2KYIA

Solution nmr structure of dsy0195(21-82) protein from desulfitobacterium hafniense. northeast structural genomics consortium target dhr8c
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
MDNRQFLSLTGVSKVQSFDPKEILLETIQGVLSIKGEKLGIKHLDLKAGQVEVEGLIDALVYPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Combining NMR and EPR methods for homodimer protein structure determination.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
total genus 12
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kyiA01
2KYIA 3IPFA 2KS0A
chains in the Genus database with same CATH superfamily
1UWEL 4PWFA 5DURD 1B4LA 1TZAA 4FNLH 3HMXA 4H8WC 1VZHA 5JHLH 1AHKA 3DC0A 2C3VA 3HW7A 2OMYA 4HMDA 1IQWL 5KBNC 1JGEB 1OTSD 2W95A 4QTFA 3LNIA 1OK8A 2J55A 3I75B 3I3BA 4JJ5B 4DTGL 2W9EL 2XZAH 1ZS8B 2ID5A 3KH4A 3TJEL 1SEQL 1SOKA 4HCIA 1U8PA 3CG8A 5AKVA 3UACA 2YPVA 4ZQTA 1UOVA 1S7TB 3D5OF 4KKCC 4V1DA 5EU7C 5HJBA 5DHVB 2IDQA 5FM4A 2WTRB 4Z7WA 3IDGB 3V0VA 4HZAA 4OZFH 5K5YA 2F19L 1DZ0A 1MFCL 4MVBC 4B7LA 3SPHA 4RCAA 3FU0A 1TZHA 4M5ZH 3HNSL 4QHUB 4P48A 3QCVL 3QRGH 2NW3B 2HJFA 1ODUA 5EO0B 1ZTMA 3ABMB 5IQNA 5IVOA 1UZ8A 2FECL 1A7NH 5DEGA 4AOFA 1Z32X 4RGMC 2VL5B 4MXQD 2ZP9A 4GKNB 1LDPH 4FEMA 1GTNA 4Q2ZA 5KYUA 5L7XH 4XC1H 3B2VH 3FO9B 2ARJA 1D6EB 3SBRA 1FL3A 3PHOB 4G9FE 3NCBB 4AGQA 4ANVA 3E7JA 4BFRA 1E4JA 3CN3A 1I7UA 1XEDA 2JJTA 3O8XD 1A14H 3IDXH 1EHLH 3HLAB 3GSXA 2H32A 3LZLA 4HZ1A 4ZW6A 5E2VH 3T0EB 1A5FL 2EXSA 1J9RA 4FZEH 3VSQA 5D5MA 4EAEA 1FV1B 2PTUA 3EH3B 1UJ3A 2OV0A 2ISDA 1JZ5A 1R1CA 2YIHA 4PVNA 5HHMD 5DVNA 3WHXB 2NW2A 5LQBL 7PCYA 3PFQA 3FB7B 4PLOB 1UM6L 3D3VA 3HHSB 4JFOB 5HBBA 3CFCL 3LNGA 3QPXH 5BRQA 5TTRA 3DK2A 1U0QA 2ICEA 1IBGL 4WTZA 1FCCA 4ANXA 2DS4A 4FG2A 3D3VD 1PLBA 4MD0B 1UWFA 2ZT9C 1I9RL 3OXRA 3QJFA 3R06A 1VDGA 2N0KA 4EOWL 5A2JH 4M29A 4AEEA 5IMKB 4XN7A 4GW1A 3DBXA 3FCGA 3GTTA 4OZHE 5H94B 1OO2A 9PCYA 4FQ1L 2HUEA 4KZEH 4HJIA 3HA0A 2OULB 3CN2A 4U3SA 3IWVA 1TEYA 2BOLA 1FLRH 2VE6A 4AEHH 3LIZH 3HG2A 3MLRH 3MACH 4M00A 2XN0A 2WOBA 5E24E 4ZDHA 1U9KA 2D9QB 3EHBC 1BD2E 1BX2A 5G4OA 2LTQB 4L9LC 2PP9A 3IAGC 3KH3A 3HVDA 1DJSA 3LVTA 4G9FB 5IBTL 4EDWL 3WGVB 4WFEE 2J72A 3MNVA 4TOYH 1A4JB 1PG7X 3HMXL 3W0WA 1LTXA 4Q14A 3W57A 3JTBA 4Y0GA 4JRXA 4NQCA 4DK5A 4RZCB 5KTEL 2WXHA 2DWXA 2YD0A 3W0WD 4JRXD 4NQCD 1N64L 2W0FB 2VLME 1DFBH 1DDHA 1AY1L 4BJLA 2WO2B 2IH3B 3UPAA 4Q9RL 3WNMA 2WWKO 1K6QL 4WEEA 2MOQA 1QFPA 2G3ZA 2XPYA 3ARGA 3BHBA 3ISRA 4MKTA 5DQJB 1RZGA 4FA6A 2WZPA 4R8WL 1J5HA 2P43B 1OM9A 4HJ1A 2AQPA 3GK8H 1LEIA 4Z77B 2PYED 2COQA 3CLFL 1CFVL 4NO0A 4KJPD 3DSNB 4R4ND 3F04A 4W9GC 4FP8H 3UCQA 5IEHB 5F71A 5LJYH 4RWYL 3TFKD 1HSBA 4JM2C 4NO0D 1HILB 3U0WL 2DQ6A 4K8RH 5IR1B 2R0WL 1GHFH 2KHAA 1BD2B 5AW1B 5B3SB 5ENWA 1TJGH 5I1CL 4L1DA 4XP5H 4PJ5D 3LRGA 4AYBA 4ZXBB 4OM0L 3T8MA 4BSWB 4PJAA 2VZSA 5IK3B 1H9VA 1RUQL 1PG7H 3AY4C 2HCZX 4NNPH 2QQLH 2DF3A 4X7SH 1U8KA 1SMAA 2GTWA 1F58L 2G9KA 1KGIA 2XY1A 3IJ9A 3BX7C 3WUWG 2W9DH 4YHPA 3AREC 5IW6B 3UPRB 2ERJC 5EWIH 4F37F 4KZ0A 5K9KB 4JKPL 4OUUB 4OFIA 4J8QA 3KLSA 1SJEA 2KLTA 1FNFA 4NQUA 5ICYB 3T0DA 1DL7L 3MBEC 3BLBA 3PUUA 3B43A 3KPLB 1DDTA 1KPVA 1KTRL 4J3BA 3ML9A 5CZVL 4LPYA 2CDEB 1NFDE 4HVBA 5JTWA 1N6QL 4PJCA 3LQZA 1G4MA 4UNVA 4TULL 4NHCH 4A2FA 5F7BA 3FT2A 1JGDA 1JI2A 1SVCP 3ZHNA 4BKLB 2IPUK 3V5DB 1UH3A 5D7JA 1RJYA 4I9XA 3UERA 5KW9H 3V0EA 1MWAB 3GMPA 1IAII 4L8SC 5D7JD 3SOBL 4AVIA 1FO0H 3PWNB 4FA7B 4XMWA 3QNZB 2OI9B 3CSYA 3V5KB 4YHML 1J9SA 2XWJB 5C2BL 5EZOL 1EAOA 5EIIA 4NI6A 1PJWA 5HYJE 3LRMA 3NSYA 1EJOH 3EJJX 4S0HA 3RL1A 2WMPA 4Q8BA 4A39A 2WLNA 3MCKB 3MLVH 1MELA 3E9TA 3GXNA 3ZTEA 1QWUA 4GO8A 4NNXA 4Y5XA 4LEOB 1BM7A 3LN4A 1WSST 3MRHB 5I1IL 2E7LA 2ENQA 3S36X 3EDDA 2FJGB 3L4CA 5HHQB 3P4LA 4PW4A 4JZJB 4G82A 1UWXK 3BGMA 5A2BA 1NFDB 3G5YA 2ZUVA 1BFOB 5D1XE 1FRGL 4OLUL 3MUGA 2AQTA 3NABL 4AM0A 1BJ8A 5GGVL 4YPGB 5KSAA 1HHGA 3U1SH 2C4FT 4R90L 1USQA 2F53A 2RD0A 4I1NB 4IU2A 4TSCH 5DFVC 5KSAD 5DMKB 1EERB 3FK3A 2J1ZA 2FO4B 3T8VA 5CFAA 4GQ9L 2ROXA 3OZLA 5FYLH 1VKXA 1BDYA 3P4NB 3UTTD 3LMJH 4I88A 3B7RL 4WUKH 4FQIL 4RMWA 3CUPB 4FABL 3QIWC 2QGDA 3UIYA 2X88A 1G1KA 3ZHDA 5E70A 3SE9L 2J88L 2Y5TA 3FH8A 5AVZB 5C0DB 3HS0A 1HDMA 4NM4H 1XV8A 5HYJB 3HG4A 2AKRA 3K6FA 3OSVA 1MFBH 2CA4A 3KLAB 3KWUA 2QGEA 3IKCB 3RIKA 3LPGA 1FH5L 5BUGA 2P24B 4EI6A 4L8BB 3K6OA 3RJQB 4OBSA 3QG6B 5FYLE 1WDAA 1QP1A 3MA9H 2VSCA 2YD8A 3LQAC 1RZPA 4LPVA 3QH3B 5I73C 5DEFB 4ZO8A 3HB3D 4B6ZA 5IOPB 2FHFA 5GS1C 4OGAD 3GSWA 3FUMA 1TPXB 3S36H 2X6MA 2IBZX 1AZVA 1KLUA 1RJZA 3QIUB 1YPZE 4LARH 4X5LA 2VDRB 2WBXA 5D1XB 3EIFA 4G1MA 4W68A 1LO3L 4YJZL 1M1XA 3FTGB 2J73A 3B9AA 5IHBA 5JXED 2VMCA 3EH2A 1ZJBA 2PCPB 3GQFA 5LGHL 4N90D 5LB1A 1MIEH 1P7KB 1RIHL 5DRXA 4AV5A 4DKTA 3O2WL 1IEAA 2IDUA 3FT9A 3KCPB 4S0TD 3MV8A 1WHOA 3FBQA 2Y1VA 3AROA 4F8PA 3KR3H 5KSBF 1RFDL 3B7YA 5HVHB 5JPNC 2MCPL 1A4AA 1EO8L 1YY8B 5KEZA 4G2AA 1BOYA 1OZUA 1VENA 4LCIL 5ETUB 3ETSA 1CU4H 1HINH 1VERA 1X9RA 4IOFC 1I4FB 4OV6F 1UXMA 4D3CH 1P6WA 5I6MA 4ATWA 1E5UI 2VSDA 4LVHB 5T3XE 3IVKA 2DJ4A 3OV6A 4CKVX 4R2GB 5CUSH 4WHTA 3V4PB 3RDJA 1PY9A 5FGSA 1AFVH 2I7SA 4IMLB 