4LOUC

Structure of the e148q mutant of clc-ec1 deltanc construct in the absence of halide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
222
structure length
222
Chain Sequence
EVRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H(+)/Cl(-) exchange transporter ClcA
publication title A fluoride interloper in a CLC-type Cl /H+ antiporter
rcsb
source organism Escherichia coli
molecule tags Membrane protein, tranport protein
total genus 39
structure length 222
sequence length 222
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-07-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4louC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4louC01
2C1PB 5EZLA 1BZ9B 4RMUA 1TMCB 1I1FA 4PB9H 3QCUL 4HIIA 3VGAC 4HIEA 4TQEH 1VEOA 3MO1A 3SGJA 1CDCA 5ECJE 4YQXL 3IETA 5JTWA 5HYIA 1LO2H 3HC0A 4ZSOB 2VRAA 1FFQA 3O3EA 4L8BB 5SX4H 3P73B 1CGSL 2JE8A 1R3IL 4G6KL 4JVUA 5C09D 5C0RL 4YXKL 4LCIH 1OY3B 3H3PL 1CXFA 5B3JE 1OT1A 2NX5B 2RCSL 1AHWA 1FLRH 5GGQH 3IU3A 1ITBB 3CCHB 4TVSa 1IEBA 4XVUD 1MFCH 4FZEH 3WXVL 2VXSL 1BZQK 5ERWB 4OCWH 3I2CL 3W9EB 5CD3B 3OXRA 1SYSB 2JB6A 4ODXA 5JZ7D 5FECA 1DSFL 3QEQD 4OKVB 2BXYA 4CAGA 4DOHE 3WIIH 5HI5D 1NGPH 5JIIA 4U6TA 5E2WH 4NQCD 1MQ8A 4XP5H 3LDBB 5ESAB 1LMKA 2J88H 3MGOA 2WM0A 5EWIH 4NN6C 2GCYB 3O11A 1JBJA 1JK8B 4H0HB 2JELH 2WIMA 5C0AD 5EZIH 2LAAA 2VLME 4FQHA 1A4KB 3MRBB 3NIGF 4A6YB 4NNYB 4MA3B 2VE6A 1EEYB 4GFTB 4OI7A 3H0TA 4M00A 1DTUA 3V6OE 1GGTA 4KJQC 2QHRH 1M6OB 1MCSA 1JRHH 1SJVA 3ZE2F 5GXBB 4JFFA 4U6XA 3IDNB 1FNEA 4GW5B 4L8SA 1XGYL 3GGWA 1JPST 4K94L 4KJPC 2QADC 3WBDA 4PJ5B 3SN6N 4U6YA 1X7QB 3S34H 3VI4E 2IG2L 2NY1C 3G6JB 3X3FH 2H32A 3OR7A 3ARFA 4HLZG 5FYLL 5BRZB 4XPHL 1A9EA 1RK1A 3X14A 3QWOB 4XCFH 5EO1A 1G7MB 4NN7C 3K0WA 1RZGA 4Q0XH 3NFSH 4TNWK 4G80B 3U6RB 4XVSL 2VDML 5CBEA 3AAZA 1TNMA 1MUJA 1AO7B 4XHQA 4P5TB 1HHIB 2KQNA 3PWVB 4F58H 4I1NB 1MLCB 1E4XI 4BSWB 5FYKL 2DB8A 3K81A 2NY4D 5CUSL 3QNXB 3LB6D 4IJ3C 4JGMA 2XV6B 3MJ9H 3O6FC 1RAMA 1QBBA 2WBJB 2Z92A 3EOAA 4QXTA 3QUKA 4MJ6B 4UT7L 3MRLB 2W0KA 1QEWA 3EFFB 5FUZH 2FD6L 4P2QA 4K7FA 4NC1C 1YNLL 3QI9B 1SVZA 3WNOA 3I9GH 3W5MA 2JCCE 5GGTH 5CEYB 3OGCB 3CSBA 4QHKJ 3NZHL 5IB2B 1F4HA 3HG1A 1GGUA 1QZ1A 4TVPD 1LK2A 3SOBL 1CWVA 5I1IH 1GC1L 1CU4H 4M5ZH 4AT6A 4XB7A 4ORGB 3MXWH 3TO2A 3HMWL 1U8MB 3ZSTA 1KJ3H 3ARRA 1DDHA 4WHTB 4JO4H 4HWZB 1KLGA 4F9PA 2YD4A 3S96A 5HPMB 1E6OL 4EN3B 4HPOH 3ARFC 4XNQA 5ADOH 1MNUH 1TTFA 1PG7L 4DQOH 3EYSH 3EFDL 2GUOB 2XZQH 1GPOH 2XTJC 2HN7A 3HZYA 4PY7A 2KPNA 4XMLH 3BEWB 3IAGC 1XF3A 3DSNA 1AD9B 5J11C 4PY8I 1SJHA 4RBPH 1ZLUH 1W0WB 4JGUA 4X0KB 4MDIA 3SDCD 3BP4B 2JCCF 2I27N 3TVMA 2J7LA 2C4FT 1E4XL 2HT3C 3MJ6A 5L2KD 2VXTH 4MD5A 3BUYB 3OZ9L 5F7DA 4JPWL 2H6PB 2BCKB 1G6RB 3EO9H 5E8NA 5FO8B 3D0LA 5B39A 1K85A 1T83C 1ZAGA 4LDLB 4DTGH 1FYTD 1H3VA 1NC4D 3FZUD 3BDYL 5TDOA 3BI9X 2FL5B 1FZOA 3CFBA 4JO2H 2H9GA 5B4MD 2Q7YA 3HRZB 4PRPB 5JOFB 1L7TL 3E6FA 1KG0B 1RUQH 3U9UB 3BRGC 1U8KA 3GI8H 5B39G 5EB9A 3E8UH 3SO3B 1IGTA 3MV7B 3VU2A 3DO7A 4JFQB 1KN4L 2PO6D 2IANB 1T3FA 4GBXD 3M1BB 1MFAL 1YPZF 2VL5B 2VC2L 5F96L 4F9PC 1MHEB 4L8DB 4NHCL 1BIIB 4UT9L 4W6WB 3F5WB 4TUJA 2BVPA 4XNXL 2HVJA 4CKVX 4MXQC 4O00A 2EZ0D 4PV8A 3SDDA 2GAZB 4EQ2A 4AEIH 3KYNB 1RMFH 4PBXA 5HGGS 1MRCH 5DDHA 4QRTA 3TVMC 4GAYA 4PREA 1DVFA 1SM3L 1JUFA 5IEKB 1FL6A 3NVQA 2YC1B 1HHJA 3Q2CA 4KAQL 4WTXA 4XVUC 3CZFA 2VDRH 2YD9A 1H8NA 3CVHB 4LHQB 5KOMC 4UQ3B 3FRUB 4HGWB 2I5YH 2I25N 2VSCA 2J6EL 2PKDA 3R06B 4GMTL 5JZ7C 3HPLB 5TE4L 4YDKH 2W65B 3W9DA 4JHBA 5CILH 2EKSA 1ND0A 3D39D 3HAEH 4OFYD 1LP9B 3LQZA 2HFFA 5T33H 4LMQE 3LKNA 3MACH 3QUZA 2CGRH 3NTCH 2HT4C 2VLJD 2UUDH 2F54D 4K71C 1GZPA 4LCWB 4I5BB 3QCVH 3P11H 4Z77A 1I3GL 4XX1G 4PRID 3MRMA 1JPGB 1E28A 1MFBL 2J8HA 4Y8DC 5HXMA 1YQ2A 1QOKA 4X9GA 3X17A 2YUVA 4FTVA 3OBAA 2VITA 2CKBH 2NW2B 3OX8B 1VGEL 2IQ9L 1TETH 2FBJH 2O5ZH 2CLRB 3RPIB 3ARBB 3CFCH 3SDDC 5F1IA 3S37L 1YEIH 4GRWH 4EUPG 2IPTL 2F9BT 1ORSA 4TN9A 4Z7QF 4XCYA 1YUHB 3DVNB 3IS1X 4HCRA 3BPOC 2J1KA 4JEGB 3ZHLA 2ENSA 4NZDA 2VAAB 2I9TB 4O58H 4OFVA 2HKFH 3VXSD 5D1QB 5J3HC 4TOYH 2XQBH 3UTSB 4Z95L 3M8OH 5IB5A 4HEME 5DEFA 3MXVL 3I3DA 3SY0A 1CVSC 3C5ZA 3QPQD 5K9OB 2ICEB 4WRLA 2NY4C 4J4PD 4PJXA 4PJ7B 3LB6C 1JGUH 4CADB 3VD9A 1FG2A 3HN3A 1TCRB 3MSPA 4LBEA 3RVUC 4BH7A 3V5KB 2XWJB 4IS6A 4QRRE 5DEGA 1L0YA 4OJFH 5FAAA 1PQZB 3UPRA 4M61B 2CRIA 3VRIB 1X4YA 3WL9B 4ODWB 4WGVB 3MOBL 1EXUB 3MNVA 2DQGH 4D2NA 3HE6A 5ESQB 1LO4H 1G7JB 3FN3A 5LBSL 5CEZE 3BP7A 4EXPX 5BQ7A 4OM0L 3FQXB 4LIQH 4NZRL 4RFNB 5FCSH 4K3JH 3BRFA 3RWGB 3CLEL 4MNGE 4NSKB 4G8GB 4MS8D 3GMPB 5E2UL 1S9KC 2VIRB 5H37H 4DZBB 3QEUA 4M62H 1TZGH 3H7LA 4GLRH 1ADQL 2FJHA 4OZGB 4MQXD 4I9WE 1V8HA 2HFTA 4I4WB 3NCFB 3DX7B 3W81A 1K4DA 4DK6A 4F7TB 4ZD3H 3O3BA 5T1LA 1OVZA 1WBYA 1MJUL 2WSKA 3MQIA 4JPKH 2R8SL 1ZE3C 2Q8BH 4L5FL 4LLWA 1Z0NA 4R2GC 5FA4A 4MJIE 5DD1L 3P0GB 4XAKD 4YFEA 1A1MB 2COQA 3UAJD 3WJLA 4OCSH 1A02N 3VXNA 1YN6A 2UYLB 3WNMA 1CLYL 4I3RH 4KI5D 2OJZL 3L3HB 1KTRL 4KXZI 3EYFA 1CZ8H 2WK2A 3FZUC 3WN5B 2IBZY 3BQUB 3D69B 2IGFH 2VXUL 5B4MC 4X6DA 1YNKL 3DBXA 1OTSC 2NLJB 1PKQB 2X4UA 5IQ9A 5EBLB 2GK2A 2P5EE 