4AG4H

Crystal structure of a ddr1-fab complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
215
structure length
209
Chain Sequence
QVQLQESGAELVRPGASVKLSCKASGYTFSISWINWVKQRPGQGLEWIGNIYPSGGYTNYNQKFKDKATLTVDKSSNTAYIQLSSPTSEDSAVYYCTRGYGHLDYWGQGTTLTVSAAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYSLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPITHELIAL DISCOIDIN DOMAIN-CONTAINING RECEPTOR 1
publication title Structure of the Discoidin Domain Receptor 1 Extracellular Region Bound to an Inhibitory Fab Fragment Reveals Features Important for Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/transferase
total genus 39
structure length 209
sequence length 215
ec nomenclature
pdb deposition date 2012-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ag4H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ag4H02
5ENWA 3LH2H 4O51B 5EBWB 3GSUA 3HG1B 3QUML 3G6JF 1WAAA 2FX8H 2JIXB 3EYVB 1RZIB 2VDPL 4G7YL 2QSCL 1JZ5A 2ICES 2XY2A 3LV3A 1FSKC 3O8XC 4OZFA 3AY4C 5I16A 5D7JC 5C0BE 3U0TB 4HLZH 4XP6H 5DTFA 3NZ8B 1XFPA 4PRAA 5TQ2H 3O6KL 3VG9B 3CMGA 4KDTC 3HNSH 3RHWF 4FZ8H 4OSUH 4FG6C 2EDNA 1RUPL 4OLVH 4OLWL 4L5FL 1AO7D 1EO5A 2GJ6A 3RL2B 3BEWA 3R06A 5IM7B 1UQSA 3O9WB 5F1KC 4ONHB 3FTGA 5E95B 5LCVL 4PJHE 4RQQA 4IOSD 3S98A 4LHQB 2SEBA 4UT9H 1YYLH 2YMXL 2HJKA 1T1ZB 1DBBL 1SM3H 2FX9H 1LDPH 3OJDA 4U7KA 3RNQA 1MY5A 5KVDH 1HWHB 5EU3B 1U3JA 3BIKA 3WS6C 4PS4H 3BP7A 5IW3A 5DHVH 3BXNA 5CZVL 2AERT 3I6KB 3PWNB 5CZXD 5A3ID 5EO1B 4UQ2B 5KZCB 4KPHL 1X7QA 3V4PL 3MUZ1 2W9EL 3W9DA 4C55A 5MEPB 2AJZB 5IOPB 2FEDC 1VACB 5JXEA 4AEFA 4U0QB 3QNZB 1JMXA 3N1QC 3LD8B 4XNZC 1UH4A 1UC6A 2ED8A 2DYPD 1HSBB 5FOBA 3RTQD 3RWEB 5HGHA 4DW2H 1JWSA 5D1ZB 1GGCH 1UXWB 3HE6C 1BVLB 1KCSH 5EA0L 3QIWA 4OJFH 2XN9E 4P3CH 3ROLB 4N90E 2DMKA 1UXSB 4ZUVA 3JV4A 1VFAA 3ARBA 3TJEL 1A3RH 2WAHA 3V5DB 4KVCL 1W8OA 3IXTB 5E1AA 3T2QA 1TVBA 4UV7H 4LMQE 3EYFA 1WBYA 5FM5M 3I02A 2DLGA 3KLHC 4EVNA 4X6DA 2HKHL 5ITBH 1QLRB 3FKUS 3ES6B 1I7UB 3BPLB 3C6LD 2YA0A 2Z8WC 4KRPC 3VFRA 3MROA 3WD5H 1VESA 4CADA 1IT9L 3RDTB 1D5IL 3UTTA 5GS0L 2CMRL 2GT9B 3M17B 3FQUB 1KJVB 3CC5B 4F8QA 3MJ9L 2D0GA 2DI7A 3GSNH 4M7KH 5K33A 4XBGB 4D0DB 4LVNC 3MLTA 4A2MA 4YK4C 1CWVA 4ELME 3WFEL 3NFPB 3P2TA 2ZUUA 4JJHA 4WV1B 4Z78A 4KI5E 3TZVB 1BIHA 4RFNB 4XXDB 4LSSH 4ZUSA 4HK0A 2YZ1A 3O8XD 4JLRA 1J1XH 1UJ3B 1T1YA 3QDMA 4M1DL 4P46C 4YFLF 1JGEA 1JPGB 5D7JD 3H7BB 2XZQH 3U9UB 1I1RA 1ZT7B 1NGQH 2GFBB 2CLVA 3W0WE 3QO1A 4TUKL 2VXTL 4FG6D 4QRPB 3RY4A 1ZANL 1S7RA 4X9HA 4K71C 5D5ME 5EULV 1KCVL 3BP5A 1FV1A 4XX1G 5MHSE 4HLZG 1BPVA 1R5IA 3H42L 1FBIH 2CKBL 2FIKB 5CJQL 4LVEA 5T5FH 2IMMA 1CDBA 2RBLA 4IOIB 4JFEA 1JP5A 2ADFH 2GCYB 5L2KA 2CRZA 1N2RB 4NOFA 2EDJA 2UY7A 1OF2B 4P5TB 5I8CA 4Z7VA 2VTFA 2VZ1A 4GQPH 5ISZB 1NUDA 5FHBH 4LCUA 3STLA 5EO9A 4K3DL 4FRWA 5KOVC 3IETA 5SWSE 3ILPA 2R1WB 2FEDD 1J1PL 1T22A 4WGVB 3TVMC 3NH7H 1E4XH 2N56A 3VFGH 1J12A 1XCTA 4PP2B 5D7KE 5C0AA 2IQAB 1MRDL 2XPGB 5C0DB 3HE6D 5BS0A 5ID1B 1MFAL 5F7HA 1D5ZB 1P7HL 3HCVB 5H35A 2DQJL 4Y5YA 1MHPL 5I73B 4OZHA 1MNUH 2XWJA 32C2A 3GMPA 3WUWB 5HHXL 3FT3B 4NZDA 4X8JA 4HEPG 4ZODA 2W07A 4XP1L 1LNUA 4QNPF 2BRRL 3IAPA 4MCZA 3WL9A 2AJYH 4YFLI 3D0LB 4YHKL 2Y25A 1BWWA 1CD1B 4JHAL 4BZ2L 3KDMA 4YAQA 2VKWA 1RUKH 3BISA 2DL2A 1S7SA 2BMKB 3BH9A 4LSVH 3TPUA 3D0VB 4RDQF 3KLHD 1TZGL 4Z7QF 4X4MA 5ESQA 1FP5A 4NUJA 1ZSDB 5BRZE 1IGTB 1HHIB 2HVKB 4RDQG 3RX7A 1RIHL 1MELA 1YMMB 5JQ6L 1OP5H 2W0PA 4RMRA 4KRPD 1MJ7L 4ETYA 3HZVA 3H9HA 3D39A 3MUGB 3O6MH 5DJ6A 3FFCA 5JPNA 5HHQB 3MRQB 4U1NA 3KYKH 5FYJD 3DTXB 5F8RC 2MQ0A 4GAYB 3ZT7A 1YC7A 4MQ7A 3BSZL 3RZWA 4BQCA 1GIGH 2X9XA 4TVSa 4PTTA 2VDLH 4CVUA 4P23C 4YHMH 4BFIA 1OGTA 4Z76A 4K7PH 1G0DA 3CU1A 3CFEA 1N3NA 3LQZB 3D25A 4MNGE 4ZS6C 4P46D 5I71B 3MRJB 5C07D 3T1FB 3K2UL 1S9VB 1JGUL 4X6CB 2BDNH 4QRTB 4AENA 5INDB 3RAJH 1EHLL 1MPAL 5HI5C 1K8IA 2MOVA 1ZA3A 4P5KB 3PL6A 5F3BB 2Z35A 1T2XA 4G8IB 4JE4B 3W39B 1MCPL 5DWUH 5LG1A 3UAJC 3SBWA 4PGBB 1Q8MA 1X5JA 5FKPA 1MCWW 1IGMH 2C5DC 2YRZA 4QGTA 1RJYA 2FEEL 3QHFL 2FBOJ 3P77A 35C8L 2YPLA 2XNAB 2E6QA 1L6ZA 2DYPB 3VFSB 3RTQB 1RZGB 4ELKB 1P4IH 2R2CA 1IM3B 2V7NB 4NO3A 3X3GH 2V2TA 5IEHA 1S9YB 2H32A 3NGBB 3ZYZA 3VD9A 1LEIA 4EN3A 1A7OH 3RNKB 3O3DA 4N5UA 1KJMA 1D6EB 3CCHB 4JM2F 2QBWA 3TVMD 2AS5M 5CP7B 3QJHB 2PW1A 3TYFA 4PRID 5HHPA 2OQJA 2A1WL 1TJGH 1OP3K 3P73A 3UROR 1MCWM 3U7YH 1VB9A 1NAMA 3E8UH 4ZG1A 5E9DE 4JY5L 3Q6GL 3MNZB 4G9FA 3KPSB 1KIRB 5TFSL 2H3NB 3DX6B 3GMOB 5HYSB 2IFFL 1T2JA 3GSQB 3PV6B 2FSEA 3OF6D 4P9ML 5JO5B 1RZKC 3FFDB 3V52H 5CINL 4I8DA 3C60C 1INEH 2ZKHH 4X0KA 5KSBA 5E56A 2WV3A 5DRZA 4PJFF 3MJ7B 4F7PA 1OM3H 2CO6B 2H26B 5I76B 2FR4B 1U8IA 3MRBB 2X4UB 1FSKB 3UZQA 5SWZE 1ZHNA 2BVPB 4KI5C 4YXKL 4PJGB 1PKQB 2FJHA 5D7JB 2YS4A 