4AG4H

Crystal structure of a ddr1-fab complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
215
structure length
209
Chain Sequence
QVQLQESGAELVRPGASVKLSCKASGYTFSISWINWVKQRPGQGLEWIGNIYPSGGYTNYNQKFKDKATLTVDKSSNTAYIQLSSPTSEDSAVYYCTRGYGHLDYWGQGTTLTVSAAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYSLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/transferase
molecule keywords EPITHELIAL DISCOIDIN DOMAIN-CONTAINING RECEPTOR 1
publication title Structure of the Discoidin Domain Receptor 1 Extracellular Region Bound to an Inhibitory Fab Fragment Reveals Features Important for Signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 209
sequence length 215
ec nomenclature
pdb deposition date 2012-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ag4H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ag4H02
2IC2A 3OR6A 1I3GL 1NC4B 1T04B 5L2KE 5C0ND 1I7TA 2ZG3A 3AREA 35C8L 4KJPC 2OR9L 1OAUH 4R26H 5ADOH 2ATKA 3WFEH 3TYFB 4NUGH 5E95B 4TOYH 5HHQB 4K7PL 4S1SH 1PSKH 4QRQB 1K9TA 2W59A 1VGKB 2BXZA 3MV8E 4JZOA 4YFEA 1A9BB 4OQTL 2AGJH 2PXYA 3MYZA 4O51A 2YR3A 4F3FA 1E4JA 4GW4A 2ICWA 5CEXA 1PVHA 4PJIA 2OSLA 1J87A 3C5ZC 1A6ZB 1W2KT 5EPMA 5KSUA 5D2NB 5GS0C 3MBXH 4F80A 4HIIA 3DX7B 2VE6A 3M1BA 4BK5A 3ZT5A 2NNAB 4JE4B 1MRFH 1H3WM 1N6VA 1NBVH 2BSSB 4FFZL 5DRNB 1DL7H 1WV7T 1NFDF 5A3ID 2BDNL 4L3EE 1F4HA 4LGRB 3V4PL 1JK8A 3DRTA 3MXWH 5JQ6H 4MA8L 3HMXL 4F2MA 4LHUG 2WQ8A 5HYQA 5E00A 1A7RH 3QQ3B 4FXGB 5E7FA 2F53E 2CKNA 5EU6E 5IKCB 5E8DH 4FQQA 1NEZG 1FO0B 4Q58C 1GAFL 4M9PA 4FN0A 5IB1B 3VCLA 1JTTA 3N85L 15C8L 1DQLH 3QDGA 5JOPD 3PGDB 4LLMB 4R90H 3ARDC 5DQJA 1TVBA 4YHZH 4WO4B 4KKCC 2HWZL 3EYUL 2ORBH 2QTEA 5FYJD 3KLAA 2HJLB 3REWA 2DL2A 1UM5H 2FGWL 4WWKC 2NY7H 5FYKD 1UCBL 2HJKA 1GOHA 1CL7I 4M1CC 2FX9H 1JPTL 2Y72A 4FOMA 4BQ8A 3IXTA 4H88H 4QGYA 1YNTB 5D70L 1P7QD 5EUOF 2D4DA 2VLJD 4JM4H 4Y5VC 4HPYH 4XBPA 1AHWC 3S3JA 3C60C 4NNYA 5A2JH 5IR1B 5I75C 3GI9H 3H7BB 3HMXA 2DLHA 3ARPA 4JY5H 2C1OA 1ZWIB 4YFDB 3EYVB 4HH9B 5J89A 3VG0L 2IH3A 1MI5B 3MFGB 4Y1AD 1AKJA 3I6KA 1BX2B 3VXPA 5I74B 5LGHL 1QFWM 2EICA 4TSBL 4Z8FH 4MJ5A 4WUUD 3ARFC 1MFDH 5D7SL 2CKBL 2Z8RA 3BKJL 4GQPH 1I9RH 4OGYH 3T0WA 3GSNL 3CFBA 3GSVB 4ZFGH 2DWEB 5AYQA 4OI8A 4U1KB 4E5XA 1VADB 3NA4A 1D6EA 1NDMB 5E8PB 1MCWM 4WHDA 4YEFA 1I4FB 1YYLH 3HNSH 5KSBE 1LVEA 3H3PH 1DLHB 2MKWA 2IJ0C 5T3XH 5IG7A 2DRUA 2PYED 4KKBC 4ZO8A 5C0DA 4QY8A 5HHNB 2UYLB 4HIEB 5SWZA 5ESAA 1UVQB 4PJGB 3U30C 2K7QA 3IDMA 1YMMB 4DFHA 2BOCA 3EJYD 5CEYA 1BM3L 2A6KA 3EYOA 2X4OB 4ZAKA 3SPVA 1V3LA 1S7VA 2ERJC 4Y2DB 5HI4D 4PTUA 3ARGC 1QKZH 4K94H 4LVHB 5D7JB 1KCSL 4LSQH 4S0TD 5K9QG 4L8SB 4JFQA 1SJHA 3CFEA 3NIGE 3QULB 4YHYC 1EO8L 4NM8H 3EYQC 4HX1A 4Y4KC 4P59H 1U93B 1JJUA 4H1LB 1UJ3A 1WWAX 4PRHE 4YBQC 1U92A 1JNLL 1F90L 1LGVA 2ZUXA 4PRNB 5FYLE 5T5FH 3SDAA 2EDOA 5EBLB 2AV1A 3DHMA 4QTIH 3QEQD 3GEWB 5ANMA 3BZFB 4HBCH 5ACLA 4G3YH 4MXQD 3QCVH 3KYKL 5E03A 3QHTC 4J3UA 4W4NA 4XPTL 2UY6A 3D9AH 3O2WL 2HAZA 3P0YL 4JY4B 1NGQL 3D2UA 3WNMA 3EOBB 4JQVC 4PR5A 1UENA 4K3EH 3T2PA 4NUJB 1F3DJ 4OLVH 3DETD 1W72L 3LQZB 3SE9H 4ALAH 1HQ4A 3FO1A 4NCC2 3O3BA 3MO1A 4XVTH 4XP4H 5DD0L 1FYTE 1NFDA 3AS0A 1D5ZA 1MWAL 1SM3H 2DI7A 2ZUQB 3P73B 4HK0B 4UDTB 5L7XH 3WHE0 4GKSA 2Y06L 3GMMB 4BFIB 4LF3A 1EMTL 3V5DB 4NHCL 3VW3H 3LKOA 3CUPA 2BNQB 5I18L 3VXRA 4LARH 4PTTA 1CDUA 2F54D 1KEML 3MACH 3QI9A 1OARH 4BFGA 1TENA 2VB5A 5F7DA 2CRZA 2VIRB 2OTWB 1MCSA 3MLWH 1FVDB 4YHNB 2MWCA 4PPTA 3LMJH 2UUDH 2APVA 4P5TB 5J6GA 4WI4A 1KOAA 5TH2B 4FFYL 3W5NA 2VL5A 3QB7C 2WP3O 4PJCB 4QXGL 1BD2B 3DOSA 5DO2C 1IQDB 4KV5F 5DJYA 3LVEA 1CE6B 4OJFH 4PRDA 1WIUA 1FRGL 2DQIH 3QUYA 3NN8A 4JN2B 5D6CA 5SWSA 4XPAH 5JZ7D 1DN2A 3FT2A 1CQKA 4XB8A 2WUCH 1NL0H 3O8XC 4GRWH 5EUOA 2XIDA 2LVCA 1LEGB 5HBBA 3HHRB 5J4MA 4A6YB 4KKAC 5BS0A 5J6HB 5IB3A 4U1IB 3SE4C 3LD8C 4YBHA 5FHAL 5F7YC 1YEIL 3HAEH 4RAHA 5IHUL 4OCSL 1R0AH 2CXGA 3G5VA 3VXUD 3BXNA 2X42A 4YH6A 3HFML 1NCAH 2GJ6B 1JI1A 4KHTH 1H3GA 4Y8DC 1MJJA 3ARWA 3MGOB 5F9AC 3DUSA 1ORQB 1NCTA 1BQLL 3JUYA 4LCIL 3CFDA 3WJLA 1JGVL 5GGVH 2VAAA 4L5FL 4KU1A 1EZVY 1NAKH 3RDTD 1AD0B 1MCHA 4HGWA 5E2VL 2OP4L 3T3PE 4BFEA 3AM8A 4P2OC 4OIIL 4ODSH 2CIKB 2AV7A 3MRNB 2DD8L 1X7QA 2PYFB 3KJ6H 4EIGB 2WBKA 1TZHB 4HXBH 1S3KL 3ZDXF 4C57C 5MERB 3GMPB 1NLBL 5E6ID 4QTHB 5ACMA 3SKOB 3NFNA 4X8JB 1RAMA 1TCRA 1TXKA 4UOW0 3BISA 2VDLH 3H9YA 3ULVH 1RK0B 1ZTXH 1RZGB 1JPGB 1JNHB 5E8EA 4C56A 4YDIL 2FJHB 5D1ZB 4HK3J 1ZHKA 5CGMA 3RKDD 2FO4A 2NY2C 3MLYH 1R24A 4L3AA 5AWNH 5HVFB 2YD2A 5IMOB 1C12A 2W92A 3CFJA 5TDNA 3DUHA 2VZ1A 3UPRA 1P4LA 2Q8AH 4XPHH 2IANB 2R9HD 3BESR 3MOBL 3RWCB 4QNPE 1G7PA 3OGCA 1I9IH 1S7UB 4U6HB 3DO7A 1F4WL 1KIRA 3QJHB 4RWYL 5INCA 1P4IL 2NY1D 3K8KA 1A6AB 1LO2L 1CIDA 3E8UH 2YA1A 4LDEB 5IROC 3SQOH 2B1AL 5C0GB 3L6FA 4G6KH 3MRMB 4LLYA 4KH2A 4TVPD 3DSFL 4WVRA 3FTGA 1Q72H 5DJ2B 5C92A 3DXAE 2QQNL 1D9KD 5FYJL 4MQSB 5BV7B 5L2KD 1EFXD 2B2XH 1JGUH 5KVFH 3CLFH 3QWOB 3T1FB 5FYKL 4WRLA 3WUWA 4CMMA 1R5IA 4PJEE 4LSUL 3I6LD 1JF1A 3RA7L 4TSCH 3ARBA 1NGWA 1P84K 4JFHE 4LSRL 4PJXE 4QRPB 1N5YL 5BZWB 1G7JA 3S7GA 1YEEL 1P4BH 3U0WL 3BH9B 3MV8D 5DMGC 1Y0LB 5HJ3B 