2KYIA

Solution nmr structure of dsy0195(21-82) protein from desulfitobacterium hafniense. northeast structural genomics consortium target dhr8c
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
MDNRQFLSLTGVSKVQSFDPKEILLETIQGVLSIKGEKLGIKHLDLKAGQVEVEGLIDALVYPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining NMR and EPR methods for homodimer protein structure determination.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 12
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kyiA01
2KYIA 3IPFA 2KS0A
chains in the Genus database with same CATH superfamily
1GYAA 3N44F 3BH9A 3FZUC 1T21B 4MNHA 4HIQA 5E2TL 5F7MC 5LNEA 1FZKA 3QZBA 4IRZH 1DSWA 3QC5X 1R5WA 4HXAL 1L5GA 4O5LH 5IEHB 1N3NB 3DX6B 3QPXH 4POUB 4W4NA 4XT1C 5ICZA 4R4ND 1NL0H 1I3RB 2MHAA 3MMEA 4XP6L 2X6MA 2R29L 4J3SA 5SWZA 4LP8A 2BP3A 2HT2C 4N2OA 4FCHA 4JPIB 4KXZH 4XNZB 1SYVA 3FH7A 2VDNB 1EGJH 3CVHH 3S5YA 5IHZA 4LXFA 1KGCD 3HPLB 3OGCB 1IGTA 2BSRA 2QDWA 4MNQA 4ATWA 3AG2B 3V79C 2X9ZA 3DHJA 4WUUB 1BHGA 2WPGA 3WLBB 4ERSH 3TZVA 3UADA 1J5OH 5LLIC 5DJDB 5HPMA 1NOFA 4BA0A 3ZT7A 4GUPB 1UXLA 4HXBH 4EUPB 4YDMA 1G4RA 2ZIDA 3EDDA 1C1EL 1QRNA 3CLFL 1A2YA 2BNRD 2VH5H 3V0GA 1P9MC 4ENED 2Z92A 1EIBA 3D3VD 3O4LE 4FXTA 3DGCR 4GT0A 4JPVH 4U1HB 2F1AA 5DFWH 1L0XA 3QJVB 1CMOA 1A22B 1U21A 3G9AB 4RAUB 2XWDA 1I1AA 1DEEA 3TEXA 2ITCB 2F54B 5DJCB 4MZRA 1P6WA 1CFVL 3WIAA 1IILE 2YK1H 1ZLSL 1Y0LB 3WAKA 4TM9A 3U0WH 3QT2A 1AO7A 2IVFC 4GG8B 2HXAA 3NT0A 4X9HA 1EANA 3L4YA 5DQDL 3EGXA 1BM3L 4KZEH 1JV5A 2FK9A 1K4DA 1V3KA 1PKQE 3CSYA 4HK0B 3ZZQA 5T1LB 3NIGF 3EAKA 2OYPA 4ZMYA 1UD8A 1F58H 1INDL 4H5SA 1VGKB 1T1XB 4XH2B 5HJDA 1TITA 1XVSA 1NCHA 2BVOB 1QLFA 4UQDA 3O3UN 4AJVA 4HPOL 1MELA 4KUZL 2WTOA 5ICXA 5CEXB 1WFTA 2Z1KA 1U93B 4E2OA 1GGBH 3X11A 5I1JH 5E5UB 2VLRD 3BEWB 4FFWC 3EG9A 2YUZA 2YD4A 5LNDA 3TYGL 3L3IA 3IVKA 5DTFB 4NRZB 3GM0A 1S7SB 3O0RL 3VFTA 3QO0B 4CC4C 5D71L 5CXPA 3WTTA 2NYZA 1U58B 3CC5A 2EYTB 4D2NA 1M1SA 2G5UA 3ATAA 1MHHA 2A6JA 3NJGA 3LS5L 5H2BB 3HPJA 4B97A 4PSRA 3FUEA 2WUCH 2N59A 4F92B 4NZRL 3DV6B 4OLYH 1ICTA 2JB5L 1KGUA 4P9ML 5IW6A 1TJGL 2VW7A 4Z7NF 5C0CD 4RWHA 4UQAA 2XIDA 1YDPA 1PS3A 1KSRA 2XKSA 4PLJD 4PRPD 3GM8A 3FN0H 4Z7UE 1P4BH 3L5WA 2BOBB 5FYLD 4IK6A 1RJLA 1TR7A 5CO1A 3P3TA 4PFEA 1NUNB 3MLTB 1QZNA 4BZ2L 1N2RB 1BZ7A 4YZWA 4BK5A 3L7FA 5IG7A 4K23L 2WVUA 1GZQB 1EWHA 4ODWB 2PWEA 4BSVA 2NOYA 4M48L 5E5MA 3TYGH 3DI2B 4HEPG 2IWFA 1OP3H 4K15A 5DJXB 3DK0A 3NESA 5LWYH 2XWJA 3FMGL 5EEUA 5DEFA 2F1BA 4PV9A 1A7OL 2ORBL 4PJ5D 5ID1B 1F56A 5FOBA 3D39A 3V5HA 3ZYOA 2F53A 1OGAE 2EZ0D 5HHPA 3KPMB 4CC4A 4IIZA 4IYKA 4DO5A 4YDKL 2GBTA 2BPBA 4X99B 2Q7YB 1JZEA 3WD5L 5D2NB 1KCSL 4YHKL 5TQ0H 3MLVL 4OLZH 2OMZA 1F1DA 2IPTL 3RJDA 5E94A 5F7KC 1C5DB 1D6EA 4CILA 3KWUA 5JIDA 4U6YB 4AWJC 4JPSA 3C8HA 2O30A 4GUPA 4M4RA 2KQMA 2VLJB 4KK9C 1MCHA 4CDHA 4GLRI 4ZX4A 5ILTH 3F12A 1LK3H 5AEAA 1JMZA 2PN5A 4G1EB 2BVEA 5EU6A 5MEQB 4GNKB 4ZMNA 2YSTA 1WPCA 3L9BA 1KJVA 4LSSL 1P5VA 4LU5H 2BSTA 2EP6A 3IU4L 5EV7A 3IT8D 3NJJA 3SDDB 1QMUA 1ET8A 1WISA 5DF0A 3QQ9D 5ICYA 5DR5H 3MUHL 3CNKA 4AMKL 1GPOL 5F72S 1V7ML 2OZ4L 1TEYA 3DURA 4C4UA 1B4LA 3OXRB 1BYPA 1OOAA 3U4BH 1X5YA 4QHUA 4H8WL 1Z5YD 3B34A 5C8JA 5KOMC 3S34H 2YMXH 5DT1L 3ZKND 1FDLL 4DFIA 1R5WB 4Y19E 5TH2B 1LE5A 3QNXB 2VYRE 4QCIB 1U3HC 3S4SG 5KVEH 1Z9SB 2F53E 3I2CH 5EDXA 3FU7A 4LP5A 2EO1A 1G7IA 3MA9L 1WGOA 2Y5TA 1LO0H 3DO7A 2W0PA 2QL1A 3UG5A 5C0EB 2YA0A 5F9JA 1FPTH 2FBJL 1AKJD 3QEHB 2F0CA 3D4YA 4W9EC 4XP4L 2YSSA 4RX4A 4MB3A 4Q8BA 1OP5H 1KT2B 1M3IA 2IQ9H 4ORGB 1PG7W 4UB0L 1HOCA 2D0GA 2ORBH 2UVFA 2XPYA 5TDOA 4RDBA 3EO9L 2XXFA 5G4MA 2AQQA 2EILB 3TA3B 1T5KA 2WCGA 2ZCLH 1EUTA 3Q6GH 3ZTJG 1F41A 5K9OB 5LUMA 4LMQE 2QGCA 4I2XA 2K7PA 4LCWB 4M48H 3WE1A 1TQCB 2NQCA 4UM9A 2OSLB 3TNMA 1HZLA 2B15A 1S3KL 3EDEA 1NANI 1ZLVK 3QWQB 3CCHB 4CVZA 6FABL 2BOCB 5D6DA 5IT2H 1TZHB 4G7VL 4LBAA 4N24A 4X0KB 2G3MA 3CD4A 3VD9A 1DFBH 4NEHB 3Q1EA 4ELDA 5I18H 3HHRB 1W6WA 1JWMA 1HHKB 3U1QA 3NOIA 4M3KB 1PU0A 1FGVH 2EAEA 4PRBB 3TA4D 4MD4A 4UBDD 4FFZA 5T1KD 2OXGB 1R5VB 3W82A 2CPUA 4DO4A 2OSXA 5J57B 3SDDC 4LB8A 5EDSA 1XTLA 4XXDA 4XCFL 4ACPA 3LKQA 1FAKT 2IPTH 2AITA 3DOSA 4JG1L 2W9DH 2UUDH 1JN6A 3OKEA 3MA7A 5IB4A 3VWKC 2OJ1A 5IB5B 2F58H 1BA9A 2ZOOA 1DBML 2N1KA 2BIHA 1BFSA 1UWGL 2LU4A 2J6EL 4G6AD 4I85A 3V4VL 5B7EA 4Y5YA 2FQDA 4DKEH 4ZSOB 4ZUUB 3O6MH 4MZIA 5TGBB 3KPLA 5CMAB 3L3IB 1KTCA 4UQIM 5D1ZA 4AL8L 5T5NG 1BAWA 2I24N 4L0ZA 3MRDA 5K1NA 1A1MA 1P1ZB 1R3HA 5DZNA 3A4EA 4DQAA 3MLXL 3G5VA 3CZLA 1AGFB 2O5YL 1QLEL 1JGEA 2X28A 1BM3H 4KZEL 2XDHA 3F7RA 4OD1H 3HVDA 3VI4E 2XOTA 3D6GA 4OCWL 4TSCL 1V27A 3C9NB 2JLPA 1KIQA 5F7NC 1ND0A 4XN2A 3ARBC 2EE3A 3S37X 1J5DA 4JKMA 5KYUA 3HZ3A 1Z66A 2HLAB 1VADB 3O6FA 2C34A 5BJTA 4KI1A 3DX7A 2Z65C 2NY0D 3W0WA 5MENA 3T8VA 5EU6D 2ITCA 4NZRH 1G9NL 2V7HA 2IAMB 5CSZA 2VLME 4BGLA 3B9VA 2A9DA 2V5RA 4KTDH 4IBWA 3QC6X 3P3YA 2FSDA 4KI5C 1I8MB 5I82A 2PP7A 5ID1A 4U7SA 5DMKB 3I85A 3P2DA 5I1LB 4F3FA 4FQ2H 1QSVA 1RZ8A 3KPQA 5E9DB 3OD3A 4F33B 3KXFE 5JYLA 1UJ3B 1N9PA 2MPVA 2UXGA 5AWNL 1U3HB 1IT9H 4B95C 1JS4A 1KGWA 3RI5K 5CCKH 2VAAA 2ITEA 