4LOUC

Structure of the e148q mutant of clc-ec1 deltanc construct in the absence of halide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
222
Chain Sequence
EVRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter ClcA
publication title A fluoride interloper in a CLC-type Cl /H+ antiporter
rcsb
source organism Escherichia coli
molecule tags Membrane protein, tranport protein
total genus 39
structure length 222
sequence length 222
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4louC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4louC01
4N9GB 4HZAA 1A1MA 4TVPH 1MAKA 2HFFB 3N85H 4KKCD 1K3IA 1YEGH 1PVHA 5MP6L 2V17L 3DMMA 5D1ZC 5JDSA 1KG0A 1YEHH 3ULSB 1CGWA 1IGTA 1FAKT 4R26L 3BDYH 5FKPA 1G1YA 3QEQE 1QSFE 1U0QA 4NHCH 1YY8B 4PJ9C 3FRUB 4OM0L 3B8YA 4X9GA 3MLTB 1OP5K 3LKQA 3WIFB 3GNML 1YEJH 1CU4H 1IARB 1XGTA 4LEOB 5IGXH 1GGYA 2IH1A 4R2GC 4PLKC 1J18A 3L5XH 4P59L 3PHOA 2IF7A 4R90L 4PJBE 4LRIC 2I07A 3W9DB 4NN7C 1I1RA 4K3DL 1IZJA 4M7KL 4DW2H 1WAAA 1YEDA 5FA3A 5F9DC 5DQ9B 1EAPB 5HVGB 1KEGH 4NGHH 1EPFA 5EC1A 3TV3H 3U4BH 2G2RA 2UWEA 2PN5A 2VDOH 4UTAL 2CLRB 5EORH 5IK3B 5MHSE 1AHWC 4JZOA 1GC1H 5ESAB 5IF0A 4JFZH 2MSPA 4IS6B 4FFZL 4ZNCD 4NQVB 1YECH 1KBGH 2DQEL 4GW1A 4P3WA 1YEEL 3HG1D 5J6GB 3TO4A 1PG7H 5L2KB 4LCIH 1LP9A 4P5KA 3EW3B 3U2SA 3CX5K 3MFGB 3D85A 1TZGL 2PYEB 4XCEA 3SEPA 4QXGH 4ZXBD 3UTSD 3LVEA 3LMJH 4YDKH 2X44D 3BAEL 1FVDB 1NGQL 3ME0A 4MNHA 4GG6F 2CRYA 4KROB 4L8SB 1F4XL 5B38A 4WJ5B 1Q38A 1QYGL 1ORQB 3HE7A 4JY4A 3SDAD 3KYNA 1MPAL 3WMSA 3NABL 4ZS6C 5IKCB 1KB9J 5HYEA 1FVCA 1KTLB 1GH7A 3CU1A 1RJYA 4WEBL 3WXVL 4BH8B 4NNXA 5T5NG 5B3NA 4OZGA 3IF1B 4QF1A 3L3KA 2EDQA 4XXDB 1CDGA 1J12A 1F45A 5JW3H 4R7NB 1W72B 1YY8A 1E28B 1I1FB 2H1PH 5DJXA 2B7DT 3WXWH 2EDLA 1BQHA 2P5WB 3HHRB 3VXSA 1D5MB 5FGBC 3WNLA 1AO7D 1JPFB 2NY1C 4M7LH 2YWZA 2IMMA 4JFPA 1RY7B 4IRSC 3P0VH 1T1ZA 1HH6A 1I1AD 1ROWA 5C7XH 1QFWL 1UM4H 3GRWA 5E8PA 3RAJL 1J0IA 3PP3K 4Q58C 4ZO8A 3ARZA 5D1ZA 3AXLA 1EK3A 1OAQH 1NGYA 2WK2A 5FYKU 1IJ9A 4I77L 4JKWA 3CVHB 5EU7C 1PKQA 3WLWD 1UACH 1LEGA 3P4NB 3FQWB 4NHUA 1GIGH 2VN4A 4ONHB 4HMDA 5T3XH 4GLRH 3QNZA 4ZTOH 4TUJA 5CJOL 3X3GH 5KJRL 1TTUA 3P4OB 3NN8A 1FH5H 4NQVA 2WV3A 4XAKD 3E3QC 5IBUB 1TPXC 2AW2A 2HTKC 3IU4H 3QIBD 2UV3A 3MNWA 5EUKB 4M3KB 4OKVA 4LRIA 2AXGB 4YHLH 1DUYA 3T04D 4RQQB 1IQWL 1A6AA 1EAJA 1K8IA 4KV5F 5EWIL 4KY1L 4R4BB 3P77B 3V4VL 1X44A 3VFOA 3W39B 3BDXA 1H3PH 1RULH 4LGSB 1RIUH 2Q76B 3AC0A 1LILA 4KQ3H 2HYMA 1B0RB 5C0IB 1I4FA 1ORQA 4KVCH 4NWTL 5ANMB 1N0XL 3HG1E 3CLEH 3T3MF 4MA3B 1AHWA 4U6VH 1CT8B 5FAAA 3WKNA 2AKRB 3VWKC 4X8XA 3ILQD 2B1AH 1XCQA 3PGFL 4WEMB 1U9KA 3AB0C 4XXDA 1CLOH 1W72A 1M71A 2F58H 3CH1A 3UTSE 3OKOB 4IIQB 4PP1C 2CKBB 4R3SA 4RA0C 3Q6GL 3T65A 1MH5B 3SE3C 4Y1AD 1IGJA 1TZIA 1JF5A 4OCXL 1VA9A 4LMQI 3W0WD 3MLZH 2XN9D 4LKCB 1U8IB 5DRZB 3H9SD 3MV7D 5KS9E 4YDVB 2YN5A 4JR9L 5J3HC 1OCWL 1WUNT 3SDDB 3ARDC 3U0TA 4OI8A 3OB0K 5DJCA 2EDNA 3NACL 3UYRH 3J8F7 1DBBL 1IGIH 4LLYB 4MQSB 1XCTA 5GGQL 4Q2ZA 5TDOB 1AO7E 5CEXA 2BCKB 2FD6H 2IPTH 3D18B 3CVIL 4XPGH 5FGBA 3NFNA 1A6PA 4HG4J 1JL8A 4N1HB 5I1HL 5DTFA 2ZPKL 4HS6A 3S36H 3D3VA 5DUPH 3SKNB 3G5XB 2AI0L 1AFVL 4IRSA 4GQ9H 2DYPB 3T09A 3DETD 1FVEB 2AXGA 2H26B 2CMRH 1Z3GL 2YUWA 1ZA6B 4E41E 1U8PA 5GGTH 4NCDA 3U9UA 2AABL 2M8XA 2ZOLA 4LVHC 2ADJB 1WIPA 2FRGP 2DQUL 3ZE2E 1FC2D 4RZCA 3K0WA 4UOW0 4GRLB 5FOBA 5MEND 4KJWD 2F15A 2QTEA 1KLUB 3RTQC 4JFFD 4XAKE 2J88H 5IHUH 2PKDA 5DVOA 4MA3A 4QTIH 3T4YA 4AK1A 2VAAB 4K2UH 5IB5A 3RWHA 5GGSB 1WZ1L 1SYSB 2W9DL 4U6HA 5CIPB 1HXYB 12E8H 3N50A 3OX8B 5ACZA 4HUWB 2IALA 1FAIL 1CE6A 4L3ED 1S7XB 5FUZH 2CH8A 5D7LA 5AD0A 4LLMA 3OZ9H 3QJFA 3INUL 2LTQB 3KPPB 1FL6A 4J2XA 5DLMH 1A14H 4YWGL 3RIFK 1X6LA 5DWUL 4KPHH 5DRZA 1EFXB 1QR4A 3R4DA 3ZO0A 4YDVA 4U2YA 4LU5H 5J57B 1XGUB 1AGCB 3KWWB 3IFNH 2FJGB 2QHLA 4TPRH 2VDQH 4PJDB 4XP1H 1SBBA 4H8WC 5FA4A 2BVPB 1T2QL 2CXGA 3QDJB 4D0DB 2ATPA 1PQZB 4NUJB 3W0WE 4UOJA 5E99H 3UPAA 3FAWA 4WU7B 1I7RB 3Q5TA 3H9SE 4CGTA 3MV7E 3NGBB 1FYTE 3W2DL 1OTSD 5IP4A 2F5AL 4JDVB 2Y72A 2HFTA 25C8H 1VFMA 5IM7B 3CDGA 3ETBF 3DECA 1DEEB 3UP1A 1AY1L 3ARDA 1QA9B 4ZUSB 2E7CA 1CZ8L 5L9DH 4Z7QF 3PIQA 3WEXA 3ULVL 4HS3A 1RJZA 2B8OT 2VDNH 3JUZA 5FGCE 1BIIB 3RWCA 3RPKA 1ZK9A 3EOTL 1IGCL 4XCYB 5TF1L 1SJHB 4NN5C 3TT3L 1S9KC 4KXZI 3LEVH 4FFYH 2AEPL 5E5MB 1ED3B 1F8TL 5F7EL 4QNPF 5KVEH 4HUWA 1CI5A 1IBGL 2KZ1B 5D5MB 1S7XA 3FL7A 2HMID 4JG0H 1RK1A 3V4PL 5MENE 3MJGX 4WNQB 4P48A 2CIIA 4U1IA 4JFFE 4YNYA 2K7QA 1M7XA 3BEWB 4ORGA 5CD5D 1WQVT 2CR6A 2OJZL 3T0BA 5CGYC 5C0JA 2OX5A 3G5YB 4GXUM 4QHMA 2P43B 2XQYG 2PXYB 2V5MA 1MFDL 3MRDB 3RTQA 4DOHB 1KSRA 4ZUUB 1QFWM 4ZFOL 4FQQB 3EFDL 4OUUB 2WBJC 1EUUA 3TIEA 1NBZB 5JORB 1X7QB 2NY0D 3FOLB 4LLQB 4H1LA 3D0VA 1NBYB 1REIA 4GRMA 1U8OB 2BSTB 2QADC 5DMGD 3LRHA 2QQQA 1B4RA 4WU7A 4ZAKB 4M5ZH 1I7RA 5EU5A 4JDTL 1MHPL 1EHLL 4G6FD 4WO4B 1BEYL 1CBVL 5KOMC 1KXQE 1MY7A 1KACB 1UENA 4MDIB 1P7QB 4GAJL 4PJIE 4EIZC 1YQVL 1PG7W 3BDBA 3A6CH 2N4IA 4UQ2B 2AK4E 1W0WB 5B8CC 1INEL 4P5MB 3IDXL 2B4CL 3BQUB 3B2UC 1OTUC 3WHXB 4XMKH 3K4ZA 4KGJA 4M1GL 3IJYB 5IB1B 2J3SA 2VE6A 