3HC4L 3V4VH 5GGSB 3GHBH 5DD3H 3EOAB 2V2XA 3O3EA 4FP8L 4MJ6B 5C2BH 1FNEB 4P2RE 3LEVL 3QRGL 3QUZD 1ERNA 4U1GC 2JCCB 4PRBA 1YJDC 4N0CD 3PHQB 4AEHL 2IBGA 4FFVC 1T4KA 4ONFL 1A02N 4LAQL 1ZLSL 4NKOB 1FCCA 4ZUSA 1I1AB 2EDXA 2R1YB 5JXEC 3TESA 3LHPL 3CZJA 1MNUH 4L3ED 3RZCC 1A0QL 4Q6IB 4TULL 5C6TH 4ZYKA 1URLA 4X6CF 5MENE 3PGCA 4OZFB 5A16B 2H9GA 3D48R 5EU6D 4I9WD 1P7QA 5TE7L 3VWJD 1LK3H 3MODL 4M4PA 2VLJA 5F7EL 4ZXBB 1FV1A 3O81A 4JRXD 1UKSA 2G75B 1YN7A 2CSPA 5GRUH 1ZS8A 2VSCA 3ULUH 1F3JB 3G5ZB 1FC2D 3KYOB 2C1PB 3ZTJG 1MCCA 4RGNE 4UQ2A 4ERSH 2GHWB 2GT9B 2VUOA 1VERA 3NCYP 4MSWB 4YDVB 3FOLA 4X0KB 2AI0H 4FZEL 4TNVK 4I0CC 1PZUB 1BZQK 2I07A 4XBGA 4Y1AA 2AK4B 2ZUUA 1V05A 3FQRA 1FGNH 4WUUA 4MWFA 1IGML 4F7CB 1L0YA 1Q9KB 5CZXC 2J4WH 1XGTA 5C0IA 4BZ2L 4UT7L 1HEZA 2P5WD 2IAMD 2PW2B 3CVHB 3IJYA 3FN0L 4DCQB 2G2RB 1KXQE 2Y7QB 43CAB 5FGBC 2BJML 2EYRB 2VXUL 1Z5LA 3KPSD 3L3OA 4M1GL 1JHTB 3RWDA 1JYWA 4LVEA 1LP9B 1U95A 2PYEA 4NSKA 1AE6L 4WFED 2WWKO 3W9DA 1WCBB 1AO7E 2PTTB 3D18B 1I1FB 3JTTB 3RI5K 3HR5B 4MCYA 5F1SA 1FNHA 1MCPL 3CXDH 4WFHD 1GL4B 2MCPH 1HHIB 2HTLC 3OMZA 4WCYL 3C2SA 1F13A 3QDME 4GJTB 1CLZH 2RCSH 2ZSWA 3HUJB 1ZT1B 1RZ8B 4I18C 5LKNA 4OM0L 5TPWL 2NY5C 5D5MB 3VDCA 2ZCLL 1B6DA 3HZKB 3LKSB 3L3DB 2X40A 3LZFL 4LSVL 3T0EB 4MB3A 1P2CB 2V9QA 1FO0H 2NZIA 2FEEI 1M7XA 5CP7B 1WICA 2FJGB 5DYOB 3BW9A 1IC5L 4PJDE 1QSFB 4NT6A 5KANG 1D5BA 3U36B 1KPVA 4LCCC 5KVEL 2F58H 2P5EB 1A7QH 3FB6B 1RZKH 2J88L 5GRVL 3QQ4A 2VH5H 4N0YL 2HFFB 1WLHA 3D0VB 3QEQA 2UV3A 4KK9C 1RFDL 2SEBB 4FQIH 4NBXB 5FKAB 4I3SL 5DEZA 4TUOB 4ELME 5EOCJ 5ITBH 2KKQA 3U4EB 5IEKB 3P9LA 2AEQL 1YMHA 4CL7A 7FABH 2AJZB 1JRHH 2VXVH 2Q6WA 3ZKXC 4NRYA 4PRHD 2AABH 4Z77B 1S7SA 2XICA 1BBDL 4JO2L 2BC4A 1XGUA 5F44A 5FYLD 4FQCL 4G8FB 3BP5B 1A6VL 2GK0A 4HF5L 1HDMB 1H5BB 2XQBH 3MROA 3U1SH 4PY8I 1MAKA 3IU3A 2GSIB 4WEBH 4Y16C 3RWJB 1UXWA 5JW4M 1S9XB 1YDPA 5DMJB 3GSQA 1HHGA 3IU4L 1AFVH 4MD5A 2NY4C 1MY5A 1CTOA 2F54A 4KRPC 3O2DL 2XRAH 2V7HB 2Q8BH 1BBJB 1WEJH 1Q9WA 2HT3C 3HC0B 3X14A 1O7VA 3S37L 4NKDA 1U8IA 2GUOA 5F3BA 3RHWK 2RQ8A 3RX5A 1CL7L 4PD4J 1G9MC 1N2RA 1YJDL 4NYLB 3V6BR 1DR9A 4JKLA 4KKLC 3K80A 1RUQL 5I30L 1NCBH 5JUEL 3O9WC 4PRIB 1RIVH 4MB4A 1EGJA 3NAAH 2VZUA 3LKQB 4NWUL 1CGUA 4HC1L 4X6CA 5HI5C 2DJ4A 1T03H 3X17A 3T8XB 3MGAA 5ITFA 4JG1L 3OJDA 4MAYB 3QHFL 1R3IH 5GGQL 3RIFK 2IBZX 4Q9QH 5FUOL 5T1DL 1QOKA 4QOKD 1G9NH 4X7SL 3UTQB 1AP2B 3AU1A 3OB0K 5EOTA 4HUNB 4LLVA 2NXZD 2P44B 3UBXG 3IETB 2HFEA 3MBED 3VXUA 3KLHC 1HYRC 3LIZH 5I1AB 1C5CH 3MLPA 4X5WA 3O2DA 4MZ2A 3FQXB 5CGYD 4CU8A 3STBA 5TQ0L 3KG5A 4H1LH 1EAPA 5LCVH 2J12B 3DURB 2R56H 2ZOLA 1EEUA 2O5XH 3MFFB 2XPGB 1YY8A 2JJSA 1JF6A 3QPQD 1LD9B 4YIQA 3RDTA 1FSKC 2J2ZA 4ONGL 3MCKB 1CDJA 3QNZA 3PHOB 5C0CE 3TZVB 1I85C 2AJUH 3EIFA 4UOJA 4P0DA 1VKXA 3MRGB 2ZP0T 1JV5A 2CDEA 4KMQA 4Q7DA 3RP1A 4J3XA 1IC4H 1RZJC 3LKRA 3E3QE 3L9RA 1JWSB 3S5LB 2WBWB 1CD1A 1J10A 3KS0H 2DQEL 3BKYL 1MCKA 4FQXB 5E6IA 2AQ2A 1A1NA 5T3ZH 3QIWB 4XCCL 2XQYK 5IBLC 4HJJL 3NFPB 4M43H 5GSVB 2CMRL 1INDH 4QXWA 3WDIA 4HUUA 1K3IA 3STZA 4LU5L 1AGEB 3B9KB 3NIFF 1BQSA 1CU4L 3FRUA 3GKZA 5D2LB 3KPRD 4OLUH 2KPNA 4HMEA 1PQZA 4R2GD 2ESVB 3FFCE 3OAYH 4QXTA 4AQOA 5KSBF 1VGEL 1HNFA 1CDGA 5ESVB 4IRJB 3DI2B 1AY1H 2ITCA 3CDFA 1N5AB 4ZNEA 3RBGA 3CPLA 1JGDB 1J1PL 1BQHB 4FQJL 2JK5A 1U8KA 2NY6D 4AEEA 2E9IA 4X9BA 1TNNA 2XZQH 4KGLA 2FIKB 5GJTH 3QNYB 1YQVL 4B5EA 4PRPD 1KUMA 2YPLB 2CK0H 5H37G 5IBUG 1OM3H 2A9ML 2DTSA 5IOPB 1R3HB 3KPOB 4X4XA 1ZLWH 5I1KL 4Q6YA 4PJ9D 1J8HE 4XWGL 1AGDA 4CADA 1D9KA 3NIGF 3WFCL 1I7ZA 5L2KA 1IAKB 1EFXA 2VDRL 4MD0B 4JFOA 5D8JH 1EPFA 1FGVH 3NZHL 1XIWD 4K9EL 2OR8A 4ONHA 1YZZA 1UB5A 4HKXA 1DBBL 1LDSA 4A6YH 5DUML 3MTRA 2MPAH 5ID0A 1BREA 2LTQC 2A73B 1LMKA 4M3JA 1HHJB 3WIFB 2JB6B 3NABH 4CNIB 4RFOH 3Q2CA 3DUUA 5BJTA 4K7FA 3QNXA 2HN7B 3MV8A 3MCG1 2GTZB 3TIEB 1JFQL 5BXFA 3LV3A 3I6GB 2CPCA 1WGOA 2KDGA 2O61B 1LNUA 3TO4D 1A9EA 3SJVB 3FT3B 3VFNB 3QUZA 1MQKH 1OWWA 2HT2C 3HNVH 2R69H 5E2UL 3IJSB 2YOCA 5I66B 3TN0C 1M6OB 4BKLA 1OAZL 1AR1C 5DLML 4JVPA 5HDLA 2NLJA 3EFFA 2DYPB 4M6NH 4JB9L 3P11L 4JFHD 2YA2A 5D6DC 2C3XA 4PJHE 5CP3A 1L7IL 3L5IA 2VZ3A 4YQXH 2DLGA 3BRGC 3ZE2E 3PDOA 4L3EA 2FLBT 1MCIA 1QLFB 4PJ5E 3TBWB 3WFBH 1ZA3B 4S0SD 4R96A 5ALBL 3RWIA 1WC7B 4O02L 4O4YL 1YUHB 3W39B 1FZJB 2J6EL 3E6HB 4JPKL 5EU6A 4Y19E 5FHBH 4JZNB 3VWJA 1K6QL 2EYSB 3IDJA 3VA2C 1G9ML 5EO1B 1ORSB 4ZS6D 1KXTB 2G5BB 3LPGA 5EULV 4J1UA 3QQNA 1PG7H 4GRMB 5AZEH 2VDOH 1N7MH 2VLLA 1IGTB 2W0KA 4JRXA 3T0DA 1ZLUH 3T08A 1QHOA 1EJ6A 1E4XL 3TH3T 3TBYB 2OMBA 1G6RB 3C5SA 1ZLVK 1R3LA 2NW2B 1ACYL 1SEBA 2B0SH 4WI3A 5I1DA 2DQUH 2P8PB 1P53A 5CWSA 2EH8L 4EI5B 2ZUVA 3M17A 1FLTX 3KPNA 2DQDL 3QJFA 4XPFH 2DQHL 1ZHBA 4DGVL 5FF6A 3T3MF 3BX7C 3RVTD 3JTSA 1VA9A 3QAZB 2CRMA 4LPVA 5T5NF 3IAGC 2X4SA 5C0FA 2P5WA 4OQ1A 2IAMA 3STLA 3QBTB 4TNVF 3DVGA 4OFYD 5C0BD 2W65B 4RGND 4YAQB 5BV7H 1MUJA 2G9HA 1E6JH 4RGMB 3VFTB 2QLVB 1QG3A 1NGZA 3KPSA 4NQEE 1TCMA 1DE4A 3DX8B 1N26A 1IAOA 4RNRB 3OPZH 5HHPB 1MJUH 3M8OL 3PWUB 4LLWA 3HRPA 5IESL 1RZJL 5GZOD 4KGJA 3QQ9D 1OW0A 2EIZB 3H7LA 3OSKA 2ZNXA 4XVUD 4PREA 3G6AA 5E9DE 4WUKH 4MXVE 1NCCH 1ZAGA 5FKPA 5IHLB 5GXBB 