3W1ZA 2EYRB 5KYXA 2VCOA 1FYTD 1BAFL 2IV8A 4O5LL 4PVBA 2CUMA 1UWEL 4WGVB 4JFXB 1UEMA 2BHYA 3U79A 2BRRH 1FE8L 2OR9L 3NIFF 4ZXBD 2WKOF 3MMEB 4W1TA 1BQUA 4MAUH 5EZJB 5FR3A 1W9XA 1IFHH 2QBWA 3KJ6L 3KWXA 3S2CA 4S1QL 3BAYA 5DO2C 2X05A 2Y7SA 2DJ4A 2J1YA 1WT5C 3P11H 1X7SA 4I3SL 2VSMB 4NKMB 4LSRH 4ADIA 1TQWA 1HXMA 2RJMA 2Y07L 3RNQB 4UYQA 4XMLH 1MHHB 4IOFD 5JPMB 5FA3B 2Y25A 2XN0A 3P54A 4MFHA 5MI0C 2X1OA 1JCKA 1WSST 5FO9B 5KG9A 3EYVA 4NRZA 1U2YA 3VXNA 1C8PA 2MNUA 1FNAA 4Y9GA 3BAKA 3EG9B 3GJFA 2H47C 1U8PA 4MCNA 2WTRB 2BWQA 3BN9C 3QRGH 4NIYE 1ANUA 4YSOA 3WO3B 4G83A 4I9WE 3WDIA 5D2NA 4KPHH 4BEIA 1QATA 3NFNB 2GKIA 2NUTA 1QG3A 2RFXA 5DURB 1AH1A 4BYHA 4XE5B 1KPUB 4H25B 1VGKA 5AW2B 3K5SA 4FFZH 3C2AH 2PF6A 5C0FA 4DP9X 3ZPDA 4F1SA 1DVFB 5I1DA 3FU0A 5E9DE 4PJ8D 4I0PC 2EO9A 4MQTB 1CUOA 2HT4C 3D69B 1MFEL 1GVIA 3LQZB 4MA3A 2VLKB 4XHQA 4G5AA 5F21B 2QV2A 3MRFB 5JMOC 3MNWA 1ED3A 1W8NA 4ZFOL 4MB4A 4R7NB 3PWVB 4XVTH 3ZX1A 2E59A 3F3HA 2YFOA 2NXZB 3PIQA 3ZIYA 4AZUA 1MAKA 3K2IA 1SBSL 1UM5L 4OQ1A 1N59B 5MP6L 4EVNA 5ETUB 5E2TH 2RHEA 2Z92B 1PDKB 4IS6B 4NUGH 3WFEL 1IO4C 3EJRA 4ACTA 1QKZL 3RIAK 2E5EA 4XCNB 3VG0H 5KVEE 1ZLSH 4GRWH 3D2UB 1H8OA 3HPJB 1QOKA 2NY1B 3I6KB 4OFKA 3GRWH 3KYNB 5C9JA 1WZAA 4QRFA 1D9KC 4EI5C 1Z3GL 2DLFL 5CJBA 4F7MA 1QQDB 2YA2A 5AAMA 4HWNA 3FB7A 5CSGA 4XO9A 3HZYB 5D5MF 1KXQE 3DNKA 2Q5BA 1VENA 3LVTA 2E9BA 1KLFB 2H9GA 3MKKA 1MEXL 3DYMA 4G42A 4IHBA 4M7ZB 4PGBB 3SQBA 4OGXH 3UTSD 5B4MC 5D1ZI 3HNSL 2Y1ZA 2JQMA 1WLHA 5JHAA 2BVOA 5I76A 3L3HA 3B9KA 1P53A 1ET5A 2OLDA 4QAWA 3OKOB 3RGVA 2H1LM 3ZQXA 3FO2B 4N0UE 4AI7A 5E0QA 2XNAB 2R29H 3LN4A 4MA1C 3L3JB 2P3YA 4YSSA 4TTDC 1KN2H 1LEKB 1W0VA 1L0PA 2HX8A 2JB6A 5FGCE 3C60B 4ZAKA 4PH8A 4YDVB 2YPLE 3LDBB 1ZHLB 2CA3A 2R39A 5JDSB 2IBZX 4J6IA 4HKJA 5KWYC 2VDLL 2X3CA 3EJZC 5E2UH 1AGBB 4WNJA 3QFDA 4AW4A 3W2DL 5I19L 3B6SA 1GYVA 2ZTBA 5EO0A 5DZAA 3CDFA 1UJTA 5IQ9A 4TQPA 2NY5H 2CSPA 4AGPA 3RWGA 2P45B 3OHXB 3HFML 1DUYA 2JIXD 1JGLL 2XN9B 3HOGA 3CZFB 3GQFA 5CJ8A 3I2CL 4HK3N 2VZUA 4AYFB 1QW8A 4JGUA 2D31A 1FIGL 5IVZA 2NX5D 3EGSA 3TBTA 1N8ZB 4KTEL 1N5YH 3MRRA 2AJ3B 4KVCL 2QADC 4S2SA 4R5TA 3WIHA 3F7YA 4QHLB 1XCTB 1MCLA 5CJXC 4WV1C 3UDWA 4DUXA 3MODH 5HHQA 5HD8D 3Q1SL 1QHPA 4CNIB 3GMQB 5I1KH 3JTTA 2ED6A 3PJNA 1Q94A 1JGEB 4MA7H 4JZNB 4TOYL 2YPVA 3MXWH 1NICA 2WXLA 5LB1A 3L7EB 3ZT5A 1X9RA 1BVLB 1S8DA 1HS6A 2AP2A 3RJOA 5EBMB 3RBGA 1BZOA 5CN2A 1CURA 3HBPA 1BVOA 2Y0SA 2ALAA 4G80B 3F04A 3QEQE 2XG5B 4G1MB 3GB7B 3RL1B 4JLRB 5CZKA 4FFYH 2EDMA 3TBWA 1ZXKA 5KSBA 4NO0B 3ZQ9A 2WNGA 3FN0L 4A6YB 5I6OA 4RGOH 3QQDA 1O9VA 3LPWA 4HP5A 3LKPB 5E2VL 2DQUL 3V4VA 1YY8A 3VW3H 1IX2A 4HDIB 4DZ8B 1PG7L 3EJCA 2VDRB 4M5SA 1E67A 5DZPA 3FQWA 4UNTA 2Q3AA 4TVUA 5FKPA 1NAMB 2V2TA 1YMHB 4LZKA 3KLQA 1S9YB 4O2FA 1OLLA 3MRNA 2EEXA 5HGBB 3GTNA 3RX8A 3JWDC 3RNKB 4LO9A 3WN5B 5CD5D 1YEDA 5SX5K 2V5TA 2XA8H 3CN3A 4F9LC 5A3ID 4G5ZL 5IBLC 5C0AA 3LEVH 3D85B 1HI6A 5LBSH 1KYOK 2E56A 3CCHA 1A6ZB 1UJ3A 4XN7A 5J9PB 2GG1A 4I4WB 5B21A 4I1NB 5JQIB 4QMEA 4N4YB 1F4XH 1A9BA 2O5XL 1YNLH 3IPBA 2PPDA 2DS4A 4U3XA 2ZKWA 2FR4B 2Z91B 2YD2A 3NQKA 2ADFL 1CG9B 4ZUTA 4NI3A 1F6AA 3B1UA 3CUPB 3DV4B 3OV6A 4UM9D 1O5PA 2YEQA 4MJJA 2EXYC 3VGDA 5GZOC 3PJSA 5AAPA 1OL0A 4ZDHB 4LLQA 4PY7B 1KT2A 5IJKA 1VADA 3O6FB 4OJDH 5KW9L 5KTEH 2WAHA 1UYWL 5E1IA 2D3VA 4ZMWA 5D7JB 4MDJA 4MDRA 4XP5L 4MMYB 1IGYB 2IH1A 3C09C 2EVHA 4CSSA 4C4KO 2NY2C 3INUH 1RJCA 1OTSD 3NK4A 1NC4D 2JQZA 3IDMB 2C3GA 2QTEA 3T1WA 2QKIC 4JZOA 4A7TA 1MZYA 3KLAA 3UTTE 1AZUA 5T1DL 2Z31B 3E38A 4NRXA 5J6SA 2W0LA 4HMCA 4KUCD 3CQQA 4B41A 3ULUE 4Z0BL 1EO5A 4DOHB 3VXMD 2NUPA 2XX1A 1EV2E 2AVGA 1FN4B 3AM8A 1JIBA 2WNKA 4Z9KB 4P3CL 3VD5A 4KO9A 4PQXA 3IAPA 3QRBA 1G5GA 4WWKA 4ENEC 1MY5A 3MLXH 4G8IA 2Y3NA 4C59B 4QY8B 4C54A 1OKEA 5ISZA 4Z7WA 1J0HA 3LNFA 3GI9L 3NPZB 4WI4A 4B0MM 1MNUH 4Y9FA 3HMXA 4HUVB 1SLXA 4BHUA 3HE7B 4OKVB 4KTGA 1F2QA 3NACL 5EORL 5IBTL 3RWCA 4DERA 3ML8A 4U6HB 2CGYA 3SE3A 1DN0A 3IMBA 3AWGA 3K72A 2UZYB 3QQXA 3WIHH 1RHFA 1ZHNA 4FQ1L 5J11C 1A21A 3KD4A 1B2WL 4V2BA 1RUML 4R84A 1ETB1 3VXPA 4XXWA 2JI1A 4M56A 2WMPB 4TVPE 2BNRB 4N1CA 1XH3A 2A6DA 2X12A 1Q9OA 1F86A 3HG1E 4W93A 4DO6A 2X2HA 1JBJA 3NMEA 2UYLB 3K6NA 3HJEA 3TVMB 4BKSC 4IKIA 4F2MA 5FS5A 3GUFA 5F9WC 1XGRA 3KYAA 2K6YA 3JWNH 3MLYL 2DYPB 4LRIC 4DP2X 1A6AA 2G2NA 4ONHA 3SPVB 2D03L 1CICB 2QJDA 4TPRH 3WKNA 4QTIH 5HP5A 2EDOA 1L6ZA 3ZHFA 5A6MA 1FGNL 3H2QA 2DQFB 3QFJB 4M6ML 3QEQA 4FN0A 3C9NA 4LSTH 4XOBA 2FGWL 2ZX6A 3FB8A 3W9EA 5JPMC 4TNEA 4UIKH 3BIKB 2ILLA 4DH2A 4YIQB 2YS4A 4JDVB 4YXKL 4H20H 1SM3L 1JFQH 3CVHB 4N2MA 4QO1A 1CE1L 5BS0E 4GBXA 4GMSH 3ZDYF 1S7TB 2Z7WA 4KRPB 4POZD 1HSBB 3TT1L 4L8CB 5D1XC 1NDGA 1NGXA 1R6VA 4JGJA 4WO4A 4AQ8C 5E6UB 2W38A 4KU1A 4ZMXA 1NGYB 3VNYA 1J1PH 2OMUB 5CN1A 2BHUA 4BKTC 3WD5H 3BT0A 5F89A 4Z7NE 3L4CA 3BAIA 3OC5A 5EB9A 3SDAB 3KS0J 4M43L 5D2LB 3PREA 4U7KA 3BSGA 1BD2A 4LLUA 4OJFH 1F1GA 3SCMD 3FCUB 1QI3A 4L4TA 3LQAH 3QGVA 4G80A 2ZD0A 3N9GL 1PEZA 1RK1A 1RZJC 3B3IB 3DVNA 4B3EA 1A1OA 2VR7A 3T2QA 2NNXA 1A4JA 3CX5K 5E4IA 4I1RA 3PAZA 5SWZE 5SV4A 1FRGH 2NZ9C 4NN5B 3MLUL 3TN0D 3EXLA 1XF1A 2OCJA 