1UWXH 4M7JH 5HBBA 1QUNA 4G3YH 2R2BB 3SE4C 1SEQL 4JFXA 3BWUC 5JW4Q 4YHLH 4WHTA 1EZVX 3INUL 4MMXC 5FO7B 3QQ3B 3S37X 4LPCA 4U6TA 4L4TE 4Y4FA 2DKUA 1GJIA 3T04D 1DLHB 2GAZA 4TRPL 5DGQA 3KJ6L 1MY7A 4P23D 1UZ8A 3HNTL 3MGOA 4OCRL 5JORB 2ZUXA 3GKZA 3UTSD 1YEJL 3HS0A 4XPTL 4YDVA 4ZS6D 3MLYL 4ZTPH 2WWMC 1J8HE 1U2HA 5D1QC 1YJDC 4JFYA 5C7XL 2Y7QB 1TFHA 3V5HA 5M94B 1Q94B 4JFDA 5D2LE 5HI5D 2IANE 1E4XI 4PLKC 2XWTB 1GHFL 4LARH 4I18A 4QHLA 5A2JH 3EFDH 5EZLA 3LN4A 4YJZL 4XPBH 3CFIC 5LQBL 2GTZA 3O3EA 5TDPA 3Q6FA 4YE4H 3D9AL 3QDJA 4ODTH 4XNZB 3WO3B 2F53D 2FX8L 3ECBA 3GSOB 4Z8FH 1N8ZA 2BVOB 1VGEH 3UBXI 3C5JA 4JZJC 3HE6B 4Y88A 4GRWH 3BFOA 5H94B 3T0EB 4F9PC 3GJFB 1EDQA 1G7JB 4H8WL 1BF2A 1XR9A 4CNIB 1YECL 1JWUB 4HIXL 3ROOB 3HZKB 4NQED 3QI9B 4M48H 3MJ8A 5CHNA 2ATKB 1BD2E 3ZDZF 5C09E 1WIPA 3QSKB 2HKFL 1TETH 1YYLL 4CDHA 2OK0L 4D9RD 4PJ7B 5AD0A 4J1UA 5IFHH 5TDNB 3ZDYF 2HN7A 1P69B 1XCQA 4LEOA 5KVDL 1U8KA 3LEYH 4GKZB 5D7LA 5GGVH 5FM5O 3VWKA 1QVOB 1SEBB 4KRPB 3PQYD 1WT5A 1JMZA 1TCRA 2EDFA 2EYTA 1OD9A 3V7AE 2AEPH 4RSVA 4LBEB 3G5YB 5L88L 4A2LA 1NL0L 3V9FA 2L0DA 1X5AA 4YK4B 3C60D 5ACZB 1S5HB 2MQ3A 1CGYA 2PYEE 3HR5A 1C5DB 3H8NA 2Y5TB 4M4PA 5D7IA 1BVZA 2J1KA 3IJSB 1A4KB 4IHOB 5IQ9B 1F6AA 1NCBL 1K9TA 3HUJB 1D5XA 4DTGL 5DJCB 3WJJA 4PJCE 1KCSL 4UQ3A 4AZ8A 2FYYA 3QA3A 5C07B 5EU4A 4Y4KC 4Y19E 5D8JH 3RI5F 1NCNA 4C83A 3MYJB 1MVFA 5AAMA 5CEZE 4BQBA 4OZ4B 4IIQC 3TBSA 4JO2H 3D87B 3QXDA 3VRIB 4IRZH 4K71B 5T1DH 1IC1A 5IHBA 3ZYOA 1ZT1A 1A6WH 4HKBB 4A6YB 2FJGA 3A6CL 3PP3H 3F8UB 3SCMC 2WWMD 5DEGA 5CJXC 1AFVL 1BQHB 1TPXC 5DLML 3L7EB 4X99B 1QFWL 4QOKE 2AXFA 2WNGA 1XF3A 4PLKD 3VI4F 4I3GA 2JTDA 4CN4A 2EIBA 2AJUH 1JNLH 1T3FB 3CXHK 4GJTB 5IMOB 2N4IA 2VQ1B 4XVJL 1HYRC 1BQLL 4P5MA 4R3SB 3RZCC 3VXNA 4GAJL 1BAFH 3V4UH 3CK0L 2DICA 2V7HB 3IFPB 1YEHL 2FX7H 3TVMB 4YUEH 4MA3B 3X12A 4U1GB 2IALA 4ZO6A 4YDIL 4LSSL 4AT6A 3BYYA 5SWSD 3IDNB 1JF6A 1QNZL 4KQ3L 3RIFK 2CDEB 5I0DA 2JK5B 4NQSB 1J1XL 1YPZE 1V7MH 15C8H 1DVFC 3I2CL 3IT8D 1A21A 3TNMA 2GIYA 3MLPA 4GRWF 4QXGL 4N8CH 4LLUA 3X13A 1JPFA 5IWLA 5D96B 4FQHB 3QHTC 5AWNL 4WWID 2VE6B 1EK3A 4PJHF 1MLCB 4RMVA 1EJOH 2H1PH 3EDEA 3CJJA 3BD4A 1XF5A 2VUYA 5D1XC 5T1KD 4BKLB 1G7PA 5CP3A 5A2FA 5I16B 1NBQA 2VOTA 3MLWH 4WFHD 1X44A 5EOQH 4DKFH 1H8SA 4PJ5E 1FFPA 3VCLA 2YXMA 3K81A 4WU7B 3UX9B 1XZ0B 1P4LA 4YR6A 4RFOH 4WI4A 5C0CE 1LP9B 2GJ6B 2R4RH 3R06B 5DUBA 4JGUA 5GGUB 4WIQA 5DS8A 2J8UA 2GY5A 2SEBB 2HJKB 1HQ4A 3LB6C 3Q1SL 2O61A 3KR3H 4NZRL 3NH7L 3OJDB 3VFGL 4Q9QH 4P23B 4U3HA 4Q74A 3OKOB 2EDWA 4JRYE 3BP7B 3ARWA 2FLRT 4JKPH 1E28A 3BOVA 4OF6A 4CKVX 3ISWA 4M8QB 5BQ7B 5T33L 4F37K 5FHAL 3MLRH 5L2JA 1T1XA 5C08A 3LS4H 12E8H 3W9DB 1I9RH 2EKSB 1CFNB 2OCFD 3ZE1E 3SDXA 3WCYA 5DJ2A 1AD0A 3MCLH 1J18A 3U1SL 4JQIH 5KW9L 1W0VA 2AQ3A 4OZIB 4LSVL 1YNLH 4JY4B 3SCMD 1FFOA 1NBYB 2VDOL 4FFVC 1IGCL 3FT4A 3UPAA 4OFIA 3RPKA 3LKQB 4O2FB 5CIPA 1FN4A 3RY5A 1S9WB 3EOYG 1FL3A 3O6ML 3D1MC 5F8QC 3FL7A 3QIBA 4O2CA 1XGTA 3LRSA 3KPPB 3UEZA 2DJSA 4Y8DC 3RZCD 1FO0B 5IK3A 4X4XA 4XP4H 4PJBE 4X5LA 2FRGP 2GK0A 4JB9L 4NQEB 5DRXB 1ZHBA 3O41A 1L7IL 1G6RH 2DQUH 5MI0B 4Q9BA 4X6DB 5F7LB 3IYLW 3RPIA 3BZEA 2XG5A 4S1DC 3WIHL 2I9TA 4WJ5B 1FH5H 1WC7A 2C26A 1QFUL 5DD6B 5A40E 4K7PL 4NUGH 1EPFA 3U0PA 4JDTH 5HYEA 5IV2A 4YX2H 1EEYB 1I75A 4L3CA 4XPAH 3MROB 1QRND 5FUCE 3IAGC 2BDNL 1F3RB 1R3KB 4JRWA 3UTTB 4EEEA 1DBKH 3PQYB 1H9VA 3MV7D 5D5MF 4TSCL 2X41A 4KGJA 1AQKH 4EIGB 3O6LL 3VFOA 4Z78B 1DUZB 4TNWF 1FPTL 1IGML 2OJZL 4PBVC 4G8EB 4HK0B 4XHQA 2Y36L 3C60B 1FIGH 2E5EA 2NXZB 5FYJL 3GSXB 5LVEA 4LMQI 5D1XD 3JWOH 4KJPC 3QDMB 1FYTE 3K8MA 4K94H 4YFDB 5FDWB 4MXVF 1AC0A 2A9NH 4J23A 4U1JB 3N50A 3QO1B 4U49A 1UZ6E 2E7LA 5CSBA 1OPGL 1I4FB 3UCRA 3NZHH 3B9VA 3AM8C 3OR6A 4U1SB 1OAKH 3QZWA 1WFOA 2GW5A 4QKXB 3VFWB 2HTLC 3S3JA 2C3HA 2BY0A 3LB6D 4JFFA 2C7UB 2UYLA 4FS0A 4AG4H 5J11C 2OMBA 5T1MB 4PJDF 4H1LH 1XF2A 3NABH 3GMMB 1R5VA 3VFMA 5I8CB 2HG5B 1DQDL 1HOCB 4KZDH 1B0WA 2IMNA 4GRLD 3CFJA 4PGZA 1EVUA 5HHVH 5GRVL 2Y06L 2VLRE 4IJ3B 5EU7C 1U95A 4L4VE 3DXAE 1T5XB 1WBZA 3HE7C 1KJ2A 3QWQB 4P0DA 2B5IB 2DLHA 2AJXH 2D03L 1T22B 3C09B 4EUPH 3OXRA 1BGXL 2R8SH 1G7HB 1FNEA 1I3RA 1W0YT 5DSCA 2A6DA 5E00B 5KANI 2W0FB 5C0AB 3QR2A 1JPSL 3V52L 2EH8L 3DRTA 3LCYA 1A1MA 3LSOB 5IJVA 2RAMA 1INEL 4LVOB 4M9PA 3SDYL 4FFVD 4EOWL 3CFCH 4M1GL 1CK0L 3FQNA 2XWJB 4JFOA 4GG8A 2NY5H 4L8SC 3NIDE 3X11A 5CUSL 3LN5B 4MAYA 2Q87A 1X6NA 4M7JL 5E5MB 4ZSOA 2RR3A 5DD3H 5IIEA 5A2IH 1T89C 3L5JA 1XGYL 3TPUB 3GHBL 1VADB 3RVWD 3K80A 1VFBB 4S1DD 1Y18A 4PLJD 4ACPA 1RURH 3G5VB 2JJVA 3HC4H 5IBLC 2A6KA 1R24A 3WNLA 3EO9H 3SGJC 1IC7H 2P8LB 4AIXA 4HS3A 4U1HA 4P2RA 5CZKA 2X7LA 3HZVB 1MHCA 3H9HB 3TYGL 3PIQA 5FF6A 1TTFA 5C09D 3TNNA 2W9DL 3W5MA 2OXHA 5CJOL 4G6ML 4YO0A 2YA2A 3QJFB 4E0RA 1HHHA 2CQVA 