5KSBA 3RI5F 4YK4C 4PJGF 3L3IB 1MAML 5ETUB 5I71B 5FYLL 2ZSVA 5C07E 1K2DB 1EEYB 3IDXL 3TJEL 5SWQA 1AO7D 4NO2B 3X12A 4N8PA 2H26B 2H32B 3B2VL 3PWPE 1TJIH 3RKPA 1NCDH 4WU7A 1I7UB 4HUXA 1OSPH 5L6YL 1TZGH 3IRZA 1Y6NR 4DVBB 4OFVA 1OF2B 5CIPB 4HS8H 5DJAB 4OZFH 1KCVH 3MGTB 3ARDB 3P77A 3C8HA 3MNWB 5D7IE 2G60L 1BGXL 5IW6B 3G6DL 2CJUH 5T1MB 3BD5A 1A47A 3LY6A 3ABZA 4HIXL 3MJ6A 1UJ3C 4DKAA 3MLUH 1A1MA 3K4DA 2BFVH 4KJQC 3RBSA 1MLBA 3EZ8A 3NH7H 4DUXA 4PRHA 4ZO7A 4MXWH 4DVRH 5C71A 3UAJD 3DLQR 3EHBD 1NQBA 5HXMA 3BRDA 2W1NA 5L2JA 5DSCB 3WXWL 1GHFL 2CD0A 1G7HA 4G8IB 4TQEL 4ZODA 4EUPA 2DLFL 4KTDH 4X6EB 1ULVA 4Z5RB 4HWEH 4LPYA 4P4RA 4XCFL 2E7LC 2R4RH 5HDQL 3IFNH 1DSFL 5HD8C 1TZIA 2NR6C 4HV8A 3CVHH 4ODXB 1IM9D 5IIEA 4FABH 1F8TH 4C4KO 4IM8A 2VKXA 1EO7A 4F7EB 1YEGH 4LHUD 4F7TA 1ZT7A 4DGYH 1CGXA 5E99L 1FYTA 1RJZB 4M6OH 3RVUC 3SDDD 3S88L 3K8LA 4DAGL 5CBEB 5C1MB 4Q97A 4I77L 3EJJX 2VXQH 3G5XB 4ZUWA 4MGXA 2QADC 2VTFA 5DURD 3W2DL 3ZDZF 3INUL 4CN4A 4N5ED 3PXJA 3RHWF 4JO1L 4KK5C 3I84A 4MAUL 5HY9B 1T1WB 3GK8L 5IT2L 4PJCF 3UROR 4KKNA 4QYOA 1LO5B 5M94B 1MCOH 2C4FU 4IMLA 5GGRY 2VJXA 4QOKA 2E7HA 3IAQA 5DGQA 5D1QC 4XNQA 1RU9L 5IQ7L 2V5TA 2DM7A 4W6XB 1HI6B 1BECA 3QUYC 3MBEA 1GC1C 2NXYC 1BHGA 3SGEI 3RIFF 4O2FA 3SKJH 2N1KA 2A77L 43C9A 4EKXA 5JPMB 1IKNC 2FSEA 2Q3AA 12E8L 4RRPA 1AJ7H 1WWWX 4X6DE 5EOQH 5DJ8B 3HCVB 4KK6C 2DLIA 3P4OA 5TE6H 2OTPA 3ULVE 3GO1L 3EGSA 1XGRB 4GKZA 1EDQA 4PGBA 5B38B 4LMQE 2W0FA 4LRNH 1J86A 2VNCA 4XCYB 4GFTB 5ICXB 4AY0A 1C5BL 4KI1A 4IRZL 5CMAB 5FOJA 3TBVA 5H2BB 1J0HA 4XPGH 3RWHB 4LEOA 4KROC 3S35X 5GS2H 1CFNA 1ZHNA 4LDLB 1IFHH 4N90E 5JO5B 1KFAH 5BO1H 1OL0A 1NC2B 5FXCH 3MRDA 3WL9A 1MHHA 3H9ZA 5JHLH 1QR1B 3KJ4C 4KI5E 1T1XA 3GM0A 4J12A 5C0CD 3LS5L 3S4SB 3U0PB 2EYTA 4Y5XB 1UGNA 4DGIL 3QG7H 5C7XH 1C5DA 1F4YH 3RX7A 1UYWH 1DQJB 5DWUH 1PYWA 3L3KB 4JRYE 2PCPA 1FZMA 4NPYA 1FZKB 4OCRH 1SVCP 2FYYB 2X4PB 1CFQA 4HLJA 3DX9A 1Y6MR 2ATPB 4OIBA 5CEZH 3VWKC 5DR5H 4GG8A 4ZOBA 4RSVA 2BP3A 3VFGH 4OB5H 3GB7A 2Q20A 2FD6L 1LE9B 2V9TA 3EW3B 3RL1A 1HSBB 4PRPA 1XCTA 4OKVB 2YKLH 3I02B 5KAQG 3CX5J 5I8CB 4ZSOE 1NBQA 1CGSH 3MRKB 3G6JB 2OMNA 4JFZL 5D4QA 2APBA 1AGCA 2WK2A 4PJ9A 1S5IL 1JPSL 4XHJC 1U3YA 1D7FA 4YNYA 4LKXB 1KENL 1QEWA 4GMSL 1CDCA 1S9WA 4UTBL 1RUKL 3MLVH 1KJ2B 1XIWA 4PG2A 3CVIH 4N8CH 4LDOB 1T5XB 5J1SC 5C0AB 1U8LB 4LIQL 5EZJA 3OKKB 4AM0A 1IBGH 3TA3D 2X1QA 4LCYB 3SY0A 5E24E 1OAQH 5E2WL 3L1OH 1PEWA 1A6WH 1NAMH 3QFJE 4TUJA 1MIEL 4DZBB 3MJ9A 4BH8A 3TGXA 3X13A 5F8RC 4LLDB 4WJ5B 4XMLL 4Y4FB 3QCUL 2WNGA 2WWMC 4WW2B 3TO4A 5KSAD 2FEDC 3U0TA 4YX2H 2HMIC 2AK1H 4D94A 1I3RB 4ZS7L 5MI0B 4JFED 3RUGB 3N1PC 3JWOH 1T83A 4L9LA 3UEZA 1U3JA 1P9MA 4G6JH 3HS0A 4YHLL 3I50H 1QRKA 4BH7A 3WD5H 1H3TA 2E8YA 1S7RB 4L4TD 4TTGA 1NFIB 3ULUE 5FO9A 2XZAL 1A14L 3HR6A 1HYSD 1KLUA 4AL8H 3OGOE 4LHJB 4NZUH 1DLFL 4IOSD 5I19H 2GY5A 5KTEH 4H20L 1T1ZA 3PQYD 5CINH 3VRLE 3UX9B 1AR2A 3WN5B 2ZKHH 4IRSD 3BWAB 4ZTPH 1LK2B 5HGHB 3MLXL 2FL5A 2V6HA 3RVWC 2MQ0A 2VDPH 2E8ZA 1JP5A 1OD9A 1JNNL 4RGOL 1KB5B 4HWZB 4F7PA 2XTJB 2R2HA 3MRRA 3VJ6A 4K3GA 3VXMB 4JJ5B 3IT8D 4PJ8B 1JPFA 4YGVA 4LMQI 2VXTH 4JM2D 4FZ8H 2EDEA 1GC1L 4U1SA 4DN4H 1DVFD 2VLRE 1JN6B 3TV3H 2DDQL 2C7UB 4N5UA 4OFYA 5C0BA 2B1HL 3ILPA 3B5TA 4U3CA 4Z7WB 2VYRE 4Z95H 4BQ6A 3SDYL 3IDGA 2WLZA 3BH8A 4NQUA 1KT2B 3CC5A 2AW2A 5IVZB 5EA0H 3T65B 2OI9B 4PG9B 1T2QH 4OCXH 4P5MB 3Q6GH 4XHQA 2VQ1B 1QHPA 3W11D 2RIKA 5CCKL 4PGDB 4MZ3A 2E6JA 2QKIB 4QCIB 1Q38A 4NCC1 4YXKH 5FUCC 4E41D 4XNMA 4DK6A 5JHDE 5CSZB 1Q0XH 3WDHA 1W0YT 2APXA 3P30L 2X44D 4F15C 3KLSA 5LXGL 3WXVL 4MQXC 2L4OA 5IB2A 4XP5H 3HE6D 1T2JA 1AO7A 5GRZA 3SKNB 4AH2A 5C9JA 1DQQB 4M6ML 4L8CB 4JPVH 2VXSL 4EXKA 3V0AC 1BLNB 4XGZA 1YN6A 1VFAA 1JYVA 5A2FA 3NZ8B 1RZ7L 5E9DD 1R3KB 4JVWA 5D5MF 4ZD3H 4JR9H 5EIIA 1XEDA 4ZUTB 1MF2L 3TT3L 4LSSL 3MRLB 5I76A 5HYJB 2C9AA 1NUNB 1K4DA 1KJMB 4DTGH 3QZWB 5C07D 4LCWD 1PDKA 4XVJH 5KVGL 4NFBA 3MREB 4WI2A 3WS6C 1OTUD 4NO0B 2R1XB 3WBDA 4X9HA 2EKJA 3D39B 3IS0X 2YEZA 1G6RH 4KZEH 4Q9RH 5FM4A 1B4JH 1WTGT 1JI2A 5K9KA 4FNLL 3D5OF 2D0FA 4EN3D 2OZ4L 2IPTL 5LAXA 3PP4L 5CILL 4I0PB 1BF8A 3H0TB 1MAJA 4PLNC 1N3NA 1X5XA 1YNKH 2GW5A 3L3GB 4HQQH 1T0MB 5EO9A 1L4IA 1EH9A 4JDVB 3QUXC 4YBLC 4ELMA 1TJGL 4MNHA 1DTUA 2HT4C 5GHWL 3HG1B 1RZFL 1IM9A 4P4KB 2EKSA 4MA7H 3AROA 3IKKA 3VXSD 2BVQB 5DJ0A 4HFWB 1JZ5A 1RD6A 5B3JF 4LHUA 4XP1L 1X5AA 2YPVL 2PW1A 3LH2H 1UJTA 3SDDA 1NEZA 3DVNA 1WT5C 4AIZB 3WLBB 6FABL 5F9WB 3MRIA 3MRJA 1SJXA 2EE9A 4XX1G 4G6MH 5EO0A 3IDIB 5I73C 1EJOH 4YGAB 5LQBL 1F11A 5GS0H 4JDZB 4PJHF 3J8F7 3MV9E 2N56A 1BFVL 2FJFA 1DZBA 2IFGA 4OLEA 3DSNA 1LO4H 4DN3L 2D03L 4QHNB 4PP1D 1ZHLB 4O2CB 4ZNCD 1SMOA 1OTTD 4K94C 4YE4H 5E5MA 2V2TA 4NN6C 2HG5B 1CCZA 2OK0L 3THMH 3VXTA 3FO0H 4QHUA 4RAVA 3GHEH 2B5IB 3D3VB 1IGYA 1B2WL 3K46A 1N4XH 1ONQA 3E6FA 3EO0A 2H32H 2FBJL 2XWBA 1H9VA 3RGVB 4ZMAT 3O4LB 5GS1C 4QT5A 1CN4A 2HLFD 4F7MA 2GITA 4X9FA 5BVJA 5J3HD 4B53A 5JNYA 1VCAA 3L5WB 5IMLB 4GS7B 2R39A 5BCAA 4CW1B 5CIPH 2NY0B 3O3AB 4GG6F 3QUMA 1OAUL 4R26L 2YXMA 3UTTD 5ADOL 4ZPTB 1AXSA 4HWBH 3WFEL 1CLCA 1HHHB 4NUGL 3Q48A 3U6RB 3QEHA 2DBLH 1AGFA 4S1SL 1PSKL 4XB7A 5CSBA 1CGYA 1UH4A 3JV4B 