2KYIA

Solution nmr structure of dsy0195(21-82) protein from desulfitobacterium hafniense. northeast structural genomics consortium target dhr8c
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
MDNRQFLSLTGVSKVQSFDPKEILLETIQGVLSIKGEKLGIKHLDLKAGQVEVEGLIDALVYPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Combining NMR and EPR methods for homodimer protein structure determination.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
total genus 12
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kyiA01
2KS0A 2KYIA 3IPFA
chains in the Genus database with same CATH superfamily
2JELH 1H9VA 4RFNB 4DGYH 1BVOA 3S34H 4GUPB 3MXWL 3US9A 1H0DA 4NWUL 1TJHL 1Q8MA 4ZDHA 1NIAA 1OAXL 4Y5VC 4DFHA 1RZKC 1HI6B 1YNLH 2P5WA 4QRSB 3RPBA 5F3BB 2IH1B 3NDZE 4L23A 3P73B 1ZS2A 3D69A 3H4FA 4HUUA 4NQXA 3FU7A 4EZMA 3FFCA 4NQSB 2WWOA 3GSOA 4WENB 4NQVB 1C7TA 4MS8D 3K72A 2A9DA 3TYGL 5EOQH 4TULH 1PCSA 2WYHA 1EDHA 5IQ9B 3CHXA 1NC4B 2FX9H 3MX0B 4R7XA 5JXAL 4K9EC 3FTSA 4G5ZL 3BHBA 4XNYL 5E8NA 1E9PB 1OW0A 2XA3A 4X4KA 1XCQA 1J48A 3OAZH 3HTLX 4NYLA 5AW8B 1YMHB 3BDYH 3I6KB 4P99A 3PWUB 2Q7AA 5EMYA 1N59B 1HEZB 4Q9RH 2CJUH 3S36H 1MFNA 4JFPA 5ICZA 3M8OL 3MTXA 1CC3A 1B4TA 1F90L 5HHPB 4N4YB 4JFFB 2R27A 2YD2A 3AW5A 4H8HA 4OSUH 4UV7H 5I8OL 15C8L 4EO5A 1I53A 4CJ1A 2E86A 2V7NB 2EIDA 4UIMA 4PLJD 3MZGB 4M62L 1MFAH 1NUFA 1MIEH 3N85H 4ZTEA 1ICTA 3C60B 5D5MA 4KJWC 3KNBA 2MRYA 3MBWA 4U1SA 5F71A 43CAA 3UGXA 3ML9A 1P5UA 2Q8BL 3LS5H 5I71B 1JBJA 1A7BA 3ZDYB 2GTZB 1IGYB 3EGSA 3HZVB 5IOPA 4HUVB 4ZFZB 4F3FA 4XHJC 5IMLB 4HYTB 1JZ5A 4ONHA 1O0VA 2IJ0C 2X4UA 3WEOA 3VD4A 1KGYE 1KPUA 1EZUA 4PAZA 2G9HA 3HB3B 2CIIA 1EXHA 1H3TA 2GK2A 5D2LB 1W8NA 5C92A 3DJSA 4V1DE 3F7KA 3SKOA 5JW4M 4P2RE 3ZZQA 1HILB 4ETQB 4FQLH 4PJDB 5C08E 1SXAA 4GBXA 3CH1A 3CK0H 3G5XA 2P52A 3GQFA 1WDAA 2QZQA 3S35X 1KPRA 3NQKA 3T09A 1A9VA 4XB3A 4XPGL 3WTVA 4B0MM 4LL1A 3T77A 1L3WA 1H0DB 5D7JC 4P23A 4ZDHB 2F68X 2UWEF 4KGLA 2OYMA 2P5WB 1OSEA 5J1SC 4NERA 5A2FA 2EH8H 3PRZA 2OW7A 1FL3A 3P3YA 5IESH 3D69B 1R3HA 1UT9A 4ANVA 1WC7A 3KLDA 3OR6A 4HUUB 4NQXB 1XF5B 2UVFA 4E0RA 3FFCB 4RGOL 1XB6A 3GSOB 4E9SA 2XXCB 3K72B 5EZJB 2ZCHH 4TM9A 1ZLWK 4Z7UB 3TA3D 3GRGA 4U0RC 5I1KL 2XZCL 2Z93A 2FNBA 2FX8H 3BHBB 1HYRC 4UOJA 1G6VK 5E8NB 2D2OA 4IOSA 1YEFL 4GSXA 1VDGA 3GS4A 3QUYC 3RZCD 3JV6A 3IDGA 3NIDE 4Q0XH 5ERWB 1FORL 3POCA 1KJ2A 4W9LC 4O5LH 1BXAA 4NO3A 3LNFA 4PREA 4JFPB 5F7WC 4HCGA 4Y7MA 1WYJA 4HIJA 4L9LA 5LBSH 4I9WE 2VLKA 2FQGA 4LFHD 5DJCA 2B4CH 1SYVA 3FT2A 2VRKA 4PIBA 4LCWE 4UIMB 4HPOH 3HVNA 3H9YA 4JGJA 2FLRT 1JGEA 1S3KL 5D5MB 1NCCH 3CSBA 3D87B 43CAB 1E4WH 4PRHA 2A6DA 3BKJL 1A8ZA 3HHRB 4ICWA 3RQ3A 1ZT7B 2PYEA 4OI7A 2HLFC 3BLPX 2B59A 3EGSB 4HUXA 1QACA 4OZHA 5IOPB 3IDXL 5E8OB 4FHJA 1E4HA 4Q2ZB 4F3FB 5BZWA 3ZTNL 4DZ8A 3IE4A 3VJ6A 2CDEA 3BAYA 4NN7B 2VMJA 4ONHB 1O9WA 3ZE1B 1BM3L 1OQXA 2PO6D 2X4UB 4KDTC 4U1HA 1KPUB 1KFAL 2CIIB 3CZSA 4H1LH 2H2PD 1SHSA 1X5YA 2J21A 1CICA 4ZW7A 3SKOB 5IFHL 3VFOA 1KJVA 3BD4A 2F19H 2ZUXA 4U4BA 3SDXA 3DMMD 5MHSE 2H4EA 1OSZA 2QGCA 3AG1B 3QDGE 1N2RA 1AG6A 3CH1B 4GBXB 3UTTE 1IBGL 1XSJA 3G5XB 5ILTL 1KPRB 2V2XB 3DWTA 3T77B 2MWCA 1PNCA 4PY8I 4XP4L 2XZQL 4P23B 3PAUA 1U8OA 2ARJA 1K4DA 5FGBA 4A7VA 5GS0H 3APNA 4OM0H 2F8XC 1KIQA 3KW7A 1YLBB 4JHZA 1M9SA 4PJ7A 4FNRA 5F72S 1QTYT 5DURB 3W9DA 1TZHB 2CPUA 1Z0NA 2ZXBA 3QFJA 1Z32X 2M1KA 5HJDA 2BDNH 5TE4H 3N41B 2EILB 1GZQA 1NWOA 4OF8A 3D8MA 4H1LA 2F18A 1R3HB 4MAUL 3GGWA 1P9MC 3OR6B 1JZ7A 4BE6A 4E0RB 3S96A 4JK0D 3ZR6A 4MJIB 4YBLB 3U48A 3EHBC 3AB0B 1GGIL 3ZRSA 2WCSA 4A6YH 3N0PB 4LOUD 4WJG3 2C9SA 3JYBA 3TF4A 2DPKA 3DDFA 1RQ5A 2Z93B 2CRYA 4YQXL 3KYOA 3QUXD 5L4FA 3VXRE 1IBDA 2VXUL 3IDGB 2KL6A 4OIFA 1Z6JT 4DETA 1KJ2B 1TF4A 5B38B 4OCMC 4NO3B 2F9BT 1AQHA 4LCIH 4JQVA 4GQZA 3WXVH 3ARGA 3U1SH 2QSTA 2YAHA 4HIJB 4QJ4B 3B7UX 4HJEA 4L9LB 3AJ7A 5IREA 2XKNA 4PR5A 5IBTH 1SPDA 5JW3L 2VLKB 2XN1A 4A6YA 4ZO9A 2DLGA 3CZJA 5CJQH 5D8JL 5DJCB 3FT2B 4HAGA 3QPQD 2DY2A 3CLWA 1MZZA 2BNRA 5HHOA 2F1EA 1JGEB 2WLKA 3DYPA 5B1JC 2VXVL 2WXMA 2A6DB 3BWZA 2VDKB 4M43L 2PYEB 5J13C 4XPFL 2B59B 5DD1H 4HUXB 3K0YA 3AY4C 4OZHB 2EE9A 5DQDL 3VWKA 4CU8A 5BZWB 4DZ8B 4WQOA 1T1ZA 3VJ6B 1M9WA 2CDEB 3AU1A 5EBLA 2MPAL 1D9KA 4UTBH 2ZCKH 2VXQL 2JIXA 3JTBA 1S9KC 2ZYRA 2HFEB 1QSZA 1Y7VA 5A2CA 1CICB 4WKZA 3VFOB 4N5ED 1AKJD 1KJVB 2HRPH 3OZ9H 3IGUA 3UDWC 3SDXB 4OF7A 4LNRB 1OSZB 3H2WA 3Q5YA 2D9QB 2VR3A 4H88H 1FCGA 1N2RB 4DP0X 1DQQA 2CBPA 1HHHA 1PS3A 4M93C 5JORA 1Q38A 4W68A 4P4RB 3BDBA 1KCSL 4X7FC 5GRVK 3VFMB 3VXMB 3STZA 1Z9MA 1ZEAL 3BP7B 4Z7VF 5C0BB 1HWGB 2CLZA 5TQ0H 1N64L 4M5ZH 4QTFA 4RLDA 1U8OB 2ARJB 1K4DB 5FO7A 1ITBB 2CKBH 2B1AL 3VTAA 3EGXA 1IKFL 1KJMA 1JYVA 5HDWA 4CVZA 3WE1A 4FQIL 4WWNA 5FYKL 4PJ7B 1AFVH 3W9DB 3QFJB 3LHPH 4IJ3B 4UTCA 2WZ0A 1AS8A 9PCYA 1GZQB 3OR7B 4GAGH 2IG2L 4H1LB 3SE3C 3BQUB 5AZEH 5ACLA 2L7JA 4MYPA 1D5MB 3ZN6A 3S96B 4Y7OC 4EI5A 2YPLB 4PJ9D 3WEBA 5HJGA 3Q2NA 3X14B 3WNPA 4WO4C 3AQZA 3W57A 1QMUA 2QKIC 2C7UA 4BQCA 5B8CC 1NGXA 3DRQA 5D7IA 4ERSH 1JZFA 1NAMH 3KPRA 1NDGA 3MRMA 3BP5B 1KXHA 1ZE3H 2E6QA 3HJEA 5D2NE 1T1YA 2CKBA 2IWKA 3O4LA 3E3QC 