3S34L 3D6GA 5DHVH 3S37X 1HINL 3TYGH 5KTEH 2DQJL 5JIPA 3FZUD 3BGFC 1ZSDA 4BSWB 5E8DH 4K7PY 4RMRA 2HP4A 2HTLD 3PQYE 4PRID 3QUXB 2C3VB 2R4SH 5H2BB 4MJID 3IAQA 2ED7A 3P4MB 4UQ3B 4RCAA 3UBXB 4JY5H 2DS4A 5HYJA 1MVUB 2C3HA 3L1OH 2BFVH 4G6ML 4ODVL 3PV7A 4OCRL 1EIBA 3TZVD 3ARVA 1IAOB 3H9YA 1XGPB 1FGVL 5DO2D 2BNRA 3DSFH 5ADOL 1IC4H 4CAGA 1EVTC 1N64L 5I74B 2XTJD 5DRNB 3MOQA 3OKLB 1RVFL 3IRPX 5EUOE 4CADB 1ZGLA 1D5ZA 2GEEA 3VGAC 3X14B 2P44B 5EOTB 2D03L 1AGEB 5JORA 2VLLA 3WYRA 5F9OH 4LLQA 1DANT 4JO3L 4ETQA 5KSUA 3LH2L 3HLAA 1F3DH 3OKEB 1SBSH 5ALCH 3BKYH 4HGMA 3IS1X 4GXVL 2X4UB 1TQCB 1IKFL 3MRFB 3HR5A 4QXUH 5L8KB 1P84K 3GGWA 3GJFA 4XNUL 5L2JB 4ZUTB 2OI9C 3BWAA 3GSQB 1IMHC 4WW1A 3BZ4B 4I3SL 4XAWL 1MCCA 3WSQH 4OF3A 5EIQA 2HT4D 5JNYB 2X4OB 3LS5L 1XH3A 3EYUH 3BEVB 3BUTA 2IGFH 5SWZE 1L0XA 1CWVA 3KPOB 2OZ4L 1YN6B 5D5MF 2YSSB 4P9HC 3N1FC 4UTBH 1A6TB 4GLRI 3WL9A 1LD9A 4S1SH 3RGHA 2EICA 2Y9RT 4GBXB 3UBXA 3VFSB 4JGJA 4CVZA 1JHLH 4X5WA 3V5DB 2NLJA 5TH2B 4ODWB 5HHOD 4EXPX 3ECBA 3CX5J 5B8CA 1G7JA 4XB8A 4HWUA 1ADQH 5E2TH 3PWLB 4LPVA 4M5YH 4WWKB 4GMSH 4ENED 2J8UB 3CFEB 5K33A 3SCMC 3SGDH 1A1NA 4PRIE 4JN2B 4MJIE 2CDFA 1C16B 2H41A 4GRWE 1QRNB 1T0MB 5TF0A 4ELKB 1DVFD 3X11A 3M8OL 1R3HB 3QAZC 2BOCB 4PYGA 1AGEA 5EOQL 1TVBA 3LQZB 4KVNH 4XBEL 3GMNA 3ARTA 3C6SB 4XMPH 1BFVL 1Y6MR 3C08L 2XTJE 5H94A 4XNXL 2ZNWA 1JZ8A 2IBGA 1QSEB 1RIHL 2DQTH 5I8CA 5IIEB 1LK2B 1J5OL 3WO3B 2YC1A 2V7HB 2XQBL 5H35B 4YQXH 1L7TL 4TNWK 2JKXA 3RDTB 3JTSB 1C12A 3KLAB 2Y5TA 1ZANL 5GZOC 5F3BA 1S7WA 1GPOH 4DGIH 3IFLL 4WI2A 1QFPA 5KS9F 5C07A 2BNUA 1T03H 2QR0B 1FNEB 3ROOA 3LZFH 4YX2L 5J1AB 3QISA 1IQDB 4F7EA 1F4HA 4RNRB 3VFWA 3OKDA 1NLBH 1WTGT 2VNCA 1BWMA 4RGNC 1A6TA 5IMMA 1FG9C 4MLIA 2FH8A 2W0PA 4JKPL 4XVUC 2VH5L 1GGIH 3T1WA 3LHPL 3MO1B 3VFTB 3GSOB 1GHFH 4Y16C 2IAMD 3ARBD 5ID1B 5IFJB 1EGJL 5CP7A 2QHRH 2R0ZL 4RRPA 2M1KA 2HT2D 1SMAA 3PWLA 3EJYD 1TVHB 4KMTH 5LGJA 1W8NA 4X6DA 3L5WB 3T77A 4XPBL 2PTUA 4JN2A 1C16A 1A5FL 4GUPB 1T66D 2R56L 3OJMB 1YMMB 2HKFH 3QEGH 4MNQA 5BOZG 4XZUB 1JZ3A 3ZE2F 4XNZB 3GMMB 5HHOE 2ZOKB 4V2CB 3LQZA 5KVGL 4PJ7E 1G7QA 2PR4L 4X0KA 3TESA 4NP4L 4KJQD 1J8KA 3V6OE 4XVJL 2GSGB 1LDPL 5BS0D 1G7IA 4D9RE 3AM8C 4UB0H 4Y19B 4DGVH 4AT6A 1OAXL 3HI1B 3SCMA 2NY4D 2VLRD 3CXHK 5JHDA 4MXVE 1CLZH 2FX8L 5MEQB 4MAUL 5IJVB 4OGYL 4IJ3B 1OP5H 4L4TD 3OQ3B 2AGJL 1C5BH 1DBAH 3A67H 5LG1A 3G6JE 1QFUH 1UC6A 4I1NB 4NC2B 4BK4A 2YPKA 2BK8A 3TA3D 1MWAL 5TPWL 4XGZB 3STZB 3QO1B 2MKLC 1KELL 3MRRA 4KK6C 1RIVL 1DTUA 3RL1B 3W5MA 4J3TA 2R8SL 4ISVB 4X6CF 3FT4B 4JHBA 1F00I 2Y1VA 4XBPB 1DANU 3IDJB 1A2YA 4PRNA 1D5BB 4P5TC 1KLGA 2XZAH 1AQKL 4FQLL 2VLKD 4I0KA 4Z7WB 1FL3A 5IVXE 3WUZA 2B1HL 3HPLA 3BGMB 3QXWA 1AI1L 3AUVA 4LHUD 4XBGA 4LCWD 3CFCH 3QHTC 5DJ2B 3VWJC 4PFEA 3OAZK 5EO1A 5K9QG 3O6KL 2IADB 2CLZB 5T33L 2VN7A 4HFUH 5I1IH 1PZ5B 4RIRA 4WHTA 2ZOKA 4JVUA 1R3LB 5DMKA 2CD0A 1XAUA 2EIBA 3CDFA 3V79C 3ARRA 3QUKA 2W0KA 4Y16A 3RWGA 3KLHC 4IRJA 4EI5D 1BFOA 1F2XK 4LSUL 1SYVA 1IL1B 3CFKA 1RUQL 3LKOA 3LKNA 5CD3A 1QO3A 1N8ZA 5KSBA 2XZZA 3RVUD 5I1GH 1J9CT 2P8PB 3KHQA 4PGDB 3O6FB 3IDNB 4ALAL 4C4KO 5I1JL 4PJ5D 3TVMB 1NL0H 2ZNXA 3E8UL 4YPGA 3RGVD 2OSLB 3QUZC 3CVHH 1IGFH 1NCBH 5HYQB 5JW5B 1UB5A 1U91B 3MV01 3ULVD 1Z6JT 4D8PA 3K3QA 3GJEB 5DJYA 3C5ZD 3ZDZE 4XGZA 1IC7L 1VGEL 1U8KB 1DQQB 5KVFL 1CFVL 2VLRE 3BH8A 4ODHH 3L3IA 3PP3H 3AM8A 4L4TE 3TBWA 4YIQA 4Z95L 1LK3L 1FNGB 2V6HA 3RWDB 1P7HL 4BZ2L 1PEWA 3IDJA 4XP9H 1SJEB 1RV6X 1JK8A 3NFPB 4OGZA 4RDQF 3ZL4H 4YFLI 1Z5LA 4M1DL 4PJIF 2W59A 3BX7C 4HV8A 1DN0A 2VIRA 5FYLH 4Z7NE 2NMSA 1YQ2A 1I7UA 1R5VA 3FQRB 1N5YL 2QKIB 2EDWA 1MIEL 2J6EH 4OT1H 3MSPA 3CCHB 2BSSA 3VXMA 4OV6F 1K2DB 2QLVB 3ES6A 1X5ZA 3KJ6L 2PTTB 3OKMA 3RIAF 1T04A 5DC4B 3VRJA 4BSVB 4HIHA 1CD8A 3VFUA 4D9QD 2J5LB 3MUGA 2CKBH 2VLKE 3O3UN 4QHUB 3QUMA 1OGTA 4XC1L 1T5XB 2QSCH 4GQPH 3JZ7A 1IL1A 3P0YL 4LCWE 3REVA 4P5TA 2BSRB 1K6QH 3DRQB 1JYXA 1BD2E 4JVWA 2P8PA 1CICC 3JWDL 4WTZG 1X3DA 5DHXB 1NAKH 1LDSA 3D0LB 3MGAA 3CH8A 2F53D 5HHMD 4H20L 3VWJA 2VDLH 2ED8A 4LBEB 1K8DB 5CSGA 4LSPL 5EUOF 5T1MB 2GJ6B 4DQOL 3B9EA 1H3GA 9CGTA 4YUEH 1ES0A 4M1CD 3F6LA 3A6BL 5E0QA 2R15A 3WN5B 3ZT6A 3WIHH 3OB0H 1T5WB 4LRNH 4G8GD 3WKML 4XVSH 2UZIH 2PW1B 3NAAH 1N2RA 4X6FB 5GRJL 1CIDA 1IAIH 5GGVH 4PB9L 2CDEB 4G3YL 2JELH 3PL6D 2HVJB 3UTOA 5E7BA 4I3RL 4L5FL 3ULVE 2YKLL 2FLRT 1U2CA 2QSTA 2EEDA 3OL2A 4OZFA 3QUZA 1E27A 2DMKA 4XNQB 3OR7B 1N7ML 1AIFA 1OAUH 4ZQKA 2PETA 1OWWA 1Q9WB 5KVDL 3FQTA 5IBTL 3T0DA 1YZZA 3RVWC 3BP7A 3O6ML 3IJHB 2D4FA 3ARFB 1HSBA 1CGSH 4X7CC 5GIRA 1HE7A 2C7UA 3VH8B 5I71C 5CIPH 1DQMH 2ZKHH 2Q7YA 1HWGB 3RY6A 4P2OC 3MRGA 3H7BA 1F2QA 3HTLX 2X4TA 3QDMB 4NFDA 3D1MC 1T5XA 3LN9A 4ODXB 4KJPD 1IEBA 4XMLH 1FGNH 4GG8B 4E42A 5IR1A 3OHXB 1RUAH 4LKXA 4N5ED 4MD4A 5EBLA 3CLFL 1AJ7H 1QEWB 3WNPA 4D9QE 4JFOB 1UM5L 4LBEA 5JPMA 1QLRA 4L3AA 3S3SA 3VFPB 3QHFL 4P2QB 3QXTA 4GRWF 3Q1SH 1VFUA 5D96C 1QVOA 2NY2D 2R2HA 3BPCB 2EC9T 4A6YA 3UJJL 3FFCB 2BVTA 1FNAA 1J8HB 1XGYH 2OL3A 3MV11 5BZWA 1HXMB 4HT1L 5I76B 2A77H 1IZKA 1HCFX 4XX1G 5HHME 2F53E 2SEBA 2GTWA 2Z93A 3CZFB 1UWEH 4MXQD 3GBNH 1DFBH 4Q6IC 3QQ3A 4BELD 