3IU4L 3Q43A 3O6FD 4HSAC 4ZPVA 5TDPA 2XPZA 1ZXKA 5DUJA 1HHJA 1MCPH 5L88L 4I1PA 3IFNH 4R7NA 25C8L 1I1FA 4Y1SA 1WFMA 4WHYH 1YDPB 2ZG3A 4AQAA 4GY4A 1OGAE 4BK5C 2ODHA 5ESQB 4K15A 5IGXL 3SDCD 1G4RA 3VFGL 3W82A 4CSSA 3QQDA 4YSQA 4I3GA 5AVQB 4YC2C 1FNHA 3NUKA 4JHZA 3S3PA 1A1MB 1YPZB 4X9BA 4NGHL 4YE4L 1M3JA 3QNXB 2EEAA 4MXVE 2J44A 4Q6YA 2LABA 1DSYA 1JRHI 4PR5A 3TN0B 2X70B 3QYNA 1RUPH 4PJ8C 4HJEA 5DSCA 1I8IB 2BWIA 4X6DF 1G7PB 2X7LA 4U6HA 2DQGL 1SF3A 5AVVB 2LLLA 4MYPA 4FZ8H 2VDPB 3MRCA 4F5CE 2E7CA 5I1HL 3O4LE 1CLOH 3L1OH 3FQTA 5HVGB 4HG4K 3IS1X 1CZ8L 2D2OA 3OKMB 4KRMB 2B15A 3MLZH 3DI2B 5IWLC 3VGHA 1FZJB 2V2TB 1QYGH 3FL7A 3MCYA 4HS8H 4DK6A 1YNLL 3KLKA 5LXGH 2JB5L 4L8CB 3NIFE 3LJ3A 4E42B 4MS8C 5IMOA 4P46D 1A47A 1V05A 5E8NA 1JFHA 3LKSB 4OIIH 2VLLB 5HHNA 5C0BA 1FHNA 5TGBB 3MV9A 1FG2A 1M2VA 4ADIA 1F4WL 5IIEB 1JPEA 1T66C 3GO1H 2NUTA 5I30L 2IANE 4N8VB 5C0BD 2VDLB 2WJ5A 1OGAB 5ESVB 3PP4L 1XD0A 2RMNA 4RIRA 4ENEC 4F20A 2OQJA 3GPEA 3QEGH 4N2BA 2O5ZH 4N0FB 4Y16C 3OX8A 4KKNA 4KX9A 1B0RB 2NLJA 5BZXA 3DXAA 3LEXA 4IIZA 4AZ8A 1KBWA 4JFSA 1NGQH 2CHWA 1A6TB 4KKAD 3WLBA 3L3GB 4M8RA 2ADFH 4DOHE 3DXAD 4I18C 3CVBA 4JFPB 1O5DT 3BN9D 5E8EB 1Q1JH 1Y6MR 2FQDA 4RFOH 1UB5A 4HJ0D 5IJKA 4EKJA 2JKJA 1DQML 1DJYA 2CCLA 4FEIA 4WSJA 2C1OA 1NLDH 1U8IA 2ZUXA 2OZ4H 5F72S 3QUXA 2WC7A 2KBGA 2KPWA 4E68A 1I3VA 3O4LB 1RVFL 2GG1A 4K9JA 3BT2L 4WFFD 4HEPA 2GUOA 4XCFH 3VRJA 1UGKA 1WLHA 2J43A 2XIBA 3KE0A 1E9PA 4M93C 4FQJH 1KXVA 3NIFB 4U0QB 3US0A 2A4CA 2OLDA 4ZFQA 4F1ZA 3FQWB 3Q2CA 3M6DA 1H0DB 2G2RA 1G7HB 2Z93B 3SDXA 3K6SA 3MODL 4DUWA 5EZLB 3V10A 4BCXA 3OPZL 2WN2A 1EXGA 4XXCA 4KK9C 2IANB 2Z8SA 4W93A 4N8CL 1IGFL 1YYLH 5KG9A 1WBXA 1LO5A 1N59A 5ACZB 1BV8A 3FUNA 1X7QB 2ZUQC 3NJHA 5D1ZB 3QORA 1XQ4A 5CEXB 2DTMH 3PAYA 3S3JA 1ZV2A 5ADOH 5F0PB 4QRQA 3CU1A 1AO7D 4DOHB 32C2B 4M56A 4F8LA 2Z91A 4HK3N 5A6LA 1TJHL 4M3JA 3CH1B 4UBDC 3QWQB 4Y4HA 1JN6A 1AKJA 3QNFA 5T5FA 2AK4E 2XTJE 3VD9A 2NR6D 3S37H 1K8IB 3FU7B 3GM0A 4Y4HD 3RTQC 1AKJD 4CU8A 3I3DA 2ZUYA 3VCLB 3U7WH 1OAUL 3EYUL 2QQNL 2F7RA 1TKWA 3BVUA 3K4AA 3IJEB 3MLTB 5E5MB 1NINA 5DJ8A 3MGOA 4L3CA 4HU2A 1I8UA 4RAUA 3V0WH 1ITCA 1J1PL 3QDME 4MRCA 1IV8A 5DS1A 2CDGA 3RUGE 3BZEA 3WFEH 5FX3A 2CDFB 2I27N 4ESKA 3FONA 5E95B 5AW3B 1FP5A 4LPTA 5DK0B 4ODXB 3CFTA 1A7RL 3ENEA 4XNMA 5EULV 1S9XB 4JM0A 3GLZA 3RRQA 3U7YH 1YRKA 3TBTA 3V55A 4FYQA 3E9UA 3GS7A 4JEGB 5I1EL 5E8OA 3WEBA 4YL9A 3V6OC 1K8DA 4CVXB 4EN3B 5T5NF 2XWRA 5JZ7C 4YSOA 2IJ0C 1I85A 2PPAA 5L2KE 3C5ZC 3BDXA 4M7LH 1FBIL 4GXFA 4AQEB 2I07A 4YO0B 1T3FB 3VXRB 3GMLA 3SE4C 3DO7B 1Z5HA 3D4CA 4UZUA 3VJ6A 2OK0H 4ANKA 3CVDA 3RHWF 3U1PA 5MENA 1PY0A 3HI6L 3QAZB 1UENA 4JQXA 1TQSA 2XTJB 3EOAA 2B1HH 1PDKB 1SFHA 3X14A 4JY5H 1NFIB 2VLRE 3BC9A 4UAOC 1DBAH 3QUYD 4XNBA 5E2WH 1G9NC 1UACH 1OB1B 2OL3L 1EXUB 4GAGL 5JOFA 3HRZB 1G7MB 3ASOB 5FCUH 4NC0B 1RIUH 1VPOL 4M7JL 2WXFA 4BRJA 1KJ3H 5IMLA 3R18A 1A8ZA 1B88A 4LKCB 5EF1A 2IVFC 1TNNA 2AXJA 2NY7H 3IU3B 3ME0A 5FUOH 1U30A 1T6VN 3QDMB 3B2MA 4JR9L 3TESA 3O6MH 1VACA 1AP2A 1MREH 3DSFL 3RUGB 3WD5H 1TLMA 4A6YA 1IAIM 1PL3A 3MV7E 2R69H 1SEBB 1RUAL 4U4IA 2O5XH 2XWBA 2JJSA 2X1WL 1FHGA 1JPFA 3EFFA 3N44B 4P5KB 4Y8DC 2LVCA 2GJ6E 4Z7VA 4UDTA 1OP9A 5DZPA 4F3FB 3S88L 4PI2A 4GO6B 5F96H 1A2YA 1P4IL 4LSSL 1KLGA 2ESVB 3HI1A 1OAXL 5D2LA 1NBVL 1U58A 5BW7A 2BSSB 5LN4A 5KBDA 1ZPLA 1L5GA 1MJ8L 1NCAL 3BKMH 1G6RH 3NQIA 4XOBA 2BHUA 2K78A 1OGTB 1WUNT 4I89A 2Q7YA 5LVEA 3X3FL 4IGBB 4XMKH 4GUQA 5DO2C 1PZUB 5L2KB 5T5FL 2ZG1A 3MRJB 1Q0XH 4UDUA 3K8LA 1A1NB 2D2CC 1FGNH 4KROD 3CLEH 3NZSA 4QCIB 3ULUH 2KYIA 3NRFA 4PV9B 1RZKC 4S10A 1JWMA 1NBCA 5IFJB 3G5XA 1H19A 5F88B 5BZZA 2CAKA 1GZQB 5DU7A 1ETB1 2MKLC 4M48L 1OSPL 3BVXA 4HT1H 5JQ6L 3T0EE 5DZVA 1TJXA 3GRWH 3CVCA 5TF0A 5JNYA 2EINB 3WIIH 4ZTPH 2WTPA 4NS0A 1E3ZA 2XQ0A 5C08E 4L2YA 5KSVB 2RGSA 1ZHLA 1S9VB 1KY7A 1BYNA 3OAZH 3HC0A 2AQSA 4UM8A 4TN9A 5TK4A 1UA6L 2R0KL 4QUOA 2VT0A 4RMQA 3MV7B 3SY6A 2IADA 3G6AB 3NTCL 4L4JA 5CGMA 1URZA 5FM8A 1XH0A 3FRPG 4R5XA 5ALBH 4UQIM 2GJ6B 3KPOB 1CR9L 4X6EA 1ZWIA 2XU9A 4NFDA 2VW4A 3L95A 5KS9F 4YSSA 1KCRL 2EC9U 4LPWA 3Q2WA 2FR4B 2R29H 4PWGA 1CI3M 1UB6A 2MEJB 3IJ8A 1ET5A 2FYYA 2YPLD 2XUWA 3GGWB 1RU9H 4PGCB 2OMZB 1W9XA 4KV5F 3S96B 3TONA 5DEJA 5GZOD 4HQQL 1IX2A 1E4XH 5KVFL 4WW2B 3NPZB 3WUWB 1P4BL 4PTUA 4N28A 1N5AB 1RJLB 5TDOA 3ZDWA 4JFQB 1ZMYA 5I76B 4XAWH 4XHJC 5GRVL 1AZBA 2OI9C 1BBDL 3Q2LA 3GUTB 1DVTA 4ZMLA 1KXTA 4LEXL 5E2JA 2Y6SD 1Z2KA 2VDQL 4GI6A 2W0KA 1D5BB 1U6AL 4FKHA 5D71H 3RVTC 1U2HA 2LLGA 1UWYA 2WY3B 4DUVA 2P1YA 5C08B 2I69A 2JTDA 4FQQB 1X7TA 1WCQA 4WNSA 3G5WA 4ORZC 3S4SA 5AKTA 4E36A 2IQ9L 3U6RB 4LIQH 4KRNA 1ADQH 2AHIA 4I77L 1JZFA 3ZDYF 1S7XB 5H37G 1QI3A 2PYFB 4S2SB 3ARBB 5EO9B 4JZJC 2ZE0A 5DZLA 1CFTA 4E41A 4YXHL 1L4IA 2CJTA 3UZVB 3TVMA 1CYWA 3DECA 4LP4A 4E41D 5HGBA 3HI5L 4HWEH 2NRDA 2XNAA 3WN5C 3H2WA 1FVDA 3TVMD 3QA3A 5FHAL 2H4EA 3CHXA 4WHDA 2VSMB 5DWUH 1I1CA 1GZPB 2KZBA 3G6JE 5LLIC 4KBPA 2CK2A 4N0UE 3T71A 1YEDB 4LHUA 1XZWA 3GYRA 1XSOA 1WA2X 4OJAA 5DC9B 1XCTA 5JW3L 2X4PB 4PGZA 3W11D 4CW1B 4GRLB 1W0YT 2APXA 4R3SB 4M7ZB 3K6NA 4DP7X 1UH2A 3U4EB 4CKQA 1S5HB 