HN3A 3L6FA 5ESQA 5EFIA 1FNEA 1ZA3B 4X8JA 2AEPL 1HDMA 4I0PD 4ZXBC 1DE4B 5IB1B 1I7UA 3BZFA 2DTSA 4AT6A 5C6TH 4J6RL 4UDTA 3RWHA 3TVMA 1D9KD 2BP3A 5CAYB 3QPQC 2FO4A 5L9DH 4FA8A 5BV7L 1SYSA 4POUB 4XNQA 1ZA6B 1H3PL 2DKUA 3PV6B 5HD8D 2D7MA 4LPUA 1UZ6F 3TNNB 1J8KA 3ZDYF 5C0IB 1QO3B 4IEFB 4K94L 5E6ZA 1ZT4A 1ZVSA 4LLYB 4PTTB 3ES6A 1F6FB 5C09E 4P4KC 4ZAKB 3DURA 1I85A 2GSIA 3F7YA 2VZOA 3U7WH 1UWEL 4PBVC 4MA7H 3MROA 4YNYB 5C07E 3WE6A 3U7YH 1FNGB 4JFYA 2G60H 1MI5A 3QDGA 1AHWA 4IMKA 4LLUB 2D9CA 2NXZB 4WFFE 1AD9A 5K9OA 4GLRI 5BV7C 4E41B 4MAUH 1JNLH 1LEGA 1I1FB 4KZEH 3KYMA 3VXSD 2R15A 3FFDB 1GCFA 1CL7L 1HHKB 4MA3A 4KFZC 3OKNB 3TO4D 5JO5B 2YK1H 5ISZA 4K94C 4HWZA 5E8PA 2DLHA 3D39B 5I76A 3K80A 4Z76A 3SDCC 4HIHA 3P4MB 3MRPA 3QG6A 5SWZD 5IHBA 3RWGA 3WN5A 3GIVA 2ZG3A 2IPKA 1IAIM 1X5AA 5ACZA 3QNXB 5DTFB 3X12B 2IADB 4RZCB 5F1NA 2OJZH 2H8PB 2XY1A 5FYKL 4DGIH 3CDGB 5DJCB 5LQBL 3KPLB 3RGVD 4JZNA 3QNZA 3DV6B 3D2UD 3RWCB 1PKQB 2N7AA 5D70H 5HHOD 2IAMA 2LV4A 3DMMA 4NQXB 1Y0LA 1D6EA 1NCCH 3HAEA 5CD3A 3PXHA 3HPLB 4U1LA 2I24N 1E4WH 4K7PL 3MBXH 1J10A 2X4OA 3UZEA 3HNSH 3QUMA 4PJXE 4YXHL 5C70A 1WBZB 3FO9B 5EWIH 5C0GA 2Z91B 1I8MA 1L6ZA 1NC4D 5F21B 2D03H 4CGTA 3GB7B 2V9TA 4P9HC 4HHAB 2HMID 4JRYB 3KPSD 4LLAA 1FFNB 3B2UC 2ORBL 4JO2L 5GGRY 1KIPB 1GYAA 4PJ9B 4EZMA 4LAJH 1ORQA 5FYLE 3DETC 3ZHLA 2BC4A 2DQGL 3C5JB 4K7PX 1JZ4A 2NY4C 5C0RL 5I6XC 4KJWD 5CMAB 3ARVA 1S7SA 2AJ3A 1F58L 1KLUA 3I3EA 5DJXB 4KI5C 3DXAA 1P69B 2DL9A 5HHXH 5H35B 1NFIB 4Y19B 2WANA 2VABB 5JHDA 1K3ZA 1LD9A 2APWA 5F70A 4MQXC 5KJRL 1CLCA 3C60D 5FHBL 1NGQH 4HWNA 4DOHE 4OTXH 1EXUA 1F11B 2ZCLH 2ZUWA 1R24A 3T0EC 2KBGA 3DX7B 1XGQB 5EU6E 2DBLL 1G0XA 3GI8L 2R0WL 4J4PD 1HILA 4NUGL 4P9ML 4XH2A 3KYNA 2DJSA 1HYRC 1FBIH 5HGHB 5L2JB 1OWRM 3GRWA 5IBTL 4ETQB 1IC4H 5M94B 4U6TA 5BO1L 1A7NH 5IHZB 1X7QA 2AJSL 3MGOB 3JV6A 2AXGB 2XXMB 2X70B 4RFEA 1Q9OB 5CEZH 2ZCHL 5KSUA 3VFUA 2VDKH 3WLWC 4JHWH 1ORSB 3I85A 1A6UH 3BI9X 4JFQB 3QHZH 4G8EA 4H88H 2HRPL 2EECA 2LU7A 3BIKB 5IVOA 3NFNA 4Z0BH 2NX5B 3KYOA 5J6HB 1FN4A 5TF0A 3V4UH 4OFDA 2V7NB 1FO0H 4MMXC 1M7XA 2A1WH 5ICYA 2XWTB 4LVNC 1ZS8A 2O5YL 3PWPD 5DMJB 5JORB 2KPNA 1J0HA 4Z7UE 4PY7B 1XH3B 3IFPA 5E8NA 5DSCA 3KNBA 32C2A 2B4CL 5I71C 1S9KC 3VXSE 4HK0B 1OTSD 1GGBH 1D6VH 3W81A 4F7CB 1Q0XL 1YC8A 1YY8A 2CRYA 1XR8A 1MQKH 3T1FA 1DQML 3S3JA 4FQXB 1Z0NA 4RIRB 1DVFB 4GAYB 1IAKA 3LKSB 5SWZE 1HWGB 2I60H 1HHGA 2HTKD 5CJ8A 3OXSB 4KTDL 1TVDA 2R69L 5D1QD 2CXGA 2YHGA 4ZXBB 5B38G 2IGFH 4HJ0D 3Q2CA 3VXMB 1PVHA 1JTTA 2DQJH 3WD5L 3RDTD 3O9WD 1G7JA 3QI9B 4S10A 1UFUA 2I9LA 4FQLL 4O51B 4V2BA 2R9HC 5GGVY 4QHLB 3BHBB 4Z7OF 2QKIA 4ZSOA 1N2RA 3BIAX 4XCYA 5MERA 4XNYL 1V7MH 1QFWI 2G2RB 3TCXA 3TBVA 