2GTWA 4JQIL 5J13B 5E08H 5CIPH 2Z8VC 2DQJL 4P46A 1CD1A 1FG9C 1F42A 3P4OB 1D5XB 4GBXC 4E41D 1FIGL 3I75B 1GAFH 1S9XA 1HKLH 4OUUA 2NNAA 5I8CA 1INDL 4P5MB 3I6KA 4EBQH 5C2UB 1LEKA 4D0BA 2Z35A 2AKRA 3SDXF 3BWAB 3RVWD 4TUOB 2KZ1B 4P2RD 5MEND 3BSZH 3MMEB 1OHQA 1N64H 1XR8B 4JRXB 5ISZD 1VCAA 2WQ8A 1KB9K 1KEML 3A6BL 1DUZB 3MUZ1 3VGDA 3KPNB 1V3MA 4PR5B 3KLDA 3SKJH 5T3ZH 1DANU 5LG1A 4UB0H 5I74C 4MXWH 1CGUA 2PF6A 5A2LH 4LRNL 1IC4H 3VXTB 5B8CB 4LSSH 5IW6A 3BWUC 1T1ZA 3QISA 3HHRB 2H26A 3GBML 2UVEA 5JLZB 2CK0L 1K5NA 5BW7A 2DQDH 5I6XC 2GIYA 5I0ZA 1C1EL 4WV1A 4HF5H 2VB5A 1FE8H 4KMTH 3ARGB 4HS6B 2XKUA 3GSNL 3O8XA 4DK3A 1REIA 1UH4A 4XPGH 2WIIA 1I7TA 2D31B 1JF6A 2ICES 3O81A 2YZ1A 4R4BB 4XGZB 2IBZX 1N5AB 1FGVH 2XOTA 5AUMB 2W60B 3QDJD 4KVNH 1HIML 2OJEA 1JGEB 2ZOKA 4XBGA 4R96B 3PGCA 4HKXA 5D2NA 1H5BA 5ICXA 1GOGA 2VLKE 3DRQB 2P8PA 3ZYIA 2DQUH 4O2CA 1QNZH 4X98A 3QP3A 4YHKH 2QQNH 4NM4L 5DGQA 1Q1JH 5IFHL 3H9HA 3SKMB 5AG8A 1AGFA 4R0LB 1CICA 5I9QC 4E5XA 2V7NA 4FHBD 4YXLL 2X4PB 4LQFL 3CLFH 4M48L 4U3HA 4G6JH 1JWMB 1QSFB 2SEBA 2P47B 4U7KA 3ZT7A 4ZUTB 5IB3B 3VG0H 1BBJB 3RWCA 5EN2B 1AQKH 4JDZA 3X12B 1UG9A 5BW7C 4X6FA 4XAWH 3KXFE 2C1OA 4WW2F 4XCNB 4XBPB 1KPVA 4N0UE 4YHYB 3WO3B 1B6DA 3EYVB 3QIBB 2CLZA 2BNQE 5HHOD 2VYRE 1L6XA 4DKFL 5E9DA 2VQUA 3BEVA 3F58H 5FYLE 3BPLB 2DQHL 1LO0H 1A7QL 1RUPL 2CRYA 4YDLB 5DJZB 4X5LA 3WLBA 1ES0B 3LH2H 3L3GA 5DK2B 5D2LA 4EZMA 4YXHL 2BJML 4QRSA 1A6ZA 1UCTA 4F80A 3REVA 4U1NB 5D2NC 1H5BC 3HRPA 1S9WA 4UNVA 4X4YB 5FYKE 1LE5B 4TVPL 1BWMA 4OB5H 1XGPB 2IBGA 5DT1L 5E2TL 4XNYL 1U6AL 3L3OA 4HWBA 1WWCA 4RFEA 3HB3C 4DOHB 3CFDB 1OLZA 1X5JA 3C8HA 3B6SA 2G5BB 2ICWJ 4P0DA 1IVLA 4L3ED 3SBWA 1Z0MA 3QEGH 1FAIH 3C2AH 5I76A 4XP9L 3O2WH 2MPAH 3FT2A 4NQDA 1ZLWH 4MVBD 4XNZB 4HFUH 4YHML 3VXUA 5ACZA 3CC5B 2ZZUT 4KUCF 1NSNL 2BMKA 3L6FB 5E94A 3UAJC 4KGJA 1NAMH 1RZKC 4LPYA 4ZFGH 4OF5A 3W82A 4KRMB 5DQDH 4X6EB 2WBKA 5DA0B 3OKKA 3ULVH 3GIZL 4BH8B 2UZIH 3G6AB 1F90H 2OK0H 4P3CH 1H3GA 4WGWB 4Z5RB 1T1WB 4ZOEA 1OB1A 4M6MH 3BKYH 2X4QA 2AAVA 4N8CL 5D7KD 2MCPL 4CBPA 5D1XD 2E27L 4NQTA 5F89B 3LN4B 1DZBA 1NEZG 4NNPL 5FA3B 1X3DA 3FB5A 4I3SH 4I18B 1AE6L 1YEHL 2DAVA 4IIQB 1N0XL 1S7SA 2B39A 1VEMA 4JHAH 3MOAH 2QKIB 2Z9TA 1O7VA 4G9FD 3G08B 1KBGH 3NA9L 3QXDB 3RIFF 4PIRF 1AY1H 1B9ZA 1J05A 1NUDA 3JTTB 5D6CA 3DECA 2YBRB 4OD1L 1H8SA 2APFA 1EX0A 1MCDA 3TM6A 2BNRA 4OZHE 2Z93A 3UBXG 5GZOC 1KEGL 5E6ZA 3IVKB 1MIMH 2A6DA 1GGCL 4QOKE 3OAYK 4MCZA 3ROOA 2JIXA 1TDQA 4JFHE 1Y18A 1UZ8A 2JCCB 1DN0B 5ALCH 1UEMA 3TGXA 3V4VH 3ZDYE 1CR9L 1T4KA 4RFOL 2P8MA 4QRUA 5CP7B 2O5XH 5CGMA 4JFDE 2IAMA 1YA5A 3QJHB 1IL1A 5HGHA 5GGVL 5DTFB 2EH7L 2H3NA 1TTGA 1YMMA 4CVZB 5I18L 5D7JD 3RDTB 4JY5L 2DBLH 2VDPH 4X7CC 1VDGA 2DWEB 2EO1A 2DTML 4NBYB 5GRVK 5IB4A 1FORH 1SEQH 1ZSDA 4RRPA 4UOJA 3CU7A 1JZ3A 1B0WA 4OV5A 2CDFB 1XIWA 1YNTB 4PGCB 2XN9D 1NGYB 5BMFL 1PEZA 1C08A 5I8EB 1NKOA 3MFFA 5KANG 3RWEA 3AREB 3QPXL 1UCBL 3ZDYF 1EAPA 5A3ID 1KJ2L 1YEGL 3RWFB 5ALBH 5FM8A 5EUKB 5HYJE 1P53A 4RMQA 1CDGA 3VFOA 3B9KD 3TFKD 3OB0H 3QO1B 3QH3A 5DVLA 4K8RD 3UMTA 1NCBL 1CK0L 3TCXA 2A74A 4UIMA 5C0CE 3PG2A 3TT1H 3Q3GB 1PLGL 1JN6B 4XMPL 4GSDH 3RAJL 2G5RA 5D5MF 4PB0L 5EZJA 3F7VB 1T1YA 2OQJA 3D9AL 3BZFA 4KJYA 1FV1B 3ILQC 3ULUH 5SWQA 4BFIA 3BPNB 5T5FH 2IFFL 1A7OL 3O4LA 1SY6L 2XYCA 5FM5M 1AC0A 3QZWA 2DYPA 5HDBF 1WIUA 2YPLA 1X5XA 3CFEB 3S7GA 2ZPKL 1RURH 2J12B 1ZA3A 5HYQB 4OGYL 2H1PL 5IW1A 3GMQA 5IFJA 1S7QB 3BH8A 3P0VH 1EERB 5KJRH 5IHUH 4JG1H 3QZWG 3VI3E 4ODVH 1VSCA 4GS7B 2ADJA 4HKZB 5HJ3A 1NUFA 1DBKL 1MQKL 1MH5B 1Q9WB 2YPKB 1KC5L 3ZTJH 4PY8J 4K7PY 5IHBA 4X8JA 2VWEC 1WT5A 4YR6A 1WWBX 4F57H 2VZOA 3PWLB 1A6VH 3ECBB 4N5ED 2FO1A 2NY7L 1H8OA 4MD4B 5J12C 3QULA 1ZK9A 4D0CA 4JZNB 4LAJH 1N8ZA 4JZJA 3ZTNL 1B90A 4QHNB 5L0QC 4NC1E 1IM3A 3KPLA 1NPUA 2IC2A 1C12A 2V9RA 5GS1A 1FNLA 3Q0HA 3VI3F 25C8H 1MI5D 3TF7C 3VGGA 2EDNA 3KYAA 4UV7H 1CFVH 5DXWA 5IBTL 1A9BA 4KQ3L 3MBEB 2XKNA 1U42A 4RGOH 2EEBA 1RZKL 4MAUL 1BFSA 3NGBC 5GGRA 2R69H 5LCVH 3O3DA 4FMKA 4MAYD 3EJYD 4X7EC 3VXPA 5T1KA 5GRYA 2XTJE 1JNLH 1B0GB 1WF5A 1U8LB 4KTEL 4YBQD 1V7NH 3PIQB 3P40A 3UROR 3TNNB 5I1JL 2X4SB 2YRPA 4HUXA 4M9PA 5C6WH 2B4CC 4Y16A 5EIIA 3V4UL 3AB0B 1RJCA 1I8LC 4LAQH 2FBOJ 4NRZA 4LLAA 3NH7L 4RMTA 1PSKH 1NCCL 4I0CC 3I6LE 4XCCL 2XT1B 3IS0X 3O3UN 3BE1L 2DJ4A 4YGVA 3WKMH 1OP5K 4QRQA 4ZOAA 1HYSC 2WW8A 5EO0B 2D0GA 3FTGA 3QR2A 4K7PX 3QIUD 3EJZD 4OCYH 4ZFFA 2OTWB 2L4OA 4QGTA 1CFNA 4UUJB 1FRGH 4R3SA 5I71C 4QRRB 5GS1C 2NXYD 5F3BB 1HH6A 4UZGA 2OX5A 4KHXL 4ZO9A 5KTEH 5E8OB 1KPUB 2HWZH 5BV7H 15C8H 3G5XB 4F2MB 1T1XB 4P49A 2A1WL 4GXUN 5DFTA 3MYJB 4RSVA 3GJFB 1MPAL 4JY4A 4IRSB 1JNJA 2XFXB 1MWAA 3VA6A 3DMMB 1DL7L 5JXAL 4MNGB 3DIFA 2APWA 4TSBL 2F15A 3KJ6H 2ADIB 3O9WD 1MHPH 1XGUB 3IXAA 3T3ME 1LE9B 1J10A 3MCLH 4F7MA 4UINH 1F4WH 5C1MB 3LQAC 5H35A 1T2XA 2B1AL 2XQYK 4Y16C 1TFHA 3K8KA 4U33A 1W0YT 4WU5B 1LDPH 3UCRA 4ZQKA 1LO5B 5E8PB 2IH1B 1UQSB 3TLRA 1OTTD 3MLTA 1T89A 4R6UA 5CEXA 3OF6A 4K2UH 4F7EA 3ARDA 5JMRA 1TJIH 1QSEB 1NFIA 4K3DH 1Z3GH 2GJ6D 3LHPH 4MJIB 1U9KA 3GSVB 1N6QL 5A3IC 3DV6B 4RX4A 1BQSA 3QEQE 4NRXA 2X4RA 4WHYH 4GRMA 3B9KC 3PWPA 1Q9OB 