2KYIA

Solution nmr structure of dsy0195(21-82) protein from desulfitobacterium hafniense. northeast structural genomics consortium target dhr8c
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
MDNRQFLSLTGVSKVQSFDPKEILLETIQGVLSIKGEKLGIKHLDLKAGQVEVEGLIDALVYPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Combining NMR and EPR methods for homodimer protein structure determination.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
total genus 12
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kyiA01
2KYIA 3IPFA 2KS0A
chains in the Genus database with same CATH superfamily
2X4SA 3V9CA 1XCQB 3QHFL 4PMFA 4HEPA 2CBQA 1ZHLB 1UQSA 1WS8A 4JZJA 4MXWL 3RGHA 4I77H 4LESA 5F9OH 2OP4H 3QRBA 4ZPTA 1ZTXH 4LSVH 2Y23A 2ZCLH 1N6QL 2IPUK 3K1DA 2ZG3A 1A4KA 1YMMB 3KPOA 4N8UA 3QK0A 4IRJC 3BDXA 1XGQB 4HPYL 4PJ8B 4GKSA 3QFGA 3TVMC 2GUOA 4TL5A 5C0AD 2XPYA 1HZLA 4PJEF 3VXSB 1X5HA 3V0IA 3UTPE 1SBSL 3NIGF 1PL3A 3FT3B 4NGHL 3KPNA 4PWIA 4KZDL 2FL5A 2HH0H 1FPTL 4PJ5A 3DTUB 4HDIB 5JIQA 3MBXH 3I6GA 1KGCD 1KXTA 2P4AB 4HIPA 1KC5H 4KKCC 1WRFA 4UILH 4YHYC 3GIZH 4ZG1A 3HE7B 1S7WB 1MY7A 2ZXWB 3MRNA 5C0DB 1J0YA 3BWUC 3WFZA 3FU7A 4PJ7B 1OKEA 4LMQI 5HJDA 4G8GA 4GEIA 5BJTB 4PJ9B 3APFA 2DI8A 5L6YH 1S3RA 3D9AL 2R0KH 4W6XB 3EJQA 1X4XA 1NCDL 3H4FA 4Y5YB 2YAFA 1N59A 4NXKA 5EEZA 4V11A 1JV2B 1RIVL 3CDZB 1TUPA 2EJ1A 5CFAA 3VXQB 2XQYK 1ZVYA 4WWKD 1HQ4B 1JUFB 3ARUA 4L3FA 2Z91B 3HC2A 4JM2A 3DK2A 2MQCA 3PP4H 3DUHA 4UU9B 4WI8A 4DP0X 1KGIA 1ACCA 2DBLH 4QTIL 5IIEA 4DUXA 1SVCP 1NGWB 1PG7X 1W72B 2I69A 2PR9A 4LSRH 5I73C 5I82A 5H4YA 2N0KA 3PV7A 2XFXB 1RCYA 4NJ9H 1XCWA 2FD6H 5FCUH 4YHOH 1Z9SB 4BKLA 4OCXH 5C1MB 1SDAB 1KGUA 5EEVA 5FUOL 4S0TD 1LJMA 1UM4L 4LHUG 4WI9A 2JCCB 1U8QB 3L5WB 2XVKA 4QO1B 4GXVH 4HCIA 3JVGA 3QAZC 3TJHD 3H3KA 1QUPA 4WV1A 1WZAA 2FCBA 3NCEB 3GSUA 1HVXA 1KN4H 4Q6IB 5LO7A 1MRFL 3GNML 4ONGH 4Z7NB 1M3JA 4BIKA 1CK0H 4KVCL 1FSKB 1WFOA 2X28A 3IDNB 4PTTB 3T0EA 3TXAA 1PKQA 3U2SA 4EBQH 3KWTA 4YHZH 1X7SA 5KUKA 4TRPH 1N3NA 5A2BA 1CE6A 5I71B 2C34A 3N42B 3O6MH 4NQQA 2DQHH 3U2JA 3GEWB 4QRFA 5IB2A 1UZ8A 2Y7MA 5T1DH 3PXJA 1TVHB 2F08A 1CT8B 1NWPA 1JK8B 1IAOB 2Y7QB 3TO2B 1LQBC 5LLIC 4HWEL 3WY4A 4K7PL 1WP6A 2YGQA 4IYKA 2C9PA 3VFVB 1YNTB 1QKZH 2KS0A 2X6MA 1N8OE 3EOBB 2C7UB 5DK2B 1FGNL 5JHLA 1CFMA 4W9JC 3X11B 5KS9B 3QFJD 3GGWA 2FJSA 2FO4A 4S1SH 1E4KC 4MSWB 1T3FB 4EQ2A 2QQKH 2F1EA 4LGSB 3FCSA 5HI5C 4S1RH 1KTLB 3SCMB 4ZMYA 3KCWA 2VLKB 4PJ5D 4EN3A 3BZEA 4F9LA 1T0OA 4ZBJA 4WEUD 5IHLB 4PGDA 5ESQA 5A6LA 2G4GA 3LHPH 4NQDA 4JFED 4PRPE 5HGHB 3OJDB 3JVFC 1VHPA 4Q52A 4MDJB 3HW7A 3DVFA 2OSXA 2J8UB 5AAWC 3SDCD 4M7ZC 3RJQB 1HXYB 3C8DA 3GRGA 4NO5B 1S9KC 1D2PA 3X12B 4FTVE 2ERJC 5KW9H 1DANT 3C60B 1IZJA 3CUPB 4XN5A 4GB9A 4DZBA 1BJ1H 2GJZA 2GC7C 4I18B 5FGRA 4NWTL 3MX0A 4B3VA 4FQHB 1UWYA 1TEFA 4X7CC 1SLVA 1BXUA 3VD1A 5D1ZD 3MV9E 5SWQB 2OMVA 2LLLA 5CLYA 3EZ8A 2RJMA 4GG6A 1Z9PA 4XVSH 2A6IB 4H20H 5C0BD 1PX8A 4IGBC 3FHEA 5DMJB 3RKDD 3L5XL 5J9PA 2OZ4A 4XP6L 3RPBA 5I6KA 4IBWA 3BYTA 2XX1A 2QDWA 2IH3A 2G9HA 2YKLL 3QPXL 3TJEL 4RH4A 2ED6A 3MRDA 4W9CC 1S6NA 3RLSA 1QW9A 1R3LB 4JDVA 3CZFA 4Y1AB 2EIZA 3W0WA 4JG1L 1Q9KB 2WUCL 2ARJA 2OL3L 4I89A 1BV8A 3LEVH 2AHIA 4PS4L 1YPZE 2ZOKA 3EGXA 4A7TA 3IAQA 3OBAA 2P49B 2F7RA 5IFJB 3D2UD 1D9KA 3VXUB 4G6MH 4OT1L 2E76C 3BE1H 1S7RA 3N85L 4PJDE 4BA0A 4MD5A 3MRCA 3MCKA 3HLAA 4ODXB 3OV6A 2E9BA 4UZUA 4XN7A 3VGGA 1NEZA 2YQBA 4HFWB 4IKJA 1FA4A 3KPLB 1IFHH 3W37A 4IQHA 3ARDB 4HJIA 2CJ3A 4FZEL 2CKBL 2OTWB 2GW5A 4IJ3C 4X4ZA 3FL7A 2IMNA 4HS8L 4ZSOB 4ZAKB 5JORA 2CUMA 2WTRB 4GSRA 4I1NB 5GGRY 1M6OA 5EDSA 1CZ8L 4J3VA 3KJ4C 1EQWA 1U3HD 2G0LA 3AU0A 3FRUB 1A4JA 1UGNA 2BVTA 2NUPB 4PGZA 2AQ1A 5JQIB 1KGXA 4B9FA 4DN4L 1ZA6B 3H6JA 5GSVA 2OSWA 2BVQB 4Z78A 2JELH 4ZMNA 4OF0A 2OYLA 3RP1A 2Q86A 2W0PA 4QT5B 1KCRH 5D70H 5EC1B 3P9MB 3L9RB 4HF5H 3CVHH 1AP2B 1KJMB 4EN3D 3TA3C 2DBJA 4DPAX 4KTDL 1YSOA 1J05B 1FZMA 2KPNA 3MNDA 5KVGL 6FABH 2Q3ZA 3LNDA 4JM0A 1MHCB 2WM0A 1WFTA 4ESKA 2YWYA 1NCWL 4MBOA 3NA4A 1FJ1B 2X42A 1ZWIA 5TDPB 4AMWA 4Z7OB 1KENH 2LU7A 2DIEA 4M3HA 4R0LB 5A2IH 3WAJA 4LVOC 4FNUA 3RZCB 5BXFB 4UTAH 3LTVA 5SWSE 4JFUA 4L5FE 5GGTL 1IX2A 1R47A 1MHPH 3UBXB 1IGML 2PO6A 5DZLA 4X6CA 5CAYB 4NKDA 1Y18A 2HPOA 4LIQL 1ET5A 3FB5B 3SJVA 1G7QB 1YN6A 3B2UD 5IHZA 5EA0H 1CGWA 4CW1A 2G3MA 1Y0LA 2AI0H 3ABMB 4QF1A 4M8QA 1LDSA 1O7DC 3SKUD 5CUSH 4ZPVA 5ACMA 2OAAA 4Z3TA 1MRDL 1UHVA 2W1NA 1L9PA 4WUKH 4ZX4A 4Z7WF 1V7ML 4U1NB 1XAUA 3KYKH 4WW1B 1RZJC 3K80A 4P3DA 4TNFA 3JV6A 4TSAH 4N0UA 3ZIYA 2XWJA 5K39A 4QRPD 3IRPX 3ULUL 4FERA 1XGPB 2AXFB 4KKLC 1JFQH 2O5ZL 2B08A 2DWEB 1OTUC 3CN4A 3FQ2A 4HQQH 4HWBL 4BE5A 4C83A 1TZOA 1YNKL 1IAII 2FLBT 5ETUA 3ZHDA 4U0QB 4AIZB 1RVFH 4H8WH 3CZNA 3I6LE 1YEGH 4MNQB 2OCFD 2WBWB 3IWUA 2ZSVB 4I3GA 4KZEL 3FN3A 2GG1A 4NM8H 3WNNA 1Q9LB 4LP5A 4EOWH 2FAUA 4X6DE 2C3XA 1LTXA 1OGAA 2AV1A 5D7LA 1KPUB 1OK0A 2WOYA 1JHKL 3BGMA 3W0WD 1IC4H 4F2EA 1ETA1 4YE4H 4RZKA 3PWPA 3BFOA 3SGEH 3L5HA 3S96A 5JHMA 1D9KD 2IAMD 5E4OA 2OW7A 1M7IB 2WAHA 4LSDA 4BYHA 2ZYHA 3KLAA 4ZDHA 1BAFH 3OR7B 1AE6H 3RVUD 3ARBB 5IFAH 4J2QA 5JIDA 1CLCA 3R06A 