1KEGL 3F62A 3IKKA 2I07A 1K4DA 1GVIA 2WWMD 3AGVA 2F19L 4OQTL 1T5XB 5GRVK 1YECL 2VZ1A 1NBVL 3QUYC 1T89C 1FVCA 2DMBA 1MY5A 5EU7C 3OAYK 5JZ7C 4QLRA 4LOUD 4M1CD 5CWSB 2YD4A 3G6JB 4YH6A 1PSKL 1PQZB 3V0VB 1I8LC 4Y2DC 3VRJA 1JGLH 5BV7B 3BRDA 2VR4A 4KUCD 1MFDL 5IM7A 4Q9RH 4Y1AA 2F53D 2R0LH 2D7OA 3ILQD 3KPSE 5E03A 2WM0A 3WXVH 3LEVL 3WHXA 5FM5M 4CADB 4JN1H 1Z0MA 4RMVA 1YPZF 5D7LB 4NNYA 3NPSC 3QWQB 3QFDA 3SDCB 5DJZB 2NY6C 3X11B 4P2OC 4XTRD 5JOEA 1JGUL 2DQDH 3FFCA 1BJ8A 4TYUA 4WJ5A 3R8BB 4JE4B 3STLA 4G8FB 4H1LB 1OP3H 3KPQA 3UJJH 4Y0GA 2WQRA 1KCSL 2OJEB 4TSBH 2W65A 3C9NB 3RIFF 1ES0B 3D85A 1UADC 3IXAB 1OAXL 4PP2A 2FHFA 2P42B 4HKJB 2BNQB 3OSKA 1FL6A 1S5HA 4K9EC 2RIKA 1N3NB 5D5MA 4Z7VA 3V6FB 1KB5H 4DN4H 2GW5A 4LSPH 3C5SB 2ITDB 5IF0B 3WFEH 4XBGA 3RUGE 2BXZA 4EVNA 1YC7A 3BPOC 1EMTH 2FR4A 4OZGA 1EAPA 1MFEL 1SEBA 3KLHC 1A9EB 1J0YA 1U8QB 5A16B 1FGNH 5FECB 5HY9B 4Q6IA 1H3VA 1GGIL 3IDMB 4ERSH 2VDML 5KVFH 2ZPKL 4NKDA 5F9AC 1PW3A 3QUZC 2W0KA 4GXUN 3T4AA 3GMQA 2H2PD 1P7QD 2R1WB 1PJ9A 3BEVB 3L9RA 5C0CB 4WIQA 5CS7A 5F7LB 1U93B 4D9QD 4ZYKA 3MRJB 3ARSA 4ORGB 5K9JL 3AFLA 2AK4E 4TNWF 2NY4B 1NPUA 3PWPE 4NYLA 4AH2A 5I6XB 1RJLA 1EO7A 1MFCL 1OGAB 4FXGA 4OF8A 3S34H 3SJVD 3EW3B 5C7XH 2O5ZL 2P24A 4B7LA 5MEOA 4KGLA 4NFCA 4P4RA 4LCWB 3PDOA 2BOCB 3DIFB 4L9LC 4XZUA 1F6AA 2J8UE 3P9MA 4D0BB 5DK2A 2BSSB 1E4XI 5E8EA 1VERA 3T0EB 1CGYA 5CP7B 3TYFA 4QCIB 4ALAH 5C0DB 3K2UH 2DF3A 4OV5B 4EEEA 2BSTA 5DLMH 4YLQT 1UH2A 1A7RL 4U1NA 4L3EA 1QSEB 1M6OB 1CZ8L 5GS0L 3RBGA 5C6TL 3MXWL 2R8SL 4ODWB 2OL3L 4I3SL 1WITA 3EYFA 5L9DL 3VXUB 3G5VB 2W38A 5IVZA 3O6LL 3TPKA 4XWOD 3S97C 1FSKC 3JTTB 3Q1SH 1BVZA 1E0OB 4HWBL 2CK2A 5DYOB 4YHOL 4KMLB 5IG7A 1H0DB 4MDJA 4Y16C 2B2XH 2RQ8A 4OF7A 2C7UB 1F8TL 2BHUA 4I13B 2BNRA 1UENA 3U7WL 2VLJB 1G7MB 4JANA 4MA7L 1EHLL 1IGYA 3RWEA 3U7YL 4LVNB 2D3VA 2N56A 1EJOH 2KH2B 3OB8A 5GS0C 2BVQA 4ZUWA 3FN3A 1EO8H 4HV8A 2ZUTA 3NFPA 2FGWH 4MAUL 1JNLL 3LEXA 1P7HL 5CLTA 5IW6A 2NNAB 4YEEA 1F4XH 5E08H 5I71B 1INQA 2F53E 3DX8B 3MLWL 3B8SA 1S9XB 4K2UH 5F7MC 4HBCH 2WWKO 3QIUD 4CBPA 2O61A 1WGOA 3O4LA 1V5JA 4WUUA 1OB1B 5E9DB 4EI5A 3ARTA 3WIHH 3V5KA 2L0DA 1S7VA 2CJUH 4UNTA 2Q76B 2VZSA 3IDJA 4XGZA 5E6IB 4OLXL 2VKWA 2OJZL 1H15A 3MYJB 3FB7A 4KKAD 4LAQH 1KT2B 1YNLH 4NQEA 4PGBA 1TMCB 1TQCC 2F54D 2IH1B 4R26H 3IT8D 5D2LE 1TVBB 1MJJA 4Z9KB 1FO0A 5D70L 4OGXL 2H41A 4PD4J 3MRIA 4TULL 4X4YB 4JHBA 3RVWD 3WCYA 2DQEH 4Q2ZA 1NCCL 3W82A 1S78C 4MS8C 1MCRA 3ARYA 5C6WH 3MRMA 1E4WL 3QUYB 1NANH 3FT4B 4JFDB 2JTDA 4P3CL 4JQXC 1KTDA 3DNKA 1RZJH 2E9JA 1JWSB 1R3KA 2IBBA 1WUNT 3IFLL 6FABH 1CFTA 3P4NB 2P7TA 3TJHD 1RULL 4RMTA 4Z0XB 4Y2DB 4ZUTA 2AQ2A 3CSPA 3HPJB 1LE5A 2CDGB 5DHYB 2VXSH 5HYJA 3BX7C 3E6HB 