2G0KA 4AYFA 7CGTA 3QHZH 2HLAB 1JL8A 3FO2A 3NJNA 2XQBH 3N1PC 3BVDB 1KGJA 1OCZB 3B9EA 1TCRB 5EH1A 4JFFE 1AOZA 1A02N 5AVXB 2BVEA 1E8WA 3TJPA 4KKPA 2D7NA 1QBAA 4QT5A 1OV8A 5AOJA 4YAQB 2BY1A 2CO6A 3RGVA 4V33A 2KL6A 2X1XR 4V2CB 3JT2A 3VW3L 3CMOH 1C5DB 2VISB 4G6AC 3Q3GA 4FNUA 4GBXB 4I85A 3QIBA 5HGAA 4X9IA 3RGVD 1TPXC 3O41A 3CVHH 1OKEA 2ZX6A 1NGZA 4YVUA 2FNWA 3KVPA 4MAUH 2DL9A 4PG9A 4PGBB 5EORH 1CD1B 4XMLL 2V8MA 1Q72L 1LP9F 4I4WA 4X6CA 3VXTB 3W39B 2FZ3B 3WFHB 1T89A 1NPUA 3N43F 3E6FB 2WQWA 2OYMA 3GMRA 4HIQA 3G6JB 3BSZA 3C6LD 4XPGH 2IBZY 4N0UB 3IYLW 5J57B 4L18A 5KZCD 5E8DH 2IQAB 3MNZB 3WIFA 5HVHC 2GFBA 5DA4A 3EJZC 4AT6B 3WSQH 3A24A 4Y5VB 4NNYA 3HBZA 3MLXL 4GNKB 4KRPB 5AQ0A 3HCVA 4YHZH 2WO4A 2EXYC 4PP1D 5DS8B 2OMWB 3WNIA 4LVHC 4ONFL 3HNVH 2ITFA 4JFFB 3BP4A 5FOBB 3L3OC 1BLNB 2P44B 1EQWA 3WXVH 3QAQA 1HSAA 2OCJA 1JGUH 2ZX7A 1HXYB 4O2CA 4NLAA 2G60L 2AXFA 4BZ1L 1CGYA 1JJUA 5ESAA 5K9JH 2WLLB 3IPEA 4Y4KB 3MJ7B 1JD9A 4NBXB 4QXWA 1RK1B 5FO9B 5GGQL 1FNGB 3TBWB 4K3EH 3BISA 4QTHB 5EN2A 2GITB 4M5TA 5HJ3B 1GR7A 5CMAB 5BO1H 4R84A 3B37A 3GI9L 3HRPA 5DR5L 1ZLSH 3TN0C 1P7QA 1V3LA 3O0RH 1RIVH 1VSCA 1T6WA 4D7PA 1E2VA 3HE7B 3ZE1E 4H1LA 3LKNA 4MMYB 2AJXH 3B5HA 3IPFA 1P7QD 4QR7A 2UY6A 5BQ7A 2X6CA 1BVKB 1IBDA 1KN4L 3TJHC 5FLVA 1PPIA 4I5BA 4PRBA 3MCLL 4BZ2H 4HGKC 1NIBA 5E99H 1Z66A 4W9EC 4KKLC 2WLHA 3Q6GL 4ZUUB 3TLRA 5EG6C 2V2XA 4P23D 1LK2B 2F74A 4W81A 4L5FL 2O6CA 4L1LA 5I16A 4PU2A 2Z7YA 5K39B 3RB7A 2IGFH 3QUMA 3P9WB 2PKDA 2VZUA 1W2KT 4ZW3A 1DJGA 5I19H 2YKLL 3KGSA 3J2PA 2W65B 3K2UL 4HV8A 4NAQA 3CVIH 4DHLA 5IHZB 1KGXA 2HFGL 1S5IH 2E74C 2XT1B 5E51A 5E8PA 5D6CA 5EEYA 5FFGA 3FB5A 2O6FA 4FFZH 3CXFA 4J3WA 5JIPA 2HKFL 4TQIA 5DHDA 4OAWA 2IF7A 2YARA 5IFAL 2QBWA 2ZSWB 2NDGA 1Z0MA 3L6FA 4GW5B 4XOCA 3ZDZE 1IC4H 3BQUC 4OGXH 4Z7UF 3D2UD 2LE9A 4HETA 2IWKA 4A7QA 4DZBB 3NIGF 1ET8A 3BVNA 1YEFL 3DX9B 3IJHB 3ZKSD 4MNHB 5HYIA 5KVDH 3ZE1B 4KWUA 2QZQA 5K59E 3ZGIA 3BUBA 2BVPB 1HNYA 3RX8A 4TVPE 5HI4D 3SE3A 3DBSA 5C9JB 1MZYA 1QNZH 5DA0B 3EJRA 4QRUB 2R0ZL 1JVOA 1HFUA 4TPRH 4YDJA 3TA3D 4NQVB 3N9GL 4OZIA 5DUML 3K5SA 4PLKD 4UOZA 3FQ2A 4GRWF 4BA8A 4PP2B 5I71B 1V7MH 1BEYL 4B9JA 4P2RE 2V9QA 5KVDE 5ICXB 1NICA 2N56A 3LEYL 4ZX5A 3PGDB 5PCYA 3R0MA 2OMTA 3HNTL 5IVXF 5A1AA 2AJUL 1OK0A 5DJ0A 2X2UA 3G5VB 5FK9A 1OOAA 4ELME 3ZKMD 3FB8A 1LMIA 4XPTL 1UADC 1MVUB 4L23A 5EOCJ 3V79C 2XRAH 1VFMA 5EDXA 2EYTB 4PTTA 2P7TA 1NMBH 1FZOA 1R3HA 3BGFB 2X3AA 4R96A 4H8PA 4LASH 2R39A 2V2WB 4JO3L 5E6UB 3SGKC 1I9JH 1R3IL 4MDJA 2J3SA 5D1ZC 3RWHB 2EUZA 1FSKB 3ZDZB 3OG4B 3UTSA 3SO3B 1KEMH 5D7HA 2NY5H 4LCWD 2ZF9A 2E76C 1H8SA 4LKXA 4PJHA 4WKZB 4X5PA 5D93C 3UTSD 1C5BL 2AI0L 3UAFA 4J3OG 3PWUB 1UZGA 3F6IA 1WGOA 3QB7C 4HH9B 1IL1B 4NQQA 4QOKA 4WO4A 5TDNA 2C9XA 3BE1L 4N22A 1ZA3A 2ATKA 4PJGF 2D3VA 2ZOLA 4O51A 1EZUA 1GAFL 3DHMA 4QOKD 4WO4D 2DJSA 3V5HB 2Q20A 1PGRB 5T1DH 4U1SA 2OMVB 4OT1L 2R2CA 3QXUA 3UGXA 3LEVH 1B2YA 3FZUC 4P2RB 1Q38A 1F11A 5CN3A 1LO2H 3A6BH 4YX2H 3ETBF 1A6WL 1HK6A 3KM2A 5HYEA 2H6UA 5FGBA 4Y8AA 1MAML 5FDYA 5JDJA 1DEEA 4YHNB 5FA3A 4P8QA 3VXOB 4ELMB 5AAPA 3GTNA 3D18A 3KWVA 5I9QB 1HQRA 5E6ZA 2Z7UA 1FPTL 1VGKA 3PS6A 4HLEA 4O2FB 3FOLA 1T83C 4MMZB 1RZ7H 4X6BA 1KT2A 1UVQA 4QRBA 3VFPB 2QPSA 3ZIYA 2YRLA 4AYSA 3QQ9C 4BBWA 2XC8A 1PLGH 3RL2A 2RFXA 3VYOA 3KDMB 2UXTA 1AG6A 3FXIC 3VE0A 3MRMA 3VDBA 2JH2A 5IW3A 4KTGA 3MBEA 5EUOA 3C08L 4HD9A 3ULVH 3CQPA 2Z31D 3MAWA 1AQKL 1KEGH 2FGWH 3BDBA 1CG9B 1MCSA 2HTKD 5JMOC 1BQUA 1U8QB 1U93B 2HH0H 3P0YL 5C09D 4IU3A 1M1SA 3DUUA 3MBXH 5B1JA 5H4ZA 1DYZA 4OGYL 1QR1B 1MW3A 2JTYA 3AWEA 3ILQC 1QFWH 5INDA 5MHSD 5GGSB 4LDCA 1BG9A 1YJDL 1MW2A 1NA8A 1UZ6F 4PRPA 2AS5M 3C5JB 2YUWA 5GJSL 1NM9A 4IRZH 3OAUH 4H25B 4G5AA 2H3NB 3TU6A 3V6FA 2EZ0D 4MZ2A 2MRYA 4PRPD 5F3HA 2PTTA 4N6QA 2IGTA 2P8PB 4PJXA 4UIMB 3PDDA 3QYMA 2OJZL 3U36B 3N41B 3OLDA 4JANA 1OD7A 1RURL 4W1TA 4UU9A 3WDHA 2CJ3A 2CRIA 3ZTDC 5DEZA 2HT3C 4MD4A 3D4GA 4BUHA 4M5SA 4OD2B 5DVOA 2QR0A 4OLYH 1OAYH 4HFWA 3B2XA 3S3CB 4KQ4H 1SXZA 5J9PB 4XN1A 4NO3B 1CXKA 5IQOA 4Z3FA 2ADGB 2ZD0A 4KPHL 2PW2A 3P2DA 3B8YA 3CXDH 4XWGH 4MNGA 2YLHA 5C0RL 3WKPA 4PS7A 4CJ0A 3RPBA 1WZLA 3T1FB 3LN5B 3INUL 1SBBA 3D25B 4HS3B 3VH8B 3EW3B 1KC5L 3BZ4A 4J2XA 2NXZB 4HJGA 4XAKE 3BKJH 3QJHA 4LAJH 5F7AA 4PCTA 4DP4X 3JVGC 2Q7AA 2ZPKL 2CBMA 5FUZL 2PLTA 4LBEA 1CT8B 3FSOA 4ZS6C 2NY3D 2C9QA 2RACA 1I7RA 1GXEA 4JHAH 2QGBA 4ZMWA 2F15A 2VDKL 1HN1A 4X7TA 4NJ9L 2EIDA 2JKIS 4JQIH 1CCZA 3LKRA 4HWZB 4AV4A 3KVQA 3UBXI 2D7MA 1VADA 3PWLA 2ITEA 3MRPB 2E86A 2AQQA 2WJ7A 3KL5A 4O2EA 3S34H 1IBHA 5F6IB 5AW0B 2KI6A 3VTMA 3O0LA 4Z3IA 2A7BA 3LOWA 4PB9H 3MRRB 4FYRA 4LBAA 4QAWA 3F83A 2D3LA 4OJFL 3NEOA 2E8YA 4R97C 1D5MA 2DMBA 4FQHA 2AEQL 4YDKH 4LVNB 2YRBA 4G6MH 4XN2A 5H37H 4WTZG 5IBLD 3IFOB 2G30A 1JUFA 5GRVK 3UX9B 3K4ZA 3X1GA 4UB0L 3L3HA 5I8CB 1IKNC 1KJ2B 4H2CA 4LCCB 4WW2C 1N4XL 5CSZA 1LEKA 1HKLH 4C56A 1I8MA 5CIPH 2BP5M 4NT6B 3FFDB 5FO8A 3OXSB 5HJDA 1MAKA 3KPMA 2FX7H 3PHAA 5J1AB 4OF3A 4C56D 3LV3B 4L1TA 3OKEB 1D7DA 3UYPA 1TQCB 1YN6B 3QC5X 5E9DD 1SJMA 4HWNA 1NBQA 2NZ9D 3BO8B 3ZKXB 1NJ9A 2PPEA 4JY4A 1AANA 4E9VA 2OX5B 3NFPB 5JDSB 5CKGA 