5EOCL 2TRHA 2B3RA 3KPTA 4JN2A 4K3EL 1EZVY 4R26L 4W4OA 3VWJD 3AC0A 4DUVA 4PRNA 3MGAA 4EI5D 2K78A 3G5XB 5IV2B 4OZHE 4AMKH 3SPCA 2H3NA 3RWDA 4G8GE 3QXDB 3A4FA 4M7LL 4JFVA 2F5BH 1XCTA 1RVFH 2AV7A 5DRNB 4X6EB 3X1GA 2GITA 2ZYRA 4YSRA 2PCXA 4S1DD 2G9HA 1JTOA 1BBJA 2ZXWB 3H2WA 4LHQB 4QEGA 5C08E 1TZGL 2OW7A 1TJIH 2KLSA 4DKFH 4IRSB 2OX5B 3P30H 2A3TA 4FI6A 4AYID 3CDYA 1FZJA 5E2VH 3RUGE 5ANMB 4Y1SA 3REVB 1FNEA 1DJIA 4PJ8A 3SGKC 1Q9WB 4Y4KD 2ADJB 5C9KA 1ERNA 3I9GH 4PAZA 4WI7A 4BZYA 3VD3A 4QTFA 4NO2A 1K8DA 3E9TA 3ATBA 3PCYA 3QRLA 4L4TE 1KDJA 1UM4H 3BP7B 3L2MA 3GINA 1RMFL 1M7XA 4NPKA 2FJHA 5DZ9A 2NY0B 3N1MC 3O9WD 5JA8B 3UZEA 1I1CA 4G72B 2WV3A 4F20A 2LFGA 1X4YA 3TN0C 1VF5C 1EJOL 2EDDA 4KXCA 3X3FH 1F4HA 2NSQA 5DS8A 4YPGA 3AROA 2VLJD 5MEOA 3BXNB 5FUCC 2W9EH 2CAKA 3L3OC 3VXTB 4AQ1A 3S88L 2P5EE 3G6DL 4IIQB 4KRMB 3QJUB 1ZE3C 1CZ8L 3QWNA 5FFLA 4ZD3H 3RKDC 1MIML 4NFBA 1UD5A 4QT5B 1G7HA 2B2XH 2NSMA 3L3KB 4LVOC 1HHIB 2PMZA 3HFFA 5AG9A 2YKLH 3GDCA 5AVRB 4GAYA 1UASA 1KXVC 3VTTA 1HT6A 3H9YA 3RX5A 5JR1H 1HH6B 1UENA 3CPUA 4UQBA 3MXVL 1RZGA 4Q9BA 1F3RB 4P23C 4PRPB 3P9MB 5KSBB 5A3IC 2WXHA 5FYKE 1G9NH 2CLZB 2GVYA 3G3LA 3W11D 1PCSA 4K4KA 4RGMB 3L4ZA 3BP5B 1KTJA 3ULVC 3D50A 1AY1L 2XICA 3U2SB 3S97C 4PRHA 3FFDA 5IQLA 3VFMB 3D87B 3OL2A 3V6ZA 3TF4A 4HH9A 1OM9A 5ANME 2EUVA 2PTVA 4JNXA 1GOHA 2OL3B 2J7LA 1I7RB 2X4TB 3O2WL 4FZEH 2DY2A 2GT9A 3MLRL 1GW6A 3P02A 2EZ0C 2EE2A 4G6FB 2ICES 1E7UA 1K4DB 1RZKC 2MSPA 4RQQA 3U30C 1CF1A 4WWPA 4WEMB 1OQOA 1G6RB 3GSXA 4XGZB 1GY1A 1I1RA 2AJUL 4FXKB 1J5HA 3IXAA 2O26U 4OGYH 3CSFA 3KPPB 4NM4L 4R4FL 4L5FL 5ESVB 2G0KA 3TLRA 1I8IB 5KZCB 3MBEA 1NIEA 4MQ7B 1PYWA 1LEGB 4YHLH 2F7IA 3QDGD 1DVFD 1U92B 3ARFC 4PTUA 1AP2B 3IKCA 1RURH 2J4WL 1XCXA 3PXJA 3FQWB 4FQQA 3CHXA 4U6HA 3GWJA 5F0PB 5C70A 2D2OA 5DO2D 3KVQA 3PFUA 1TMCB 3VX1A 4JFED 3MZGB 5L2KD 3RHWK 4HJJL 4KK5C 4HHAA 1H0DA 2XZCH 3K0WA 3T0WA 3WLWC 1GHFL 1NEPA 1UOLA 1OWWA 2HT3C 1EFXA 1U58A 3CC5B 1FV1A 4APXB 4GY4A 4G3YL 2CM6A 3Q8FA 4JREC 3QZNA 3OAYH 5DJYA 1FNFA 3DXAD 4ZW3A 2X4OA 1MJJB 4GKNB 2NUPB 2Q7NA 3CV5A 3MV7B 1HHJB 5CGMA 1BQHB 2R9HC 1O5DT 4OLVH 4KKPA 4ONOA 3CFQA 4P2OA 5EOTB 4JFPB 2K4WA 4D8PB 1DEDA 4XVSL 3S6CA 5ADPL 3L4TA 1I8LC 4KKBC 4OZGE 2IO5A 1GGUA 3B9DA 5H8DA 3IGLA 3LD8C 4UNUA 4Q2ZA 1FZKB 5JZ7C 2WIIB 1XGYL 5B8CC 2JLLA 2DLTA 4PJFF 4FQJH 4R7LA 4K7FA 5TJWK 5LGJB 5KVDL 2CM5A 1BOGB 1OD9A 3L1FA 4G8FA 3F7KA 4FLHA 1SHWA 1ZHKB 1U95A 1CD1A 3KEDA 3MPCA 4FL4B 3UJTH 4YHOL 3PJSB 3QE5A 2OS7A 3NCEB 1ZXQA 1TG8A 3DV4A 1SJEB 4PW4A 5J0BA 4K9EL 2A6IB 3GZOA 4U1HA 5L0QC 1X7QA 5A7BA 3EKCA 3JTSA 1OIOA 3KL5A 4E9SA 4F7KA 1WA1X 2W8CA 1MF2L 4HOMA 3MV8D 4JGNA 4YDZA 4YC2B 2V7NB 2CO6A 4LEOB 4GRLC 2NMSA 4P3CH 2DH2A 3TO4C 2AS5M 3VFOB 5DRXA 4HUUB 4GYBA 1CO1A 2R2BB 3PRZA 1T1ZA 3QIWB 1QEXA 4ZQKA 4KVNL 1U8LA 5HGBA 4X7TA 4R4FH 3KDPB 3ETSA 4HH9B 2R59A 2EDBA 1NLBL 2NYYC 3ZYJA 3VI3A 3BSZL 3MRJB 3N91A 5GGSY 3VWJA 1RZFH 2BOBA 5HDRA 3KNBB 1P7KA 1UB6B 1IE5A 1HHHA 3I84A 4XB3A 1IC0A 2RH0A 1YDPB 3FFOA 1ORSB 4KH9A 5CR8A 3OR6B 4AENB 1YEEL 1IIIA 3ZE0E 3V8OA 1XGQB 4NNYA 2JJVA 4IBVA 2FIKA 3LN5B 4V33A 2J55A 1B90A 3KW8A 2LLNA 2XBDA 3IETA 3UZQA 3GBLA 5T5NF 5K9QG 2XKNA 1WS7A 5FO7A 4U1MB 3O2VH 4EQ2A 4LE8A 4L3EE 1G0YR 5GS1A 2OFQA 3DSNB 3LB6D 5E00A 5JLZB 4NQSB 3TJHD 1J05B 2W1NA 2WXNA 5EU5B 4JFFD 2WZ0A 4PGJA 5C86A 1ZS8A 1A1NB 2WM0A 2KERA 1E8XA 2ARJB 5LWYL 1FFNA 1CIDA 4EZJA 4PG2C 1AZRA 5GRUH 1CXHA 2IALA 2ZUVA 4K5MA 2CHZA 2BWDA 2X0UA 3PWPE 4OIIH 5T1LA 3CZEA 3VRIA 3X17A 3KBFA 3SPVA 2AI0H 3ZN6A 4AIEA 2PPCA 1C16A 1IM3B 4UNIA 1XF4B 3O8XB 3T4YB 2BS8A 3H9SB 4X4YA 2N1TE 4XPFH 2HH0H 4L3CB 3CC1A 3O11B 5EZOH 1MCRA 2VMDA 1GTFA 3ZDXB 5K5YA 2QQKH 3JVGA 4HKZB 3APCA 1JPSH 2XZQL 3IN2A 1BBJB 1AGCB 1WVZA 3CAFA 1U3HD 3UL4A 3BPOC 4HCFA 5E08L 3Q5TA 2C9QA 4X6CA 2FX8H 3FRPB 3HNVH 4JANA 4YXKH 4EN2A 1G7IB 2NXYB 3GIZH 3DX1A 4UT6H 4D9QE 1YMME 4EDXA 1GYWA 4UT7H 3O6FD 1Y1UA 1F8TL 4E9LA 1FGNH 4KDTC 1WS8A 4MMXC 2FBOJ 3NZSA 4GXVL 3NIGB 2JJUA 4C56A 4F7EB 3EH5B 4W9HC 1U30A 3KPLB 1REIA 5CMAA 1W0WB 3HAEA 2BSTB 4HSAC 4RMRA 4Y2DA 5E1GA 1ACYL 4NQQA 3HFMH 1KXTB 2BVTA 1JZFA 3GJFH 2XZAH 4GFTB 4N2BA 1RUMH 2P7TA 4IOIA 2ZCLL 2WBJD 3NFSL 1JGDA 4MAYC 4TULL 4HQQH 4GOSA 4P2QB 2DI8A 5IQ7L 2A9ML 3BLPX 4XPHL 5D7IB 1K8DB 3SBRA 3KGUA 3RU8L 2WINB 2WLLB 3EJYC 3OZKA 1A7PH 2VDOH 4J6RH 4PS3A 4YE4H 3THML 3UTPD 1CDUA 1FNEB 1IB5A 4G2AA 3PHQB 4MQ7A 4PRBA 2H32H 3UAAA 4HISA 1N10A 3T4AA 2I9TA 1JWMB 4Y2OB 1TJHL 1CR9L 5EFIB 1IEBB 5DRWB 5JOEA 5FGBA 4FULA 1MHPL 3HRZA 4HAKA 4QF1A 4BFGA 3DOIA 2KDYA 4L2LA 1XTMA 3RVTD 2FX9L 3NIFB 3EYOA 3DRQA 4JKKA 1MI5A 2NNAA 5HGHB 3P73B 2DBLH 3PP4H 2NX5B 3MGOA 4JHBA 1A6TB 1Q1PA 4H7VA 2MPAL 4PJAA 3DUUB 4E5XA 2DBLL 3PP4L 5EZPA 4CC0A 1HIML 2QSCL 5C0AD 3C60C 1E40A 1MWAB 1WHOA 1FNHA 4XPBH 3VXSB 1OTSC 3CX2A 4FNLH 3K7UA 4UM8A 4ORZC 1RL1A 4Q56A 4YEFA 1JPSL 1INEL 4R0LC 4Y1AD 3V6FB 3O4OB 4ZMOA 2FO4A 1VLXA 3VB8A 4HHWA 4N6QA 3N1PC 3BVDB 3FH8A 2VDPH 2VITA 5L0QB 4FFWD 4WHYG 2FWOA 2PXYC 1Z9SA 4K0OA 3RKDD 3RNQA 4P46B 4ZQTA 4ZD3L 1CLZH 1QWNA 4X7SL 4I89A 2R0LH 4Y4HA 4PD4J 5IHWA 3JWDH 4GKZA 2VN6A 3MA7B 3NZHL 4M7ZC 