3O6FD 5LAXA 3SEPA 4GRWE 5GGUA 2A74A 3TH2T 3NACH 2FBJH 5JNYB 2VLKB 1A6WH 2FX8L 4JREC 3TBSB 2EYRB 3Q6GH 3NPSB 4D9QE 2NY6B 4P2OB 3PHOA 3U4BH 1MI5D 3QDGD 3VI3F 3SJVE 1VGKB 5EU3B 2VQTA 3D0VB 3RPIB 4N8CH 3QA3A 35C8L 1KCKA 3DV4B 3BKYH 3IDNB 5KVDL 5DUPH 1FZMA 1A6AB 1MVUB 2NXYD 4XVSL 4LNRA 3RJQB 4KK6C 4CVXB 3VDBA 3L3JB 5ISZD 1FL5A 2ZOLB 1JF1B 1KBGL 1FFOB 2ZCLL 4PJ7A 2MCPH 3B2VL 4HS6B 1MCOL 4NN6B 5BZDB 1M1SA 3N1GC 1OF2B 1P84J 3PGDA 5ABDE 3JWOC 1VACA 1KIQA 1T6WA 1FBIL 1RZGA 4OSUH 3KYAA 1WWCA 5I1LA 1TXKA 4PR5B 3ULUD 1A7NL 2ZUVA 2JCCA 2GIYA 4P23B 4YK4C 5FA3B 4P2QA 3RY4A 3ZHKA 1ZWIB 5D1ZC 1MLBB 1YEHL 1PD6A 2EDRA 4N90D 3WIFB 5IOPB 1ZOXA 2NY2D 3LS4L 3EYOB 2VB5A 4EKXA 4LIQL 3QUZB 3H9SD 5CIPH 2HVKB 4JY4B 2XICA 4Z0BL 1TQBB 3EO1A 4NC0B 5IGXL 2GAZB 4XNMB 1S9WA 3MXVL 1YMHA 5CJOH 3I50H 5ILTL 3RX8A 3TV3H 5TE6H 3F7RA 3L3HB 5EUOF 1WAAE 4PJIF 4FQHB 2XWJA 1DBJH 3GGWA 3FB6B 1BD2A 5EH1A 2IH3B 5TDPB 5ETUA 2DM2A 4KPHH 4BSVB 4F58L 1KB5A 4FFZH 1PEZA 5FDYA 3U0WH 5BOZG 3DRQA 5C8JB 5E5RB 4JCLA 2AJZA 4L9LB 4PJFE 4BQBA 1W72A 1U3JA 3CAFA 2ICWI 3IU3A 3FN0L 4YZFF 5GZNC 5FYKE 2OXHA 3KGRA 3NCMA 3MRRB 1ZHNB 5INCA 4OFIA 3RTQA 4XX1G 5I8OH 1UG9A 3RKDD 4RGMB 3QNYA 2PYFB 1F2XK 3VCLA 3WNKA 2IGFL 3DXAD 3IDUA 3K74B 5GSRB 4KTEH 5FGSA 3HG1B 1OGTB 1IZJA 3RVVC 1WBXB 5JHDD 3AM8A 3MRGB 3S36L 1D9KC 2EIDA 1TNMA 4Y4HC 2F54E 4ZS6D 5ICZA 3SKMB 2YS4A 5KN5B 1FSKB 3B9VA 1EHNA 3CSYB 1HH6B 3RPKA 4DN3L 2CKBA 1WCBB 2XXCB 3MFFB 3EDDA 5FO8A 4MAYD 2W1NA 4AEHL 4K3EH 1A5FL 3O41A 4Y16B 2ZCKH 4UTAL 2LFGA 1JI2A 1N5YL 2VISA 1WLHA 2FO1A 2V2WA 2IANB 5JW5B 1PBYA 3K8LA 3O6KL 3OAZH 1R5VB 4CW1A 5A3ID 5KVGL 4NDMB 4JGMA 1NBZA 2HFEB 3S36X 1L0YA 3MOBL 4GKNB 3DYMA 5DRNA 3GSWB 1I9EA 2R0LL 4L4TA 4LCCA 3U6RA 1WEJH 3FTGA 3S88H 5IFAH 2HLAB 5EOTB 4JN1L 4M3KB 4R7NB 2A6JA 2NY7L 4PJGB 2HJFA 3FQXA 1LNUB 2MTPA 1MI5E 3QAZB 4XVTH 2GCYB 1U6AH 4WI4A 3QCUH 3D69A 1QBMH 4H8WC 3TIEB 4N0YH 5CFHA 5LCVH 3K7UA 4Y5XC 4RX4A 2QR0B 5JQHC 5D71L 5K9KB 1RHHA 3T2OA 5GGRA 1TQCB 4ZFOA 4LLQA 2D0GA 1CFSA 3STZA 1SM3L 2ZOKB 3MACH 2VSCA 1FJ1B 3GHEH 5HHVH 5JPMA 5INDB 4X5WB 1EH9A 1RUPH 5DJAA 1RUMH 3WFEL 5FO9A 3VGAB 4U3HA 1Q9WA 3W0WA 2FEEL 4F3FA 2W9LA 4DZ8A 3LRSA 3P30H 5CSGA 4N0UB 4C83B 5JIHA 2J6EH 4FP8H 4J3SA 5T3ZL 3ULUE 1NC2D 3G9VA 1LK2A 3HI1B 3KS0J 1MUJB 3BH9B 1YEKH 2GQHA 3CH8A 4JKWA 2YD8A 4LSRH 3BJ91 1N64H 3LQZB 4CN1A 2CIIA 1WC7B 1K3IA 4X9IA 1JK8B 1SVCP 3WIHA 4D8PA 4UT6H 3H9SE 1NLBH 1I7RA 1XZ0A 1A6TB 3C6SA 3NOIA 1A3LL 2OTUA 2WW8A 4CNIA 1OP5K 4JREB 2X6MA 4X7CC 4CU6A 1BBJB 4NBYB 4NPYB 1C5DA 2B8OT 3U36B 1GZPB 2A9NH 1AR1D 1EA9C 3BZEA 4ACPA 2Q86A 1FVEA 3VFSB 3IVKB 1V3MA 1DLFH 3P11L 4NRZA 4Y1AD 3C2AH 1ONQB 3EDJA 4Y4KB 1Z6JT 2R56H 4U2ZA 