4RGMB 4KVNH 1OL0A 1I7TB 3EFDL 3O3AB 1OCWH 2BSED 5DT1L 3BIAX 1RMFH 2N1KA 4K9EL 1D6VH 1OGTB 3TCXA 5E8PB 4E42A 3CFEB 1N3NB 3E0GA 4KJPD 3VJ6A 2WLZA 3J8F7 3P0YL 2X4TA 4HG4K 1J5OH 3IDJA 1MFCH 4ZNCD 4O9HH 4N1CA 5GXBB 3RU8L 1B0RA 3F7PC 4YEEA 5BO1L 3QT2A 5IVXF 1K8DB 3OXSB 1T7WA 4FZEH 1GGBH 4ZYKA 1CFTA 1DQQA 1JPTH 1NDMA 5FKPB 5I1JL 3RWHA 4HWZA 5EOTA 2HTLD 4PGJA 3BD3A 3JV5A 4IIQB 1U6AL 4PRNA 4QHUA 1HNFA 3CZJA 4NHUA 4K3JH 4Y19D 5TE6L 1QSVA 3AROA 1KOAA 3CDGB 3CLFL 3BH8A 2AXHA 2K7PA 4OB5H 3S3PA 2D3VA 1DQML 1YN7A 2ARJB 2W59A 3SCMB 1ITBB 3QEHA 4DCQB 1KBGH 4C56D 3NCCB 1Q72L 4XBEH 3LEYL 1F5WA 2ZG1A 4HWBH 5I8OL 4NRYA 2EIEA 5T3XE 1T21A 4H1LG 1KJMB 5J12B 2VH5L 3HE7D 2F15A 2B2XH 3C5ZC 4Z77A 5DK2B 1MIEL 5BXFA 4XCFL 4MJID 1T5WA 1J0JA 5HHPB 1I1YA 2OJEB 3QXAA 5DVNA 1E6OL 1CGSL 5HGAA 4PB9L 2MCPL 1FO0L 3D3VD 4XP5L 4LSUH 2VLJE 5JMRA 4G80B 1QR1B 1MCHA 3HMXH 3WYRA 4K2UH 3MRGA 4Z95H 5JDSA 3P4OA 1U8QB 3T77A 4AIOA 5CEZH 4JO3H 1QRNB 1S9XB 1CCZA 2P24A 5D8JL 5I66A 1YEKL 3EW3B 4MNQE 4LQFL 1BLNA 3MV7B 3KWWA 2XXCB 3B2VL 1SJEA 5EOCH 1ETZA 5FUCC 2EH7H 5B3NA 1EERB 5T1DL 5IBLD 1SJXA 2IADB 2K9UA 1A6WL 1Z3GH 4MDIA 2VC2L 2XG4A 3P4MA 2VKXA 5C0IA 2Y9RT 1ZHNB 5D1XB 1IEBA 5FA4B 4M93C 3VXMD 3C8DA 3SE8L 1PYWB 3ZLQC 5JA9A 1A6VL 1SYSA 5FEBA 3SKOA 3DVGA 4JFXB 1Q9WB 3G6AB 4KMTH 4NZUH 4ZQKB 1BOGA 1JF1B 5CSGA 5F1OB 3MRRB 4YPGA 3MA9L 5FK9B 3MRMA 2VMFA 4ODXA 1UH2A 3CX5J 3FOLB 1FZKA 2HA1A 1LHZA 1AGFA 3TBYB 3K8KA 4JVPA 4YBQC 1Z2KA 2OM5A 1NCTA 2UWEA 5TH2A 3EDJA 2YK1L 4JFYB 4JPIB 2OR9H 5ALCH 3V6FA 4UDUA 4Y2DA 1KPRB 2DS4A 2VXVL 4DN4H 1WAAE 5F7DB 4OCSL 4GRLB 4R4FL 3PXJA 4Y5VA 4NT6B 4P2OA 5F1IA 1AE6H 3B4NA 1YJDL 4Z7WA 3FT2A 2YPKA 2EXWC 2YEZA 3BAEH 4GMSH 2BY1A 1GOFA 5EU6D 5F6HI 5TDPB 2M26A 3U0WL 2VABB 4X83A 1PQZA 3QEQE 4I2XB 3OPZL 3WKNA 5DR5L 4XVSH 3ECBB 1EJOL 3VI3E 1OWRM 4S1SH 3UJIH 1W72H 3C5JB 3GI8L 5JLZB 3JUZA 2FD6H 4ZO7A 4XI5C 3ULUE 4K7PY 3UTPE 4WHDA 5EOQL 1A7QL 4RFEA 1MEXL 1X3DA 5E7FA 3WNOA 3OX8B 1CDJA 2C3VA 3C5ZD 4FQJH 4S10A 3O3BA 1IFHH 2XQBH 1I8LC 2H41A 1XIWC 4B53A 3TH4T 2E9BA 5KVFH 1AXSA 1DQJA 2R4RL 2XZCL 3HAEB 5KVEL 3T0BA 4PJXA 1NEZA 2RHEA 1GAFL 2XFXB 2AP2A 3GO1H 3QFDA 4KKLC 3F7YB 4XBPA 3T3ME 5AD0B 2XA8H 3AVEA 1XCQB 4PBXA 4MQTB 2CJUH 4UOW1 1U8KB 1LK3L 5LGKA 3MO1B 4NSKB 3SOBH 1NFDB 4NO5B 5TQ0H 5FYLD 3K1DA 1CD9B 4WFGD 2OL3H 5HYJD 1AD9A 1S7UA 4YLQT 4IDLA 2YSSA 3SPVA 2CK0H 3WHXA 1FNLA 3S88H 3FAWA 3UTZB 5ICYB 4ZTOH 2GITB 2VLKA 4K55A 1WZLA 3DI3B 3V6OC 43C9A 1NC2A 2NY0D 5J3HD 4JQIL 4TVPD 2X05A 2DM3A 5BVPL 5D7IB 5HJ3A 1N5AB 5I18H 1F6AB 4JHWL 2EE2A 5EBLA 43CAB 1GGIH 4KGLA 3QA3B 3CZFB 3IDUA 3AS1A 3FO9A 4Y5XB 2P7TB 1NGPL 1CXLA 2ZCHH 3C5SA 1QBLH 5F9JA 4ESKA 2Q6WB 5HGBA 1DZBA 2WINA 1H3UA 2ZSVA 4Y1AD 4F2MB 5IB1B 3IFOA 4H26A 2FL5A 3ULVE 4M61A 4ZUWA 4BZ1L 3FQTA 4YBQD 3AGVA 2J5LB 5E1HB 2DN7A 3IVKA 3MXWH 5DEGB 1ZV5A 1VEOA 5KVGH 4QTIH 2HJLB 2WIMA 2VAJA 4OKVA 5FYKU 1XF3B 4C56B 1PEZA 1TTGA 5HXMA 1LD9A 1FQ9C 1SVCP 1DBKL 2DQTH 2DOCA 3HE7B 1FE8L 2EXWD 5IHUH 5B39G 3T8XA 1MJ8L 1UJTA 2EYRB 2MHAA 4MJIB 3ZDXF 4BH7B 2VLRD 5F88A 4D0CA 4JFPB 5LGHH 4AT6B 2P5EA 5DJYA 1KC5H 1H3XA 3D3VB 1DBJH 3JWOL 1F3DJ 1I9EA 4XI5D 4HAGA 4D8PA 4NNXB 1A6AB 4ODHL 4QEGA 2DM4A 4HJGA 3RWJA 3OWEA 3X13B 3GSWA 4JFEE 4WW1B 1JHTB 5L2KE 1XIWD 4QXTA 3B8YA 4Z7VE 4ODBD 1IGIL 4NZTH 4RGNE 1LE9A 2R1XB 4JG1L 1NGYB 4KKLD 7CGTA 5HHME 3MLXL 1XF5B 5IESL 1RHFA 4PYGA 1A0QL 2B4CC 1KF9B 1G7LA 3PWLB 3FQWB 4GKSB 4AG4L 4RAUA 3WUWG 5B8CC 2AEQH 1UEYA 2V2WA 5HY9A 1JRHH 1TTUA 4DKDC 5INCB 3MOBL 2D2OA 2KPNA 5CCKH 4ODUA 3VXMB 1P4LB 3GSVA 5BS0E 1RIVH 3ZE1F 2AXGB 1S5IH 1KXTB 2Q86A 4X6BB 4O58L 1NMAH 4YGVA 4OZHE 3GK8H 3H7LA 2VJXA 2GYSA 1LO4H 2R8SL 4AMKH 2YRPA 4I3RL 2NXYC 2DWDA 3BKYL 2AEIT 3L3HB 1S3KL 2DQEH 1WGOA 2IH1B 1T83C 3JBG7 4M7LH 5JUEL 1E28B 4U1LA 2Q7YA 5HPMA 4KJQC 4MXWH 3HC3H 3L9RB 4KC3B 4X4ME 3G6DL 5E6YA 1CLOL 2NY5L 3WNPA 5ICXA 1AD0B 5GGVY 4HUNB 4X6CF 4FABH 3SKJL 4NQXB 1W0VB 4JZOB 3D39E 3FFCE 1UH3A 4XAWL 2PNDA 5JHLL 1FFOB 3PGCB 5EU6B 2W91A 4WW2C 4DEPB 4YIQA 5DI8A 1RURL 2AJVH 4N0UB 1MRCH 4WI9A 3DARA 3ARGA 4G6JL 3MLVH 4PG9A 1N7MH 3EO9L 4EI5C 5FUOH 1IC7L 2JB5L 1FN4B 4UB0L 2YWZA 3B5GA 2D7QA 2PYFB 2CRIA 1X9QA 2ZJSH 4F9LA 2P47B 2WIIA 3LZFL 3VFPA 3U36B 4KUZL 1OLZA 1A3LL 4X4XB 4K23H 1NFIB 3C5ZB 1EEZB 3VXTA 2X1OA 5GQBA 3ULUC 1ZHBB 2VSDA 3QO0A 2OZ4H 5GGQL 3I3EA 4MS8C 1RZ8A 5T3XD 4HC1A 1D6VL 3F58L 4AH2A 3TT3L 3R8QA 5DJXB 3MFFA 2CIKA 4C4KO 3DI2B 5EUOA 4L8CA 1HCFX 3T08A 4GW4A 5DC0A 3QUZC 5C6TH 1C7SA 4BH8A 4O9HL 3THMH 1I85C 2Z9TA 2YPLE 5E03A 4DVRL 5HYJB 4AJ0A 1JNNH 1Q9KA 4PBWD 2G2RA 3VGAC 1F4YH 4QRSA 1UB5A 5C2BL 4GT7A 2FB4H 1I7ZB 2D31B 4JZNA 4HSQA 2NY0B 3DVFA 5HDQH 1V7NL 1M7DA 2BSTA 3TFKC 4KWUA 2QQLL 4C54A 3K3QA 1AC6A 2HT4C 2OP4L 5KN5A 4HS6A 4LIQL 2H45A 1DQLH 3U4BH 