3TFKC 3G04B 4NQCE 3VH8B 2EDTA 4MJ5A 1ZHKB 2ESVA 3CFIC 4K8RC 3MJ8B 1CGTA 5GRUL 1QBAA 3T2NL 1CLCA 4XT1C 5C0AE 1FL5A 3S36L 4C59B 1CGYA 2K1MA 1KTDB 2J3SA 1DP0A 4GQ9H 3VFUA 5LXGH 2P5EB 4YHNA 4I0PD 2EYRB 1A64A 1U93A 4YDIH 4ZS7L 2DDQL 4Y4FA 3FOLB 2ZJSH 3TT3L 1W8OA 4LLDA 5INCB 6CGTA 1IAOB 1S7WB 3UC0H 1H0DB 5KZCD 2M8XA 3QBTB 1U3HB 5DRXB 5D6DA 4R8WH 1HQ4B 5GQBA 2NMSA 2XWTA 2R56H 3HNTL 3TN0A 4L4VD 3MV9B 5GRZA 4FFVD 3QUXB 4P23B 3RWHB 3BMVA 2FB4H 3KHQA 4F15C 2EXWD 4XBEL 1K8IA 3ARDC 5IQ7H 1B6UA 4LQ1A 4G8IA 3WS3B 1JP5A 2NW3A 1R3LB 4NKDA 2CR3A 3C09B 4R26H 3RTQB 3U4AA 4HDIA 2QL1A 1YJDH 1ZS8B 3G9VA 4KV5E 1A2YA 4P57B 4F8QA 3ABZA 4AEHL 3HC4L 4G5ZH 2Q6WA 2F58L 5IMLA 4OFDA 1RZ8A 2YWYA 1A1OB 5I1CL 5EORL 4IRZL 4R4ND 4NT6A 1U91A 2G9HB 1IEAA 3SO5A 3D85D 1UM4L 2AJVL 2XRAH 3D2UB 3FQWB 2VLRA 43C9B 3TA3A 4LSQL 4JHWL 4CVXA 1SQ2N 4CW1A 3V0WH 4AH2B 1K8DA 5JQ6L 1J0YA 3QXUA 4EI5D 2DLEA 3G5YA 4N9OB 4O2EA 4EIGB 5GSVB 4MYWB 5A16A 3ETBF 3IKKA 1XGTB 3CVIL 4I8DA 4CU6A 3ARZA 1I7ZA 5ANMA 5I73B 3PDGA 2DQCH 3QJFB 4XPFL 3PV7A 4YLQT 2ICWB 4E0RB 4TVPE 2DQEH 3R0MA 3IDGA 1PY9A 4NO0A 1RUML 4Q9QL 1P4IL 4YJZL 5FGBC 3OKYA 1WBZA 2AQ1A 3LKPA 4LVEA 3CH8A 5D6DC 2YRZA 3EYOA 1UB6B 2OYPA 4YZFF 1DLHB 2MKWA 3MLXH 3GSUB 3TN0C 2VLKB 4ZO7A 2HYMA 4W4OC 1P1ZA 2BVQA 3EJYC 2NX5D 4MAYC 2NCMA 3UTZA 1KXVC 1A5FL 1T5WA 2LVEA 1P5VA 4XPTL 4YBQC 5I1AA 1E6JH 2EDKA 4K9EL 4MDJA 3RWIB 2AVGA 3RVVC 1CG9A 4HLZH 5C0ND 2DLHA 4ZFZA 4LFHD 1NANH 3LN5A 1Q9LA 1I1RA 2CLVA 5C07A 5L2KE 3IDYC 5IR1A 5F70A 4UOW0 5C9JA 4TULH 5DQJB 1ZMYA 4WU7A 3IGAB 4PJXE 1Z6JT 3OR6B 2F8OA 3BESR 4JM2A 2H32H 1UWGH 3BGFB 4NZUL 5F7MC 3MLZL 5C70A 3N9GL 3MCKA 2FIKB 3TA3C 3KXFB 4EOWL 4CVUA 5LGHH 3VFSB 1BAFH 4N0UB 3NBNA 5CKAA 2R23B 1F8TH 4GUPA 3KPSA 3RUGE 4ODHH 2BNQB 1SEBA 3EOBA 2LTQB 3EJZC 2VQTA 4FQ1L 1EGJA 1T21B 2FX8L 1MRDH 3WIFB 1LNUB 1RUAH 1JJUA 4GG6E 4NDMA 1U8HB 3DURA 2D4DA 2EKJA 1QO3A 4Y89A 3MLPA 4ZAKB 1RZJC 1WZMA 4HZLB 3VFWA 3NN8B 3C8KA 2XICA 4U2YA 1WBXB 1UENA 4Y7MA 4FFWD 1XCQB 4LGPB 4RNRA 3MBXL 3FQNA 5EA0H 1MVUB 4PGJA 4CDHA 2E9WA 5IBLD 4PJXF 5DJ0A 3O9WC 3P30H 1UFUA 3CMOL 5I17B 1H3PH 1Q0YH 4Y5XB 4PV9A 2FSEA 4GW1B 4ODSH 2AI0L 3NPSC 4HJJH 1AO7D 3ORJA 4BA8A 4P5TD 5I8OL 4KK6D 1OGTA 4M7KL 2CD0A 2Y7QA 1DUYA 4P4RB 4HXBH 1JV5A 4N5UA 4NN5B 1C5DB 3MCG1 5GS2H 3U4BH 1RIUL 1X5IA 3PWUA 4JM2C 4C58B 3G6DL 2BOCA 4WDIA 3OPZL 4G9DB 4WJ5A 4IMLB 2AERT 1CTNA 1INQA 3VFVB 1KCSL 1DJSA 1IC1A 1G7LA 4GAGH 1IGJB 1FDLH 2UY6A 7FABH 3QI9D 3CFKB 2WWKO 4Y0GA 4ZPTA 3B2VH 5DI8A 2UZYB 4LVNC 2GY7B 3B2UC 3D39E 4K8RL 3STZB 1CIDA 3WIHA 4IRJA 4Q9RL 3UXFA 5DHVB 2AS5M 4FQJH 2CDGA 3A6CL 2VLJE 3NA4A 3IRZA 1E4WL 1YEDA 1KUMA 1LHZA 2C3VB 2F54E 1HSBB 4N9GA 1EO8L 1KJMA 4NUJA 3MRQA 3WUWA 4PRIE 1N7ML 2VO5A 5CGYD 1GXEA 4JLRB 1CFQA 2ATPB 3GHEH 1U8JA 5C08A 1R0AH 5HHXH 1OAKH 4EN3D 1NGZB 3A67H 3W39B 3U30B 4ENED 3HUJA 5MERA 2ADGB 5KAQF 1QFUH 3WUWG 2X9WA 5JIHA 1IM9A 2E7MA 1GGIL 5E2VH 4AL8L 5IBUG 5F71A 2P5WA 5B38B 4Y5VA 1A4JA 2N7AA 2NZ9D 1BVLB 2VLLB 5F9OL 1AKJA 3U7YL 1BMGA 1UA6H 1BWWA 4X6DF 1H3UA 4OZHB 4TSAL 3K3QA 1AD0B 1F4XH 1NMCB 5EOCL 4FFVC 3ZKQD 1F4AA 3NZ8A 4HWEL 2E6JA 1VPOL 2H2PD 4QOKB 3QQ9D 3T3PF 1SMOA 4OT1H 3VW3L 3LKSB 1KB5H 5FV2A 2BSED 4LSUH 4Y1AD 3MRKB 1Z9LA 1FN4B 3PV6A 2VUOA 2GJZA 2BDNL 3WXWL 3LIZL 5J6GB 4NKMA 1CT8B 4JFDB 2E7LC 3HE7B 4XH2A 4FP8L 4TNVK 5F9JA 4PRPD 4R4NC 2RAMA 1BBDH 1V3KA 1EV2E 1BHGA 4BZ2L 5ABDE 1BECA 2VDOL 5A2IH 3VGAB 3T0VA 1EFXA 1TPXC 1ED3A 3GBNL 4HIHA 3VFTB 1NUNB 3D0VB 1HILB 1K2DB 3FOMB 3BJ91 1EUTA 4I48A 1TVHB 3W0WA 3QYCA 4LSTH 3O6MH 2VN4A 3DV4B 5F7EL 1RD6A 4QXGL 4M8QB 4R7NB 3TPUB 4HIXL 4TSCH 1G1YA 5GGSB 3BXNA 4D9LL 3PGDA 1KLUA 5JDJA 4Z8FL 3PJSA 4BKLB 4BZ1H 2ITCA 3X11B 1P4BH 3FQUA 1FVDB 1IZJA 4JRWA 2Z0BA 1TTUA 3U36A 4JE4B 3T4YA 4YNYA 4P59L 5F7KC 4Y5VC 1D6EA 1MHHA 3RRQA 4KQ4L 5HYJB 4HUVB 4ZUVA 1CTOA 3VA2C 1JTTA 3NCJL 3CXDL 3O6KH 4WUUA 3CSGA 1U36A 2ITDA 1F00I 3TV3H 3VJ6A 2DLFL 3MGTA 4NN6B 4NJ9L 4OF8A 2V5SA 4R90H 1V3LA 5ITBL 4EUPH 5C0CB 3KPPB 5C0NC 3QDGA 4PJAA 3N1PC 4NGHL 3CDYA 2VH5H 4HJGA 1U3YA 4KDTC 4OLVH 4XAKE 4HPYH 3MREA 5IG7A 3OL2A 4ALAH 4GKZB 4LKXB 1IGML 2QSQA 4CNIA 5SWSA 3C5JA 3KNBB 3NCYP 1ZVSB 3KYOB 4JKPH 4HIIB 1J8HA 3QIWA 4RISL 3GJFK 4HIEB 4KI5E 2X89D 3QWRA 3WV0A 3ZKND 1HQRB 2A38A 4OAWB 1DBJH 1PDKA 4OCXH 4X7FC 4NO5B 4OD3L 4HCRH 1W72A 3IETB 4XP4L 1IAIH 1SYVA 1NLDH 3KVQA 3FJTA 1EMTH 2HG5B 5D2LE 2NY1B 3S3JA 4IDJL 1XGRA 2GFBA 3IU3B 3WFDH 4HT1H 3HI1A 1D9KD 5TFSH 2WV3A 2EIBA 4NN7B 1RZJL 2Z8WC 4EIZC 4Y4KB 1ZGLA 3ARBD 4E41E 1QLFA 5EUOE 1IKNC 4GMSL 2X2YA 1XCTB 1NGWB 2JB6B 3FL7A 2HH0L 4KK8D 5GRWA 2CIIB 4NKIL 2Z8SA 5IBLC 4ZPVA 3OXSB 3WNKA 2OR9L 1U2HA 1NCDL 1WV7T 2XWBA 3MGOB 4IJ3B 5L7XL 5BJTA 3O6FB 4JPVL 4P2RE 1BD2A 5D1QD 4FQHB 5ISZE 1XGQB 5BS0D 4Z7NE 3UTSD 4O5LL 3V6FA 5D2LF 3TIEA 1VGKA 4HJ0D 2BY1A 3B5HA 3JTSA 4JRYA 2WUCH 3PWJA 5TGBB 3F6IA 2VZ3A 1VACA 5D1ZB 2R0KH 1BQLH 2GYSA 5IROA 2CIKA 1AR1D 1A1NB 1BQUA 2W9DH 2XACC 4KKCC 1FPTL 1GVIA 4POZC 4U6XB 1FNEB 4H20H 1CL7L 2BVEA 2YK1H 5EUOF 4FNLH 1IFHH 4J3WA 3ZT6A 5BZWB 2NPLX 2EO9A 4U6YB 1CE6A 1W0VB 4P9HC 2A9NH 1RIHH 3IFPA 3QRGL 3SQOL 3TIDB 3QSKB 2R39A 