3HNTL 4KROD 3I2CH 2X40A 3TP4A 3FOMA 2XNAB 2X41A 5TQ2H 3K2UL 4YE4L 4AEIH 3FFCD 3MGTA 2IFFH 4PRAB 1HXMA 5AAMA 1C08B 4Z5RA 4FQJL 3EDEA 3U30C 3JV4B 3GM8A 3DXAE 1BFSA 1WZMA 3D85D 5ITFA 2ADGA 5JHDE 3CPLB 5C08D 1KTLA 1MIMH 2G75A 4HF5L 3GMNA 2R2BA 3WO3B 1GOFA 1A2YB 4YK4B 1DDHA 2C4XA 5HVWA 3Q1SL 4POZD 5D1ZB 1T20A 3MCKB 3MO1A 3RL2A 1MLCB 3G6DH 5LKNA 5IBUB 2B2XL 1Y18B 2NW3B 3O3EB 4WU5A 1VB9A 4XXDA 2Q6WB 3WL9A 3MLZH 2VC2L 5C2BH 1IQDA 1EJOL 4UBDD 1Q38A 1T22A 1S7WB 3GKZA 4KI1A 4MJ2A 3VXPA 4GG6F 2EYSB 1EO8L 4UQ2A 1BVKB 1LO4L 3LPGA 1KJMB 3QH3B 5E08L 4K07A 4NRXB 4KV5F 2PYEB 2MWCA 2ARJA 3KR3H 4K2UL 4XC1H 5DGQA 4YDLB 3OMZA 4R2GC 2YPKB 4M7KH 2JB6B 1A7PH 3TF7C 4NKQB 1VEPA 4WTZG 4GAFB 1IAOA 3OR7A 4R7DA 4PV8A 5JLZB 4PREB 5IMKB 5I8CB 2LVCA 1MHEB 3EFDH 4DFHA 1K6QL 1Q72H 4XHJD 4JGJA 4OGYH 1QRKA 3DX9B 5KSAA 4QO1A 4RSVA 4UNVA 3TNMB 4YO0A 4LAQL 4X7TB 3RDTC 1YNLL 4HKZA 5CIPA 3G5YB 1QUNA 4PRBB 4U1JA 1D9KB 3PWLB 4ODTH 3JUYA 1DLHB 1HINH 3O3BB 3F8UB 2FIKA 3LKNA 5HDBE 3WXWL 4RRPG 1HXYB 2VDNH 4X6CF 4ZUUB 4D9LL 3DGCR 1IKFH 4QRTA 5C0FA 1KN2L 2B5IC 2DQEL 2WWMC 1MHHB 3KAAA 5E8DH 3VU2A 3PIQB 4JAMB 4Q9BA 3FB8A 3ARGC 1FGVL 5DI8A 4GO6B 4DGVH 4LCIL 3CUPB 3ZTNH 2HVJA 1G9MH 1MCJA 4PGEB 1J5OH 6FABL 4K7FA 4FTVB 4GSDH 2EDEA 1F90H 5FB8B 4Z78A 4JFEA 5IIEA 3QHTC 2EH7H 4TPRH 1UWGH 3BGMB 3VFTB 1C5BL 1I9JH 1BQLH 4HBQA 3BVNB 1I1AC 2BVPB 1XF5A 3JSSA 5IHUH 1VGEH 1GSMA 4QOKD 3R4DA 5T3XH 2FBJL 4OZHF 3TO4B 1FAIH 2BNRD 4QYOA 4XPTH 2XTJD 1MJUH 2X4RB 4PGCA 5F6IC 3R06B 4I5BB 5HYIA 1MIEH 3J7HA 4NKIH 3GJFH 1QSFB 3UYPA 3CVHB 1CGTA 5C0JA 4LCYA 5D7IF 3TCLB 1NGWA 3TH3T 4Q0XL 4UIMB 1CYGA 5DUPL 2ENSA 3VH8A 4XP5H 3MA7A 4Y1AE 3MUGA 1OAYH 4Y5XB 3G5XB 2M1KA 5JOFB 3CFCH 3BQUA 3S9DB 1A9BA 2Q20A 3VWKA 1DUYB 1QBAA 3T04D 5DFWH 1AO7A 3PQYD 3JUZA 2XTLA 2D0FA 2Q8BL 2BSRA 4WUUD 2ZSVB 1YMMD 2HP4A 4EI5D 3D2UB 1KJ2L 5IB5A 3GIZL 3AMLA 4OLEA 5HHOB 3IFOA 3QCVL 5CEZD 3BH8A 3MRHB 2DN7A 5BJTB 4AM0B 4XP4L 4OCSL 4ORZC 3CCHA 3SY0B 4JO3L 5C08E 3MJ9L 1OW0C 4NQED 5EOQL 3U9UB 4R8WH 4OCRL 1MF2L 1I3VA 3GI9H 4DQOL 2NZ9C 2CD0A 3ZT6A 5F97E 1RU9H 3S4SB 5ICXB 3MLTA 3ULSA 1RQ5A 2BERA 3OXRA 4JO4H 1XGYH 5EU5A 1UYWH 5FKPA 2HJKA 5I1IL 4NSKB 4JQIL 4ZUVA 3I6KA 4Z7WE 3VXQB 4R4NC 4RMSA 4P2RA 4OZGE 4PRNB 5HPMB 4PJEB 3ROLA 4PJDE 3TV3L 2CUIA 3B83A 3L1OL 5TE6L 1IQWH 1YEIL 1RJZA 1IBGH 4QY8B 1G9NL 2IALA 4WEUD 1DBJL 4E5XB 3VXRD 1SJEB 5IUSA 4DEPC 1I8KA 5HYJD 3U0WL 4YHYC 5J1TC 2DBJA 4ONHA 1QRNA 1F6LL 2HJLA 4OIIH 5I8KL 1G6RL 15C8L 4OUUB 4OCYL 4PLKD 4LHUD 2Z31D 3INUH 2X1XR 3KPPB 3QQ9D 3PWUA 3U4EA 4YWGH 2Q3ZA 1UVQB 5GRWA 4TSAH 5EC1B 3KPOB 3G08A 5I8OL 5TE7L 3WEXB 1MNUH 4UOW1 3N0PB 4HH9B 1IZKA 5DVOA 4KTEL 5A2FA 3U30B 3LKPA 3OAUH 5LGHL 