2X4NA 3KS0J 3ARBC 2IPTH 2AQ2A 2O26U 3LOWA 3QDAA 4N5EC 4MZ3A 1CD8A 2RB8A 4J6RH 4NWUH 2Q7NA 3OR6B 1UA6L 2VDNH 3UO1L 2DJ4A 3HI6H 4LASH 1IE5A 4G9FE 4KROD 4JFFB 4PJGF 4PRPD 3BDYH 4CRPA 2IEPA 2NXYD 5DJDA 5E6IA 3GZKA 4Y1AB 1WQVT 5EN2B 5AEAA 5J1TC 4LSUL 1KB5B 4HFWA 4M4RA 4HLJA 4KJQD 1FFNB 2W65B 4A6YH 5CD3B 5GJTH 4Z95L 5FB8B 5KSBE 2HVJB 4FQPA 3NIDF 2X4OB 4QYOA 3T4AB 3EO0B 5LXGL 4TOYL 4IDJH 4PRHD 3OSKA 1FNEB 4RZCB 1EAJA 3LAFA 3CVHB 2E6PA 4HIJA 4YNYB 4M8VA 1LO2L 2EEBA 3CSGA 3GIZL 4N0FA 1ZKAA 1NLBH 3A0OA 2B1HL 3NOIA 3G5XB 3RVVC 1H15A 2APBA 3VD4A 2EH7L 5F1NA 1MFEH 2P45B 3LKPA 5F89A 4Q2ZB 1DCLA 3FQNB 1HHJB 1JWMA 4EI5D 1Z3GL 3MMEB 3ZT6A 2V5RA 4G43B 3T0XA 3IU3A 1DLFH 2B20A 3QEQD 4HUUA 3CSBA 5F7KC 1WUNT 2KL6A 2ZNWA 4WI2A 3MLUH 1GCFA 1VKXA 3H9SD 4PGCA 2FH8A 2LABA 3EYQC 1NBZB 1XIWB 1MWAA 1A7NL 1JRHI 4MS8D 4JFDE 3QFJA 1Y18B 4MMZC 4F7EB 1DBMH 3O45A 4PG2A 4U1HB 4BSWA 2LU4A 3ABZA 4P2RB 4YEFA 4G6FD 1ONQB 3TNNB 3QUZD 4Q97A 2OR9L 1MLBA 5GGSA 5IMKB 4XNYH 1XT5A 2G60H 4DGYH 2E9IA 3JSSA 4GW1B 3QIUA 4OZFH 3QDJE 2J88L 4PJ7F 5I19L 1HI6B 4D9LL 3KLAA 4AIZA 3ARRA 2KDGA 1EAPB 5MEND 1CE1L 3EBAA 1YNTB 4GMSL 2ICWJ 1NQBA 4E42B 2DLTA 1I7RA 1RZFH 5EZOL 2AJ3B 2C1OA 4LCCC 3TFKD 3IDJB 1RFDH 2NY6C 3DYPA 4DVBA 2HT4D 5T1LA 2O5XL 3ARPA 4N1HB 4S1SL 1W72L 3UJIL 1YQVH 5DYOB 1FVCA 1RZ7L 3CFKB 4N5ED 4ETQA 4HWUA 3GBMH 2E3VA 4PIRF 5FV2A 4ZYKB 4GBXD 2X4RA 1NDMB 4HF5L 5GIRA 3DYMA 1ZGLA 5D7LE 4NHUB 4Q6IA 1NGWB 1W2KT 5T5NF 2AABL 1CFSB 2X09A 3WDJA 2BSRA 2ZCKH 2PO6A 3UYOD 4G7VH 3ZKMC 1YN7B 3S36L 2QLVB 4GSDL 5T5NG 2XA8L 1NCAL 1WZ1H 5K59E 2H8PA 5I1GH 5DJ8B 3ME0A 4YFEA 5F21B 2JCCA 4LLQA 3L95A 4MGXA 4R4BA 4BSJA 2DQFA 3SOBL 3ZMRA 1EXUA 5ABDE 2V17L 3PJSA 4IOFC 1IGJA 1R3JA 3H0TA 1F4WH 5SWQB 1T5WB 4NO2B 1N59B 5E08H 1QSZA 2HLFC 4N0RA 5HGAB 1JZ7A 4HT1L 2ZOLA 2APFA 2BSSA 3RVVD 2CGRH 1U3YA 1BQHG 1ZLVK 4GXVH 4I48A 2A6JA 4P2QD 1R6VA 4L8BA 3O3UN 4MSWA 5DJ0A 2MWCA 1BEYL 4X7SH 3QWOA 3RHWK 1GGIL 4B7IA 2DIAA 3LIZH 5C0FA 4UDTB 5DD5H 4HKZA 4NN6B 4QRUB 3S96A 3T3PE 3GIVA 3FJTA 4NHCL 1U92A 1BIIA 4BM7A 3EYQD 1J1OL 1KIQA 1QBLL 1T1WA 1DDHA 2YC1A 5I30H 1QQDA 3AS2A 4WI6A 1KIPB 2K7QA 5B3JF 4U6YA 1TZHB 5CEYA 1B4RA 2ESVD 3BRDA 4YHPA 3FN0L 3F12B 4PREA 1FG9C 1TJIL 1V5JA 1F90L 1UACL 4QXWA 2A6IA 2APXA 5B8CB 4OLYL 1M6OA 5J1AA 3DVGB 1WAAF 2E7HA 1FYHB 4QY8A 3OB8A 3W11C 3WHE0 1B2WH 4OQTL 1BOGB 3DMMA 2N7BA 2YUWA 1JV5A 4M3JA 3MX0A 3DV4A 4P9HH 5BMFL 4OM1L 1PBYA 4M00A 4KV5F 5F96H 2GTWB 2PTTB 4Z6AT 3RWIA 5L9DH 3V0VA 3RWCA 2IQ9H 4OBRA 4EJ1C 5J06A 1J05B 4HAFA 1UWEH 5C0GA 5E2UH 1OGAA 4KROB 3GEWB 4PRPB 1MAML 1T0NA 3VI3F 5LGHL 1YC8A 5TGBB 3IDMA 2UWEB 1LP9F 4FN0A 4G8GA 5GS1A 5MERA 1OQXA 4KFZC 5EZJA 3V6FB 4UDUB 1SY6A 4Y2DB 5ILTL 5FGBA 4D0BA 3TC9A 3S6CA 5CSZA 2G75B 3HN3A 1KB5L 3F65A 4NQCD 4Y5VB 2C1PB 4N9GB 5IG7A 4P2OB 4O2EB 1QYGH 3L3DB 1SQ2N 2R0WL 4PRHB 1OAUH 1LO3H 4F7MB 4D94A 1OW0A 2BY3A 4J3UA 5DFWH 1R3IH 4OT1L 5EIQA 4XC3H 5J6GB 3T3MF 1FNHA 5EBMA 3ZKMD 3MBEA 1IBGH 4I0PA 2Q8BH 1GZPB 1NPUA 3UDWC 2H6PB 5E8DL 1GOGA 4APQC 4MJ6B 2J8UE 2NY3C 4OLEA 4EI5B 3MV9D 3ARZA 5JPMA 4GG6B 4RFEB 4OZIF 3JTTB 3HZMA 5DJZB 4K7FB 4UV4H 1ZGLM 2YBRB 4LGRB 4IOFD 1HXMA 4CGTA 1DQJB 2HLFD 1GL4B 2XQYK 1CGTA 1S5IL 1NEZB 3L1OL 4L9LA 4BYHA 3H9SB 3OB0H 3LHPH 2KKQA 1IKNA 4S0SD 1LO4L 5C08E 3P9LB 1IEAA 2X4SA 4LSDA 3EGSA 1FRGH 2DQEL 3SDXE 5DK0A 4KHTH 4MZ2A 2B0SH 4JQXA 1LDSA 1H8OA 4M6OH 4MAUL 5E99L 4G6FB 4QRQA 3VWJC 4X6DF 5HVWA 1C08A 1S7UB 3FOMB 4OTXL 3VU2A 3W9EA 2IF7A 4IS6A 3RA7L 3WHXB 1JZ6A 1UGNA 4PJ8A 3ARFA 3VXUA 1RJLB 1JK8A 4G9DB 3WNNA 2X4QB 3CPLA 4OGXH 1U8JA 1G7MB 3FQRB 1S9KC 3VGAB 4FABL 5MENB 3SDCC 1JN6A 3NCJL 3EOTH 2I5YH 3X14B 3FO1A 1P9MC 2FHCA 4JCLA 1GH7A 3WDIA 4WI8A 2JJUA 4YXHH 4R4NC 4KK9C 4J12A 2BVUA 5LKNA 5FUOL 4H0GA 3PHQA 3WFBH 1U58A 3W11D 3L5HA 2BVYA 1HDMB 4OI9A 5F9JB 4J4PA 4GBXB 4X9IA 4NP4H 3UPRA 3VFTA 2FL5B 4ISVA 4K8RC 1BBJB 5KTEL 1BVKA 4G6KH 2F5AL 5IW6B 3DV6B 1GGUA 1MUJB 3LS5L 3STBA 4RIRB 3VWKC 3RQ3A 1YEEH 4PJAB 3OGCB 5JHDE 1TENA 1MJJA 1UVQA 2ZCLL 1O7SA 5LBSH 3EJJX 3BEVB 4U05A 5E70A 3O6FA 3PWUA 1A47A 3PE9A 4XNUH 5HGGS 2AAVA 2H32H 3NCYS 1I9IL 3SY0B 4H25B 3LEVH 4OLXH 2HJFA 4XNXH 4OIIH 2FO1A 2QQNH 2JJSA 5JIKA 2EDLA 3DVNB 4M5ZH 4FQCH 1L6XA 3BW9B 5L7XH 1A9BB 2VZVA 4P2QB 4APQD 5E8EA 2NY3D 4NRXA 4LHUD 1UM4H 5K9OA 3MA7A 1KACB 1BQSA 5T3XL 3MREB 3GSWB 1HHKB 3LRGA 4HKJA 1GPOH 4FFYL 4K3EL 3VFNB 4ZFZA 2PTVA 1AI1L 1ES0A 1U36A 2YXFA 3GHEH 5LGJB 2YD1A 3QUMA 1RZJH 4OZHF 5T3ZE 2Y4SA 3EYSH 1LK2A 5D7SL 4LASL 1TZIB 2WQ8A 1R0AL 1ZVSA 1G7LB 3P0VH 4NN5C 4P4KA 3GSRA 2OX5A 2E8ZA 5DHYA 3VGHA 3TM6A 1ZEAH 5HY9B 4YBHA 2ESVB 3GB7A 3E1F1 5I1IH 4BUGA 3SE9L 2WUCL 3PHSA 3BUYA 3QNXB 3VWJD 4U31A 1HSAB 4UT6H 3GMNA 4FP8H 1JFQL 1CICA 2FNBA 2B4CL 3GSVB 1J0KA 1YEDB 4Y4HA 4PJDA 4P2CG 4FQXA 