4NFDA 3EF4A 3Q8EA 3CD4A 5ALBH 3EKCA 3UG3A 2L04A 4OCRL 1PZSA 3ARGB 5CLTA 4RGNC 2A9NL 3N44F 3QSKB 3QFGA 2FTAA 3L4XA 3N42F 4O02H 5F21B 2XKNB 4PR5B 2QV4A 5F96L 4I9XA 1U8CA 1UYWL 1WS8A 4NKDB 4A6YB 5BJTB 5I6OA 6CGTA 3WTYA 4C83A 1GY2A 1TDQA 2BRQA 2QPSA 3LXBA 3VE0A 4G6AD 1I1AA 3DHPA 3MXWH 3RFRA 1KN4L 1GVIA 1TJHH 4NWUH 1CXKA 1ED3A 2B20A 2FJUB 2PKDA 5HHOB 3BPLB 1OAXH 4KC3B 3S4SG 2X1PA 4NM4L 2BVPA 1ZTXL 2G0KA 1A1NA 3MV01 4GUOA 1XGQA 1IMHC 1XX9C 4DKEL 4I0KA 3CSFA 4GAAA 4ODWB 2IBZY 4PJEF 1KB3A 1T1ZB 2NNRA 1L0PA 3AU1B 5D72L 3Q06A 3I9GH 1J88A 4N2BA 4O02A 4DJMA 1D9KB 1H15A 2LU5A 4WV1C 4QAMB 2DV6A 5JXAH 1M53A 1NGWB 4Z0XB 3RKDD 4YL4A 2E7DA 2ZXEB 3FONA 2ARJQ 2ZXGA 4G7RB 2XQYG 4E9XA 5A40E 1DCEA 5ANMA 3H9SE 1FO0H 1JZEA 1FZMA 2AI0L 2K6WA 3F58H 3QI9A 1DQQB 1YAZA 3EFDL 2X9XA 4XPAL 4GSUA 5JORB 2CUAA 3QEUA 5C0JA 2I9LA 3STZB 5ID0B 5EB9A 1TQSA 2CLZB 3X12A 4HHGA 1F90H 1PAZA 2AITA 2AK4E 3LKPA 3EGXB 1KJMB 5JHLH 3Q13A 5DVKA 3WIIL 1L9PA 4CVZB 3RWEA 1P84K 3RUGF 15C8H 5IF0A 4UILL 5FF6A 1E5AA 4RFNC 2B2XL 4G9FD 3GZKA 5EF3A 1LGVA 2TAAA 4M62H 1SLXA 3I9IA 3T4AA 5D1XD 5J89A 1JP5A 2VH5H 2C7FA 2XC8A 4HUWA 1TSHA 2IWFA 2GFBA 1NBZB 4GSQA 3NDYE 5DZLA 3JVGA 1V3KA 3HBZA 3QJUB 3FOMA 4Y16D 5EO1B 4Z7OB 2Q8BH 4WFEE 1E4KC 5T3XE 2C7UB 3I6LD 1NGXB 5D7IB 1AQDA 5CJXC 5J1TC 1HSBA 1NDGB 3GNMH 2K7PA 3DUUB 3MRMB 4QRRA 4R7DA 5H37G 1X4ZA 5CILL 4JO8A 4XP1L 3C5ZD 1T1YB 2CKBB 4A1RA 4BFJA 2QEJA 3LZNA 2BY0A 2YA0A 4OAWB 3L48A 4GRLA 4J12A 5KUKA 5DMGD 4NNYB 3TESA 3EJYD 2VN6A 4DUXA 2HZHA 2FJGA 1JAEA 3QIBD 4NC2B 2IPTH 5L0QB 3U2SA 1QSED 3PWLA 4ZOBA 4JUSA 5LJYH 4NWTH 1U8CB 3DGDA 4J1UA 5CZVL 1CLCA 3MOBL 3HS8A 4C83B 3VE0B 3L6FA 3CN2A 5FHBH 2VJ8A 2PP7A 4HGMA 1U4EA 3QO0A 5JW4Q 4Y88A 1G5AA 2F08A 1ED3B 1IAIM 3NQIA 5C0CD 1YSOA 4KAQL 1M1XB 3OB8A 4LLUA 2BVPB 4HU8A 4DKDC 1A1NB 1AZRA 3MRNA 4J28A 1SMAA 3MOAL 1OB1A 3VM7A 4EDWL 4JM2C 4LLDA 4QOKD 4PV8B 3C60C 4UF7C 5FO2A 1YY8A 4BJLA 1M6UA 3QZNA 5I71C 2VNCA 1H15B 1R3IL 1UA6H 4P57A 3OTTA 5I1KH 3PQYD 3LY6A 3GBDA 3P0YL 4IU3B 4WGWB 5TK4A 3FONB 3QGVA 5AD0A 1XF4A 5JHDA 5FFGA 1YEFH 4I48A 4IU2A 4ZPVA 4JHWL 5ANMB 2NTFA 1SZNA 1FZMB 4AG4L 3BT2H 3NN8A 3QI9B 3MLRL 3VFTA 3HB3C 4PCTA 4KX9A 4B60A 2K70A 2OSXA 4W81A 1IKOP 2FQFA 4XVJL 3QEUB 5C0JB 1ZJAA 5LG1A 1FAKT 3FAWA 4H20L 4V2BA 2E59A 1EEUA 2FL5A 1T22A 3LKPB 3OC5A 2ZKWA 4G1MB 2OL3L 2K1MA 4HIQA 4KI1A 2AV1A 3WI9A 3FUEA 3K8LA 3NFNA 3RWEB 2OTPA 4HMCA 2V5RA 2YS4A 4OCYH 1CDJA 3GINA 5IF0B 5FF6B 5KANG 4A68A 3QK0A 1Q9LA 4FTVA 5KBMA 5F70A 4KK8C 3T4AB 5F7EL 3AVEA 2EO1A 1E2WA 3WNOA 2LTQC 4HUWB 5A7EA 1S3KH 2GFBB 3G6JB 3MNDA 3WIHL 1KEML 4YSDA 4TV3A 1AI1L 2K3TA 3FOMB 4G83A 3BKJH 4G43B 3GZPA 1K8IA 1AP2A 3KWVA 1I3GL 2Z4QA 1AQDB 4I3SL 4XBEL 3RWGA 2X87A 1HSBB 2FJFA 3IDXH 1BMZA 4R7DB 1XTLA 3OXRA 1FIEA 2G2PA 4W9IC 2YARA 4X7TB 5FFOA 5IVXA 1Q1PA 3ISYA 5TGBA 1BM3H 3UMTA 3QO1B 5GS1C 3DUSA 1KFAH 4L1HA 4M1GH 5FS5A 2QPDB 1UM4L 4UM8A 1F13A 4EUPG 3WY3A 2GJ6D 1J0IA 2A77L 2QSQA 3QUZA 1KXVA 2B0SL 3BWSA 5IFHH 5E4AA 1AY1L 3U2SB 4OLUL 2WLLA 2VIRA 3ESVF 4FFWC 2AJ3A 1IBGH 4J1UB 3GB7A 3RA7L 5ILTH 3Q2CA 1U41A 4W9GC 2WIMA 3BIBX 3MJ8A 4CKVX 5ESAB 3QO0B 3A5VA 4XP4H 4P2OD 4YSRA 2XN9D 3SQBA 3DBSA 3OLGA 1FVDA 3IMSA 2B14A 1J86A 3TCLA 4LLUB 4POYA 2ATAA 1LM8V 1PU0A 3MRNB 1CXIA 1OB1B 4BUQA 3D0VA 2PPFA 4YGAB 3M17A 4LLDB 1NCWL 3QNFA 4QXWA 3T6WA 4MAUH 1YY8B 4C56D 1KGCD 3R18A 4XO4A 4XNMB 1QBML 3JV4A 4MJ6A 3UOAB 5CGMA 2CUHA 2A3TA 3C8HA 4P57B 1SQ2N 3HAEH 2QR0B 3VGHA 4A63A 1JPTL 5AUMA 2HJLA 3LZLA 2Z65C 4QHPA 5AD0B 4NN7C 2V0AA 5KANI 1A3QA 2VQTA 2WTRA 3B34A 3F65A 4I48B 4NUMA 4IU2B 4ZPVB 3RVTC 3DURA 2NTFB 3TEUA 3NN8B 2BSED 5CCJA 3O41A 4P46D 1ZT1A 3BZ4B 2WXKA 3MUY1 5FV1L 3VSTA 2FL5B 1T22B 4XCCL 4M7ZB 4GBXC 2QQNL 4LKXB 2AV1B 3CVCA 3NFNB 5C07D 1TETH 3O2WL 2NY4B 4JO1L 4GT7A 4AEFA 1XAUA 2YQGA 3GTTA 3HAEA 3GSRA 3MRDB 2PWDA 2W0KA 5DQJA 1T4KB 5C0DA 4D0BA 1HL8A 2VXVH 5HI3D 4PJ6A 4JHUA 4M43H 1E8ZA 1R19A 4NKIL 4ALAH 4WUUA 2Z4QB 2R83A 3B5GA 4J4PA 2OLDA 3RWGB 2FJFB 3LPGA 5L9DL 3HI1A 3ULVL 1M7IA 3U0WL 3H7BA 1A1MA 4YBLC 3KWXA 4RVBA 4ZODA 5IVXB 2O1AA 2QV2A 2CJSA 4HUCA 4Z5RA 1JGIA 3QVAA 5TGBB 2RIKA 4TN9A 4TQ8A 2VXQH 4Q9CA 3DUSB 2HN7A 4QHKJ 2JK5A 4QRPD 2GI0A 3F7VA 1JHLL 3RIFK 2GUOB 2XCMC 2YUVA 4DP1X 2CR6A 2WLLB 2VIRB 3VO0A 3AXIA 4PJXF 2AJ3B 4JW3A 1TZ8A 1WCBA 1ZIBA 4L4TD 1T2QL 1FFOA 3GB7B 4JFZH 1B3JA 2JKIS 3L3GA 3MJ8B 2VDQH 3ZSSA 4UMSA 2HT2D 2HG0A 1NPUA 3BUYA 1HINH 4AW4A 3TF7C 1ZEAH 4HD5A 3LNHA 1N64H 4HOXA 5EC1A 1BQUA 1T7VA 4WAFA 5FUCC 1IKFH 1FVDB 5AFAA 2NYKA 3VG0L 3U2IA 4LVEA 1FI8C 3BGMA 2TRYA 4FQIH 1A14H 1KY7A 3OLEA 1OK8A 1PBYA 2ZWKA 1HOCA 5FYKH 5H2BA 2AANA 2VXQA 4YVNA 4TVPL 3ORJA 3M17B 4MXWH 1NUGA 3BAIA 1BGXH 3BUBA 4GSRA 3E3QE 3T3MB 5GSVA 3JV4B 4MJ6B 5C7ZA 4KK9C 2Y36L 3F12A 3GIVA 2BPBA 4IBQA 4ANWA 5DJ8A 4NCC1 4RGNE 43C9A 4E41D 4LOVA 3AS2A 4KJQD 5AUMB 2HJLB 3UG4A 4E5XG 3S8FB 3P3UA 3R1GH 2WTRB 3IWUA 2EABA 2H6PA 3DURB 3ECWA 1H5BC 4JFXA 1KTKE 3E7JA 2MCG1 1SJXA 1WIUA 2F53D 4FNLH 5DXWA 3EUDA 3O41B 4CVUA 1ZT1B 3KPMB 4XXWA 3OJMB 4OCRH 1ZS8A 4AQEA 4PLOB 5DGQA 3DIFA 3NGBB 3UJJL 5KN5A 2X1OA 2Y24A 4ZTOL 4EXPX 4TNVK 4MXQD 