4MAUL 2YRPA 1NLBH 1O0VA 4G6JL 3F05A 3KPRD 2IJ0C 4XP4H 2ADFL 3DPDA 1J8HE 1K3ZA 2NXYC 3CMOL 2XWBB 4N2MA 4PTUA 3ARGB 4OJCA 4ELMA 1E4KA 1MY5A 4PGJA 1C16A 5DZOA 3GBMH 1CURA 5EOCL 1IAIL 1ED3A 2H0FA 5BVJA 1QSZA 4GAGL 3QPQD 1JHLL 4U1IB 3RWJA 1ZLSH 1X5KA 2NDFA 3GSVB 2FQEA 4DPBX 1FIGL 1UXMA 4ONFL 3OJ2C 5D2NC 2J20A 5FYJD 1KYDA 4P4KB 2Z64C 3VE0A 5E8EB 3I9GL 1PYWB 5EPMB 2NTFB 2AEQH 3CFKA 5BZWB 4PJIA 3FU3A 4UAOB 4X9FA 1RZIB 2NR6C 4X9HA 4G9DA 5C0AE 2C1OB 2OJZL 1MW1A 2R9HD 1OARL 3K5RA 1E28B 4U1HB 1FZKA 4ZTOL 5AAWA 4UCFA 4F3FB 1BD2A 5C0IA 3VD3A 3WJMB 2F54E 2VABB 1I3RB 1AJ7H 3OZ9H 3GDCA 1NA8A 5TE6H 3VG0H 3OMAB 4XO3A 4KROB 3U4EB 3F04A 3LH2L 4RRPA 1PLCA 3LQAL 4Z7IA 1KGCE 2B1AH 1N6VA 4LCWB 4PV8A 5G2NA 3QXAB 2J2ZB 3HE6A 3HJ0A 4P07A 3IU3A 4U1SA 4PV1C 3QVAA 2ZG1A 5J12B 5DD5H 5GS3A 1JZGA 4JKLA 3HG1B 4OGAC 4PGBB 4R5XA 1JNLH 4Z7UF 3TCLB 4OV5B 5JPNB 2W88A 3L4UA 5IJCC 3V4PA 1HHHA 2C9XA 1XH3B 4BFRA 2R2EB 4X4XB 4APXA 1PSKH 4KHTL 1X5AA 1QOKA 4CSZA 4OM1H 5FYKH 1F56A 4LEBA 5CJQL 3SGKC 1XF3A 2EXWC 4FFVD 1ZS8B 2GEEA 3MRQB 1CL7I 2YSTA 4UQ9A 1G7MB 4FQIH 4WVRA 2VXTH 1ZE3C 2F18A 4LAQH 5GJSL 5F7MC 2YQ3A 4JDEB 5I2IB 2LW3A 2HXAA 1EEZB 2AZUA 3PABA 1F90L 3O3DA 5GS1B 1HIMH 1ETZA 3N9GH 1JCKA 3O3BA 3HS0B 4FDWA 5EBLB 3TYGH 4FNPA 1V8HA 2J21A 3RUGE 4DP2X 2ZXQA 5DSCA 5C0CA 1A3LL 2F19L 4O02B 5C07D 1AR1B 3V0VB 1DDHB 2V3EA 3LQZB 5HYFA 4F37K 3GSWA 4WI4A 2QKIB 1E27B 3V7MA 3AREC 3IGUA 2E6PA 4PR5B 4XPBH 4WWNA 3C5JA 3MV8D 2VDNB 2WWMD 4YHPA 3D30A 3DX3A 2GSMB 4MCMA 3ATAA 4RAHA 1IT9L 2J4WH 3BKJH 2HA1A 2E59A 3ULUF 4WKZA 2BDNH 2AQQA 3IXTB 1KXVC 2Y07L 2DZEA 1N0XL 1KYFA 3EH3B 2Q6WA 1DUYB 5D8JH 5CN3A 1SNRA 5SWZD 3LRMA 3UGUA 3WSQL 4JJOA 3VMNA 4LPWA 2A6JB 3RTLA 5HGDA 2D3NA 4LSSL 1DLFL 3RY5A 2APVA 5E1IA 2KZ1B 5AYUL 4FHKA 5GISL 2BWQA 2UYLA 5I1DB 3A6BL 3ML8A 5B1KA 3Q5TA 2VE6B 2WP3T 3DETC 2BSRB 1BVOA 1NC4A 3QFJE 4LPXA 3VNYA 3W9DA 5C0JA 1E8YA 4AQEB 4NUGL 4PLNC 2A4ZA 4KZ0A 4M93C 3QDGD 3GBDA 4U6VL 3K74B 4PJ5E 3NJHA 1OSYA 1TSHA 2CLVA 1G9NH 4XMWA 3L3IB 2IOIA 3HE6D 2R27A 4JFEE 3IJEB 4GXFA 3FTGB 4OFQA 4W9KC 4FNSA 3SPHA 1H15B 1UD4A 1QRNA 4IBLT 4HS6B 3REWA 2I26N 5FUCE 4BDVA 3I3EA 5HYSB 2X0UA 5DC9B 5KSAB 3NIFB 2X1QA 3QEQD 3VFSA 5C7XH 1GGBH 4K94H 3MRRB 5EEUA 4ATTA 4AC4A 1A7OH 5MHSD 3SHSA 3RWEB 2GITB 3GHEH 1LD9B 2ZOUA 4OCWL 3QEGL 5HD8D 2QVMA 5CD5C 3BUQA 1DEEB 3KPMB 3DYPA 5C0BE 2BJMH 2VC2L 3CFJB 1MXDA 1DFBH 1KZQA 3CN3A 4QKTA 1WZKA 4K5NA 2EUVA 3NCWA 5HHQA 2GY5A 4X5RA 5DJ0A 1WBYA 3ZO0A 4PPTA 3A67H 3MBWB 5EC2B 4D7BA 3DRQB 1S78D 4YL4A 3VXMB 2GT9B 3QE5A 3KPSA 2VDRB 1V54B 3FU5A 2VUYA 4C47A 1GPOH 5I0XA 4O5LL 5JOEA 3DK0A 4ABWA 4FQXB 2BZCA 2ATKA 2IGTA 1GOHA 5IQ9B 1IBBA 4JUSA 1UM5H 2KLRA 1JGUH 3VAEA 3DX6A 2WXRA 4LT7A 1T1ZA 1U8JA 3CN2A 5DI8A 2QJDA 4NPYA 5ICYA 4WWOA 3MRHA 1BBDH 2WHVA 4YO0A 1KWGA 5E6IB 1EEYA 4Y19D 4R2GB 2PTTB 2J88L 2XYCA 4Y8DC 5HYJA 1FYTD 3VQ1C 1X4YA 1BPLB 3P2DA 4OZHB 1PEWA 2HKHL 4U0RB 1C5DA 3S2CA 4PJBB 3U1SH 4DTGL 4PY8J 1CIUA 5GSRB 1WAAE 1BYOA 1X44A 3EYVA 4XMPL 1NC4D 4D9QD 4AG4L 3QUXC 4A7VA 4ZMTA 4RGNC 2DKUA 4GAFB 4YHNB 2IPTL 1UCBL 8FABA 1IBGH 4N2KA 1FV1B 3UIYA 1K8DB 1MLBB 4KUZH 5D7IF 4JO3H 1L9OA 4MQSB 1ZAGA 4FFWD 3Q6FA 4UDTA 1ZVHA 1ZS2A 3MNVA 2DM4A 5B22A 3U48A 2PPCA 1HNGA 3LS5H 4PWKA 4PJCB 1N8ZA 4GIOA 4WZ9A 5BRZA 2WXIA 2Y25A 1RJZA 2PTUA 2FT8A 5GRWA 5F9JA 3Q05A 4YDKH 1ETJA 2X4OA 1MUJA 4XWGH 2ZAHA 4GMSL 3SGKA 1TQCB 5IB3A 1OP4A 2WXQA 3DBSA 1EPFA 2BS9A 4YUEL 4AUYA 1CGTA 2BVUA 2CXGA 1YYMH 2X4UA 3NH7H 4Y9CA 3P9LB 4Z7VF 2BRQA 3IE4A 3LOWA 5D93C 4RRPG 4AMKL 5BQ7A 3GZKA 1RZQA 2Z7UA 5CS7A 1VEPA 43C9B 4BHUA 4KDTC 4N90D 1AKJB 3EGDA 4XWOC 4OZFG 4FYTA 4QRPE 5CJXC 3CSTA 5FFLA 2FO8A 4PRDA 5DEGA 1FG2A 4FI7A 3QXWA 3VA6A 3A6CL 3CAFA 3NIGB 1I7ZB 3PG2A 4N2NA 2SEBA 5F3BB 1NC2D 2EC9U 5F1IB 1KGJA 4XMKL 2XLLA 1DL7H 1PG7H 1R3KA 3AREA 2YXVA 2VXSL 2VZ3A 3C6LC 3NPZB 4X5XA 1DBAH 4UF7C 2B20A 2N59A 3T2NL 3W0WE 2H3NA 1FQ9C 3UFIA 3ZRSA 3GUTA 3RAJL 2CSPA 3LKPA 4L4VB 4L9LB 4PD4J 1IAIM 1KBGH 5E5LA 1HINH 5C92A 1BW8A 2Y1AA 4L4TA 2HFFB 2ALAA 3ATBA 4NO0B 4P57B 1SDYA 2XRAH 5GGRB 5K59F 5DR5L 3ROLB 2OK0H 4Y7MA 4F33B 4P2OD 2PW1B 5DA4A 1E4XI 3KPRE 5J1TC 1AXSB 1X3DA 2PWHA 1I8KB 4L1LA 3FMGH 5E00B 3UZVB 2XBTA 3FN0H 3MV7B 1ZSHA 4MDRA 2UY7B 4PSRA 5J1SC 1VKXA 3MNMA 2K0RA 1YY8A 4YR6A 4ABVA 1YEHL 2VDML 4M43H 5CJOL 1I1FB 3L1FA 3GMMB 3N2JA 4YLQT 4CSTA 4XP9L 1KT2A 1DVYA 3HJEA 4ES9A 5LQBL 1JIBA 1NMCC 4MX7A 4Z8FH 1FHNA 1A7PH 1O9ZA 5FKPA 1NEPA 1AC0A 1B4JH 1OCRB 1IUZA 2A0LD 5FYJE 3KLHC 1AANA 5BMFH 1XIWD 3PAUA 1OD7A 2QVIA 1UT9A 2OYKA 4DP5X 3D69B 4XXWA 5ECGA 3V0WH 1YNLL 2ED9A 4WEMB 4AVIA 5JQ6L 3CSFA 1T03H 3TFKC 4N24A 3VRJB 3IKKA 1V7NH 1SEQL 4E9VA 4ZTPL 1MG2C 1MZZA 1OM9A 4JKKA 4BUHA 3M86A 1E4XL 1KYUA 1RY7B 1QBLL 2R0LH 1KXQA 2XI9A 3BO8B 4P8QA 1II4E 2HTLD 1OB1B 1BQKA 3H9YA 5HDBF 4NBYB 5IK3B 4BFJA 3NRPA 2Q3AA 3APDA 2EUXA 1AGEA 1E8WA 1KCLA 1F3DJ 4MZ2A 3FUMA 3SDAC 1I85A 1NFDA 1OCWH 2FBOJ 2ZCHH 3PJSB 1V3MA 3U82B 4ES8A 1U8HB 1LEKA 1GS8A 1CLZL 2EZ0D 4X9YA 4OLWL 3II1A 3WEOA 4W9FC 4EPSA 4Z5RB 3AB0C 4OFYD 4JFHD 4KTEH 3LS4H 3IFPA 4JDZA 2CHNA 1AC6A 4E9XA 5ECJE 3VYPA 3DROB 3EFDL 4P9HH 