3SE3C 2PF6A 5DA0B 3VXPA 5B22A 1T7VA 3SDCD 4TYUA 5J9PA 1JHKL 3MRPA 3L5XH 4ZSOE 5FO8B 3U4EB 2NX5A 4LAQL 4UINL 3UTOA 4B50A 5HGDA 3AREA 4R4ND 3GMQA 4NRZA 4CMMA 5MEQA 3QG7H 3DUUB 1HXYB 1D5MA 4LF3A 3T2NL 3L5WA 1A2YA 3VFUA 1GZQB 4GW5A 3KPRD 1S7WB 1G7IB 4NQCB 4YWGH 4GH7B 1YDPA 4EDWH 3MLUL 4HHAB 1AIFA 5I1EH 4R7NB 3ZKXC 3K74B 4K8RD 1KEML 3MZGB 2F54D 1UFUA 3UP1A 5A1AA 5DHXB 1OQOA 3G04A 2YD9A 4ZOBA 3STZA 1CF8H 4F15C 1U0QA 1A8JH 4WUUA 1DBML 1VHPA 4X5WB 3OTTA 5C0NC 1P7KA 1MFDH 3KXFA 3NIFE 3MV9B 3CX5K 3VFPB 1A6ZA 4XNYL 5E2VL 4ZS7H 4Z0BH 1SMOA 3MC0A 2FJFB 3AS3A 3CMOL 2X1QA 4OI7A 3BIBX 3QO0B 4XCCH 3HI1A 3T65A 2PW2A 1RZ8B 2Q3AA 1LO5B 1KEGH 4ZUUA 1PZUB 1F3JB 3PP4L 5GGRB 3OGOE 4RBPK 3BZ4A 4Z7UA 4TPRL 5GHWL 3ULUL 4P57B 1RFDL 4XP9H 4JANB 1KCRH 3OKEA 2DQDL 3LQAH 1JZ3A 2GSIB 1PX3A 3V5KA 3MJ9A 2FWOB 4UIKL 4HIHB 5I8EA 5CILH 3S36X 3MV8E 3QXTA 3T4YB 1HQRB 1CS6A 4QRSB 3D85A 1ULVA 2P8PA 4OZGA 4BZYA 1KIUA 1L4IA 1M7DB 4LCWA 5I1KH 1PLGH 3VG0H 1DUYA 1E4WL 4MXQC 2J12B 4I13B 4QRRA 1T2QH 4YHZL 1A4JA 4KAQH 2ZZUT 5GGTL 3QUXA 4HGWA 5KSBF 2OYPA 3IDYC 3AAZA 2FLBT 4QO1A 1T7YA 1X5XA 3QUKA 4OCWL 4JPWH 2XIDA 1YMHA 2JB6B 2CKBA 5JW5A 1JGLL 1V3JA 3BGMA 1F4WL 5E6IB 1FHGA 5IQ7H 3QDGD 3U6RB 1KCUH 3GGWA 4KTEH 2R56L 3E6FA 1KUMA 5DRWB 2BVQB 4OLZL 5D6DA 2RFXA 4XRCA 4U1IB 3FZUC 3O4LA 1UB6A 2V2XB 2VDML 4HUKB 4JFHD 4HIJB 3GMLB 4BA8A 1B88A 2BNUB 2VISB 5DZNA 2AV1B 3ULVL 3ZKNC 2D7OA 1E4KC 5DJAB 5F1NB 1AP2A 5IT2H 1CL7H 5TPWH 4XPFL 2BOBA 3Q3GB 1KENH 3TA3A 5BJTB 4FMKA 4NPYA 1QEWA 4HZLA 1IKFL 4QTHA 4MJ5B 2I60L 4U1KB 5GRVK 5HHNA 1AXTL 4PRDA 5C0ND 5IMMA 5CJ8A 4LHUB 4CW1A 4GKNB 4LLWB 5DRNA 1YEIH 2Y07L 3ZHDA 1EHNA 1MF2H 4IMLA 1AQDB 3B5TA 4CVXA 1KN4H 1AGBB 1MCNA 4O51A 5DF0A 3EO1A 5EBWA 2BC4B 3U46B 2IQ9L 3ZO0A 3HG1A 3WFZA 8CGTA 1UWEL 4ZOAA 1TITA 2JIXA 4RCAA 3EYVA 1RZIA 5E94B 4UI2A 3C08H 4Z7WE 3RUGA 3MACH 1RU9H 4Y16C 4NNPL 1UWXK 1JUFB 2UVEA 1GXEA 3U0TA 5CP3H 1PY4A 3VWJB 4HQQL 3HHRB 3HAEG 3NZ8A 3JV0A 4AIZB 3RRQA 1HINH 1QYGL 2X1XR 2HT3C 3RL2A 2XRAH 1NFDF 5IM7A 5E7BA 2AKRB 3O9WA 1T04B 4ONHA 4WU5B 1LO3L 4X9FA 1IGFH 3SDCB 3TEUA 3TJHC 1T1ZA 3N06B 4MXQD 4IRSC 1CXHA 2QKIB 4NC2B 5K59F 2Q8AH 1IBGL 2I24N 4PJXE 1K4CA 3ZTNL 1MFBL 2OXGA 1BX2A 4ALAL 4ORGB 5I1CL 2ZUVA 5IJKA 4OCXL 4HJJL 1UM6H 3I6KA 5D7IF 5EO1A 4UQ2A 4N8VA 5GIRB 3DRQB 4YH6A 4UV4L 2LTQC 1O7VA 1J0HA 3E3QE 1AY1L 3KPRB 1KFAH 3F7VB 5D70L 2AJZA 2DL9A 5IOPA 1VACA 2XZAL 3HFML 1LE5B 1UEMA 2F54B 1WTLA 4HBCH 2IBGA 1ZLSH 1K4DA 5D1ZA 3RIAK 1UXWA 5IB2B 1BVLA 2VLKE 4LLQB 3L95B 1N4XH 1CGXA 2B0SL 4CVZB 2R2EB 3JZ7A 2DQFB 4R4BB 3FZUD 5JIIA 3JVGA 3ROLA 1UXSA 3ZSSA 3T3PF 5CIPH 3H3PH 1RIUH 3V5DA 5KOMC 5I1LB 3K1KC 4R7DB 3IXTA 2NLJB 5D72L 2AI0L 5JHDD 4P3DA 3ZKND 4OGZA 1GSMA 3CVIL 1U8NB 2Q76B 3CDCA 4I48B 4ZD3H 1JHLL 2A6JB 2C3GA 5F7EL 1JTPA 5DJ0B 3QWOB 3ES6A 1XEDA 4AQ1B 4KH2A 1I7UA 1S7XB 4JPVL 2QQKL 4LSPH 1NCWH 3NA9L 1CG9A 4LRIC 1OAQL 3RDTA 1ZA6B 3WFBL 5D71L 5EUKB 4HH9A 1TJHL 2GT9A 1HEZB 3M17A 3FQUA 1KJVA 3CC5A 3R8BB 5C8JA 4XBGA 4D0DA 3WV0A 4LSRL 1RUAL 1CIUA 1WBXB 3TZVA 1CDGA 3BT2H 4O02H 2ED9A 1YY8A 4Z7OE 4L8DB 4UUJB 4NN5B 4JN1H 3FB6B 4Y16D 1UJ3A 5KS9B 3PXHA 5CBEB 1F2XK 1JPGA 1S7VB 3H7BA 4P99A 3U9UA 1ZT7A 4QY8B 1YEEL 3UYRL 3NFNB 2GFBA 2B1AH 2KQNA 2P5EE 3DMMB 3QCVH 4LCIH 1JV5B 5LBSL 5JQHC 1J8KA 2EC8A 2Y1VA 2VO5A 3ARTA 1CXEA 2A77H 3RWIB 2HT3D 1WFNA 5LWYL 4F8TA 3CFBB 3LEVL 5EBGA 3ALPA 3TWCH 1P2CB 2FIKA 3TJHD 4UTBL 2D9QB 3IDMB 2FGWH 4IRSD 3QDGB 5GS1B 3QCTL 2VITB 2GCYA 5B38B 3I50H 1OF2A 1YEGH 2JJTA 4FXGB 4P5TA 5MP6H 1I9JL 2D7TH 3WXWH 2VAAB 5KAQF 1OARH 1Q9LB 1NC4D 5ISZA 1G9NC 4L1DA 1NAML 4XX1E 5T3ZH 5JXAL 1TMCB 1CL7I 1YNKL 1ZWIB 6FABL 2IAMC 5I1HH 1OAYL 2R1WA 4LDOB 4ODVH 1AJ7H 4Q0XL 5ADOL 1NCDH 1ADQL 4OF3A 1KJ2H 4Y8AA 3UZVB 3K4AA 3ZKXB 1E4JA 3BE1H 3O2WH 4TSAH 4PP2A 3MBEB 2IQAA 5IFAH 3CVHH 4WCYH 2XPGA 3SDXF 2W38A 5ADPL 2G9HA 5ID1A 4F15B 1D5ZA 4W4NA 3HCVA 3SGKA 1KYOK 5IHLB 2EECA 2X89D 4XT1C 3FT3A 3ESVF 4FP8L 2FECL 1KCLA 1U8OB 5GSRA 4N0YH 1REIA 5KBNC 4MVBC 3D0LA 4HCRL 4TQEH 1CD1A 1ZLUK 2B8OT 2BMKA 1IJ9A 3D0VA 1WEJH 3MGTA 1IEAB 1SYVB 3EGSB 3RX5A 5ANMB 1NLDL 1KXVC 4RWYH 5C0RH 5GS0D 4AEIH 3UMTA 2HVKA 1MCKA 3MOQA 4YHOL 3V4VL 4QRQB 3C8KB 1MRFL 5LAXB 1PKOA 2W0LA 1C08B 3QG7L 3MUGA 4R96A 4IS6B 4UAOC 3VXUB 4QNPE 4GAGL 2DLFL 3CPLB 4NQDE 1IQDA 3S5LB 5BV7H 1UKSA 1AO7A 3CXHJ 1XGUA 3BN3B 1DJSA 3NAAL 3MV8D 4FFWD 1ACYH 4QHKI 4PJEB 3RY6A 1CF8L 3LQZA 4E41D 4F7TA 3MRJA 3PHQB 1X5YA 5INDA 1S9VA 1RVFL 4QRTA 1TQCB 4L3EE 4JM4H 2DBLL 3IDYB 3ARDC 1S7TA 4M6AA 5H2BB 2X4PB 4P5KA 5F3BA 4G8IA 3W39A 1B0GB 1KTLB 5EUOE 1I3VA 4PGBA 2DTMH 4ZFOB 3PGFL 4S1RL 1BVKB 4XVUC 2OR8A 2MJWA 2NTFA 2VERN 2VXQH 4HJ0C 3HMWL 3A6OA 1OSPH 5JOFB 5DUMH 1OP3H 2XNAA 3E3QC 3P9MB 3VXRD 2DYPA 3VFSA 3RTQA 3DGGA 1RZGA 1Q1JH 4ELKA 