4RFOL 2X3CA 3GLDA 2BHYA 5INCA 5J6GA 5AB9A 1UYWH 2MHAA 1SOKA 3MRJA 5JZ7C 2J6WA 3FTGA 4A66A 2B16A 1ZPLA 3HAEB 5CR1A 4YZWA 3GSRB 5HI5C 1KN4H 4PG2C 2JCCA 1OHQA 4D0BB 5C0DB 3T6QC 5C71A 2RACA 5DDHA 2FX7H 4NM4H 4WW1A 2HTLC 2OULB 3BQUC 1PKQE 4KVPA 5HP5A 2ZPKH 3HI1B 1M7IB 3H7BB 4Z95L 2Z9TA 1GR7A 1SHXA 1TJMA 3QAZB 4Z5RB 5DUML 3ARZA 2A9ML 4P5RA 2HN7B 2A1WL 4GKNB 3IPFA 2LW3A 4JANB 2JK5B 1YNTB 3OJDA 1BFOA 3F7VB 4PJ8A 2ZG2A 2WYIA 4FJZA 4R6UA 5E94A 1EJFA 1HS6A 2J88L 4L8SA 1SNRA 3ZZSA 1HHJA 1ZJBA 2XIBA 4N6RA 2ITEA 1YJDC 2WQAA 5GS0C 2OSLA 5HYIA 2AI0H 5DMJB 1WCBB 1JK8B 3EFDH 1SDYA 4RRPA 4JQVC 1FFOB 1G87A 2AXFA 3WLBA 4QRQA 3ZU8A 4KQ0A 4XPAH 1OPOA 3L3GB 2DLHA 3HE6D 6FABH 3NIGB 5CLZA 3VXTA 1OTSC 5KS9A 2D8KA 4M9OA 1HIML 2H2SD 2Q20A 3WIIH 3BGMB 2B1OA 2WSKA 5H2BB 1HOCB 2P80A 3TO4A 1XXFC 4UILH 2KZWA 5F7FA 4AVJA 2B2XH 5ICXA 3UTOA 2ATPA 1J0KA 3WUWA 5EZIL 5GSVB 2CCVA 1FF5A 4ONGH 1P53A 3RGVD 4ES8A 3F12B 5EIIG 5DJ8B 3ILEA 4ELKB 43C9B 3OKYA 2KQMA 3EO0B 2XBDA 2YD0A 3IRPX 2EIEA 3FXIC 4KH2A 3AAZA 4WEUD 3VXOA 4QNPE 1D9KC 3IDYC 3WKQA 4XP1H 3BZ5A 4BXVA 1A7NH 4JFXB 1QEWA 1I3RB 1OZTG 1J10A 2IBZX 4ZUVA 3V4VL 3MCYA 4X6DA 2HG5A 5K69A 1ZS8B 2DQHL 3ARDD 4TNGA 3U7WL 1KCRL 1OIOA 3BVXA 3DKHA 3SJVE 4L5FL 4AQEB 4Q89A 1YG9A 2EEBA 1J1PH 2N1KA 1RZ8B 5INCB 3PAVA 5I1IL 1HXMA 2MHAB 3MRJB 3FTGB 3DRTA 4JG9A 3T0EB 3EZJB 2WUCH 3HS9A 1CBVL 2I60H 1BA9A 4X0NA 4BQBA 2DKSA 3V5HB 4KAQH 3G7TA 1S7SA 3NP4A 4Y9BA 5DDHB 2VKWA 2XWBB 3WY2A 3ZDXF 3FQRA 1X44A 4WW1B 2QQKL 3FBKA 4R0LA 1HFUA 1M57B 3U0TA 3E6HA 1FCCA 3BLBA 3CVDA 1AJ7L 1IV8A 4EDWH 3ULUF 1PGRB 2C9RA 3U25A 4JJHA 5EEWA 5B1AB 1A9EA 5D1QE 3KJ4B 3N1FC 2GTWA 1U92A 1PFOA 1KZYA 4PJDE 4PW9A 3OJDB 5HDLA 1BFOB 3A0OA 3TL5A 2RQ8A 5E94B 3P0YH 1XSOA 4FG2A 4L8SB 1HHJB 3D4GA 4N6RB 2OSLB 4D3CL 1WSST 4JHWH 1QW8A 1AMYA 4OJCA 3GSXB 4IBWA 4AG4H 2Z0UA 3MLRH 3WLBB 3CC1A 2AXFB 3MJ7A 2VLJD 3L1EA 4QRQB 1CFVL 2X09A 3PP3H 4XVJH 4BSJA 2C4XA 5L0QC 4H20H 4GJTB 4BZ2H 1BECA 1QZ1A 5I2IA 3VXTB 3KLHC 4LSUL 1DBAL 5KS9B 2LGNA 4ONOA 2OL3H 5JTWA 2GK0A 5FV2A 1ETB1 4YWGL 1PQZA 1IX2A 4K2UL 1M05A 3TO4B 1XMEB 3FFCE 3EH3B 3ET9F 4FXGA 4J8QA 5ICXB 1JWSA 4Z7UE 1NGZA 2ED6A 1FG2A 1ZE3C 4Z7NF 4R5VA 4FL4C 1TR7A 5F7EH 2KDGA 2MFNA 4UT6L 5MI0B 2EUZA 5SX5H 5C6TL 3SGDI 2XN9E 1DEDA 1D5RA 2IV8A 3BKML 2F6AA 1RIHH 3C5JA 3AAZB 4OF0A 3NIFF 3K6IA 1B2YA 1BBJA 4M1DL 2P5EA 3VXOB 1U3HB 1UZ6E 5A3ID 5E9DE 4PU2A 5AVSB 4FA7B 2OL3A 5DSCB 1QEWB 1UWEL 3MNMA 1J9SA 1KGCE 5BRZE 1NICA 4MQXC 4MD4B 1OLZA 4TRPL 4X6DB 2BC4A 1LEKA 2HG5B 4XAKE 3FN0L 2ED9A 1UM4H 4MA7H 5CP7A 2O61A 1P4BL 2A77H 4F8LA 1F42A 2B0SH 4N28A 4JZJA 2EDXA 4XGZA 3ZTEA 1CPUA 3QI9C 2VERN 5K39A 3JWNG 2YEZA 2R4RL 5EUKB 1SBBA 2X9WA 4DCQB 3DHMA 4HBCL 2EDTA 3UL4A 4AQOA 2XXMB 3WIHA 1CUOA 5D7SL 1HXMB 1NBVL 3RA7H 1V5JA 4ODHL 2MKLC 2BIQA 3DRTB 4NZ8A 4WZ9A 3RTQB 3L9YA 3ZDWA 2IADA 2IFGA 1OTUC 1GTNA 2NY1B 1KPVB 2PR4H 1T04A 1CFNA 1S7SB 5I8KL 5L2KB 3Q2LA 3NACL 3FQRB 4N20A 1GHFL 3EJJX 4J3WA 3I9PA 4FQCL 3U0TB 5L88L 3E6HB 3F00A 3MYJA 3RX7A 5FX3A 3T4AC 3CFTA 2OZ4L 4NQEA 3HMXL 5ITFA 2L0DA 1U8MA 4H0LC 5DJYA 3JVGC 2X4NA 2BIPA 3VYNA 3RVVC 1A9EB 4X8GA 2GTWB 1U92B 3A23A 3JWNE 2FH8A 3ZTJG 4MAYD 5EIVA 3QHTC 3ZKSD 5LGHL 2VITA 1NTDA 3FPYA 4L1BA 4YFDB 1FNSL 4LDEB 2WK2A 4KTGA 1XGTA 1CGYA 5LNGA 4M48H 4GXVH 4D2NA 4TKWA 3GWJA 4R2GD 4QXGH 2NRDA 2A6KA 3CXFA 3MJ7B 1J7VR 3BWUF 4PJGF 2FYYA 2QTEA 3FZUC 2B77A 1EAPA 2ZX7A 2J8UA 1LXMA 1VCAA 2JI2A 4O58L 4KHXH 4OFYD 4C4KT 2BS71 4E68A 4CMMA 2GK0B 1X5KA 4QRTA 4PWIA 1PQZB 1S5IH 2L7QA 4ZNEE 1LVEA 2OPCA 1QW9A 3FU9A 2VR5A 1XSIA 4FXGB 1HH6A 4MJIE 4AIZA 5DD0L 1JWSB 3TS8A 5GISL 1L9RA 2DIAA 5HHXL 4GINA 4L4TE 1FG2B 3WEMA 3K6OA 4O51B 3O8XA 3SPHA 4ZZKA 1N6UA 5B39B 2EIBA 4NKIH 4N2HA 1MN4A 5JW4N 2ESVE 5FO8A 1WA0X 2JQMA 2EP6A 3W2DH 1R47A 4X6EA 3C5JB 4ELMA 3ULVH 4PRNA 1BBJB 2P5EB 3RG1C 4LAQL 3GRWH 4LVNB 5JDJA 2OL3B 2JKNA 4F1SA 5BV7C 2I27N 2NY7L 4YHNB 4WU7A 2G30A 1GPOL 4PJCA 5J12B 2BC4B 1LEKB 4FXTA 5FUCE 1C1EL 4XMUA 5GS2D 2O61B 3ZE2B 2VLKE 2PCXA 1W0VA 4XHQA 3UGUA 4JZJB 4XGZB 5K39B 2YEZB 2ZXCA 1DVQA 3JQOB 2BW4A 1R0AL 5DJ2A 3QYNA 1T2QH 4G7YH 4RMUA 2DLEA 5F7DA 2Q76A 5JLZA 5JDSA 4X6BA 1AHMA 2IADB 4M7ZC 2P8MA 3CZEA 2GI7A 2O5ZL 5L6YL 3ABMB 3T0BA 1T04B 1CFNB 1PSKL 3D3VE 1INEL 2UXFA 4HH9B 4TLUA 3V7AE 2DMKA 2NY4C 3VG0H 3VXUD 2IDSA 3ARBA 2VZUA 3EYFB 2DZEA 4FD0A 5FYLD 4TVPH 3VFGL 4KU1A 3NFPA 3WEAA 3T3PB 4LRIC 3IMWA 4YHZL 2WJ7A 3C6SB 5ITFB 1U8MB 2QSCL 1M7UA 2X4NB 1BQHA 4XWOC 5PCYA 3Q05A 2CE6A 3HPJA 1CL7L 2EAEA 6PAZA 1ONQA 1OGAA 4PJAA 1G7PB 5CFAA 2VITB 5CBEA 3ZHKA 4HCRL 4JPKH 1G7QA 3HFML 1PG7L 4PGDA 4M02A 1JGDB 1HESA 1JXJA 1QI5A 1XGTB 4R4BA 4UB0L 3VXME 1YEGL 3UYRH 1F4HA 1KB5H 2GPZA 5C0BE 5J57B 3IAGC 2A6KB 3HNVL 3L8QA 5IY5B 1HEJC 2W81C 4U3SA 2FYYB 4HWEL 1OM3H 5T3ZD 1BWMA 1KXVC 2NY3D 2J8UB 1CGSL 3T71A 1VEPA 3AREA 1UASA 4XPBH 3UJJH 2YN5A 2B5IB 4CMMB 1YMME 4QRTB 5IW3A 4RFOH 4BFOA 1PEWA 4E9RA 1A3RL 2ZOTA 3SYCA 2YPLE 5I1AB 4AIZB 4AITA 1HHGA 3LQZA 1B0WA 2NMSA 3B2UD 3HRZA 3KBEA 4OJEH 4QWWD 4JL2A 2Z7ZA 4L4VA 4KXAA 5AVTB 1KEGL 3TV8A 3ZYZA 5CD3A 3O8XB 2Y7QA 4PRPA 1W2KT 4FHKA 1KB5A 4ZMVA 2EIJB 