2B7DT 3ARFB 1EGJL 4PTTA 1AJ7L 3RZCB 4DVBA 2D7NA 1A9EB 1FH5L 4POYA 3VRJA 2W91A 4RGMC 2WZPD 1GRWA 2XTJB 3W11D 1HHKA 5EO1B 1T66D 4G8GD 5D96C 1P7QD 5J11B 3RVXC 4Z7NF 1CFSA 4XI5D 5DJYA 1DN2A 5CBEB 4Q6IA 4L9LA 1MUJB 1ZANL 3QDJE 2YOCA 3PP3K 3QQ4A 1BFOA 1MFEL 1ZA6B 5SX5K 5IMMA 1RVFL 4NYLA 8FABB 4GG8A 4ENEC 5D7SL 4NCC1 3L5XL 2A6JB 2XA8L 2Z92B 3EOAB 5DQ9A 4QXTB 4V2BA 3MYZA 3U1SH 1TZIB 2NZ9C 4HH9B 4XNUH 3WEXB 5C7XL 4LCYA 4ZNEA 2AGJH 4H8WH 2OZ4L 2QR0A 3HA0A 3T2PA 3QQ9C 3SE9H 5IROC 1I3RA 4TPRH 2IALA 5JIKA 3SPVB 1MCRA 3PQYA 5J0BA 2BFVH 4WHCA 4OQTA 3QHFL 1AXIB 1YMME 3BQUD 3VXSA 1KLGB 2VXQH 1E4JA 5I8KL 1LQSR 1NAKL 3CPLB 1DQTA 1UYWH 1QRNA 2WMPA 5HHOE 1NMBH 2Y07L 5LQBH 1YEKL 3HZYB 4PRHD 1XF3B 5D7LA 1EH9A 2UY7A 4P2OA 1SJHB 5K9QI 3B9DA 4UT6L 5AZEH 3BZ4A 4Q6IC 4A2LA 4L9LC 1TJHH 1WIOA 2N7BA 5HD8D 3TVMB 1AXSA 4FXGA 3S6CA 5DJAA 4PS4H 5E56A 5IGXH 4KK5C 4XP6H 1T6VN 5F7DB 3VFMA 3KLAB 5IHZA 3VXQB 3LRGA 1EEZA 2ZP0T 2VWEE 4IOIA 4MNQA 2NR6D 4H0IA 3T8XB 1PYWB 3KDMB 2ED7A 3S98A 3QEQB 1FZOB 3GZKA 4WFED 5BVJB 3IDXL 2H9GB 2Q7YB 2EECA 5JPMB 1KCUH 1F3JA 3O45B 1NLBH 4NQCB 4N90D 3UTTD 3GSNB 4L3EE 1X5KA 3WD5L 2CK2A 1IGTB 4MCYA 3EOTH 1W8NA 3SDAD 3T0EA 5D7IA 3JWOL 3VWKA 1S7TA 2Y9RT 3RFZC 2RFXB 4NC2B 1EIBA 1T3FB 1KOAA 1CDUA 5CKGA 1LK3H 1AGEA 2Z31A 4D0DA 2AK1H 4DKEH 1MCLA 3CUPB 4F3FA 2PYEA 4PUBH 4FQXD 4TUJB 1M7DA 5AAWA 4S1QL 5D72H 1FNHA 1CS6A 4JANB 3U7AA 5GZND 4G42A 1I85A 4MA8H 3SDDB 3GB7A 3FONB 2V17L 4PJDE 1ROWA 5D7KE 1BGXL 1S7UA 2VR5A 1XEDA 4M43H 3MRGA 1RJYA 2ZCHL 4PG9A 3QUMA 3HC3H 3QXWA 1JUFB 1FL6B 3V79C 2O5YH 1N6UA 3BYYA 1IC7H 3BPOB 4TUKH 1OP3K 1G9NC 1MAJA 1KCRL 3BKML 4P3WA 3N1MC 4LOUD 3STLA 3QFJA 2K9UA 3DSFH 2VXVL 3O6LL 4G43B 2EIZB 1Z5LA 2EDXA 1GCFA 4PGEA 2DD8H 3RL1B 4G9FE 1D5BA 3W9DB 1G0XA 3UZEA 4M7LT 1ND0B 2NY4B 5DS8A 3FO0H 1WIPA 1QP1A 4Y19A 2HFFB 1U95B 2IF7A 3LKNB 3RIFK 3T0EC 4PJ9A 3VWKC 3RGHA 1LD9A 1OQXA 1CD9B 1ZOXA 2VDLH 5D8JH 5JHLL 4NM8H 1GZPB 5CEZH 2ZSWA 3N1FC 1S3KH 4HJ0C 2A6KB 2A9MH 4WFFD 3T2OA 1MCIA 2WUBH 1XFPA 4HWBH 5KG9B 2P46B 3JSSA 1HCVA 1AR1C 2XY1A 2KH2B 4JY6B 3QB7C 2FDBP 2YMXL 4J8RA 3L7EA 1J87A 1D5IH 4YFLI 1CLOH 1ZKAA 5IIEA 1JPFA 3MLYH 4P9HL 5T5NG 2Q76A 4GAJL 3L3DA 3S88L 3MJ9A 4OTXL 1UKTA 1FFPB 2X70B 1VERA 2NY5H 4PJIE 1A6UL 1YDPA 1G9ML 3VD3A 1JHKL 2BY0A 2AQ3A 2B0SH 2YXMA 5JR1H 4WI5A 1T66C 2I26N 1UACL 5H94A 1CE1H 4WHDA 1RFDH 1IT9L 3OHXB 4XI5C 2DLIA 2EDRA 2XN9E 3PL6A 4XWOD 2MHAA 5IB5B 3SDCB 1OOAA 5E6IA 4R2GB 5DJCA 1R24B 2PUQT 4S0TD 5HHPA 5L2KB 2NY6D 1A6PA 1IQWL 3RZWA 4PJXB 1JNHA 1INEH 3BT2H 2OTUA 1BLNA 5FB8B 3DTXA 1ZT4A 4WFGD 5TDPB 2R0ZH 3KR3L 1U8NA 4LF3B 1NC4B 3FT4A 3HLAA 3RUGB 1HINL 1I9JL 3SE8L 4DUXA 5KVMC 1UXWA 5TH2A 1S7XA 4FRWA 5C3LD 3TCLA 3RQ3A 3O3AB 5IVXA 3F7YB 1X5GA 3BP7B 5BQ7B 2IMMA 4GG6B 2ATKB 5JO5A 4U1LB 3GSWA 5IOPB 3MOQA 4GKNA 5HY9B 4G7VH 3B9AA 4J3OC 3FO2B 2ED8A 2V9TA 1BVKA 4GBXB 4UNUA 1RK0B 2R2BA 3L3JA 4KU1A 3BO8A 3D48R 1WICA 2F5BL 5IM7B 4PG2A 3AU1A 1DQDL 4HWUA 3QEHA 1WAAA 4FQQA 4XVTL 3O41A 5K59E 2CUMA 3VMNA 1HNGA 3GNML 4WY7H 4JM4H 2EDOA 2XI9A 5I15L 4EDWH 3K2UL 3IDMB 1I4FA 4R9HA 3QDMD 5F21B 4GH7B 4LLWB 5E6IC 4F33B 5FA4B 4J3SA 5HD8C 4H25B 4X9BA 2AJYL 5I1DA 2YS4A 1BM3H 1KIPB 1T7XA 2HP4A 5I74B 1WLHA 1Z9MA 1RJZA 4FQLL 2HA1A 1BJ1H 5LWYL 3WCYA 1DQQB 3PABA 3PWPE 4F37F 3LKOA 1ZLVH 3LV3A 4C57C 2AXFA 5BXFB 4PLOB 4OM1L 5EG6C 4GW4A 2X4TA 1YEFL 3D25A 1M71B 4JAMA 2A0LC 1I8MA 5FUCC 2DI7A 3H3PH 3D39B 4PYHA 2RCSH 3RKPA 3SKNA 5DMJB 5K59F 3BH9B 2GTWB 5LGKA 2I9LB 3SDAC 3WXVH 3ZKXC 1FZKA 4QHUA 3I2CH 5DUBA 2VLJB 1MI5E 2F54B 4X9FA 2HRPL 1IQDA 5HYEA 4L1HA 1J0JA 1OGAA 2EDYA 5EO9B 2D03L 1A7NL 4PRIB 1BFVL 1F6AB 1G7PA 3DX9A 4YBLC 3WFBH 1ZT7A 3H7BA 3WO4C 4EKXA 5J1SC 2YPVL 4U6VL 5DMGD 1XZ0A 1KJ2B 1LEKB 5ETUB 4P3DA 4X5WB 2DQIH 4S0SD 1U3JA 2WLZA 3FB6A 5GZNC 5DA4A 4ZTPL 5CWSA 3QHTC 1ONQA 3EOYG 3HPJB 3DVGA 4QTHA 3HAEA 3AS2A 2BP3A 4MWFA 1KPRA 1UEYA 3ARED 2YA2A 1HEZA 4EXKA 3ZKMC 4QHMB 2AEQL 3NFNA 3WHE1 1X5LA 2UVFA 4J3VA 1G9NL 2A77L 4MZ2A 4MNHB 3KPOB 4Y8AA 1XGYH 5F1NB 1ZHBB 5IW6B 3MC0A 5GRVL 4MX7A 3EYQD 2FHBA 5HGBA 1T1ZB 2X1OA 2IG2H 5KN5B 3K1DA 2H26B 5EOCJ 1I1AD 4DGIH 3BW9A 1K5NB 2VLRE 3L95A 5IK3B 4PB9L 3IT8D 1WVZA 1JRHI 4TQEL 4Z7VE 1LO2L 3EO1A 2B1HL 3M07A 2DWDA 3L3KB 3LZFL 4EDXA 5IV2A 1FCGA 5ADPH 5IB1A 3QNYA 2ZUQC 4HS3B 4LCIL 4XVSH 2VDMH 4H88H 1R5IB 2AJ3A 1FLRL 3LEYH 2HVKB 3OV6A 2GJJA 3BDXA 4GOSA 2ZOKB 4FZEL 3S5LB 5CUSH 3GMOA 4OCWL 3MRDB 3CK0H 5DFVC 1NUGA 4JKMA 3ZL4H 2DM7A 3BD5A 3EBAA 3WIIL 4LASL 4D3CL 4U1JB 1YECH 5CS7A 3H9HB 2FD6H 1OTUD 3AY4A 5E2WL 1NFDA 2AV7A 4XP5L 2J88L 4Z7VF 3MTRA 4GJTB 5EWIL 2QJDA 5L6YL 3QWQB 2HJKA 2OCFD 4GXUM 5ILTL 4HX1B 5EZIL 4PGDB 4ODTH 3RWDB 4LLUB 1KIUA 2EDFA 1RHHB 1FNSL 1GOFA 4FZ8L 5C07E 3VGFA 5GS0H 1UT9A 4QCIA 3K46A 3HMWH 4XWOC 1G7QA 4X6BB 4I13B 4L4TD 1OM3H 3P4MA 1X5YA 2QHRL 4OSUL 3LKRA 3VDCA 1JRHL 1MAKA 2NY6C 4G3YL 1KPVB 1MREL 3KWWB 1ETZA 3KPSE 1PG7H 3EFDH 1FSKC 5H2BB 2CKNA 5JUEH 3VXMD 4C56A 3DRTA 2LVCA 3BEVB 1T7ZA 3S34L 2BOBA 5EBMB 4YIQB 5FKAB 1E0OB 2BRRH 4LU5H 4LLYB 1N3NA 1I1YA 5D2LB 3PWNB 3RU8H 2AJUH 3DLQR 5H37G 5EIQA 4XCFL 3CH1A 5T1DH 5HGAA 2X1PA 2XKSA 4ODUB 