4AYGA 2W94A 1WZMA 4KWUA 3NFSH 3VI4A 2CO3A 3LKQB 4NQCB 1HCZA 2Y4SA 2X7LA 2R1XB 3MROA 2R83A 1CDYA 3N2JA 4X8JA 1A7BA 2ZUTA 4FTVA 3JV6A 4OJCA 4KFMA 3S96B 5JNYA 4HKBA 5AVYB 3MOAL 1LTXA 4EI0A 4PJXA 1YQ2A 3C5XA 5D70H 4ZQKB 1XIWA 1LMKA 4A68A 4PJAE 3C60D 3QP3A 4YXHL 5KN5B 1PZAA 2AW2A 4AJWA 3BVVA 3VFRA 2XCMC 1ZWIB 4JAMB 2X2UA 4NGHH 3QR0A 5TQ2L 5DYOA 1BX2B 3BE1H 4Z6AT 3IDYC 4BWUA 3BRGC 5IVZB 3OAUH 2IDUA 5C0RH 4MHHG 1NGWA 1Y6MR 5I1EL 3KEHA 1ZY9A 3BAXA 3VXUE 4POZC 1J0ZA 1HEJC 1DBJH 3JZYA 3VXRA 1X5HA 1L4IA 1CDIA 5F3BA 4XZUB 3C6LC 5BJTB 1XZWA 1L9MA 4NZUL 1XEUA 4FOMA 4W9KC 1MW1A 2ZP8A 4LSRL 1M42A 2R15A 2V5YA 1AMXA 4FYRA 1I9RH 2AZUA 3WJLC 5J13C 3WTYA 4AUYA 1AZCA 1RD6A 4QNPF 1CZ8H 1G1YA 1NEZG 3MRGA 1DJSA 4KQ3H 4M9PA 2J8UE 4NZTH 4LOFA 1IAOB 5MP6H 2J5WA 1T04B 1ZS8B 4QKTA 4QWWC 3BUPA 5AVVB 1PG7X 3QUZC 2JKRM 4ZYKA 2DIEA 3RVXD 3EYUL 4XPGL 1SF3A 5IFJA 2BFVH 1T6WA 1E27A 3PDDA 4H0LC 4JRLA 3S2AA 3BGFB 5D1ZB 3HZYA 1FIGH 1QEWB 2Z31D 4KJPD 2VSDA 5ITFB 3D5OF 3QR2A 3T71A 2EIMB 2XA3A 2P5EA 1YY8B 4P4KC 4YHIA 2FNBA 1YPZF 5GGQH 3VGHA 4I77H 4ZUSA 2BNQA 2E3VA 2Z8WC 1NMAH 1XGPA 4P2YA 5DJZB 4BQ8A 1AXSB 4OZHA 1BQ5A 1X5IA 4XPTL 3AMLA 3TCTA 1T21A 2FATL 5FKAA 2DQGL 2KI6A 3OAYK 1OCRB 3ZGIA 5A2JH 2CKNA 1CE1H 2AKRA 2JKSA 1KPVB 2A9NL 2E47A 5HVWA 1UVQB 2KKQA 5A43C 2YD3A 2XACC 1SN5A 2A9NH 2H32B 4P57B 1EA9C 2VH5L 2ZJSL 3U9PL 1GC1L 4W9GC 1RVFL 2P8PA 1NPNA 2FD6L 1WZ1L 3GLDA 4GSDH 4UT9H 2VRKA 5F1NA 1IEHA 3QUKA 4EJ1C 3MOAH 3UBXB 5I75C 4X7TB 1M05B 1CG9A 5AYUH 2CHDA 1I7UA 4OCWH 5K1JA 3BJLA 3QUXB 3ZW3A 2FR4A 3RVXC 4GQRA 4XNQA 4XVUC 3TBSB 1NA8A 1CXLA 3SDXB 2VLRA 5CJOL 4UOZA 4Z23A 4MCMA 1CYXA 4PVNA 1HNYA 3KCPA 3TBTB 1K3IA 1JF1A 1DL7L 3MJ7A 4H26B 4R9HA 2MNWA 5GJSH 5A2LH 5GISL 3VXOB 5FB8A 1L9QA 2OR9H 4ZW8A 1YA5A 3ROOA 2ARJA 4XBEL 4NQEE 4KX7A 5BW7C 2J8UB 2YN5A 3L13A 4M43H 1TQTA 5HHNB 3SOBL 3S35X 4DN3H 3V5DA 3ISRA 2KLRA 3NH7H 3X3FL 4QRRD 1I1AB 2ITDA 2HB0A 3AADB 4I18B 3VM7A 5FKPB 3WSQL 2GB2A 4NUPA 2CNYA 3ASOB 2YZ8A 5DJ8B 1YY9D 2QGBA 5AKVA 4S1RH 2Z7ZA 4G8FB 4BFNA 2YXVA 3ARBB 4ZAKB 4Z3FA 5IW6B 3UBHA 3ZGHA 4Y2DD 4FZ8L 1W0VB 3QDMB 2NTFA 5KZCD 4AX3A 1Z3RA 4PRID 1SYSB 1YEGH 3ARGA 1A6PA 4JX0A 3FCTB 4NQDE 5I0XA 7PAZA 3B5GA 2KL6A 4RDQG 3A6CH 2AAAA 2R8SH 2YUWA 3KPSB 5JXAL 5F96H 4E41A 4FLSA 3VB9A 1K5WA 1O7DC 4PG9B 1BVKA 2BC4B 2G3ZA 1N0LB 3FYIB 3UAFA 2FX7L 1EXGA 3HI6H 1IKFL 3Q0HA 4JE4B 3U7YL 1KCLA 5FYKL 4Q9QL 3D39E 5IMOA 2YD0A 4P9HL 2GAZB 3ZTEA 3PGDA 1PLAA 4HUXA 5F7HA 4OTXL 3N0PB 5DJ0A 1U8LB 1E4WL 1MHPH 2F8OA 1AY1H 4LOUC 4XCCH 3TCLA 4PP1C 2MMXA 1LQBC 3CFUA 1U8OA 4NLAA 4UOW1 5E9AA 2MQ3A 4YAQA 3L8QA 3P2BA 3FQUA 3VWKB 2R4RL 2G0LA 1KJ3H 1RIUH 5AD0A 4HEMA 4MDJB 4X6CF 5TPWH 2I9LA 3RGHA 2ZXCA 2Y1AA 3D52A 3G7TA 3QXTA 1WAEA 4X7SH 4PJ5A 3TONA 3RB5A 3UBFA 3N43F 4H8UA 3VGEA 2CDEA 4TL4A 4CVXB 2D8KA 3CFDA 4GG8A 1ILUA 2VZ1A 3P3RA 3RY6C 1KG0B 3FUKA 5FUZH 4EN3C 2IG2L 2AK4E 2FJFA 5HI3D 3GSNL 4G9FA 4X5LA 5FHBL 2UWEB 4HIJB 4J3XA 6PCYA 1B0RA 2LHAA 3GO1L 3NCJH 4X98B 5FX3A 3MRIA 2FIRT 3BO8A 4XN5A 4OLUH 3PAVA 2NCMA 2DQEH 2AJZB 3MTXA 2V9UA 3QJZA 4LVOB 1XF2A 1X44A 4J23A 4FCAA 5JPNB 2GFBA 5I26A 5FA4B 5I6XC 4J2XA 1M7UA 4Q97A 1A25A 1KY6A 5F7EL 2LTQB 3PGCA 1E2WA 2CJ3A 4HWBA 4R83A 1IKNC 3RWFA 4H40A 4JM2A 4M6OL 3IU4H 1Q72H 4AZ8B 1NJ9A 5KVGE 5TTRA 5I16A 5JZ7D 4WI3A 1UT9A 4KJQC 1DR9A 4OCRH 3SE4A 1L9TA 3OZ9L 1LEIA 3EJZD 4GW1A 3BKMH 2W0FB 3IJSB 4L9LB 3HA0A 3X3GH 2NT1A 4HS3A 2R23B 5DWUL 2R9HD 3F64A 4JKWA 4G6ML 4M93B 4C83B 1N3NA 4JHVA 3NEXA 3IF1B 2EDYA 4RNRB 5D4HA 1XHHA 5SWSD 2LW3A 3G6JB 1TJIL 2XZQH 4DKFL 3EADA 3MQIA 4P5TC 4Z5RA 5F2FA 3QIUA 3MAWA 1XL6A 2Q86B 4GG6E 1K2DA 2ZCHH 2OYMA 2VO5A 3KYMB 2GK0B 5J13B 2VJ8A 3X2QB 1TUPA 2DQHH 1SOXA 5ITFA 1P4IL 5E2JA 3T2NL 4N0YH 2BP8B 2J43A 3BSZA 3DI3B 3QCVH 4PS7A 3R8BB 4ALAH 3MXVH 1IU1A 1J48A 3FQNA 3QNYA 4WK2B 4A2HA 3CVHA 4B53A 5MHSE 4OD3L 5I1HL 4JG0L 3FTXA 3SIKA 1TFPA 3B8SA 1D2PA 4K2UL 1IAOA 2DWDA 3DTXB 3BH8B 2IANA 3SJVA 1IUZA 3MGOB 3PWJB 4L3EA 3MRGB 5EU4A 5CGBA 3U4KA 5HYFA 3TCXA 5IGXH 1JWSA 2VDMH 4LPTA 1XCQB 1A6AB 4K8RH 2VIRB 5EUOA 5D1QE 1AQ8A 4Z7QF 2QVIA 4M3HA 5IJVA 2K9UA 2O4EA 3A0OA 4N0YL 3F62A 5F9DC 3LKSA 2AMGA 3T2LA 4Z7QE 3M1BA 1DEEB 3TA3A 3POHA 4HUCA 2P8LB 3A5VA 1QI5A 3RL2B 4IDLA 2XPZA 1G6VK 4ORGA 1DCLA 4V11A 3E2HB 1B4RA 5DEGB 3OKKB 1X5MA 3FQTA 1YEJL 3GHEL 5EZOL 3TO2A 3QORD 3BQUA 3VYOA 9PCYA 1MRFH 1HDMB 5I24A 3WDJA 1IGMH 5DYFA 4HBCL 1I3GL 4LVNB 1LJMA 4WZ9A 2X89A 1IGIL 2AXGA 2I26N 2R29A 2D73A 4D8OA 3DVGB 3IDYB 4LKXA 2EDNA 4P2RD 3OXRA 4M7LH 1OTUC 3B5HA 3MRLB 2VSKB 3V0JA 3DVNB 4FEMA 1EZVX 1URLA 2PWHA 3EOAB 1JDDA 3T0XA 4M1CC 1USQA 2ZKYA 4QYAA 2WO4A 3PGFL 2VN4A 3RY5A 4ONGH 3WE6B 1QSEB 4FQ1H 2BNUB 4OLUL 4U1LA 1ETA1 4DZBB 5BNXD 2E7LA 1T20A 4HLZH 4BKLA 4MLIA 4UOQA 4C56D 3PWPA 4J8RA 1MFVA 4XP4H 1ZANL 1BIIA 4WFHD 3BPCB 2W91A 3V6FA 2XQBL 3BOVA 4Y4FD 5E94B 4I3GA 4MYWB 1I8MA 1G7LB 2VJ0A 3VFGL 2GJJA 4NWTL 2L8AA 3WS6A 3KBEA 4ECNA 3UP1A 2ENPA 4FGMA 3U9WA 1OQXA 1PZ5A 4UV4L 5D6CA 1NGQH 3DGGA 1MCPL 4I48A 2R27A 2CDFA 2WBJB 5ESVA 1WD9A 4GRMB 4KXBA 4U1JB 1LL1A 2H2SD 2W5PA 4IRJA 4ZNEE 2BOCA 1SDAB 3PHOB 5GGUA 4FTVD 5KANI 