3FB6A 3GK8L 3V0JA 1IC7L 4BE5A 4X99A 1BVNT 3S0PA 4NX0A 1K2DA 2W65A 2DH3A 4AMXA 4X6EB 3MLUH 2ZUTA 4DK3A 5TF1H 4PRNB 3OAYH 2CLRA 4Z95H 2B8OT 1BAGA 4XP6L 1TQVA 3FU0A 5FUZL 4OKDA 3RU8H 4AGLA 2V5TA 3ARRA 3QEGL 2A9MH 1U3YA 3NRQA 4M8UA 5LO7A 4WU7B 5I0WA 2A1WH 3A4AA 4PJCB 2AJXH 4YDJA 2WP3O 5FYJL 4CSZA 3W11D 3BUPA 4B41A 2XNAA 3E38A 4BQ9A 3OGCA 4Z9KB 4TYUA 1IQDA 4FOMA 1G9EA 1FFNA 5DJ2B 1P4LB 2RJMA 5AKTA 2VZOA 3KVDD 3TEZA 5AAWC 3IJHA 5T5FL 4K3HA 1NQBA 2Q76B 5JDSB 4X6BB 3UTQA 3NGBC 5CJ5A 1VGEH 1VCBC 3BE1L 1HIMH 2Y1YA 1OAYH 4U1LB 3KHQA 4NUQA 3ARBB 2XQ0A 1TT6A 3SDCD 1CS6A 2BP8A 4JKPL 3NFPB 3EGDA 2I24N 2DQFA 4IMKA 1S9WB 4RMVA 4XO9A 4JFOA 1RURH 5BVPH 1BQHB 3HPJB 4PB0L 1YQ2A 3VFNB 1VFBA 3CU7A 4NLAA 3ARQA 1ONQB 2B7DT 1YRKA 4J4PC 1OGAB 1A66A 5JXEA 4PJAB 3SE8L 3RDJA 3NEXA 1KGXA 3VX1A 1F58H 1G7QB 4PGDB 3QAZC 4W9HC 1N9PA 4R4BB 3CDFA 1CLOH 3ULUD 4KX8A 2G5BA 3HR6A 1UWFA 4O2CA 2VOTA 3JT2A 3OZKA 2VDPH 4U3SB 3NMEA 2D4DA 1TKWA 1MRFL 1WD9A 3ARPA 1QFWI 4A37A 4HALA 1KCRH 4PCSA 2JJTA 3AREB 4L5FH 1PZBA 2JWYA 2JTYA 2V37A 4NKOA 3BP6A 2R0LH 4M7LL 2GSIA 2CJTA 4LCYA 5JOEA 5ES4B 1E27A 4Q6KA 4FMFA 1BFVL 3QUKA 4PLKC 4Z3FA 1HHGB 2BSDA 2ZKYA 2Q7YA 2NNAA 3LQZB 3HRZB 2N0MA 4PWHA 4KJWD 5I5MA 3OC8A 4NN5B 1H8OA 4L4VB 1CBVH 1H3PH 2P46B 4EIBA 2Y7QB 3HG0A 4PRPB 5CD3B 4OGAD 4DVRL 5DD3L 1OO2A 4N2FA 2QQKH 1H3GA 1UACL 4KXCA 4X99B 2F54D 4MJHA 3WLWD 5I1JL 1K2DB 3H8NA 3UBHA 2W65B 2H41A 5ICUA 5F7KC 3V4VA 3TYFA 3VVVA 3PAZA 3AT0A 1LK3L 2NR6A 2Q5BA 1LP9F 1K3ZA 4RFEB 3RX5A 4ZMPA 4WSGA 4HXBH 2IDQA 1SJHA 4GLRI 4Y19B 2CK0H 4IGBD 3ZIMA 1QSFA 1BREA 1IARB 3VQ1C 4AGQA 1NGPH 1CZ8H 3KCWA 4KH9A 5SX5K 2A6JA 4YDJB 4AEIL 3ZW3A 2RQEA 4W93A 2RCSL 5B21A 1RXLA 5IHUH 2OW6A 5EF2A 3KPNA 3OGCB 4D3CH 3QYMA 1IQDB 4R4FH 2QMKA 1FFNB 2X1QA 4XXWC 3LN4A 2YPVL 5J4MA 2AAVA 3GI9L 3IJHB 3M88A 1CFVH 5D7JD 5C3IA 1HXYA 5FR3A 1HNFA 1E2ZA 1CQKA 3UTQB 5SWSD 1CDHA 3GJFH 4GNKB 4UQ9A 3IMVA 3MCKA 5EUOF 3MRIB 4ZAKB 1T4WA 4NI3A 3VDAA 4X7SL 4YWGH 2Q2EB 5KYUA 2JTDA 4K2UH 1F11A 4Y2DD 3T0EC 4KFMA 2BP8B 4YDIH 4XBGB 4ZMWA 2DMBA 2XVLA 1A6PA 2DQFB 3I9AA 4S1SL 1MAKA 3RJQB 1CBJA 4S10A 2X4RB 3TZVA 1RSFA 1VFBB 5E5UB 5C6TH 1PZ3A 1MCDA 5DD5L 2YK1L 3BKMH 4XN2A 1ITCA 5C6PB 1AGEA 2JNZA 4XAWH 3QJXA 4ZW3A 4WFFE 1RJCA 2LLGA 1DJIA 3GJFA 4M1DH 3DHUA 3QCVL 4H44C 3MCLL 4R8WL 4R96A 3EG9A 1J0HA 2G5BB 5DC4B 1UWEH 2DEYX 2EIMB 4Z7QF 4UZGA 1SFDA 3RVWC 3TBVA 4YDMA 3FN0H 4L8SC 3RWDB 4RISL 4W6YB 1P4BH 4GRWH 5EOCL 4AGMA 1JZ4A 3V9EA 4NKOB 2F7PA 1PCXA 4RBPK 4UT6A 1X7TA 4LCYB 3PS6A 5D7SH 1E27B 3G6JE 3QUKB 4MJ2A 2Q7YB 2X70A 1JTTA 1S7TA 1JF5A 2F7IA 1A6WL 4NQCE 5DFWH 1JPGA 4HWZB 4BA0A 4MS6A 5JPMB 1WBXA 3K3QA 3TO4C 2A73B 5M95B 3NACH 1GHFH 4M5YL 1KYDA 4PWEA 1IEAA 3V4VB 3TYFB 4DP6X 5LVEA 1DBMH 4Z76A 5D2LF 2OZ4H 3HMXH 5KJRL 1QFUL 4PJXE 1LNUA 2ZAHA 5MI0C 3P2DA 5LQBL 1SJHB 1XAKA 4N85A 3KLQA 1QSFB 3LH2H 4QCIA 5F89A 1FBIL 1T20B 4KGJA 3AWFA 5LG6A 3LIZH 4PW4A 3CU1A 1KV3A 5LGHH 2A6JB 3N43B 5TE6L 5JHBA 3TWYA 1RIVL 1U3HC 4HWBL 4KROC 4X9YA 1FNSH 3BN9D 3G08B 3PV6A 4QR7A 2WOBA 4YAQB 4L3ED 4BFNA 4TF4A 3IDIB 3KPNB 4OV6F 4I1RA 4F7EA 3PWPD 3LN4B 3ZT7A 5F7AA 3OBAA 5EU7E 3G5VA 2VL4A 4Y5XA 1HXYB 4NBZB 3LDBB 4GSDH 3ETTA 3S88L 3NZ8A 1DO6A 2A9BA 2HTKC 3LSOB 4R7NA 3CN0A 3MCKB 2BVTA 2ALWA 2OZ4A 3RY5A 3HMXA 3VGFA 3B6SB 3K6FA 3VRLE 4HT1L 2DQIH 1IE4A 1BZ9A 1YEIL 5KYUB 1NCTA 4YR6A 5T1JA 3RTQC 3QXAA 5F8QC 5HDQL 4U6YB 2YGOA 2WXIA 5DD0H 1PIGA 2NY1C 3EH2A 3B43A 1EFXA 4JDZA 2Y6SC 4PRDA 2X0UA 4KKAC 4UT7L 3RDTA 3IFLL 4AW7A 3BCFA 2F5BH 5C2BH 1KBVA 1E5UI 5MEND 1MCHA 4OZIF 1Y6NR 2OP4L 1AGEB 1HHKA 3F5WB 4XCYA 4LT7A 1SLVA 3ZMRA 5IZ7A 1GW0A 4XPTH 2XV0A 5DJ6A 4KX7A 3FRUB 2MCPL 3VFUA 4AL8C 1A4BA 2QLYA 3DYOA 3DX1A 2AS5M 1IAOB 2NY7H 3ZE0F 1NC2D 4KTDH 4A7TA 5EHFA 1RUKL 1GPOH 4MB5A 5F6HJ 4BHUA 3TBVB 3H9ZA 1C1EH 4UOZA 4TNWF 4N25A 3K2UH 4G8GD 3WO4B 2DYPD 1F4YL 2J56A 2OXHA 5MP6L 1JG9A 3H4HA 1RVFL 4IJTA 1CGVA 5KVFE 1MHPH 5D5MF 3HN3A 1R0AH 1A7PL 1H6EA 2ADIB 1N5AA 2VQ4A 3B2VL 1GIGL 1K4CA 5I5IA 3S9DB 4M7JH 2IANA 1JPGB 3EJPA 1VHPA 1FL6A 3FUIA 2Y5EA 2O5ZH 3OLDA 2DD8L 1WBXB 1PSKH 1INEH 5E00A 1PVHA 3L81A 4BFIA 3QQNA 4HH8A 4PVNA 2WAQA 3U4AA 3W56A 4BK8A 4NM8L 3CCHA 1IEAB 1S7VA 3W0WA 1XIWD 3D2UA 4YHZH 3O6FA 1U95B 5C6WH 4XMPL 1LNUB 4NN6B 5GGTL 5IROC 3P9LB 1CL7H 4AK2A 1YPZA 2IGLA 1MWOA 3OKMA 2VXTH 1ORQB 4QCIB 4YFEA 2R1XA 4XNZB 1OAQL 3LB6C 4OKVA 4G6JL 2BHUA 4YPGA 1F6LL 1OT1A 3PXJA 3Q7JA 4HCRH 4APQA 3PV6B 1PG7H 3FCGA 4LVNC 2XXFA 1F02I 2WQVA 2HKHL 3FQXA 4UB0H 5SV3A 3FW6A 4F7EB 1E8YA 5J12C 3OD3A 3HNVH 3G5VB 4NXKA 3JXAA 4Y5XB 3UBXI 2X89A 3KS0H 4JZJC 3SE9L 1ZA6A 3NZ8B 4W9CC 4EDXB 1IGIL 4R7NB 4KO6A 1AXTL 1ZXQA 3MV9B 3HMWL 1T6BX 1J1OL 1CLZL 2FT8A 3T3ME 1BZ9B 2CNYA 5EBGA 4YR6B 1YYLL 3QXAB 4Q9QL 3K91A 5C0EA 1F6AA 2P9RA 1LQBC 4JDZB 2ZOOA 1CD0A 3QZWA 4HCRA 4PRDB 1MDTA 5JMOC 5DS2A 1AIZA 1WRFA 3ZGHA 1S7RA 3RDTB 4X6CE 4N0FA 5D7LA 4AEEA 4ODSL 2DQTL 4F9PA 1D5XB 4XCYB 1MCLA 2QBWA 1B6DA 4NGHH 5E99L 2AEPH 4GMSL 4YSPA 4ODBD 4N8VA 4XP6H 4YGVA 3LIUA 5HHMD 4YZFF 3QEGH 4E9VA 1UWGH 3L5XH 3WBDA 4MNQD 3E2HC 2EDQA 2G60L 2HH0H 3WHXA 1M7XA 5FYJH 2ICWJ 1QABA 2OXHB 3N1PC 