1PLGL 1CICA 3VG9B 3KPNB 4FXLA 1JHKL 2D0GA 4LCUA 2FB4H 1XIWD 2Y36H 4FQPA 4W70A 1G9ML 4WI7A 5IEKB 5LKNA 3L3OA 4JB9L 5TQ2L 1JYWA 1RZJL 1O7SA 5KANG 4MNGE 2OQJA 4G8GE 1X5XA 4HS8L 3UTTB 3UPRA 2NY6C 5IG7B 2L7UA 3NMEA 1P4LA 2OS7A 4ONFL 2C1PA 5C0NC 1MLCB 4X99A 1UXSA 3IJHA 5GGRY 4QRPD 4FABL 1P4BH 4L8CA 2NY5C 4TTDD 1ACYH 2OMBA 5CSZA 3T0XA 1T22A 4K3EL 3AMKA 3C2AL 3C6LB 1G9NH 1VERA 3MQIA 5L6YL 4P57B 4PR5A 5E03A 1I1YA 4Y2DC 1JGVL 1UM6L 4AL8L 15C8L 3U36A 3MJ6A 5I1EH 3SGJA 2HLFC 4EUPA 3MRLB 4L9DA 4F33A 2FX7H 4MA1C 5JIKA 4N8PA 4GXUN 1BLNA 2EXYC 2MPAH 1TJGL 3VFPA 4BK5A 3KPSA 1DUZA 1AXTH 3DARA 5FYKH 3Q3GB 3U6RB 4UBDD 3MRHA 5ALBL 3DO3A 2J8OA 4GG6A 2R4RH 4P2OA 4DUVA 3TFKC 4E0RA 4PJ7F 5DJZB 3WDJA 1C1EL 3IFPA 1KCVL 5AZ2H 1BOGB 5HI3C 1YPZB 1ZLUK 5JLZA 2XV6B 3DUSA 1LNUB 2A74B 1CL7L 3FAXA 1TNNA 3CUPA 3M07A 5TE4H 2XNAA 3L3HA 1KPRA 4FZEH 1DLHA 5D70H 2V2XB 5FKAB 3WFBH 5CZVH 3DX8B 4LVNC 3BUYB 4UZGA 4MXVF 3HAEB 4QHKJ 2XWBA 3QIUB 4PJAB 3ZKQD 4XWGH 4M6NL 3OBAA 1ZTXH 4NO0B 4R0LB 3MFFB 3G6JF 3RX7A 3CC5B 3DV4B 3P30L 4P23D 4N0YH 3TBTA 2GT9B 2ZUQB 1MQKL 5HGAA 3PUCA 3UPCA 2F19L 4Q6IA 3O3EB 2E7HA 5BVJA 4YHIA 5AAWA 3C6LA 4JRYA 5D7IB 4I18C 3NIDE 2P5ED 4M9PA 1YDPB 3D48R 5F3HB 2HT3C 4ZDHA 2Y5EA 1CFNB 5E08L 4ZSOB 1L0QA 3NCFB 2IEPA 2CSPA 4O02H 1A6WL 4QRPE 4UINH 4S1QH 3IT8D 5C6WH 3C5JB 3LDBB 3T0EB 5IVXF 4RGMC 4FQ2H 5GGRA 4YHPA 2NXZD 5I1CL 1RZKH 3EO1B 4K9EC 1WFOA 1ZA3A 1MRFL 1GAFL 5DQDL 5ELIA 1XF4B 2MHAB 1RZ7H 1UCBL 4NSKB 4ERSH 2NXYD 1NJ9B 4JCMA 4WRLA 5DEFB 1UKSA 1CIUA 3P11H 3PWNA 4Y2DA 4ZD3L 5DHYB 2X4PA 4TSAL 2IANB 3QQ4B 5L88L 4WHCA 4KRPC 5D2LF 1UKQA 2A74A 5J11C 4UV7H 2KPNA 2C4FT 4FFVD 4KK9D 3TH2T 3S35H 5JW4N 1NAMA 4MMXC 1GGBH 1HEZB 1KNOB 5F72S 3AREB 2QEJA 3LQAH 5DUBB 4Z76A 1AKJD 1A4JA 4KKLC 1ZHNA 1FZMB 1Y0LB 3MBEB 3U0WL 1KIUA 4NN6C 4XWOC 3NCYS 4OCYL 2JIXD 1ZEAL 1A1OB 1U8HB 1X6NA 2VMFA 1GGCL 3DV4A 2IPKA 4OZ4A 3M1BB 3ISWA 2BRQA 3H0TB 4TVPL 2UYLA 3G5ZB 1X5LA 3OMZA 4FTVB 4J3OC 2VDRH 4NRXA 3N85L 3OAYK 1S7QB 4XHJD 1MFBH 3D5OF 1G0YR 3ZDZF 2EIDA 2IBZX 1YEGL 3TCLB 2HJFB 1YEHL 5I8KH 5HI5D 3ZKMD 5GS0C 3O3DB 5J1SC 2FWOB 4XNMB 3BDYL 2ADIA 1GZQB 1U3JA 4NHCL 3HZYA 2BVOB 1DLFH 1UVQB 4Y0GA 5FOJA 3K2UH 1WCBB 3TWCH 3PABA 4PREA 5DS8A 1QBMH 1YEJL 1CU4L 3T0EA 5IGXL 2MJWA 1AC0A 4NKIH 5HDOA 2AJVH 4C56B 1KCUL 3L5XL 1JN6B 3U4EA 1I8MB 3SE4C 4HIIA 2EE2A 2CR3A 3TBVA 2P5EE 4OLVH 4CN4A 1VGKA 1MLBA 4F37F 3NCEB 4AEIH 4I18A 1KEGL 4NGHL 3OGCA 5CJ5A 1JHTB 5AWNL 5EBGA 3QQ4A 4HJ0D 3TV3L 2Y7QA 3U4BL 2VDOL 3KPRA 5EORL 4OCSH 2X89A 4AH2A 1GC1L 4AMKH 1QFHA 4JKMA 5E1AB 2VERN 4JFZL 1HEZA 2J2ZA 4V2BA 3EUUA 4PG9B 3SJVB 2R23B 1YECL 1KBGL 3QNYA 4MD5B 1PG7L 3UBXG 4LCIL 1GJIA 5JDJA 5I1LA 3MBEA 2FEEL 3BKCH 4FQJH 4UUJA 4DZBA 3EDFA 3DX6A 4QXGL 5T1LD 3LMJL 4YDKL 4EN3C 5GS1C 1HH9B 4K23H 2RCSH 2XYCA 4MA7H 4KHTH 3DV6A 3ZDYF 4F9PC 4PLOB 4B41A 1FJ1A 4FTVA 3NCCB 2N56A 2NY7H 4ONGH 1CDIA 4WEUD 4G8FB 5IMLA 4HW6A 3DROA 1IGYB 2CKNA 4Z78B 4PJ9D 5JW3L 4AG4H 2XXMB 4PGCB 2NX5D 3VXTB 2BXZA 4JRXB 2C1OA 2H1PL 5A2FA 3WXWL 3MCG1 5C3LD 3ULVF 3JWOC 3F12B 4M7LL 3THMH 2NY3D 3O81A 5IWLC 4NQDA 8CGTA 3P0VL 3TF7C 2EIZB 5MI0C 4Q9RH 1WSST 4TULH 5C7XL 5IJKC 1QKZH 1UM4L 4JFQB 5IVZB 3EOYG 3LRSB 1OLLA 4MDJB 2VABB 1OAQL 2FBOJ 5IW6A 5HDBE 5BRZD 2V7NA 1UACL 2YBRB 1JV5A 2Y25A 3IJSB 1GIGL 4JEGB 4P4KC 3T0AA 2C3XA 5T3XL 3FQXA 4ZTOL 3WFHA 4BZ1H 4WFED 4YFEA 2D7NA 1KGCE 5I66B 3X3GL 5D2NE 1FH5L 5CJXC 3TO2B 1CDYA 2VXTH 1A47A 4B0MM 5IHZB 1JTOA 2R9HC 4MAYD 3I3EA 3IU4L 3RVVD 3SE4A 4KZEH 1VPOH 4YHLL 4OCNC 1AQDB 1F6AB 3V2AR 3IDMB 1VKXB 2VRAA 4RRPG 2DIBA 4HAGA 1M4KA 3TJEH 1RULL 1RIUL 4MQ7A 4RX4A 4WGVB 2EO1A 4U1LB 4LSRH 3OWEA 4KQ3L 3IDIA 2EYRB 4KVCL 2GK0A 4R97B 4ZS6D 4FMFA 1U8QB 3MOAH 1KIPA 4U6XB 3CPLB 4HCRA 3CLEL 4U6VL 3KXFB 4WW2B 1AGFB 3QULB 3VXSE 2L0DA 3HUJE 2B1AL 2WZPD 4APQD 1JZ2A 3TT1H 5FM8A 5HHXH 3QEQA 1QSFA 1IC1A 2F58L 1O5DT 2M26A 2YPVH 1GOHA 4DKAA 3VD4A 4NRZA 1GGUA 4M93B 3QI9B 5E8EA 1V8HA 2V2TB 1K4CB 2VLMD 3MLPA 4EN3A 5GS1A 3MLZL 5J06A 3C5SA 4DN3H 1WIUA 4F9PA 4PJBA 1BBDH 3BN3B 1HNFA 3L9RA 5JQ6H 4JFQA 3AS1A 1MJJB 2NX5E 5FV2A 3UYRL 2W60A 3OAZH 1IGIL 3MCLH 1WBZA 1RUKH 2ESVA 2GFBB 2YBRA 4NQSA 3WS3A 2FD6L 4I4WA 4QCIB 5HY9A 3G04A 4AZ8A 2IPTL 2FLBT 1H3VA 4LVOC 4XPGL 5I66A 1UWGH 4G5ZH 3MZGB 5EH1A 2CIKA 3S36L 5IWLA 4ZXBC 5C0BD 4FQXB 4GQ9L 1SM3H 5BRZE 1AQDA 2CMRL 5J6HB 1AD9B 4GOSA 4I8DA 2W07A 5GGTL 4J6RL 5MERB 5J13B 1D9KB 5LAXB 1A9BB 2VDKH 4OLUL 4WFEE 4ZS7H 4J4PD 1JWSB 4C83B 5C0CD 4L9LB 3AAZA 3GSUB 3K4DA 1MCPH 4XH2B 4YK4B 2OXGA 4HHAB 4P4KA 3DIFB 3LEXB 4Y8AA 2XG5A 2J88L 5IHUL 3HG1B 5KOVC 4OZHB 3K74B 4QTIL 1EV2E 2ICES 5F93C 3VWKD 3IVKA 4LQ1A 4DUXA 4K2UL 4WDIA 4CBPA 5CJXA 3QG6A 5E8OB 3TC9A 2VDPH 5I74C 3VGHA 4PP1D 1CS6A 1QHOA 3MRCB 2ORBH 3BXNB 3U0PB 3N9GH 5T3ZH 5FUZL 3Q6FB 2NYYD 3ARSA 3OZ9L 4K3DH 3SDAB 4K94H 3OXSA 1UH4A 5DLML 3O4OB 1A14L 4PUBH 4U6TA 5F7DA 1H3WM 4KPHL 1C5CL 4YGAB 5I18H 2G75B 4GKSB 4LU5L 4PY7B 3GSXB 5SWQA 3IFNL 1XZ0B 4TPRL 4YBLB 1ZHLA 3V6ZB 4O2CA 1I85C 2VDQL 4LSDA 1Y18A 4PB0H 1FIEA 4XP1L 3VFRB 1DBKH 3MNVB 3WE6A 5C08D 4KHXH 3S88H 3K81A 5DUMH 2YS4A 4QRTB 5ITFA 3QQ9D 5FCSH 