1XR8B 3O6FD 5ERWB 3GZKA 4MDIA 4R0LB 2YD6A 1E4WH 1FJ1B 2BNQE 1B4RA 4N8VG 2AGJL 4Y5YB 3FB8B 4Q74A 4XAKE 3RDTC 2PO6C 1XGYH 4KMLB 1G1CA 3QEGH 1EV2E 1AC0A 3BWUC 4NHUB 2ZOKB 2D31B 3WUZA 5C0CA 3MBXL 5DT1H 3JXAA 3ECBB 3AS1A 4XRCB 4XXDA 4PGCB 4JRWA 3PV6B 4U31A 2A83B 1BFTA 3QIBD 1FL6A 1J1OH 1MRFL 4F9PC 3TBTB 4P2QD 1NBVL 4F8QA 3DARA 4DEPB 3VMNA 1GPOH 1JRHI 1DL7L 1WK0A 3EDFA 3RX8A 2A6IA 3HC3L 4H5SA 1P1ZA 4N90D 2BY2A 5EBWA 4WV1C 3MXWL 3QIUD 3OXSA 5JQ6L 1G7MA 4Y16B 2EECA 1HWGB 1NJ9B 2HKHH 4JZJC 1CGWA 1A7RL 3MMEA 1FLRH 2R1WA 1CG9B 4OD2A 4KRPB 5E8DL 3C9NA 4BZ1H 3G9VA 5B39G 2GFBA 4JN1H 1DQLL 4R90L 3KWWB 3RWEA 1G9EA 4OZGF 5EU5A 3UCRA 4YHZL 4U6VH 1BZ9B 2JJWA 3LKNB 1UM5L 3EYFA 3BPOC 2NY1C 2NY7L 5F93C 3G5YA 4QRTA 2H2SC 4XTRD 3FFDB 3BMWA 3X3FL 1BEYH 1SEQH 3U48A 3TA3A 2Y07H 3EO9H 4GBXD 2X2YA 4H88L 4ESKA 5I0ZA 2CDFB 2BCKB 1P7HL 5D7LB 5HHVH 4JM4L 4Z6AT 2BHZA 1EA9C 4HPYL 4U49A 5D7IF 3TO2A 1YQ2A 3CAFA 1K3ZA 2I9LA 3FB7B 1S9YB 3GI9L 3WMSA 3R0MA 5KSAA 3OHXB 3N1FC 2FNBA 4JY5L 4P46B 4ZUVB 3LB6D 4L8BA 4JFEA 1C16B 1G7QA 1EEZA 2NYYC 5E8NB 2P7TB 1QVOA 5I9QC 1NKOA 2FCBA 1GGIH 5EU3B 1KCUH 5GGVY 4YZFF 3UXFA 4PJAF 4L4VB 1T89C 3QH3B 2M1KA 4L4TA 4Z8FL 3QFJD 1MFDL 3VGFA 4X4ME 4S2SB 4XPBH 4KJYB 1E27A 1FSKB 5HGAA 5FO8B 1I9RL 1X5HA 1YNLH 4ODUA 4OGYL 1N8ZA 3QUZC 3UTSE 3PDGA 3SDCB 4JCMA 1LEIA 1RIHH 1YPZB 4MQ7B 1YYLL 3HNSL 1IGJB 4UINL 1W8NA 3FZUD 4OBRA 4HCRH 3H3PL 2GYSA 4HFUH 4K8RH 4U1NA 3PQYA 4OLXL 1Q9LB 4NNXA 4IRSA 1SJEB 3BN9C 2V5RA 4POZC 2EZ0D 4PJHA 4XMKL 1HH6A 4L29A 3B43A 4UUJA 5CHNB 4LOUC 5DHYB 3IDYB 5D72H 5GGUA 2BRQA 3MOAL 5LGJA 1FPTH 3HI6H 4UT6H 3FT4B 2VLKB 4H25B 1QBMH 4APQC 2XTLA 3U2SB 1QKZL 4K94L 4KI5C 1CXEA 5IFAH 5JORA 6CGTA 1S9VA 2ADJB 4LSQL 4JM2A 1ZVHA 2HYMA 3LAFA 1TVHB 3HZYA 3DTXA 4QRPE 1DVFA 4NM8L 1ZGLB 5F89A 5CJQH 4C54A 1AIFB 4MX7B 4P59L 2CUMA 5K9OB 4GG6A 3FOMA 5TJWK 4I8DA 4GRLD 3DBXA 4G42A 5E70A 1KJ2H 1A4JB 5D1XB 2V7NA 2JCCE 3OR6B 5T5FL 1ETZA 1S78C 3A67H 2C26A 4QTIL 1PAMA 1HQRA 1LO3H 5F96H 1I7TB 4HBCL 4YEEA 4OZ4A 4CJ1A 3CLEH 3QCVL 2Z9TA 4JFXA 4KY1H 2VLRD 2ATKB 3PWVA 2H6PA 3D9AL 2WSKA 1BFSA 4CVZA 1K8DA 4W4OC 5C0RH 4U2YA 4E41A 4K3EL 4HUVA 3ZMRA 4JZOB 4OLVL 2BX5A 3SE9L 1F58L 4ALAL 1D6VL 4XVTL 4O51B 2AEPH 4JKMA 4F3FB 4XP4L 2NW3A 4GW4B 2ICWB 5CJXC 4Z7QE 3HE6A 5CEXB 4M4RA 3WNKA 4PJIB 4U1LA 2OSLB 2Z31D 3SKMA 1SM3L 4MCZA 5HGBA 1VEPA 5EPMB 5L7XL 5KSUB 5HGDB 3CH8A 4HIIB 2VE6B 3M1BB 2A38A 3PXHA 5E9DA 4DFIA 3VW3L 1Z9OA 4LARL 1WJ3A 2BSRA 3MACL 4EEEA 1OARL 1QSEE 3NMEA 4FFWD 3QXDA 2CLRA 5JHDD 1F00I 5EZIH 3MLWL 3SCMC 5KVMC 4P5KA 3TVMD 2AK4E 2IPKA 3LMJL 5C07A 1JK8B 4FTVD 4LCWA 3RJQB 4OZGA 2DN7A 2NMSA 4F2MB 5HYQB 1OP3H 3O45A 5E00B 1B9ZA 1CWVA 4S11A 3V6FA 2IMMA 4OJFL 5IEHA 3PWPA 3HNTH 3HN3A 4FQQB 3UMTA 2DQIL 2VDKH 2WM0A 3QDGB 3B5GA 4EN3A 1NDGA 1KB5H 2XT1B 5DQJB 2EEDA 1TVBB 2WUCL 5CZVH 5EC1A 4RMTA 4Y0GA 1LP9E 3RY5A 2EDRA 3REWB 5D7IA 4AQ1B 2VKWA 3S37X 5MEPA 2EDTA 2HJKB 4XNZB 5F7LB 1R0AL 4NJAH 4G80A 3ZYIA 3IXTB 4U7MA 1CR9H 3OKLA 1NCAL 5KS9F 5J1AA 3VRIA 1D3CA 4KHTL 3VXSA 3GSXB 4XBPB 1RURH 3HUJE 4NNYB 5SX4H 1N59A 1NAKL 5D2NC 1DJSA 1A1OA 5CKGA 2C1OB 2EDDA 4NQCB 2C3VA 1KJVA 3KJ6L 3TJHC 4OIAA 2IH3B 3O41A 1AKJB 3I6KB 4HXBL 3VXPB 3ZHKA 1N0XH 2W91A 3N1QC 1CICD 4ENED 1RJYA 4MJ5B 3VFPA 2Q7YA 4X98A 3F6LA 4FXKA 1U8HA 4UQ3A 3ZT7A 4IOFD 5AG9A 2P5EE 2KUTA 2E7CA 4PY8J 5MEOA 3MA9H 5C2UB 3S97C 5HVHB 4MS8C 2VDLL 3CFBB 1U36A 2BRRH 4RIRA 3ULVL 1ZTXL 2I9TA 4E5XB 1IL1A 4N0RA 1D6EB 5BOPA 5LGKA 3BQUD 5J11B 1EUUA 1P6FA 4XBEL 3DGGA 5IG7B 1VFMA 2ENSA 2IMNA 2MSPA 3MLYL 4H0GA 5AWNL 3DMMD 5C0DB 5FA3A 2BSTA 4QY8B 1I8MA 4WO4C 5SWZB 5ESAB 5JTWA 3IDMB 4LPXA 3MV9D 4XPHL 5DD6A 2BOCB 1E28A 4YUEH 1JMZA 4FQ2H 5CEYB 1RZKC 1I9IL 2A6KB 4J6RH 3EYOB 4ZAKB 3SPVB 1S7VB 3UTTA 3MBEC 5AUMA 5A2LH 3ZKMC 4PTUB 2W38A 3E8UL 3PL6D 4FS0A 3SQOL 1DANU 4LAJH 3O6FA 1HHKA 1QQDB 3QUKA 5HPOA 1TJHH 1OOAA 4JFQB 1DN0A 5CEZE 1Q72L 1SJHB 3CFEB 4X6DA 5DJZA 2IG2H 5BVPH 1CS6A 2VISA 4WENB 5DMYA 2B2XL 4HX1B 1JGUL 4QWWC 5KVFL 2IH1A 3CLFL 1UJ3B 1U92B 3QIBA 4TSCL 3OAZH 4JFDD 5I74C 2X9YA 3TBSA 3O3UN 1HOCA 3SDAB 4P2QA 1VSCA 2AV1B 4CDHA 2NTSP 1WCQA 1BWMA 1HCFX 3UPAA 4QRUA 4OZHE 1P4BL 2ZPKL 1ZMYA 3CJJA 3QT2A 3DVFA 2WAHA 4XAKD 4UTAH 5DD3L 3QIUA 1A5FH 1ES0A 1A3QA 1SY6A 3I2CH 5C2BL 4YFLI 3D2UB 4PR5B 3GI8H 1QFHA 3AC0A 2Y6SD 4XNYH 5L88L 3CU1A 1KCLA 1HQ4B 2J3SA 3FO1B 3O3BB 2AXGB 3MO1B 5IVXE 4WFGE 2WP3T 1NFDB 1D5ZB 4CKVX 4PV9A 5C8JA 1X5KA 3EBAA 3RNQA 1MNUL 3A6CH 1F6LL 4GKSB 1ZV5A 1RULH 4Y2DC 3OAUH 4LF3B 4RCAA 5C6TL 3GSUA 4P48A 3LKOB 3CUPB 3O6LH 4J4PD 3VXRB 3G6JF 1IARB 4PTTB 1QBLH 3QI9B 3OF6A 4GBXA 2YZ1A 1G9NC 5F7DB 4LVHC 5D7JC 1CXLA 4ZSOA 4L8SC 4DQOH 3BEWA 1U8NB 1BIHA 3CGTA 3P4LA 5J6GB 5DC0A 3L95A 3MLSH 5GRUL 3CD4A 3ULUL 2VL5B 5GISH 3U9PH 3CSYA 2NY5H 3CCHA 4ERSL 1T0NA 2HP4A 2F74A 3SGJC 5DJYB 4PRDB 1P7KA 3QUYB 2AI0L 3NN8B 4JJHA 5D6CB 5SWSB 3T4AA 3FT2B 3GFUA 5TDPA 3RIAK 3U82B 2ESVE 4V2CB 4M6AA 3FKUS 5KS9A 5EUOB 2Q3ZA 1FGNL 3QFJA 4XX1E 1YY9D 2J4WL 4JLRA 5BS0B 5IB3B 5FCUH 1UB6A 4YO0A 4JO3H 5L9DH 3KPTA 3G5VB 3BXNB 4TUKH 3PWNA 3H9HA 3QXUA 1OB1A 4N0UA 4OFPA 3LN9A 4A2LA 1CFSA 1MJJB 1F02I 3DUSB 2CR6A 2YPLE 