4JO5A 1TU2A 1JDAA 4MA3A 2VZ3A 1QKZL 1JL8A 2Y06L 4H5SB 2KC0A 4RX4D 4YDZA 2WLMA 5CEZD 1N5AB 5T5FH 2VDML 3RX8A 1K4CB 3B9VA 3P9MA 5IG7A 2IANB 3EJRA 3KPQA 4DKAA 1BD2E 1FL6B 1XV8A 2B5IC 4B27A 2A5UA 3OHXC 3BE1H 4Y4KA 1YO4A 2D73A 1FH2A 1BVKA 5E00B 2CU9A 3OKNA 1EHKB 4BFIB 3FJTA 4JKPH 1S7VB 2WYTA 1A0QL 1B9KA 1MDAA 5BUPA 3QJSB 3D2UB 3NJJA 3O6FB 3UC0H 1DHKA 2VM3A 7TAAA 1NOFA 4PB0H 1LDPL 4Y1TA 4AZUA 1YPZB 3OKMB 2OYLA 1X6NA 1ET7A 2Z3FA 1UXSA 4MVBD 2R1XB 4LSQL 3BAEL 1HYSC 4XCFH 1HXKA 1MCOH 1HH9A 3SE8H 5T5FA 2X1XR 3H85A 1EEZB 4KO9A 1OCWL 2NYYC 1EAJA 5L4IA 3E1ZA 4AE1A 2F54E 3NPSB 3FQXB 4HS3A 3X2QB 1CD8A 4EN3A 1UG9A 3Q8AA 4AQAA 3VH8G 4PJ7F 5I16A 4NUPA 4Z7NE 4RH4A 1MRFH 1ZA6B 3B2MA 4HPYH 4U31A 4XNXL 4JNXA 1FH5L 1V8HA 5JIMA 4PJBA 4M3KB 1BVZA 2QPEB 4K8RL 5ISZD 1GTFA 3ZHNA 1BFVH 3NIFE 3ULVC 1G4RA 3CBRA 5C0EB 1YY9D 4N8CL 3QZWB 3V0WL 1G7IA 3LZQA 4ENEC 1S7RB 3ZUCA 3H2PA 4DVRH 5FHAH 3S48A 4JR9H 4RMBA 4IK7A 3UEZA 4U1NA 3LQMA 1RLBA 5EN2A 2BX5A 1P4UA 1OXYA 3L9RA 1QQDA 5CLYA 2JKTM 3GS0A 2VSCA 3NRPA 3NSCA 1FC2D 1LK3H 3QQDA 2Y23A 4N8VB 4IRJA 1GMEA 4YGVB 5IQ7L 4FQXC 4YNYA 2FB4L 4DP5X 2VABA 4TOYL 2TRHA 3KLAB 5BNXD 2X4TB 4M6ML 1AGFA 3CDGA 4HWNA 4OY9A 1QRND 2H0FA 4JPWL 4AEIH 4B3VA 4ZMAT 7FABH 2O5YL 2RCSH 3TN0A 1VZIA 4LSDA 3T0EE 1CDBA 1J1XL 5AENA 3MBXL 4B50A 4MA3B 4F33A 1ZPUA 2IH3A 2WXGA 1YEKH 2WGNB 2YPVH 4JFFD 2FUQA 3GI9H 5FLVA 3P9MB 4ZOAA 3AREC 5IG7B 1QATA 2EUWA 5BZXA 1IU1A 5LB1A 4KY1L 3V0DA 4A55A 4YSTA 2K4AA 3RNQA 1E65A 1BVKB 1UQSA 3LZFL 3SKNA 3OKNB 2LVCA 4BEIA 5DS1A 3BH8B 3IXAA 4QY8A 3SBWA 1DBJL 3HRZC 4GP4B 3G9AB 3ZDZF 4WI9A 2DWYA 5C09A 2O5XL 4DO4A 3NT0A 1DLHA 5DZOA 1ADQL 4UMGA 2HFFA 5DR5L 4QT5A 2D3JA 1Q9KA 3DX7B 3PL6A 3UTSA 1I7UA 1IZKA 4GFTB 3U4EA 1UXSB 1GC1L 2QFRA 2YPVA 5DD5H 2HCZX 2B39A 1DVFA 2YK1H 3D1MC 1B0IA 2VAJA 5D7HA 1WF5A 3RE0A 4JQXA 4F15B 5I30L 1CU4L 1QG3A 5IFJA 2ITCA 2HVKA 5LBVA 4Q14A 2AEOA 3MCLH 1BLNA 4JJ5B 2ADGB 3MYZA 5GIRA 1MH5A 4AYGA 4WW2F 1PY4A 4N5UA 4UNIA 4ATTA 1DFBL 4HW6A 4F2EA 1MHEA 5I16B 3CMOL 4PV1C 2H1LM 3SHSA 4ABUA 1BW8A 4RISH 3QWQB 4LASL 5EOCH 1T21A 3L4YA 3SO3C 1TJIL 1ES0A 3D48R 4DGIL 2YWZA 1L0XA 3CFUA 4G3YL 4PJBB 5AZ2L 2OBGA 2Q1EA 4P05A 2IPUG 4J2QA 4L3EE 4LVOB 4IRZH 4JRYB 3Q3GA 3VTTA 4XOEA 5DUPL 2G5RA 1AO7B 1IVLA 1A6WH 2P5WD 1XR8A 4X9IA 1G7IB 2ORBL 4ZAKC 3AG3B 3K7UA 3KXFA 1R34A 3T2PA 1MAJA 2XZAL 1H9DA 4B95C 1CDUA 2HYMA 4U1NB 2NZIA 1Z5HA 2P49B 4RZCA 1Y0LA 4W1TA 5EN2B 3SDAA 4FFZL 1QQDB 2EUXA 3SGDH 4I0PA 3QP3A 4YHKL 5EU6E 3LKQB 4LPCA 4X6DE 4U05A 1NBQA 3WSQL 3GSQA 4IRJB 4Z3EA 5C0AA 3P4OA 3ZKMC 3CXHJ 4YNYB 3QFDB 5I17B 1OF2A 4JG0L 5I6LA 3ZIYA 5JXEC 4N86A 3DXAA 1AGFB 3FO0H 2DICA 3DHJA 4AQ8C 3WFCL 1RIVH 4HWBH 2Z0BA 2WYZA 4FFWD 3UP1A 2JKWA 3VDCA 5DMKB 3QZBA 5CD5C 1KWKA 4F33B 5HVGB 2IH3B 5LDUA 4HIHA 5FKAA 3KAAA 4P4KA 5L2KE 2JJTC 4YK4C 4JEGB 3WN5A 1BQRA 3S88H 2QVFB 2YZ8A 1OCZB 3RNQB 2EVJA 1ZSHA 4JY6A 1UQSB 3SKNB 5FK9A 3JWDL 1IRAY 1YEIH 1JV5B 3IXAB 4QY8B 5HDQH 3FU5A 5DHYA 1OAZL 1U3JA 2DTSA 5HHNA 1OAKL 4HVBA 5F6IB 2ZAGA 5JPMC 4HMEA 4HWBA 4KUZL 5E8EB 4DP9X 4GUCA 2HFFB 1AG0A 4QT5B 4R84A 4Y1AA 2Z31A 1Q9KB 4RMSA 3IFLH 3PL6B 1SUHA 3UTSB 1I7UB 5TFSH 3RL1A 3U4EB 1C8PA 3EOBA 2AJYL 1DVFB 4HEPA 3DECA 2H1PH 4LIQL 2W9LA 5CF3A 3EW3B 2UY6A 4NZUL 5I6XB 4L9DA 1O6SA 5IFJB 1K85A 5IBUB 4KXZH 3QPXL 5C0IA 1BLNB 3UPRA 2MCPH 1MH5B 4C8XA 1DCLA 2CJ3A 5ABAA 1CD1A 4BCXA 3L7FB 3PDGA 4JRLA 5JPNB 2LAAA 3CE1A 4GBXD 3DBXA 3D9AL 1TVBB 4L18A 1XFPA 3RI5F 2K3HA 1T21B 3FQWB 1ES0B 5MP6H 3HG1A 1ZGLP 2DQCH 1JZ8A 2Y7NA 4AKOA 1T0PB 5HGGS 3IU3A 4P23D 3LDBC 1A7PH 4J3XA 4GY4A 1MOEA 3VU1A 4TS6A 3Q3GB 2PABA 1GIGH 5ABZA 3CPLB 1XR8B 3I74A 5E2VL 1GGYA 1J12A 2MPVA 4MMZA 1UH2A 1FP5A 1KIPA 3P4MA 3ECBA 3PHQA 2KH2B 3KXFB 2DD8H 2EO7A 1F4XL 4G8EA 1E3XA 1FYHB 1UXLA 1WH0A 2R8SH 2PW2A 1WTGT 4RZCB 5CSZA 1Y0LB 3D0LA 2CLVB 4K94L 3RJOA 2AVFA 4DP7X 4NM8H 4GH7B 3FSVA 4X4XA 5JR1H 2OTWA 5JO5A 4OLWL 4I0PB 1AR2A 4J23A 3LRLA 4JAMA 1T66C 3KPLA 4BH7B 3O3AA 5IJCC 4XMPH 3GSQB 4P9MH 5GGTH 5IM7A 2WBWB 2X9YA 2VM9A 3P4OB 4LLYA 3ZE2E 1WEJH 1OF2B 3X13A 4UTAH 2ROYA 3MUGA 2X28A 1ZOXA 3DXAB 3IYLW 2ZXQA 2F7OA 4KQ3L 3TT1L 5KBKA 4G6JH 4JCWA 2MOGA 4LHUA 2VL5A 1UEYA 1QAWA 3Q5TA 1G7MB 3ARYA 3LYRA 1NWPA 3ELAT 2HXAA 3GKWL 4OW6A 5KJ4A 1JYXA 1VB9A 5F1KC 5I66A 3GXNA 4HIHB 1MFDL 5FKAB 3WIFA 4AYEC 4DW2L 3D12B 3WO4C 2H0PA 3WN5B 3PUCA 4EE2A 1I31A 3SE9H 3R8BB 4BBWA 1B4JH 1IC5L 2VJ0A 1AXTH 4APXA 4LLWB 3T3PE 4JY6B 4ELDA 4QPEA 2WWMD 5GGTA 2AEWA 1J1OH 1CLZH 5FK9B 5JYLA 4HHAA 4F7CB 4UTAA 3BPOB 4N8UA 3EJUA 4NO5A 3S2CA 4PRHD 5HHNB 1MFCL 3NOIA 4KK9D 2PYED 4OLEA 5CEZE 3O9WA 3OQ3B 1FUNA 4JFEB 5E8PA 4LBEA 3S5ZA 1UM6L 1Y1DA 4Y1AB 4Y2OA 4FQQA 2CCWA 3HE7A 4YDNA 4ODSH 2Z64C 2AXHA 2OYKA 2W80C 3WMQA 2EEAA 3QHFL 1SFHA 4WNQB 2UY6B 4NN6C 1O6SB 5E99H 1AR1B 4TUJA 1BJ1H 1L5GA 3UZQB 3UPRB 3SKMA 3MLXH 1CICD 1PDKA 3HNSH 1ADWA 5IIEA 5AYQA 3KR3L 3OG6B 2KLSA 4LDOB 2KPWA 2NY5L 4ZW6A 5FO9A 3T8MA 3BPNB 3U6XA 1RZGA 4QYOA 3DBXB 2WNWA 2FJHA 2YBRA 2AKRB 2XN0A 1FHNA 3HG1B 8CGTA 3MNZB 2Y2TA 2Y7SA 2YOCA 4Y5XC 3IU3B 1QKZH 5HI5D 2AMGA 2Y06H 1VPOL 25C8H 3VRJA 5IB2A 2HVJA 3E8UH 2VDMH 3U7YH 3VFWA 