2WLIA 3U0TA 1A14L 3OGOE 3M8OL 2NY0B 2I9LB 3KWXA 4H13C 4XPAH 1P5VB 4QRRA 1T66D 1Q38A 1OP9A 1MCLA 1NAMB 1QO3A 1LO3H 2EIDA 1KCWA 2I9TA 1HOCB 2DL9A 1EO8H 4KOCA 3EF7A 2CPUA 4A6YL 2RTTA 5I5MA 2P8LB 4FQ1L 7TAAA 1VA9A 4FLQA 3H9SA 1BAGA 4M48L 1HZHL 5BO1H 3ZHKA 1U2HA 2VDOB 3GF8A 5D5ME 3RY4A 2V3FA 3MRPB 1O9WA 1MWAA 4AGPA 1NDMB 3WS6A 3WFBH 5I18L 3RVWD 4G2AA 3MODL 3HKFA 3QR0A 4MJJA 1JZFA 4ZUSB 1UZ6F 2WXMA 1PDKB 4PJGA 5C07E 2QVTA 1KLGB 5LNGA 5HYQA 1NIFA 5DD3H 4PFEA 1KB3A 2VDKH 2WMPA 4ISVA 1E6JL 4LSQH 4TM9A 4CC1A 3QNYA 3RNKB 2JK5A 1XGYL 1XB8A 2AQTA 3MV8E 4OIIL 2ZNWA 4WEBL 4UM9A 5E8NA 3EJYC 1JVOA 2JKXA 1IKFL 5E5UB 3QUXA 1J1OL 4M7LT 2HB0A 1AO7B 3K4DA 3V9EA 1T5XB 1IGFL 8CGTA 1P1ZA 5FKAA 4JO8A 5SWZE 1IFGA 2WB7A 5DJ8B 4Z76B 1MIEL 3MJGX 4XZUB 4NUJA 1E4WH 5LBVA 3RIAK 1FO0A 5MEQB 4RRPM 2YLHA 5KANI 4DKAA 2EO1A 4RMRA 4OJFL 1DEDA 4HWUA 5CBEA 3INOA 4FMKA 2IANA 5BOJA 3IXAB 1G94A 1TITA 2VM3A 3QZPA 3LZRA 5I1KH 3VDCA 2YPVH 1BSIA 3NIDE 3S8GB 4CADB 3N41F 4AM0B 4AYGA 1Q9OA 1WC7A 4WW2A 2CALA 2VL4A 3D18A 1AD9B 3QDGE 4JJHA 2WSDA 3U9UB 5C2BH 3VWJC 1NAKH 3P3SA 2Z31B 3QJHB 2PCFA 4FYRA 2GABA 4Y2LA 2HUEA 2DLHA 2AXJA 3HS8A 4MXQC 3HBPA 1KBVA 5EBWA 4M6OH 2YKKA 3RWCA 4KDTA 3QJFB 2FEDD 4F8PA 2EDMA 4YSOA 4XE0A 5CJXA 4DQOH 3QHTC 4BK8A 3Q1SH 3FQTB 3NZUA 1H3PH 5I0DA 2F5AH 2YUVA 4DK5A 3ULVC 3D06A 1UB6B 2AJXH 3EOTH 5EF0A 3FZUD 3M1BA 2AJZA 3IB4A 3MV11 3RNQA 5J6GB 5MEND 1UUSA 3TEZA 3QEQE 4GKZB 5LCVA 4HUXA 3VVVA 1OAQH 3OKDA 4AYSA 3DSNB 4RX4D 3RWHA 5CGTA 4MAYB 3TM6A 3B9KB 4JK0D 5MHSE 4QRRD 5F3HB 3UTQA 4UUJA 4I4WA 2JJWA 4HUCA 3KVDD 1QTSA 3RTQA 2BOCB 4XVTH 2QDVA 4KAQL 2XWCA 3IDGB 3F62A 2D8KA 4OFIA 2D7NA 2UY6B 3NSCA 1XF5A 4DP1X 3IDIB 2AVFA 3E1F1 3CSYB 3MRIB 5DS1A 1XXDC 3FFCD 1RMFH 3BSZH 5DTFB 4NQVA 4YFLI 3TJHC 4AENB 3WXVL 5B39G 4CVZB 4YIQA 3TFBA 1UB5A 4NN5B 4S0SD 3GSRB 4PLJD 5EBGA 1IEHA 4P59L 4G42A 4PM1A 2XWXA 4F7TB 3AWFA 4RBPH 3G5XB 4UV7L 1RZPA 5I0ZA 4OI8A 1HEZA 1UQSB 4JZJB 5D4HA 5FUZL 1OP5K 4NNPL 1DQDL 2JKRM 1A7RH 2ZOOA 3ILDA 1A6WH 4RGOL 4DGIL 4ZPTB 1FNSH 1DQLH 5JW4M 1A5FH 4WY7L 3WD5H 1QEXA 4U6YA 1MJ8L 1A4KB 2WO4A 3F85A 4PJHF 3FTYA 4MYWB 5A2AA 4BRVA 3BD5A 2G4EA 3LKNA 2GUOB 1I9IH 3WL9A 3PNWA 2CGYA 1YUKB 2AF2A 2ZWLT 1MH5B 1FYTE 1TZHB 4M1GH 2XXGA 5IWLA 3KPNB 1U2CA 4HX1A 1SMAA 5IT2L 4N3TA 1FLTX 4AY0A 5E2WL 4B60A 1KXTB 2MOGA 2O5NA 2LU3A 4QXUL 1OB0A 4HLZH 5I30H 1INEL 3CVIL 1MCKA 3NJVA 1GTFA 5JHAA 1MFDL 3L81A 1OAKH 4D9QE 5C71A 1JSYA 3FU7B 4DO4A 1S7QA 2WN3A 3RBSA 3CFQA 5MERB 3SDAA 4BZ1L 3VX0A 2YO3A 1KTDA 1T04A 2FATH 1HKLH 1FBIL 4HKBA 2UWEE 4ONHB 4NQEA 2ZUYA 3CMGA 5INCA 1N59B 1ZHNB 4KX9A 3N1MC 4XC1L 4FXTA 4YX2H 3TWCH 2ESVB 1RUKH 5E1HB 1B2WL 3KPPA 3V95A 1YJDC 3GHBH 4ZFQA 3WEAA 2ADIA 1GGIH 4JM2B 4P2AA 4BFNA 4YLCA 1AY1H 5CEYA 5JW3H 3SDCC 1MPAH 1NL0H 3SQOL 5IBUG 2B1HH 5IIEB 2BC4A 1I3VA 3H42H 1U58A 1TENA 3OKLB 4JPVH 3UYPA 3EUDA 4UNTA 1L9SA 3FB8A 1CBVH 4OLUL 4S11A 3VMPA 4Z3JA 2VISA 4BKLB 5JZ7D 2R1XA 4G8FA 5JIIA 5LGJA 4JHAH 5D1ZC 1BAWA 1UC6A 1F8TL 1RJYA 2OA9A 4QOKA 4N90E 4Q9BA 4D3CL 3LRKA 3H0TB 3BN9D 5L0QB 1P5UC 3RTQD 3MRKB 1XBDA 2YAOA 5I1GH 4WV1B 4ALAL 3TNNA 1NKRA 5ICZA 3QWOB 4K8RD 3W39A 5GRUH 3GSUB 5KBPA 1A22B 3H3BC 4H44C 5FO8A 5J4MA 2Y5TB 1KFAL 1P2CA 1WV7T 5FV2A 3KEHA 4LLMA 5KANG 1HTYA 3T0EB 2R8SH 1PKQB 2DH2A 3HI5H 4FG4A 3U2SB 3JWDL 4Y16C 5E5RB 3SEPA 2J12B 3QHFH 5HHMB 3S8WA 3L1EA 1WFJA 5IB2B 3V5KA 4TUKL 1I3UA 1MCWM 4MXWH 3LPOA 3U1PA 2FGWL 35C8L 3CFUA 1S7SA 3ECUA 4NC1E 4NNXA 5DLLA 4JRLA 1N6QH 3K4ZA 4D7PA 5DQDL 1DP0A 2GBTA 3QUMA 3LKQA 2YUXA 4JPQA 4ANUA 5J1AA 4LLUA 4APQB 1OTSD 2Z8VC 2MCAA 5TPWL 3FU6A 15C8L 1SBSH 3LVTA 2FO4B 3LXUX 4NGHH 3OHXB 4KZDH 1FPTH 3U1QA 1F4YL 1ZA3A 3FCSB 4OLZL 3OXSB 3MA7A 3GK8L 1E4HA 3VSVA 4R83A 2NYZA 4JFSA 5JIKA 4YC2C 1UUNA 3MU3A 4OZGF 2NY1D 4PGDB 5EOTA 4JMNA 3H55A 3VWJA 1Q9WA 4NQDB 1Z6JT 3EFOA 1J5CA 1EXHA 1OSZA 1J8SA 5I9QC 5T1KB 3GINA 3OJVC 4I3SL 1COBA 2GBUA 3D9AH 3QJQB 3IMRA 1NCDH 3QULA 3MCG1 2JXMA 4H2CA 1XZ0A 4L29A 3MI6A 1RUPL 4NAJA 1RIVH 1ZT4A 4L8CB 1TZIA 1IEAB 3DA0A 3WJLC 1BG1A 5DC4B 3MGTB 4DZBB 4OKVB 4MJIA 4N6QA 1U8MA 5SV4A 2BW5A 3EJSA 3GSQA 4ZUVA 4QTIH 4XMUA 5ANMB 3HEIB 3QJTB 3UCRA 2EC9T 4HIHA 2OMVB 4TNVK 2NW3A 4P5TC 3UAEA 4GG6B 4BA8A 3MGOA 3MYJA 1AG0A 2GAZB 3E9TA 1IM9A 3A47A 3ATDA 1QACA 3W81A 1W15A 1E9OA 1X5ZA 3FO2A 3IPBA 4XNQB 2DLIA 2MOVA 4GG8A 4ZS6C 3T09A 4KI5D 2PNDA 1NMAL 1FH2A 3RFRA 5B7MA 2K1MA 3EJRA 4F7EA 5FUOH 4Y7OC 1UM4H 2PXYD 2G9HB 4RFOL 3QRFM 4JFHE 3VW3L 4YDVA 4QHPA 3DIFA 4XTRC 1AQDA 3FUJA 2X88A 3UP6A 4DO5A 5AVQB 1P6AB 4YFLF 3E9UA 1QG3A 2X4NA 5L2KD 1QHPA 4PJ6A 4PS7A 5DJZA 3U7WL 1MRFH 1DUZA 2ARJB 3GNMH 5IBTL 1QPXA 1SXZA 4KVCH 3LZQA 5DHYB 3AQXA 4KNTA 4NI6A 1NCNA 5EUOF 1SZNA 3HHMA 1D5XB 1S4IA 3QZWA 3EGSA 1KCVL 4XNMB 2MFNA 2Z92A 4ECNA 3DOSA 3MRCB 3MCKB 1H0DB 1ZJBA 3HLAB 2OSLA 3L3GA 4U31A 2DQDL 1ND0A 2CKNA 4KO6A 5EZLA 1SM3L 2YMXL 3OC5A 4IRJB 4K55A 4HWEH 4K7PH 2KDGA 3WUZA 2IAMC 3TVMB 4OIAA 3VXOA 3T3ME 3PLYA 5JORB 4N2OA 3UEZA 5JMOC 4PHXA 5CJBA 5EEYA 2VQTA 2BOLA 4DIXA 1MWOA 1FGNH 5BRPA 2TRHA 2WLLA 3HN5A 3MRJA 5GSVB 1W80A 3GJFH 4Z78B 2P5EB 2OMYA 2C9AA 5E6ZA 4YHYB 1NCIA 