5IB3A 5GRJH 1G9NC 4U6VH 3R1GL 1E28B 3P0VH 3HI5L 4G8IB 1HZHH 4MB4A 1U8IA 1EV2E 2CLZA 1B0GB 3L5WB 5CBAA 2V2XB 2WSKA 1I1RA 5GS1A 4L4JA 1R3LA 1GIGL 1KSRA 2GFBA 4ZFGH 2FEDC 2P5WA 3NPZB 4K3EL 3TN0C 3S5LA 3MPCA 4DK6A 5EO9A 3U83A 5J8OA 2R2HB 3VFRB 2WIIA 4R0LC 5KANG 2Y36H 4YPGA 1NGXA 5I18H 1NJ9A 4G7VL 4P2QD 2VMFA 5D1XD 3JWDH 4JM2D 4ELKA 2IMNA 1H3GA 4M03A 1C12A 1EFQA 2AP2A 3EO0A 2VQ1B 5CD5C 1WEJL 4PGDA 1IEBB 2VWEE 4JG1L 4YDIH 2E7MA 4QOKE 1U8JB 2BMKB 2BNRE 1U8MA 1Z5LB 5SWSD 1KN4H 2D9QB 3KLSA 5TDNA 4P46A 4YDKH 3CMOL 4XVTL 4JDZA 4Y88A 3ZT5A 1U6AL 1BD2D 2XT1B 3ALXA 1T80A 3FO0H 3SKJL 4ONGH 5D1QB 3MOQA 4K3JH 2HN7A 4PYHA 5LCVL 4OFYD 5BW7C 1U8HB 4KKLC 1IT9H 3RDTB 4QRUB 1QBLH 4NO0B 3T77A 4D9RD 2FWOB 3HS0A 4F33B 3QG7L 3DVNA 3O3AA 3PQYE 2JK5B 1KELH 3ZZ1A 3GHEL 5HHVL 3UTPD 1A3QA 4WUUE 1YMME 4W6WB 2RFXA 3RTQD 1JNJA 4OZ4B 2B5IB 1JYWA 3RWFB 3GMOA 5DRWA 3QDMA 5F8RC 3M1BA 3ARDD 4WTZA 2CK0L 2J6EL 3QSKB 4FP8L 4L8SA 4RNRA 2P1YA 1ZXQA 3ARGB 3BAEH 3K4ZA 4S1RL 1N26A 5DZNA 5A40E 1YEKL 2JJTA 2BCKA 4LIQE 2DM3A 3TVMC 3SPVB 4N1HB 4F9LA 3LKRB 4LSRL 3DWTA 3QBTB 4BH7A 1WWAX 3EJZC 3UTZA 5MI0C 2VAJA 3SDXF 4UU9A 3SDYH 5JOPD 4PB9H 4A6YL 1HHHB 1KNOB 1U8LA 1A4JA 4UT6L 5IMLB 4XMKL 1I1AB 1NLBL 4EQ3A 1XCQA 3FOLB 4YBQD 8FABB 2NTSP 4JFPB 2PF6A 2APFA 4MYWB 4TUJA 5ALBH 1I85C 4JFXA 3CX2A 3WNMA 5F6IB 4ELMB 5IKCA 5AUMA 4H1LG 4CUCA 4WNQA 4WO4C 3X13B 4X6FB 1AHWC 3VXRE 4TTGA 4IMKC 1HHJA 3L7EA 5HYJE 5D7SH 2ZKHH 2PW1A 2EDKA 4L4TD 2EXWC 1AGBB 5IVXA 3LS5L 3FKUS 3I2CL 3OWEA 1LO0H 2YSSA 2O5XH 3HC0A 1N5AB 1UB6B 2IFFL 4ZPVB 3N1FC 4JJHA 4QHKJ 2MQ0A 4X7SH 3FQUB 1EZVX 4OI9A 5E2UH 4UQ3B 4P5KB 3QEQB 4NJAL 1N4XL 3HKFA 5DEZA 4PRID 1CR9H 4X4XB 1DEEA 1QP1A 3ZKXC 2YRPA 3UTQA 2AKRA 2EYTA 1RJCA 3EBAA 1J05A 3CH1B 1GAFL 1T6VN 5CZXC 2HWZH 4JRXB 5L2KA 1LMKA 2FNBA 2IAMC 3GJFA 3V6ZB 4E0RA 1L0XA 3HI6H 3DMMC 4WY7H 4PJCF 5TDOA 3W0WD 1TIUA 4HZLB 2ADJB 4PRDB 2ICWB 4LF3A 4U0RC 2OR9H 3FJTA 1VCAA 3MLZL 1HYSD 3NFSH 3NIGE 1CDCA 4RFOH 4JJ5B 5C2BL 3RI5K 1JPST 1FFQA 3B9EA 3PP3H 4P2QE 3QZWA 4LARL 5EC2B 2FDBP 5D8JL 2Z93A 5F7UA 4HS3A 3ARRA 1BZ7A 4DEPB 2R23B 1YUHA 2YWYA 4FQQB 4DTGH 2WQ8A 3E2HB 4C56A 1FLRL 2HT4D 4OJFH 5JW4Q 1ZHKA 3M8OH 4WV1C 5D6CA 3V5DB 1KPRB 4YHYB 4MXVE 4V1DA 1A64A 3IU4L 1MQ8A 1RK0A 4F7TB 3EOYG 4CJ0A 5SWSE 1ZK9A 2ZSWB 1ITCA 2J1KA 3L5XL 4WWKD 2ERJC 3HMWH 3U0TB 3OV6A 2VLLB 1GC1C 1BIIA 3RKDC 4AMKL 1NSNH 2YD6A 1BD2E 3EFDL 5DRXB 5I1EL 3VFOA 5IEHB 3T0VA 3S96A 3BESR 5IB2A 1T1YB 4KDTA 2YMXL 1I8IB 4APQA 2WINA 5F3BB 1HINL 2CRZA 5FEBA 4WW2F 3P73B 1QA9A 1CBVL 1F3RB 3PGCB 1JGVL 3HRZA 3UTPE 1EPFA 1I1CA 1NAMA 1DP0A 2YC1A 2C1PA 4LKXA 4OM0H 3DO7B 1D5MB 4M4PA 3UDWC 2V5YA 2R2EA 3TN0B 3GNML 5FHAH 4IS6B 5DD3L 2EC8A 