2BWDA 2HVBA 2CH8A 3FT9A 4MMZB 2WW8A 4WHTA 3QNZA 3OWEA 1KIPB 3P4MB 3PHQB 2YR3A 4G8EB 4GP8B 1V05A 2XA8L 5IVXF 2Y07L 1B2WL 3BD3A 4GS7B 2CNZA 1QA9B 1G7HA 2VRAA 5CSZB 5TPWL 3D0LB 2FECL 2DBJA 1HCFX 1Z9NA 4GMTL 4X4XB 1A0QH 2P8LA 2OTWB 3KDPB 2R2BA 3LNEA 4HXAL 5JO5B 3ABLB 4JAMB 3KPLB 2DM4A 1HAUA 2X6UA 5DLML 3RDTC 2Q3ZA 5IM7B 5KSAA 1RMFL 2JKLA 4LLYB 1LDPH 4K4KA 3X13B 1JF6A 3S7GA 1FFPA 1ZWIB 1C7SA 3MV8E 3BAEH 5DEJA 1E5YA 5GS0D 1GSMA 1TQCB 2VL5B 4NO0A 4WHDA 4X8JA 2EVFA 1OCWH 5E0QA 2EDNA 2RAMA 5D1ZA 4FA6A 4L0YA 3ARGD 4YH6A 1MNUL 1CT8B 1J8HA 2DWTA 5I66B 1GH7A 1OD7A 3CSPA 2VMDA 3FN3A 4F91B 4HDIA 5C0NC 2YD8A 4ACTA 1MFVA 5D7KD 3T6XA 1WD8A 2XYBA 2ZXAA 1JWMA 4KI5F 3RNKA 1QRNE 4EJ1C 1FH5H 1JGLH 5J3HD 4HHAB 2KDYA 4K8RH 2BNRD 5HHOD 1DANT 1AD9A 2B1HL 4PI0A 4JO4L 4NO5B 4XR8C 1TMCB 2LV4A 3ILQD 1X9RA 3P1VA 4J8RA 5E7BA 3T65A 4M6NL 1RZKL 4N8CH 1F4WL 3NVQA 4IHOA 1CJYA 2XXGA 3V0WH 2XJKA 4JJOA 4OIAA 3AG4B 5E8PB 4LBEB 2WZPA 4Y2OB 4FQQB 5BW7C 1WITA 4Z7QE 3VWKD 5A43C 3HE7B 3CSTA 1WBZA 4FN0A 2C26A 1Y1UA 5SWZA 2JB5H 1WLHA 1D9KD 4PUBL 5I0YA 5KEZA 4OD1L 2JIXD 1DQLL 4ZSOA 4TUJB 4FNPA 4K9EL 1L5GB 3BI9X 3SKMB 5IQ7H 5IW6A 1PDKB 1U30A 5IIEB 4OCSL 4XNDA 4TOYH 5DVMA 1E50A 5FO9B 4XXDA 3GMQA 1YEEH 2V2WA 4XO3A 4M6MH 2J57A 3NPSC 2XVBA 4JPWH 2O5YH 2OSYA 1TZIB 2FJHB 2DJUA 2YBRB 2K9FB 4H8UA 4XN8A 3KWUA 4RMWA 4MCYA 2QELA 2VW6A 2DEXX 5IUCA 3MBXH 5HYSB 2BFVL 3W39A 3KVQA 3VRJB 3U36A 5CGYD 1B0GA 2HVJB 3DTUB 4KMLB 2YXWA 1XGUA 1GJWA 3QORA 1E4XI 1W72H 4WHTB 4KY1H 2G2RA 3QNZB 4LE8A 2ZJSL 8PAZA 4MX7A 1BYOA 4GO6B 2QADB 1JVKA 4IBSA 1TUPA 2EDJA 1G7HB 2YSTA 1UH3A 2X2IA 4EI5D 2BY1A 1DBJH 5I15L 4Y19E 1P0SE 4BELD 4NBYB 2GVYA 1JXDA 2P8LB 5AG8A 2R56L 2R2BB 3CG8A 3V4PL 2J25A 4DPBX 4BQ6A 2FWUA 2QDWA 3S5LA 3D09A 3RBGA 5C1MB 3MNVB 4MMYA 4MCNA 1DN2A 1ADQH 5KSAB 3KPRD 5DR5H 4P5TA 3VXNA 4F9PC 2DQJH 5LGJA 1BQ5A 1FFPB 5I0DA 4KKBC 4EKXA 2YAMA 5E8DH 3R4DA 3IAPA 3B83A 4IIQA 2VDMB 3O4LD 4NO0B 1JVLA 1AYRA 4X8JB 2Y5TA 4YUEL 5AALA 4MCZB 4KK6D 3C5XA 1BPLB 4YVUA 3NCBB 5E08H 1CGWA 1J8HB 1ACXA 5EF0A 5T3XL 1OD9A 5B4MD 2NXYD 1E7VA 3TBCA 1DFBH 4A2FA 2DWDA 3CMOH 1Z5LB 3MU3A 4HDIB 4HIXL 4AH2A 3QUGA 4AJ0A 1JWMB 3RNKB 4HJGA 3RY6A 4Z7WF 4DGIH 3CFMA 1I1AD 1ADQA 1S8DA 2EACA 4OZIE 1F3DJ 5AZ2H 1MCNA 2NW3A 1HSAA 2MCAA 2O5NA 3P4LA 4OT1L 2I7SA 1AD9B 2C1PA 2A99A 4Z8FL 2X44D 5DUPH 2CCLA 4J8RB 3T65B 4IHOB 5CMAA 2OTUA 5HHVH 3CSYB 1MJ8H 4FE9A 2ORBH 2YUXA 5FKPA 3MGTA 2WKLA 5F0MB 2XZAH 3K1KC 4BWTA 2FO8A 3N40F 5JUEL 2PXYB 5SWZB 1J5IA 4FFZH 2OI9C 4PN6A 2NX5D 3QWOA 4LGRB 3ERXA 5CSGA 1JXFA 2MH4A 1N67A 4ZSOB 4QO1A 5IMKA 5IBLD 3I6GA 1R24A 4MQXD 1AOHA 4Q97A 3ABGA 2OMNA 4WCYL 4OLYL 2R39A 1T7ZA 2QFPA 4XXDB 2V2WB 2XY2A 3PNWA 5FECA 2A83A 4F15C 1OGTA 1JZDC 3LXCA 3B9EA 3WFCH 7PAZA 5D9SA 2X3AA 4V1DA 4P2RA 2IXQA 1J0JA 2WQRA 2GBAA 2AQ2A 2ICEA 3LHAA 4MCYB 4UQ2A 5HDBF 5MEPA 2JCCF 5C08A 1O7DC 1TNNA 4U6VL 1QNZH 1KY6A 3W39B 3FSAA 5E6YA 3FRPG 4WEMB 1A6UL 3WL9A 1XGUB 2QTVA 1WZ1L 3QORB 2GITA 4FFZA 4WJKB 4EPSA 1ACCA 1YYMH 2G2RB 2ILLA 1CR9H 4NT6A 4QHMA 5KSVB 4HKBA 4MX7B 5B3JF 5H94B 1UUSA 1M3JA 3SBRA 4OGXH 2ZTBA 3HNTL 1BFSA 4LVOC 4EMZA 1ZA3B 2IOIA 1DVYA 3JWDH 3OPZL 5A2JH 3S37H 2WB7A 2YO3A 4M5SA 5ACZB 4YHIB 4GUQA 3K6NA 1OAZH 4LBAA 1OAKH 3S5LB 4PBVC 1WZAA 3WTSA 2Z8SA 4FCHA 2VQUA 1IBHA 2XWDA 4QRRD 4P5TB 5DA4A 3VXNB 3FCUB 5LGJB 4YDLB 3UGEA 1Q0YL 2AJYH 5TD4A 2DLFL 1XL4A 2L8AA 1VJSA 4IIQB 4GAFB 4NFCA 2Y5TB 2Y72A 4IRJC 1T5KA 4GRLD 2EIKB 1LEGA 3QPXH 3ROLA 1OSYA 3KPSD 4UT9L 2J71A 1JF1A 3QNXA 3ARSA 2DWDB 3MBEA 3QBTB 4UI2A 2BNQD 3UJTL 4AH2B 4NZTL 4MMXA 3D9AH 4X9HA 2VISA 3C6EA 2NW3B 3MRCA 1NMCC 1HSAB 3EIFA 2WB1A 1M71B 3EJZC 5IB5A 2C1PB 3Q9PA 3UZEA 5F7BA 4LOEA 3AM8C 3NABH 5CKAA 4LCWA 4LDCA 2E5EA 2VW4A 1BZEA 3DX6A 5CMAB 2OTUB 5E2VH 1FJ1B 3EH5B 2PCYA 5I1GH 1BP3B 2WZ6A 5BRQA 5FKPB 4YZFE 2VR7A 3MGTB 5CKGA 1F4XH 3V52L 1JD7A 1RZQA 4RA0C 4NZRL 2ZOUA 3HR5B 1V27A 4K94H 4UIKL 1TCRA 3EO9L 4F7PA 4EQ3A 3QWOB 2ISDA 3P2BA 5JIDA 1DN0A 3RX9A 4GG6E 1C5BH 4PRIE 4HOWA 3R0MA 4QO1B 2ICWA 4UOQA 5IMKB 3I6GB 2ZNXA 5GGVY 1S78C 1DVFC 5JHDD 5TJWK 5LCVL 5IK3A 3MLYL 2A83B 3NJLA 4KQ3H 3TT1H 3KGRA 3UAJA 3PUUA 1OGTB 3TJHC 5I6XC 1EXGA 2W95A 2DMGA 3DIVA 3KLSA 5D9SB 5GZOA 1HCZA 1ZD6A 2FBRA 4V1DB 1E43A 2Y3NA 2IXQB 4UQ2B 2ICEB 1UURA 4N2EA 5DQ9A 5C08B 2UUDK 1KLFA 3GKWH 3QDGA 1BJ8A 4JG1L 3UTTA 3IRCA 3Q48A 4JCLA 3VI3B 5JQ6L 5JPNC 3QCUH 4WTQA 4DW2H 1ROCA 1AGDB 1B9ZA 4OUUA 1V3JA 1RKRA 5F9JA 2GITB 1II4E 3BZFB 4NT6B 4QHMB 1WO2A 1OGSA 4ANXA 3BFQG 4FTVD 4A04A 4X7DC 5JMRA 2UZIL 4AI7A 4XMKL 4JFHE 4AMWA 4KV5F 2QHLA 4XNUL 3SSGA 2FR4A 3UBFA 1MFCH 2C9PA 1QR1A 5K9KA 4QXUH 1NSNH 5DJDA 2V5SA 3I3BA 4GO9A 1UM6H 3MFFA 4OD2A 5CHNB 2UV3A 1XGYH 2VDNL 1MREL 1DQVA 4I0PC 2XTJD 1H3WM 3ARWA 4MRCA 3QHFH 5CP3H 2A74B 5J1AA 1LEGB 2BCMA 1IGCL 2PTTA 4JPQA 1IBYA 4HOZA 3VXRA 4DOHE 5F7YC 4G59C 3ROLB 3MO1A 4M8QA 1WAPA 3QUZD 1K5WA 1BOGB 3KR3H 3E80A 3MV9E 3QNXB 1GCFA 4LSTH 1Z3GH 2LR4A 4MMXB 2QGBA 2N59A 4N2LA 2J6EL 1BHGA 3HI5H 4YBQD 1CIUA 3G5WA 1MRDL 5IQMA 3TBTA 1NL0H 1R46A 3MRCB 4U6XA 4DIXA 1BEYL 4ISVA 1VFMA 2CBTA 2KS0A 2WD0A 5IB5B 3T8XA 1VENA 4KBPA 3WN5C 