5AAPA 4EDXA 1I82A 1YPZF 4FFZL 5AB2A 1TZ8A 3FHAA 4WK2B 3QPQC 4RSVA 4HUWA 2IBBA 3US1A 4V1DA 1RU9L 4PJDF 4Y4HD 3ETBF 4R84A 5JHBA 1FZMB 1PLBA 1HH9A 1U2YA 5F7EL 4F8TA 3NQIA 4JFWA 4N2IA 3NBNA 3EXLA 1ZWIB 4PMEA 4E9WA 3VU1A 2WQUA 4F7KA 3HB3C 2HJLA 2WNGA 5A2LH 4X6CB 3T2OA 4NKDB 1Y18B 5CP3H 5E0FA 1CVRA 3LXAA 1YN6B 1OIOA 3LZLA 3SJVB 5IHZB 4CW1B 4IOSA 2Q87A 4QF1B 3DX8A 5I73B 3KL5A 3C75A 3MXWL 4FL4C 1R3HA 3CSGA 4Y4KA 1PCSA 4PRHD 3WIHL 5FDWA 2Q5BA 1IC5L 3CN0A 4ZUUA 3L5XH 4HIXL 4U1KA 4XP6H 4BWTA 4X9IA 2DLFL 2XVGA 4PVMA 2AABL 3ZKNC 1FN4A 5IB5A 1P5UA 2VAAA 2BFVH 3QAZB 2YKLH 3L3DB 4N4YB 2E74C 1FVDA 3BDYL 4WHDA 3RVVC 3QPXH 5ID1A 4GKNA 2MPAL 3IMUA 1GH7A 5ETUB 4KY2A 3TJEH 4AL8L 2XHNA 5F7DA 5AKVA 3G08A 4XR8C 5MENE 5LHDA 4JG1H 2F2HA 2WUCH 1BECA 1RK7A 3CVBA 2OL3H 1CXKA 1OTTD 4KDWA 2I07A 1EEUA 2AV1B 5D7LB 1QFPA 3O2DA 4PS4H 3ZT5A 2OMWA 3BGMB 5TFSL 3GKWL 3O45B 1LO0L 4OQTA 2WLKA 3DC0A 4QRRE 3IU4L 3TEYA 1R5IA 1Z5LA 4Y9FA 3PWPB 3VB8A 3N85H 3LEXA 3S96B 4FEIA 1XR9B 3EW3B 2EDBA 1UOLA 3WNMA 4ABQA 3P3RA 4HKZA 5FWRA 3VFGL 5D7IB 2Z6FA 4QHLA 1UXSA 1EIBA 5HI3D 4UNUA 1X6LA 1QFWI 3E0GA 3R06B 1LMKA 3GM8A 2NT1A 3LIUA 2FYYA 3L7FA 3L4WA 4FZEH 2CKBH 3HUJF 4HS8H 3FFCE 1KIRA 1M71A 3LPFA 5C0GA 3KDMA 1IVLA 1CZ8H 4PTUB 3IDMA 3TCXA 4N2AA 1C16B 3WKML 1A8ZA 4XX1G 4X2UA 4ZOCA 4DN4H 3T71A 2ZNXA 4Z0XB 1E50A 3GJFK 3AZUA 3D39D 2E6QA 3RWJB 2FIKA 4ZTEA 1T1YA 4X6DF 4G80B 4GAJL 5E2VL 3ARRA 2YRZA 5GRJL 3HG0A 5D1ZI 2OXHA 3MJ7A 3APNA 2VAJA 4XBGA 1LP9A 3T0XA 2ITCA 3CFKB 3VWKD 1K5WA 4KTDH 4G9DB 5KEZA 1BQUA 3BMWA 5KVGH 3A22A 2YD6A 2WPGA 5TDOA 1NCWH 1FZKB 1QAWA 4BM7A 1BD2B 2LE9A 4M7ZB 2IC2A 1L9TA 1QFWL 4ACTA 2ERJB 4FHJA 5GGTH 4YXKL 3R8BB 3V5HB 2VITA 3NCYS 4N8VA 2V5RA 1IGMH 4JRYB 3SPGA 5EFIA 1MCOL 3PWUA 4PV8B 4PN6A 5E2JA 2FLRT 3VD0A 3FUDA 2KKQA 5G4MA 2DW5A 2L3BA 5GPRA 2V0AA 4G6AC 4IIQA 4P5TA 3IU3B 4ZOBA 2NZ9C 2K45A 5EF2A 1MRDH 2HLEB 3KM2A 3ESPA 2A77L 4IGBB 1V7MH 1JZ8A 3P2BA 2TAAA 2NY6C 1NCJA 5L7XL 3ULUH 4Z0BL 1XCTA 2HWZL 2EDOA 3FYIB 1HHHB 4PW3A 5GQBA 2O5ZH 3V4PB 4OI7A 3V9FA 3J8F7 4HWBH 1YNKH 3A4DA 3HZKA 5IMLB 4L1TA 1HL8A 1QMUA 1OAYL 1WIUA 3MREA 4KZEH 1XF3B 3N0PB 1VDGA 2BLFA 2YAQA 1FZOB 4XVOA 1I8MA 1JHKH 3N40P 1NKOA 2OX5A 1BLIA 3KD4A 4ZMAT 3AADB 2YPKA 5C0EB 1JN6A 3VFUA 4BFIA 4MB1A 4JFZL 1RLWA 3PABB 2HRHA 4PREB 4HZ1A 5MEPA 3BXNA 1M1SA 3O3BB 4X8CA 3NA9L 5IVXA 2Z0UA 3M45A 5AAMC 1MDTA 2X3CA 4IJ3B 5C0CB 4XOBA 1N10A 5E5MB 4MAUH 4DSYA 4Y2OA 2JKIS 3UAFA 2D9QB 4G6JH 3KJ4B 3TTYA 4Q97A 5I1AA 2ADFH 1N70A 4WGVB 3EO0A 1WYJA 3CMOH 2YMTA 3OTTA 4AGMA 3TEWA 1JHTA 3C5JB 3MKKA 5E7BA 1G7LB 1IAIH 1RIHL 5EOCH 5HDBB 2EVGA 2CO7A 4GAGH 4NDMA 1JHLH 1K4CA 5E1GA 2OM5A 4P46D 1KCBA 4OW6A 3LH9A 3ZE2E 3SZ6A 1IGYA 2VT0A 1FIGH 2ZSWA 4U33A 2H0EA 4ONFH 3U0PB 4M9OA 1QSED 5IQMA 3TA3B 1AH1A 4ZMLA 3OMNB 1WUZA 1T5WA 3ETBJ 2N0MA 4GRLD 4BWWA 2XZCL 5AZ2L 3HNSL 5AW0B 1JDAA 4JY6B 2OJZH 4M56A 4YWGL 4GSQA 4LVOB 1OARH 3FDWA 4YZFE 4BINA 3RUGF 1T6WA 4ZTOH 1QTYT 2VXUL 1CE1L 3W9DB 3VUAA 5JW5B 1B6UA 1DBKL 2CHXA 2BSTB 4QEGA 2H3XC 4DKEL 3LH2H 5D1QA 3LQAH 1MXGA 3CGTA 3HZ3A 4OUUA 4RAVA 5F1OB 1WHOA 1CD0A 2X7LB 5HVGB 5DURD 3UDWC 3DXAA 3AUVA 3C09C 3E80A 4EUPG 1ZHBB 1MCIA 5EUKB 3QR2A 2YD5A 3T1FA 2WBJD 1T6BX 4U49A 4XBPB 3FSOA 2V8LA 4KKAC 1QRNB 2YEQA 1T7XA 3OWRA 2PYEA 3ORJA 2BNQD 3REWB 3TU6A 4BDVB 2Z34A 2W8CA 1YDPA 1CTOA 1JK9A 4FFWC 7PCYA 1YC7A 1SFHA 4XHJD 4KHTH 3ZDYE 3VFSB 4HIIA 3DURA 5E94A 1C9SA 4HUNB 4JBSA 1A3QA 2VW7A 2VQ1A 1QYGL 5CJQH 3WFEL 3U6XA 5F7UA 1EBAA 5JA9A 5KAQG 5CGYD 5DJDA 2W65A 3HRPA 3EJZD 4WSKA 4BH7A 5IBLD 3LPGA 4RCAA 3BH8A 5J57B 5HYEA 4KRMB 3F8UB 5GJSH 4F58L 3CJJA 4JY4A 4KI5E 1P7BA 4HOXA 3AW5A 5E8PA 4NYLA 4F7CB 1F90H 2W38A 5HHQB 3AJ7A 4JUTA 5F1KC 3CU1A 2VR6A 1TETL 4NZTL 3N40F 4NFCA 5KAQF 3ARTA 1A3LH 2F19H 4KRPC 5IG7A 5L2KE 4ZYKA 4XPFL 2NXYB 2NW2A 2ZWKA 3KPSB 4UYPA 3II3A 5I28A 3ZT6A 1WWBX 5GGSA 1IC7L 3BLKA 3IGAA 2ATKB 4OZ4A 4LZKA 4AE0A 4AYEC 5BZDB 5L8LB 2R29A 4GLRI 3N50A 1IT9H 3LKRA 1T1ZB 4X8XA 2G75A 2IEPA 5DI8B 2ICCA 2Y07H 5ICYB 1N0XH 3C5ZD 5D2NB 2WJ5A 4AGLA 2YS4A 1W16A 4NZUL 2LAAA 2VGLM 2PMZA 3WSQH 4NC1C 4HSCX 2EIJB 1YHPA 4P2CG 1EEYB 2LVCA 4LEXL 4LSSH 5HYJB 1DLFH 1KZYA 3LN5A 5EIIA 2DYRB 1VIWA 5EIQA 5AYUH 5AVYB 5GISH 4HETA 3WKQA 2IPKA 3VFNA 3ARFD 3BUDA 1WBXA 4P2OC 2FSEA 5FYJL 3VRLE 1U8OA 3F7VA 1K2DA 2PUQT 3EYVB 2APWA 2VQUA 4JVPA 4KQ3L 4CN1A 1AOHA 1P1VA 1KEML 4NUGH 1BEXA 3GLDA 4J3OC 4ETQA 2D31A 1O5DT 4U6VH 3O9WB 3HMXA 2J72A 2OMNA 4A38A 5D1QD 3H3PL 4S1DC 3Q2LA 3WMSA 2BIHA 1ES0A 1F0LA 1PTZA 3H2PA 5DFVC 1BZOA 4L48A 1XT5A 5CSGA 4OZFH 4DKDC 4LPYA 1IKNC 3OR6B 5ENWA 4BD4A 4PRIA 1XBRA 1B0RA 1GS7A 4WHCA 1N8ZB 5H37G 2FX8L 3FO0L 5BRZB 1SJVA 4FNQA 4OAWB 3AWGA 1RJZB 4N2CA 1ZJAA 3Q8AA 3S4SA 3OX8A 1TIUA 1MUJB 4OF5A 2V9TA 3VYNA 5IB3B 2WXGA 1BLNB 1KTCA 3FO1A 2FX7L 4BH8A 3Q8CA 5ILTL 2X4UB 1ITBB 1WAAF 3NCFB 4OCWH 1VFUA 3HFFA 3CFDB 3QEGH 5EZJB 1AZCA 3TZVC 4PRHE 5BO0D 4WJKB 5JLZA 1KEGL 3EGDB 5B39B 2ED8A 3CQQA 2VC2H 2AEWA 4IBYA 2JJUA 4PRDB 2A38A 5DEGB 1XL6A 1FG2B 3K8LA 3ZYJA 1EEQA 2YRLA 4HPHA 1NICA 3UEQA 1HYSD 3F58L 2DRUA 1XL4A 4XPTL 2SEBB 1KG0A 2WC7A 1J88A 1R3KB 3MKGA 