1DL7L 2WBJC 4IMKC 4PV8B 1PAMA 1IM3A 2V7NA 2EIZA 4DKAA 1S9YA 2O5YL 5IB3B 5H37G 3RNKA 2XZZA 1BJ1H 1EGJA 2IAMD 3B3IB 3AXLB 1D6EA 4OF8A 5E4IA 1S8DA 3L3GA 3QJHA 5CP7A 2VR4A 4OGAC 4NJ9H 5I6XB 1P4BL 1NUNB 5FUZH 3WKML 5J13C 1OB1B 2R0LL 3PG2A 5E8EB 5I15L 2HP4A 3F62A 1T2QL 1YUHB 3BP4B 1MHEB 4HKJB 3MNZA 4NKIH 4EXPX 3DNKA 5K9JH 3C6LA 2WM0A 2WSKA 1KIRA 1MCLA 4PV9B 2MCG1 2H3NA 5HHOD 3QUMB 3DX6A 2WUBL 3DWTA 4MVBD 1Z0MA 4XMKH 5HYSA 2XTJE 3PV6A 1KG0B 3TO4C 2GUOA 3UC0L 4LPWA 2VLMD 3RGVC 2BHZA 2F8XC 3MJ7A 1C1EH 5I76A 2FR4A 4ZPTB 2X4UA 3O8XA 4Y16B 2BVPA 2W92A 1KV3A 4PJGA 1PKQA 3AY4A 1KGCE 5D7JA 5DMGC 3ZTJH 1MI5D 5CBAB 1ZT4B 1FGVH 1MCFA 1HIML 5FO7A 3QQ3A 2F9BT 1M71B 3A6BH 4KDTA 3SO5A 1ZGLP 3VFVB 3ZYJA 5J9PB 1DLHA 2WWKO 3PHOB 4W4OC 4P4RB 1U8LA 4X7DC 4MNHB 1QG3A 2NX5B 4PJIA 2EXYC 4FQ1H 4PY7B 2EZ0C 3M1BB 5HGDB 4UU9B 3GMQB 5MEQB 4IRSB 2NY7H 5FGRA 2CLRB 3QFJE 3OKKB 4RISH 2R0ZL 2DF3A 3QHZH 3WS6A 1HYSC 2Y7QA 25C8L 3ARDD 3NIFF 3VFUB 1Q94A 4XPGL 3MNVB 1KLUA 3TBWA 2XWTA 2V9QA 1NC4B 4G6AC 3S35H 1YDPB 1MAJA 3WEXB 1AIFB 1FG2A 4Z5RB 3U7WL 4NDMA 3QQNA 2ITDB 2LTQB 1JZ4A 3P11L 3LKRB 2BNRD 1MVUB 3KPLA 4GQ9H 4XVUD 1KN4L 5FKAA 3W2DL 3OHXB 3WO4C 1QP1A 4HJ0D 3STZB 4CUCA 5CS7A 4FTVD 2VWEC 2BVOA 2J2ZA 4L3AA 4O4YH 2NZIA 2WBJD 3HE6A 3PDOB 3MACL 1ACZA 3FCTB 1A6ZB 3L6FB 3GJFA 1FDLH 1G7JA 1FC2D 4ZDHB 5EC1B 3IGAA 1JWUA 1QA9B 4X80L 5IUSA 4LSQH 1F4XH 3WIHA 2R0KH 1IAMA 7FABH 3OKLB 4ZUTB 2EDRA 4Q9RL 2ATKA 1U42A 4WUKH 4W70A 1N5YL 1P6AB 3ELAT 1L9NA 2DDQL 3H6JA 4AYFA 1I8KB 3ARYA 2VB5A 1INDL 4GKZA 1RD6A 1QVOA 3M8OH 2HH0L 5HI3C 2VIRB 1QSED 4CDGC 2Q20A 4Y0GA 3TO4D 4LBEA 3G5YA 2JCCE 3VXQB 2HRPH 4KTDH 1F58H 1P7QD 1OAZL 3RGVD 5ACZA 2ZOKB 1S5HA 3ZDZE 2BNQD 3IS0X 5AZ2H 1C5DA 2R2HA 2XV6B 4G8FB 2YRLA 2Y5TA 5CAYB 4DZ8B 4OF5A 3IJSA 1A4KA 4IHOA 5E4EC 1JYWA 5IQ9A 3HUJA 3QUXB 5ALBL 5DJCA 3AAZB 5AZEL 4E41B 4P46A 4F9LC 5C07A 3PABB 4RAVB 5DMGD 1E27B 1YYML 2E9WA 5JW5B 3BGMB 1HCVA 1WZMA 1BP3B 3WFDH 1JZ2A 4KXZH 2EDHA 4OZ4A 5GRZA 4GMTH 3VRIA 4JFZL 1E6JL 4M1CC 3TN0C 5MEOB 4I9WD 3REWA 1I3GH 4DN3H 4XC1L 3ZTJG 3E6FB 2EXYD 2EZ0D 4A6YA 4ZFOL 3L3OB 4UTAL 2MKWA 1MCQA 4F57H 5JIPA 2VZTA 5EPMB 4YBLB 1ED3A 4TUJA 3SDDC 4XRCB 1BQHA 1HYSD 5DVOA 3L7EA 2VXSH 3VXRB 4X99A 3QPQC 4NO0D 4FXKB 3O4LB 5FGCE 2CUIA 4G6AD 1T3FA 6CGTA 2UWEF 5IMOA 4KY1H 5DD0L 4DQOL 4FQ2L 4NJAH 4R3SA 2IAMB 1ZAGA 2V7HA 5C70A 3IFPA 3CUPA 2AK4D 4JN2B 3TVMA 2NW2B 4EBQL 4MA3A 1J10A 1K6QH 3M07A 4HXAH 3MQIA 1QFOA 1TQBC 1UCBL 2DM7A 4HKXA 1Q9OB 5ESAB 4PRIA 5L6YH 3TA3B 1JIBA 3NPSB 4NBXB 4XPHH 1MQKL 4M3KB 4NPYB 1DEDA 2GI7A 4ZPVB 3JTSB 3ULSB 4Z7WF 5F7UA 3OAYH 2P5WD 5HHNB 4RGOH 3PDGA 1KELH 2CDEA 2OTUB 2JK5A 2VZ3A 4NQSA 2BOCA 1OGAE 4QXUH 4GAFB 5F71A 3FONB 5DRNB 4HG4J 3O2DA 5JW3L 3LKNB 5D2NC 2DKMA 3S4SB 3SKMB 1HKLH 3F7QA 4G8GE 2KQMA 4FQHA 3U83A 5HHOB 3EO1B 2VE6A 4NM8L 4GG6F 1NAKL 3B2UC 5GISL 3OF6A 1MCOL 2ERJC 1MLCA 3QRFM 4IRJD 3VXSD 5F7YC 1EIBA 2AGJH 2OBGA 2R69H 3RUGB 1I1CA 2Z8SA 3I3DA 4JM2C 4WWKC 4BKLA 4PJXF 1II4E 4WI5A 4QHNB 4LHJB 5HI3D 1OARL 1NEZG 4WU7A 3WFCL 4GRWE 4X8XA 3HLAB 3L3KB 3SJVD 1XZ0A 4XAKE 4UAOB 2VDKL 5KJRH 4TN9A 1MI5B 1LP9A 3B6SB 1MREL 3FRPG 2DWEA 4KJYB 4LSTH 5GGUA 4UMGA 3MXVH 5DVMA 2X9YA 1G0XA 4LLYB 1FNFA 2HWZH 4P23A 4DGIH 3EFFB 4NQDD 4WCYL 3OKOA 5CGYC 1K4CB 3JWDH 3TPKA 3UTSA 1BX2B 1MQ8A 1ZTXH 3GMRB 3WLWC 4M8QA 5BQ7A 4N8VB 4J8RB 1CBVH 3ARDB 3G6JB 4RMQA 4R90L 3L3IB 2EKSA 2HFFB 1CFNA 2IBZX 5A16B 1A7BA 4IEFB 3FO0L 3O2VH 4M62H 4M1CD 1QLEH 3TN0D 1JE6A 1AHWB 4L3ED 3GM8A 4OFYD 3N85H 3Q5OA 2BNRB 3MUY1 2J4WH 3FN3A 4OZIA 2YUVA 1X4YA 2AJSL 4JY4A 1K4DB 3SO3C 1NBYA 1WZKA 2IPKB 2HT2C 5C0RL 1M05A 4QHMB 3SDDD 4FTVB 2DD8H 4M43H 2F53A 3LKQA 2JELH 2EKJA 3QPQD 4O2FA 4JRXD 2Y23A 2WBJB 4LNRB 1S9WA 4G5ZH 5IBTH 3Q48A 4WGWB 4AK1A 4MQXC 3KPPA 3AS0A 4P3DB 1FO0A 1NEUA 4ODWB 2EE6A 5DRXA 4NQEA 1GGYA 5C71A 3LKOB 2EDYA 3RWFB 4Z7OF 3NMEA 1LMKA 2JJWA 3SQOH 1N6UA 2COQA 2FHBA 4NQVA 4OD3H 4WJ5A 4ZXBC 5ITFB 4HC1H 5DD6A 5J13B 1J87A 1L7TL 4RX4D 3RX8A 3V8CA 5FYKE 3LVEA 1EEYA 1CG9B 3MODL 2HAZA 2DQCH 1R3KA 3I75B 4HH9B 3P9WB 4LFHD 4XGZA 5C8JB 5A2KH 3PQYA 2BFVL 1I8MA 2PR4L 1QSEB 2XKNB 3ARVA 1CLZH 2VLLB 2FH6A 5C6WH 2CDFB 1DUZA 2A73A 3B2UD 5DQDH 1QPPA 1YY8B 4G8EA 1C8PA 3BKCH 4HFUH 3C60A 4AEHL 1Q0YH 3RGVB 3GSXA 5GZOC 1FGNL 2BNQB 4XWOC 4JM2D 1V3KA 4WWKD 5JIHA 3P4NB 4FQIL 2M2DA 1T20B 2F19H 3KPMB 4KXZI 1QR4A 3BPOC 3HC0B 1CTOA 5FDWA 5DZLA 4IM8A 5IW1B 3G08B 3OAUL 3VD3A 4WI3A 4U1JA 4LP4A 4XVTH 4FQLL 5FCUL 4FNLL 1I4FA 2JF1A 3SE4A 1Z9SA 4U1SA 4F37F 3VFWA 1RSFA 5FFLA 3LEXB 1PG7X 2VZSA 4PB0H 1WK0A 4MLIA 4UZGA 4KDVA 2C7UA 3ALWA 1HZHH 5T1MA 4ZO9A 3WN5C 3C2AH 5CGYD 5IP4A 3GMMA 1D9KC 5F44A 1MIMH 1FLRH 2HG5A 1WTGT 2I9LB 3WLWD 4K07A 1HOCA 3DETC 4MXVE 4X6FB 4UILL 2YUXA 1QRKA 4ERSH 2I07B 1IM9D 1FAIL 