5DHEA 2CGRH 5J8OA 5DUBA 3HHRB 3OL2A 1NBZB 5DQ9B 1URIA 4J12A 4JL2A 4U1KA 2HLFC 3RY5A 5EF2A 1BZ9A 5HHPB 2GI7A 1R3LA 3GKWH 3VWJB 4FXGB 2D3NA 4WI0A 5JPNA 4Z5RA 1WEJL 2UUDK 2V17L 2Y25A 1SXAA 4H8QA 4JDVB 1O6SA 4AYID 1UWXH 5HY9A 2B77A 4XPHH 2XETA 1PX8A 5F93C 5CHNA 5D6DA 3H55A 3MVSA 1JP5A 4QJ5B 1XR9B 4LGSB 4OLZL 3WG7B 2YQ2A 5I6OA 1JS4A 4GI9A 3I9AA 1JPTL 2XN9E 2JI2A 2ADIA 2WKOF 3BZFA 4JGUA 1G7JA 4ODHL 3K1DA 4IHOB 1KDJA 4YNYB 3TZVD 4I9WD 5GSRA 3PAZA 3TT1L 3I6SA 4ZMNA 3O81A 1D6VH 1XGRB 4J2QA 2QKIC 3OMAB 2VXTH 5IQ7L 4X7FC 5I15L 3KW8A 4WK0B 1M9SA 1PJ9A 3LTVA 3HZMB 1EHAA 3FQNB 3SKOA 2V5RA 2DB8A 4X0KB 2EVIA 4GKSA 4UAHA 1UD3A 2YOCA 2HFTA 4GRLC 1SZNA 2RR3A 3GXDA 5PAZA 3T6VA 3DVGA 4JHWL 4TQEL 1RZFH 3OTTA 5JHDA 2ZONA 4PJ8A 1KLFB 4IBZA 1MJUL 4Q0XH 5IF0B 2NY6D 3BWZA 4UF7C 1JWSA 3FW6A 4U2ZA 2DQTH 4BQBA 4OZ4B 4F9PA 1JNHA 2VAAB 3QDGB 3O6LL 3ROLB 3FQXB 2L7EA 3QZOA 1AJ7L 1R4XA 3VXNA 3MLYL 3N85H 2WKGA 4A68A 1H3WM 1QNIA 3H6JA 4PLJD 5K9OB 1HI6B 1J5IA 1AQDB 1KB5H 1O7VA 1WUZA 3NZHH 4XOAA 3FSZA 5LCVA 3WXWL 4CA4A 1UATA 3QFGA 4KK8D 5F7MC 4QRSB 1E3XA 1DO6A 1QLRA 1L3WA 1BREA 1ZIBA 3DVNA 4GW4B 3PWPE 1ACYH 3CBKB 3O3EB 3ATFA 2XN9B 1DLHB 1MCEA 2E9GA 5DQDH 1AQ8A 4ODSL 4HX1B 4JM4H 5H2BB 1EBAA 4W6WB 3B9KA 4I2XE 3X12B 4EUPA 1FAKT 3C5XA 1ZHNA 4FADA 5D9SA 4GAYB 1FF5A 5E4OA 4U6VL 3GSUB 2FX8H 4NYLA 3ZTNL 2UY7B 3B9KD 4Y16A 5J11B 1WFNA 3NGBB 2HJKB 1XB3A 4HUXB 4OF7A 1ECZA 1LLAA 3IMBA 1AZZC 4GFXA 3LRSB 2BSCA 4X9FA 4H0GA 4Y5VC 2BNRA 1W8EA 3ARDB 2X4RA 3ETTA 2DQJH 2JV6A 4PD4J 1BOGB 5B3JF 3D08A 3ZXAC 1CICD 4A2HA 5KYYB 2H41A 4E9WA 4HIHA 1B0WA 2EDMA 4HULB 3R1GL 2HUHA 3CDGB 5EIIG 5L4MA 1QKZL 1YYML 1NMCB 4JG1L 4ILDA 3I9PA 3TPKA 3SGEH 1NCUA 1NL0H 2AAAA 2XV6B 4J7RA 4X80H 4Y4KC 5ERWB 4YK4B 1HEHC 4XTRD 3N04A 4AE0A 1F3RB 4HXAH 5IP4A 3OHXB 4P3DB 3BFWA 1KFGA 2WNKA 1JGEA 1A7PL 3B3BA 1GMIA 1TYJA 3SQBB 3C2AL 4DVBB 3I75A 3TM6A 1LE5B 3BAIA 3PWPB 2BP3A 3BAYA 4JJ5A 1ZS8A 3L81A 4K3JH 4ORGB 3UMTA 2EDFA 1AHWC 1IGIH 4OI8A 1EAPB 1KFAH 1MN4A 2DQDH 5DHVA 4I2XB 1PS3A 2WTRA 4JK0D 3HE7C 5D4QA 5SX5K 4K5MA 3IDGA 3CJJA 1DQLL 1D5IH 4NUGH 3ARFB 5C3LD 5CXPA 4YOKA 4XBMA 4QHUA 1IM3A 1DSWA 5FAAA 4K94C 4FFVC 1QLFB 1T0NB 2VZTA 4EXKA 1JZGA 2VL5A 3OGOE 4DQOL 4GKNA 1IM3D 1QLEL 1GRWA 4IHBA 5IM7A 2VRQA 3DDFA 3FO9A 1D6EA 1PG7W 3PHOA 2HVJB 1DBBL 3P30H 4NKDB 4E9QA 5C07B 5I1LB 4RSYA 2WQRA 4U3CA 5FO7A 4BINA 2DQCH 3X3GH 3HLAA 3QXVA 1JGIA 1HNGA 2YN3A 5J7CC 2RCSL 1D5XB 3VO0A 3T0EA 1C8PA 3EXJA 2QVIA 2FT6A 4YR6B 1EGJL 2A83B 2NX5E 1IC5L 4N2LA 1N3NB 1FV1A 1V7NH 3T0ED 3IJYA 3NSJA 4DGYH 4CMHB 2DWEB 1R3KB 1SXNA 4Q6KA 1P69B 3A47A 3NZ8B 4MLIA 3N40F 1CGSL 3FUIA 1MFNA 3MOAL 4G7YH 3WHXA 1XGQB 3FB7A 5TE6L 4KDVA 2XZQL 3HHSA 4JFOA 3MRFB 4QNPF 5GGRY 3L5HA 5DMIL 4NJAL 1CQKA 3BRGC 1RP9A 4MD0A 5IOKA 1S7WB 2ZAHA 4UILL 1D2OA 4WAFA 2JKLA 2UZIH 5I2IA 5IMKA 2M2DA 1ULVA 4ZODA 1IQWH 1YY9C 3AZUA 5H94A 2E3VA 3NCJH 1IGCL 3ES6B 3KYMB 2W9EH 1BZ7B 3QUZB 3AMKA 4XO8A 1ZV5A 1BFVL 2DWSA 2WKLA 1A6AB 1HCVA 4DGIL 5JLZB 3IETB 2PABA 1NOLA 4WFGD 2FO1A 4J3OH 4PHXA 4Z95L 4Z78B 2HP4A 1MHPL 5I71C 1XFPA 3SE4A 4OCYH 3OKKB 1P53A 4U0RB 4BCYA 5F7HA 1HH6B 2WXGA 2NSXA 1EEUA 4G9FA 4EZJA 5D72H 5CJ8A 4PVBA 4AQ8C 2EDTA 4R4FL 3IBEA 3JYBA 3QI9C 1A4JA 3HNSH 2AEPL 4OCLC 2EXWC 4AIZB 4X4MA 2J8HA 1BVNT 4RZCA 5DT1H 4F91B 12E8L 5E9NA 4U1HB 3BUDA 2Z0BA 2NX5B 4PB0L 2VZ3A 4JUSA 3QO1B 3KHQA 5DDHA 4FG6C 2W0FA 4LSRL 4AKOA 3QZPA 3BMWA 3HBQA 2XV0A 3CU7A 2IH3A 2WCPA 1F4XL 1H3TA 3GLAA 1ZTXH 1FSKC 3H8NA 3T1WA 1WZ1L 3E8UH 2X0WA 3BWUF 3H53A 4L29B 5DJ2B 4NQED 3ZR6A 1GY1A 5JYMA 1K85A 2AABH 4X5XA 3LDBB 5DQJA 1SN5A 3SDAB 3QRBA 5JR1L 3ZQXA 3P0VL 2EDHA 4Z77A 5JQIB 1UH4A 1YEKL 3PL6C 3DSNA 4XCCL 4OZHA 4XNYH 5IEHA 1UM6H 1WH0A 2PUQT 1F4HA 4WY7H 3OQ3B 2IFFL 1ZTXE 3ZZQA 3GZKA 1Y1UA 4AIOA 2PCXA 1HILA 3QJSB 2WN3A 2EVGA 1CFNB 5F9OH 1BD2A 3HZVB 5F9JB 5BV7B 4L4VE 4QDGA 4IK6A 3UTZB 4ALAH 1GSMA 5ACLA 2KLSA 4KX8A 4XRCB 3HFML 2NOYA 2EIZB 4CC0A 4N1HB 4ZXBA 1F4YH 2XVGA 4FQ1H 4BSWA 5C6TL 2EACA 3LYRA 3ZU8A 1IE5A 1S7VA 5IK3A 4P3CL 4WFED 2DLFL 5F3BB 1ACCA 1MFDL 3RURA 4ZXBD 5ITFB 1R5WB 2D7TH 5I9QC 1L7TH 4XBPB 4PJBE 4N24A 5BZWB 3VUAA 2H7WA 1SYSB 1XF1A 3POHA 3F5WB 3VGBA 5IW6A 4Z7NF 4NENB 4CILA 2V9TA 1R24B 5E1AB 3FU8A 5K9KA 4OUUA 5KUMA 1CBJA 4TRPL 3HMXH 2VLMD 1BQRA 5ICUA 1BWWA 2GBUA 3A6CH 4JJOA 5ICYA 1T1XB 3TF4A 5BRPA 5KTEH 3KPLA 1SUJA 5D70L 4DEWA 2H3XC 1VFUA 1PEZA 1JXJA 2CDEA 3RA7H 1GIGL 1UD2A 2BVQB 2VR4A 1DJWA 4JPQA 2X87A 2XZAL 1F4AA 2YPVH 2G75B 1GC1C 4OLXL 4GP5B 2WWMD 1GA2A 4Q9RH 1F0LA 1NANH 3T3PE 4BKLA 1PLCA 2AMUA 3V5DA 2PPDA 3CDFA 4M6NH 2BSED 3V0DA 1MWAA 4LFHG 3VQMA 4NQDE 1M9WA 2FWOB 3VD4A 2X2HA 3KWWB 4M5ZL 4FJZA 3VRLE 4HUVB 3QRGL 2OZNA 4L4VB 4AEFA 2WCGA 2EC9T 1CFVH 4FFYA 3QNZA 1NAKH 3V5KA 2XWJA 4PWHA 1MFEL 1N0LB 2R2HB 2QTVA 1LDPL 3E0GA 2NXYD 2WXOA 3RIAK 3MC0A 2YRZA 4K5NA 2L4OA 4XC1L 3T09A 3U0WH 1CMOA 1ZXQA 3F7QA 2R0WH 3MCKA 5KAQF 4NPJA 4PJBB 3U0TB 3CC1A 2H32H 3IDXL 4LLUB 1DUZB 4K8RD 5I1CH 1KTDB 3RVTD 4LEOA 3QUGA 3PU7A 2GEEA 3IEAA 3NQKA 1RD6A 3H9HB 2JVUA 4FZEL 1M6OB 3BDYH 3WUZA 3SSGA 1QFHA 3FT1A 4WU5B 2XN1A 1TTFA 1ZS2A 2FJGA 3LXCA 5HHQA 