5B1CA 3SKOB 4X6EA 3OF6D 2P43B 3LV3A 1HC1A 1IGCL 4YSUA 8FABB 5KN5A 1OAYL 1S7RB 3RTQD 5DHYA 4LGRB 3T9WA 3BN3B 3C08L 3WIIL 4JN2B 3ZUNC 1JUFA 2GABA 1ZK5A 4HC1A 4ONFH 3ZR5A 2D4FA 2PTUA 4G6KL 4UMGA 1HE8A 5CEZE 1P84K 2D7MA 1W0YT 3UCQA 2K8MA 1CXKA 1A3RL 2O61B 1IBHA 1JRHH 2H32A 2HJKB 4WJ5A 4KK6D 3TL5A 4AXWA 2EIDA 3V6OA 5DVLA 3N42F 1BM7A 3RY4A 5C0BB 1H9DA 1T7YA 5IREA 4JY5L 3ZDXF 2FO8A 3FHAA 5I9QB 1GGIL 1JXJA 3G6JA 3IFLL 3QNXA 3OM3B 2OA9A 4XVTL 4A66A 4ODSL 3BYYA 1VFBB 3PXLA 4IMKA 1OSYA 5CAYB 1EO8L 1BG1A 3O3DB 3NH7L 1XD1A 4YSCA 2SODB 4A2MA 4JUTA 4MAYB 4JHZA 4U6VL 1HSBA 5I15H 4L8CA 1JNJA 2WXMA 4G11A 1FPTL 4QWWD 4XXDB 5IVXE 1W2KT 3QA3B 1XGYH 3HAEH 2BVQA 4NYLB 3FT3B 1Z7JA 2OXGA 5GJSL 5LG1A 1P7QA 3BWUF 1QBML 1T22B 3LCYA 4UQ2B 2QQNH 5DDHA 1U6AH 2K70A 3O3BB 1LP9F 4P46D 1SXZA 3FUFA 5KYXB 3T08A 3H9HB 4PHXA 1YG9A 4WFFE 1HDMA 2GQHA 1OF2B 4HK3J 4ODBD 2EXWC 4XHJD 3T0VA 4ODXB 2QHRH 4BIKA 2WHVA 2OTWA 1G9MC 3WMPA 2BINA 5IUCA 2FJHB 5I8KH 5DMJB 2V6HA 4DPRA 3TEZA 2BIQA 3IMSA 4NO2B 1N68A 2R2HA 4A6YH 3PPSA 4KKNA 3D4CA 5I74B 4NAJA 2Z8SA 4ZS7L 3AB0B 1X7QB 2LQRA 2CZNA 3NEEA 2DKUA 4HU2A 2IH3A 4LIQE 4GUOA 2GK2A 5C07A 3OJDA 2DQDH 4HIHA 3NA9H 5M94B 1FFRA 3G5ZB 4Y5VC 3RPKA 1X9UA 3CFKB 3MV8B 1J8HB 2Q7AA 4IRSA 4URKA 3GGWA 1MJ8H 4G7SB 4EXKA 2AJXH 1IEAB 4BH7A 1HL4A 3CVDA 5IB3A 3IFNH 2VKXA 3OB8A 1BXXA 4NCC1 2QVMA 5EIVA 4X4XA 5CN3A 2FLBT 2NXZC 1F13A 1X5ZA 4PJCE 1M9WA 2A9AA 1XFPA 1BAFH 5INCB 3NGBC 2AXFB 3H4HA 3I6SA 4KX8A 3HUJB 2FEEI 1JXFA 4HOZA 1DJYA 1LO3H 2AEQH 2BS9A 4PI0A 4HVBA 1TFHA 5J7CC 3MREA 3E3QC 3VGFA 2VDQL 3ZTNH 5D7KD 3KZ8A 4LLAA 4XNUL 4PBDA 3V9CA 3BT2L 3EYFA 1YNKH 4GMTL 2UZXB 4IM8A 4MNQD 4FFZL 4KTDL 4D0CB 3QFJE 2X2JA 3FUHA 4DW2H 3VQLA 2FT7A 3O2VL 4AIZA 3AAZA 3AQXA 4P8QA 2AXJA 3DPBB 1WH0A 1K6QL 4N2KA 1JYXA 4GW4A 1EUUA 3VGAB 2DTML 2WWOA 1V3JA 4Y16A 2VXQH 2ZWKA 4C83A 2X1QA 3CBKB 4HXBL 4HX1B 4PU2A 5BS0B 4JZJB 4XAWL 1M1XB 2V9TA 2X4UB 3QW9A 1FG2A 4QRQB 4AMWA 1I7TA 3D25B 3VI3B 4HIXH 3HZVA 5DA0B 2ESVA 5C0RL 4N9GA 4IRZA 4UUJA 1L9SA 2HRGA 5IBUG 2IH8A 4XXCC 1K4CA 4X8XA 1NCWH 4JM2B 3ESNA 1BZ9B 2VC2H 3AQDA 1Z2KA 3U2JA 5EF0A 2IXQB 3T0DA 4MNGB 5J5EA 4L9DA 3V9EA 3IGKA 1RJYA 3POCA 2LFEA 3KCPB 2CA4A 2YEZA 5JPNA 3U82B 5I1JL 1BF5A 3S9DB 1SXAA 4FYTA 3V6OE 4ZFOA 5I1KL 2DYSB 1KGCE 2IH9A 1I7RA 1J9TA 2X1PA 1C7TA 3LXCA 2GSGB 4HUKB 4LCUB 4NN6B 4U1IB 5D4JA 3H0TA 4N0CD 2FVNA 1OANA 3JWDL 3KLDA 3QFDB 3Q8CA 3OAZH 3RWIA 5I6PA 4NB7A 2WQSA 5JLZA 2ZCHL 4J3TA 3EOYG 4ZTOH 3GJFB 5SWQB 1DVZA 4E68A 3BPCA 2RBLA 1BOGA 3O4LD 3MNVA 3WMQA 3K8LA 2VRAA 3MOBL 3PF2A 1L9RA 1CLVA 3QBTB 5IB2A 1NCJA 1T20B 4F7CA 5HYQA 1HKLH 1MFCH 5ISZE 1INEH 2ESVD 2FB4H 1GZPB 2ATPB 1QSEA 1THAA 4U2YA 1HXMB 4ZO9A 4YXLL 5JMRA 4OD2A 3BESR 5AW4B 5TE4H 2TSBA 4DWHA 4DCQA 3JBG7 4BCZA 3GXFA 1ORSA 4ZAKD 3ARBD 5EZJA 4K55A 1JGUH 3QULB 4ESKA 4ZS7H 1GIGH 1C12B 2YMOA 3KNBA 5JIMA 3GNML 4N6RB 3IRPX 2B59A 3QORC 1D5MA 5IEKA 1NCCH 4P5TB 2XXCB 2YJLA 1Q94B 3MLYH 2AQTA 2K0RA 1KBKA 3PQYE 1JPEA 1RK0B 3RILA 1CLYH 4WSGA 1QPXA 5SV3A 3L2LA 4K73A 2OQJA 2YAMA 3FQRA 4KKQA 5C0ND 5MEPB 3VFOA 2OK0L 3IFOB 1RY7B 1Z0NA 2VLRE 3Q2LA 4MNGE 5D5MA 2CMRL 1BQLH 1NGPH 4JQIH 4A7GA 3NG5A 3LRSA 2JELH 4PJIE 2CO7B 3EBHA 2VR5A 3OHXA 4A2DA 2Y07H 1C8QA 4BFFA 1M57B 3R7RA 3WAJA 3J2PA 4NSKB 2R0WL 1C5CH 2F74A 4ODSH 3OJDB 1AGBA 1HTYA 3PIQB 5FM4A 3VH8G 1JRHL 4N90D 3SBWA 4BV1A 1UH3A 3HBQA 2WKLA 5EU4B 2R2HB 3GSVB 3K8KA 4PRPE 1HJBC 4EQ3A 5A1AA 4MSWA 2XG4A 5J1AB 1EDYA 3FO1B 4WY7L 5FYLE 4F15C 4PM1A 2JB6B 2OZ4H 4NRYA 2R2CA 3K91A 1L6PA 3MCKB 1D5ZA 3OKLB 3RWHA 5B39G 5C0AB 3QUYA 5A6IA 5KEZA 1DVXA 2J2ZA 4LU5L 2VR8A 2BMKA 2XPGA 2D3NA 1BGXH 1AC6A 4YXLH 4YBHA 1T03H 2R8SL 1S5IH 5F93C 5GS1B 3X1EA 4Q4IA 1MJJA 4GKNA 1RZQA 2NY1D 5FUOL 3OXSB 1IQWL 1XGTA 4H13C 2BJML 4WU7B 4F7MB 4XB7A 1Z9OA 3MLVH 2I69A 2VDOL 2OV0A 4J6RL 3STLB 3OMNB 4NUMA 1YMMA 3KYNA 3KPRD 3BH9B 1DSFH 1EEQA 2OTPA 5E1HB 2O5XH 2DD8L 4NQCD 5CLWA 5TDPB 2E6JA 3T2PA 5GGSB 3NN8A 1MIEH 1A0QH 3PXHA 4ZFGH 1GZHC 2X87A 3EW3B 4GUQA 4D7BA 2HH0L 5HI5D 1ZD6A 5HDBF 3BKYL 2XQ0A 1XX9C 5T3ZH 3D48R 2PO6D 3F65A 1QSFB 1BVLA 1KFGA 5IGXL 4L8DB 1HYRC 3RE0A 3K1KC 3WO4C 4JZNA 1QUPA 3VH8A 3PY9A 1VHPA 4DNLA 2XWBA 2YMTA 1FZOA 1S7RA 4H5SB 2FWSA 1CLYL 2QGEA 2YAHA 5I75B 5FF6B 4J3UA 4M03A 5BRZD 5I1HH 5F7DB 1TQCC 1J5IA 4MQXD 3SKOA 4OB5L 3ZIMA 4KRLB 4TUJB 3L08A 5JXEA 3AS0A 2PYFA 1NFKA 2ARJQ 4YEEA 3GKWL 5ENWA 3NP4A 4RA3A 4Y16D 3A3YB 5CZRA 3RX7A 2RA1A 4XC1L 2D7NA 3JWOH 2F53D 2F8IA 1KGYE 4UI2A 4KJWC 4UV7L 5IVXA 4WRLA 3S3PA 4JGMA 2R69A 4KKRA 1VFOA 2VXVL 1BYOA 4CRPA 2GTWB 3S8WA 2WSPA 5KYWA 3M6DA 3WFHB 4BFKA 2DQGH 4XCFH 1F1AA 1TNMA 3SN6N 2JJSC 3R4RA 5AOKA 5C0GB 1I8KA 1NIAA 1SOSA 5AW8B 1ES0A 5HPMB 4A39A 5GSRB 4PREA 5ERWA 5EBLB 3WJMB 3PNWB 3CFCL 1SJHB 3B3BA 4OF0A 2ZAGA 3IJEB 4KO5A 2ZOKA 4CADB 4Y2DB 3ULSA 1F6LL 5ISZB 4LVHC 5DJ2B 3O3BA 3GKWH 3MV9A 3VFPA 5JOFB 3I50L 5IBLD 1WYJA 3FT3A 4KKAC 5GQBA 3SDCD 6TAAA 1BCIA 1PIGA 1FN4A 2W9LA 4JQXA 5HYJA 1TQVA 1X5LA 5BPPA 1QSFE 3M7OA 4F15B 2K6ZA 1E2VA 4PRIA 4UDUB 4H8PA 2ZWSA 3TBCA 4RMWA 4RZCA 2X0VA 4P2RA 5INCA 1H3PL 3LZPA 5I28A 1JGLH 4Q0XL 5ITBH 1R9FA 4OCXL 