1QR4A 3OJDB 3B3IA 3OR6B 4XXCA 5DT1L 3JWNC 1TDQA 1G9ML 5D72L 4R0LB 1J5OL 5IV2B 4KK5D 5A3IC 1PYWA 2HKFL 2DQFA 2UWEE 3V7AG 1D5IH 1JGEA 1EK3A 1FZOB 3C2SA 3SKOA 1UWGL 1K5NA 1I9JL 1CWVA 4QXTB 2OYPA 1VPOL 3MUHL 3ZE0F 2F8OA 1WFTA 3MRNB 2EIZA 4WI8A 1AI1L 2DIBA 4QRSA 4XPTL 1CG9A 4LGPB 1JHLL 1AH1A 3O4OC 5KSBB 1MIEL 4NKIL 1I1YB 4N68A 1QOKA 1FORH 4X8XA 4KAQH 2DQIL 1T1XB 4AYFA 4HWEH 2CUHA 4X80L 4OD2B 1TJGH 3RGHA 1ZT7B 4HXAH 4PJAB 1OAYL 2CPCA 3MA9H 4O02L 1CFVL 4K8RL 2VXUL 1UJ3C 1F00I 3CMGA 5AWNH 4CL7A 4R3SA 1S9YB 3QCTH 1X4YA 3U1SL 2XFXA 4X6DB 3KHOA 4M5ZH 2FB4H 2IPTL 2BHYA 4MNGE 2FH6A 3QQ3A 1A02N 4E9LA 2H45A 4F7PA 4ISVB 1OL0A 3VXOA 5ESQB 1M71A 5EFIB 2MQCA 3MLYL 4X8JB 1MJ8L 3WNOA 1UZ6E 4IRSD 5KSAD 1I7UB 3ZDYE 5HI5D 3BZFB 2YUZA 3NZHH 4Z77A 2AI0H 4PRIE 4FQ1H 4S1QH 2WV3A 4BSJA 4AT6B 1KCRH 4GRMB 4UDTB 5TJWK 3RWHB 3TVMB 1SYSB 3OKMB 4XNQB 4K8RC 3LIZH 1P6FA 1G1CA 5MI0B 3BO8A 2E5EA 4JKPL 1BM3H 4Z18A 4XB8A 4S1DD 5IJVB 1ZVSB 3ARBD 4G6ML 5FUOH 4JR9H 4JCMA 1TCRB 5HGDB 3ES6B 1A1OA 1UM4H 3KPNA 3DURB 4O9HH 2GSIB 3ALWA 3GBNH 2M26A 3MROB 3WE6B 2HKHH 2NCMA 4JFED 4JFYB 1Y6KR 4JZJA 4MNQD 3QDGB 5BQ7A 1AHWB 1H3XA 1H3TA 4WEBH 3HFMH 3GSVA 5J12C 1AD9B 3QUKA 5K9OB 2ZZUT 3O45A 4JVWA 3VFPA 2JELH 5E94A 1XAUA 3KYMB 3CLEH 3ZKMD 4MA3B 3INUL 4QRPB 3AUVA 2BXYA 3FB5A 4OLYH 4A6YB 4OZIA 5ISZB 4JM4H 1A3RL 4HWZB 5E8PB 2RHEA 3ILPA 4N8VA 1LGVA 5DUMH 4TSAL 2DYPD 1BX2A 3MRPB 1D5BA 3VW3L 3RWGB 1RUKH 3GIVB 2IPKB 2VLRA 5GRJL 2DI8A 5ACZB 2PW2A 3SCMA 1KCUL 5F1NB 3RVUC 4U6XA 5DJ0A 2GSGA 3ZKXB 3BQUD 2E8YA 3VWKD 4FN0A 1AO7D 3X17A 4JZNB 4UB0H 3QNZB 2EIBA 2GY7B 4JPWH 2E3VA 2DM7A 3LAFA 4ZFGL 2IAMB 4WDIA 5FIEA 4FNLH 3DMMB 4NNXA 1Y0LB 1TTUA 2FECI 1UEMA 1D6EB 1CXIA 4U0RB 3MRQA 3HAEB 2F58L 5CD3B 4KRMB 4U1LB 1SEQH 1NDGB 3MODL 3RY6C 4YHNA 2Y36L 3QUMB 1WZ1L 3QEHB 5I18L 3WO4C 4G9FB 4NN7C 1MREH 1I8MB 4HKXB 4Q6IC 3BPLC 1AGDA 5H37G 5J3HD 2E9BA 1RI8A 1FV1B 4WV1B 1ED3A 1H5BC 2HT2D 3CZFA 2NY5H 2B1AL 4ODHH 1UJTA 3UX9B 1CGXA 1W0VA 1KN4L 4KKNA 5L88H 1CD9B 2BC4B 4YDKL 1G7LA 4PLOB 4GW5A 1NLDH 2ERJB 4OV6F 1S7SB 2AJ3B 3FO0L 5KS9A 2RB8A 1KLUB 4ONGL 1CXLA 4HLJA 2QQLH 1I4FA 1P2CB 3RHWK 1QRND 4MD5A 1BQHA 3BWUC 1LD9B 3FHAA 1QKZL 1CICA 1IFHH 2GITA 2YPLB 4LSVH 1A0QH 1QSVA 1KELL 5A43C 1WT5A 4GXVH 1EXUB 4WHYG 1R24B 1YEJH 2XA3A 1QFUH 2A9MH 3O0RL 3LVEA 3MV7A 1HILB 1TTFA 3MV9A 1A21A 5HYFA 3KYNB 3TYGL 4G6KL 4GG6A 2V2TB 1MAMH 3BAEL 5HGBA 5LXGH 1XIWA 4JHAL 1X7QB 1WBYB 4NWTH 3JV6B 3HNVL 3VRLF 2X9XA 5I17B 4RFEB 1CVSC 3IFNH 3SDYL 3VFUB 4KY1H 3P4OA 3E3QE 1NANI 2P5WD 3WUWA 2YKLH 2GHWB 4G8EB 1QG3A 1LO3H 4S1SL 4EQ2A 1G84A 2W59A 3NFNB 4NT6A 2FHBA 2E6QA 4W4OA 3KYOB 1MWAL 4X9GA 1FN4B 2R1XA 3O4OB 4HKBA 1NCAL 3BMVA 1VFAA 