3CFDB 3EDJA 2VAAB 4Y7MA 2ZUQC 3GNMH 2FWOA 3PWJA 5BRZD 1WZKA 4HGWB 3CXDL 2IFFH 1DBKH 1NGYA 3KJ4B 2AV7B 5GSRA 1HZHH 4LRIC 1X7QB 3UTSD 3RY6C 4RDQG 4DW2H 5LJYH 5J0BA 5ADPH 1D5IH 3PGFH 5MHSE 1XGQA 2NY3D 1CLZL 2RCSL 1NBYA 4HG4J 1NSNH 3BP6A 3HRZA 2Z8SA 3TYFA 3NFNB 4P5TC 1TCRB 1V5JA 1BJ1J 1R5VA 3O4OB 2NX5E 1FO0L 4EZMA 1F5WA 3UBXA 1Z9SA 1FHGA 3OV6A 5E8EB 2DS4A 3ULSA 4RBPK 4C56B 1ZHKB 2FO4B 1T7ZA 1T7XA 1R24B 2FZ3A 3LEXA 9CGTA 1C12B 2F58L 1CLOH 2DAVA 3B9VA 3CFJB 1CXHA 4HT1H 3R4DA 5FK9A 5TDNB 1RZKL 2VH5L 1HXMB 3UPRB 1P4LB 1L9NA 2NNAA 2FECI 1I3VA 4OGXH 4R4BA 4ZQKA 1G7PB 3OGCB 4XNXL 5FV2A 3BZDA 1KIRB 4P2CG 5ITBL 2VLRA 4K71B 1II4E 2XXCB 7FABL 3FO2A 5DTFA 4UBDD 2VXVL 1H15A 2Q86A 3L6FB 4LEXH 5J57B 3BKML 2AABL 4LLYB 2PR4H 4R8WH 2XACC 1VFUA 1KB9J 4OLZH 2ZNWA 3FTGB 3TP4A 2JTDA 1T22A 2Z31A 1SBSH 4M7ZB 2V2WA 2XQBL 3U1SL 3U9UA 3WUWB 4CU6A 1SBBA 4WEBL 5DZOA 5C9KA 4CMMB 1R5IB 1U3HD 1JF1B 1UA6H 4KDTC 4LNRA 1NGWB 1AFVL 1KXVC 2XRAL 2Q8BL 5GRJH 1DBAH 4U1MA 5C08D 1G7JB 1WEJL 1C7SA 5JHDA 1ZK9A 3VH8G 2FATL 4UV7H 4DKEH 4FTVA 5DFVC 5KSVB 1EUTA 3OL2A 2DM2A 2V2XB 3O3EB 1L9MA 2ZUSA 3QDJE 1JWMA 3MV7E 4R9HA 2AJYH 3UDWC 3F58H 1NCBL 5E1AA 5D1ZC 3PP3H 4PRBB 1RIVL 4KJWC 3NAAL 1T4KB 3KNBA 1T03L 4QHLA 1U6AH 1TTFA 4PD4K 4O5LH 1QSED 3VRJA 4FA8A 1XGPA 1YEDA 3EYVA 5DFTA 4HH9A 3VFSA 4Q9QL 4Y4HD 2XA3A 1P69B 4X5LA 1G9NL 1GGCL 4ZYKB 2WLYA 2B4CH 3PGCB 4ZOAA 3PABB 1K85A 1DDHA 5FM5M 2WBJD 2H9GB 3LIZL 1P7QB 3SE3C 1C5CL 3B2UD 4KZDH 2APFA 1WFUA 2VLJB 4AMKL 3VI3F 4HS3A 1FV1B 1T3FA 5LCVL 3K2UH 5BV7C 1YN7B 2O5XL 1ZS8B 3HE7D 3SE8H 3B5HA 3QO0A 4G8GE 4LVNB 4UQ2B 5EG6C 2MKLC 5ICZB 5EC2B 2AJUL 3ARVA 3FOLB 2YRZA 3U46A 3EAKA 1BOYA 1H0DA 3PE9A 1IC4L 2I07B 4XBGB 4Y1AB 2WWKT 3UO1H 3WJJC 1CICA 3FQRB 4WUUB 4MWFB 5T3ZL 5DEFA 3K1KC 3QFDA 5FEBA 4XI5D 4M43L 1XGTB 2X70A 4IJ3B 5C0IB 3I85A 1INDL 3VI4F 1HEZB 3RVXC 5GGSY 3IJYB 4KK8D 3GMLA 1DQDH 1TTGA 1CGTA 4OLUL 5INDA 3BQUA 3S3PA 4IOIA 1Z5LB 3L3OB 2NPLX 3RTQD 3MZGB 4HPOH 1T66D 3ARTA 1MEXH 1YEKH 3RWDB 1U95B 2PYEB 4NSKB 2D7PA 3S36X 3DMMA 1M7DA 1I1AC 4H1LA 2HVJA 1AY1L 1NEUA 5HHMD 3VE0A 3QG6A 3JV6A 4MCYB 3MV9A 5FOBA 4NQTA 5SV3A 5B8CA 4Q6IC 1CXKA 3QWRD 4IIQA 4KTEH 3O0RH 2XZQL 2QJDA 1C1EH 1X4YA 5GJTL 3PL6A 4R6UA 2ZSWB 4Y2OA 2CK0L 4M03A 1OM3L 2OL3A 4CU7A 2AXFA 1CBVH 3BPLB 5JW3H 2F19H 4HKJA 2B20A 3REVA 1JCKA 4DOHE 1FGVL 1MFEH 3WIIH 3BW9B 3U4BH 1UKTA 4WHTA 2AJXH 4NT6B 4OKDA 3TH4T 4Z9KB 1HKLH 1D5BB 4A6YL 4JFFE 2MPAL 1KPVB 4JFDA 5E4IA 4JPIA 2FR4A 3QQ4B 2I26N 3QEQB 4RFOL 3KYNA 1CF8H 3ARED 5BZDA 5CEZD 4WHCA 4FFZH 1QA9A 1QRNE 2BDNH 5J8OA 1IRAY 1FBIH 1X5IA 3P9LB 4K3JH 2AS5M 1YMHB 1MQKL 3BAEH 3B9AA 2Q6WB 5HYSG 4NRYB 3HNVL 4XXCA 2R69L 1S7SB 4YXLH 4RX4A 5EFIA 2OTUA 2IWGA 4PBWD 5DQ9A 2BC4B 1XGUB 4PS4L 4KFZC 4QRSA 4QLRA 3TH2T 2PXYD 4M6NL 2XYCA 3C6LD 1F6AA 3NBNA 4ZDHA 2GK0B 3CFCL 2E7MA 1IT9H 4YQXL 3RRQA 5KAQF 3ARRA 4UT9H 1CD0A 3IU3B 1UXWB 3MV11 1YDPB 1S7QA 3WFBL 1T0PB 1NUFA 3RAJH 3GSQB 1HHGB 3MUJA 4J4PA 4MD5B 2F54B 4PLKD 2FGWH 4FMKA 1GZQA 3BP4A 4U1IA 5FHBL 3VFWA 3NACH 1Q9WB 3T0EC 1XZ0A 4NQXA 3X14B 5D7KD 1B6UA 4S1DC 4NKDB 1U8IB 1PG7L 2GUOB 3GBNH 1N7ML 5AZEL 5F3BB 5DDHB 1QPPA 3IFOA 1N2RB 4WFGD 5BMFH 5IP4A 4UIMA 1CVSC 1J0JA 1KN4H 3JBG7 3MGOA 5B4MC 3VGAC 3F7YA 2DQUL 3HI5H 1J12A 2DF3A 4GUPA 4M7LL 5IJKA 4X6CB 4ZPVA 5ENWA 4HMCA 5ITFB 4OCMC 4XPFL 4B50A 3OJDB 1KPRA 4E9LA 1U8MA 2EH7H 1S5HA 5J7CC 3RWFA 4N9GA 1KIUA 1FCGA 4ODWA 4ZUUA 1FN4A 1G7IA 2IGFL 4OT1H 3L7FB 1CT8A 5EOTB 1PKQE 4LLVB 3RIAF 1PKOA 2HFEB 3VXUB 2VL4A 3VFOA 1CE1H 1OAKH 1GZPA 3V5HA 5FECA 5BV7L 2DB8A 1E6JL 1XF4A 4X5WB 2AKRA 4LBEA 1EAPB 2D0GA 3BPNB 2JLLA 2BVOA 2ZOLB 3OPZL 1YY8B 1H5BC 1MJUL 1JUFA 1Z6JT 4YIQB 3RDTB 4UILH 4KUZH 1HYSC 5BRZA 3O6KL 2UVFA 3UZEA 3VGHA 2PKDA 3QNZB 1VKXB 3B83A 3KHOA 1LDPL 2K7PA 1QLRA 5I0DA 4X7FC 1JV5B 2CDEB 2LE9A 3JVGC 3SBWA 3TFKD 25C8H 3LKRB 3L9RB 4WUKL 3UTSA 1NCCL 1CD1B 3WIHA 1AQDA 5E6IB 1A1NB 3IKCA 3C8KA 2VR5A 5FB8A 3HZMA 5F1NA 4XZUA 3Q5TA 3TWCH 4HUUB 3STZB 1PEZA 1EX0A 4PLJD 4OF3A 1DFBH 1KCSH 3FRUB 4MNQE 4YPGA 1PQZB 1TJIL 4QXTB 3LKPA 4P57A 1NCDL 1TETH 4GW5A 2MJWA 3OTTA 1WZLA 1U58A 1OSPL 4P23D 4ZOEA 1TZGL 1XFPA 2P4AB 4MAYC 3QWOA 2OYPA 4OLYH 3F62A 4HS8L 4F9LA 3Q3GA 2ITCB 1OSZA 2YD5A 1KCVL 3CPLB 1RZIA 1KELH 1A2YA 4KPHH 5EDXA 2DTMH 3BRFA 2JK5B 1U8KB 2NX5D 3RZWA 4QRPA 1T6VN 4HH8A 2NY1B 4NC1E 2QHRH 3GJFH 4NOBA 3MLUL 1Y0LA 2Y5TA 2BFVL 2EEAA 1T20A 3UPCA 3UZVB 4YDLB 1QTYT 2W07A 3NH7L 4M5YL 4DVRL 3HTLX 4MJ6A 1GYAA 3P0YH 3QXTA 2A0LC 1A7PH 4GMTL 4QGTA 2DMKA 3P2TA 1CFVH 3AMKA 3JWOC 1AGDB 1T5WA 4CADB 1D9KB 1I7ZB 5L2KB 3EUUA 1EFXB 5LBSH 3UC0H 4JFOB 4HWEL 5HHOD 4KXZH 4ONHB 1VFBA 4JQIH 5FGSA 4NQSA 1UB5B 1U3HA 1H8OA 2FHBA 4HKXB 3IFNL 5ID0B 4MJID 4WTWA 1FE8H 4UI2A 5I9QB 4FQXC 5DC9B 3QIWC 3DUUB 5BJTB 4K7FB 1F8TL 3QNXB 4FABL 3CZFA 4OZHF 3MV8B 5BXFB 4JAMA 3LV3B 1YEGL 5JIHA 4YHKH 3B9KC 4Y88A 1LNUB 4HZLA 4N1EA 1A9EB 3PWLA 3QUZB 1SYSA 2VXQL 3OJ2C 3TNMA 3GBMH 3BKCH 2E27H 4BKLB 4JREB 2NLJB 2IQAA 4IRJC 3EFFB 4X83A 5IVXF 4UNVA 2F5AH 1QSEA 5CFHA 4HGKC 1MHEA 3PDOB 3GUTA 4L3EB 4LKCA 3WO3B 3L3JA 4OGAD 4Y4HA 1QD0A 2XN9D 2EO1A 3FMGH 5FFLA 4R96B 3RWIB 1UWXK 1IAII 3QDJD 4XNUH 