1JRHL 4LCWB 4XVOA 4M7KL 4ZS7L 1LE9A 3EYUH 4G2AA 4TSAL 4FAAB 4N90E 5CP3A 5A2BA 4P9HL 2XA8H 2Y07H 3BPOC 1KCBA 1B2WH 1C12A 2IV9A 3F8UB 4KI5D 2K4WA 1NKOA 3OHMB 4PVBA 2KLTA 2VLRE 1I85A 3RFZA 1KJ3H 3L13A 4F7PB 4GMTH 1DN0B 4HXAH 5FLUA 1T03L 4JLRA 3JTTA 4PMEA 5DLMH 2ICWB 1HKFA 2BFGA 1PZDA 4XPHL 4MB3A 4J3OH 4DHLA 3DO3A 4POZD 3OF6A 3QXDA 2MEJB 2OMVA 3SE4A 1KCUH 5L8KB 5DQ9B 5GRJL 1KLFB 1F41A 1V55B 1WK0A 1MNUH 3BPNC 3QDGB 5EZPA 1NPNA 5AYUH 4S2SA 3UTTB 3ZDZE 4CGTA 2X41A 3GTNA 4OUUB 3UAFA 3CFBA 4QI3A 3L2MA 1U58B 5DO2C 4UQBA 3FUNA 2M2DA 1UXMA 3U4BL 1MI5E 4U7MA 3UP6A 3PJSA 2WHVA 2WBJA 3F83A 2B1HH 4QLWA 3ML8A 4Y4HD 3DARA 4FQJH 4WHYH 1ZLVK 2FR4B 3RWJA 4WUUD 1RZKH 1F4WH 5K9KB 1QR1B 3V2AR 3Q1EA 4DO5A 5DEFA 4J4PD 4D8PA 3AU0A 3LN5A 4GS7C 2DQ6A 1OARL 4HLZG 3SD5A 4OD2B 3ESUF 1MCBA 1V7NH 5F7NC 1IM9A 4PUBH 2ZG3A 4OD1H 5J1AB 3E6FA 1RUPL 1DQLH 2PTTB 1D5IL 2P44B 5D2NA 1SXCA 1JCKA 2ZKHH 3MO1B 1EEQA 4K9EH 4M8QB 3DTXA 5IR1A 3B56A 4HKJA 2COVD 4XBPA 2AHIA 3X3FL 1TQCC 3V0HA 2JE8A 1BG9A 1P4IH 2W9EL 5DTFA 2AZAA 5CGTA 1I9IL 3INOA 3QQ4B 3TBTB 4U6XB 1TTBA 3V4UL 2BFVH 2ITFA 2FO1A 3QAQA 2DOCA 3T8XB 5IEHA 5LWYL 1MW3A 4R26L 3I3EA 4EI0A 5A2IH 4RWYH 4CJ0A 1KTDA 1VLXA 4ELMF 1TFHA 4UU9A 1NMAL 3QIWB 3DETC 5CCHE 4TMPA 1C12B 3AMKA 4Y9EA 5I15H 3RFZB 5JW5A 4PJCF 4CN1A 3CFEA 2Q6WA 2AGJL 3BGAA 3O0LA 3JTTB 3V4PH 3GEWB 3TP4A 1S46A 3A22A 5EN3A 2BSRA 1N10A 3QXDB 1MY7A 3A67L 1OCCB 4DK5A 3QQ9C 1W91A 3N6YA 2A2QT 5FYKD 3AT8A 4XZUA 4DQOL 3MCG1 3FFOA 3H9SA 2NX5E 1DL7L 2CO7A 2LU7A 3L4CA 5T3XH 3ZHDA 4NNPH 1QI3A 4NAQA 2M83A 5B7MA 3HC0A 1UT1A 1H3XA 4ZUSA 4M9PA 4H0IA 4HIXH 4WU5A 4KRNA 3VYOA 1CE6B 2R1WA 2YGVA 2IO5A 1NBYA 3V4PA 2AK4A 1EPFA 2FSDA 4KKLC 1OE3A 4PP1C 3PJSB 1KGIA 4JQIL 4OT1H 4UZSA 5F3FA 1CQYA 1QP1A 4PJAF 5EO9B 3QIUB 1U93A 4MLIA 1YUHA 3B3IA 2QADC 1UD2A 4PJFF 5DEFB 1XMWA 3LN5B 5EORL 1NMBH 2E74C 3LZOA 2L7EA 2XQYA 4KPHH 1MXDA 4L8CA 5JUEH 1IM9B 1MLCA 4B3EA 4MKMA 2R2HA 1O7DE 1GXEA 4ORGA 5E9AA 1BJMA 4PJ8D 2D9CA 5D2NB 4IKNA 4ANUA 1WFIA 3DTXB 4QXVA 4H13C 4HKZA 4OLYH 4WCYH 4XC1L 5BQDA 4HKJB 4XBPB 1AHWC 3QR2A 3PDOA 3EFFA 4IS6B 5I1CL 4JRYE 3TA3A 2EDKA 2Y3AA 3APDA 4IIZA 4QUOA 3V0GA 2ZWYA 1AO7E 1VGKA 5E2UH 3IJYA 2XPZA 5EH1A 2D03L 4U6VH 4XO8A 3HIZA 12E8H 5F7MC 3TVMA 5IEHB 5ENWA 5HJBA 1WZ1H 2NW2A 4HLJA 3ULSA 1KTDB 2P80D 3TO4D 3WE6A 4UU9B 5EO0A 5GGVH 1DE4A 2C9UA 2AEQH 3HNTH 3DO7A 3WKMH 5CGBA 4KQ4L 3QUYA 5JW5B 3CFEB 3ZKQD 1C16B 1XEUA 4Z3TA 1U8KA 2FAUA 3N2JA 3PV7A 3SY0A 1D5ZA 4BIKA 1XH2A 1OTTD 3LJ3A 1R5WA 2IQ9L 3TFKC 3MRFA 1A6ZA 3CIQA 4K3DL 3HG4A 1M4KA 2PXYC 2CGYA 1TO5A 2YD6A 3S2AA 1Q0YH 1JIBA 2DLFH 5KVDH 1UWXH 1G1OA 3L7EA 4XZUB 3GLAA 3MRHA 4GXFA 4MXVF 2Y1VA 1PYWB 3H9SB 3N55A 2CO7B 5E4EB 4K8RC 5AAPA 4OTXL 4UT9H 1KCVL 1A6TA 2AF2A 4DGUA 3IWVA 3HC0B 3HBPA 32C2B 3UJTH 2CHDA 3LRMA 1I1CA 2PO6A 2PTUA 2R1WB 5ESQA 4ZMOA 1NBYB 4NI6A 5IMOA 3V4PB 2XWRA 1J11A 2X3BA 2Z34A 3QORC 3UIZA 3VI4B 3LKSB 2E7LC 3L3JA 3UJIL 1U93B 1HZHH 1YUHB 3KPOA 3UYPA 3B3IB 4CW1A 3U6RB 1FNAA 2Y5QA 4R4NC 2JF1A 5EU4A 5I6PA 4DK6A 3V52H 2CO4A 3MKGA 1KLUA 4BWWA 1MCPL 4NZRH 1EUTA 4UT9A 4LP5A 3Q44A 4HFUH 4L8CB 4OLVH 1MLCB 2UZPA 2Y2YA 3QYCA 4UIKH 2BIIA 2GEEA 2CDFB 4ORGB 3MROB 1EXUA 4ZFGL 5F2FA 3FUMA 4YDLC 3FSOA 3S5YA 1SXNA 4HKZB 1X9QA 2J4WH 2LAGB 2DBLL 2CZNA 4IIQC 5LCVH 4GW1A 3MLYH 5E1AA 3PDOB 3EFFB 4HJ0D 5CNHA 4EOWL 2XQBL 2OX5A 3EFOA 1CXEA 4A2EA 5HPMB 3TA3B 1I3UA 3SOBL 2B9BA 5AVRB 1VGKB 3IJYB 5HPOA 4QGYA 3D52A 2DWEA 4JG1H 5F7LB 5JQ6H 3TPUA 1X9LA 3TVMB 4ZTPL 3RZCB 3ARVA 5ENWB 1Q72L 2NW2B 1OWWA 3NTCL 3ULSB 4GI6A 1CLYH 3TV3L 3MV7D 3WE6B 2WY3B 4N0CC 1X4XA 4R7VA 4XMKH 1HNYA 1GC1C 3BAWA 3QZPA 4CBPA 4N3TA 4X5XA 3BW9B 4XNUH 5G4OA 3VVWA 3QUYB 5LCVA 4D9QD 1KOAA 4ZFOL 4NXSA 3THMH 4XRCA 4XNQA 2E47A 2W0FA 2OMWA 1M7DB 2JJUA 3ZOAA 5F0PB 3MJWA 2OAAA 1R5WB 1YEDA 1A6ZB 1QPPA 5EC2A 1QOKA 2P5ED 1JWUA 3V6OE 3D39E 3SPJA 3JV5A 2VDNH 2JI1A 4I5BA 1T1XB 4U0QB 2ZUSA 3L7EB 1MKFA 1UB6A 4FP8L 1IGCH 1U6AL 2QT6A 4ZX4A 2VE6A 3JTSA 4CA4A 4ZI8A 1P7QA 1A6TB 1NM9A 3RWFB 4N1EA 3UZVA 4Y8AA 1AIFB 4MNGA 8FABA 4AEHH 3AUWB 3IDJA 5E1GA 2PO6B 2R9HC 2ICEC 5ESQB 1L0YA 3OKOA 4YN3A 4F92B 5KG9A 5M7QA 4FFYL 1MRDH 2ZSWA 2VR4A 1SM3L 1BEYH 2AMUA 1AKJA 4JFEE 3QXTA 5J56B 2O6CA 1JRHH 3GIZL 3L3JB 2WVVA 4TSAH 4CW1B 3CHOA 3UYPB 2EVHA 5MEQA 3BUQA 4X0KA 4XI5D 3DV4A 4P9HH 2AVGA 1QFOA 5EU4B 1RK0A 1IJ9A 5HI4C 3DLQR 1ODAA 4NQED 4JFSA 2YGNA 4AT6A 3T4YA 4R5XA 5IJBC 4JGMA 3UDWA 4GI9A 4QGTA 3W9EA 2YQ3A 5CBAA 2YMTA 1T03H 4OLXH 4X7CC 1XBRA 3GSVA 5J11B 4XPHH 3IDMA 1FE8L 3M6DA 2NT1A 2KBGA 4HQQL 4PJ5D 4Z0BH 5DFVC 4GW1B 4TUOB 5E1AB 2A74C 4JVWA 4OGQC 2OX5B 2XU9A 3VMOA 3UPAA 3HPLA 5I18L 5SX4H 1HWHB 3ZKND 3TURA 5GRJH 3X1FA 3QUXB 4L1LA 2DWEB 2Z8RA 3SE3A 4TQEL 1E6JH 3TPUB 3D5OF 4G72B 4MMXC 4L2YA 3FO2B 1YEJL 4AZ8A 4X9BA 3E8VA 1JI1A 2R2EA 3CLEL 4WO4A 3KEDA 1D2PA 1Y18B 3U4BH 4GRWF 4Z23A 1UGKA 4ABWA 2ZXWB 2YIHA 3KBHE 5HBBA 4MJJA 3FN9A 3O8XD 3PFQA 4UM9D 3WMSA 1T0MA 1IFHL 5AVQB 1JZ2A 3H9HA 4K23L 4LP4A 4F37F 4ZQTA 4XRCB 1AXIB 4XNQB 2W0FB 2OMWB 1WAAF 4R3SB 1YEDB 4HJJH 1HYSD 4PJHB 5EC2B 5E5MA 2NY0B 4F57H 2NYYD 4J27A 5DU7A 1QFHA 4M7LT 2RH0A 