4JAMA 4PRPD 3BO8A 5E99L 3NIDF 2F74A 2LAAA 4ZFGH 5DC9B 2XT1B 3RZCC 3QIBC 2O26U 3MV9D 3BD3A 2VITB 1KYOK 1DP0A 1DL7H 4HQQH 4ODSH 4I2XB 25C8L 1JF1A 4NPYB 5IB2A 4CJ1A 5EU7E 4HKZB 2DMCA 1JUFA 2DL9A 1RZ8A 5IQ9B 5KN5A 3FB8A 4HMEA 5F8QC 4E41B 4PLNC 3ARQA 2Y06H 2FL5A 5L9DL 1CLYL 2DN7A 2E9IA 2NNAB 4XNYH 3WXVH 1BOYA 3MROA 2VDNL 1S9YB 1A7RH 4QRRB 3RNQA 3E3QE 5C0BE 2P1YA 1FFNB 3HG1A 1P1ZB 4U1JA 4P4RA 3SOBH 3LEVL 5L7XH 4UDUB 4LMQE 4FFYL 2P4AB 5DGQA 4ZXBA 2DLGA 5DD0H 1IM9B 3UTSA 4G80A 32C2A 3MJ7B 5KVEL 1PW3A 2ENSA 2A6KB 3BIBX 1S9XB 3VMNA 2VWEC 5C0CE 5AG8A 1T4KA 4JG0L 2PCPB 1QFWH 3SDAA 3RAJH 3G6AB 3CGTA 5DK2A 1NBQA 4N0FB 2CJUH 3U79A 2I9TB 5KS9A 1RD6A 4CU7A 2B0SL 3EFFA 2Z31B 2HJKA 5CKGA 3BISA 4YC2C 1D5XA 4U2ZA 3ET9F 5HJ3B 3LKSB 1DBJH 4MJ5B 5C09B 4EI6A 1KJMB 1G6RB 1AO7A 5F1SA 4MXWL 3O41B 1Q72L 4M7LT 5HGHB 3H7LA 3LN5B 4PJ8D 4N0CC 5HHPB 4M5ZL 1VACA 3GM0A 1FYTB 1HSAA 5K9KB 1P53A 3VI4F 1I1AA 4JQVC 1N5AB 5J0BA 5HVHB 5KG9A 1KPUB 3QEUA 3S96A 3O8XB 1RZIB 2WWMD 1D5IH 3DXAD 4UT6H 3A6CL 4L4JA 5C08E 1CFTB 5I8EB 3FO2A 2VXSH 3W9EA 1Q94B 4KJWC 4XMKL 4EVNB 4PGBB 1VEMA 3CFBA 4PRPE 4NWUH 3P40A 3GHBH 4ELMB 3LV3B 3DRTA 3WFZA 3MV9E 4DKDC 4TVPD 4Z77A 3TYGL 1F11B 5EG6C 5KTEL 2D7MA 5FGCB 1KN4H 3VFMA 2FH6A 5T1KD 5E8DL 1KPVB 4S2SA 2R2BB 5CWSB 4L29A 3RZCA 5CGMA 3QIBA 4X83A 5DGRA 2R4SL 3HRZA 5I1DB 1ZS8A 4D0CA 3OV6A 1YA5A 4PJCF 4JY5L 1BQSA 1XR8A 2P24B 3L1OL 2BFVL 3QFJB 3QPQD 4JGMA 1QG3A 1OCWH 3DSFL 4TQEH 1IC4L 3JV6B 3DHMA 1WT5C 1FSKB 4XNZC 1HWHB 5HHNB 2PNDA 3FB6B 5CGYD 4QOKB 3MRKA 2A6DB 1HHJB 3LKPA 4OZIF 4MCYA 3LPGA 4WFFD 4Z5RB 3BZEA 3S4SB 2WBJD 3TN0D 4QHKI 4QTHB 4ODUA 3VXRD 8FABB 2WINB 5F9OL 4Y1AA 5CUSH 4K8RH 1OTSC 1QTYT 3RVTC 3W0WA 2BMKB 1MNUH 2XN9A 1FL5B 5EBMB 4YAQB 1SBSL 2AAVA 3C60D 5ALCL 3BKYL 2LFGA 3H9SA 3MV7A 3VGFA 4XRCA 4QXUL 1EXUA 1WZMA 1CYGA 1KPUA 4HGWB 2FCBA 3D39D 1OSPH 2X10A 2DQUH 2AK4B 4BSJA 1YMHB 2HJLA 3KYMB 4PJFB 5E4EC 5I8EA 2LU3A 3SDXB 4LPYA 3WSQL 1OTUD 4LF3B 4OLZH 3ZHLA 3BVNB 2GITB 3EAKA 2HVKB 3EYUL 1YYLH 4Z6AT 2IGFL 5I30H 5DVLA 2W9EH 4L8BA 4WUKH 2YPLB 1GXEA 5D1QD 1P4IH 2VXVH 2KKQA 3QRFM 4UTBL 3PQYB 3DXAE 1D6EB 3RUGB 1FAIH 4H26B 3VD9A 5F21B 3JUYA 4U0RB 4S1SL 3GKWH 2HMIC 3T08A 2EEBA 3DBXB 3HAEH 3VH8G 1WBYB 3O2DH 1JHLL 4J3WA 2PO6D 5DWUH 1ZLUH 5CD5C 1U36A 4TVPE 4B53A 4NYLA 2MFNA 1ADQL 5E2TL 4N5UA 5MENA 4M5YL 4GMSL 4JFFA 5FECB 3LS4H 5C1MB 2DWDB 2X42A 2NY0C 1T2QH 2Z92B 2IBZY 4LASH 3L3GA 3JWNC 2YRPA 4LLVB 1BAFL 2I24N 5CJQH 5DMGC 5DJ0A 3HFMH 4L3EA 2H9GA 3BESR 4LHQB 4RAVA 2GAZA 3TNMA 1L6XA 3MJ8A 5GZND 4XMPL 1S7UA 4O2FB 2BMKA 5T3XD 3O6FC 4YAQA 1XF2A 1WZLA 5E5UB 5EU4B 1DQJB 4O2EA 1IGMH 2DQTL 1H5BB 1S9WA 4ELMF 1FRGH 3QXDB 4WFFE 5E24E 1WT5A 3MLVH 3SPVA 5GS2H 5IEHB 4HGWA 3BHBB 4PJIA 4WTXA 3VXRE 1TDQA 4PJXB 5I17A 4JM4H 1U92B 2IBBA 4HH9B 4NZTL 1MCSA 4MWFB 1FNFA 1BX2A 5GRWA 2H2SD 4DGIL 5I2IA 2I9LB 3QWRD 4UMGA 2ZCKL 1OGAD 2HTLC 3RWEB 1U3ZA 5SWZB 1H0DA 1T03L 2FIRT 3GSWB 1T1YA 3LZFL 1FLTX 4KTDH 4N9OB 4DGYH 1R5IB 3PE9A 4RSVA 5KAQG 2H2PD 1I8KA 3D39E 4H26A 3KR3H 3TZVC 5BV7B 1GZPA 1GGIL 4U1SA 2P47B 5DO2C 3MJ9H 1QFOA 4G8IA 4FQ1H 1GHFL 1SHMA 2QHRL 3QNXA 4KMTL 5E9DD 2JK5A 3RI5K 2WAHA 4S1DD 2BVYA 3EFDH 4PRIB 2BRRH 4LDLB 4MJIB 5EUOA 2YWYA 2FGWH 4MS8D 2AJZB 2OTUB 4Y4HB 2HKFL 1Q9LA 3QEGL 5BJTB 4N0UB 1PGRB 3OJ2C 4P9MH 5LJYH 4F2MB 3B9KB 4N1CA 3SDXF 2Z4QA 1FG2B 3OAYH 2YD7A 5FYJH 3QA3A 4UB0L 5C0EA 1RZGA 5HTSA 3QXDA 4DGVL 4D2NA 2NW3B 2VQ1B 5GHWH 5I15H 1NCNA 3F7RA 2HT4C 3S5LB 2AV7B 3GMRB 1CLZL 1GOFA 4PJHB 3DSNA 1PSKH 3V8OA 4HC1H 1C5BL 4G6JH 5C0AB 1DBAL 3A67L 2G5BB 5T3XE 4LLWB 2DKSA 3BRDA 3IKCA 2WIIB 5IB4A 2XWTB 1QFUL 3HAEG 4R7DB 5INDB 5I73B 3TYFB 4OAWA 3IGAA 3SN6N 3NFSH 3DX9A 5DURD 3HB3D 1HILB 1UJ3C 5HYSB 2YD9A 2E8ZA 3ZT5A 3W5NA 5I6XB 2EO9A 4ENEC 4L8DB 3TGXA 3SDYH 3UCRA 1OGAE 3C8KB 3V6OC 5F8RC 3FB5B 1C8PA 4XVTH 3RHWF 5J7CC 2XZAL 1KJ2B 1M6OA 1DVFC 1S5HA 3MUJA 1B3JA 5D4QA 5IMOA 2Z35A 4MJIA 1CGUA 3CFCL 1T83C 3TCXA 5F7KC 2EDEA 4RFEB 1KTDA 1LO5A 2Z91B 4HFUL 4Y4FD 3L5HA 3GBLA 5I1IL 4RAUB 3R06A 2UVFA 1YEFH 3TZVA 1U58B 3QO0A 4HUMB 5ICXB 3V5KB 1W72L 1IKFH 5FO7A 1QSVA 5E9DE 3T4AB 4HXBH 5IMKB 3H9HB 3P9MB 2DKUA 1PYWA 3FB7B 5AYQA 4XC3H 4OF6A 2YA1A 3VGGA 1QFWI 1CFQA 5I1GL 4HKXA 5TE7H 1QOKA 5F7LB 1S8DA 1X5JA 1NL0L 3PG2A 4CW1A 3K1DA 2HH0H 5F9JB 1TTGA 3CVHL 1IGFL 2VZ3A 1NCBL 4EDXB 4GAYB 4PRBA 4EBQH 1CXFA 1VADB 3ZKXB 4Z7UB 3D2UB 5IBLD 1B4JH 1KYOJ 1UZ8A 2Q86A 2IAMC 4LLUB 1ITCA 1LQSR 4ODHL 2EECA 1MJ7L 1WF5A 4HWNA 2MQ0A 5HYSA 3O2WH 4D94A 3EJYC 4JJ5B 1E6JH 1NQBA 5TGBB 4TNVF 1XGRA 1JPGB 2VZUA 3DX7A 4Q7DA 4R96B 4XP9L 1EEYB 1T66C 3R0NA 3ZL4L 3SDCB 3M8OH 3V9FA 1GOGA 5DJ8B 5F1NB 5FYLL 4U1KB 2GTZA 5EOQH 1E4WL 1OB1A 5EC2B 4OT1L 2GKIA 3MLSH 4KQ4H 2Z91A 3WFEH 1ZWIA 4AM0B 1RHHB 5BZDB 3K8MA 3RWFA 2GUOA 5IOPA 4C59B 5HHOA 1UJ3A 5ICXA 4PJ7A 2KUTA 5F7FA 1U93A 4PG2C 4HJGB 2OJEA 2OTWB 2CKBL 3IB4A 4L1HA 3T4AA 1BJ1H 2XQBH 1NC2D 4M61A 3V6OA 2QSCL 5JR1H 2NY4C 2OBGA 1K6QL 4Q6YA 4LCYA 5AAMA 1DVFA 4LK4A 1HIMH 1INDL 2J8HA 2FO4B 3RWIA 1KB5B 1P5VA 1T83A 5DFWH 3WIIH 1NAKL 2VDLL 2ZCHH 1SJXA 3DUUA 3MRBB 3O45A 4IEFB 3TA3C 5HGDB 3G6JA 2EYSA 3OPZL 