1PX4A 1I3RB 1WZAA 4JZJA 4KUCD 2EC8A 3O9WB 1UXLA 1KYDA 1NFDA 2NXZC 2UWEE 5T1KD 2YA0A 1WAPA 1BFOA 5CWSB 2WLYA 3BKYL 2HZHA 2W81C 3QPXL 4JPWL 4LL4A 4QYAA 1NDGA 4Y2LA 1RHFA 4YPGA 2VLKE 1YMME 4JKPH 3T3PB 4AKPA 1QATA 1N2RB 2B20A 4N25A 4GKZB 4AVHA 2B1AH 4QHNB 3OR6B 2NY2C 3SZ6A 4MQXD 1GJUA 5DMKA 1B4TA 4JFTA 3QDAA 4NQDB 1N6QH 2FO4A 2WWNA 3RBSA 3CBJB 4YHKL 2EDWA 4Y2DC 1ND0B 4KZEL 2H9GB 3P4NA 2IAAC 1E4HA 4PRHE 3PY9A 4MJ5B 3L3KB 2WLIB 3WO4B 1FLRL 3CUPA 3LIZL 2F58L 1S9WB 3MACL 3MLRL 2X4TB 2WVSA 5C0DA 2WK2A 5F6IC 3RBGA 5HYJA 1SDDA 5F44A 1J9CT 4D9QE 4Z7WF 4LPXA 2CR0A 3KLAA 3NEEA 3IKCA 4TOYL 2P24A 4L8BA 3B1UA 1TETL 4CVWA 4N85A 3QG6A 5IB5B 2B8OT 2YSSB 1LXMA 1O6TA 3RAJL 1SF5A 5C2BH 2XTSA 2V3DA 4KJQD 3QH3A 2BVOB 5DEFA 1CFSB 1PKQE 1ETA1 4YSAA 4ZMQA 5CINL 1OP3H 5K1VA 2YD5A 1BA9A 3L4VA 2UWEB 3QIUA 4N20A 1WAAF 3SBWC 5CD5C 1FLTX 5ANME 5D1XA 1FE8H 5ILTH 2H1PH 1MWAL 2FL5B 3QIUD 5C0EB 2VLKB 5I1GL 1BFTA 1YMMB 1ZLWK 1U3JA 5D1XD 4XZ4A 2PCPA 3T08A 5J13C 1W6LA 3ZKXC 1P7KA 5D7LE 1J8HD 3U46B 1FJ1B 3GK8L 1N9PA 2BRQA 2Q1EA 1IARB 2VN4A 4UOW1 3KCPA 2JKWA 4FLSA 1SHSA 4ZUSB 1HS6A 1WTGT 2VXQH 2JSFA 4FP8L 1UCTA 3M46A 4J3UA 4UINH 5F97E 5CBAB 2MFNA 1FRGH 4PRHB 4KKZA 5F21B 1YY8A 4K8RL 5ETUA 4DN3L 1GHFL 1I4FA 4TQ8A 1AR1B 2FBRA 5E9AA 4R7DB 3QJUB 5A2CA 1NGPH 1TDQA 2E56A 2VAJA 1G7LB 1DVZA 5FM5M 5JUEH 4XP5L 5BMFH 3V4PA 5SWZD 1FFNB 2VQTA 4IMLA 3VTAA 5FPIA 4N4YB 1KB9K 5CFHA 4OH2A 4JBSA 4BFEA 1PG7L 4R2GD 4FQIH 3APCA 3T2PA 4NNPL 1OCOB 3EH4B 2QQLL 3VM7A 1HYSC 3PLYA 4X7SL 4CN1A 1IM9B 1E9OB 3BPNB 1YDPA 1NSNH 4TNEA 4XP9H 5DC4B 2J88H 5FYLD 5ESQA 1PKQB 4O00A 5INCB 3HS8A 2QVFB 1QASA 1SLXA 5EWIL 1E8XA 1WYJA 3U9UB 4G8AC 8CGTA 4JRFA 1VA9A 3QPQC 4H0HB 4P57B 3ZL4H 4NERA 3ZY7A 4ZAKC 3BEVB 5FB8B 4EXPX 5K69A 1A1MA 1YPZA 1OF2B 3P9LB 5ANMB 3X1EA 1MHCB 3QNXA 2J1WA 4LOEA 5F8RC 3VQLA 3LNFA 3BWSA 1GYCA 3CFIC 3TN0A 4ETQB 2X70A 1K5WA 4L9DA 5D7LB 2YFOA 4OFYD 1I8IA 2DYRB 2NYYD 5HDQH 3WTXA 1G7PA 3PE9A 1OLZA 2DLTA 3DIDA 3BPCB 3NCCB 3ISYA 1NAMB 2YAOA 4J1UB 1ESOA 1LO3H 1ZOXA 2IAMD 5LDUA 1MY7A 4GLRH 2G0LA 3NCWA 1VRSA 2J7LA 4FFWC 2DBLL 3OKMA 3UBGA 2GK2A 3NRQA 1QSFE 1EAQA 2X6BA 1FZJA 4MJIE 1RIHH 3APDA 1XIWC 2V2TA 1JGLH 2GAZB 4L8CA 5ES4B 2O5YH 4E42A 4I0PB 1FNEB 1GSKA 1KIQB 4TLKA 1WD8A 4I7ZC 2VLLA 5TGBA 1EO8H 2C3GA 5EC1B 2P5EE 1EJOL 1G6VK 4ZJ9A 4OM1H 5IIEA 4ZX3A 4N8VA 4UMSA 4RRPM 2OMBA 4J3XA 5KS9E 1OGAA 3DETC 5ESVA 1YCSA 1D9KC 4H8VA 1MCHA 5GS0D 4FMVA 3VRIB 3MXVL 1X5GA 2JIXD 4N0FA 1OGAD 5J11C 2WBWB 3NGBC 1B0RA 1KJVB 2EDJA 3IU4H 5FYJE 3Q44A 2WQXA 1A6TA 2R7EB 5B3NA 3L3GA 2BY2A 2GW5A 4LGPB 4GQPH 4PJAF 4YWGH 4RH4A 3UEQA 4JFPA 3L2MA 4KFMA 4WV1B 3IGUA 1PAZA 2WNGA 5GXBB 1KIPB 4P59L 1WFUA 5E8EA 1EEZB 2DAVA 5IGXH 4MA8H 3D06A 1X7SA 4LOUD 4ELKB 4ABWA 1C08B 2ZUUA 5DCCA 2FJHB 3IM1A 1J0HA 5HDLA 4NGHH 3U1SL 4BFBD 4NN5B 3VG0L 4ETYA 2JJUA 4F5CA 2AJVH 1KPUB 3O4LA 2XXCB 3QS3A 4CL7A 1OE2A 1EHKB 3KJ6L 1SFDA 3SHSA 4MJIB 1QSFB 3GTVA 1Q90A 4YK4C 5FYLL 3TV8A 3JZYA 3LMJL 3PP3H 1GW6A 2BFVL 4WUKL 3I74A 3OHXC 4PJCF 2HPTA 4FOMA 4N26A 1JFQH 3FQWA 3OGCB 1H0DA 1SN2A 3FAXA 1G7HA 3AU1B 3HBGA 4ES8A 2Z93A 3LAFA 1C12B 1II4E 4NM4L 5EZLA 2P5EB 3ZDYE 1OWRM 2VXUL 1MFBL 3BPLC 2IANA 1CYGA 1CZ8H 3AY2A 5I6XB 4WWKC 5KS9B 1GGTA 2FBJL 2NQDA 5EO1B 3ZYIA 1UOLA 5B4MC 1F00I 5EOTB 2JCCE 3SGKA 5ACZA 1HL9A 3MA9L 2P9RA 3ARFC 3JWDH 1X7QA 3GIVB 4JO1H 5D1ZA 5EPMB 4KDWA 4OI9A 5CEXA 1WQVT 1QSEE 1N10A 3DKHA 4XI5D 3S2CA 1GYWA 4FQXD 4WTQA 2ADJB 2HG5B 3ALWA 1IIKA 2WYZA 4GAJL 2R8SH 32C2A 5C0GB 4ZYKB 4YDMA 4P2OB 4LARL 3G6DH 3Q5OA 5M94B 4LHUG 3CH1A 5DLLA 1WJ3A 3AG2B 3G3LA 5D4IA 3RZCB 1MPAL 3QZLA 1TQWA 1K8IA 3FU7A 3F7PC 2H47C 4I48B 6TAAA 1CLVA 1JZJA 3OPUA 3VFRB 3VCLA 4L48A 3EFOB 4N2AA 3SPCA 2BIOA 3IJEA 3MLTA 5E5MA 4B9IA 2P8MB 1LQSR 3KR3L 2XFXB 4CMHC 4PPTA 1O75A 4Z76B 1OAQL 5IMMA 4CNIB 4F7CB 5GS0L 4J27A 2QMJA 4TLTA 4NUMA 1HINL 1QG3A 2CDFA 2VLJD 3L1GA 3L7EB 3NJKA 4NQXB 4MTMA 3US9A 2OZ4A 3UYRH 4D3CL 4XR8C 1KN2H 4MD5B 1PFOA 5DK0A 4ODXA 1BF5A 4LL1A 3ZDYB 2DQHH 4CSTA 1D2PA 3AS2A 3HTLX 3WNJA 2J1KA 3O3AB 3UBXB 4G7VL 3AW5A 4PWEA 3FFCE 1T83A 3EKCA 3V9FA 2JCCB 3IFNL 1KYFA 1T2QH 4CVXA 1XTLA 4EN3A 1KTBA 3QUZC 1FFRA 4HDIB 4J23A 2WW8A 1QSEB 3A6OA 3MODH 3ZL1A 2AVGA 5DRNB 4EN3D 3CFEB 4S1QL 4FS0A 2R9HD 4QWWC 4AQEA 3VXRA 3JQOB 1T3FA 2PNDA 4YO0A 5JW4R 4ODWB 4MB5A 5LAXB 3DO7A 2WBJD 4UNTA 3JWNC 3F12B 2BIHA 3KYOB 4RMUA 1HESA 1PDKA 4MA1B 1NFIA 1TG8A 3LS5H 1OB1A 2AK4D 1EXUA 2XTJD 4HC1A 3A67H 3HRZA 1G7MA 3K3QA 1TZ8A 1DR9A 1OHZA 3D7PA 5E2UH 2AF2A 4FLRA 4LKCA 3IU3A 1H3XA 4FZ8L 3QDMA 4K0OA 4TQHA 3RUGA 1CLOL 3RVUD 4APQD 1PIGA 2X4OB 3QS2A 4NKQB 5DZJA 1SEBA 2W1NA 3N55A 3MLZL 3QDMD 4P9HC 4P5KA 4MZIA 1QYGL 3H3BC 4CSPA 1X4XA 4OFPA 4PMFA 4F3FA 3DNKA 2Y5QA 3BUYB 2ESVA 4G43B 2I9TB 5E4AA 4K2UH 4RMVA 3TBVB 4Y4FC 3SYCA 2NPLX 2BSSA 3FFCB 4OIIL 1QBBA 2E75C 3BAXA 5CS7A 2WGNB 3O3BB 5DZ9A 1JVLA 4IGBA 1ILSA 4KTEH 2C9RA 2LU7A 3N43B 5DI8B 5L2KA 3MRJA 5KOVC 2DLEA 1A1NA 2O5ZL 3AM8A 4IGBD 4HFUL 4QCIA 4P4RB 2BW5A 4PV9A 3BH4A 4OD1H 4Y89A 3GBNL 4YSDA 5DRZB 3LNEA 1R5IB 4J3TA 5IFJA 1NGQL 1XSKA 2ZX5A 3PXHA 5I1EH 5F88A 2ZKXA 3D85B 1GZQA 4WJKB 4RWHA 