5ICYB 4NFDA 3FO1A 3BWAA 4Y5YA 4MNQE 4TVSa 4XP1H 5F3HA 5DC9B 3G5ZB 3IFPB 5B3JF 4U1KA 5D7SL 5GXBB 5GJSH 4LVOC 4LSQH 5DSCB 3KNBB 32C2B 4LRNH 3RY5A 1UJ3B 5JW3L 2C4FU 4BK5A 3M17B 4JFFB 1JHTA 1YY8B 4LSUH 1XR8B 3T1FB 2B39A 4F7MB 3DVGA 43CAA 3BN9C 1IAKB 1RHFA 4J3UA 4EI5C 4Z7OE 3NCFB 1MFBH 3DGGB 4X7SL 1H9VA 5C3LD 4M6AA 4OD3H 5E2UL 2JJSC 3T3PF 5KBNC 2APVA 2XA8L 4KRPD 4QEGA 2E7LA 1NMAH 1CR9L 4WHDA 5I73B 2DLTA 1TITA 5I1AA 1G7JB 2I9LB 4LFHD 3SGEH 3BIBX 1X5KA 2QKIB 4ZSOB 1N2RB 4OZHA 4NM4H 4XCYB 2AEQH 4MLSA 5MERB 4RISH 3TBVB 4HXBL 4WY7L 2AERT 2I07B 1K4DB 2OR9L 3DVIA 1LE9A 5D7IA 3CD4A 3QULB 1RIHH 4RMRA 4RFOL 3CX5J 4XPBH 4XVUC 2FJHA 2NTFA 5DK3A 3VFMA 5GRVL 3D9AH 4NQSA 4IIQA 1HOCA 2A0LC 2EE3A 4JY5L 1R3HB 1YPZE 3HMXL 1FRGL 4OJFL 1MOEA 5J12B 3M8OL 1MRCH 5IK3A 5DWUL 5IM7B 5D4QA 4HEPG 3GMRA 4YFLF 3WHXB 4U49A 3GFUA 3V4VL 4L8CB 1V05A 4NNYB 4MWFA 4UIKH 4GAGH 5JA8B 1BWWA 5GGSY 3MRDA 3FFCB 4WJ5B 3STLB 2YD7A 2RBLA 2VITA 5IBLC 3PXJA 4NBZB 5I19L 2MCG1 3V4PH 5E2WH 2SEBA 2D7NA 3ALPA 3MNVB 5I74C 3GSNL 4ZOAA 2K3TA 2NY0C 3D85B 1QRNE 2R0ZL 3FONA 4I2XE 2EDYA 4PP2B 1U8PA 4P3DA 3PHSA 4N5EC 4YXKH 3PDGA 3VI4F 1FL6B 1S5HB 1F3JA 4Z7VB 5D5MB 5JR1L 3H6JA 1OCWL 5IBUG 1Q94A 3EOTH 1GOGA 3D3VA 5FHAL 2ZNWA 4HPYH 4XBGB 4EVNB 5BRZE 3HZMB 2GJJA 3TT3L 3TZVC 2FR4B 1EAPB 1IILE 2ESVA 3BGFC 2IQAA 5KG9A 4O00A 3OGOE 2HA1A 1CGSL 4M48H 1AGCA 5T3XD 3WO4B 3G6JF 4NQUA 3E1F1 5E00A 2YZ8A 3CK0H 1WFUA 4NN7B 3S35H 3T3MF 4OLZL 5L2KD 4OLUH 2AJVH 4Q6IB 3BPLB 1AXIB 5TE4L 1NEZA 1MCBA 1KYOJ 2P5WE 2ZWLT 3MBED 3B6SA 4HCRH 1WV7T 4NKDB 4K3DL 1VEMA 2ZJSL 4MSWA 4YAQA 2KZWA 1JF5A 3T4AB 4BYHA 3TC9A 1PEWA 2WAHA 4JO1H 1JE6A 3L9RB 4P99A 4G43A 5IFHH 1EGJL 1F02I 3LN5A 1OPGL 2A2QT 4ZYKB 3C5ZC 4KXZH 3JXAA 3C08L 4PG9A 2VXVH 4NYLB 1OP5H 4AH2B 3GKWH 1W8OA 1RJLB 4FXGB 3MX0A 1TJGL 5E8OA 2XZCH 2P24B 4HXAL 4C56D 4PJHA 1YYLL 5MEOB 4P4RB 1G6VK 3U48A 25C8L 3PDOB 3ARPA 1CIUA 4V1DD 2QSCL 3WNLA 4XZUB 1F6AB 1F13A 4XBPA 2YBRA 3VMOA 1K4CA 4EBQH 4HW6A 3REVB 2J88H 3FRPG 1XGRA 3TYFB 1NGYA 4M93C 5J6GB 3O6MH 1ZT1A 5GHWH 2C1OA 2BSTB 5FGCB 3FCTA 4OKVA 4Y4FA 4QRRA 2AI0L 2GJZA 4U1NB 4L3EB 4FQ1L 4S1QL 3CFEB 1F5WA 1Q9LA 3AM8C 3EYFB 1EEYA 3QDJA 3MLSH 5GGTH 5IVZB 3MV8D 3ZDXF 1S7TA 4I77H 1LO5A 3RAJH 1SY6L 3CFDB 2XKUA 4P49A 3LIZL 4KMTH 1A6VL 3CVIL 2LTQB 1BEYL 1BM3L 4OBSA 4HS8L 4KVCH 3UTSB 3KPMA 2AV7A 4EI6A 4BZ2H 4DAGH 5IG7B 4NP4H 2EE6A 4IRZL 3VFNA 1TENA 4HDIA 3HE7A 5I0DA 2MKLC 3Q5TA 3GBNL 3QT2A 4M62H 2XTJB 4JANB 4YHZL 2VL5A 1T1ZA 4LVEA 5CJQL 3NA9L 3RWEB 5C0AA 3AAZA 1IAIL 2BVQB 4ZUWB 3HFML 3RI5F 4N8PA 4KI5F 4NZUH 1HN1A 2JELL 3NFPB 5IMMA 1LP9A 1ZEAL 3LEXB 2EDHA 3DROB 5IW6B 2EDXA 1KIUA 3CLEL 1INQB 4S11A 1JPTL 2Q7NA 4OLYL 1BJ1J 