3O11B 1FLRL 3E6FB 3AROA 4YUEL 3C09C 4M6MH 1F4AA 4PLJD 1Z9MA 2HAZA 3VCLB 3RJDA 4YDIH 4H0HB 4ZMAT 5E00B 3ZE0E 5SWSD 1QNZH 3WIHL 4LRNL 2VLRB 5TDPB 4XVSL 3T2OA 2UZIL 5T5NF 3HZVA 3NAAL 4G9DB 3KPMB 2EH7H 4V1DB 4Y5VC 1HI6B 4LSQH 1IAIL 5GGVL 4X80H 5IV2A 2IFGA 4PJEF 3MRNB 2JELL 1ZHKB 5DDHA 5ID0B 4F8QA 3QIUC 3U46B 2WQRA 1JGLH 3UTZA 3VXQA 3F8UB 5D1XD 5DD1H 3VXNA 4YDJA 3VXME 4LAQH 5IVXA 3CSBA 1YJDH 5F1NA 3DJ9A 2A73A 5EU6D 1OAUL 3WHE1 2ADGB 1PBYA 4IOFD 4ODTH 3DO7A 5I0DA 4WV1B 2AV1A 4H25A 2DQFB 1EZVX 1V7MH 3IDUA 3DPBA 1R3IH 2WMPA 3PNWB 5ERWA 2IAMA 3ARBA 4EI5C 1CGSL 4G43A 3WFCH 5ETUB 5GXBB 5B4MC 1RPQA 3P0GB 1DQML 5IUSA 2ZKHL 1ZLSH 2R1WB 4MJ6A 4HKJB 4LPUA 5D2LA 1Q0YH 2EIEA 3UDWC 3RVUC 1NC4D 3T1FA 3BD5A 3QEHA 4XMLL 4MAUH 1FGNL 3PHQA 1ORSB 4HXAH 2CK2A 2ICEA 1UWXK 2K1MA 2VSDA 1RUAL 2PTVA 3RGVC 3TLRA 1BD2B 2VQTA 4BYHA 5IVOA 1HQ4A 1SY6H 4Z7UF 1J05B 1AC6A 4OLYH 5K93A 1AJ7L 3ULVC 3B2VH 4KI1A 1FNSH 2F8VA 3HI6L 2A2QT 3CK0H 4PRHB 4QHLA 4OQTH 3KPTA 4WU5A 3B9AA 3MYJB 3Q1SL 5BS0A 3V6FA 3E6FA 1IEAA 4PG2A 1IT9H 2FBJH 4KUZH 1CXKA 4C58B 1XGYL 2G9HB 5E00A 3L3DA 2VLRA 5FV1L 4OV5B 5CP3A 5TDPA 3AREC 2A77L 5C0FB 3ARXA 3LEYH 1UWEL 1AQKH 1DFBL 3GBNL 4L4TA 5JUEH 3VFVA 1KENH 2X9YA 4ZOBA 4A2MA 1X5KA 4JFED 1AI1H 3DVNB 4MCZA 4N8VA 2FB4L 1URLA 3T2NL 1PEZA 2Y36L 3ZZ1A 4DEPC 4QXTA 5ABDE 2ITDB 3TA3A 3CSYB 4IRZH 3FMGH 2X41A 3RQ3A 2VC2H 2NTFA 2RB8A 4Y4KB 1ITBB 2F54D 1INQA 1NPUA 2XQYK 2ICWB 5F88B 3BPLC 3QWOB 3G5VA 1FC1A 1MHCB 1U41A 4LPTA 3STLA 1P4BL 4LDEB 3GIZH 2YA2A 3MLWH 4X4XB 1ACYL 4J23A 3L3JA 4PRDB 2HFEB 3LN4B 3RNKB 1CXEA 1S7TB 4Y5VA 1I7TA 4CNIA 3VXUD 3X12B 2VLKA 1B6DA 1G9NL 2DI8A 4CVXB 4LHUA 5EU6E 4P2RD 3GUTA 3NZ8A 4LCWA 5SV3A 4ALAH 5ENWA 1EEQA 2DLIA 4WCYL 1NCWH 3FO9B 2B4CC 1NFIB 3DVGA 2B5IB 5I1EL 3OJDA 4L4VB 3HN3A 1J05A 2FX7L 3SBWC 1LO2H 4QYOA 5E6IB 2FJFB 5KSAB 2MPAL 4M1CC 4M8QA 3EJJX 3HE6D 4U1MB 3D87B 4P46B 4DK3A 5EPMB 1AXTL 1I3VA 4EI5A 5KVFH 1G6RH 5FYKL 2GW5A 5ESVA 1HHHB 1RK0A 4KTYA 4X6EB 5EIVA 5AUMA 2R4RL 4XCNB 1PDKA 1RUMH 5FDWA 1QQDA 1OP3K 3UDWA 3IFOB 3RZWA 4W6XB 5C0GB 3HNTH 3FQNB 4FQIH 2E9WA 5AZ2L 2F53B 1T3FA 4PJ5A 1EH9A 1AXSA 3RGVA 4D3CH 1ZLWK 2CUHA 4WTWA 1JTPA 3DVNA 1JGEA 3HC0B 4FZEL 3PJSB 4RMUA 5D70L 3WFBL 4CDGC 5E94A 3C9NB 4RAHA 5CZVL 4N68A 1Z0NA 2ITDA 5IHBA 3C5ZA 1BBJA 1G7PA 2AP2A 3EBAA 3V5HB 2NY6D 3TIDA 5F88A 4XWGL 1J1PH 1WC7B 4BH7B 1I9IH 1ZTXL 2R39A 5IFAH 2BY0A 5FO9B 2I25N 1R5WA 2LAGB 1MCRA 4N0YL 1FYHB 2ZG3A 1KFAH 4JFEE 3ZYOA 2I27N 3BP5B 2X7LB 4KJPC 4JCLA 1JWUB 2H3NA 3LN4A 3SKOA 4X7TA 4FXKB 5C0DB 2XKNA 1S3KH 4F15B 2D7QA 4U1GC 4N5EC 2F54E 2XZCL 4QY8B 5INCB 2VR5A 1J88A 1NDMA 2FX9H 2ADFH 4QHNA 3L7EB 1H3XA 4ZFOA 4O02L 3MR9B 3MLXL 4UINL 4S1QL 4XTRC 1EEZA 2N1KA 3PWJB 2NY2C 3U48A 4FQ2L 4ZODA 3VXUE 2FJFA 4HDIB 1RZKL 2L4OA 1NCDH 1OF2B 4P2RE 3ULUH 3MNZB 1RZ7L 4ERSL 1NANH 4JQXC 3B6SA 5BXFA 4MXQC 2W0LA 3HS0B 1N3NA 2DQCH 2XRAH 3P11L 1S7VA 3HNVH 3MCKA 3NIGF 1HHIA 5HI3D 2F53A 1XIWC 2XOTA 4YBQD 3HMXH 5L2KD 3OKNA 1UT9A 1BREA 4UV7L 4K71C 1SEBA 2JJUA 3S35L 1IAIM 1I75A 2PYED 2IFFH 1GGBL 2GCYB 3SBWA 5HPMB 4HIJB 4YFDB 3V6BR 4OFIA 3EOAB 1Z0MA 5F96H 5ICZA 5J9PA 2R2EA 3GEWB 2X1XR 3LQAL 4OJFH 4QEGA 4B7LA 3UTPD 4KKBC 3RWJB 3WO4B 4M4PA 4MNGA 4NKMA 5DMJB 4G8GA 1WIOA 4NT6A 4TTDC 4MQXD 5IB3B 5DYOA 1WC7A 3MA7A 2YEZA 2XI9A 1O0VA 3MRPA 3PL6A 3BH9B 3GHEH 2X4RA 5ILTH 1W0VB 1JRHH 3EYOA 2VDRL 3VU2A 5EZLB 3FN9A 3EYFA 2P5WD 2MQCA 3PWPB 4ZO7A 5I8KL 3U9PH 1ONQB 1T1XB 2BNQB 3HZKA 3OR6A 4FXGA 3RU8H 1FP5A 5JOFA 1UM5H 1A0QL 1CK0H 2X4NB 2X4QB 1DLFL 4PJGB 1NEZB 1CTOA 3K2UL 3B9DA 3WV0A 3PWVB 3O9WB 3TWCL 4DCQB 4UBDC 1QBML 4CMHC 4YDLB 5I1AB 1UXWB 1EBAA 4NKIL 1N4XH 2AJVL 3QXAA 4UOW1 2HFGH 4QRSA 4UDTA 2BOBA 1QBBA 4WUUB 4OLVL 2P8MB 3JV4A 1OSZB 4EEEA 1LEIA 4G9FB 4J7RA 3ZHDA 3L5JA 1BMGA 4I0PC 1TLKA 4JFXA 4GW4A 4ZOAA 4KRNA 2ERJC 3QH3B 1FZKB 4YR6B 4OCSL 3Q48A 1XR9A 1CFBA 4AMKL 1I8LC 1NFDB 4L3CB 4LLDA 3MGTA 2OZ4A 3MLRH 1D9KC 1HZHH 5I75B 2HLAB 4S0TD 1NMCC 3QP3A 4P23C 5FYLD 4ONOA 4CVUA 4FABH 3MRJB 5H8DA 2EDDA 4FQJL 5CEYA 4NQCD 4YK4C 3KLSA 4JQXA 1I7ZB 5JO5B 1F3JA 4Q0XH 4WI5A 5EFIA 4K23L 2X1OA 4FRWA 3S3PA 2RCSL 5BV7H 2PYEE 6FABL 4MA7L 4KHTL 3MRMB 4CU6A 1W0VA 3VE0B 1XIWA 2FJHA 4GKZB 5EZLA 3ZE0F 2NY7L 3F65A 4NQXB 5CGTA 1LE5B 4ONGL 5CBAA 3SKMA 3UTPE 3QIWC 4PD4J 3S4SG 1PY4A 1QR1B 2EDTA 3BP6B 5DRXA 3OKKB 1F5WA 4AG4L 3NPSC 4NO3B 3AS3A 1NEZA 4QRPA 4Z7VF 3SDDD 4JKKA 2P42B 4Y5XC 1KF9B 1ZGLM 1PG7X 3KPLA 4YBLC 2WUBH 3THML 1K3ZA 3FCTA 5HGBA 5A3ID 2P5WE 2VZTA 4AIZB 1CD0A 1L7IH 4JM2B 2A0LD 4U1NB 4Q9RL 1BZ7A 4TULL 1QKZL 1T21A 2ZJSL 4I13B 1ZXQA 3KJ4B 1G7HB 4NKOB 1UB6B 1FPTH 1TQBB 3FT2B 2HN7A 4FFVC 3REWB 3GK8H 5ISZB 4F3FA 1G1CA 1XF5B 1YC7A 1HN1A 4JZNA 4JFDB 2DYPD 1LHZA 3BIKA 3I3DA 3IU3A 2NXZB 5KZCD 4DTGH 3CSPA 1BECA 1NCTA 4BZ1L 4FNLH 4KDTC 2H32B 3BKJH 1P9MC 2NXYB 2VXTL 1PY9A 2Z8WC 2DM7A 5JPNA 4KZEL 1A1MB 1VPOL 4GRLD 1EO7A 3GI9H 4XHJC 1OAYL 2D2OA 5H37G 1ZT1A 5JDSB 3DMMB 3TJEL 1KG0B 1EGJA 4NKDA 4N8CH 3OB8A 1U8MA 1IGTB 3VE0A 3ZKMC 4LSRL 4PJGF 5LBSH 5FKPB 3MOAL 2VAJA 4XX1E 3NIFF 2P49B 3OG4B 4NZUH 5FYLE 3I6GA 2YUXA 3LKQB 5LVEA 1KJ2H 4NQCE 1UQSA 