4LU5H 4KKCC 4M5YL 4NKIL 1A6TB 4NO0B 3S34H 1QHPA 5K9JL 2UZIH 1IC5H 4K3HA 1T5XA 4AL8H 2O5ZL 3CXDH 5JW4M 1G7HA 5E00A 2W0FA 1G9NL 3JUYA 2WZPD 1LEKB 2R4SL 3MRLB 4ZAKC 3LSOA 3WO4B 3QRGL 2AK4B 1FNSH 4LLMA 2RQ8A 4PJDE 1S78C 4LEXH 2G9HB 2HT2D 1U9KA 1I1FA 2NNAB 1FORL 2QHRL 1C1EL 5SWSA 2P5WB 3D2UD 3E6HB 4JZJA 3TIDA 4M6NH 4QCIB 5JR1H 1KTDB 3LN5A 5GSRB 4F58L 4F9PA 3KJ4B 5E5MA 4MQXD 3T09A 3V95A 3CLEL 1QSFD 2YKLL 1PGRB 2VR9A 4QT5B 4GRMB 4YHIB 2VDRH 4DZBB 1VADA 3PWPD 3MGTB 5C2UB 1VFBA 4YDJB 1ITCA 1MWAH 4ZXBD 3G5VA 4IRJB 3VXSB 5KSVB 1SMAA 2NCMA 2P8LA 4DUVA 3IDXL 3MRKB 4EDXA 3QG6B 1QACA 5CFHA 5T1KA 4R96B 4XB7A 4XMLL 4K9EC 5JW4R 3CH1B 2VZOA 4DOHE 1NJ9B 4P59L 4DK6A 3QJFA 2HFEB 1M7IA 4J3XA 4WUUE 2NW3B 1IQDB 4LLVB 3MOAH 5EUOF 2A9MH 3SJVB 1I7TA 5ESVA 3O3AA 1AO7B 4XMPL 4OIAA 1XGUB 3HRZA 1T6WA 4NNYB 3KXFE 3PV7A 5GZOD 1KJ3L 2J6EL 4JO4L 4XWOD 5E8PA 1MJUL 3I6LE 4F7TB 4OD1H 1CI5A 5E4EB 1HKFA 1XR8B 3ZL4L 1Q0XH 1QO3B 2ENSA 1S7TB 4TTGA 4OQ1A 1K8DA 3OXSA 1VSCA 4Z7UE 1BJMA 2DQHH 1FAKT 3OZ9H 1N26A 2FATH 1F8TL 3QCUH 5GRYA 3F6IA 4IIQA 1BFVH 4FFZL 5DDHB 1V8HA 5EU5B 3TF7C 5GJSH 3MBXL 2NTFB 3UJTL 4TULL 1YY9C 4MA1C 5E8OA 3CDGA 4PR5B 2RCSH 2Z0BA 4UNTA 3DGGB 3IJHB 3WLBB 1D9KD 4HV8B 1RY7B 2ARJA 3SCMA 5DMIL 1QZ1A 3DETD 4DCQA 3WIIH 2X9WA 4RA3A 3K4ZA 3SDDB 1F97A 2EIZB 5CJXA 1ZE3C 4OZGE 2QHLA 2YPVH 3I6GB 4KKCD 4LCWE 4WRLA 5IVXE 4JRXB 4S1QH 2FBJH 3HNVH 4KQ4L 4QRRE 1BBDL 5DK2A 1YEFH 1QLFA 2P42B 2ID5A 3TBVB 3M45A 1S8DB 3L3GB 3DSFH 4HPYL 2OJEA 3RZCA 1H3PH 2YZ8A 1DFBL 2HRPL 4ZAKD 1U8MB 4JDZA 1FL5B 4OUUB 1S78D 2XTLA 3RP1A 4U6VH 1TQBB 4JREC 1NCCH 4G80A 3N9GH 5I9QC 2BCKB 2F8OA 4TNVK 1QR1A 1B4JL 3MLZH 3K7UA 5DUPH 2KZWA 4TSBH 5DXWA 1WICA 1PG7H 2Y6SC 2HFGL 3C6LB 4ZFFB 1U8QA 1T03H 4R26H 3VW3L 3EKCA 1QRNA 1FLTX 1S9XA 1DSFL 1ZK9A 5D2NB 4K3GA 4XWGH 1NGZA 2GUOB 1QFPA 3BKJH 3V0WH 4WHCA 3MV7A 4I77H 4DKEL 3VA6A 1P6FA 1RUQH 2ERJB 1ZHLB 4DN3L 1MCEA 4DAGH 2G5RA 2IADA 3GKWL 4HXBL 4V1DE 5EB9A 3KYMA 4RRPG 2BRQA 4LHUG 4PY8J 4OGYH 1G7QB 4F57L 3O8XB 2QJDA 3FQXB 5D1XA 3JWNC 4JM2B 4WWKB 5FA4A 1PYWA 1X5KA 1CU4L 4MCYB 3LY6A 2ZUTA 1Q9WA 3G6AA 4FA8A 1GC1H 5I1DA 4JO1H 4ONFH 4ZQKA 2ORBL 1K2DB 1DN2A 1JF1A 1NMBL 4L29B 3MRRA 4YDKH 5C0BD 5FK9A 4MA7H 1EMTH 4XCEB 1B90A 1T7ZA 1U8LB 3IFLH 2OS7A 3SKNB 4JR9H 5HI4C 4PJIB 2BK8A 3FOLA 3KYOB 3GRWL 3O81A 3TBYA 5L6YL 2BY2A 2HMIC 3O11B 4YQXL 1Q38A 1UM5H 3UJJH 4JPIA 2AK1H 3WFHB 4GO6B 3UBXB 3QAZC 1KPRA 3HG1E 3HTLX 1KLUB 5GRJL 3TBWB 1SY6H 5F7DA 3OKDB 4GRLA 1IM9B 1FG2B 4PJFB 3UAJD 4NDMB 5IBUB 1HE7A 3WE6B 5CD5C 4NT6A 4JY6B 5EORH 1QBAA 3KPLB 1N0XH 1F6LL 5FKAB 1O0VA 3LH2L 2J3SA 3MFGB 3QEGH 3R0MA 1YY9D 2VABA 4I2XA 4P4KC 2AGJL 5IF0B 3SO3B 1H8NA 5JLZA 5I8KH 1Z5LB 4XP6L 4NN7C 3D2UB 3MUHL 5L0QC 4X6EA 1JBJA 4B5EA 3IGAB 3OX8A 4Y4HC 4LVHC 5TQ2L 1QFHA 3KPOA 1CVRA 4PUBH 3HNSL 2A74B 4FZ8L 4OSUL 1TNNA 4PRBB 5DD1H 2JCCF 2XN9D 1CFVH 4N90D 4OLVL 5KJRL 5C6PB 1PVHA 3HAEA 1QSFB 2VDQH 1TVHB 4OLUH 2XFXA 3C6SB 3PWPB 1U3HC 3U9PH 4UT9L 1F00I 5TE4H 3F7YA 1SM3L 2FX9L 5IGXH 3GI9H 1LDPL 3R0NA 1P1ZA 4ZXBB 5EWIH 3IU4H 2WBWB 2I27N 3I9GH 4DJMA 3VRJB 3JWDL 3MO1A 4NSKA 4PS4L 3MZTA 1NFDA 4NO5A 1SBSH 2GK2A 5C09A 1NSNH 1QKZH 4OF7A 3UTZA 4LVNB 5ICYA 3N1MC 3S9DB 2GITA 1QLEL 5BW7C 4PYHA 4H0IA 1AGEB 3OKMA 5KSAC 4OBSA 2R2HB 4HWEH 1N5AA 1VEPA 1EA9C 2V9RA 1EFXD 4DW2L 3B83A 3MSPA 1GGCL 5TF1H 4KI5D 43CAA 1DBAH 4P46B 3CZFA 1I3UA 4OJFL 4P3CL 4WY7H 4Y5XA 1A3RL 2P7TA 5E2WH 1MHHA 3ARSA 4GLRH 2Q6WA 2BHUA 4KUCD 1P84K 2AV7B 3H2WA 5KS9F 3AM8A 4UV7L 4WO4C 3REWB 5F7NC 4F2MA 5HI4D 3PF2A 5IB1A 1WIUA 3W0WD 1FVDA 2X1WL 1AGDB 5TF0A 1XAUA 4H5SB 2Z31C 5FYKH 3P30H 4Y19A 3MLSH 4HK3N 4JJ5B 1A9EB 2HMID 3FMGH 3TBTB 1ED3B 4TUJB 5D1QD 5MHSD 3PNWB 5ITBL 1D9KB 3ZT5A 4OV5B 2HJLA 1A64A 2BERA 4WFEE 4C56A 4U6HB 3WD5L 3NVQA 2P49B 5CD5D 4FQQA 3BWAB 3LPGA 3QWRD 4UT7H 3GSNL 3HE7A 3JWOC 4M7KL 1K3ZA 3DROB 3CUPB 4U7MA 2EYRA 3FHQA 4MJIA 4K94C 4HKXB 5B38G 4PRIB 4BH7A 2CLZB 4JFPA 4ZAKB 4QRPE 1X5LA 1VGKA 3S37H 4I3SH 3ZYIA 3D3VA 4U3CA 2IGFH 1DEEB 2Z4QB 3ALXA 2BOCB 3WSQH 5D7KD 4NNXA 1A6AA 1TDQA 1ERNA 2XZQL 1ROWA 3BGFC 1NGQL 2BJMH 4WW1A 1JHTA 2P4AB 5CGTA 4L1HA 1GVIA 4OAWB 4OI8A 3IAQA 2P43B 3X3FH 2R1XA 3ZDXE 3ZHKA 5ISZE 1NGYA 1VFOA 3QUMH 1FBIL 1U3HD 2VDPH 5T5FL 4G7YH 2QSCH 4XHJC 3PWLA 3CNKA 3FQWA 4GKSA 1HZHL 2ADFL 2PN5A 2GJZB 3SGJA 5AAWA 5BRZD 5INCA 5BZDA 1M1SA 2VQTA 3VXMA 5IVZA 2NTSP 1XH3B 3DPBA 4LU5L 5FHBL 5DVKA 3GBLA 1RUPH 4OLWH 5FA3B 3S34L 4L5FH 1N6VA 5FM8A 2AXGA 2UZIL 4BQ8A 2RGSA 3BRGC 4X6BA 2DWEB 1UCTA 2CUHA 4AL8L 5KSAD 5C0BB 3A67H 2YMXH 1E4XL 2XKSA 5C1MB 3L3HA 1X4XA 3C2SA 2NY5C 2IH1A 1T6VN 3UTSB 5HSFA 4YHNB 1M7XA 5CZVH 1FZMB 4Y4KD 1MNUL 4PJHB 3L9RA 4J3VA 1ND0B 3S3SA 4KPHH 1G1CA 4HX1B 3V4PH 2X5PA 3I6LD 3WHE1 2W9EH 5C92A 1ZS8A 2EDDA 2AJYL 1YMME 4WO4D 