2Q76A 3PABB 3O3AB 4KK6C 3SYCA 5C07D 3DYOA 2IH1B 2J25A 3BZ4A 3D05A 1FAIL 5D7JA 5B1KA 1PLBA 1H5BA 4Y5XB 4XNXL 4M8QA 5HDBB 1RJZB 4YL9A 4CSPA 4RGOL 3NSCA 3SKUD 3WJJC 3QUXC 4HIHB 4X7EC 2QHRL 3K71B 5E4EB 3LPGA 1J9CT 5TQ2H 1PZ2A 1ORQB 1NCCL 2E9IA 2H1PH 3H8NA 4WDIB 3CK0H 1CF8L 1JPGB 2GY7B 3T3MF 1E28A 4GKLA 1Z1WA 2OCCB 1JYVA 4LIQL 4QHKI 3QEUA 1UKSA 1YLBB 5DRNA 1V8HA 4WU5B 3BT2H 4K3JH 1KTDB 4RCAA 3T04D 4IHOB 1KJ2H 1NAKL 4MNGA 1IKFH 4UM9B 1DE4B 3E9UA 1KBVA 3U0TB 3EZ8A 1I1AD 4KUZH 4H0HB 5I1AA 1CIUA 4WTWA 3TTYA 1Z9LA 4U3SB 5CP3A 5J1TC 3QXWA 4H88L 2NR6C 4BSVB 1IAMA 3PAUA 4UU9B 3FF8A 4GSRA 4L3FA 5FCSH 2IDSA 4LCIL 1HN1A 2BVYA 2AEQL 1OAXH 5AZ2H 1BZ7B 5F6HJ 4FTVB 5H94B 5DHXB 1AG6A 2Y36L 4PWKA 3WL9B 1FLRH 2MCG1 4JY5H 3V55A 3JT2A 3TH4T 1WA0X 4KMTL 4KH2A 3LRMA 1M71B 3KH4A 1IC7H 4JE0A 5HYSG 1IC4H 2VDKL 1VFUA 2XN9E 2YGNA 1P5UC 4L4TB 2QDVA 4F8TA 2RIKA 5EU6E 3SBPA 1UD2A 1MJ8L 1DQVA 1UXSB 1RK7A 1KYOJ 4C58B 3NSXA 5DK0A 1ZLWK 3ME0B 4B9KC 1VFAA 3MJ9H 5I8EB 1C9SA 2OPCA 3DROA 1ILSA 1CXFA 5KBDA 2P5EB 4YHIB 1NFAA 3HG1A 1UCBL 1EERB 5AW5B 3PHSA 5CHNB 3EHBD 2XTJB 4JFHE 5DS2A 2H26A 3PWLB 4MJIB 1S7TA 1E27B 2F7RA 4PTTB 2IWKA 2J8HA 5AVWB 4MZ2A 4WI0B 1L3WA 1QRNE 2CGRL 2EICA 1KJ3L 1RIUL 1RZJL 3RWJB 2FX9H 3LTVA 1SMOA 1LNUA 3PV6B 2AXFA 1QFWH 4JR9H 4XH2A 3IMWA 1YAIA 1QA9A 1JNLH 1NBVH 3WEBA 3WXVL 5JDJA 3NSDA 3NGBB 4A7GF 4CN4A 5KSBE 2LLGA 2YD6A 2JKTM 3H6AA 3IJYA 3B56A 1U8IA 3LXUX 1WZ1H 2Z93B 4PR5A 2FD6H 2XG4B 4ANKA 3PDOA 4OBSA 3QNFA 3SKNA 3IK2A 5KSAC 1K72A 4YMPA 1IAIH 2H5UA 4FX5A 4GXUM 3TO4D 3NSJA 4YE4L 3TVMA 3LSOB 2OJEA 4Z3GA 4OSUL 2OMZB 3MCLL 3BZEA 5HGDA 3GRWL 4ZOCA 1FFTB 1AR1B 4FJYA 2FB4L 1ODUA 1UXMA 4YLQT 4YE0A 3UYPA 1SLVA 2XJKA 2R51A 1HL8A 2XV6B 3ZMRA 5F0LB 2E7BA 4OZIB 2XY1A 3MV9E 4I77L 2X4SA 3QAZC 4B50A 3P4MA 1NBCA 2DWEA 1WWWX 1I3VA 1MLBB 3LOWA 3HZMA 3RIKA 5A16A 2AQ2A 4LEXH 4YLBA 1B4TA 1DSYA 2Q2EB 3QXDA 3HLAB 4YJZL 4M1GL 5A2KH 4TNGA 3TOPA 1H15A 2FQGA 5TE7H 3HHSB 3WSQH 1T83C 4Z7WB 3VQ2C 1GKEA 2XLLA 1J7VR 4TSAL 3ILQC 5GGRB 2QLYA 2EINB 1HINL 4KMLB 4QHUB 3BP4A 4W9ZA 5E8NA 5T33L 4GW5A 4XCEB 5E9DD 3DURB 1IT9L 1OTTC 3MJ8A 5AYUL 2FJGA 2FYYB 3WUWA 4EF3A 2HPOA 4IW4C 3L6FB 5F6IC 1BD2B 1EVTC 4HG4K 3NIFE 3STBA 2WBJC 3FCSB 3PUCA 4E5XG 1OY3B 3SCMB 3CGTA 5EZLB 5DK2B 1T0NA 1V54B 3NZ8A 1EGJA 1T1WA 2EEBA 4KGLA 3REWB 1EHLL 4O51B 2JE8A 4FMKA 4ZXBB 2HT3D 3UTQA 2E0PA 5GZNC 3TGXA 3H7LA 3GMRA 2JJTC 1QVOB 2OMBA 4QIRA 3UEQA 1DJGA 2W81C 2Z35B 1EEYB 2WBKA 2P80A 2H1XA 5LGKA 1UHVA 3WFCL 4LNRB 3O81A 4KHTL 5AAWC 3ZE1F 3L5JA 5HGAB 4H2CA 1T1ZB 2VXUL 5CUSL 1TKWB 1JNNH 2BVUA 2JCCA 1CBVH 3PAYA 3BUBA 3MCKA 5B1JA 1G84A 3IXTA 4HJGA 4HEME 2KT6A 1WAAF 1VKXB 4XNQB 1JPGA 5E8OA 4V1DB 1UZ8B 4CSZA 5BXFB 4L1HA 5EO9B 3FFCE 4K5LA 3Q06A 1R3JB 4I0CC 2R0LL 2O6EA 3M86A 3VH8B 4AM0Q 2QHLA 4G9FB 1AXTL 1MJ7H 4KKZA 1BZEA 4MJ5A 5F1SA 2HFGL 3VAEA 1T66D 2YPLA 3GMNA 1KB5H 3KLKA 5FM5M 1DBMH 3H42L 1B4JH 3LRSB 5ALBH 3HG3A 2CLZA 3KXFA 3CHQA 3ZKMD 2IWGA 4M1DL 3WV0A 1GMIA 2Z6FA 5EBWA 3P30L 3CIQA 3DX9B 1D9KB 3NQIA 4ZO7A 1V7NL 2J21A 3VFVA 1BGXL 2GJ6A 1I1FB 1F4AA 2P80D 1UQSA 4OCRL 1XGPB 4P2RB 4DP5X 2ZOUA 1C1EH 3WS3A 3E6FA 4TNFA 1WFNA 2RCSH 4Q58C 4OR1A 4P2OB 4PLKD 4LLYA 5DI8B 1BYNA 4PJDE 1SDDA 1KIUB 1DVTA 1IFGA 2EUXA 2Z4QA 1L7IH 4OB5H 2W0FA 4U6TA 1O9WA 2NY6D 4QRBA 2FGWH 2WTPA 4WEEA 3S8GB 5D70L 4K8RL 3FCGA 3QWOB 4PG9A 2JK5A 35C8L 3C8KB 1HVXA 1A7QL 5DJ2A 3ZE0B 4YSAA 4W9DC 4MA1B 4R96B 5B3JE 3T8XB 3RWFB 3IPFA 3V0EA 3AY2A 4M9OA 1UD4A 1JK8B 2WLZA 3BQUB 3K1DA 4LQFH 1YY9C 4MXWH 5DMIL 3BKYH 5T3ZL 4PV8A 2WC7A 2J6WA 3QEQD 1XF2B 2MTAA 2CXGA 3OG4B 4IGBD 3AFLA 3OF6A 4LSUL 5B4MD 4D0DA 4HCGA 4XPHH 3V5KB 5JW3L 3MJWA 4I18A 5GS2D 3VRLE 3VG0L 2F74B 3ZRFC 2JFCA 3PGFH 1D6VL 1S9XA 5E4AA 2OJEB 5DSCB 5IJVB 1PZCA 4N26A 5GS0C 3GS4A 1KN4H 4PJIA 4NQXB 3TYFB 1AMYA 1ZE3H 1SBSH 3B7UX 1EJ6A 3CX5J 1A14H 4FJ6A 1J8HD 2XVKA 3B7YA 3NCWA 1S5IL 5E03A 2VLLA 3LNDA 4P5MA 5FWQA 3VXRD 3MRPB 3ZZLA 2HRLA 5IJDC 3CQPA 5K39B 2DM4A 2HTKC 5B38B 2WLKA 4UAOB 4HBCH 5IF0A 5I8CA 4PJXF 2V8MA 4IEFB 4J7RA 4D8PA 3G9VA 2DWYA 1MH5B 3L5HA 4UT7L 4AYEC 3DHUA 4WI0A 1XD0A 1J0KA 2AANA 1M56B 1UB5B 2LLLA 4G42B 1YEJH 4XBGA 2BW4A 1I4FB 2V2XA 5L2KB 4AKQA 1CR9H 4AQAA 3AS2A 1LK3L 3VFUB 4QJ5B 5FO7B 1TQBC 3FB7B 1D6VH 3VXNB 1E6OH 5I5IA 3TJEL 2WUBH 2MCAA 4YQXL 2WY3B 1B2WH 4O00A 1OAZL 5FO9A 3VU1A 1A65A 4NO5B 3ESPA 4LAQH 5TE6H 2YBGA 5JHDD 1YMMB 1L0YA 5DD3L 5E99H 1E5CA 4WWID 5I6NA 4FXKC 5EZLA 4KJPC 4NM8L 2BSBA 3LD8B 1OM3H 1JZIA 1BJ1H 2DIJA 4HS8H 1JYWA 3TBYB 1FAIH 5EG6C 5I1GH 2VMFA 3SYPA 1KLGA 1U8QA 5C7XL 3QJHB 1NGPL 1P7KB 1UB6A 3VO0A 2X3BA 3BN9D 1T89A 5KOVC 4PJFA 2YC1B 3KPRB 1U8JB 1BV8A 1ZSDA 2FAUA 3KPPA 3B2VH 3QUHA 4R7NA 3QIWA 4MS8C 4X5XA 5AVTB 4P05A 4R90L 3K8MA 3LNGA 3R06A 3W9DA 2AF2A 5LN4A 4FQXA 1WD8A 3S35L 4JL2A 5C2UB 2H0JA 3ESUF 3MRRB 4GI6A 1F90L 1JHLH 5IB3B 2WAQA 1NFIB 1EQWA 4ISVA 3ARQA 2CU9A 5E51A 1TPXB 3DA0A 4F5CA 3I3BA 2IAMA 3IMUA 1KB5B 4U1KB 2DWTA 2O5ZL 4OZHF 3KGTA 3PHQA 3EJJX 4RH4A 2C9PA 2WK2A 3BD4A 2XWXA 3QXAA 4Y5XA 5JDSA 1F11A 4AEEA 2CPCA 4N5UA 3T6WA 3BKJL 1YHPA 5GGQL 4KKBD 2F2HA 1R5IB 5HI5C 1K8IB 4ZXBA 3WOVA 