5ANME 3TT1L 1XGTB 5HHXL 3U4AA 1A4KB 2J12B 5DEGA 2IH1B 1EFXD 4P23A 3PHOB 3VGBA 5DQDH 1OARH 2I07B 4CMMA 4MB5A 2Z31C 4OSUH 1FZOA 5D2NC 5HSFA 3KS0J 1YEDB 5FA3B 4DN3L 5J56B 3MXVH 4RFNC 5MEPA 3QDJD 1BBDL 3OXRA 2A6JA 2P5EA 1NGPH 5JQ6L 5EC1B 1BP3B 5L88H 2G2RB 2UWEB 1FO0A 2XICA 4KMQA 4HJ0C 5F1IA 3P73A 3REWA 3MCLL 4JZOB 5CAYB 1X4ZA 3C8DA 5IF0B 1RUKL 5EU3A 5J4MA 4E5XA 5HVHC 3QZWA 3KPQA 1UYWH 4GW1B 1QLEL 5I9QB 4PJCA 4NQTA 2FNBA 3TO4B 1YEKH 4JZJB 1LP9B 4P5KB 5JMRA 4Y5XA 3MGOA 1UWGL 2A83B 3U2SB 3EGSA 4G5ZL 3D85B 4XCEB 3GSRA 4HJJH 3V4UH 1JF6A 3L6FA 4LOUD 5EA0H 1Q1JH 1MWAA 4K3JH 4HUVA 1MCJA 2FDBP 4EQ3A 4MNHB 1SJVA 1Y6NR 2WUCL 5TDNA 1SM3L 3F7QA 5B38B 4U3XA 3HE7B 4JY4B 3KYNB 1HOCA 1SQ2N 4Y7MA 4OZIA 3W11D 3PGCA 3QFDA 2F8XC 1FVCB 2VDKL 1RJYB 4FQHA 4Y5YA 4ZS7L 5J12C 4NNXB 4OZGB 3VI3F 4QF1B 2P8LA 3L3KB 1FN4A 1MCPL 4JO2H 1BPVA 3KDMA 1AKJA 3MRQA 2YD3A 1MCQA 3BWUC 4OF8A 5DJXB 1X5AA 4M00A 1BQHB 5F1OB 3VXSB 3JWDC 1XMWA 1ZVHA 4M7ZB 2JIXA 4OBSA 2VDPL 4OD3H 1JIBA 1MELA 1A4KA 4NM4H 1KCUH 2NY3C 5EZIH 4JFPB 2E6JA 1RJLA 2ORBL 4TUKH 1T1ZB 3QJHA 4J3XA 3N9GL 5T3ZL 3S36X 2PXYD 2Y23A 4S11A 3DUHA 1EZVY 1HH6B 2YOCA 4ZPTB 5E8PB 1C5DA 4K94L 5CSBA 3P3YA 4PUBL 5F7YC 4Y89A 5D1ZB 3AXLB 1X5GA 1LO0H 1NGYB 5FYKD 5AWNH 1OAZH 1CLCA 1PKQB 2ESVE 3S5LG 5I18L 5FO8A 1LEGB 4OQ1A 1TFHA 4PJ9B 4ZAKD 4NHUB 2NX5B 3NH7H 3QNZB 3P4LA 4PB0L 4U7MA 1IAKA 3I9GH 1DBKL 2IPUK 4TUJB 4WO4D 2MKWA 1RURL 4KHXL 3S88L 3IDYC 3NN8B 5HDLA 3I84A 3HPJA 4GFTB 5DUML 5CZKA 1P7QD 4R2GB 2DOCA 5IW1A 2DWEB 1Z9OA 1KB5H 4ZFGL 4JZJA 4MAYC 3MNWB 4OKVB 3RVVC 5FCUH 3BQUD 1DUYB 3QDJE 2A83A 5F6IC 5D2NA 1A6AB 1FFRA 1K8IB 1DL7L 4HQQL 2X05A 4GS7C 4ODSL 4HWBH 3MUHL 5HYSG 3QCUH 4KK5D 3VFOB 1A21A 1I4FB 3BW9B 1CDHA 3MMEB 1PX4A 3QUXD 2Y06L 1NANI 3FQUA 1AHWB 1FV1A 3UX9B 1KOAA 2Q3ZA 5DD3H 4XNYL 2JCCF 1XCQB 3ELAT 1MHHA 1A7RL 3PWUB 2BHUA 2CGRH 4W6WB 4APQC 1H15A 3QHZH 1HQRB 4DVBA 1M71B 3CH1B 4HBQA 3GKZA 1WCQA 1CTNA 4R3SB 3T65B 1T89C 4U0QB 3SOBL 5FEBA 3BT2H 1A8JH 3HUJA 1OL0A 3V0AC 5L7XL 4NQED 1IGJB 1U8NA 1TZIB 2XKUA 1S7SB 2O5XH 5DD0L 5T1LA 3N1QC 4I5BA 4KU1A 4BUHA 3EJZD 1HHKA 1TETH 4ZNEE 4ZPTA 1V5JA 4ZFFB 2CO6B 3U0TB 4XCCL 2BZDA 4KKAD 1UJTA 5DJCB 5D5ME 4WENB 2CJUL 1MCEA 1XCTB 4Q2ZB 1LP9F 5CEXB 3RA7H 4PJ9A 2NX5A 2Q8BH 1OOAA 1HNGA 1DBJL 3E2HC 5JTWA 1H5BC 2XFXA 3KS0H 3NFNB 5ACLA 1VFOA 2APXA 4DOHE 2NY1B 5DTFB 1MUJA 4HS6B 3D3VB 1G9MC 3QB7C 2DWEA 3RZCD 4IRSB 2O5ZH 3BZDA 1RZJC 5FYKE 5K59E 3M17A 4U1HA 4OBRA 1WJ3A 3Q2CA 2QQNH 3B5HA 3CDCA 1U8PB 3U9UB 2BC4A 4EQ2A 2ZOLB 1D5IL 4UT6L 1UWXH 4MHHI 5BRZA 4JDZA 4YO0B 4J4PC 3PGDA 4RZCB 3BW9A 2VXSL 5FOBB 3MMEA 3N1PC 2ARJQ 5L0QB 4NWUL 3GHBL 2V5SA 3QDAA 3T4YB 3SO3C 1WZKA 4GBXD 2DLFH 5IB5B 3PWUA 3RWHB 5JIIA 3L7FA 1KN4L 2ZP0T 1HQRA 1TPXB 1CD1A 3QDHA 4U6HB 4MAYA 1LEKA 5ACZB 5EZJA 2IALB 1CE6B 1EHNA 2Q7NA 5D7LB 4WWKD 3ZYZA 5AD0B 4LLMB 2NYYC 3QJFB 3HZMA 1EA9C 1FL6B 1S7SA 1BWWA 1HHGA 1F6LL 5CLWA 3BPOC 1QRND 5B39A 1X9QA 3T3PF 1IC5H 3LKRA 2V5TA 3RPIA 1WFNA 4TQEL 4ZFFA 3T2QA 3WLBA 3QG7H 3PXJA 3AU1A 5FA4B 2RFXA 4NQEE 4APQA 7CGTA 4FOMA 1P2CA 4OIAA 1F4WH 2ATPB 2A6IA 3QQ9C 4HK0A 4LQFH 1QSED 5B21A 4J3SA 1T89A 4LP4A 4K8RL 5CUSL 4FZ8H 3FFDB 3CFIC 1ERNA 4N0CD 1MNUL 3RDTD 1ZKAA 3SY0A 3CDGB 3E1F1 2DTMH 1BVKA 1MF2H 3ARDB 3F5WA 3TEUA 3UXFA 4HUUA 1C08A 1A7QH 3WUWA 4J6RH 3QXUA 4OLUH 1OSPL 1ZT4B 3PIQB 5FXCH 3WEXB 4YO0A 4HS3B 1RJZB 4MJ2A 1DE4A 1WITA 3RWCB 4OLZL 2ZSVA 2D31A 2J4WH 5I30L 1YYLL 1CL7I 5FK9A 2W9EL 4WUKL 2AJ3A 1KIRA 2VR4A 1P4IL 5EZOH 2VXVL 3BP4A 4ZFZA 5C0BA 2JB5L 4O4YH 3RKPA 1J0YA 3RVXD 1OP3H 1RK1B 5SX4I 3GKWL 2V9RA 4YHMH 2JJTC 2CIIB 3HNSH 4U1IB 4YNYB 3GB7A 5D6CA 3O2DL 1R3KA 4ORGB 3VXPA 3V0VA 2EDJA 4LGRB 4PV8B 1F3DJ 4XPTH 1C5CH 5C0JB 4J4PA 5C0CA 1YMMD 1ZLWH 3LD8C 4QHMB 5FB8A 3RTQB 2P46B 1A02N 3HCVA 3LS4L 3TIEB 4HUNB 3VWKA 2VISA 4H1LB 3GM8A 4Y1AE 3D0VB 5F6HJ 2J8UE 4GRMB 4LASL 5HHQB 2X09A 2XN9E 5CJQL 4XCFH 1TJHH 1QRNE 4PJ8C 2VWEE 3EO0A 5EU5B 3HFML 4X6CE 2FSEA 4Y19D 1BZ9B 4X9BA 3SE3A 2YXFA 3RVTD 2VR9A 3FFDA 4HBCH 1RSFA 3Q0HA 4YHOH 1OAKH 2WWMC 3EYQD 1IGML 5TQ0H 2Z8RA 4BFBD 1FRGL 1NSNH 3EOBA 4K7FA 4F7CA 1U3HC 3MLVL 4OKDA 3IDGA 2R69H 3DWTA 2VE6B 3H3PH 1CLYH 3RY4A 1ZT4A 2CK0H 4JM4L 1JVKA 5C08A 5JXEC 4U3HA 1ZSDB 4PRPA 1QLFA 4MJ4A 1CGXA 5GRXG 3MV9A 2FYYA 5KSVA 1ZVSA 1L4IA 4QRUA 4KKNA 4KTDL 1QD0A 4DGYL 5HI4C 5HYJB 2W0FA 3EYVA 2VXQH 3KLDA 4BFIA 3JTTA 3HC4H 1MJ8H 3QPQC 1T20B 3KR3L 3IXTA 4M48L 4U3CA 5GJTH 2QQKH 2BNRB 3MJ9L 4FQ1L 4PV8A 2H8PA 1T7YA 3IETA 2ZUTA 1ZGLB 2X5PA 1D5ZB 2B0SH 5AEAA 3BRFA 3UEZA 2O61A 2E5EA 3UMTA 4NN5B 1M7IB 3GJFK 2BRRL 3TN0C 3MZTA 2VLLB 4L3EE 2FGWL 4ETQB 5HHQA 4M6OH 3L95A 3VXOA 4MXWH 5KSUB 1Q72H 3HLAB 4KDVA 4X5XA 1X4YA 2E9JA 3C60C 1BZ9A 1GC1C 2HRPH 1YMME 4P9ML 2JJTA 3HR5B 2DQIH 4NZJA 3H6JA 3GGWB 3O6FD 3GJFB 3N06B 43CAA 3BWAB 3KYKH 3P9LA 4WW1B 1CDJA 3TVMD 5FYJL 2XPGA 1NGWA 5GHWL 5BW7C 4NO2A 5I15L 1K4DA 5EIIA 2WBJB 3TPKA 4D9LH 4NCC2 1XH3B 4MX7B 2MQ3A 1PSKL 1E0OB 2Q20A 2VUYA 4HC1L 2QADB 5D1QC 4UV4H 4G6JL 4PJ8A 1NUGA 3EDKA 4IMLA 3WL9B 1LD9B 4IM8A 2UUDK 1AP2A 4YBHA 4IHOA 3ZHKA 4LSSH 4FA8A 1MFEH 4CVZB 3S9DB 4X5WB 3NFSL 1X4XA 