3MLRH 4HKZA 5K59F 3MV7D 2WBJA 5EU6B 1U8PA 3F7VA 3LRSB 4YXHL 5SX5H 3R8BB 3DROA 3VWJB 3IDJB 4ODBD 3SKJL 2Y9RT 4KJPD 1XR9A 4J1UB 2VLLB 4JRXB 1AJ7L 4G6AC 4NZRH 4XC3H 1BP3B 5EOQL 3QO1A 5I6XB 3NIDE 3C5SB 4RMSA 4Z7VF 5JW4R 1R3LB 4OZIE 1SEBB 4NO5B 5JDSB 5I1DB 2GTWA 1BMGA 2YPKA 5DZLA 5CWSB 2VLME 2Y25A 3M17B 3KPNB 4LRNL 5HI3C 3QJFB 4XCEA 4EVNA 1ZHBB 5FF6B 4XPGL 3C5ZD 3JTSB 2XA8H 3FQUA 3LRHA 1IFHL 4LLUA 2X4SB 5C0FB 1KFAL 5BO1L 2P5WB 2IAMB 1J0ZA 3STLB 1NLBH 2IPUG 3IGAA 1CI5A 3MXVH 3DVGB 1TVDA 4G8GD 5JHLL 3SO3B 1MUJB 1HXYA 2G9HB 4NKIH 3TPKA 3KPSB 1NGZB 3RTQA 3V6OC 1DE4B 3QG7L 5C7XL 1F4YL 1UYWL 4E42A 5DWUL 1IAOB 3DIFA 1AGBA 4OCRL 3UP1A 3B9EA 1EHLH 2X4TA 1FZOA 4IDJH 4MA1C 5CEZL 5ACZA 5DR5L 4X7TA 4WHYG 3QWRA 4X4YA 4OD1H 4PREB 2YA0A 3G6AB 3VFGL 4U2ZA 4OB5L 1UH3A 5AAMA 1UM4H 1MCQA 4OV6F 2ARJA 5FKPB 4KKCD 3MOBH 5DI8A 3Q1SH 5IHBA 2YKLL 5KSBB 1O7SA 4RWYH 2OM5A 2FECL 3AS3A 3I75A 4WWKD 1CGSL 2ZSVB 3MA7B 4M1CD 5F9OH 3BE1H 3VFVA 5J3HC 3HG1E 1RUML 5SWQB 3CXHJ 2R29H 2ED9A 3X12B 5H94A 1E4KA 3MLVL 4EI5C 3CVIL 4N8CL 3CX5K 4WU7B 2EDYA 1A6UH 5FYJH 2EO9A 4HUXB 1U8QA 3C08H 3C60D 1OQOA 1F4XH 1IBGL 3QAZC 4MLIA 3L1OL 1A6WL 1NAML 3NGBB 5JOEA 3P77B 1ITCA 1U9KA 3FN9A 1ITBB 2A2QT 4X6BA 4JKPL 1WBZA 1CXFA 4I2XA 5IW3A 5TE4H 4G5ZH 4U3XA 4XP9H 4FQ1H 1A1MB 3EFDH 4RGMC 3ARFD 2AK1L 1MLBB 1AI1H 2OJEA 5F7NC 3QISA 4PRHB 4KUCD 4C4KT 1TITA 3BP7A 3Q5YA 4G6JL 4I1NB 1K5NA 4PP2A 4JFFD 3UYOD 5L2JB 3C6LA 1G7HB 4EUPB 3D3VE 1FG9C 4R7NA 5DRXA 5HTSA 4OZHA 3U7YH 5ILTH 4IHOA 2X05A 1U91A 4P4RB 5DQDH 1KGCE 3SDXF 4PRAB 1A8JH 1CFBA 4KKBD 1RQ5A 4AL8L 1QRND 3KVQA 1TFHA 5FGCB 5SX4I 3ARBD 1TZIB 2CH8A 4NZUL 4DZ8A 3ILQC 4HV8B 1BIIA 5I19L 5DK0A 4HD9A 5IIEB 5KTEL 3TT1H 5I71C 4OGZA 2V17H 5GRVK 1IC7H 1NAMA 5CINL 1MRDH 2DWDA 4F7TB 3IETA 5IW1A 3FONA 1ZT7B 4ZTPL 1XH3B 5IVXA 2JJUA 4WI6A 4H8WH 4PIRF 3ARGD 4FQLH 1B0RA 4LFHG 3QXWA 2VDPL 1IGCL 4ZUWB 4ZFOB 1FFPA 1G0XA 5DMKB 2LU4A 1ZE3C 1H8NA 2Z91A 3EYQD 3I3EA 1CK0H 5E94A 4OQTA 4Y4KD 5D9SA 3BGAA 4Q9BA 4QYOB 1GJIA 2VXTL 4IMLB 1GSMA 4QOKB 4RQQA 4DN4L 4C83A 4FG6C 4XNQB 4Z7VA 1W8OA 3TV3L 4MYWB 4G9FE 3VFMA 2NXZB 2ZCKH 3MBEB 5GSVA 4XVSH 2DM4A 4O2FB 4Z95L 43C9B 2EDHA 2YD7A 3V52H 2FSEB 2BJMH 3MJ7A 1ZOXA 3I3DA 3CIQA 3IXAA 2DOCA 3NCMA 2VDNH 4MDJA 1T2QL 2HH0H 3P4OB 4OCXL 3Q6GL 2NZ9C 1EXUB 3EGSB 5BW7A 3GGWB 4GKZB 4PGBB 4NRXA 4MQTB 2W0FB 5E0QA 2DQGH 2XNAA 5CJBA 4YXKL 2Q87A 4LEOB 2W9LA 3NCJH 4U1JA 4S1QH 1Q0XL 1CFNB 1ZHNB 1FAIH 2ZUWA 5IM7A 1BZ7A 3MRDB 2ID5A 4XP5L 1OGAE 1MJ7H 3WL9B 1MHHB 4D0BA 2AXHA 3JWDC 1B0GA 3GIVA 1T1XB 3KPRB 4JPVL 4LSVH 4I3GA 3L7EA 4R2GB 3WNLA 4EJ1C 2EYTB 2EDBA 1C5DB 2DKUA 1G7LA 4P23A 3BGFB 1ZT4A 1PYWB 1R6VA 1V3MA 3GIZH 4JR9L 2R0LH 1ZANH 2PCPB 4ZD3L 1FZMB 1CFQB 3DX9B 5IGXH 5JMOC 4W6WB 1FNFA 4BSWA 4DTGL 3KS0J 4GG8B 3SGEH 1A3RH 4XVJL 2NY6B 1HHJA 2NX5A 4N0YH 3GB7B 1IZJA 1HSAA 3RL1B 5I1IH 3O8XD 4PRPB 4GRLC 3PIQA 1XCTB 4MNQD 4PB0H 4MHHG 1G6RL 4N8VA 1J05A 2VDMH 5DJDB 1B4JL 3S96A 1YEHH 1EGJH 1AGCB 2CKBA 4PJ9B 1YPZE 1H3VA 5KG9A 5H35A 4X8XA 4YNYB 3W9EA 5I66A 2CO6B 1S9WB 3GSNA 3AY4C 1XIWB 1YNKL 4HQQL 2H8PA 5HHOA 2ENYA 4Q9CA 4ODHH 4FQCH 4JQXA 3WE6A 2BVUA 1J5OH 4KUCF 1FNSH 3MR9A 4R4FH 4D0DA 1JGLH 5EZJB 4MJIA 4AM0B 5KOVC 5JIPA 3SY0B 3MNZA 4RMVA 2BHUA 1AC6A 3NOIA 4TUJB 4NP4H 4P2OD 2VERN 4BH8B 4MA7L 3X13B 5KJRH 5DD5H 1UADC 4YHMH 2XY2A 2W60A 1UM6H 4ISVA 4K8RC 1Z2KA 2UZIH 3TO4B 3LH2L 3H3BC 4GQ9H 4P9MH 4ORGA 3U0TB 2J7LA 4Y5XC 3SDXA 3ARQA 4M7JH 2HJFA 5B39A 4L9LB 4GAGH 4G6ML 3HS0B 1G6RA 4BH7B 1EBPA 5D93B 4FFWC 5IJVA 1EJOL 2VWEC 5GRWA 1OGTA 1CGVA 5GS0L 4ZFFA 4UAOB 5T1KD 3TVMC 4KMTH 1FIEA 5FO9B 2C5DC 5I15H 1LO4L 4HLZH 2XN9A 2NY2D 2E9WA 1NCUA 1KLUB 3BZEA 3QDJA 3K3QA 2EIEA 3MV7A 2H1PH 5FUOH 3THML 3FO0L 3GHEL 3GMNA 2YWYA 3OR7A 2H45A 4JGMA 2PN5A 1KYOK 1N4XL 2YN3A 1KLGA 3GSRA 3I3BA 4QRRD 3BEVA 1GXEA 4KDWA 1C08A 5GIRA 3WKNA 4M62H 4MA3A 4BJLA 1KG0B 4YHOH 4F7PB 4PJIE 2R2HB 5C0EB 3MRRB 4RMQA 2GSGA 3VJ6B 2DBLL 1W72A 2D9CA 3C5ZA 5IMMA 3EJZC 1JPFB 4YGVB 1E4WL 1QFOA 1MWAA 4Y4FC 3AFLA 1KTRL 4U1SB 3MX0A 3BT2H 4WW2C 1XGYL 2WV3A 2W0PA 3QEGL 4TVPH 4HJJH 5C0BB 4G8GA 5MI0C 4RGNB 1NGPH 2HRLA 3K4AA 1GGTA 3ILPB 3S3SA 1V7MH 3RPIA 5I17A 5JA8B 5DMGD 5HDOA 1EO5A 1F97A 2OJZH 5DT1L 1FDLH 5I1GH 2N7BA 1XF2A 4RA3A 3IDGB 2VLMD 4ENEC 2DQCH 1J1OL 3CC5B 4CN1A 5JR1H 1M71A 2QL1A 4IMKC 4NC1C 1GPOL 2H2PC 5GPRA 4MVBC 4FFVD 3BIBX 4M02A 3BPCA 5EZOL 2K9UA 1Q94A 2UWEE 3ARDA 2X89D 5ABDE 1FLRL 5JXED 5E4EB 5DUPH 4R97B 3V6ZA 4XNMB 2XZCH 3RZCD 3PNWB 4WWKA 4F58H 4BZ1L 3WN5C 3LSOB 4ONOA 4OI9A 4U6XA 3OQ3B 5IB2B 3WLWC 1AO7B 3O11A 4AH2B 4U6VL 5C9JB 5ESQA 2LAAA 3TIDA 5CP3H 4XGZB 1YN6B 4Y5VA 1VFAB 1ADQL 2XTJC 4HULB 1UH2A 2BERA 2CIIA 5CBAA 1AHWA 3C60A 2D7TL 1BEYL 1SEQL 5EIIB 1RJCA 4GAJH 4Z78A 2Y07L 3EO9L 4K9EH 4NQCE 4PJ8C 1F4AA 2IQ9H 3HZVA 5FA4A 3C8DA 5A2KH 1K4DB 5HHVL 3N50A 3F5WA 4NQDE 5F9JA 4NGHH 5EU7C 1ZVSA 2X4RA 3MSPA 2YEZB 3ARFA 4CVXA 1PY9A 5CZXD 5DC4B 3NA9L 5K9KB 3K81A 4JFFA 2IBZY 5I1LA 1KCUL 2OI9C 5LAXB 3N1MC 1W0WB 1WIPA 3UYRH 2EDFA 3BDXA 3GMQA 1N3NB 1OAZH 4F57H 1Y6KR 4XPBL 1FIGH 5EO9B 4NFCA 4JB9H 3KYMA 3P11H 2EE3A 4PJFF 1LEKA 1YNLL 4ELMB 1L7IH 4MNHB 2GJZA 3VGEA 