3FFCA 2EICA 5TJWK 4UV4L 3NFSL 4ZS6D 1G0YR 3ROLA 3W2DH 4APQA 2PCPB 4E41B 5EUOB 5E00B 4YHZL 3MRNA 4F58L 4JM2F 3L3OB 5DYOA 4CJ1A 2PTTA 1U8PA 3C6LA 2WWMD 3MUGB 4V1DA 1GSMA 1ZHNB 4M4PA 3SCMA 4JO1H 2LQRA 2BHZA 4L4VE 3AC0A 5F1OB 4P2RB 1GJIA 2P24A 5I76B 1MWAH 5FUZL 5ISZB 1MFAH 1N2RA 4NQDB 4OIAA 3TZVA 5GGTL 3T08A 1FGNH 1T22A 5JXED 1FZJA 2F19H 2VC2H 4NZJA 3ME0A 2ERJB 1DQMH 2C3HA 4PJ8A 2BMKB 5F9AC 5GHWH 5E94B 4UT9H 5DK3A 5I1IL 3TPKA 4KMQA 1U0QA 4M5ZL 3DX6A 3OKKB 2HJFA 3C87A 1KJ3L 1MY5A 4QRRD 4JO4L 1JL8A 2GITA 4Z78A 4P4KA 1NH6A 3MNZB 4BYHA 4RQQB 2EEDA 3GKWH 4HPOL 5ADOL 3F65A 1MNUL 3U46A 4G6AC 4HKBA 1AGDA 1I9EA 3ALPA 4DQOL 2XZQL 3JV6A 1BJMA 1GPOL 3OKMA 4XMLL 4PRBB 1URLA 4M3KB 4KAQH 4XCEB 3CD4A 4X6CE 3KLHD 4APQC 2VNCA 1RJLA 4GMTH 2F53A 3QDJB 2EC9T 3U0TB 3LSOB 5KSBA 2P5WE 1J05B 3PHQA 5EOQH 5GIRA 4LNRB 1KTLA 1FP5A 3ULSA 2HJLB 5JHDD 5CJQH 1QQDA 4JO2L 3IJSA 1ZHLB 3FQRA 1QSED 2A6DB 2YUXA 5T3XH 1NDGA 3ROOB 2DMCA 1RUQL 1MFBH 3HR5A 5BO1H 3GI8L 4LKCA 4PJ8C 1JGVL 5CSGA 5AYQA 2D7TH 3QUYD 5CJBA 4LHUA 2P8MB 2AJZA 2V5MA 1A3QA 2IQ9H 3RI5K 6FABH 5EPMA 4BELD 2F8VA 3ZDXF 3WNPA 1QKZH 1YY9D 3EYQC 4P4KC 3HUJF 3S37H 1YMMB 1CDYA 1I1AC 4WI7A 4FG6D 4LHUG 4N1HB 2IPTH 3FFDB 4ELKA 2KQMA 3HI5H 3WUZA 4KKLC 4FABL 5HHOB 5IB4B 1P7KA 3KPMB 4YDVB 4DZ8A 2EDJA 1FNGB 2R15A 5E8DL 2A6IA 1RMFL 3NAAH 1LEGB 1MRCL 2V5YA 4YPJA 4Z95H 5F1SA 1G7IB 1PZUB 3DOSA 3MXVH 4RMVA 1C08B 5GGUB 4JFXA 4OIIH 3GMNB 3RWEB 2CR6A 4RDQG 2C4FU 2V7HA 4M5YH 1J8KA 1ZGLP 4H1LA 3V95A 2VDRL 3FAWA 5E0QA 1FVCA 1PX3A 3ARYA 1KNOA 2Y6SD 3MV9D 3G6JE 2X42A 3IDIA 3EGSA 1YEEH 2OL3A 3H9SE 3QUXD 5GGSY 4CU7A 1O5DT 3KYMB 1PG7X 4WUUE 1OP9A 4YDKL 4HQQL 4KTYA 4RWYL 2G2RA 1OTUC 5EU6A 1XAUA 4NQVA 1DQJA 5B21A 3PHOA 4H1LG 1KV3A 5KSAD 5J12B 3V8CA 1FC2D 5T33L 3T4AB 4LEOB 3BGMA 4N0YH 3RPKA 4E42A 3MACL 3FT3A 4PJAE 1AO7E 2CGRL 3NTCL 4L3EB 4NZRH 3T0XA 3GRWA 1NBZA 4YC2C 2AXGB 4MD0A 4ZG1A 1TVBA 5JW3H 3NCMA 5JDSA 3GMMA 1I9IH 4L3CA 4X5XB 1RUKH 4BFIB 3D2UD 1FFNA 1DLFL 4JO3L 4L8CA 2DYPB 3PDOB 2CKBL 2HLAA 3KS0J 1TETL 2BNUA 2FBJL 3MZGB 4R7DA 2R2EA 2Y72A 4CMHB 5FDWA 3AS0A 3NGBB 1A3RL 1VHPA 1YEJH 2VN7A 3BH8B 1YEIL 1AGBB 5MEPA 5CJ8A 3WFHA 1MJUH 4L5FH 4PJDB 1FVEB 5DD1H 1XT5A 3C6SB 3GMRA 3OSKA 4PJAF 1T0MA 4O58L 2HKFL 5IVNA 4IMKC 3M8OL 3H9YA 4X8JB 5K9JH 3HS0A 3U7WH 3OAUH 1RZFH 1IGIH 1NAMA 1IAKA 1U8IB 2IH3A 4G9FB 4OV6F 2VXUH 3L5JA 4Q2ZA 3QULB 1JGUL 1YNKH 3T04D 4PJGE 4BUGA 1TQCC 2BZDA 3KPRA 5C0GA 1NQBA 1IM3B 2DQFB 4QXWA 1CXHA 4JRYE 1C12B 5I71B 5GS1B 1HXMB 5BVPH 4QRPD 2DQGL 3TJHD 5DZLA 1EJ6A 3N85H 1LO4L 4PP2B 5JW4N 2DM3A 5I75C 4YEFA 4MA7L 5CHNA 1X5AA 1INDH 5I0DA 4OCRL 5DJ6A 4Y1AE 3FHQA 4JFOB 3RY6A 1QLRA 4Y2DD 3BP6A 3CSYB 5DSCA 2BY2A 3ZT5A 2ZG2A 1FO0H 3FB8A 2FJGB 5ICZA 3GSOB 2F8XC 3O3DB 1OAXL 4M62L 5IHLB 5EU7C 4LCUB 5FO7A 5I16B 4KUCD 4PJGF 3MRHA 3AXLB 3EHBD 4Y16B 3T2QA 4PJIB 4ZD3L 5BOPA 1U58A 3MV8D 3LS5L 3IB4A 5MP6L 4LRNH 4JPKL 1F3DJ 4MLSA 2YSSA 1A14H 4NRZB 2XN9B 4PJBA 2EXYD 1B0RA 4QF1B 5AYUL 2CK0H 3CDGB 4OCSL 3BRDA 2OSLA 1UWEH 3ULVC 3WIHH 4I3RL 3S37X 2E6PA 4QRQB 1IGYB 4OKDA 4MLIA 4JHZA 2Z4QB 4ZSOA 4ZFFB 3B9KB 3P73A 1CFNB 5C8JB 2OM5A 2C4XA 2YWZA 4KGLA 1HH6B 2IGFL 2UZXB 1L9NA 4JDVB 1ULVA 1KN2H 4WIQA 5I30H 2FIRT 4DWHA 2EDBA 4C83B 3CCHA 5E08L 1HIMH 3QUYC 1S9YA 1I8IB 2DMBA 4HK0B 1WFUA 1CDIA 3W9EA 1UVQA 4DN4H 5EOTA 3OKNB 4B53A 1SYSA 1GAFL 1QRNE 4FQCL 3V0VB 4OKVA 2EYSA 4NFDA 4HC1L 4EBQL 4GAFB 4FG6C 4JFEA 5ESAA 3JVGA 2FATL 1JGDB 1CIUA 5H35B 2GCYA 3MRRA 3NCCB 3BX7C 1P6AB 3ARXA 2FEDD 3BSZL 1N64L 1A4KA 2ZG3A 3MRBA 4ZQKB 3BVNA 4M48H 4A6YA 5JW5B 3TH2T 3MLTB 4KI1A 1T0PB 2CPCA 4MA3A 4F15B 5CEXB 1EEYA 1GGYA 2KDGA 3ARDB 3SKJL 3R8QA 4UB0L 4G6ML 4MNQE 4MXWL 2HT2D 1IAIM 3IDNA 4GW5A 4MXVE 4W4NA 1A7BA 1IC4L 2Y6SC 4DKFH 2HAZA 4PJ5A 4GRMB 1X7QA 3PWPB 1H3WM 1RUPH 2DQDL 4JFPB 1SJEA 1MVFA 5KSAC 3T0EE 4HF5L 5BRZA 1FE8L 2BJMH 2OXHA 4KK9D 5BS0E 1GGBL 1IGFH 5I2IA 4RAVB 1G9EA 1G7MA 4XPGL 1S5IH 2RR3A 1MHCB 4HBQA 4YHNB 5ID1B 1WISA 4HKJB 4G80A 3U6RA 2PYEE 2EDEA 5DT1H 4NKQB 4LLVA 3IXTB 1U93B 3LRSB 1MI5B 3HMXA 4HUWB 1HHIA 3PWVA 2EYTA 4DUWA 2R0WH 4KVNL 1MLCA 4K3HA 3MLWL 1LO3H 3LDBC 3G9AB 5EC1A 5C0IB 3SKUD 5E5UB 2WBJA 4LPTA 2XWTB 3MRJA 3TN0B 3VRLF 3I85A 2QQNL 3NIFF 4MAYB 1Q1JL 3EFFA 4XP9H 4BQ8A 5I1LA 1DFBH 3EYUH 1M05B 1S5HA 5CEYA 2ZUTA 3THML 5D7IF 4AENB 3OGCA 2NW3B 4G8GE 4YK4C 4NKDB 1NBQA 5IT2H 1NSNH 4HDIB 3CLFL 4WW2C 4G6JL 4JDTL 5IMLB 1FIEA 3ULUC 3EIFA 4ORGA 3GIZH 3FRPA 3IDYB 4NT6B 4WHTA 1D5MA 3OKOB 5DO2C 3TWCL 1S78C 5HPMA 4XAWL 5FHBL 5DURB 2VLRB 1IJ9A 4N8CH 2MCPH 3TA3B 1JNNH 4U49A 4ZUSB 4CW1B 3U82B 4Z7VB 3BEWA 4O2EB 1AD9A 3F58L 4LP4A 3FRPG 1UZ6E 2QSVA 4NNPH 1LO0L 3QIUB 1JZ7A 1W0WA 2O93L 2ED9A 1JF1B 2NXYB 2X9YA 1WEJL 3BP4A 3K2MC 4ESKA 4UTAH 1EFQA 3IDGB 4KJPD 2H6PA 2QADD 4Y2DC 2BCKA 1G6RA 1AP2B 5FO8A 3FO1A 4OB5L 3PDDA 3EYOB 2OMNA 4NWUH 2BK8A 4OD1H 2NY1D 2DBJA 2QQLH 4MQ7B 3I50L 4OF6A 2BVQB 1JZ8A 2FL5A 1KEGH 3UTZB 3ZKSD 3O9WB 1T5WB 1GGCH 5I1KL 2PW2B 1KG0A 1F97A 4PRHE 3U9UA 2XG4A 2FGWH 3MV7A 2BHYA 1CG9B 2LU4A 3QEGL 5HYSB 1CR9H 3NPSB 1UZ6F 4JFQA 4GKSA 1JGLH 3EAKA 2IANA 3O2WL 4X4ME 5FM5O 1NMAH 4HFUL 5T5NF 2VL5A 