1G7LA 2NLJB 1P7KA 2PO6C 1D3CA 3DXAA 7FABH 3ECBB 1T20A 5B8CB 1G7JB 1WGOA 4JQIH 2FEEI 4PJDF 3WNKA 1U3HA 3NCJH 5HVFB 5EN2B 1NGXA 3CJJA 2ARWA 3SDYL 1A1NB 3RIFF 3ZMRA 1FCGA 2CDFB 4XVTL 4AENA 1NMAH 3BGFB 2XZQH 3BMWA 5F9WC 5GPRA 3X11B 2ZUWA 5T1KA 1QZ1A 3DVIA 4XP6H 3TBYA 3PP4H 2DI9A 1M7IA 1AD0B 2Q6WA 5GISH 1TVBB 1MCFA 4RA3A 5CMAA 3GMNB 4Z7WE 1UGNA 2FATH 3AS2A 4GAGH 5GZNC 1KC5H 4G6AD 1TCRA 5H94B 1YEFL 2HWZH 4H5SA 5I8CB 3QUYC 3ROLA 1CDBA 4U31A 2YC1B 4HXBL 1QACA 4JG1H 3DOSA 5LXGH 1R24A 2DBLH 4WWID 2AXFA 3VGAB 1C12B 4PS4H 4MQTB 2Y5TB 4XC3L 5M94B 5F3BB 1S7WB 2EYTA 4HUXA 2GJ6D 2WBJA 3TN0A 2H2SC 2FO1A 2CPCA 1GSMA 5TE7L 5C07B 3E6HA 3VXRA 2BNUB 3ROOB 3KNBA 4MX7A 4F7EB 2Q8AL 3VFWB 3OKDB 2HH0L 2GHWB 4HD9A 1NBVH 3C60A 5IMMB 2Y07H 2D0FA 2H2PC 1AGDA 4KUCF 4EBQL 4JANA 1QPPA 4JPWH 4F7PA 1IE5A 2OI9B 1FDLH 4TOYH 1B4JL 2H32H 3D39A 5CP7B 1KV3A 3UJIH 3GMOA 2DLEA 3O2WL 1YNKH 5LGJB 1JWMA 4X6DB 2VSCA 4XT1C 3T77B 1E6JL 1UG9A 5EN2A 5K59F 2ILLA 4NQUA 1OGAB 4S1DC 1S7RA 3AMLA 5E1HB 1JZ4A 4LIQH 4HSQA 5D1QA 4TYUA 4MS8C 5C0RH 1VESA 1L6ZA 4MNQB 1JYNA 3ARFD 1UH2A 1H8OA 1BAFH 1AD0A 3SE9H 1NEZG 4ZPVA 1G7QB 5ESQB 4IBLT 1KLFA 4R8WL 5C3TA 3KAAA 4X0KB 3MLSL 4KQ4L 3WFEL 2IJ0C 1H3TA 2PO6A 1ZLVK 1J0KA 4OM1H 1JYVA 1G7IB 1LE9A 4OD1H 4TSBH 3VJ6A 4AT6B 5F7WC 4FQCH 3SCMB 3TNNB 3UTQA 1OM3H 5JHDB 5JR1L 4OGAD 4NZTH 4LFHG 4YHNA 1A7OH 2YMXH 4OFVA 4P2QD 3QAZB 4I9WD 3E0GA 1HIML 1UCTA 2ZCKH 3BZFA 3HI5H 3WIIL 3BJ91 3DTXA 4D0BB 3FFCD 2ZCHL 4JPVH 1J8HD 2YPKB 1I8IA 5LCVH 2UZXB 1XGQB 1U8JA 3QUYA 3MRRB 3HB3C 1EX0A 5D93C 4M6ML 4YDIL 2GJ6E 4YGVA 3LB6D 5SX5K 1DBMH 1QNZL 3AVEA 2GK2A 1A2YB 4PRNB 5LWYH 2R1XA 1KLGB 2EH7L 1NGZB 4LSQL 4X80L 1FL3B 2KL6A 3HPLB 1S9VA 4N0RA 2FIKA 3QWRA 3UTTD 1OGAA 4XBGB 1PZUB 1JGLL 1OD7A 4HIXH 3VG0H 1J1OH 1DN2A 3MA9H 5DD1L 4K07A 2PW2A 2HRLA 5EO1B 3ARGC 5DSCA 1KB9K 3VMPA 4LAQL 4BKLA 1YJDL 4UIKL 4RGNB 4Y4FC 4RIRB 4WHTB 5DMKB 4ODTL 2PYFA 5ESQA 4NDMA 1V7ML 2C3WA 4NCC1 1R3IL 4X7DC 3QUKB 1I3RA 43C9A 2V2WA 4Y16B 3RWGB 4GKNA 4IRJB 1BFOB 1V3JA 5I19H 1SYVB 2A9NH 1NDGA 3CFKB 2ZUXA 3MRIB 3WFCL 4K8RD 3LKOB 1ZLSL 5E9DA 1ZT7A 3LKNB 5CD3B 2YZ8A 1QO3B 1N8ZB 5KSBB 4CN6A 2Z8VC 3TNNA 4OIBA 1Q0YL 3IXAA 3GRWH 1WWAX 2ATKA 3UYOD 4HXAL 4YPGB 4KTEH 2XWJA 3F7YA 3SGEH 1E6OH 2B20A 1A9EA 2V9QA 1NCUA 1UB5B 3MODH 4JJHA 2DQHH 1SY6L 2DL2A 4OLYL 2FZ3A 4D0BA 3B2VL 5AG9A 4D8PB 1FNSL 4KK8D 3CK0L 4PGZA 5T1DH 5DJYB 4OQTL 1XGQA 5DD6A 3O2VH 4UT7H 5IBLC 4ZUWA 3H9ZA 2J8UF 3BH8B 3L3IB 3MV8A 1IT9L 2FBJL 4P2QE 4OTXH 4KUZL 3TBWB 4YIQB 4I9WE 3OF6D 3K1KC 5IT2H 3K2MC 4F7MA 1JK8B 5F7UA 3FFCE 3LEYL 1J8HE 4XP4H 4PTUB 1NGZA 2DI7A 1Z5LB 3MBXL 4HV8B 2EDXA 5GGTA 5JUEL 1DN0B 2VIRB 1KENL 3QIUD 4EOWH 1EERB 1I7UB 1P6FA 3BPNC 4J1UA 1R5VB 4NO0D 3QSKB 3I50H 2BSSB 3T8XA 1V7NH 3VXMB 4IRZL 3FMGL 3ES6B 2VC2L 5MEOA 3OKMB 4MLSA 3TBSA 1N26A 1T04B 3VRJB 3X13A 5C8JB 4HIHB 1W72H 3FO0H 3VFUB 3MUGB 5D72H 3H3BC 3ZDXE 4NRYA 4NNYB 4BUGA 4LARH 3QUMB 5D2LE 3UTTE 1OGTB 3GIZL 3MLWL 3MRIA 5B4MD 3REVB 4P5TB 4U4BA 3JBG7 4O51B 5TFSH 4X8JA 2ZSWA 2CDGA 2E9BA 2DQDH 4TNWF 3VWJB 4AY0A 1NCWL 5DZNA 5C71A 5GS2D 5EO0A 3SKJH 5B3JF 4Y4FA 2OM5A 3BN9C 1CFSA 3QT2A 3NZHH 4P3DA 2E7MA 5BS0E 3V7MA 1LWRA 1XF3A 1LO2L 2WANA 4H0GA 1ES0B 3HC3H 2X1QA 4WFGD 4KGLA 4J3UA 4PLJC 4G7VH 1UFUA 1MCDA 2XY1A 2IAND 1G6RL 4HG4K 5LQBH 1N2RB 1MJ7H 4QKXB 2F8OA 5B38G 5EBWA 1RUML 3D69A 3CXDH 1OWRM 3LSOA 5D71H 3ARED 1BVZA 3HNTL 3NVQA 4FQIL 3LCYA 5D1XC 4PTUA 4YHYC 4OZFB 3QUZB 3AGVA 1E27B 4D3CL 5D7JC 2W65B 5D7SH 1AIFB 4ZQKB 1VFAA 1YPZE 2J1KA 1E4WH 4OF5A 5E8NA 4Z7VA 4IOFC 1K5NB 1BQHG 3O4LD 3FQTB 2WM0A 2VZVA 2WLZA 3BP7B 4KI5D 1KT2A 3O3AA 5EOCH 4UI2A 1H8SA 1FFPA 1HSBB 5GIRB 2EKSA 5C8JA 2C7UB 1J1PL 1NFKA 4DKFH 1I9IL 2Q7YB 4NNYA 3MRGB 3H7BB 5IFAL 4MSWA 4UIMA 2X4TB 4PJAE 1MFCH 1KFAL 4HKBA 3TPUA 1N6QH 1BIHA 1IEBB 4PTTA 4A2LA 4O51A 4E42B 5CZXC 1H3UA 5IR1B 3FHQA 5FF6A 1INDH 4LKXB 4PV9A 1VFBA 1S3KL 2AEIT 3CMGA 4MD4B 5EBLB 4GAFB 5FYJD 1MCHA 2EE9A 4X98A 5BMFH 5C9JB 3B4NA 4C56D 2FX9L 4DN4H 5D7IE 1YUHA 5JPMB 1QLRB 2ADFL 4RBPK 1U95A 3IYLW 4LCCC 4OI9A 2CRIA 3OPZH 5DK0A 3ZSTA 1MY5A 1QVOB 1FLRH 3CFJB 3EYSH 2R2HB 3ZDYE 1IM3A 4A6YB 3MOBH 4P3CH 2OL3B 5BZWB 2DDQH 4PBXA 1NC2A 1NCDL 3HA0A 4Z7WF 4PGEB 4NNPH 4KZDH 1E4XH 3ULUL 2IPUG 2SEBB 2GTWB 4PJ5E 4IMKC 2Z93B 3K8KA 3EDEA 3QQ3B 2XA3A 2MCG1 1CICB 2DQCL 2XRAL 4HWEH 3WD5H 4J8RA 4OD2A 3HNVL 4LCUB 4OCMC 5CBEA 3SJVD 5F6HI 4ESKA 1T1WA 3HMXL 1DR9A 1ND0A 4NFBA 4WFGE 3L3OB 1B9ZA 2W65A 1NCAH 4KJYA 2IANE 6CGTA 2IFFL 2OQJB 1WFTA 2FECL 5DK3A 4JPIA 5DHVA 1P69B 3UPRB 3ILPA 1K5NA 2ARJA 1P4LB 1TENA 5F96L 4OJFL 2C1PB 1MCBA 1JMXA 4F58H 4X99B 1UXSB 4ZTPH 4HFWA 5SWSA 5ADPH 4PIRF 4L8CB 2VO5A 5CSZB 3I02A 1T22B 5B39G 3T0WA 2NZ9D 4NOFA 2YD1A 1FHGA 1T0NA 1CXIA 4BQCA 4PR5B 2ZUYA 4UU9A 4PY8J 1I1YB 3GHEL 4JY6A 5CJBA 5ILTL 1JPST 1JRHL 4AIOA 4WI4A 5D1XA 3U36B 3O4LE 1WBXA 1BQUA 3FONA 1VENA 4JRXD 3EZJB 1V3KA 4UILL 2GSIA 4JLRA 4XPAH 1M7DA 4IOIB 4EUPB 3F58H 3U9PL 4F33B 4URTB 5EU6A 3CNKA 5FYJU 3FOMA 3SGDI 3RU8L 5C9JA 5T5FH 4GJTB 3S35X 1BLNB 1Q9KB 4E9LA 3OAUH 3I75B 3HI6H 1CK0L 3KPSB 3D25A 1DUZB 1R6VA 4H1LH 3HE6C 1JNJA 