1ADQA 1QRNA 4WFFE 4XXCC 2DQTH 3QXAA 3S6CA 1ND0A 2XY1A 1RIHL 3SO5A 4OI7A 1NLDH 1IM9B 2XFXA 2Y1VA 4JPWH 4HCRL 4FXLA 2EKSB 4HFUL 4K8RL 4O02H 4O4YH 4NZJA 1MCJA 3L5HA 2HTLD 5DJ0B 2E6QA 4NKMA 4LHUB 1U8JB 3OXRA 4OLWH 2YRPA 4GXUN 2PW1B 3ARGA 3SDDB 1NEZB 4LIQE 4JDTH 1UZ8A 3MRIB 1WFOA 5T1LD 5D72L 3MRJB 3K4ZA 5DURB 2A9NH 5EO0B 1ACYH 3ALPA 2BY0A 5A1AA 1OP5K 1EHXA 2XG5A 1FPTL 3HI6L 4UT6L 5J12B 5GS3A 1U42A 1F11B 1QBML 2LFGA 4HAFA 4Y4KA 2ICWI 2P46B 4G9DA 1HINH 2FJFB 5IFAL 5B38A 4EQ2A 4L9DA 5CJOH 3V0VA 3DWTA 4LLQA 5EUKA 5CJQL 5E5MB 2V2TB 2YZ8A 1S7WA 3U7WH 3VXTB 4QHUB 4RAVB 4KK9D 2F53D 5DHVH 3HAEG 3OKYA 1IGYB 1ONQB 3E6FB 3EO0B 2XWBB 1KJ2L 2VQUA 4PUBH 3ES6A 4I0PC 4QT5B 2RGSA 3RWGA 1JGEA 1Z3GH 4F7MB 2GITB 3WSQH 3S4SA 2BVYA 5BVJB 2VITA 5JNYB 5F96L 1LO3L 5K9JL 4JQVA 4OZIF 4NNPH 3FQTA 4CGTA 3CLEL 5DK3A 4OM1H 3QUMB 4KY1L 2BVEA 2X4PA 5I8OH 4BELD 1AXSB 4G9FD 4WDIA 1PKQA 3QEHB 2YUWA 1AGFB 4P4KC 3V5KA 3ROLA 1IKFH 2ADGA 2QR0A 3VXRE 3FB5A 2AJSH 4UB0H 3WFHA 2AEPL 3ISWA 1EK3A 4RDQF 2NY4D 1MFCL 3C09B 1UEMA 5F9WC 5FYLH 2HT3D 4YHPA 5C0CB 4NIKB 4EUPH 1KIQA 3VG9B 4G43A 2HA1A 1ZA6A 3DNKA 4XXDB 2X4NA 2ZWLT 4HIJB 2EEBA 4QEGA 3T2NH 1FL6B 2P24A 2CXKA 3ZKND 4KKLD 2A74A 1PG7W 4LASH 3O9WD 4UNUA 1XMWA 5SWSE 2A6IB 5EZIL 4H5SB 1MJ8L 1P1ZB 1RHFA 5EBWB 5HI5D 2YXFA 4LCYA 2VR4A 3OXSB 1G7MB 5EUOE 1OGAD 2LABA 4EI6B 5GZNC 2D7MA 1CTNA 3LPWA 3O8XA 3MMEB 2R1WB 5BS0E 2B5IC 4YLQT 4HJ0C 4MNQA 3DVIA 3DECA 4OD2B 1A64A 3MRBA 3HNTL 3RGVC 2L7UA 3C9NB 4HZAA 3SE4A 4U0RB 2E6PA 3WHXA 2GFBB 2VDKL 2P8MA 5D71H 2ZUYA 4ACPA 1WTLA 1KB5L 4FQHA 3RWEB 5EU5B 1T80A 4NN5B 4GS7C 5CZVL 3KLHD 2NY0C 3ZDYE 1RMFH 1NKRA 2JB5H 3EYFB 2EDNA 4LQ1A 1FFOA 3TPUA 3NCEB 3G5YB 4QRTB 4TQEH 1U3ZA 3VGAB 2IEPA 1E6OH 2IADA 4DKFH 4NJAL 3TA3B 2X7LA 1FG2A 1CR9L 2AJ3A 3FO9A 5AZ2H 4R0LC 5I1JH 5F3HA 1TIUA 2FX7H 4P2OA 3S34H 4Y5YC 1F6FB 3TO2B 3KDMA 1RURL 2I9LB 1UKQA 5KSAB 4NRZA 3V8CA 5L8JB 3NTCH 4L8BB 1UWEH 3OBAA 4JFEB 5IBLD 1G7QB 4PJFA 1EEZB 2YBRA 1IQWL 1MHCA 2DI9A 4DEPC 1N0XL 2E5EA 1I7RA 4L4TB 5T1KA 5E6YA 4ETQA 4HWZA 1E27B 5HGAB 1A6TA 4YC2B 3MA9L 4ODUB 3P4NA 1N8ZB 3GK8H 1KTLA 2BRRL 4JFPA 5IFJA 1LEIB 3LS4H 2Z35A 4QHMA 2JIXD 4JGJA 5M7QA 4U1NB 3PQYB 3SQBA 4U6YA 3ZE1E 3ZKSD 4HKBA 2JJTA 5B21A 4NNXB 3GSWA 4IRSB 4QRRA 4KQ3H 4A2MA 1FYTD 4MNGA 4PJHB 1HH6B 3F8UB 4L29B 4UUJB 5IROA 3QSKB 1HNGA 4YUEL 2OS7A 4FQ2L 1IEAA 5JDJA 2BVPA 5GGUB 3JSSA 2EXYC 4EDXA 5LGJB 1T1YA 1MHPH 5DD1H 2R4SH 2DQFA 3MLZH 3GO1H 4QKXB 2FGZA 3BDBA 3S36H 1UWGH 5JORB 4NZDA 3H9SE 1S9VB 2HFGH 1C5BH 1TJHL 3O2VH 4JM2B 3HE7C 2IPUK 3HZYB 3DTXB 1WISA 3QR2A 1DVFB 2IG2L 5DEGA 5F89B 5BVPL 4OZIA 2VN7A 5DVMA 2VC2H 4P46C 5DJXA 2YSSA 4GG6B 3FOMB 3I9GL 3DBXB 5I1EH 4G42B 3AB0B 5L0QB 4LQFH 3BD4A 4YDJA 5F97E 3E0GA 2V7NB 3QP3A 4IS6A 3MRPA 4B41A 1ETZB 2ICES 1NANI 2MTPA 1HQRB 3NZ8A 4LP5A 4MD4B 3LN5A 4OZ4B 5JOPE 3TN0D 4QF1A 1J88A 4KK8C 3VMOA 4JFXB 1UT9A 3MJ9H 4UTAL 1A5FL 3A6OA 3PWVB 2H6PB 8FABA 3SDCC 5IBTH 5HYEA 4HC1A 2X89A 1K8DB 4PJ7E 4TPRH 4CVZB 5JXEA 1JPST 4QO1A 3GI8L 4E41B 4KXZI 4HUVB 4XNYL 3H8NA 3T09A 3RZCA 5CUSH 4BK4A 2G5RA 5HVGB 2OR7A 1MCEA 1IEHA 2ARJQ 4KV5E 1DBJH 4D3CH 5IWLC 2NW3B 4EOWH 3MJ8A 3F7PC 4NO3A 2A6JA 1J9CT 2YC1A 3HE6B 2GEEA 4U1LB 4P49A 3SKMB 3IDYC 4JFZH 4MCZB 5HGBB 3IVKB 4HDIA 3A6CL 3C2AH 1R5WA 1RULL 1JL8A 1XF3A 1NBZA 3OAUL 3WNNA 5E9DB 4YHIA 3O6LL 1RUKH 2BSRB 2GQHA 1QBLL 4OUOA 1M7IA 3Q6FA 3KXFE 4PJBE 4PB9H 2LVEA 4M1DL 3UTOA 3E1F1 4GW1A 2CLRB 2XWTA 3GMRA 2B4CC 2R0KH 1GGBH 4P5KB 4DQOL 3O6MH 1DQMH 2CDGA 1H3UA 2IPKB 5EBMA 5C07B 4LCWB 4P3WA 3QRFM 5E2WH 1QUNA 4OZGB 4WUUE 4JANA 3O45B 5GISL 3U9PL 1W0VA 2NY5L 2CRIA 2CUHA 3P9MA 3V6FB 5IEHB 1CFTA 4D9QE 5CD5C 5D1XC 1O0VA 4Z0BH 4HS6A 5MEQA 4EN3B 1NDGB 3CSBA 4AIZA 3UTPE 3TNNA 5FGBA 3AREC 5EC1B 5FUCE 5D7IB 5DJCA 3QCTH 2WINA 5MEPB 5FCUL 1UQSA 4I48A 4NQDD 3HKFA 4JO3L 5L9DL 1I75A 4LL9A 1LO0H 3B6SA 3OZ9H 1YA5A 3QDHA 4G80B 1BAFH 4TUKL 1JWUA 1BVKB 3X3GH 3ZLQC 3OB0H 3OKLB 2W9EH 3VH8A 3FJTA 5J1AB 3VRIB 2OX5A 2EXWC 4OSUL 3VXSB 4LSTH 2PXYC 1J11A 2BNUA 1DLFH 4PJAB 4Z7UE 3ZT6A 1LE5A 3CDCA 3DXAD 1N59B 4H20H 3GNML 3K7UA 1ED3A 4I18A 1A1OB 3NVQA 2IFFL 3BYYA 5T1LA 1DBKL 5KZCD 1J8KA 4C55A 2C3VB 1KJVB 1HZHL 5F1OB 1Z0NA 2CQVA 3PDDA 4PGEA 4WFFD 3O41B 3BZ4A 4DW2L 1P5VA 3ZYJA 1D5IL 1RJYB 3DV4A 1OTSC 3VFPB 2Q7YB 2BXYA 4X98B 1QNZH 1NSNL 4FXKB 1U8HB 4UQ3B 4WTZG 4N0FA 5MEOB 5I16A 4MA1B 4LCCA 3QEQE 4RIRB 5GGTH 1MFAH 2I9TB 3UTZA 1IL1B 3C5JA 5F72S 4P2RD 2ZJSL 1DBMH 3L5XH 2F53A 4HG4K 3DGGB 3V8OA 5JLZA 5F7MC 2ADIA 2B1HH 2BSTB 3DRQA 1I8MB 2YMXH 1CLOL 3VD7A 5TF0A 4KJQD 5F1KC 5DD6B 4H1LG 1E28B 4OGXL 5C86A 5IFHH 3CDGA 4X6FA 5F6IB 2I60H 4PV8A 4XNZC 3UTTB 1KN2H 5AUMB 4G9FA 5MEND 5T3XE 1SMAA 4M48H 3O6FB 4LEXL 1HHKB 1MCRA 3QUKB 5AEAA 2PR4L 4R8WL 3SKUD 2J8UE 1QFUH 4OLZL 1DN0B 2B39A 5FDWA 2AAVA 5HD8D 4X6DB 5DJZB 2NR6D 2VISB 4OD3H 1SBSL 2IH1B 2JJVA 1CLYH 2AQ1A 1JZ2A 1WQVT 4ZFZA 2J6EA 4AIXA 2UVEA 3QIBB 1KB9K 3TBSB 4G7VH 1HOCB 2OXHA 4P2QB 3RVUD 5GRJL 3EDDA 1DBAL 3O9WA 4QRUB 5BOZG 4OF5A 2W0LA 4TTDC 2QADD 4UV7L 4DKEL 5C09E 5HVHC 3R0NA 1QP1A 1UXSA 5CJ5A 2LU3A 3EO1A 3T3PF 3QIUB 1ES0B 2I24N 3UJJL 1OGAA 4KVNH 4KK5D 2UWEF 1L7TH 3RNKA 