4JM4L 4XMLH 1BOYA 3LD8C 5CEYA 1T7VA 4FQ2H 3V0WH 2O61B 3O4LB 1DBMH 1HSAA 2YD2A 4EI5B 1RUKL 1MCLA 3V5KB 3ZL4H 1S7VB 4IDJL 3FQTA 1CD1B 2WUBL 3IDJB 1OSZA 3UPRA 1H15B 4X4MA 3B9DA 2YXFA 3FB7B 1IGFH 5I16B 4NQEB 2HYMA 2QADC 4PGBB 1X9QA 1QEWA 3L3OA 3S4SG 3GSQA 4FXLA 1R3JA 4WI3A 3SOBH 4ENED 2ADFL 1A1NB 2P46B 1MJJB 4NRYA 3T0XA 3VJ6A 1FO0B 4O4YH 3MRIB 3MCLH 4NKOA 4L5FH 4EIGB 3FN9A 4GBXA 4F57H 1AQDB 1CI5A 4CVUA 1M7DA 1JGDA 4P5TD 1E27A 4U6YA 4Q2ZB 2MNUA 4PUBH 5HSFA 4BQ8A 3QUXD 5A2JH 1T2QL 2XRAH 4N0CC 3MRMB 1KCVL 2X4SB 4AG4L 1TZIA 1BJ1H 2PO6C 5KW9L 3MJ8A 5T3XE 5C09A 1QNZH 5J4MA 2A73A 1MREL 1Q0YL 1CFTB 4Y8DC 3MLUH 5TQ0H 1BF8A 3OTTA 2P7TB 2DKMA 4ZUTB 1K8IA 5C07A 1LE5B 4Z7QF 1AE6H 2HT4C 1MPAL 4MD0A 3B9AA 5KTEH 5LAXB 5CUSH 3QJFA 2OP4H 3VI3E 4G6AD 1JFQH 5GGUB 5L88L 2A74B 5FGBA 5IFJA 1QPPA 3OF6A 1U8OB 4CMMA 3BPNC 1SJXA 4OAWA 1S5IL 3WLBB 5EPMA 2QQNL 3PHOB 3VMNA 1S7QB 4ZTPL 5IW1A 5JW4R 4K7PY 1N6VA 1DEDA 3ABZA 3TA3C 3QA3B 5I74B 2HLFD 5EZOL 2NY0B 1FZMB 1B90A 4V1DE 2BFVH 4LNRB 4PJCA 4JN2A 1FL5B 4PRPD 4JFZL 5DS8B 2X1OA 5CCKH 4HC1H 1CDIA 4PJ7B 1YEJL 1AD0A 1QFUL 3UZVB 1FNSL 1RMFH 3MLXL 3PGDB 4ZO6A 1CQKA 1KXQE 5IT2H 1VACB 5DEGB 2EC9U 4PRHA 1KIQB 2VUOA 3CFKA 4FS0A 1RZGB 2VLRD 3VE0A 5KVEL 5JUEL 2EKSA 3FO2A 4ZO9A 3SCMD 3TZVB 3B9KA 3I9GH 5I1LB 4PG2A 1FHGA 3BGFB 5F96H 5LXGL 2X42A 1P4LA 2DB8A 1JRHH 2JCCB 3Q5YA 2CO7B 3BZ4A 3MV8E 3IFNL 2B0SL 2B7DT 4PJXA 3RX7A 2X1WL 1J7VR 1NCNA 5EG6C 2YKLL 2CMRH 1MCPH 3ELAT 2VXQH 2LU3A 4PJIE 3SGKA 3ZO0A 4OCXL 5BZWB 3EO1B 2X44D 4K3HA 1S9WB 4G5ZL 3SDDA 1YMHB 3IGAA 3O2DH 3GSOA 4TTDC 4F8QA 3E6FA 3C5ZB 1N0XH 5EZIH 1IC7H 2HT3C 2IPUK 2XWJB 4XP1L 3VDCA 3P77A 4UV4L 5I1CL 1K85A 4YZFE 4NOBA 4EDWH 3TO2B 5GJSL 3FQNB 5ETUB 2IPUG 1KB5B 4LRNL 4CMHC 4LASH 4YXLH 4PJBB 3PNWA 2Z0BA 2QJDA 2WP3O 3DRQB 3DSFL 2AJZB 5KSVA 2Y6SC 3V2AR 3DHMA 1W72B 3RWJB 2D31A 3KPRD 2EDDA 3IU3B 1XGTA 5C6PB 4U1MA 5INCB 3RTQB 4ODVH 3VRIA 1JVKA 3AS2A 3QNYB 3CSGA 3WKML 5L7XH 4GMSL 5KSAC 5EU6A 4O2EA 3TWCH 4HCRA 1O7VA 4I0PA 1MCWM 3SGJA 3TLRA 1V7NL 5E95B 3NGBC 2AEQL 3F7VB 4IOIA 4HK3N 4RDQF 1L7TH 3IAQA 4RISL 2ZUQC 2CKBB 4JPVH 3TBTA 5FO8B 1JZ3A 3MV7D 5KZCD 4S1DC 3MV9D 2DQCL 2VZUA 1YY9D 2IF7A 1G0DA 3ULVF 2XN9B 2VISB 3OKKA 2V2WB 4G3YL 5DJ2A 3GK8L 1XIWD 3L7FA 4EN3A 1PLGL 1UWXK 4CW1B 1NMCC 1N6UA 3MV01 1NBZB 5C0NC 1VA9A 4NM8H 1I75A 1MRDH 5HHPA 1KJVA 3O3UN 1MRCL 1E6JH 5DRNB 1HH9A 5F8QC 3H7BA 4ZTOH 1FYTD 4L4TB 3V8OA 4KJQD 3U6RB 3FTGB 2AJXH 4L8BA 3IF1A 4Q9QL 1II4E 3LSOB 3SGDH 2A6JB 3LD8B 1YQVH 1B0WA 4UIKL 1KFAH 4NZTH 3VXSA 2OTPA 5MEPA 3DRTA 3FQXB 5GGTA 1QACA 3RKPA 2A6DA 3RWIA 3V4PL 3BP7A 1A7OL 4YDJA 4K23L 2ADIA 2FYYA 5SWZA 2DOCA 4HLZG 2R4RH 2Y5TA 4H0IA 1IC5H 5IJKA 4HIJA 1RHHB