4HMEA 5EEXA 5A2CA 5ACZA 1T1WB 2B08A 2LVEA 4WUUA 2WIIA 5FOJA 2W07B 1INDH 1X6NA 2RR3A 3WE6A 5EHFA 3ZR6A 2UXVA 5ID0B 3IFPB 3K2UH 2O6PA 1QFUL 4PJXB 4WTZA 3RWJA 2AQRA 2UZXA 1KIRA 4JRFA 1HCFX 2YXWA 3DDFA 4KFZC 1JF6A 3F58L 5GJTH 1GCYA 3DPDA 3ARVA 1QPKA 5J6HB 1G9ML 4U4BA 4UBDC 3OMZA 3UX9B 3E8UL 1NDTA 4XCYB 4QHPA 2YK1L 4R8WL 5LGHH 1C5CL 2A6KA 2VKWA 1L5GB 3S48A 2XY2A 3NJMA 3ZHDA 3SDCA 3J7HA 2C3VB 4XO8A 3U1SH 2DQDL 5C9JB 5BS0D 4KQ4L 1JZHA 2MFNA 2ICWA 4N3TA 4JO2H 4IOSD 4OVUA 3VXMB 3GJEB 3LZFH 5JW4M 4HIIA 3UEZA 2DWEB 1EZLA 1KACB 1AGCA 4XWOC 5DO8A 4JFFB 1CFQA 1CLOH 2EDKA 4JM2D 1NTDA 4PJDA 4E36A 3S3BB 1NCUA 3HBGA 4AC4A 4F57L 1C7SA 4IIQC 2CK0L 5C07B 1I9IH 2GSGA 1TEFA 3NJVA 4DW2L 4PJAB 4IGBC 2MWCA 4KY1H 3ES6B 4OZGB 1K9TA 5HGHA 3K81A 2ZYHA 2ZUXA 1C16B 3VD1A 4BJLA 3QCTL 4R4BB 3BVWA 3IXTB 4HJGB 5EOCH 1TDQA 2ICEC 4NQVB 1XB6A 2N3JA 4NZFA 4QXUH 4GG6A 4UT6A 3V4UH 1TETH 3IMRA 3LS4H 3PV6A 4FXGA 4IKNA 4WENB 5L8LB 3PNRB 3H7BA 1U0QA 5ALCH 4G8GD 5IW1A 1RUAL 1GS7A 1YMHA 1Z5LB 4XWOD 1FCGA 3SGDH 1YJDC 3AJ7A 2XT1B 3D25A 5IM7B 2YRBA 1NFDB 4PB9L 5C08A 4PCTA 4NP4H 1NCOA 1IFRA 3S5LA 2G4EA 2WOBA 3F7QA 5GXBB 1EBAA 1G4MA 4GKSA 2J4WH 2DM3A 2EC9U 2R0WH 5D1XB 5E6ID 2F6AA 4HUVA 5AYTA 3TH3T 1E9PB 1T0NB 1P2CA 1U4EA 3LJ3A 4NO0A 3KM1A 4UZUA 1DQLH 3PQYA 5C8JB 4JO4H 2APFA 4OLWH 2XI9A 1A3QA 2H0EA 4IJ3B 3SGJC 2QFRA 3MRQB 4P5TD 2BY3A 4M7KL 1HHHB 5BV7H 3UO8B 3AU0A 3KAAA 2R2EB 5IFJB 3TM6A 5CGYD 5FC9A 4OJEH 5CEYB 5HVFB 5CLXA 2V17L 5GRJL 3T1FB 2JXMB 3RFZA 4Y4KA 1T04A 4OJYA 4WWNA 5FYJH 4JZOB 2Z0UA 4U6XB 5I8CB 5FCUL 5KJRH 3O45B 3UCRA 4CNIA 4H1LB 4ALAC 3KGRA 1PGRB 4GAFB 4JQVA 4X80L 5GSVB 4DUWA 5H4ZA 2XQYK 3FBKA 1NKOA 3HI5H 4LASH 2EXSA 2PUQT 3CFTA 4N9OB 5GHWL 5J11B 5IHHA 4CUCA 3QIBC 1M7DB 4WCYL 1D7BA 4LCCC 3EGXB 3D0VA 1PY4A 2F15A 5EFIA 5EH1A 1AHWB 1CU4L 3IU3B 2NLJA 2I60H 4YBLB 3FQXB 3P0GB 2I9TB 3HN3A 1UKQA 5LAXB 4WUUD 4R2GC 3IJ7A 1KB5A 2IFFH 2MJWA 2IGTA 4KO6A 3I3DA 3HS0A 4YO0A 2OX5A 4E41E 5FYKD 2F53B 5F6HI 5GZND 3ARTA 2P46B 1FNGB 5BOJA 1J9SA 1MAJA 5L88H 3IB4A 3RDTC 2A74A 2VXTH 3Q7JA 5AB1A 1FFOB 4OFYA 1AG0A 4NKIH 2X38A 5C0EA 2QTVA 2NZ9D 2RAMA 2P48B 2QEJA 1IGIH 1J1OL 1ETZA 1ZCRA 3WN5A 3F84A 4N8VB 4QAMB 3NP3A 2ENSA 3GRWA 4KHXH 4O2FB 3C8KA 3TZVD 3COOA 3LHPH 4JCMA 1LYQA 4H8VA 4WWKB 2BVQB 1FSKC 4UT6L 2Z4QB 1A1OB 4M7JH 3QULA 1EFQA 4FD0A 4FQLH 2CR0A 3ZE1B 3RZCC 1DJZA 1CK0L 2BNQD 3O9WC 3ARZA 5F1IA 4BZ2A 4N2FA 2FBRA 3ZKXB 4ZMLA 1G94A 3RIAF 2ED7A 3QDGE 2CRMA 2NCEA 4G7QB 2JSFA 1FVCA 4Y4FC 2KC0A 4HS6B 1LWRA 2CBOA 2IFGA 3JVFC 3DX8B 5GS0L 4RFEB 1AIFB 2DLHA 4I0KA 4W9CC 1TYEB 2MH4A 5SWQA 4J3OG 5IQMA 5KYYA 5CU5A 3SY6A 1AE6L 2WXOA 4ZMQA 3KVDD 3GS0A 3VD0A 3BH4A 5HHVL 4LPXA 4OIIL 4GEIA 4PLJC 1OEZW 4WF7A 3IGUA 2ATKB 2WWMD 2X3AA 5EA0L 3IS0X 3ULAB 5HY9A 3O2DA 4N2AA 2J8UA 2J2ZB 4OFVA 2GI0A 1E8YA 3P4OA 4U4IA 4NI6A 4L05A 4J4PC 3CN4A 1OALA 1I3UA 1Z6JT 3DXAE 1PQZB 3Q13A 3VXOA 4Q9CA 3R1GL 5MEND 1IZKA 2WQRA 1OP9A 3B2VL 3F83A 2JTDA 3FAWA 4JFZL 1MZZA 3TH2T 1SUJA 3WFDL 4O4YH 1KPRA 3U6RA 3U4AA 2GSIA 5DCCA 4G8AC 1QBBA 2IXQA 1MVUB 4PP1D 4PJ9A 4NOFA 1LLAA 4KOBA 3ETTA 1RP9A 4LEXL 1U8MA 1NSNH 1YYLL 3BD5A 3VVWA 4ODWA 4WK4B 1CCZA 2DJMA 3QUKB 3VXPB 2ZX9A 3FT0A 1KLUB 3DVFA 4HOXA 2HRHA 2YKKA 2QPSA 3UTTA 3I9GL 3GIZL 1MCFA 5DFVD 3OX8B 1EAPB 1TVBB 1NIDA 3GJFK 4NQUA 4PJ5B 1S78D 1UATA 3IGAB 3U46A 1UOWA 4RAHA 3DIDA 5F9JB 3LKNB 4Q52A 4XPBL 3TIDA 3CQFA 2WXFA 4Z7IA 4PYGA 4G9FD 5D93B 4BUQA 2XV3A 3SDCB 3L9YA 3ZT6A 1IGCH 3WKYA 2EDXA 3QO0A 5DJ0B 5K93A 5D1ZD 3HI5L 1U8CB 4LASL 3N40P 3I75B 1QEWA 1XXDC 4PRDB 1VPOL 4UTBL 2HX7A 4TTGA 3WXWH 4A2LA 1QLEH 2G3XA 1N0LA 2N7AA 1HNGA 2FH8A 2L7QA 1WQVT 4LARL 1J0YA 4DP8X 3TF7C 1NPJA 1IBDA 1OGAA 5ECGA 4MJID 4NUQA 1TZOA 4N2LA 3US9A 3BXNA 1PMYA 1P5VB 1ROWA 2P28B 3QIBD 5DK3A 1HFUA 4PVLA 4OBRA 5L88L 2ZCKL 2PYED 3ATFA 3M07A 2M8XA 3DXAB 4ZMPA 3WJMA 4JO1H 1UM6L 1QBLL 2VZVA 4RLDA 4WNQA 5DD5H 2DQMA 3SODB 4NRYB 7CGTA 3UYRH 2VERA 5EU3B 4LFHG 5DMKA 2ERJB 3EJYD 3IDIA 3NIDB 4BWTA 5D93C 5E2UL 4J3OC 1KC5L 4HQQL 4MBRA 1LD9A 5F97E 4OIAA 3D0LA 4OGAC 1U91B 2HLFD 3GBEA 4X98A 3RPIB 4B60A 2IBBA 4HZAA 5J12C 4YGAB 4N25A 3QUXD 5MERB 5ANMA 2D9CA 4O02A 1FL3A 3HE6C 4A67A 3H0TB 2KHAA 3ARXA 5HHNA 2ZG1A 1MREL 1FL6B 4NP4L 3IXAB 1FP5A 2I32A 2VDPB 4J3BA 5HJGA 3UC0H 3ZO0A 4PWIA 2WVSA 1TJMA 2F1EA 3GTTA 3MO1A 1MPAL 4L3ED 2DDQL 3UFIA 3WCYA 3HMXL 4MJ2A 4IKJA 4R7VA 1MDAA 2LV4A 5F7DA 4W9LC 1AXIB 1ND0B 4NKOB 4CJ1A 2H3NB 3CMOH 5D7SH 3RWDB 2FHCA 5T5FL 4M3JA 4GPVA 5DD1L 5D2LF 4EKXA 1AGEA 1LP9A 1MHEA 1OPGL 5FLVA 3RVTC 4HUXB 4JUSA 4N0FA 4WTXA 4F2FA 2WQWA 5IG7B 1MCOH 1GL4B 3DSFH 5CBEA 5K1VA 1EJFA 4PW9A 2GTZA 3MBWB 4E9RA 1N0XL 3MRMB 1R3HB 4NERA 5IROA 2R2EA 1ZVSA 1RLWA 4DP7X 5DJ6B 4KOCA 1S2EA 2VDNL 4XP5H 2B5IC 1BECA 2B1OA 3L4UA 2AQNA 5J12B 3IWUA 5FDWA 2J73A 2D03H 4TPRL 3AS3A 1VIWA 2J56A 3KYMA 3DX3A 4LSPH 4AIOA 1EX0A 4N2HA 3PP3H 3QIUB 1YNTA 4LDOB 5KBNC 2XTJD 1OXYA 4HHAB 5KAQG 1S9WB 4NKMA 4LLWB 5KBPA 1FUNA 4ELMB 2V3FA 4PWJA 4DAGL 2FYVA 4FS0A 4JO1L 5DD5L 4L4VB 2FCBA 1EAPA 1TVBA 4KXAA 1YJDH 3IJSA 4AVHA 3ULVH 1MQKL 4X9GA 1KTLA 3G6JF 4Q89A 1GAFL 3NK3A 4QXUL 4UZSA 2XZAL 