5J11C 2AJYL 3F58L 4AENA 3KPMA 4JFYA 2IALA 4HK3N 3LN4A 4P3DA 5D1QD 5J13B 5J56B 1U6AL 1N6QH 3F6IA 4O5LL 3P3YA 4PV9B 5C8JB 2NXYD 2WIIA 3H2WA 3RNQB 5FO7A 4ZAKC 4WU5A 2LQRA 1MLCA 5IVOA 3Q0HA 2VABA 2ADFH 2RBLA 1HK6A 3GSUB 4LHQB 2B4CL 1MFBH 1R3JA 1S7XA 2I27N 3QDMD 4GBXB 4KK6D 3EKCA 4KZDL 1S7TA 4ZSOB 1I85A 3WFDH 5I2IA 3BEWB 5CJ8A 3K2UL 3L95B 1AXTH 4QNPF 5I1CH 5GQBA 1KNOA 5ECJE 3SE8L 1YYML 5HYSA 4H26A 4NJ9L 3ZHLA 1T0NB 4KROD 4BQCA 2F74B 1ZLVH 1KJ3H 1P7KB 4R7DA 1J1XH 3W0WE 2V5MA 3SDAC 2A6DA 2GCYA 3T4AB 4CBPA 5CHNA 3QYCA 5TDPB 3QUMH 3UO1L 4LSPH 1OCWL 4M8QA 1I8LA 3UJTH 5KS9B 3QFJB 3TF7C 4I3RH 4JLRB 1L0QA 3PJSA 1UB6B 1RVFH 4YO0B 4ZTOH 4ZNEE 2KH2B 4HHAB 2RHEA 4PJEF 2JELH 1KPUA 3DO3A 1DQDL 1KTKE 2XQYG 3PWNB 3H9HB 3K74B 1OB1B 2BNRE 4N0UB 2JIXA 4X5XA 5IK3B 3VWKD 4PJXF 4HPOL 3N06B 4OUUA 5DVOA 1MEXL 1MCLA 1YEKL 1CFSB 4GRWE 4NBYB 4V1DE 3TM6A 2NTFA 1S9KC 2C3HA 3HPLA 4W6YB 4RAUA 4LFHD 2FWOB 3PWJB 4RWHA 4TVPE 2DJSA 1MPAH 3RPKA 2R8SL 1JHKH 3J7HA 1NGYB 3VFUA 4OTXL 1F3RB 5GSRB 4KTEL 1I9EA 4UV4H 3SHSA 3WV0A 2O5YH 3O0RL 4P2YA 3QI9C 4LPCA 1C1EL 4YR6A 1UACH 1NCWH 4XHJD 2J8HA 4BSJA 5F1IA 1XGQB 2H41A 1NBYB 3BUYA 3I6LE 3AXLA 3BP6B 3HRZB 3BGMA 3OJVC 1R5VB 1CBVL 5JW3L 1GVIA 2F19L 4LPUA 3UBXB 3DYMA 4K3DH 3CK0H 1MFEL 2XZZA 3WIIL 1RIUH 3U4BL 1YEFH 3ULSB 4GRLB 2AJXL 1HKLL 5FDYA 5KN5A 2UZYB 2FZ3B 3LEXB 5KVDH 5FK9B 3GBLA 2WWMD 2HTKC 5HGDA 3DX6A 5K33A 3T0BA 2FEDD 5F6HJ 1JZ8A 2HMID 2GY7B 2R0WH 1FNLA 3H9SD 1CF8L 4R4BB 4ZQKB 2KBGA 4TRPH 2Y5EA 3TN0A 1O5DT 3NCBB 4NC2B 2VLRB 3OKNA 4R4NC 3HC3H 3F12A 1FBIL 4K3JL 5D6DA 3FO2B 5DTFB 3BAEL 5E2TH 1H15B 3MUHL 2Q86B 4G6FD 2VUYA 1IEBA 2D0HA 2M8XA 2LAGB 4YXLL 1P6AB 3WJLC 2J5LB 4O2EA 1U0QA 1FFNA 1T22B 4I9WE 4JY6A 1MREH 1IT9L 2Z31B 1JZ4A 2V2WB 3BI9X 3AM8C 3U9UB 4JRXE 2X9WA 4UT9L 1KIPA 4R3SA 1JYXA 1BF2A 4J3OC 3RAJL 1IGIH 1PW3A 3MOQA 4LNRB 2UWEA 4URTB 4OV5A 1RHHA 3GKWH 2FEEL 4K7PX 3RVWD 4U1MB 4KRLB 3NACL 5JHDB 3O4OC 1ROWA 3X3FH 3TVMB 3AMLA 4FTVB 3GBNL 3R1GH 5DJ6A 1T6WA 4OZFG 5BMFL 4OCWH 1RUPH 1JWMB 5IBUB 1KN4L 3GSXA 5E1AB 2P5WE 3HI5L 4TSAH 2CO7B 3FFCD 3KNBB 3H42H 4QHLB 3T4YA 1WZ1H 3N9GH 4HUMB 5C0NC 4ORZC 2EH7L 3KPSE 3KXFD 4NQCA 3VRJB 1XGPB 1YEDB 5C6PB 3GSOA 1KCKA 4UIKH 4L1HA 3VFSB 3ZDYF 4WFEE 5ISZE 4PYHA 4K71C 2Z92A 4NQDA 4OT1L 4PJDF 4KRMB 1DDHB 4NQVA 5A43C 4WFHE 1CE1L 1I8KA 1OAKL 3BHBA 4D9QD 1QO3A 3NIFE 4HS3B 1JHLH 1T3FB 5E5UB 2QSCL 3TYGH 3UTPD 1J8HD 3DXAA 4M7ZC 2XKNA 4UINH 1BJ8A 1OPGH 2UUDK 4ELMF 3QO0B 3WS3A 4UILL 4KUZL 1S8DA 3KHQA 4OLXH 5A2IH 5AYUH 3U46B 3ARBC 4MQXD 1H0DB 4XMKH 4PJEA 25C8L 2MMXA 1UFUA 1TQBB 5GRYA 5A3IC 1CICB 1VFOA 4PJXA 5ICYA 3MOAH 2D7NA 5DEFB 3MRQA 3JUZA 1XF5A 3QFDB 2X70B 1TPXB 4HMDA 4I4WA 3TWCL 3V7AE 1DEEA 2W9DL 3GMLB 1DFBL 2BY3A 3X11A 1QQDA 5C6WH 4P2RA 5INDB 1OD7A 2QHLA 3BQUB 4IOIB 1PZ5A 1BPVA 1TETL 1V7NH 5DUBA 5TDOA 3LEYH 3DMMB 4JHZA 1M7DB 3ZE1F 4OLYL 3WKMH 2HVJB 1QFWH 3VE0B 3QG6B 4E0RA 1INQA 3JV6B 3MV9B 5FOBB 1KELL 2Z4QA 4KPHL 5B8CB 2DTML 2GK2A 3KPQA 4IIQB 5I8KH 4PJ5D 2P42B 3R06A 4YPJA 4K3HA 5MENA 2QHRL 4OF0A 1K8IA 3PL6B 5D2NE 3IDUA 1FVEA 3PF2A 1Q0YH 1CDIA 1HH9A 4Y19D 2OL3B 2E7LA 5FGCE 2AXFB 3QUXD 4RFEA 2RFXA 1A7PL 5LVEA 5BQ7A 1CFVL 1T2XA 3E2HB 4HKJB 3GDBA 4LVNC 1MCNA 3QPXH 3REVB 3WFZA 3OKMA 2AERT 5LBSL 2HT4D 3UC0L 1OP9A 1F58H 1D6VH 3VD5A 2AXGA 1Q9OA 3FQNA 2WZPD 4WHTB 4JQIL 3F7RA 1K4CB 3T0VA 1A7NH 1AXIB 5TQ2H 4JFDB 5GRXG 2CLVA 3D69A 5T3XD 1FE8L 2VDQL 4JPIB 5HPMA 2FR4B 1EVTC 2UY7A 3KYNB 4NZTL 5DK2A 4IJ3C 5E56A 4YDKH 5BZDB 3VDBA 1T21A 5AAWA 3FQWA 4YHKL 5EWIH 2BSED 1QA9B 4BQBA 2E3VA 2YD8A 1U8OA 1U8NA 1CZ8H 1X4ZA 2KZWA 5CZKA 4PJ7F 5GGRA 2QSTA 4QOKE 3D0LB 3GJFA 4Z0XA 1MVUA 4H8WC 3GBML 3BKCL 4NQED 2E27L 5EFIB 2OTUB 4JHWH 5D1QA 3D85D 5DQ9B 4QRSB 1F6AB 4ZDHB 2F5AL 1EHAA 3EJYC 1INEH 1A7OL 1VENA 4M93B 5C09D 3T3ME 1S7QB 4J23A 1IKNA 5HI4C 4DUVA 3FMGL 4Q0XH 4U1HA 1Y18A 1IGFH 3HPJA 3MLRL 4XNUL 5J9PA 1GZQB 3QDMA 3BP4B 3VFWB 1UEYA 2VN4A 4PJBF 4GLRI 1XZ0B 4NQXB 1E4XI 3BPLC 1I1YA 4X80L 1MI5E 3B9DA 1ZSDA 4NZRL 4CJ0A 4XC3L 3TCLA 1BOGA 3IFOB 3RU8H 4UIMB 4QHKI 3ZTJH 3MPCA 2E9BA 3F7QA 3F7YB 5EORH 3IRPX 4GUPB 4OBSA 3PWPD 4BQ9A 1WFTA 4PJDA 2D9QB 4NDMA 3ZKQD 4ZPVB 5ENWB 2PO6D 4WY7H 5IB4A 3D87B 3KPRE 4LLAA 1KPRB 1U8MB 4U05A 1S5HB 5DRWA 4WEUD 3WEXA 3RWFB 4L1DA 4N9GB 4MXQC 2XA8L 1TDQA 4O58H 5DS8A 4ODWB 4ZUUB 1FN4B 1G7IB 1BVZA 4BSVA 3IFPA 4XAWH 2YD1A 1CT8B 3MXVL 4PJGE 3S5LG 2X1WL 4GXUM 1YMME 3VXNA 5JPNA 1FFQA 3VFOB 1GZPB 1KCRH 1JE6A 3V5HB 5FECB 4NKIL 1XF4B 3DETC 3VWKA 2DQJH 3W0WD 8CGTA 2AKRB 1X44A 4LBEB 3QHZH 1GH7A 4PRPE 2BVOB 4Z76A 4Z7UF 5I1HH 2BMKA 1JUFB 3BO8A 3JV5A 4UZGA 3IFLH 4XBEH 3KPLA 5C3TA 1EHLL 1UC6A 5E8OA 5BRZB 1HILA 4IDJL 4DUWA 4UU9A 4OD1L 1QLRB 2AEWA 1T7VA 1HXMA 3UTSB 2GAZA 3IF1A 3T04D 1UM4L 2NY3B 1AQDB 1OQXA 1SY6H 3Q1SL 3MCLH 2BNRD 3IKCB 5I8EA 1BQHG 2OZ4A 3C8KB 2JJTC 3P40A 5FB8B 3HZMB 1KYOJ 4JO4H 4J3WA 4XZUB 5F1NB 2H2SD 4V1DD 5T33H 3ZE2F 5F9OL 3BE1L 1I8IA 2R29L 3B8SA 3VFRA 4YPGB 1P5UA 1G0DA 3LKPB 4P57B 4XP6H 5F21B 5IHZA 4GW5B 1A6UL 3BFOA 4XWOD 5JZ7C 1U58B 1NGXA 3C08L 3GMOA 5T3ZE 4WNQA 1F4XL 4NN7B 4JM2F 1G0YR 3OX8A 3CXHK 3Q3GB 1JTPA 1OSZB 4JKWA 2R2EA 3CFKA 1F2QA 3KPP