3AREB 1GW6A 2WZPA 1PG7W 4ZS7L 3DJSA 2QQLL 4HPOL 4AZ8A 2X1OA 3CXDL 1R3JA 4QAWA 3IAPA 3KXFA 4O5LH 4X50A 2H3NB 4MBRA 3SBWC 1FP5A 3VD7A 3DGGA 3LKPB 4WI3A 4ODTL 1UENA 4A7QA 3VGEA 4D0CA 3RPKA 2BY2A 1OGSA 1PJ9A 4L4TB 1DDTA 2ROYA 3QQ9C 4U3SB 3PQYB 2RCSL 2WY3B 3CBRA 5HVFB 4QXWA 1JPGA 3H2WA 1WS7A 5HGAB 5C8JA 4AI7A 4JQIA 2J88H 3VGFA 5DF0A 2WQAA 1E4JA 4RAUA 3K2UL 2DH3A 3BD3A 3N1FC 4FJ6A 4KKZA 4MNGA 1W0VB 5G55A 1VKXB 3EHBD 1YY8B 3FK3A 3JT0A 4YR6B 3SPVB 1KUMA 4ZX5A 5CCHE 4DTGH 4JFDD 4M93B 1QFWM 3D39E 5A16A 4YHLL 5M7QA 4HS3A 4MX7B 2IIJA 2LTQC 4NJAL 3KBFA 4XMPH 4AG4H 3JTTA 4JZOA 3CN1A 1T4KA 6TAAA 3Q8BA 2IPTH 2E7HA 3UDWA 3MLUL 3FO9A 1UCBH 2F1AA 4IRSC 1V3KA 1N64L 1KWKA 3ESMA 1HC1A 3RB5A 1ECYA 5IBUB 5HHOB 5A2FA 3OLDA 2EXSA 1G1OA 1T0MA 4FLSA 5FB8A 3T6WA 2GUYA 4Q89A 4WU5A 5I8KL 2NY5L 1QQDA 4Z7AA 1QD0A 4BFBD 5K9JL 3DX7B 3QWRD 5IMKB 4LBEB 1NFKA 1CFNA 2BSBA 2DQUL 4N86A 5AVSB 3IJYB 3DUSB 3T8XB 3ETTA 4TL4A 4YUEH 4N0FA 1LEKB 2X3BA 3T6VA 4AMKH 1PZBA 1J86A 4X9BA 1GKOA 1MW2A 5A2KH 1E9PB 2ZWSA 3T0VA 4U3XA 3SDXA 3UAJD 3IFPB 3BPNC 1OGPA 4JDZB 1IB5A 1UEYA 3ZTDC 2X4RA 2FEDC 1HAUA 3C8HA 5EZPA 2WLIB 3U0TB 1UG9A 3A6CH 3RGVC 3VFMA 1D5BA 1KJVB 4XMKH 2EAEA 3HI1B 4MS8D 5DQ9A 5AOJA 3ZYZA 4RA0C 1PCXA 1MFVA 5DA0B 2VXSH 1ANUA 4ZW3A 2HVBA 1PAZA 3KL0A 3RB7A 2P44B 3H9SB 1EAPA 3T2NH 1AD0A 4OZGB 4RSYA 3UYRL 4F5CE 3UMNA 4G9FD 5FGCB 3RAJH 4OI9A 3V0FA 5AOKA 5ISZA 3AXIA 3RVTD 3QZLA 4HT1L 5I0WA 4P2RB 1MWAB 1C7TA 1A6TA 1LO4L 2E3VA 4U6XA 2ZT9C 3FB7A 3ZT7A 1IGJA 1XFPA 4PJGB 1SXNA 1HE8A 2ID5A 5DR5H 1ET8A 2AW2A 3TPKA 1MJJA 2R69A 4OFPA 4D0BA 1JGLL 2P42B 3FRPA 2WMPB 4HV8A 4ISVB 1MI5A 2IADA 2FH6A 3HRZC 1NCCL 2MHAB 1YEDA 1MCNA 3QNYB 2JK5B 4UM9B 5CCJA 5E8NB 4AJYV 1RZ8A 1YEHH 5AL8A 2VDMH 5CJOH 4K71C 2VLJA 1FH5L 3QUXB 2EYRA 4M02A 2Y6SD 4MA1C 4RGNB 4HIQA 4XP9H 1LYQA 1BGXL 2YAPA 2KBGA 4N25A 2ICWA 4NQUA 5LQBH 1P1ZB 1B3JA 3MOQA 1QSEE 5DO8A 2MCPL 5D5MF 1FO0B 2X40A 1M42A 5C3IA 1IQDB 2P5WD 3P3UA 3WI9A 4E41A 4JQVA 3WKNA 5TD4A 5CBEB 1IKNA 3F7KA 3T2LA 5IHWA 2WLYA 4TYUA 1HHIB 3N1PC 4X7DC 4XP1L 4QHUB 2BCMA 5JQ6H 4IHOA 1TYEB 4U2ZA 4ZJ9A 5AB1A 1AGFB 1DYZA 2O72A 5ELIA 1LHZA 1Q9OB 3DMMC 3TO4D 4ABUA 1F6FB 1JNHA 1SEQH 4FTVB 4ZTPH 5EIIG 3DPBB 2G60L 2BVPB 3QO1A 5EUOB 1E4XH 2XV3A 4FYSA 3UTSA 1QBLH 3GLAA 1CXHA 5C0FA 2K8QA 3KVPA 4H7VA 1NGYA 2BIMA 2PCFB 3NK3A 5D93B 4B97A 1E5UI 4HGMA 4ICWA 2QSQA 2ITFA 3V6FA 3KPQA 5EBWB 3PUUA 5KSUB 1CLZH 4OLWH 4G70B 3GBLA 4IMLA 5D72L 2AXGB 4R3SA 5CLXA 3JV4A 2WO3B 2YD3A 2BNQE 4YXLL 5JXEC 2NUTA 2A9ML 5D7JD 3QQ4A 1VFMA 5T1MB 3M1BB 2AJZB 3EFDH 2N3JA 4FXKC 3RNQB 3WMPA 2FGZA 1A14H 1IAKB 3M8OH 3KWWA 1P6WA 4HUXB 3OKDB 4WHYG 3TWYA 2MKWA 5LDUA 3G3LA 3IFLL 1OWRM 5DD1L 1I8AA 3C6LB 3NIDF 3UTQB 4A6YH 4UUJB 1IKOP 4I4WB 4FQ1H 3SBWA 3S34L 4MA3B 4M48H 1HZHH 3S4SG 4HCRL 1NFIA 4NIYE 3LV3A 3V0JA 4PJDB 1TVDA 4I85A 3ARWA 4AYMC 4GP4B 5LG6A 5I8EA 3SYAA 4FLOA 4P05A 5I18H 4IBSA 2G5RA 4WDIA 1DJHA 1CXEA 2AK4A 3MODH 3BN9C 5J8OA 1ROWA 4EKJA 3APMA 1E5CA 1UURA 4NQVB 1YEKL 3IMWA 1ASQA 1UB5B 2CH8A 3ATEA 1DVFA 3MACL 4G42B 4P23D 2XPGA 4XAKD 4DZ8B 5F21B 3ZZQA 5LXVA 3CHXA 1XGYH 1A9BA 1MI5D 4OIIH 4WEBH 2C3WA 4XXCC 2FRGP 3AS1A 3BT0A 5DEZA 3E2HC 1NMCB 3NAAL 1J1OH 4DGYL 4ODUA 3GTVA 2GTZA 2GTWA 3G6JE 1IGFH 4U6YB 1ZLDA 2B16A 4WTZG 1WA1X 2WYZA 3D4CA 4IRSA 3CTTA 3GO1L 4RFEB 1MIEH 3WL9B 3DVGA 4HALA 1J0KA 3WLBA 2WKOA 3K6SB 4YGVB 3POHA 4ZXBC 1FNAA 4OJFH 1M6UA 3HN8A 4JPIA 1RKRA 5BVPL 3BAYA 4HX1B 3ECBA 2ZP0T 1H8SA 3O8XC 3FPXA 4NP9A 4F8LA 1OTSC 3FHQA 2IALA 4H26A 1H19A 1QNIA 1UD6A 2XIIA 3Q5YA 4H8WC 1B0GB 3PDDA 4U1JA 2GJ6D 4LKCA 1ID2A 1FVEA 1S7UA 1WFUA 3MJ8A 3LXBA 1SYVB 3L5JA 4DP4X 1S7QB 2ICEC 2IAAC 3SDAB 1VESA 1H3TA 1S7VB 5D1QE 1FSKC 2FJGB 4HKBB 1FZJA 2NY1C 3ZU8A 3IEAA 4NQEB 4BQBA 5FYLD 3AB0B 5INCB 4HUMB 4NQCA 5GGVY 3TURA 1QLEL 4DGUA 1JZJA 2GK2A 5C0NC 4GS7C 3V52H 1XGUB 1NIEA 3HUJB 3KPPB 4NKIL 1BYNA 3EUUA 3H56A 5ALCL 3IGKA 1JXGA 4P5SA 3DV6A 3RGVA 3GJEB 1OP3K 3PPSA 3OKOA 1B3IA 5IOKA 3POCA 4JGJA 1F58L 1U58B 4K3DL 1JMXA 3UYPB 5F0MB 2OJEB 3RWIB 3B2MA 3D50A 1UKTA 5DRZA 4X6DB 3OSKA 5LGJB 2BK8A 4G8FB 2YWZA 1FAKT 2F7QA 4JO1L 5CP7A 2ATPA 1RJYB 3IDJB 1B9ZA 4QOKB 4FCHA 4KAQH 1JJUA 1WD9A 3GIZL 1ZLVK 4JFOB 1XWVA 2R15A 4K3JL 4A39A 1UJ3C 5GIRA 3VFPA 4UIMA 2UWEF 2PPEA 3BAWA 5D4JA 3GMOA 3W39B 2BXZA 2ZOLA 4X7TB 1TCMA 5B8CC 3V0GA 1SJMA 2QKSA 3R8QA 1FWXA 4G71B 5CR8A 2CIIB 4LLMB 3WXVH 1CYGA 4FFYL 3V4UL 3SYPA 4P59H 1T0NB 1DN0B 4UV7H 5GGSY 1AFVL 1OV8A 3N1GC 2P8PA 1J5IA 1JZHA 4OLEA 5FUZH 1DVFD 4NNPH 1DQDH 4TTDD 5DZVA 1S7SB 2UVEA 2O61A 3DUUB 3MBEC 5E4EC 2OSYA 4DGIH 4ANVA 1NBZB 2XN9A 1HCYA 4NI3A 3UAAA 4IHBA 2GBVA 3O4LA 3RWFA 4NERA 2VN4A 4WY7H 3VXNB 4DWHA 2CBPA 3QIUC 4LEEA 1MJ8H 3LKQB 3PHOB 4C56B 5DS2A 4XNUL 2YD9A 1DBJL 1DO6A 5DZ9A 5J1AB 1A7QL 1P4LA 4LLUB 2FD6L 2X9WA 4BZ2L 1D7FA 5EU6A 5C0AB 5IKCB 1EK3A 5KVEE 1HN1A 2QSCL 5FPIA 5IT2H 3EO1A 1YY9C 5E2WH 4LOUD 3DMMA 1AGDA 2KI6A 2HZHA 4XBMA 1INEH 2VZUA 4JFDE 3ZHLA 5I0VA 3FRPG 3SBRA 4B50A 5KSBA 1MFDH 1JGDA 5EOTB 5JHDD 1KLFA 3VWJB 1Q9WB 5CLWA 1OO2A 2K7QA 3QDJD 3IMBA 1GHFL 3M1OA 4QWWD 3MUJA 5SX5H 3ZKMC 1F4HA 4BZ1H 1WDAA 4YSRA 2CDFA 