5CILH 2ZQKA 3RWDB 5ADPL 2P80A 1OTTC 3JVGA 4NRYB 2Q7NA 2WZ5A 2E0PA 1DVFC 4ZPTB 3WLWC 1Q1JL 3T2LA 3U82B 4RFOL 4H40A 3DMMC 3VD3A 2HAZA 4X9YA 2VLRD 1DO5A 2YC1B 2OZ4L 4GP8B 5KSVA 1BVZA 4IMKC 2K7QA 3PJSB 2XHNA 1S9VA 5KVGH 3ASNB 5TFSL 3Q9PA 1TNMA 2IDSA 4JVWA 5HI3D 1KV3A 3MV7A 5AUMB 3G6AA 1P5UB 4XCFL 2GSGB 1BXAA 1XWVA 4B95C 3ASWA 1X3DA 4GAGH 2GJ6A 3KPOA 4CBZA 4FQJL 3CDCA 3KWXA 4J8RB 3RJDA 4ZFGH 4YDIH 4M7JH 3GRGA 3QP3A 1IGYB 1OAZH 2FR4A 2GJ6D 5L8KB 1I7TA 2CZNA 1G5GA 4GAFB 3NOIA 1M7IB 3DSFH 2CH8A 1BQLH 1J8SA 1JV5B 3GGWA 3K1KC 4IS6B 4WVRA 5KVEH 2BZ7A 4PGCA 2OMZA 3TEYA 2W80C 3S96A 5IUCA 3WTWA 3F05A 2X28A 3NIGE 3MUY1 4LSQH 1YYLL 4PRNB 3VWKB 4AIXA 6FABL 2IOMA 2EVJA 1IKNA 4WW2A 1AR2A 3WUWA 4LSSH 4DCQB 5B7EA 5FW7A 2A6KB 1N5AA 4HZLB 1RJLA 2Q87A 1WS7A 4JFQA 5I76A 1AHMA 4HC1L 3KLDA 1NCAH 1OCWH 1G7QB 3QEQD 3GUTA 3VI4F 2APFA 5DHMC 3BP5B 2MQ0A 4ZO9A 3X3FH 2HX8A 4AZUA 4A2GA 3Q06A 5T5FH 3LCYA 1IAKB 1D5BA 3EJYC 3HZ3A 5I8OH 2GJZB 3S37L 5C08A 2VCOA 2CPCA 1M6UA 4FQQA 4QHKI 4K71B 2C26A 1Z3RA 3MN8A 5C08D 4M48H 3U6RA 4WRLA 3WV0A 3ULUD 3QGVA 2F9BT 1C5CH 2PO6B 1S7XA 2PYFA 2WQ8A 4KGJA 4S2SA 3ARBA 3BD4A 3EJUA 5EO9A 4CVZA 1DTUA 1EZVX 3WFEL 5F6HI 2X1PA 4QEGA 1JHKH 3UZVA 3ARBD 5F1OB 3WNPA 1M56B 4B60A 2VR9A 1QVOB 4JKWA 1UA6H 2R0KH 2ZOTA 3MLPA 4A7UA 1L9SA 3NTCH 3U7YL 3NIGB 4HKZB 1GZPA 3B8SA 3U4KA 1AZNA 2V3FA 4AC4A 1KCRH 3HJEA 1YEDA 2UX7A 3VGAB 1LL1A 1FORL 4U6XB 4XE5B 4LOFA 5G4MA 4PJGE 4W4OA 3TEXA 1F1AA 2GHZA 3U2SB 4CW1A 1HC1A 2V37A 1Q9WB 4GRLA 4RMTA 4R3SA 3G5ZB 4HK0B 3DOIA 1H3PH 4G8EB 1E27B 3U4EA 1S5HA 2HLAA 4JL1A 3FTXA 1FQ9C 3QJOA 1QZ1A 2BFGA 1OARH 1TCRA 1NFAA 1P4BH 1X4YA 2B1HL 4PCYA 2DM7A 3R19A 2VUYA 4ZMYA 4JY5L 3BJLA 3IGKA 1HEZB 5AW8B 1UACL 2AITA 2V5YA 4YAQA 3MRIB 1BBDH 4LSPH 3LD8B 2Q6WB 1DANU 1OQXA 3MRLB 2B3IA 2Z65C 5D4HA 3T6XA 5B7FA 3V4UH 2B59B 4LEXH 1T5XB 1C5DA 2VISA 2CHXA 4GBXA 4YN3A 2NY7L 3VI3F 1HL8A 4A6YH 1U6AH 1IE4A 1NOFA 3FU3A 1MH5B 3O11A 1C1EH 3JTTB 4IRSC 2B1OA 2R69L 4GBXD 1GGIH 2UYLB 2O5XL 4PGBA 2XQYG 3EO1B 5I18H 2ZKHH 1CD1A 1OTUD 2CNYA 3VXQB 2IQ9H 1DEDA 3W39A 3VXTA 2FZ3A 3WFHA 4BWTA 2HN7B 3B2UD 1MRCH 3E6FA 3N6YA 3R4RA 4JFZH 3JWOH 4GEIA 4XWOD 2YA1A 3G6JA 4QXTB 1BECA 1FL6B 1AGDB 2HX7A 3TO4B 5EC2B 4N0UA 1G6RL 1VFBB 3GHPA 2IQAA 3MNZA 3DTXB 4XMKL 3TNNB 4PJGB 4QRPE 1E6OL 2LFEA 5IW1B 4G83A 4AT6A 5A3ID 4N9GB 4KXDA 4QRTB 1Q0XL 1UZ6E 4Y5VA 3ZYOA 1AR1C 2XG4B 3TF7C 4DUXA 3CLEL 2XZZA 3ULUL 2PXYC 2ZAIA 2ZOKB 4TLSA 5DS8A 5E6IB 3RWJB 2OMWA 1YHPA 3BEWB 4ONHB 4KRPD 2XI9A 4JFFA 5FOBA 1BLNA 1UXSB 3GRWL 2XWEA 3S35H 2W0PA 1SXCA 2ITCA 2BWQA 4GMTL 4JFFD 4ZTPL 1PZAA 4GUPB 3UH8A 3P73B 4ZMZA 2QT6A 4OQ1A 1CLYH 5I6PA 2WLLA 4Y4KA 3MJ7A 3OF6D 5DF0A 4YSPA 4AGOA 2BDNL 1E0OB 1RK1A 3H9SE 5FO9A 1FNGA 4QTHA 3QHTC 2GBTA 2GITA 5HJ3A 4L4TD 5CMAA 3HPLB 5ALBL 4NEHB 2Y4SA 1KACB 4WJG3 1NPNA 2APTA 5BVJB 3SDDB 1LK3H 3S5ZA 4PREB 3F7YB 4PD4K 4AYGA 4YBLC 3HE7A 2R29L 2M26A 4LLDB 4MMYA 3FN0L 2J1YA 3QULB 4XX1G 2CO4A 1BVKA 1XVSA 1RU9L 2OTPA 3HE7D 2NNCA 4LRIA 1EJ8A 2UXVA 4QRPB 1E4XL 3MA7B 3EOTL 2DWTA 4ZUUA 2FJUB 5HHVH 3R8QA 4Z7VF 2K6YA 1LK2A 4Y1AE 3JV4B 3RNQA 4YSEA 5EBMB 3QCUL 3MHZA 4XAWL 2XJLA 2ZZUT 1BXXA 5K39A 3KGUA 3RJOA 1I1YB 2WGXA 1B2WL 1OLLA 1EFXB 5GSVB 4KKBC 5DFTA 3B7SA 4PW3A 2W65A 4U7MA 2EDLA 5IHZA 4U3HA 4DFHA 2EH7H 2CHNA 4ES9A 4PY8I 3EF4A 2NSMA 4F58H 4Z3HA 3ZT6A 4X4ZA 3BCDA 3C6EA 3DO3A 4NX0A 3H9SB 3ECUA 1YNTB 2BCKB 2C7FA 1HT6A 3JUYA 3OKOB 3PV7A 2ZSWA 4GG8B 4GW5A 1K3IA 4GXVL 4DZBA 5EBLB 1JXGA 3CPLB 2EAEA 6PCYA 1LD9B 4WV1C 1IAOB 2H26B 3FDWA 3DX9A 3IJHA 4ZZFA 4K9EH 4MNHA 2GSMB 3OM3B 2WLMA 3K2MC 4AQ1B 3EBHA 1JZHA 3DPBB 2BVPA 4HWEL 5C3TA 4QO1B 1I7ZB 3V0JA 4XC3L 2CIKB 4UM9D 5C9JA 3LXAA 4EJ1C 4NN5C 4QRUA 8PAZA 3CFJB 3KJ4B 5DWUL 3T3MF 4DEUA 4NQVA 1JYXA 1OM3L 4YMPA 1KPRB 4DKEH 3QPKA 4ZW8A 1QRNE 2WLZA 4PP2A 3AITA 3K72B 5ICXA 4IBWA 3PGDA 4AQ8A 4R7VA 2IWFA 3MCLH 1RHHB 4FCHA 4GUCA 4YDLB 2JELH 1WA1X 2JKSA 3G5VA 3QHZL 5SX5H 1LEGB 4MZ3A 2CK0H 3PFUA 3RWEA 1MVUA 4F9LA 3ABLB 3EJCA 2EYTA 5HHOE 2H45A 1T22B 3IGLA 3QXWA 4AGMA 1CK0H 1Q94B 3ORJA 4KK6C 3R7QA 4BFNA 2V2WA 4AJ0A 4TVSa 4OJCA 3EGDB 4DESA 1L6PA 3DURB 3H2PA 3RWHA 2YKLH 2AXGB 3CMOL 5DD6B 1M71B 2FEEI 4LEBA 4E9YA 4WKZA 2P5PA 2X1OA 4P5TD 2YK1H 2VITB 3QUKB 3II1A 2HKFH 4IOSD 3PWUA 4F7TB 1E28B 1YECH 4N2OA 3N42F 4HH9A 1IL1A 3TBCA 3U6XA 1W91A 2X41A 3D2TA 3B7UX 3H9YA 4XHQA 4MA3A 2PMZA 3BW9B 3QXTA 3BSZH 4B9GA 1I1AB 3DIFB 3V5HA 1AS6A 1IU1A 2NDFA 3EYVB 3MFGB 2CO2A 2OMVA 5AW6B 1QRNB 1J0ZA 2HTLD 4P2RA 4EVNA 1CB4A 2X0VA 3AQDA 4OLEA 1B6DA 2FD6H 3TWCH 4X6CE 3WSQL 4XVJH 5LGJA 4P2RD 2FUQA 4MA7H 3L5WB 1ZA6B 1UKQA 4YHNA 4B50A 1YEGH 3CSTA 3VXOA 2GQHA 4BFIB 4ELMA 3HNVL 4M1CD 4TNVK 2WVVB 1XCXA 4O2FA 1NLBH 1BEYH 5MP6H 4M4RB 5HHOB 5AW9B 4MMZA 3WXVL 4B27A 1JGUL 1V3JA 3VFPA 2NY1C 5CM1A 5J6SA 3VX0A 3I3EA 1DQTA 2F7IA 4O58H 3KDMA 4H8WH 4RGNE 4EUPG 5A2KH 4X7DC 1RLWA 5IHHA 4ANWA 5D1QE 2J6EA 2E6PA 4XPTH 3SCMB 2GJPA 2D73A 1ZV9A 2Q3XA 1CG9A 4XMZA 3T0BA 5HI5C 2F61A 1H8OA 1GH7A 2HT4D 1U8QA 1U93A 3C8KB 4M8VA 2VM4A 3NYKA 3WY4A 4M62L 3FUDA 5F7DB 3IGAB 3UTOA 1ZLSL 4MA1C 1QR1A 3A4DA 2DQEH 4OVUA 5GGSA 1I8LA 