4I5BB 4YJZL 1ETA1 2Z92B 3CLFL 3NA9L 3NUKA 1UB6B 4XH2B 4UINL 4H8PA 3V55A 4JB9L 1D5IH 1QYGH 2DI8A 2VE6B 2YQ2A 3JTSB 4OFVA 4OZFG 3UTPD 4KNTA 1KCKA 1P7QB 3O3DA 5G5DA 5IB1A 3UZVB 4KDWA 1YJDL 2FDBP 3AS1A 3FS9A 2E7LA 3CSGA 4MNGB 5GZOC 3R7RA 3BO8A 4NJAL 3IDJB 5GXBB 2RMNA 2Q10A 1INQA 2AJZB 2W9EH 3Q1SH 3GD1C 4RNRB 2JJSA 5KG9B 4AIXA 3M1BB 3X1GA 2ZSWB 4U6HB 3MLWL 1CXLA 2ADFL 2BWIA 1AKJB 2G75B 4KJPC 3ULVD 5KBDA 2NZ9C 2XG5A 4X42A 4F8QA 1IAMA 1N18A 2VDNB 2XQYK 3CHSA 3RB7A 1AQMA 4R26H 5HVFB 2WVVB 4YXHL 4ENED 1P7BA 3FAXA 2DQUH 3ARBD 4WV1A 5MEQB 1DDHA 4WY7L 3DV4B 4JHBA 4E5XA 1RK0B 3MSPA 2NUTA 2KHAA 1DZBA 1ULVA 4AT6B 2E3VA 4NNXB 3N1QC 3T4YB 3L08A 3DSFL 1Z7JA 3EO1A 1PKQA 1W0WB 1LQSR 2N7BA 4IRSD 3W9EB 4KNSA 4AX3A 3NJMA 3VACA 1J9CT 5F8RC 1A6AA 4KVCL 3GSVB 4M93B 1ZLEA 3O4OC 3QZLA 5CJOH 5AKRA 3IDMB 1NDMA 4QRUA 1F8TL 1EGJH 3IDNB 4XP9L 1S7WA 4CNIA 4S1QH 4HG4K 1SOQA 1V54B 3A67H 5JA9A 4PJ9B 4C4UA 5IKCA 3WFEL 4NUGH 1HHIA 4DZBA 1YUKB 3HPLB 5TE7H 4AENA 1DVTA 4TVPD 2EC9T 4GUPA 1DL7H 4ZK8A 1AH1A 2WIIA 3II3A 2QVKA 1SN0A 3WUWG 4LSPL 1CIDA 2J73A 5GZNC 1NCIA 4AZ8B 3IS1X 2GYSA 1J9TA 5IT2L 1RV6X 5F3BA 1OAUL 2FZ3A 2IH1A 2R2EB 3IJ7A 4OZGF 1LE5A 1PLAA 4OD3L 1QLEL 1E4XH 5AOLA 1E4KA 4Q9BA 1A65A 1DUYA 5FCUL 3GHPA 4JVPA 4NQDE 3L9EA 3TBSA 1T1WA 3QIBA 4WGVB 3I50L 4NQSA 4JQIH 2Z35B 1T0MB 4NQVA 3QG7L 3TT3L 3H9HB 4WO0A 4YC2B 1NA8A 3UO1H 2CD0A 2BVEA 3WNKA 5TDPB 1NC4A 2R7EB 3MX0A 3AFLA 3QIWC 4N2OA 1SEQL 1XB3A 2BXZA 3MJ6A 5HTSA 5EORH 2WXNA 1E9PA 5E5MB 4FG6D 1I85C 2NY5C 1ZGLA 4RESB 1U8PA 1YMHA 4OCLC 2EXYC 5CEXB 4ZS6D 1N26A 4YBHA 3HHSA 4L0ZA 1DJHA 3P3RA 1KXQE 1KELL 3T0AA 4ETYA 1NIEA 3O3DB 4XC1H 5G5DB 5HHPA 5IB1B 4TL5A 4LL4A 4F7KA 1GZPB 2CM5A 1Q94A 3BO8B 4JQIA 4EVNA 1KGUA 3GZOA 3CQQA 1INQB 1EO8L 3QUML 3SJVA 2FGWH 4Q6IB 2YD4A 1LO5A 3FYEB 3FULA 3S35H 3WFDL 1ZCRA 2D03H 4JM2A 1TTUA 3B5HA 4NENB 2PW1B 1TITA 1G0DA 2NZ1A 1IT9L 5EIIA 1U8HA 1R6VA 4D0DB 1BBDL 4LHJB 3FF8A 1DDHB 3WOVA 3D4YA 2R0KL 4E5XB 4N2CA 2CBQA 1C5CH 1BXUA 2VC2L 4OIBA 4HS8H 1EEYA 5F1NA 1K3IA 5FYKU 5CXPA 3QIUC 4YSEA 4KQ4H 3EO1B 1N70A 3L3OA 3H55A 2BK8A 4A2DA 4KZEL 3ZKMD 1A6AB 1A47A 5J0BA 4QRUB 1KTRL 2WTOA 5D1QA 2J7LA 4K3DH 3MRBA 1S7WB 4MASA 4CNIB 4G7VH 4PJDA 3IJEA 4AYBA 2UWEB 1QASA 4AVHA 1HHIB 5D2NC 4DZBB 1MZYA 4AENB 3D0AA 4YEEA 3CDCA 2AJUL 4ENZA 4UDTA 4KK5D 3FH8A 4C47A 5C9KA 2WIIB 1ID2A 4OTXH 1C5DB 1KCVH 4RETB 2FK9A 4JPIB 1P6AB 4MS8C 4CMHC 1R3LA 3PHOB 3VUAA 2FZ3B 1LE5B 2H6OA 2OV0A 4JY5L 1DUYB 4HHWA 4I18B 2FRGP 3TBSB 4GAYA 1T1WB 1XF5A 3QIBB 5CUSL 2GKIA 4OBRA 1LEIB 4JFQA 1DO5A 4WUKH 1IE5A 5EZJA 1E6OL 4Z7UA 3RAJL 5GS1A 4Z3HA 3UAEA 4G8IA 4WTZG 2NR6D 1ZGLB 1HKLH 3MV7E 1U8PB 2XN9A 4HOMA 5ERWA 2H6UA 3TH2T 4DTGL 1QSFD 3HHSB 4PLJC 1WWAX 5F9WB 5SWQB 4AJWA 5E9DA 3VFVB 1DP0A 2YN3A 1F5WA 1XF2A 2OMZA 1HJBC 4RCAA 4NS0A 9CGTA 2ZOKA 3BX7C 4PJBF 4I1NB 2DBLH 5BRZA 4MHHG 3KYKL 2JFCA 4G9DA 1ZLUH 2VW7A 1Q94B 4EVNB 3US1A 1DTUA 1GS8A 4EOWH 2XQBH 3SJVB 3B8SA 3RWHA 4BM7A 2IDFA 3PQYB 5E4EC 1LO5B 3HC3L 4FNUA 2WVUA 4D9LL 3TONA 3HBGA 4JDTL 3SKJH 5I1EL 2NY2D 4JM2B 4OCXL 4R90L 1WGVA 3ASOB 4ZTPH 3NCEB 1XH1A 5EIIB 3AS3A 1Q72H 1U8HB 2HRLA 3IS0X 1ZT7A 3FCSA 4LEEA 1PJ9A 2C9AA 4P46A 5KBLA 2VAAA 1VFUA 5E8OA 4KZDH 4Q2ZA 4X5RA 3T6ZA 5F9OH 1UD5A 2O6FA 3T9WA 1A7OL 3MRGA 1EEYB 1FGNH 3ISWA 5F1NB 3TZVD 5BS0D 5IW1A 1VKXA 3L3OB 1QFWM 3WEXA 1A4AA 5MEOB 1SMOA 2BNUA 4N26A 2W8CA 3WS3A 4YLQT 1OCOB 4FG0A 1JPSL 3BRGC 5D1QB 5IFAL 3MRBB 2P1YA 1PX4A 3LPOA 3C9NA 3IJEB 5KSBF 2CA4A 5BV7L 3NZSA 5F7HA 3VI3E 3ZTJH 4OFKA 4P04A 1IM3D 4FP8H 4AYDC 5EDSA 1U6AH 2V2XA 4UDTB 2NSMA 1N6QH 4AKPA 4MZIA 3OG4B 4KNUA 4AYSA 2HFGL 1KJ2H 4L29A 5J9PA 1R3LB 2LTQB 3OJVC 4KKCD 2DQEL 2K6ZA 1UZGA 1VEMA 2P8PA 4PJ5E 3TA3C 4ZFOA 1TZHA 2YMXL 4DH2A 2L4OA 2EE2A 3FMGL 1PJWA 3FQUA 4FFYH 4GEIA 4YIQA 4CSTA 2GJ6B 1FQ9C 3MAWA 5I26A 5EG6C 2PPDA 4JG5A 3TVMC 2OKMA 3RZCC 4GAYB 1Y6KR 3WNMA 4YHLL 4ZNEA 3VXQA 3BRFA 4MJIA 3CVBA 3EYQC 4JFQB 4LLAA 3R7QA 4MLSA 5E6ZA 1ANUA 1N12A 4L4TA 4K5PA 4MHHI 1HE7A 3MJGX 5KVFL 4AYMC 1FN4A 5GS1B 4LMQI 4G8IB 5EBMA 1WV7T 2FLBT 2XN9B 2ESVA 4FADA 1OWRM 2VDKH 3S3BB 2MNJB 4HZ1A 5B38A 1V10A 2W0LA 3M46A 4DEUA 3TEYA 2IFFL 1X5AA 5E9DB 2FBJH 2E6PA 1XF2B 2OMZB 4FFYA 2D7NA 4HQQH 5IHZA 1MAML 4OIIL 2ZOKB 4DESA 4C56B 5BRZB 4G9DB 3BZEA 3O2DH 4JN1H 4U4IA 5HHQA 3RWHB 5I76A 5DRZA 5MERA 1CFSB 1OP3H 2MOVA 2ZE0A 5FCSH 5I18H 4LIQE 4X9FA 2G3XA 1UCTA 4U1KB 2PO6C 1YQVL 3BN3B 4PJEA 4HGKC 1YEJH 2D4FA 3FCSB 1YN6A 2H2PC 2O6DA 3CLEH 4P46B 4ZXBA 1FYTD 2CWRA 2VAAB 3NCFB 1OSPH 2OZNA 4HWUA 1EFXD 3D3VA 1HOEA 3DMMC 3PREA 1MW0A 3MRGB 4RAUA 1VKXB 1QRKA 5IW1B 3SKUD 3PXLA 4NO2A 3RDTD 4HX1A 3WEXB 1QUNB 1H5BA 3O2DA 3K8MA 2APSA 3NCYS 1WA1X 2BNUB 4FG4A 2XSKA 3QG6A 2HFEA 3WS3B 5JIPA 4ZOEA 1QHQA 1YC8A 4D9RD 5DVNA 3FU3A 4ODVL 4ZMLA 5I24A 2P3YA 4PCYA 4LNRA 3OVUB 3C9NB 1HDMB 4Z7VB 4DWHA 2RR3A 4Z3JA 1MFEL 2ZUQC 1UT2A 2VERA 5J11C 4DKFH 4U1IA 5DZJA 3FTXA 3TC9A 1T89A 4JB9H 4N2NA 4P4RA 3VFMA 3VXMA 2HPOA 2HLAB 3ARFA 3BP7A 3KYNA 5C0BA 3RGHA 2CALA 2NT0A 3BSZH 3F2LA 3QDHA 5T5NF 4F7TA 3ATFA 1MG2C 2IBBA 1YJDH 4PG2A 4L29B 5J9PB 5FOBA 2CAKA 4NJAH 4AC2A 1OGPA 1I8AA