1FBIH 2BPBA 3QULB 2ZZUT 4TLSA 4GI6A 4GSUA 5B7FA 3OQ3B 2BNUA 2JXMB 1XZ0B 1T89C 2GIYA 1X5LA 4P3CL 2XY1A 1ZT4B 1X9QA 4XC1H 5JXEA 2P3YA 2K78A 5HY9A 2D7OA 4Y4FD 3UO1L 4FXKA 4MJIB 1U8MB 2WINA 4NBXB 3SQOH 2IFFL 3GSQB 4ZUVB 5FLUA 4HIHB 1A7NH 1CGSL 3NJXA 3RDJA 3T5WA 4QPEA 3NP4A 4B3EA 1GA2A 3MGOB 1X5MA 3MYJB 5I1LA 4OLUH 2YBRB 1IM9B 2X53A 1OAZL 4JRFA 5KOMC 5J06A 3FO2B 4GG8B 5FYJU 1SHXA 3SGJC 4AW4A 1MHHA 4I2XA 4PJFE 4IOIA 3CVHA 1RZ7L 1O7SA 1F8TH 3WNJA 3VJ6A 1M57B 3ES6A 3TBCA 3I2CL 2QT6A 4D3CH 1Z9OA 2NNAB 1AQDB 2BP8B 1K4DA 1F6LL 2W0KA 5DUPL 5C0DA 5D1XD 3VI4A 4ALAH 1EFXA 1SBBA 2JLPA 2XWRA 2X4NB 4KK6C 3RUGB 1QWUA 3KR3L 5DJZB 4PJ9A 4BKTC 1DUZB 2W59A 4X5QA 4UTAA 1KFAH 1JPTL 2W9EL 4NBZB 4XXDA 4EE2A 1KNOA 5I8CA 2MH4A 2CR3A 4BUGA 2N7BA 4Y5YA 3JWDH 2VJ8A 3S3DB 1EDQA 3QZWB 3EGSB 5GRXG 1LK2B 3VXQA 1CUOA 2AKRA 4XXCA 1U41A 3RKPA 4TUKH 3A23A 5TF1L 5TGBB 1HQ4A 4KFZC 1JUFA 4G9FE 1ND0B 2Z91A 2FGWH 35C8H 3EBHA 4JFTA 1G9NC 4J39A 4W81A 4UU9A 3S2AA 1FNGA 4LU5H 5D9SA 3O81A 2YXMA 5DQDH 2Y5EA 1NGWA 1W72A 3WIIL 3QUKB 3BRDA 2DMGA 1LK3L 1A6VL 5CU5A 2XFXA 4ZXBA 3JBG7 4IK7A 1EHNA 1Z9SA 5TPWH 15C8H 2DEYX 2KT6A 3O8XA 3MRJB 2OTUA 4FS0A 3AFLA 2FJUB 2MKLC 4MA7H 2H47C 2OMYB 2J56A 1U8QA 3ZRFC 1F4YH 3CVDA 4K94C 4OLZH 2EINB 4QO1A 5EU6D 1XVSA 1G7HA 2JTYA 3GK8H 1PF3A 3LB6D 4EDXB 4XMVA 3VGHA 5L9DL 4KZCA 3KWVA 5DHMC 5CJ8A 3E6FB 4HUWB 3AY4A 4Q6IA 1JZ2A 1GGCL 3V2AR 5E8DL 1ICTA 5AB0A 1NUGA 4UTBA 4O2FA 1HH9B 2D7PA 5FGBA 4PTTA 2NYYC 4I3SH 3TBWB 1P7KA 4BBWA 2XV0A 1P7QA 2P5WE 4AWJC 4GRMA 1F02I 2MNWA 5AVVB 1MKFA 1M1XA 1RUPH 2TSBA 2WJ7A 5FHBL 3T3MF 1H8OA 1MRCL 1GAFL 4N5ED 1CT8A 1HHJB 1JK8A 1IFHL 1IAOA 2DWTA 3SDCB 1PY4A 3TO2A 2EILB 2DEWX 5DVPA 5G4NA 4QHKJ 1PPIA 3DX8B 4JRXA 5GZNC 1KB9J 4NN7C 4KVNL 3SYCA 2FZ3A 3QIBC 3EOBA 1R3HB 1YMMD 2C7UA 5DK2A 1I9EA 3ZR5A 4D0DA 1SPDA 4PJ8D 4R4NC 5D1ZB 5FDWB 4TNWF 3UH8A 5KS9A 3CC5B 4POUB 4ZUUB 2COQA 4U1KB 4MSWA 3COOA 1T3FA 3BVVA 3VXSD 4PRBA 4DHLA 1NMAH 1OSEA 5IB5B 1P5UB 3QNXA 1ZDQA 4RFOH 1UJ3A 3DLQR 1FVDB 1OY3B 3QUYC 2QTEA 3VW3H 1GW0A 2FUQA 2VLKA 2XIDA 3BOVA 3D87B 4CRPA 5LCVL 1V3LA 4HJUA 1ZEAL 5F7DB 3D33A 3G08B 1JBJA 4UBDC 5DLML 1QNZL 1HYRC 3HE7D 4JE4B 1PBYA 2HTKD 3P77A 2I32A 3E3QC 3U7WH 3U79A 5IBTH 2DEXX 2I07B 3A5VA 4J3BA 4Y16B 2H1LM 2L7JA 5E1QA 5EBMA 1Q0YL 4MDJA 4PJ9D 1ET7A 1BM3L 5E6SB 3L1GA 1Z5LB 2DWYA 2J8UA 4K8RL 3CFNA 3CIAA 1KCVH 3AXHA 3QZBA 2GJRA 4NO5A 4M5YL 2NY4C 3MBEA 4OCNC 3X12A 4Y88A 4HKZB 3BFWA 4MQTB 3VGDA 3CUPA 2DQDH 3VI3E 4QHLB 1UXSB 3QIUA 1TJGL 3Q9QA 1SM3H 2AI0L 2YMXH 4JG9A 1J48A 2FYYB 3FCUB 1TG8A 1VJSA 4PGCB 1DQVA 2FWUA 1KIRB 1M71B 2A6IA 4RMQA 3KDMB 1U6AL 4H5SA 3IDMB 4JFXA 5FO7A 4C57C 4LRIC 4XAKE 5LGKA 2J55A 2APFA 2Y7OA 4RWYL 1ZV9A 4HMCA 3II2A 2FIKB 3R0MA 1MI5E 1T1YB 1TYJA 4YC2B 2YPLD 1S5IL 2J1YA 1LM8V 1YEGL 1N9PA 2DYPB 3QEUA 3RVXC 2Q8BL 5IV2A 4R7NA 4Y1AA 1MAKA 4ACPA 1Q9KA 3ZMRA 1LP9B 2ITCB 5E03A 1RU9H 3RJDA 4J3UA 4ZFOB 5JQHC 3BUTA 1J5OL 1DVQA 1HWWA 5F7EH 5IFJA 4ADGA 1LWHA 5TDOB 3NJJA 3VXUA 3BUYB 5I6LA 4M4RB 5EEXA 2PWGA 4X6FB 2KPWA 2H0JA 4U05A 1KTRL 1NGPL 5D6DA 4H0HB 3AY2A 4G8AC 2X05A 2VITB 3KPLA 1SVZA 5GJTL 1PZCA 2GJ6E 3FF7A 3PWUB 3CLWA 2J6EL 3ARDA 4C58B 1A2YB 4QR7A 2OTWA 1VZIA 2BNRA 2ZCZA 4DEPC 4P5TB 4LO9A 4ZSOA 1IIIA 1M9WA 2Q7AA 3MXWH 4PW9A 4MCNA 2NQDA 2QPFA 3SGJA 3FRUA 1J8KA 3GS4A 2VN6A 4JEGB 3WIHH 2NUPA 1IC5H 1ZA6A 5FYLE 1CFBA 3V10A 4HIXH 2BVQA 1FFOB 4NFBA 4OCRL 3QS3A 4LPTA 3SPIA 5AW6B 2WBJC 2AABH 5IY5B 2OLDA 4FULA 3VFRA 3BDYH 5EC1A 2VSMB 5LAXA 2MPAH 4AL8H 1DQTA 4KH9A 1BXVA 4HK3J 5EU7C 4WJG3 1I1AD 3SCMD 2BY0A 2VLKD 3MREB 3AROA 1OE1A 4BGDA 1J05A 1PZAA 1G7JB 1MCPL 3T2PA 3WY1A 1QZ1A 3K2KA 3OAUL 1FJ1A 5TFSH 3GKWH 2OX5B 1LO0H 3IVKB 4FA8A 1KMGA 2YPKB 1JN6B 3IU4H 3L1OL 1SLUA 4J3WA 4AQOA 4BFIB 5BXFA 2Z93B 1D2OA 4H0GA 2XTJC 3EJZC 2RBLA 4BK5C 3UBXA 1VENA 3RILA 4J7RA 5IBLC 2EH7L 3EKCA 3FB5A 3VFGH 1LILA 1G7QA 3PRZA 4F7MA 2IAMB 3GSOB 4IIZA 3ROOA 5IESL 1E5BA 1OCCB 3QSKB 3C60D 5KG9A 1U21A 4B7IA 2NQ3A 4Y2OB 3UBGA 4XAWL 4L23A 1KB5L 3MC0A 3CSPA 4N20A 5TQ0L 4P04A 1TJMA 3EO0B 5J89A 5ACLA 3L2MA 2BSSB 5HHXL 3WKMH 3ZMEA 2CO7B 4NDMB 1G6RL 5FO2A 5JMRA 1P4BL 4FG0A 1QBML 1T1WB 2YAMA 5AALA 2I60L 4GAJH 5E2VH 5T5NG 1W6WA 1IGYB 3QUML 4EUPH 5GRJH 1L3NA 1XSKA 1CDGA 4JHWL 4HLJA 1Q9LA 4YXHL 3BHBB 5I8OL 4XNZC 4PIBA 3C5ZC 2HKAA 4YDJA 4Y1AD 2J8HA 3O2VL 5DXWA 3CWGA 1QFOA 2WW8A 1EZUA 1Z5YD 3GM0A 4KXDA 2MCMA 5EEWA 3CIQA 4B9ZA 3B8YA 4P9HC 3O6KL 4ZMPA 3HB3B 4RZCB 3BP4A 1MCEA 1QASA 4F57L 5DJXB 5DVLA 1QFWH 5GHWL 5T5NF 3NJGA 1XF1A 3QC5X 1M7IA 4YXKH 4KITB 5DVKA 4RAVB 4OUUB 4W9DC 3UC0L 1MCOH 3QIWC 5GZNA 1M2OA 2DM2A 3QRGL 2CO6A 2YHGA 3WG7B 5JHDE 4FL4B 3DXAB 2X9XA 2E7LC 3QDJE 4DETA 1M9SA 2AQNA 2XWBA 3T1FB 3TBTA 4LEOA 1FHGA 2A77H 4IU3A 1ILUA 3S98A 4ZAKD 3ZE2F 4A2HA 2B77A 3D12B 1JPST 4QIRA 2CJUL 3FQXA 5FS5A 4HLEA 4EI5C 3QUYA 5L7XH 2ZP8A 4U1IA 4Z0BH 1JK9B 2HWZH 4FABL 3FUEA 1HXKA 1D7DA 2BFGA 3TT3L 5LWYL 1MFAL 3X1NA 5JYMA 5IW1A 4HIIB 3DURB 5E94B 5CKGA 3S5LG 2QPEB 4YZFF 4DGWC 4RWHA 5EPMA 2XZZA 1OAYH 3UZEC 5DJDB 2NSXA 4KTGA 1IGTB 1DJXA 2W65B 2C1OA 3F12B 3IJSA 2R1WA 5ANHA 3WNLA 2XX0A 4YSQA 2GFBB 