1RZIB 3QWRA 3C5JA 2AJXL 5KJ7E 3E3QE 4G8GD 5B3JE 1XAUA 5IESL 3QWRD 2VQ4A 4H25A 2H3NA 2P45B 1IAIL 2QGCA 2Y24A 3I2CH 4HIIB 2AI0H 4ERSH 4BZ2L 2AQ2A 2P8PA 5E99L 1NWOA 2R1YB 4UIMA 4YDVB 4ZFOB 2HMIC 3U36A 3GJFB 4N2EA 4X7CC 1DHKA 1IT9L 4BGLA 2J1XA 3QUMH 4OT1H 3VSVA 2ENYA 5J3HC 1MJ7H 4IIQB 5I19L 3MUJA 5J9PA 3HG3A 4NO3A 1FCGA 1KG0A 1O6VA 1SRDA 2OXHB 3CVIL 2ADGA 4Y9BA 2XPGA 5AW2B 4DO6A 1MAMH 4RGNB 4F7EB 4YZFE 3Q2NA 3REWB 3T1FA 1WA0X 3LN5A 5D1QB 3D25A 4G11A 4HS3A 3VH8A 4LQFL 1FPTH 4OIBA 2Q5BA 1E67A 3CCHB 1BVNP 3CPUA 4BRVA 1CD9B 4HUWB 3ARZA 3NCEB 2NTFB 2BNQE 4YHYB 4PRAB 1S6NA 3QZBA 4P9MH 1DVXA 1D7BA 1CT8A 4N5ED 1OD9A 4DERA 4Z3TA 5I75C 5H4YA 5KVDL 1DBML 2UZYB 3MV11 2KH2B 3C08H 2ZYHA 4KVCL 3CD4A 4EIZC 5DC0A 1AQKH 5IJVB 5FECB 1YVLA 1XX9C 3SQOL 1QNZL 2ORBL 5SX4I 3ULVD 3C60B 4TPRL 4KAQL 1VCAA 3VGGA 4HWZA 5E4EC 4OGYH 4Z7OE 1PZ5B 3PG2A 1U2YA 3MRPA 1MCWW 2ZWNA 1EV2E 1V7ML 1PZDA 3GHBH 3UC0L 2VN3A 2DICA 3LN9A 3BT0A 4UYPA 2FWSA 3QDJE 3MRRA 1A9EB 4GRMB 4FC3E 2W0LA 2DYPB 1SPDA 1E7UA 2GEQA 1WFIA 4W6YB 3RVXC 5DJYB 4WUUE 1PZCA 1Z5LB 5DHYB 2NY4B 1U3HC 1JPGB 2OJZH 4ONGH 5IY5B 3SD2A 3IFOA 4RMRA 4G6KL 4X2UA 2XRAL 4HIEB 3VWKC 1E5AA 1RURH 5I8CA 1NMBL 4JFED 1KJ2A 4LCCA 2DL2A 5B39B 4LASL 4KHXH 2OXGB 1I9JL 1ZDSA 3BPOC 4NT6A 4YGVB 3FFDA 2KLRA 1JMZA 3OXSA 4KMQA 4U49A 2N01B 1QA9B 4XNDA 1HCZA 3DRQA 5J1AA 2YMXL 3LV3A 1FVCB 4BWUA 3OKEA 5C0JB 1FIGH 1JNNH 1KEML 2BNQB 2CJSA 2WIIB 3HR5B 4XAKD 3LH8A 1HKFA 2R2BB 3BO8A 4N0CD 5C0RH 1XCQB 4NZRH 3TO2B 2OX5A 3NFPA 2YQGA 4AW7A 4UQDA 4YSCA 5JDSA 2Q86B 2BIIA 4WENB 2B7DT 3MJ8B 3L3JB 4FG4A 5DQ9A 4F8OA 3I84A 4FYSA 3U9PL 3ATDA 4OLVH 2APSA 1U8OA 5FFOA 4RETB 3ABZA 2AQNA 2HRLA 3VWJA 4FXGA 1LM8V 3AACA 4FYTA 5HHPA 3Q1EA 2HVBA 1ET7A 2H2SD 3IXTB 4JDVA 5T1DL 4Z7OB 1GYAA 3VWJD 1M7DB 3LEVL 1LO0H 2HXAA 4KDTC 1CGVA 3WS3B 2F1BA 1NH6A 1T21B 1FFOB 1FNSL 1LO2L 3X1BA 1QFUH 3A6BL 4WNJA 2MSPA 4YX2L 5HYSG 4CC1A 4NN7C 1XR9A 1A6PA 2Y22A 1PZ2A 3MXWH 2EDOA 4JHBA 2WYHA 3WE1A 2JKRM 4WUUB 2IDCA 2VR3A 4OCNC 1RERA 3WEOA 4IHOA 5CZXC 4YNYA 1JXFA 1A7OH 2XDHA 1NDTA 4MZRA 1HYSD 5C8JB 3HG1E 4L9LB 1XD1A 2A4EA 1RZ7L 3C5SB 1SQ2N 1EZVY 1XGRA 2GCYB 1BPVA 2J21A 1NC4B 2UVFA 2JF1A 1PLGL 1QOKA 3RVWC 1U2CA 4E9LA 3HZMA 3FQNA 4X0KA 3PUCA 3ULVL 1G9MC 4A1RA 4M03A 1XSIA 1WVZA 3H4FA 1T2XA 2E27L 3ABGA 2FGWL 5H37A 3BZDA 1KLFA 3AUWB 4F8TA 2OTUB 3CNKA 3FQ1A 3MBXL 5IF0A 2Q3ZA 3EJQA 4TV3A 3SGDI 1QHOA 4JDTH 4OZ4A 5C9KA 4Y5YC 5DJ6B 1B0GB 2VAAA 2QQQA 3ROLA 3FQXA 4PMEA 4Z3JA 4Z3GA 5K9OA 1GGBH 3OAUL 1HI6A 4IRZL 3RIAF 1AQDA 3WTVA 4OV5B 2E7MA 1X6NA 1MZZA 1D7CA 1IGMH 4PJHF 3HG0A 3RPIB 4YSUA 2VZ1A 3KPSE 4Z7NE 5J1SC 3T6WA 4OCXH 1ZLWH 3O3EA 4K7PL 1RKRA 4Y9EA 4JM2B 5FWRA 2XN9A 1MHEB 1DLHA 2VABB 4B9KC 1MCIA 4HPOL 2Y1ZA 5I1AB 1WEJH 1CE6B 2JMRA 3AAZB 4HX1A 5H2BA 3X12A 1YMHB 2OYKA 2XN9D 4OLYL 4UUJB 1YEHL 3VX1A 2NNAB 4GAYA 3HG1B 4TUKH 3TO4C 3GSUA 1I31A 4KQ4L 2UY7A 3T8XB 2H6PB 5AB0A 1LVEA 4CC4C 4KJWD 4OLZH 2HJKA 4YQXL 2YAMA 2HKHH 4XGZB 3DOHA 1VEPA 1NOAA 1OW0A 4HJSA 3LRSA 4OFKA 3UAEA 2WINB 4D0BA 2B14A 4ODHH 4JE0A 4XH2B 2BXYA 2E7BA 3DGGB 2QPDB 1SVBA 3ARDA 4DN4H 4OCWH 3TT1H 2F7QA 3BKJL 1BOGA 3AREB 3E38A 1A7QL 3ARDD 1EMTL 4H8UA 3G04B 4XXDB 2WSKA 5KYYA 3ZX1A 2X4UB 1KZYA 3OAZK 1FYTD 4BH7B 4TKWA 2Q76B 4IRJD 3CDGA 2AC0A 4NO5B 2TRYA 3CDZB 3PHSA 1UA3A 2Q10A 5D96C 4JHWH 3MTRA 4ZMTA 5ERWA 5MEOB 4GIOA 4HIPA 4JCMA 4XX1E 5FF6B 2UVEA 5BRZE 1MJUH 3OHXA 3KPSB 4JQIL 1FAIL 4P3DA 4Z7NB 2VR7A 3ILEA 3SQBA 4DVBA 4WI5A 3RKDC 1LE5A 3PWPA 3TA4D 3LXUX 4ORGA 5JIQA 5GZNC 2IFGA 3GSVB 2AJSL 3MGTB 3O6LH 3S34L 5JMRA 2WVUA 3KAAA 3RDTD 4TUJB 1EAPA 3SDDC 2YAPA 3PWPD 4PB9L 1L9PA 4I2XA 2MTPA 2PCFB 2GK0B 4L8SB 4M3KB 3ZE0E 2EH8H 2ICWI 5I0ZA 4WJ5B 2BX5A 4TNWK 5AYUH 2FEJA 4FJ6A 3LQAH 1K4DB 3U4BH 3ARFA 3K46A 4G6ML 5TE4L 2XZCH 4PJXF 1IKOP 4LMQI 1PZBA 2Z9TA 4CDHA 1T0NA 3WENA 3IJSB 3V0FA 2H2PC 3BAEL 3ZYJA 2CUIA 2JK5B 3ZO0A 3SYAA 4K3DH 4DKFH 3B9VA 2FX7L 3K6IA 1F3JA 2HVJA 4NKDA 3ZTNH 2EE0A 5I1LA 5JO5B 2NY5C 3NFSL 4W70A 5AAWC 5GHWH 4YFLF 3NEXA 3MUHL 3GWJA 1D5XA 2WP3O 2BWDA 4A55A 4GG6E 1C16B 4JY6B 5I0DA 3BIBX 1P1ZB 2Y2YA 4YR6A 2A83A 2CGRL 5KJRH 1MW1A 5TPWH 5IVZB 1N3NA 2NZ1A 1MJJB 4ZUWB 4P07A 1CDIA 3CIQA 5AL0A 1KYAA 1IBBA 1R3KA 1S7UB 2DWEA 5BRZB 4CVUA 1ZGLM 1HL4A 3GKWL 3L2NA 3VXSE 5IROD 3NZ8A 1DUYA 4NC2B 1T5WB 2EEXA 4NWTL 1XGQA 4HGWB 4KI5D 4JS7A 2VERN 5EEVA 3MRFA 1PCXA 3UZQB 3R1GH 4XPHL 2A9DA 4UV7H 2ATAA 2ED7A 4KXBA 4OKVB 1YYMH 4ACPA 3RWFB 5T3ZE 2A0LC 4U1NB 1S7WA 2C7UB 3FQRB 4NRXB 3NJGA 3ZE0B 4L37B 5F9WB 4B3EA 3W2DL 3KPRE 3Q7JA 4AQ1C 1WAAE 1FL5B 2FRGP 4JG0H 3I9IA 1SVZA 1A7PH 3QIWB 5AZUA 5DURB 3ES6A 3KYMA 4PV1C 4N0YH 3QUZA 1BZ7A 5LN8A 3KJ4C 3IMWA 4R4BB 43CAB 3EXLA 5JLZA 1A6AA 3IETA 2C3XA 5AOLA 1JNLL 2UZXB 1D6VL 3U4AA 4Z78A 2VXTL 1F6AB 5FHBL 1BJ1H 3OKKA 1HH6A 2DI7A 3RWCA 1FZKB 3F7LA 3WJJA 3ARVA 1JPSL 5CAYB 4KUZH 1J9QA 1KB3A 3NA9H 1RZFL 1N8OE 5I73B 1U8PB 4EI5C 4AIZA 2UXGA 4XCNB 2KKQA 2WXPA 2UV3A 5DVMA 1IFRA 1P6FA 4GG6B 4MJ2A 4Q0XL 3M88A 4U1HA 4Z7AA 1MCCA 1CPUA 1QLEH 2NX5A 2X4QB 3ESPA 2VDMH 4NRZB 2DQTL 4XB3A 3QO1A 5A43C 3V0VB 1DQQA 2XKSA 5AOKA 3SE8H 2YPKB 3W38A 3VXSB 