5C07B 5E8EB 2QQQA 5C9JB 1MHEA 4WU7B 4D9RD 2DM2A 5EU4B 4L8DA 4ZFOA 2AW2A 4JM2B 1BIIA 3WHXA 4KUZH 4IHOB 4ZFGL 4JY5H 3MCKB 5DQDL 3TO4A 3U9PL 4MHHI 1AC6A 2UZIL 4HS8H 1F90L 3KPSB 4P3CL 5IFAH 3OG4B 4WFEE 3AFLA 3EOBB 4TRPL 2GAZA 4LVNB 5FUCE 5DD0H 2P4AB 3U48A 3KYNA 4N90E 4M6ML 1IC5L 3UTTE 4J7RA 4NDMB 4JFFD 3GHBL 1QO3B 5L8KB 5BMFH 4L9DA 4HK3N 5IEKA 2YC1A 3VFWB 3RBGA 3EDDA 2NTFB 3QPXH 2QSCH 1UCBH 2AABH 2DL9A 4KRPD 2EDDA 2XNAA 1MFNA 2I60L 3CVHA 3FQNB 4UQ3A 1NBYB 4HGWA 1F5WA 3R06A 3ARFD 1HHGA 1T03H 2Y36H 3GUTA 2W65A 5DJ0B 3Q6GL 1KBGL 5KZCB 1CK0H 1UKSA 4Z7WE 1AY1L 4PV9B 1RPQA 1LP9A 2FHCA 4AIXA 4RZCB 1C5BL 1I3UA 4L4VB 8CGTA 2AV1A 2ZUYA 4UBDC 4PB0H 4LCWA 5IVXF 1OGTB 4I5BA 5DGRA 5BV7C 1KJVB 3VCLB 1JPGA 5ALCL 4WHYG 3I6LD 1A7OH 2ZNWA 5GPRA 2WINB 3V4VL 1N4XH 2J5LC 3OJDA 4WDIB 3TO4C 2NW2A 3OX8A 4FQPA 1UXSB 2HT2C 2L7UA 2R1XA 2CLRA 4KZEL 32C2B 4P2QD 2FO4A 5L9DH 3A0OA 3IYLW 3MLUH 2D0HA 1LWRA 4XXCA 2VDPL 1RHFA 1WAAF 1MIEH 1XF2B 3MGAA 1AIFB 3HG1D 1TPXB 1YUHA 4PJCE 5DVOA 3T65B 2I07B 2YD8A 1UM5H 4KK9C 2XXMB 3PHSA 5GGVY 5HBBA 1OW0A 1SEQL 4EI5B 1DBKH 1MQKH 1MCOH 4NUJB 2VAAA 4DVRH 5AAMA 3GIVA 4LVHC 5D1QA 5GRJH 4WFFE 4X6CB 5GS2D 1K4CB 5K9OA 3MROA 1FZMB 4MXQD 2OTPA 4PJ7A 3S8WA 4CADA 3H2WA 5ALBL 2P5WB 2P44B 5LGJB 3NIGE 5K9KA 5DRZB 4AIZB 2VZUA 3V5KA 1RU9H 1PQZA 5I66A 3CDCA 3TVMD 2JJVA 2FGZA 3VRIA 2IEPA 1WSST 5ESQA 3ZE2E 4PJCF 4YUEL 5IBTH 1NCUA 3TT1L 4U3CA 3VE0B 4GSDL 3MUJA 1Y0LB 3ARWA 4NSKA 2X40A 2GJZB 4MAUH 3GMPA 4N8PA 2VIRA 4DZBA 4XC3H 5DWUH 4LCCC 5T5FL 2PW1B 3VFGH 1G84A 3FMGH 3QUMH 3GO1H 5TQ0L 5T1MB 3T0DA 2HT4D 4HIHB 4WFGE 5FHAL 4GRWE 4OFKA 1VFOA 5CCKL 3DX7A 4F7TA 3HCVB 3P0VL 1F2XK 3V4UH 5IHUL 2CRZA 3UJIH 3PJSB 1PAMA 4WI8A 1YJDC 3ELAT 2FECI 1A1MA 4XCCH 3SGJC 5J6HB 3FQUB 4OBSA 2XZCH 2ADFH 3SDDD 2UYLA 4YNYB 3VWJA 4U05A 3P9WB 4XVJH 1F11B 4F57L 1HHHB 4WTZG 1CGXA 1EVUA 2EE2A 1DVFD 1A6VL 3H9SB 3WN5A 3BQUA 1AHWC 3D69A 4WUKH 4WUUB 3L1OH 3U0PB 1G7HB 3WHE0 1PKQA 1CGWA 4DGYL 4JKKA 4GRWF 5J3HD 3K74B 3QDME 4WCYH 2GI7A 4PJAB 1MRFL 4MGXA 2FWOB 3P4OA 1D5XA 1I8KB 4LIQE 5JXAH 25C8L 3B3IB 4HHAA 4UV7L 4X83A 1CXKA 4PJBB 1XR9A 3RA7H 4P5MA 3RVUD 5I8CB 5E99H 3UX9B 1JMXA 4RGOL 3QUZD 2D3VA 3LMJL 3TYFA 3P4NB 4TUOA 2R69L 5LCVL 4UNTA 4WFHD 3MMEA 4M3JA 1XR8A 4JRXA 2GSIA 1IMHC 3E2HC 1DUZA 1XGRB 4NQSB 1JNLL 1O0VA 1R3KB 4Y4HA 1V7NL 4FTVD 3KPNA 1M7IB 1S9VB 2FECL 4PR5A 1YZZA 3HI1B 4RGMB 4X8XA 3FFCE 2H2SD 3HFML 4L8SC 5D96B 3VD7A 3F7PC 1MCKA 2YD2A 4KRPC 5CAYB 4IDLA 4KDWA 3VWJC 3VXTA 1X44A 4QWWD 5CZVH 4LAQL 4LEXH 2BSSA 4N0FB 1PSKL 4V1DE 3ZHKA 2CJUH 4NQUA 5JLZA 3BD4A 1MOEA 2M1KA 2XWBB 1KCKA 3WKML 5ENWA 1BD2B 1NC2A 3S36H 3VFPA 3ARGA 2DM4A 4DN3H 5MEOB 4OZFG 4HS6A 5J13C 4PJGB 2DJUA 5TQ2H 1YPZE 1UJTA 1L0XA 2L7JA 4R2GD 1FRGL 3WE6B 4WNQB 1VGKB 2D31A 3C5ZD 4XGZA 2R0LL 3JTSB 4JRYB 4H26A 4HMCA 1ZEAH 4NZTL 15C8L 2OR8A 5AUMA 2W60A 4FFYH 3HZKB 1TXKA 5F7YC 4R96A 4HFWB 5ICYA 5IW3A 4Y1AB 1NGXA 1HSAA 4LP5A 5DJ2B 1TQBC 3DRQA 3C60A 5EC2B 1E27B 4MB3A 4YHOL 1F13A 3KJ6L 3IFPB 3HE6D 1MEXH 5DJDA 1OTSD 2FX9L 2IBBA 1MCJA 5SWZA 2HMID 4NO3B 4UINL 2HFGL 4HXAH 4PTTB 4Y4HC 4DVBB 3VRJB 3QA3B 4R0LA 4X4ZA 2NTSP 3V5HB 4HUUB 2X4PA 2XQYG 4FS0A 4G8FB 4ZYKB 3I02B 3NABL 4B50A 4U1MA 3HC4H 2F58H 1CFBA 4L9LB 3IJHA 1JWMA 1QSFA 3QNZB 4K2UL 5IB3A 1BBJA 5DZNA 5I1CH 5EORH 2BXZA 5FKPB 4K3DL 5EN2A 1KB5A 1Z3GL 3LHPL 5SV4A 5IMMB 3X12A 1FLTX 5FF6B 4XBPA 3KLSA 2ORBH 3EYVA 4ZODA 5DQ9B 3QIBA 5T1LD 4EVNB 5JQ6H 1WFNA 1WQVT 4ONFH 4RGNC 4HW6A 1OSZB 4LCYB 4JJ5B 4S11A 4AG4L 1ITCA 5JW4Q 1ES0A 1MLBB 5DK2A 4U0QB 4XPFH 4HBCL 3BUTA 1DE4B 3E6HB 4GQ9L 5LXGL 4Q9QH 1P4IH 2RJMA 1VFBB 1XGPA 4L4TE 2YRLA 3C60C 3U4EA 5KSBF 2ZJSL 3T1FB 4UOW1 4Z7QE 2EE9A 4J6RL 3UC0L 1QRNB 1A5FH 1MCPH 4QT5B 3CFDA 2X4OA 4JB9H 1KT2A 3VXME 4R0LC 4P46D 4R8WL 1IGCH 2R56L 4K9EH 5FO9B 1N6VA 2WBWB 3QHZH 1HE7A 1DBBL 2JJWA 3BZ4B 3ISWA 4LSRL 2FB4L 4RIRB 1AXSB 2P45B 1MCBA 5IQ7L 3CC5A 4EUPA 1P84J 1D9KB 4R26L 1KULA 3L6FA 3V6OA 1YJDL 3QCTH 5IHZB 1I7RB 4IOIB 4MNQB 4X6EA 4EOWH 4PGZA 3QIBC 1Q94B 1VADA 2AP2A 4PLJC 4BH8A 1MCNA 3G6AA 4QYOB 3EJJX 3UEZA 1U8QB 4W6YB 1A7RH 1OWWA 5EU6E 2XRAL 1HDMB 4Z5RA 1T1WA 1DVFC 1WCQA 4FQ1H 3TBSB 4OLWH 3GSRA 4X4XA 4XMKH 4RCAA 4M1DH 3V0WL 1OSPH 5F89A 3T0EB 1BJ8A 3LN4A 5BS0B 4PRNB 5FA3A 1PG7W 4I18A 1K9TA 4IIQA 4L29A 4TTDD 1QA9A 3MBXH 4F3FB 4OLYH 4JZOB 2PYEB 2QKIA 1KELL 2DQEL 5E4IA 3IFOB 3CMOH 5FXCH 3G08A 1NCWL 1GZQB 3O8XD 3LPFA 1YYLH 3VFNA 3QXDA 3QUZC 5EZOH 3JTTA 4NQXB 2YBRA 5EU7E 3MLXL 1UWXK 4N1EA 3P9MA 1BFTA 1PVHA 1X5FA 5ELIA 3S36X 3IVKA 1I1CA 1RJYB 1J5OH 4IEFB 4M7KH 1UKQA 5D70L 1YMHA 5CBAB 1E6JL 4YDJB 4ZUWB 2JCCA 1DN0A 2H2SC 4S1SL 1YN7A 4ONHB 1P7QB 3SE3A 2V2TB 2YXFA 4PGEB 1TZHB 4HIJB 4OLXH 1KCSH 4QWWC 3HB3D 4WW1A 4RMWA 4UU9A 3CAFA 3HZVA 1WC7A 3ULVE 1CICD 1U8OB 4CVZA 1UWGL 3RDTA 4R97B 4F7PB 2N56A 3KPRE 1JHLL 4S1RL 5F93C 2ARJA 2DWEA 1BAFL 5TDNB 5JHDE 1F8TL 4TTGA 2A73A 3A6CH 4K3EH 4ODHL 4KY1H 5DC9B 1E4WH 4NHUB 1QSEE 3SKOA 2F74B 2X44D 2HLFC 4EEEA 1RUAL 3C5ZC 4PGCA 4KTDH 1NGYA 1V5JA 1DEDA 2MNUA 5I8EA 1JFQH 1PEWA 1VKXB 4QXUH 1KXTB 3SDXE 5E9DD 5HHQB 1OAZH 4R4FH 4HG4K 5I1EL 3U2SB 2NQCA 3L7EB 4CJ0A 4Q9CA 