4U1HA 1CTNA 3BH8B 1J0ZA 3CC1A 4F3FA 1B4RA 2VABA 5GS0D 1I3RA 4JY4B 4JFZH 2MQ0A 4FKKA 5IF0A 4NYLB 5FDYA 5KVGE 3RY6C 4PJAE 3RZCD 3NA9H 3UO8B 1OOAA 3NJKA 4RMBA 2OR7A 5DMGD 1AZVA 2RD0A 1K5NA 2X09A 5IG7B 2XICA 5HGGS 4ZYKB 1F1DA 2NW2B 1E65A 5I75C 3SY6A 1HILB 3FTUA 5GGSB 4N2EA 1PU0A 2VDLB 2KLTA 5HBBA 3HG1A 3IGAB 3JSSA 1I8IA 4PGBA 3NVQA 3ZDYF 3EDFA 3K46A 5AVTB 3TCLA 4W9GC 1TTFA 2FWOA 1RIHH 4MLIA 1PQZB 1AIFB 2H2SD 1XH3A 3BZDA 2G75B 2XPZA 4X4XA 3QYMA 3ESUF 5CSBA 1TEYA 1BZ9A 4AVHA 1T21B 4DKFL 4JKPL 3W57A 2BVYA 5SWZB 4KI5F 1EUUA 1ZS8A 1ONQB 3MRQA 1KJ3L 2R0ZL 3LJ3A 1XXFC 3LN5B 4GAAA 4MNQD 2XZCH 5EIIB 5AZ2H 3HNSH 2XKNA 2IPKB 1ZT7A 4YWGH 5ABZA 2GSGB 5H37H 1WBXB 2FSEB 2QSVA 1ORQA 3UJJH 3VSUA 2KL6A 2VXUH 3MCYA 3F7VB 1CE1H 1JPSH 1K2DB 4FA6A 2QR0B 4MMYB 1DBKH 5EU6E 2XNAA 3L3KA 4DKEH 2BZ7A 3HI6L 1BJ1J 2KC0A 3EHBC 4GRWE 2D31B 5D6CA 1MFMA 3V0VA 1TF4A 2SODB 4KNQA 1DDHA 5IREA 1XF2B 4L18A 3RDTC 3P1VA 3ARBD 5DUJA 1ES0B 2D73A 4H25B 1J5HA 2MSPA 1JGIA 3P9WB 2A7BA 1LL1A 1M56B 1WVZA 2LABA 5ENWB 3ARGD 2DS4A 1EAOA 2CLRB 3CQFA 3TH3T 1DLHB 1G0YR 2E7DA 1DUYA 4IDJL 1CQYA 5AW5B 2H4EA 4LBAA 4W68A 5EO0A 3B37A 3GMLB 3OX8B 3S4SB 3D0AA 2ZKYA 2A6JA 2HX8A 5BQDA 5C09D 1SOSA 5C08A 2B14A 3VRLF 1LQSR 1QYGH 3FO1B 3WFEH 1JWSA 3H9HA 4BH8B 4MJ5A 3C2AL 4P4KD 3FSVA 4M7KL 5I1DA 1YMME 1BFVL 1H3GA 2CUAA 4QXTB 1BVKA 4KJWD 3SO5A 5JLZB 3QARA 4KBPA 4F58H 1NWOA 1UD2A 3VXSE 4BE6A 4ZUWA 1QSFD 4GSDL 2EE0A 3WFHA 2X44D 1KIUA 4JPKL 4Q6YA 4NZTH 1TETH 4KROD 5B1AB 1EZVX 4ZNCD 1CLVA 3T0WA 3O2DL 4LCWD 1U30A 4OQTL 2EDJA 4XPFH 3IJEA 3FTGA 2GEQA 1GMIA 4PJ7E 1IC7H 4WQOA 5T3ZD 4JNXA 3KXFB 4JAMB 1YQ2A 3WKYA 2QV4A 5CEXB 3GT6A 3HR6A 1PKOA 3HG1D 5HYSA 1DQML 4D0CB 5KSAA 5HDWA 3I50L 3KS0H 4A2MA 3MRRA 1PFOA 4NZUH 4XVUC 4NRXA 3WN6A 4GW4A 1MCBA 1S7XA 1FFPA 1L6PA 2YGVA 4LEXH 1UWEL 2V5SA 3ZVVA 5C86A 4NNYA 5DD6A 1GYVA 3UGXA 5T5FL 4Y19B 1DEEA 3KPMA 4MNGB 1FVCA 5J11C 4YAQA 1ZGLM 4Z95H 5FYJH 3CFBB 4RESB 5JIPA 3I74A 1RFDL 3HC3L 1SEBA 5A16B 4KQ3H 3QIWA 1SRDA 4U1GB 4HS3B 4GQQA 1OE3A 1NM4A 1KEMH 2YPLE 3BPLC 3JTTB 4QXGL 3IGLA 4Q9RL 1T4KB 3DRQA 2JCCE 2XQBL 3Q43A 2E7LA 5D2LA 2IBZY 3C09B 4NM4L 2GT9A 3L3HB 2XZQL 4WGWB 3VXMA 2OR9L 2Y6SC 3H3PH 1KJ2L 2YOCA 4HW6A 2CJSA 5JOPD 3TBYA 1AR1D 1HNFA 2WZ0A 4OLXL 1UKSA 3L3JB 4GLRH 4FQXA 1T0MB 4Z7NE 4POYA 4TULL 4KJPD 1HS6A 4Q8BA 4WU5B 3P3TA 1RD6A 3DHUA 1CICD 1EUTA 1QQDB 1TFHA 2BIIA 4W9HC 4BJLA 2FX8H 2IFGA 3FO0H 2CUHA 5CHNB 1IFRA 5E9DA 1BMWA 3PHSA 4HOZA 2G0KA 1ZRUA 4XOEA 1Y07A 1R0AL 1THCA 3TBSB 5E6IA 3O2WL 2J8OA 1KYAA 2FX7H 4N2HA 5CILL 5ILTH 1M05B 2DQIL 4OZHA 2AXWA 5F96L 1AQMA 3IS1X 4B41A 4JG0L 3SDXB 1L3WA 5HVHC 1KEGH 3RY6A 2CCWA 4ZFZB 1UYWL 3Q6GL 5EZIL 2WQWA 3W11D 3MLZL 1XB6A 3ESNA 1W6LA 4KRPB 3F58H 3ZDXB 2YN5A 1BX2A 4LL1A 4XPTH 3N44F 5J3HD 3D85A 2K9UA 3E38A 5D7JC 2HLAA 5DQ9B 2VLKE 2UXTA 3NJFA 4Q74A 1ITCA 1RI8A 2YPVA 3GXIA 1EXUB 4ZS7H 1OEZW 4LOEA 2QQLH 4HPOH 3VXTA 3CXDH 3MA9L 2UZYA 4GT7A 4PGEA 4YQXL 4Y2DC 3CV5A 2IWEA 2DLGA 3L6FB 4FXGC 3PP3K 4ODTH 4PJCA 5ISZB 4O58L 4FQ2L 4WTWA 4IBQA 1MCQA 5CU9A 5H2BA 2J8UE 1A6TB 4U6XB 5A3IC 4JJ5A 3S8FB 4G83A 1IGJB 1YN7B 2C9VA 2HRPL 3CHOA 5KSAD 2FT6A 4GP5B 4D0BB 3JWNE 2IV9A 3FRPB 3MPCA 3V5DA 3K2UH 4MDIB 4P2OB 2J7LA 2HJKA 1YEDB 4KKNA 1RPQA 1CBJA 3T65B 5T1LB 1AKJA 2O6PA 1QP1A 3FT1A 3GZQA 1RZ8B 4EQ3A 1MCWW 4UQ3A 2VRAA 3DBXA 4PJEA 2EYTB 2EYRB 4YHLH 2EEXA 4ZZFA 1J12A 1VCBC 4NJAH 1DZBA 5INDA 5F3BA 1HQRA 3OM3B 3H1ZA 1I3GL 3RDTA 5FA4A 1E2ZA 2E8ZA 3MLUH 3G04A 3FQ1A 1N64H 5B38G 4E41B 3EG9B 3ET9F 4Y1AE 2F7OA 4EMZA 4W4OC 4P5KB 3D4GA 3MUUA 1J9TA 3BI9X 4L4VA 2KH2B 4WRLA 4NFDA 5I8KH 3DX2A 2NY5H 3V6ZA 2HFFA 1CB4A 3FFOA 3VXUE 2WXPA 2AQSA 3QO1B 4PB9L 2B59A 5ITFA 5C0FB 5K9JH 3UTSB 2Y5QA 4WFGD 2PP9A 2DQUH 3ROLA 3GXTA 1IU1A 4F33A 3TS8A 5IW6A 3TZVB 3SDDC 4K9EL 3NN8A 1I8KA 3UZVA 5F6HI 3V6FB 4R2GD 2A3TA 1J9RA 5DYOA 4ZSOE 4AMXA 3RE0A 3DSFL 2VDQL 5A1AA 1A65A 2NUTB 5JIMA 3ZY7A 3QQ4B 3FPYA 3K71A 2MRYA 2HLFD 4H88L 1D7CA 1JE6A 3KWWB 1SOKA 4R9HA 3X14A 1KY7A 1D5IH 1J7VR 4GYBA 3D69A 4XN1A 4A68A 3VG9C 1OK8A 2HUHA 4M1CD 3UROR 1QA9A 3UJTL 2F53D 2VR4A 3UYRH 12E8L 1CFSB 5ESAB 3VRJA 4B9GA 3ZOAA 4Z7OE 4HT1H 4NLHA 4UOQA 3C2SA 4J6IA 4LHUA 1LO4H 3MV9D 4WDIB 1TKWA 3AQZA 3I75A 2ZUSA 2VR9A 5GGQL 3TIEB 2VWEC 5HPMA 2Z0BA 2V37A 3PJSA 3T3MB 1JGLH 1E67A 3V4VL 2XPGB 1SJEA 3NTCL 4I0KA 4ODBD 3EYOA 4Z5RA 2YD0A 1NCCH 1PW3A 4W6YB 3LNGA 1U3NA 3EH4B 3FT9A 3FFDA 3M7FB 2LTQB 1FH5H 1NIBA 4MQ7A 5EB9A 1OWWA 4AVKA 4Q9QL 2X38A 4LSPL 1BA9A 3VQLA 1BGXH 2GTWB 3HPLB 3VX1A 5BV7L 3MO1B 5KVEL 4XN9A 1KLUB 4O9HL 25C8L 4IRSB 4BQ9A 3MJ6A 4KO5A 1GYWA 4Z3EA 1NAMA 3KMDA 4KK8C 4AYFB 1H8LA 2MCPH 4QY8A 2WXNA 2Z3FA 4G6KL 1KTKE 3HBZA 4MFHA 2UUDK 4MNQE 4A7UA 4OIBA 2X4TB 3P4LA 3RX7A 1BIIA 4XP1H 2IALB 4H26B 3HAEG 2G3ZA 1WUNT 4RMTA 4U1JB 1ZANL 3NJIA 2NXZD 1OF0A 4QJ4B 1FVEB 4BV1A 1S7UB 3HMXL 1DVSA 2DY2A 4G82A 2AJ3B 1GMEA 2V2TA 2XACC 3WCYA 4PJXB 4M7LL 2G60H 1RJLA 3PDOB 4LOUC 4W70A 4LVNC 1PDKA 4MQXC 4A55A 1SYSB 4NO0D 4U7MA 5J13C 3PWJA 5I6XC 5KYNA 1FZJB 2DMCA 1I7UA 1CD1A 2Z8WC 4PP2B 5E24E 4NQCB 2YR3A 3G6JF 3U7AA 4FAAB 3T8VA 5D72H 5AFAA 2JB5L 3BPNB 1U4FA 