3H0TB 1UOWA 3N85L 1N5YH 3RFZB 5LCVH 2COVD 1FNAA 1HE7A 2FIKB 4F7PB 4L29A 5DJ2A 1UZ8B 1Z9SB 5ICZB 5AOZA 2A5UA 2F7OA 3WIAA 3QZMA 4RAVB 3SDAA 1IC5H 3CTTA 3L54A 4FXKC 1JWUB 4H4NA 4BSVB 3O8XB 2CD0A 3KPRB 3SDAD 1BXVA 1JHLH 4DPRA 5J5EA 5DQDL 3UZEC 1NGXB 4CU7A 4EUPH 9CGTA 2GTZB 1FN4B 4YL4A 5HYFA 3RZWA 3WTUA 1OALA 1SBSH 1IKFL 3SPIA 1X5YA 1GKEA 1ID2A 4RBPH 2FX8L 5I8EB 2GT9B 5I6LA 1CFNA 5FYKH 4ECNA 4UILH 1UGNA 5F9JA 3HZVA 2DD8H 3UTZA 3O6KL 4CDGC 4XRCA 3TEUA 1H8LA 2XKNB 2EIZA 3QCTL 1FFQA 4NUJB 4P3WA 1I9EA 2YD3A 4IJTA 1D5ZB 1BFVH 2FBOJ 5F3BA 2DQJL 3NSFA 4YBQC 4XVSH 2PYEE 5ITFA 1R5WA 2BHYA 4XBPA 3NCXA 5BZWA 3MSPA 4FXLA 1U95B 4YC2B 1O9VA 1GPOL 1SYSA 4BD4A 3F5WA 4IMKA 5EU4B 3QG7L 1KXQE 1T0MA 4NENA 1R24A 1IC0A 5E1AA 4HUKB 4J3OD 3P69A 5TE7H 4D8PB 1XBDA 2GJJA 3MJGX 4N8VG 1NL0L 1T1XA 4X80L 3Q01A 3SGJC 2K8MA 4PGEB 1FC2D 2IBBA 4BFJA 2QELA 2Q2LA 2WLKA 4ZMOA 1BX2B 2BVQA 4DP6X 2IDFA 2DMKA 3PXLA 2VDMB 4K3JL 2G75A 3BAJA 4WKXA 1SNRA 4HS6B 4LSRH 2I25N 1O0VA 4HJUA 5DHVH 4MBOA 4MAYD 1F4XH 2DQDL 3M8OL 4PWJA 1BIIB 1WZ1H 1J12A 4QXGH 4NQCB 2GKIA 4KK5D 3G9VA 4E5XB 3RU8H 1D5IL 1DVUA 3NJVA 4WFHE 3EYQC 1H5BC 4NUGL 2FWOA 4G7QB 3KWWA 4HUVA 1VIWA 4L4VA 4J4PA 3IAQA 3WNKA 1F02I 4IKLA 4P4KC 3AT8A 3U25A 1N0LA 2X6AA 4L4VD 2R2HA 4J4PD 4Z6AT 3K8KA 4U1IB 4FXTA 2H8PB 6CGTA 4WWID 3P30L 2PYEB 4JNXA 5JOPE 4PJBA 2X6UA 3L3IB 5IG7B 3U0TA 3S8WA 2DQCL 4X0NA 3X3GL 4N2GA 4P5RA 4LLUA 1DUZA 4XO4A 5IQMA 2CIIB 1KTDA 3TPUB 2BSTB 3HFMH 1ECYA 3O2DA 4L1SA 4MBRA 3H9HA 3Q5YA 1M6OA 4I18B 3Q6FB 2ZWLT 4PBDA 4FF9A 4BHUI 5EHFA 1WAEA 4DNLA 5TQ2H 1V7NL 1PAMA 5E2TH 4DGYL 4DP8X 1C7TA 3DI3B 4POZD 5D1QC 4JFHE 1I3RA 2DEWX 4H26B 3GI8H 2BVTA 3T0XA 3O9WA 1AGEB 4PJ5B 2FEDC 2HB0A 4G7YL 4URTB 5DMYA 2MQGA 3D05A 3O9WD 5DMGD 4X6FB 5I0WA 4LXFA 4YHYC 4TRPH 1TENA 2A74B 4ZG1A 2QVTA 5BV7L 1N2RA 5C0CD 4GKZA 3SDYH 1MCJA 3MMEB 2UZIL 4QHNA 3OR6A 4WZ9A 1CIUA 1RY7B 2VW6A 4M93B 2RTTA 5D70H 3E3QC 3L9RB 1U8KB 1JK8B 1DN0B 4NQDA 3TTYA 1GIGH 2Z4TA 2MNJB 1ANUA 1UFUA 3NCJL 1E5ZA 2GBVA 4YHPB 1ND0A 2H9GA 1UEMA 4KNUA 4LZKA 4JFUA 4MJ5A 3C60C 4EN3C 4MCNA 4OLXH 2WLIA 4NQDD 1OXYA 3N2JA 1I8AA 3EADA 1S9WA 4H13C 5DJCB 2X4TA 4ADJA 5FKPB 4OCYL 5EZIH 3UAJC 4V1DD 1K4CB 1KCSH 3WFZA 5A2IH 4HHWA 5D72L 1AC0A 2LHAA 1MIMH 2Y5EA 2BIPA 3KNBB 3V6OE 2ZUQB 1JBJA 2YGOA 1G9NH 4C4KO 2YSSA 4DP9X 5DT1L 3S8FB 3V4VB 1MFEH 2NY4C 3B6SB 1UQSB 4LRNH 2XCMC 4HCFA 2BVOA 3Q2VA 1TYRA 3DLQR 1T4KB 5D7JB 1KULA 1SY6A 1CFSA 2JCWA 3OJDB 3UTTE 3WJLA 4FI7A 4EZMA 2F6AA 1B90A 1QPXA 1WG3A 4PJIF 2FQEA 2UWEA 1ZTXL 4EE2A 4HOZA 3E8UL 2I9LB 3RTQB 3DARA 2QPFA 4X4ME 1IAMA 3LSOB 2AABL 2FL5A 3EBAA 5C0EA 2VLKA 5LNGA 1YMMA 15C8H 2JLLA 5F8QC 3FN3A 1KGCE 4QGTA 1DANT 3U46A 3IE9A 1FJ1A 1HHKB 2VLKD 1YMMD 2DLIA 3VD0A 3MZTA 2VMFA 5CEZE 4ZUSA 4TUOB 3PGCB 4XNYL 5CBAA 4WY7L 4ZO7A 1DSFH 4PRHA 3BKYH 3N1MC 3OAYH 4JPWH 2K3TA 2YXWA 4MCZB 4Z8FL 4LO9A 4S1RH 3DYOA 5F9OL 4PRHD 4GSXA 3WEMA 1RZKH 1JTPA 4R7DA 3U0PB 5CGBA 4ALAL 3M1BB 3L2LA 3L4UA 4G71B 2AQRA 3CBRA 5ECGA 1G7LA 4JZNA 1KWGA 1HNFA 1FFNA 2RH0A 1EFQA 4NIKB 1F4YL 3ECVA 1YQ2A 1XO8A 4YHKH 1HCYA 5AZ2L 1HCFX 2PP7A 4D9QD 3B56A 1WWCA 3C5ZB 2D7TL 1L7TL 4EIGB 4LCYB 1E9OA 2F58H 3ZK0A 1I3GH 2Z35B 4AMKH 4D9LH 1ZVYA 5LGYA 1PKQA 5DJAB 1LYQA 3L1FA 3CXHJ 5INCA 3UTTB 4F15C 2Y23A 1HQ4B 3EO9H 3U9UA 4JO5A 3DO4A 5CN1A 4P57A 3BEVA 5FB8A 4JAMB 4OF6A 1OF2A 1OE1A 1TETH 3P9LA 4UAOB 5ANMA 4B97A 1MHCA 3A6CL 3FT3B 1JZ2A 2LOEA 3R7RA 1C8QA 4H20L 3RAJH 2Z34A 3PXJA 4ETQA 3RA7L 2D7OA 1JGVH 2KPNA 2PCYA 2ZF8A 3CIAA 1J11A 2YO3A 5D7LA 3X1FA 1XAKA 1CURA 1RZJC 4F33B 2YPVL 4UOJA 5HYSB 2HWZH 4GJTB 4PLNC 5CINH 3B83A 2CRMA 5D7LD 1S3KL 1NAMA 4J1UA 1BAWA 4O5LH 2AW2A 2BSRB 3FNKA 2IG2H 4S1DC 2J5LB 3HB3B 2GVYA 3LIUA 4BXSV 1MWAH 4M6NL 1J5OL 2M1KA 3NESA 5I1GH 3RQ3A 2Z92B 3NZUA 4PVLA 2NTSP 3ARGD 3U79A 2CO1A 5FW8A 5GS3A 4JX0A 4FFYH 1LILA 4I8DA 2GAZA 3P4OB 2WZPD 3QISA 1NAKL 4OJEH 2J56A 4I0PA 1FNEA 5DLMH 1ZGLB 5BUAA 3WIHA 2FHBA 1KIQA 2VXQA 2ZG2A 4XP1H 3FT0A 4J3VA 4OZHF 4PI0A 3UG5A 4DP1X 3BWUC 5EC1A 4I0PD 1UWGL 4LLWB 3CLWA 4D9RE 2AXWA 2R23B 4DN3H 5I0VA 2R1WB 1G87A 1PSKH 4UYQA 1YNKL 4UNUA 1WGVA 1MY5A 2FT8A 4UQ3B 1IEAB 3VRIA 1G84A 3NRPA 2ITDB 1KJVA 1UKSA 3BDYL 3D4YA 4G9DB 4A2MA 2BHFA 3OMIB 2R7EA 5H35B 4AJVA 1RK7A 2B16A 3CMGA 4HPHA 1E9QB 4BDVB 4TYUA 3IS0X 4WV1A 5CGYD 4K07A 1KIPA 4P0DA 4GXUM 3ILPB 3MRGB 1EEZA 1QWHA 3O6FB 4O02H 3AGWA 4C4UA 4DO4A 1N7MH 1AVAA 4ELKA 5HD8C 4OQTA 1C08A 2MCMA 3VI4E 1J18A 1W8OA 3L3DB 2FJHA 4GPVA 5IJCC 3VYNA 1SM3H 2B1AL 2XSKA 1KPUA 4P2YA 5ID1B 3SDCB 2X9YA 5IJDC 3ZSSA 5AW5B 3RY6C 4RISH 4MJIA 1QSFA 4Q6IC 5AWNH 4UQAA 2JFCA 1A1OB 1Z9OA 4MAZA 4CBPA 2O61B 1BFSA 1EH9A 2EKSB 3FT4B 1MNUL 1QPKA 2HT2C 3S7GA 4MJID 1QSFD 3OGCA 4KC3B 1P6AB 2FTAA 3AU1A 1RV6X 4M7LT 3UGEA 3PHQB 1C12A 2P5EA 3WL9B 3CAFA 4L8DB 3HEIB 5I8KH 1ZSDB 4PYGA 1QUPA 2DBLH 4DWHA 5KS9A 3HFFA 1MCQA 4AQOA 1IO4C 5DSCB 2P5ED 3K81A 5C0AE 1U3NA 5EO1A 2EO9A 1UT1A 5EOTA 1TTUA 5C92A 5A40E 1A6VL 2HA1A 4XCEB 3LB6C 3GIVA 5EPMA 3HN8A 4XVUC 1QW8A 4JO2H 5AAMC 2ADJA 2HG5A 4LSVH 1D5RA 5C0GA 1NAML 3TCLB 4ZYKA 2VDRH 2VQUA 3GIZH 3UO8B 4P2OA 5J56B 5KSUA 3PGFL 4FLQA