2J8UE 5E4EC 2DQTL 5EA0L 1KIQB 2W9EH 5DUMH 2GK0A 3F8UB 4YE4H 3BAEH 3QO1A 1F4YL 1JZ5A 4DFHA 4JN2A 3HE6C 4M7LH 3ULVF 3P30L 2Q76B 1UJ3A 3L3DB 3FQTB 4TSAH 2VABA 1H3PL 2HMIC 4NBXB 2RIKA 1YDPB 1DBML 1VESA 4ODSL 5DUPH 4PRHB 5DJXB 3VW3H 5L2JA 3BIAX 5H94B 3SE3C 1JN6A 2EDHA 4HJJL 3TEUA 4AQOA 3HZMB 4M7JH 3F7VA 2MHAB 2BDNH 5E6IB 5CJXA 1EBAA 4AMKH 4XTRC 4HXBL 2W0PA 2YKLH 1Z2KA 2EE6A 5DJ8A 5HHPB 4QTIH 5AEAA 3QDAA 4BZ2H 2VDKH 2VDOH 1QUNA 3NPZB 3MV9E 3CFEA 2V9QA 5GZOD 2J8UF 4GAGL 4PJHE 1FDLL 4NQDD 3IKCA 3B2VL 3LY6A 3FT4B 3HLAB 3VXUD 1S7QA 1EEQA 1UXWB 1MCEA 4HIXH 4D9LH 3UTTB 3WJLC 3I84A 4DEPC 2BVYA 4FQJL 1J7VR 4HKZA 2X4NB 1EEUA 4OD2A 3SDAB 3O2DA 1MH5A 1Q9WA 4GKNB 5DFWH 4OZFB 4U1SA 5C86A 4PJBF 2YA1A 3IDJA 4P59H 3GHEL 2GQHA 3FO9B 4YBLB 1OAKL 3OJMB 3A67L 5E1AA 4GRLA 4KZDH 1MJJA 4JFEE 1UJ3C 5EIVA 3PWLA 2QLVB 4OFIA 1N59A 4FQXB 3AU1B 5C0JB 2E9JA 3QEHB 1YC8A 4P46C 1RULH 4JZNA 4NJ9H 4JVPA 4C54A 3WFEH 4ZTOL 1KFAL 4Z7WB 4PJHF 5ITBH 1BREA 3QRFM 1BOGB 3F12A 4NFBA 2XG5A 1F4XL 4H8WC 2EDLA 1ZXQA 5GJTL 5KSUB 1IGMH 4NQEA 3MBEA 1NCAH 1R5WB 4LSUL 2BNRD 4Z9KB 1KACB 3BPCB 4JFZH 1JYVA 3PABB 4AK1A 4PYGA 3LKOB 2AK4A 4XP4H 2AXFB 4BSVA 3L9RB 2JIXD 5AD0A 4JAMB 2VQ1A 5ESVB 3IFLH 1NFKA 3NACL 1B0GA 2K7QA 2IQAA 2X4SA 2IAMD 1IAII 4H1LH 1FZKB 4PJCB 4QHUB 4QRPE 3ILQD 5EFIB 1IQDB 2ZUQB 3SJVA 1YMMD 4TSCL 2OL3H 1G7PB 4TTDC 1KYOK 2P7TB 4NKIH 4GRLC 4OI8A 1PD6A 1P4BL 4WV1C 1AH1A 2D9QB 3ULUF 2FYYB 2R2HB 3O8XC 2Y4SA 5GJSL 4U3XA 4JPVH 3FB6B 2DIBA 3B5TA 1XIWD 3GRWH 5CWSB 1IAMA 1ONQB 4FFZH 4Q6YA 3V5DA 1MJ7H 1IILE 1M7XA 5F3BA 4MWFB 1KPRB 1R5VB 4AJ0A 3TV3L 5JW4M 1HEZB 1KPUA 1K3ZA 3G5XA 3NFNB 4R90L 3E1F1 1T0NB 3MV8E 4BK4A 4W70A 2MQ3A 1FPTH 3UTOA 3GJFA 4M9OA 5DD6B 4HUKB 4IRSA 3R4DA 2XFXA 4KMLB 3DMMA 1L4IA 2ID5A 4MNGA 4HPYL 4UIKH 2Q3AA 4YWGH 2CKBB 3L95B 3QRGH 1RSFA 4WWKA 1XGUA 1CICC 2NY6B 1LE9A 3NOIA 1DBJL 1AJ7H 4HCRL 4FMFA 1FH5H 1FSKB 1IAIL 2JTDA 2DWDB 1QHOA 1EMTL 4WU5A 4GRWB 1P5UA 2IJ0C 1UQSA 3TYGH 3QNYB 3O4LD 1I9RL 3AMLA 3JBG7 2DYPD 2YPLD 1A8JH 4UQ2B 4HT1L 5TFSL 4MJIA 5F7WC 3GSVA 5D7SH 4RA0C 2XA8H 4MJ4A 5E24E 1NEZA 3LCYA 4OZIE 2CXGA 3SE4A 3IF1A 1YQVL 5E7BA 1Q9OA 3G04A 3VH8A 3OGOE 1HWGB 5CINH 3Q6FB 3IRPX 1Y6MR 1KTDA 4AM0B 3MRCB 3F62A 4IRSC 4OLUH 2P5EA 5E5MA 4NCDA 5DC4B 3V7AE 3VH8G 3QDMB 2EYRA 3UBXA 1G7QB 2WUCL 1SHMA 3FOLA 3C9NB 2R0KL 1L9MA 1BQLL 2A83B 1G6VK 1NAKH 1UB5B 4WWKC 5INCA 1S7WA 1HYSD 1T6WA 1U3HA 4FNLL 3SBWC 4O9HH 5DRXA 2FJFA 5JPNB 4OZIF 3Q1SH 2AEWA 4EI6B 2FR4A 4XRCB 4X7SH 4X80H 4P23A 1N3NB 1I1YB 4LHJB 3RWHA 2NY5C 5CMAA 4UTBL 1XF4B 3N0PB 1N26A 4P5KB 3ZHDA 3WS3A 1R6VA 1R3LA 3PF2A 1CF8H 3RTQA 2NY0D 3OAZK 3FFCB 4P57A 3QAZC 1OAYL 3ROLB 3CJJA 5DF0A 3GK8H 3ARVA 2DL2A 1A1OA 2GT9B 5T1KD 3ZDZE 3SE4C 2DN7A 2G9HA 4L1DA 5DYOB 3DUUB 1U8PB 4K7PH 4V1DB 5EBWA 3DO3A 1HXYB 4Y16D 3FQWA 5C0BA 1JPSL 2KBGA 3LPGA 4U6HB 4AH2A 5D5ME 3D3VA 1A6TA 3JWOH 1ZVHA 4XNUL 5GSVA 3QXAB 4QO1A 2ZOLA 4YHLH 3OB8A 1LEIB 4OGAD 1XGTA 2F5AL 1YPZB 1FZJB 4H8WL 4KH2A 1P9MA 4PJ8B 3GSQB 3QJFA 4WO4A 5CIPB 5HDBE 1RIVH 2ICWA 4E0RA 2DKUA 2X10A 2CMRL 1ACZA 4S1QH 2BFVL 1KENH 3JWDH 2HJFB 1PFCA 1UB6A 1DLHA 3ZDZF 2VXQL 2GITB 3GSUA 4Z78B 2VLKA 5ID0B 4A6YH 2IWGA 1I1AB 1UYWL 1LP9F 2ZCKH 3U46B 1NMBL 1HI6A 5LQBL 2WP3O 3OKMB 4MMZC 3TBTB 1OARL 2WWKT 1QLEH 5K33A 3MLRH 3RTQC 3RWIA 2IAMC 2VUYA 5AZEL 2BSRA 3O6LH 2VXVH 4UDTA 3HNVL 1ZWIB 1J1PL 2AXJA 2PETA 1KSRA 4BQ6A 1P2CB 5DQJA 3NIDE 5IGXL 4XP6L 3IGAA 5F8RC 1L7IL 3OR6A 1A22B 3BP5B 3DXAA 3IDUA 3HTLX 3PHQB 3KXFA 4LPVA 5GIRB 3VFSA 1ZGLM 4P9MH 4N0UA 2PXYA 2R23A 4HMDA 4JKWA 1XIWC 2BNQA 3OF6D 1CBVL 1OAQH 5IJVB 5JHLH 3ARDD 3P77B 4B5EA 3FQRB 5I73C 3WIFA 1KCUL 3GJEA 3HMXH 4LLMB 3HR5B 1P9MC 3VDBA 4LKCB 4WO4C 2MFNA 5L88H 2XIDA 3BJLA 4OLEA 4RX4D 5JNYB 4ZAKA 4HZLA 3P9LB 4O2FA 3RVTD 3NN8A 4X9HA 1WBXA 2OP4L 4YC2B 1NJ9B 3NFPA 3V4PL 1RZIB 3PWPD 1LK3L 5HHNB 4DKEL 3KPQB 4FN0A 2VISB 4D9RE 2ESVD 4K07A 1MVUA 4L4TB 3NIDF 4PUBL 4GAJH 4N8VG 1NBVH 4NKOB 5FCUL 5BZDA 2FH8A 2IPUK 2NYYC 5I17A 4YPGB 2UV3A 4Y5XA 2O61B 4PJEA 1I3VA 1G9MH 2R1YA 4GW1A 4Z0XB 3VXMB 4DZ8B 1WK0A 3C08L 3D87B 5T3XD 1YYML 2P43B 5J9PB 1S7RB 4PLNC 4Y4FD 2P8LB 4M43L 5HDQH 1IEHA 4JFFE 4NIKB 4OF3A 4PLKC 4RWHA 4U1IB 2Y1VA 3HC3L 4P4RA 5DLMH 3G5ZA 4JPIB 4JFXB 1EAJA 4TUKL 3INUL 1SVCP 2ZUXA 3OTTA 5I1GL 1QYGH 3DSFL 5KSVA 2YD3A 4G9DA 3TN0D 4IMLA 1IBGH 4ZXBA 2PXYC 2DD8L 4ETQB 3VFVA 1BPVA 3IDIB 3EGSB 4X99B 1IGJA 5I19H 1QFOA 3CFKA 2LTQC 4F9LA 3I6GB 3X3GL 1HINH 2G2RB 1AXTH 5EU6B 1QPPA 1MAMH 3A6OA 5F7LB 3RVVD 3STZA 5DHVA 4ZAKC 1TQCB 2G60L 4U1GB 2C3VA 5HHVH 1G6RH 1HSBA 1NBZB 5D8JL 4J1UA 4Z7OE 4P99A 1WT5C 4J23A 4LSPH 3IU4H 2R4RL 2X41A 4JLRA 4NUGH 4GO6B 4IOFD 4U1HB 5FYJH 2ATPA 4HWBL 2WUBL 4PD4J 3T0WA 5DURD 2GSGA 5I75B 3W39A 2VLRD 4RBPK 2AQ2A 1ZLUK 3TA3D 1TITA 2YD5A 4A2MA 3MJ7A 2ADGA 2HLAB 4JZJC 2VL4A 4R7DB 2R2EB 4P2QE 5C0FA 3RIAF 2NY3C 2Y25A 1D5IL 2IPKA 2LE9A 4ONGL 1CLOL 4OQ1A 5C0DB 3GNMH 3P2TA 1BVLA 2VLLA 4O51B 3MLYL 5F6IC 3K2UH 4JR9H 1S8DA 2EC8A 4OZHA 3WFHB 5FDYA 4ISVB 3HG1E 1N5YH 3BGAA 4U31A 3E3QC 4WEBH 4NO0D 1MCWW 2AJYH 4QOKA 3EZ8A 5JR1L 3LKSA 4U1KB 1M4KA 5B38G 3MNWB 2NY0C 5GS0C 1RFDL 1CLZL 