1WTLA 4HZLB 4O4YL 1PNDA 1U95A 3MV7D 3QS2A 2IG2L 4YXLH 2A9MH 4AGQA 3RGVB 1AO7A 4TF4A 4BSVA 1JZ3A 3OKOB 3NEEA 1VZGA 4AKOA 2H2PD 3CH1B 4Y4FC 1WCBB 1N0LA 1I9IL 6PCYA 4XZUA 5CZVL 2CO3A 5C09E 3IFLH 2VRQA 5DD1H 4J3SA 3VXRD 5DRZB 4GUQA 5I1HL 4WI0A 1ZTMA 2X70A 1R19A 4J4PD 3T9WA 4RGMC 4L1BA 4ZNEA 4Y2DA 3BEVA 3IXAA 3S34H 3KGTA 4OLYL 5CP7B 3S9DB 4FXGA 4HCRH 1IM3A 3EYFA 2I27N 2E27L 5IHHA 4AM0A 1YG9A 3GB7A 3VFPB 4HJGA 4UIMB 2JIXB 1QSFE 1FCCA 3GMOB 2E0PA 2EIBA 2ZOLB 3GSNL 2DB8A 4TUJA 1FNEA 3X3FL 1HKLL 1YEKH 5IOPA 4KX7A 2AEPL 5D1XC 4LCWE 4DN3L 1QUNA 5CLZA 2JKNA 3HRZB 4FG6C 3MACH 4P2QA 3CHQA 4GBXC 3R19A 4CUCA 5T3ZE 4JREC 2P8PB 1TCRA 3H8NA 4K71B 3FQTA 4EIGB 2YGOA 3MLWL 4MA1B 3HG1E 2O61B 1AY1L 2XN9B 1KPVB 3NAAH 3GI9L 1JP5A 4HBCL 5CIPH 3IDXL 3O4LB 3SD2A 4DGYH 5BNXD 3IMTA 3BSGA 2BOBA 3QO0B 5IB4B 3VQMA 4GKZA 1VGKA 1KB9K 3OKNA 4HKXA 4JO2L 3GO1H 3NRFA 4XVJL 2DIBA 1SVBA 1HHKA 2XIBA 2NY0D 3WE6B 1P4LB 4WFHD 3WDIA 1VACA 5BUAA 4W4OA 5IM7A 3IPFA 1CD8A 4F9PC 2IXQB 5GRYA 3KLKA 5BVPH 3PS6A 2BOCA 4N85A 4GO8A 2E4FA 2WKLA 1HL5A 1Y7VA 3UCQA 3DMMB 4YMPA 1O6TA 1AGDB 2UY6A 3GZOA 3WUWG 5KSBB 4L8DB 1BZEA 1JGDB 3MRIA 3CSYA 4R7DA 2HJFB 1KLFB 5DTFA 3SDDA 1N12A 1TQUA 4TPRL 2VLMD 3ETSA 2DJ4A 5HI4C 3NJMA 1WJ3A 3N06B 4S1QL 5JOPE 3MFFA 5JW4N 3EH1A 1KULA 4F7TA 3PAYA 3G5XA 2BNUB 3NYKA 2EDQA 5IGXL 3BPCA 1TU2A 1QLEH 4XI5C 5AZUA 4DCQA 3D6GA 4Q58C 5HY9B 4LF3A 4NKIH 2QGCA 1HWGB 4FXKB 4Z7WA 1CR9L 5ALCH 4G7YL 2WINB 3OC8A 3Q8FA 5E6UB 3L4ZA 5LBSA 4M5ZL 5ID0B 4WUUB 4N9GB 1F58H 4K3DH 4W9LC 2XCMC 3GJFA 2X2UA 5I1LB 3LN9A 5I16A 2D7QA 2IDCA 1GL4B 4ZD3L 1MH5A 5IVZB 1TZHA 2K9FB 1AACA 2R7EA 3K4AA 1RUQL 2F54D 2IWKA 1F13A 2QGBA 3UJIL 3V6OA 3FU9A 1MHHB 2L8AA 4I2XB 1WPCA 4IOIB 4JO1H 5DUML 1ZLWK 3CVHB 4KI1A 3L4TA 2FQDA 3IJ8A 3VJ6B 3ES6B 3OAYK 1W8NA 1UTDA 1K4DB 4K3JH 3KLQA 1JOIA 3BAXA 3VI4B 1EFXB 2EE3A 3NGBC 3T3PE 3B7YA 4CGUB 3ZE0E 4HCFA 3QJXA 5MERA 4BELD 4X4KA 1EO7A 1J9CT 3Q8EA 1H3WM 2Z7YA 2VW4A 4XXDB 1KNOB 5I8CB 3UTTD 4ONHA 1W8OA 2K3TA 4FFYH 4HUVB 1ZY9A 3V4UH 1DJGA 3VTMA 4EZMA 5CP3A 2Z31D 1ZHNA 2X1WL 3NZSA 3M07A 3LQAC 4EVNB 1AFVH 2AK1L 2AKRB 2ESVA 3LZFL 2HVJA 3E2HB 1C8PA 1ADQL 1W9XA 4FLRA 5EIVA 3OLIA 2HG0A 1FNGB 4HLZG 1B90A 3BAEL 5D9SB 3PJNA 1N5AB 2R69L 4PJFF 2E9GA 5DWUL 2XN1A 3OKLA 3WNKA 5M95B 1U8IA 4TXVB 4HH9B 4XNUH 1DBJH 4ZXBB 3N3EA 1A7QH 1NCHA 4AZUA 1JPFA 2XBDA 3O8XB 4BZ2H 1DHKA 4MAYD 3T6XA 3B9KD 2OTUB 2DOCA 4JFFD 4UOZA 1JXJA 2DQMA 2N4IA 4E0RB 2QSCH 4HA1A 2BIOA 3H0TA 4R97C 1G7HB 1NDGB 2VDPL 1I9RL 3MRKA 3OG6B 3QORD 5IJDC 3FT2B 4Z7QB 2AGJL 2A4CA 2ICEB 3QWOA 2WQSA 2Y5TA 1ZGLB 1DJZA 3K0YA 2NY1B 4O2FB 1GHFH 1UFUA 5DO2D 1P7KB 3R4RA 2BERA 5JW4R 1P7QB 2G2RB 5CINL 5ERWA 1DJSA 5CN1A 2YD1A 4GRMB 3V6BR 3GRWL 2R2CA 1M1XB 3IWVA 1D6VL 4GS7B 4P3CH 4CVXB 1J5DA 3V7AE 1KV7A 1K9TA 2CKBA 5BZXA 2ISDA 3KYMB 2NY3C 5EHFA 3UO1H 4BFKA 1M7XA 3DV4A 4IJTA 5FYLL 2IFFH 4R7LA 2H5UA 4BSJA 4JRXB 5EOQL 4GP8B 4WFGE 2QFRA 3FSZA 4Z7UA 43CAB 3U6XS 1CGSH 2FZ3B 4APQA 1EBPA 3B9EA 4DO6A 4D0DB 2IQ9L 3AGVA 1OAZH 3GLZA 3WIAA 4CGTA 4ENED 3OHXA 3VNZA 2Y69B 4PRBB 1S8DA 1S9YB 2CG9X 1RZ7H 2VMEA 3OXSA 3QNXB 4FI8A 1UJ3B 2O30A 4OZHE 2F15A 3I2CH 4ZQTA 2NSQA 3B5TA 1WCQA 1RPKA 4PJBE 1CO1A 5DUPH 4P0DA 5B8CB 4AQ1C 5E95B 3KR3H 3P77B 4NZRH 4PCSA 4PV9B 5T1KA 3ZYIA 4IOFD 1YCSA 1JPTH 2W9EH 3DARA 2FE0A 1G4MA 1YEJL 4OCYL 5C6WH 2FNBA 4G8GD 5EBMB 5GGTA 1I1AC 3ASWA 4GBXA 4QMEA 1HH6A 4LDOB 1BOYA 2VH5L 2QELA 5E6RB 2F53E 3U9WA 4L8CA 3NG5A 2BHUA 3APCA 3MBEB 1IEAA 5E4EB 3ECVA 5TF1H 2ZWNA 1ZVNA 3R7RA 4N2FA 3MGTA 4BQ8A 4OKVA 3WN5C 2F7PA 3QIUB 4ZUTB 2X12A 2MJWA 2MIZA 5ANMA 2ZAIA 3MNZB 2EICA 4JM2D 4PJCE 3WIIH 4FEMA 1NJ9A 1GXEA 1LK3H 1A6VH 3D3VA 2GAZA 5FXCH 4H5SB 4F9PA 2WCPA 3ZZ1A 4JFXB 5FO7B 4TNWK 4XNQA 3ZUNC 4HWBA 4K73A 5PCYA 5IMMB 3WV0A 5H8DA 1PLGL 3WLWC 2BFVL 3PAZA 3IS0X 3ZDZB 3B34A 1VF5C 2GCYA 2WVUA 5ACZB 3GMNB 2HT3C 2EDYA 4PS3A 2PTVA 3QEUB 4CNIA 5L9DH 1HJCA 5I1CL 5IV2B 4R7NB 3K1KC 3K6FA 5ABDE 3VGBA 1DSWA 1EGJL 1SGKA 1GGCH 5E8DH 3MDJA 1A3ZA 5DHYA 1XF4B 3FTZA 3VI3F 2AJSL 4Y4HB 5E4AA 1D5XA 1I75A 3G5YA 4ZRGA 3LXCA 4XNMA 3T0ED 1UXLA 3L8QA 1H0DA 3N55A 1B4TA 1BWWA 3O6FC 5DHDA 1TPXC 4QGTA 4NIKB 5FHBH 1XGRB 1MRCH 5HHMD 1GAFH 5CSZA 1R24A 2DTSA 1A6AA 3AM8C 3KBPA 4IRJA 1P6FA 4N0CC 1GOGA 1PEZA 2BNRB 3TVMA 3MZTA 2Q20A 2VR8A 5FM4A 4A2LA 4JFPA 5BCAA 4KVNH 3LH8A 3ABLB 1CF8L 1UXWB 4APQD 2AAAA 1D5MB 4PAZA 2P5EA 2P8MA 3M6DA 4PRHB 5CEZD 4HJ0D 3G5ZB 2Z7WA 2KZWA 4OF7A 4UWQB 1EH9A 2XT1B 3VFRB 4F2MA 2BMKA 3MV7E 2OPCA 1RH8A 2X9ZA 5LAXB 2XG4B 4RLDA 4CDHA 2DL2A 5LCVH 1ZEAH 4IKIA 1JTPA 1B4LA 5DLMH 1QNZH 2JB6A 3BQUC 3GIVA 3P54A 3U36B 3AG1B 1H3VA 3L4VA 2EDHA 2XKSA 3ARVA 1GGYA 1M7UA 3ILEA 2CM6A 4NQDD 1DCEA 3C5XA 3VXRE 2MQGA 5C6TL 1Q0YH 1BJ8A 1MREL 2D0GA 1BM3H 4G5ZL 4LCCC 2OKMA 3UIZA 4K8RH 4WI2A 3KAAA 1R5VB 2IO5A 2Y1ZA 4M5YH 3VFTA 4WO4C 3A3YB 2G2NA 2XYBA 3Q3GA 4F7MB 3SBQA 2A83B 1TJGH 3ROOB 3QCTL 5DMIL 3M17A 5KG9B 1BHGA 1KCUH 2IOMA 5BS0A 4OZIE 3T1WA 3ZIMA 3KLLA 4L3AA 1TTBA 1U8NB 2P45B 5ABAA 4GFXA 1U6AH 4B9JA 4M6ML 2BRRL 3KDPB 4ZO7A 4EJ1C 4PG2C 3MJ9A 1DQQB 4DPRA 4JN1H 4RWYH 4KKBC 5SX4I 2RMNA 3OB0H 3L3DA