3QNZB 1S7QB 4X42A 2DL2A 2QADD 4P4RA 4AQ1B 4GI9A 2JIXA 2BS71 4G5ZH 4JG0H 2NY1C 2BSDA 3QVAA 4N8VA 3X12B 5C6WH 3MNDA 1NZRA 5DS8B 2R2BA 3FL7A 3QZWA 1RCYA 5TF0A 3B7TA 2Q8AH 3ESOA 3H9ZA 2QKSA 1QHQA 5KSAB 4K9EC 3HW7A 5AYQA 4F80A 1BVNP 2RQ8A 4YR6B 5E70A 2BSED 4PUBL 3QI9D 5FO8B 4FG2A 4FNQA 5D96B 4MD0B 2OTUA 4DGUA 4JDZA 3UBGA 5BVPL 1XQ4A 2FATH 1QTPA 3R7QA 5JXED 1I8AA 3N40F 2NTSP 4GS7C 3HNVL 3UPCA 4Y9EA 1D5BB 4HHGA 5E5LA 4TQ8A 1TSRA 1HWGB 3TP4A 4JDTH 1DHKA 4W6XB 3VA2C 1GGTA 2EC8A 1MCCA 4FI7A 3TV3H 3UTPE 2X5PA 1HQ4B 4Z7UF 3ZY7A 3FQUB 2AEIT 1QFWM 3MLZH 2EVFA 1D5IH 2VQUA 2WNXA 3RWEB 1Z5HA 1RUQL 2X10A 5T3ZE 4U6XA 3L3HB 1OGTB 1LNUB 3RA7L 1FSKB 1SXSA 3CU7A 3AS1A 2YRPA 1HEZA 2JXMA 1CTMA 4WNSA 3EOAA 4R4NC 5D8JL 2F19L 4BHUI 5D7LD 4HWBL 2Y23A 2X70B 1YUHB 5B3JF 4LCWE 5JOFA 2E9WA 4OCNC 4M6NH 2ZWYA 3JXAA 4P99A 4KZDH 4JDTL 2FDBP 2OJZH 2YN3A 2VAAB 1OK0A 3EOBB 3IJ8A 4MMZA 3ESMA 5CCHE 5C0CB 3VFSA 1UXSA 1SLWA 4XMUA 4ADJA 4WW1B 1CDGA 4OU3A 1BLNA 1KENL 3HN5A 3TO2B 4GT7A 1DANU 3DX2A 3HZMB 1N18A 3MOQA 4JY4A 1QACA 4Y1AE 3KPSE 5BRQA 4ELMF 2O6FA 1I7ZA 2P5WE 1WUNT 5JUEL 3MRHA 4OSUH 1JGVL 1J8KA 5D71H 4HWEL 2VRQA 1FG9C 4F7PA 4GP5B 1S7VB 2GY5A 5F0JB 3HE6D 2BRQA 2XZZA 12E8H 3TFKC 2J5LC 3DX7B 2X53A 4E9XA 2X6AA 4JRYA 5B1AB 5E8OB 5I1IL 3RVVC 3SKMB 3HI6L 3K5RA 3UGEA 3U30B 4F8QA 3BZ5A 4EOWL 1SY6H 1VESA 1CFSA 3WFBH 3LV3B 3CHRA 1QW9A 4RGNC 4XVJH 1SXBA 4Y8DC 4FQLL 4MXVE 3SO3C 1TU2A 4DGIL 4F2ME 2WYIA 4PUBH 3AY4A 3FRUB 3BP6B 1D2OA 2FHBA 5DURD 4OCSL 1ORQA 4X7DC 2B9BA 4BSWA 1J9RA 3UXFA 2HA1A 1NM9A 4HC1L 4CSTA 2N7SA 3WTXA 5F7EH 1ODAA 4PTTA 2V2TB 3CZKA 2Z35A 3DHPA 1AHMA 2UWEE 3DRTB 4JQIA 5LQBH 2X4QB 1RUKL 3SE8H 2NYKA 1H8NA 4PIBA 2CKBA 1E3FA 5CHNA 3EGDB 4O2CB 4MQSB 3VXUD 1WFUA 1BIIB 1RUKH 4P2QA 4OUUB 3TV3L 2BY1A 1CFTA 2UY7A 3FONB 4ZK8A 1FVCB 1YEWA 1PFCA 3O3AA 3OG6B 5DGQA 5DUMH 5FYLL 2OP4L 1E9PA 3A6BH 1WO2A 4P2OD 3AREB 4XNDA 1KXTA 3V52L 4DTGL 3NCXA 3VXSD 1JHTB 1UXWB 4NM4H 4QKXB 4LLVB 4EN3B 1T0OA 2FE0A 4YSQA 2DN7A 1PNCA 5LHDA 3FUNA 4UIKL 4JRYE 3NCCB 3BAWA 1CFNA 3IE4A 2P5WB 4LRNL 1SXNA 3BZFB 1JNHB 2R69L 3FOLB 1QSED 2F8XC 1KIPB 4DHLA 5CEXA 4AGMA 2Q3ZA 1CL7I 3QCTH 3I9IA 2EC9T 2DJSA 5TD4A 1G0DA 3E6HB 2YFNA 4LEEA 1SHMA 4EDXB 2D7TH 3RRQA 2E4FA 4YFLI 2DI7A 4LPVA 5KVMC 1J10A 1E42A 1WICA 1I9IL 2X4NB 1MRCL 2ZJSH 3G6JE 3PL6C 4WU5A 2DEXX 4IGBB 4UILH 5A16B 2DTSA 3P69A 4XMTA 1G9NC 4JMXA 5DD1H 4EMZA 5E8DH 3RJQB 3QG6A 3WIHL 4AYFA 3ETBF 4F2MB 5BZZA 4IRJB 4J3WA 4U3HA 4XPTH 4P49A 2NT0A 2IQ9L 2QR0B 2XUWA 3LQAL 2CDFB 1Y0LA 4U1GC 1RSFA 4FFYA 2Y6SD 2Q6WB 3E8VA 3LMJH 1NCBL 1BG9A 2FL5A 4L5FE 2IQAB 4NKIL 2FJSA 4O02B 5DEZA 5F3HA 1OTUD 1RFDL 4Z3TA 3D0AA 3FN3A 4DEWA 4HCIA 2JCWA 4GAJL 2OTUB 2ZP9A 2DQ6A 3C8DA 3WIFA 3W38A 5EO1A 2WP3O 4BGDA 4KRPC 3C5JA 3S34L 1U8NB 2XSKA 3HE7A 4QOKE 2PCFA 1NM4A 4OAWA 4ODXA 4RESB 4CU8A 3FB5A 4XE0A 3ENEA 2GJPA 5HJ3A 3GFUA 2WXKA 5HDBE 3L4VA 2R4SL 2JIXB 5IHZB 3ECVA 3KDMA 2SEBB 3QUMA 1OGAB 1RULL 4QRSB 4XODA 1OHZA 3OKMA 2KYIA 4OCLC 5ANHA 1ZA3B 1XR9A 4ATTA 2ZQKA 2VABA 1FORH 1NCWL 3QFGA 1KIUA 5JHDB 1E43A 3HR6A 2OR7A 3ZUCA 4OT1H 3DX6A 1G7PB 4LARH 4NQED 2DDQH 2IV9A 1T5WB 3QZOA 1ACZA 2Y7OA 3RKPA 1CGXA 4K8RD 1YEKL 3SDAC 5I2IB 5H2BA 5GRJH 5AVQB 4PCKA 2ZYIA 1DBAH 5IB2B 4XPFL 1IAKA 5LXGH 1MREH 2WWKT 3IPEA 2VXQL 1FBIH 4A63A 5DC4B 3HLKA 3RVUD 3ZKNC 1KCSH 4YHKH 1JDCA 3GB7A 1OCWL 1K6QH 1NCGA 1JVLA 3RL1A 5IOPA 1ET7A 3IDXH 4KROD 3ZBMA 4DVBA 4E9TA 1IJNA 2V2XB 5EBMA 4KK5D 4GBXB 3GLAA 1UB5A 4XI5D 1SN0A 3BIBX 4HIEA 2HKHH 2LU7A 1UM6H 4PJFE 4ANXA 3UAJA 1R3JA 3CFNA 1LO2L 4K3EH 1JVOA 4LCUA 4U1IA 4W68A 5E1AB 5FOBB 5J3HC 4TYUA 3F58H 3DHMA 1Q0XH 4X6DF 3ISYA 2OMTB 4MB5A 4XZ4A 1DANT 3NA4A 4W9IC 1TIUA 5HHVH 1CTOA 2WWNA 2B1AH 3MKGA 2NW3A 5DEFB 2Y2YA 2HFFA 4RRPG 5JHMA 3TBSA 5I71C 1U3ZA 1XGRB 2HWZH 5C7XH 1JZ8A 4PJIB 1CICC 3GXTA 1U8HA 3X12A 5HGAA 2CH8A 4P9HC 5M95B 5AWNH 4XOEA 4P4RB 5C3TA 2EJ1A 1E90A 4C8XA 1KBGH 4UUJB 3MRBA 1OK8A 2Z9TA 3II2A 3VD7A 4BK4A 2YAFA 5CCKL 2FX8L 1SMDA 5F7AA 1CE6B 2OMXA 2CKBH 2ZKHL 4QXTB 5DD6B 4L4VA 1A7RH 2FUTA 2XWTB 1RH8A 3MGTA 4YQXH 3TJEH 3WGUB 4WI5A 1LP9E 1X4ZA 3N41B 4FQ2L 2JKIS 4DK6A 4HWEH 5DJDA 4F7TA 2AK4D 1FYTB 2CQVA 4M7JL 4UOJA 4PY8I 3RDTA 3REWA 4HGWB 1DBJL 3WLBA 2G5BB 1W16A 4APQA 5DJZA 3SCMA 4AG4H 3W11C 3EOBA 3OGCA 1YC8A 2PXYD 3BPNB 3HS0C 3IDGB 1X5KA 3QDJD 4XC1H 3ZTJH 5BMFH 5KBLA 1HINH 1I1YA 2PWDA 3IVKB 1TLMA 3Q01A 4F58H 4ETQA 1CD8A 3LYRA 2PW1A 4A7UA 3K80A 4IU2B 4MWFA 4L8BB 1E6JH 2OMNA 2CUHA 4LCCA 1OAQH 1QFWL 1XH1A 4TSBL 4JFOB 3SB3A 1U8KA 2B1HL 4EZLA 2H6PB 4U1NB 4ZMAT 3PJLA 1ASOA 2GUOA 3QO1B 3E6FB 3FDWA 1OARH 4NO3A 1MHEB 4KAQH 4IKKA 3BEVA 5ABAA 4DP0X 1DCEA 1M6UA 2VOTA 1VEMA 1IBGH 3T77B 1MQKH 1QFWI 1R5IA 1X5XA 1OLZA 4U1SA 3C09B 3NRFA 2APXA 1FFQA 2BERA 2EO7A 4LPWA 5SWSE 1R47A 2HG5B 2Q20A 3TXAA 3V4PB 4E42B 3LPFA 1XMWA 2WSDA 4MJ5B 1YN6B 3P0VL 5E8EB 1FL3B 3GXUB 3WUZA 3H3PH 3NAAL 3RGVD 2GEQA 5KANG 4Z7OE 1IC7L 3R18A 2ZG2A 4D0DB 3ULUL 4FP8H 2QQQA 1Z9NA 1QABA 3P9LA 4M00A 4TVSa 1X5AA 1SOQA 4NT6A 1Z9PA 4XNMB 3CFMA 5BVPH 5MHSD 2QSCH 2V3DA 4BUGA 3FT2B 3QZWB 4LLDB 1XIWB 3ZMNA 3QUGA 3K4DA 5H37H 1QTYT 3MC0A