3H8NA 4Z7OF 3LRHA 5LWYH 1FN4A 4ZXBC 1CT8A 3BIKB 5E6YA 4JFDA 3HE7A 4I77L 2WAHA 1DCLA 4OFPA 1JYWA 3JV4B 5C3TA 2BRQA 1P4LB 1YEFH 2DI9A 5F9WC 2AJXL 4Q2ZB 1INEL 4NOFA 5DVKA 3KPRB 2V2WB 3VFRB 5J06A 1K2DA 3FOMA 5JHDB 4DAGL 5C07D 3S4SB 1UH2A 2ZUSA 3CVHH 4OGAC 3DV4A 3RGVA 1D5ZA 4R7NA 3TPUA 2D03H 5GGSA 4JM2D 2MTPA 5CZXD 3H9ZA 4BKLA 3X11A 3QUYB 4W81A 3U30C 3OAYH 3KPSD 2MQCA 1IARB 3SDXB 3FB8B 2RB8A 2J6EA 3B2UD 5J8OA 1KGCD 3WDHA 5SWZE 5HYJA 4ZTPH 4XC1H 3RX8A 4KPHH 2J8UB 5FV1L 5D71H 4HUVA 2H41A 2DRUA 5DRNB 1NMCC 3TBYB 5HGDA 2G75B 1ERNA 3MRHB 3LAFA 3BZEB 2Y06L 5F88B 2AEQH 4WY7L 4JM4L 4LSDA 1X4ZA 4FOMA 5C0CA 3C5SA 3KPPA 4MSWB 4HEPG 2Q1EA 1HH9B 5D9SA 3HE7C 3GEWB 3DETD 4GKZA 1B0RB 1BM3L 3HI6L 4LKXA 2UUDK 3KNBA 1ZVSA 3KYOA 2OSLB 3ALXA 1HQRA 4OAWA 3PNWB 5J1TC 4NO5A 5DHYB 1J0IA 3NCBB 2B1HH 1T89C 3LZFH 4P48A 2HG5A 4PJHB 4XP1L 2YN5A 3CU1A 4OCNC 4FQIH 3WFCL 3RGVC 3UO1L 3V6ZB 1FYHB 1ORQA 1XH3A 5TE7H 5KSAB 2Q8AL 4MZ3A 5CSZB 3SGDI 1QFWH 4DCQA 5LAXB 1S9YB 3RVTC 2YEZB 1T5XB 4Y4KA 5FEBA 4YZFE 1UVQB 3Q48A 4XZUB 4C4KO 5EOTB 4XX1E 1XCTA 4PGBB 1NGWA 2B2XH 5AWNH 3WFBL 1Q0XL 2C7UA 2CIIA 2HFEB 3D18B 3GSXA 5DMIH 5IMOB 3VMPA 4NCC2 2EYSB 1BQHB 4LASH 4D3CH 4IRJD 4X7TB 4S1DC 3FCTB 3OXSA 4JFEB 1T7YA 2XTLA 3PGFH 2DQIL 3O6FA 2E3VA 5L6YH 3MRRB 4WFHE 5ILTH 1Q9KB 5E70A 1XGQA 2BVOB 3UPCA 3BVNB 3IFNH 4LVOC 5C08D 1FNSH 4FZ8H 4Y4FC 5HDOA 4FTVE 2VZVA 5EU3A 3C2SA 4ZOCA 5B3JF 2M2DA 1DQLH 2JKXA 4YK4B 5TGBA 3RNQB 4OSUH 1IM9D 5D1ZA 4OUOA 4NNXB 1A1NA 4WW2B 4PRDB 4G3YH 2P5WD 1MREH 3TBVA 5C6TL 1A0QL 1AKJD 4DW2H 1JF5A 5BZWA 1P69B 2NXZD 3DYOA 3GI9L 2C5DC 3RWJB 1W0VA 1ADQA 4KRNA 1P7HL 4DGIL 2X1QA 3TIDA 2B8OT 1SJEB 1Z9OA 1AGCA 3L5IA 3RZCA 2DICA 1DEEA 5I2IB 2B4CL 4M03A 5F72S 2BC4B 4W6XB 3VXRA 5J57B 4Y4KC 4UV4H 5AZ2H 5ADPL 5HI3C 1JMZA 1EK3A 4H88L 4LLVB 4QRPB 4KHTL 3M17A 3SQBA 3LEYL 4IOFC 4YHZH 2EYTB 2DLGA 1C16B 1JWUB 2KL6A 1ZA6A 1A6AB 3TJEH 1EFXD 8FABA 3GM0A 4Y2DB 3CK0L 5EC1B 4YX2L 3FB7B 2BVUA 2A6JA 3RJDA 5FUOH 3W0WD 3LPWA 4OI9A 1T83A 4I0KA 2ZNXA 3MR9B 2QHLA 3MRJB 4M6OL 3ZL4L 1JE6A 1TZIA 3VI4F 3OQ3B 4HH9A 2N1KA 1YECL 4YO0B 5I1LB 3WEXA 5KVGL 4LDEB 2X05A 3UJTH 2DTSA 4JJHA 1S5HB 1JHTB 2V2XB 3EZJB 4N8VB 1BEYL 2UWEA 1GL4B 5D1ZC 4ODTL 4ZO8A 2X7LA 1MJ8H 4FQ2H 3SPVA 2VSDA 3MV8B 5GS0L 4ONOA 4ZDHB 1WZKA 5IMKB 4PBVC 3H9SD 2Z91B 1T04B 1OM3L 4KROD 4WUUD 3OKEB 1D5MB 3UJJL 3MUY1 5IWLA 5CP3H 4QKXB 3ALWA 3CPLA 5IESH 1WZ1H 1FO0A 3RZCC 3LQAL 1OF2A 3TNMA 2FZ3A 3BKJH 3QDGD 2X09A 3QG6B 5JUEL 4Z0BH 4M6NH 5MEQB 1QBML 1P84K 4E9LA 1MCHA 5MI0C 2BRRL 4LU5L 1OP5H 5M95B 4OGZA 5C09A 4DUVA 4OZFH 4YGAB 5SWSD 3RU8L 1R3HA 2AJUL 1J8HD 3QIWD 4KKCD 4POZD 3QWRD 5CZXC 5DMKA 5T1DL 3X13B 1OPGL 1F58H 3DGGA 3KLAA 3VXQA 1ACYH 3H42H 3B83A 3FO1B 3CXHK 2BSTB 4ZUUB 3W2DL 3SHSA 4OCMC 3T8XA 4X6DE 1UH3A 1HN1A 1OCWH 1PYWA 1YY8A 3KDMA 1GH7A 1O7SA 4OZIB 3QEQA 3DROB 5BVJA 5CJ5A 4S2SB 5JPMA 1EO7A 4N1CA 3T3PE 3O45A 1TJGL 4NQCA 1EHAA 2EH8L 4JO1L 5C2BL 3RVXD 3GSNA 4RAHA 5E2JA 1JGVH 3LS4H 2ZSVA 1V7MH 5C0AA 4PTUB 4ODBD 3L5WB 1CDJA 1MF2L 4GKSB 1MWAL 2RFXA 3CSPA 1NGQH 5BV7B 4LGSB 1FGNL 2F19L 3OKDA 1QR4A 3CUPA 1DQML 5IWLC 3P0YH 3DETC 4H5SB 5GHWL 4ZFOB 1VB9A 3WHXB 5TE6H 2BY3A 1BD2D 2J5LB 1K3IA 3TO4B 1EHXA 3JUYA 1S7VB 4YAQB 43CAB 4OCLC 4UDUB 3LKQB 4JANA 4FABH 2R1WB 1UM6H 1MFDH 3PP4L 3DARA 4Q9BA 1KTKE 3FONA 3L3IA 2V5RA 4JRYD 1QBLH 4Q74A 2IADB 4QHLB 1FL3B 5E8DH 3ES6A 4LLQA 3GKWL 1IKFH 35C8H 1XF5B 4YHPB 5GISH 4Z18A 1T7VA 3DI3B 4QGYA 3MJGX 1D6VL 1X6NA 4RAUB 4D8PB 4CRPA 3TBWA 1NDMB 2PYFB 3OKLB 5EH1A 2XNAB 2MKLC 4LVHB 3V8OA 4G43A 2EIZA 2XZAL 4P2CG 1U92B 3RL1A 1VFUA 5TF1L 5FK9B 1HHGB 3GUTB 4NO2A 2R4SH 4JFYA 4HQQH 3R1GH 4RWYH 3ZMRA 4K23H 5HI5C 4IRJC 5HPOA 4NJAH 1T2QL 2PNDA 5EOQL 1U95A 3K8LA 2ZCLH 4OZ4B 5CJQL 2AV1B 5D5MB 3W5NA 4UMGA 5T3XL 1EVTC 1OAUL 4LNVA 1E4KA 4KK5D 1FJ1B 2A6KA 2EDWA 4NQEE 2ZKHH 3LEXA 5D2NE 5BO1L 3ZYJA 3IJYB 2QQKH 1D3CA 5KG9A 2JB5H 2D7TL 1DLFH 4JO3H 3T1WA 4O4YH 5J56B 3OJDB 2AK4E 2R1XB 5FGCE 1VFAB 4JY6A 6FABL 1QKZL 1GYAA 2FO4B 2NXZC 4EJ1C 2RQ8A 1A3RH 4LCCB 3MRPA 1PZ5A 4G7YL 5DRWB 3RL2B 1J1XL 1FQ9C 3HI5L 5IJKA 2WANA 2BHUA 1FFPA 2X70A 3S3PA 1J0HA 1SBSL 3PQYD 3I3EA 3SJVE 4UILL 12E8H 3MRIB 4NRYB 4F7CB 3GIVB 1B4JH 4OLZH 5A2JH 4JQVA 3OHXA 3VFMB 3NAAL 1H15B 4TNVF 5EZLB 3SDCA 1MCFA 1QRND 1R24A 1I1FB 4QY8A 4XWGL 2XA3A 2J4WL 4OIIL 5E9DE 3MO1B 2PR4H 4PJFA 5IKCA 4M5YL 5L2KA 3MROB 5ITFA 1CL7I 1II4E 5D7LD 3EKCA 3HC0B 1ZLWK 2QADB 1T80A 4P2OD 2EC9U 2NY2D 3O3EB 2ZG1A 5K9KB 1YEEL 5FB8A 1FYTA 3JZ7A 5TDPA 5I66B 1OL0A 4LF3A 1NC4A 3RUGA 1AHWB 1E4KC 4M1GH 3DGCR 5KVFL 2VJXA 1IEBB 2OBGA 3O3AA 3F7YA 4N0YL 4MA7H 4MNQD 4GG6A 2ATKA 4OCRH 4U1LA 3OXRB 5E1HB 5IOPA 4ODXB 3O2VH 5HY9A 2PO6A 3FO2A 4LSVH 5FECB 2VTFA 4GBXA 3DHMA 3O0RH 5JW3L 4DGVL 1I9IL 1RK0A 1RUKL 1OAXH 4KROC 1AI1H 4ORZC 4JN1H 3O11B 4XPAH 2LABA 3T0ED 3S97C 5IM7A 5IJKC 3VWKD 1QHPA 4NQDE 3S35L 3VXUE 2Z31D 1MSPA 2VE6B 1YEJL 4JQVC 3IDMA 3H0TB 2BX5A 3LS5H 4YFDB 4Z76A 2PYED 3E2HB 5MP6H 3SDCC 4F33A 3LVEA 7CGTA 5HVWA 3F7RA 2QV2A 2XPGA 4JFFB 3QIWC 4H25A 4NWTH 4AYFA 3QG7H 4L8SB 1KIPA 5AYUH 3GGWB 5FYJU 3DUHA 4KRPB 5DD3L 4NC0B 3VWJB 2D7MA 1DQQA