4XTRD 3MRHB 3CFJA 5I71B 2DKMA 1F13A 1A6ZA 4GG6B 4P2OB 1N4XL 4O5LH 2YA0A 4HF5H 4PYHA 4LLAA 4E0RB 2HFGL 4R4NC 3WUWG 2BVQB 3B3IB 1NC4A 4PGEA 4MD0A 3IFPB 5K9QI 4C56E 3V7AG 5DFVD 4NZRH 1CDCA 4JREC 5JLZB 4TVSa 1P84J 3DUSB 4QRQB 1DDHA 4WI3A 3CUPB 2XNAB 3L3HB 2HKHH 1KPRB 4KFZC 1DLHB 4M6AA 5EO9A 3T2NH 4H8WH 5C92A 4LCCA 1FIGH 5CILH 5D96B 2XWBB 1F3RB 4YE4H 3NA9H 3ZKNC 5FHBH 3MLRL 1BM3H 1HZHL 4KXZH 4KKBD 3TBTB 1U3YA 1N59A 3SJVE 5HGAB 1JBJA 4IMKA 2LU7A 4Q6IB 5BVJB 4YHIB 3KXFD 4DFIA 4Q0XL 4JRYB 3BJLA 1OTTD 5BV7L 4JFEA 3NTCH 4G42B 1KJVA 3GO1H 3CD4A 1ADQA 1VB9A 4WCYH 4ZDHB 4CVWA 4JHZA 2FHBA 5DR5H 3QI9D 5D9SB 4IOIA 3CFDA 3EO9H 2F54A 2NY6B 1EVUA 4HZLA 1Q9KA 2HG5A 3I75A 5GGRB 1ACZA 4YHPB 1ZA3B 5JIHA 4X4ME 3NPZB 3FT3A 2H6PA 2WUBL 2EDFA 4JRXE 3VXUA 5DRWA 1F58H 2K9UA 1B0WA 5ICYA 4OCWH 3PWNB 4Y2DB 1L7IL 3KGRA 2BVQA 3B3IA 1KIQB 2GJZA 1CE1H 4P2RA 2X4PB 4X6BA 2JCCA 2AS5M 3GJFH 4BM7A 4I48A 4YBQC 1R3JA 1YC8A 4QRQA 1FPTL 4I0PD 3G08A 2R0KH 1NAMB 3GK8L 4PP2A 3UO1H 4MA1B 2APFA 2DJ4A 4F7TA 2ITCA 3QCTH 4Z0XA 3I6KA 4HIEA 4FQXD 4Z76B 4JHWH 5GSVA 4RMQA 3J7HA 2WWKT 1A4JB 1ZHNB 3GMQA 3HE6A 3TH3T 4DTGL 4KROC 4L8SC 3SGEI 4FNLL 2GY7B 3BKJL 4MQXC 1D9KD 3O3BB 4IDJH 2IPKB 4TSCH 3I6LD 2CLVA 4OZ4B 2UYLB 3KYAA 4NRXB 1X5IA 3GI9L 1MJUL 5FUOH 4HLJA 5CEZH 3UC0L 4B50A 2R1YA 3B5GA 5DJDA 4RMSA 4U6YA 1MCOH 2EDHA 2EXWD 4N8CL 5FGRA 4G42A 2XZCH 5LBSL 2ADIB 4LVNB 4H1LG 1NKOA 4N9GA 3HZYB 2APTA 3QPXH 3QIWD 2UUDH 5D9SA 4NZUL 2HFFA 1YN7B 3MLXH 1HYSD 4K7PH 1KJ2L 1F97A 3PABB 4PREB 5DS8B 3G9AB 2PUQT 3U82B 2X1PA 3KXFE 1T2JA 4IDLA 3ULSA 1JPTH 2LVCA 3U4EB 1OARL 5GJSH 4HIIB 3UROR 3TBVB 4OSUL 4NJ9H 1VGKB 3FRUA 1MLBB 3MLTA 4Z18A 4I18B 3WIFA 3OGCB 1KCKA 3MXVL 4BFEA 3NCYP 1KIQA 4LEOA 3AFLA 3I3BA 3ZDXF 1NGPL 2WLYA 3CMOH 1VCAA 3H42H 4GO6B 2Y7QB 3KPRB 2AXJA 3W9DA 3CXHJ 4AH2B 5KAQF 1A3RH 2X9WA 4U49A 2YRZA 3L5IA 4RGMB 5CS7A 5DQ9A 3R1GL 1UYWL 2E6PA 1EAPA 3QNYB 1WEJL 5F44A 4KH2A 1YEKL 1ZAGA 1A6UH 5I1LB 2G60H 4E41D 1MRDH 4CU8A 2FEDC 3VRLF 4DZBB 4UUJB 4P2YA 3DX6B 4HJJL 4WTZA 2CLRA 5E7FA 3SGKC 3O3BA 5IK3A 3V4UL 5L0QC 4Z7OE 5EA0L 1Q1JL 4K3JL 5ESAA 3LPFA 4IS6A 2VXUH 3DV6B 4QRRD 2I60H 1MCLA 1FJ1B 2EH8H 5DZLA 1FORH 1BJ8A 4KRPB 5J6GA 1H9VA 5L2KA 5J11B 4IIQC 3ARPA 1BFSA 2LABA 1HDMB 1CQKA 1A7NH 2PYEA 3VDAA 5IMLB 3DROB 2EC9U 1IM9D 3W81A 4JO2L 3VI4E 2AEWA 1BHGA 1FVDA 2XA8H 5FDYA 4WIQA 1A0QH 1D6VH 3I6LE 2C1OB 1FZJB 3DLQR 4L8SA 5C2UB 1YN7A 2M2DA 4WJ5A 4KMLB 4NN6B 1MAMH 3SDDC 4NQCB 5F97E 1MFAH 4P9HH 5IKCA 2P45B 4OD3L 1AE6H 4OZHE 1GVIA 1KTLA 4BH8A 4NM4L 5EZIL 1JFQH 5A3IC 4NQDB 1YPZF 1TZHB 4TUKL 4W4NA 3IF1A 2Z31D 2A0LC 4R7NA 2KQMA 1E28A 2RIKA 1I1FA 1WWCA 5A2JH 4P49A 5KANI 3AY4C 5C09D 3RY5A 1A6VH 2P5WA 4LSTH 1D5MA 5GRVK 1LO0L 1MEXH 4WHDA 3CZJA 4UNUA 5IW6B 1JPFA 1OAZL 3HR6A 1QBLH 2V7NB 1JV5B 4PJAF 4PJCE 3NH7L 1FYTD 3FQXB 5GGVY 3WFHB 3I9GL 1ZLVH 3O8XD 2VLJD 1KB5L 3CVHA 5FCUL 5K9OB 3FRPA 3P4NA 3R0MA 4GRLC 2BX5A 1RU9H 2A1WH 5D7IF 3FQWA 4ONHA 1T2XA 4AIXA 4OZIE 4HWBL 1XEDA 1I1CA 3MREB 3QCUL 3RX5A 5E5RB 3P4OA 6FABH 4MQ7B 4I2XE 3IDIB 1E4XI 2GK0B 5GGSY 1YNTB 5EUKA 1KIPB 1HDMA 5KZCB 2E7BA 1IAII 5DD3L 4EXKA 4RQQA 2LTQC 4R4BA 4JVPA 3GSVB 3P77A 2CGRL 3QHZL 3QFJD 3QEQB 1QSFB 3W39A 5JOPD 1FZJA 2Q76A 1CDUA 4NRZB 5C0IA 1B0RA 5A2LH 4QRRE 5E8EB 3BT2L 3LOWA 4NQCA 5ANMA 3SGKA 1HCVA 2J6EA 5SX5H 2O5XL 1CT8A 4M7JH 4QOKD 4EN3B 5GS1B 3C5SB 2AKRA 4Q9CA 5HXMA 3G6DH 1TZHA 4PJBB 2BSED 1TETL 2OLDA 3L9RB 1KN2H 2ZJSH 1OD9A 1TJIH 3JV5A 3OKOA 4IIQA 2CKBA 4XI5C 1F4YH 1MH5A 1YYMH 5F7MC 2W60B 1CQYA 3NGBC 3LIZH 1WBZB 3ULUD 2ESVB 2APWA 3RA7L 5CKAA 4NQSB 3WS3B 4I4WB 4LKCA 1U8IA 4Q74A 5HY9B 3G04B 2Q8BL 5A1AA 3V0WH 4ODBD 4RMTA 3SDDA 2ICCA 1UA6H 4EDWH 4KI5F 1OPGH 2CIKB 4O58H 2NPLX 3BI9X 5I1KH 5LGKA 4LOUC 5C09E 4CUCA 4LLYA 2AK4D 2O5ZL 5TDOA 5MI0B 5K9OA 3VW3H 2BCKA 1G9EA 1WWBX 2QQNL 3QR2A 3D18A 3AY4A 1FFQA 2DJUA 3MREA 1OAYH 3W11C 2YPLD 4F9LC 4JGUA 3WIHA 1VHPA 3AAZB 2R2CA 1FQ9C 3SKNA 3R8BB 3G5XA 3GI8H 4P4KB 1YNTA 3PQYD 2DYPA 4FP8H 2VLJE 2X6MA 1FVEA 1G9NC 2H26A 5E2WH 3IVKB 1KXTB 1ZA6A 5TE6H 1QPXA 2OP4H 4WDIB 1IRAY 3QG6B 2DLFL 3GSVA 2D9QB 4ELME 5GRYA 1K9TA 4AEEA 2ADJA 3GZKA 1L9NA 3GIVB 3NCBB 1I9EA 4GRLA 2PXYC 3CX2A 2AVGA 1KLUA 2BDNH 3OG6B 3OXSB 2C4FU 2VAAA 4OF0A 4TRPH 5F7DB 1A7PH 1IC5L 4YJZL 5GGSA 1SYSA 3QUMH 5CIPA 1HXYA 1Q9OB 3OX8A 5K9JH 5GSRB 3QFJE 5SWQB 4Q9QH 1T80A 1ZHLB 4ZAKC 5JOPE 4O2CB 3QG7L 1Y18B 3WE6B 3UJTH 2C5DC 3OSKA 3KPPA 4WO4C 2FR4B 5ITFB 1UH3A 1F4WL 4QOKE 4JAMB 1QLEH 4LQFL 3BO8B 1EFXA 2F74B 4JO4H 4POZD 3GSNB 1LO4H 1XGUA 4NJAH 5ITBH 1AGCA 3KWWA 3BQUC 2NR6D 2FJGA 2LE9A 4FZ8L 3SE8H 4XPHH 4PJDA 1JF1B 5IB2B 4KK5C 2BVPA 2WUCH 1JUFB 1RZ8B 4OFYD 3QDJA 3ULUE 4D0DA 2DTML 3FB8B 5CINH 5KN5B 5IJKA 1PQZA 4NUJA 1MF2L 1CR9H 1EMTH 1A7QL 2FL5B 3QUXC 5SWZD 5GQBA 1LO3H 3MLYH 1WFUA 4JDVA 3MROB 3RNQB 5CHNB 2MWCA 2EE3A 1MI5D 5IM7A 1FE8H 1PKOA 1SEQH 1SVZA 4C57C 2H45A 2J4WL 4YHKH 4PJFE 4LVOB 1DEEA 2DTSA 4U1JB 4P4RB 3SDXE 1QA9A 4ZUSA 4OZFH 3ORJA 4PJBF 5EZOL 3FO1B 4ZXBB 3BE1H 3UTSB 4G80B 32C2B 2BJMH 3GIVA 4O4YL 5IESH 2YK1H 2YPLE 3EJZC 1T4KB 1BIIA 4NBXB 2IG2H 4YHML 4XCYA 3HNSL 3RUGE 1SJHA