3OMZA 5DQ9B 2ARJQ 3ZE0F 4NQXA 4JZOA 1RUKL 4KI1A 2Z31D 4KKBC 2L7UA 1U91A 3DUHA 3PGCA 5EU6A 3DGCR 4MA1B 1M05B 1MWAL 4N0UA 2F53B 1JL8A 2IH3A 1DQTA 4MJ2A 2IBBA 1NH6A 2PYFA 1EO8H 5J89A 4KVCH 3KYKL 3U36A 4C57C 3U79A 1NFIA 3C5ZA 1EEZA 3OB0K 3MOAL 4X6CE 1NKRA 3O9WC 2XN9B 1GIGL 3HI5H 3IB4A 3BP6A 1U8PB 2HKHH 4PGEB 2VDLL 4NQVB 4YHML 4JREB 5DJXA 3AU1B 3HPLB 3QNYB 1YZZA 1CGWA 1DVFD 4Q9CA 4R9HA 4PJBA 1IT9H 3RAJL 1D5IH 3NFSH 5GS0H 4XGZB 2CMRH 2CH8A 1I8MB 3MJ9H 5HYJA 5E9DD 5DWUL 3WFEH 4XCNB 2A73B 2EE9A 2FATL 1DP0A 2F58H 4GOSA 3NCEB 1BFVL 2A83B 1BMGA 1OTTC 4XHJD 1I7ZA 2D31A 2CO7B 3D48R 4WDIA 2OSLB 4JQVC 3RGHA 1A5FH 2QTEA 4M1DH 1EFXB 4OQTA 4ELMB 4GLRI 2YD6A 1A3QA 3JVGC 1X4ZA 1P4IL 3IDGB 2MPAH 3X3GL 4WENB 4V1DD 5IROC 4TUKH 2VXTH 3F5WB 1ZANH 1A7OL 2YN3A 2QEJA 1Y0LB 1KCVH 3B9KC 2FBJL 4U1MB 5SWZD 5JA8B 3WNKA 3H42H 2CKBH 5CJQH 5DC4B 3KPSE 2WMPA 4Y1AA 3W0WB 1TJGL 3LKSB 2ADGB 5EN2A 4NFBA 4L4TD 5CEXB 3U7YL 1KB5A 4OM0H 5D5MB 4NIKB 4WHYH 1L9MA 3E8UL 5D1QB 2NYYC 5EDXA 1FFNA 2W65A 4TSBL 5CD3A 3KHQA 5FB8A 3BVNA 4V2BA 5IB5B 4BFEA 2HVJA 2X4OA 1WFTA 4TUOB 3T4AA 4Z18A 3DX8A 3EO0A 1ZHKA 1J8HD 2MKLC 4RZCA 1J1PH 4OCLC 3CVHA 4WV1C 4RMTA 2IAND 4YNYA 4PJGE 3QXWA 1PKQE 4RFNC 1MRDH 2ZKHL 4LLMB 3G5XA 1IL1B 1I1FB 1MCDA 2VLRA 1MFAH 1N64H 2Z92B 4U0RC 1OM3L 4DAGL 4Q2ZA 1HHJA 5SWSB 3MMEA 4JZJB 1MCSA 5ETUB 2Z91B 3REVB 1D5BB 3TIDB 4G43A 5HHXH 3P4LA 3DX7B 4XP1H 4D3CH 4NN7B 5DURD 4AM0B 1C5BH 1WCBB 4G3YL 5L0QB 4YHKH 2OTWB 4LVHB 4YHLL 1GC1L 4R2GC 4NKOB 4JHAH 4BZ2H 4C59B 1C16B 2BXZA 1C7TA 1XF4B 1NBZA 1I8LA 3QUYC 4X9BA 1XIWA 3BRFA 1BZ9A 2ICEB 1TZGH 5CKGA 5ERWA 1T80A 4F7EA 2X40A 3OAZH 5D6CA 1U3HB 1UG9A 1RIHH 2EO1A 4EDXB 2JJTC 5JQ6H 4RA0C 1MJ7H 5T1KB 1PSKH 1ONQA 4ZTPL 3WJLC 1EJ6A 3KYNB 1BD2D 5KG9B 2IJ0C 2DQIH 4PP1C 1A7RH 5IMKA 5EZIH 5BRZB 4GW1A 1M7IB 1KLGB 4Z7UF 4CU7A 1T7XA 4LARL 5EO0B 2ADIB 3OR7B 3OBAA 1HI6A 4X7TA 5ESVB 3BSZH 4XPBL 1EAPA 5EORL 3HRZB 1FJ1A 1YNTA 3T0EE 1OTTD 3V6OA 2HLAB 5SX4H 2NQCA 2OR7A 2AJ3A 4F80A 4ZFGH 2BX5A 4YE4L 4ODTL 1A6UH 3QH3B 1T4KB 4Z8FL 1VGEL 3K2UH 1JGUH 2H9GA 1EHLH 4OZGF 2PYED 5DYOA 5EFIB 1MPAH 2ICWB 4MX7B 3CFKA 4Y4KB 4AQOA 1MCPH 4PJ7E 1AGCB 4XTRC 3B9KD 1G6RB 4MNGB 1KPVB 5CJ5A 4WNQB 4M48L 3TIEB 1SJHA 1NGWA 4WO4B 5E8OB 1CFSA 2AW2A 1MCBA 1IZJA 5CEZD 3EOAB 35C8H 1W8NA 2I26N 2Z31B 1TETL 5TE4L 3V6ZA 4AY0A 5IGXL 3GI9L 5FYJE 5IFHL 2NYYD 2G5BA 1TPXB 5DJ8A 2ILLA 3MRCB 4OFVA 2E7BA 5GGVL 5IFJA 3R1GH 1CYGA 3OG6B 1CDCA 1QLFB 1NUFA 3HUJE 1QKZL 4WHYG 2AEPL 5E8NB 5SWQA 3Q0HA 4NO2A 3FN9A 4QOKD 1N59A 3RZCB 5C07E 3MRHB 4JDZB 4C4KT 1G6VK 5JOEA 3MCG1 4ORZC 3I84A 5ELIA 4U3XA 2XWBB 2EDXA 3Q6GH 5TF1L 2PXYC 3TLRA 5TFSH 1DVFB 4QRPD 4UDTA 4QRUA 5C0JB 4WY7L 1NGZB 2IFFH 4R2GD 5F3HA 2DI8A 1OSZB 3QUYD 3Q2CA 4JO2L 5CINH 5DMJB 4IRZL 5E9DB 2P8MB 4H1LB 4PFEA 5DQJB 1KIPA 1KPUB 2A38A 3KYMB 1CLYH 1TZHA 1DANT 5ID0B 3VXOA 1DE4B 5AUMB 5FYKL 3F12A 3FHAA 1G1YA 1WVZA 3S4SG 5B8CA 4YXKH 1NGXB 1PEWA 4PP1D 3QULA 4I0CC 3EOBB 4EUPB 5I1DB 5EC2B 4LCYB 5DMKB 4WEUD 2UZXB 3UZEA 2QSQA 3RUGF 2AJUL 1JNLL 3BJLA 3INUH 2FCBA 1C12B 4PJ5D 2GTWA 2PTTA 9CGTA 5SWZB 2R1YB 1BAFL 3KJ6H 3V4UL 1J05A 2FX7L 2X70B 3TV3H 4HIEB 3HNTH 4OCRH 4YUEL 5B3JE 3LPFA 5C0CD 4PRPA 1YEJH 1F11B 4XPTH 3MNWB 3BQUC 4NKQB 5TGBA 1CT8B 1MH5B 1T83A 3S37L 4L4TB 1RHHA 5C7XH 2IGFL 2DQGH 2Z8RA 2G75A 3PWVB 1HK6A 1V7ML 1GHFH 5H8DA 5DA4A 1IMHC 15C8L 4JRYD 4XTRD 2C1PA 4N9GA 4N8CL 3TCLB 2CDGB 4O2EA 3L3DA 4KV5E 5M7QA 1J8HB 5BOZG 3VE0B 4PRHA 5LQBH 4NKMA 4F7MA 5GGSY 5D2LB 3NCMA 2IANB 3X3FL 5J6GA 4G42B 3D9AH 2H1PL 4KZEH 4CN6A 1LP9E 2GJ6E 1YMMD 4WW2A 4N8VG 1GZPA 5I1AB 3D6GA 2H6PA 1FNAA 4GFTB 5IKCB 3MLWL 4MJ6A 4EI5A 4DKFL 4GG6A 4X6EB 4H8WH 3JTTA 5DJZA 2LVEA 4K7FA 1YECH 3KPOB 3DX9B 3QEQA 2YBRA 4HIXH 5SX5K 4RFOL 4OFKA 5DURB 3UTSE 4WTZA 4HGMA 3HZYB 3H9SA 4DWHA 2FZ3B 3T0WA 3CDYA 3KR3L 2HKFH 3A67L 2OK0H 3HRPA 3FRPA 1P1ZB 3CSYA 4Q9QL 3P9LA 1EFQA 1NDGB 1F4AA 1PX4A 3MCKB 4JKPL 2PXYD 2J8OA 1Z9LA 4OZIE 1BD2B 2DRUA 5C09B 1LILA 2MNUA 3QUZA 3FOMA 3MLRL 5SX4I 3LS4L 12E8L 4OD2B 1I85A 1I9RL 2JKXA 5L88H 1NL0H 1RJLA 5KSUB 3W81A 2F53E 4G9DA 3TH3T 2X4QA 3MCLL 3KPQB 3OKMB 1G7MA 2L4OA 3FQRA 5MENA 1NBVH 5GGTA 3KPNB 1YNLL 1H3GA 3X14A 1A1OB 1NCBH 2CSPA 4DTGH 3RVXC 1A1NB 4HMCA 4NQEE 4ONOA 3Q5TA 5DVLA 3SDAC 3T0EC 4X6DE 2PYEB 2F74B 3VA2C 1MHHB 1FYTD 1EO8L 2FEEI 1HDMA 3RBSA 2VYRE 4PJ9C 4K7PX 4D9RE 3QI9C 4GBXA 3B9KB 5FXCH 3GUTB 3T0DA 4PJCB 4XP4L 1FVDB 3IKCB 5HDBF 1BBJA 3UTTE 1G6RL 2DQUL 3HI5L 3A6CH 4Y19B 3BQUD 5IW6A 3PQYE 5J11B 1FH5L 3DV6A 1MUJA 1AFVH 3IDIB 5DLMH 4NUGL 4R0LC 4RIRA 4Z0XB 1QFWH 4JDTL 4YX2L 4PJAA 3OGCA 3KPSD 4XPAL 3MYZA 3BEVA 3EJYC 4FQQB 3NFSL 1HILA 4XVJH 2XXMB 1BQLH 3DECA 3DIFB 3QDME 3FO2B 4BFBD 4GAJH 1NMCC 3CK0H 4KKNA 1AQKL 3MRFB 1YEHH 3SY0A 1TXKA 1EGJH 4H25A 2MSPA 4QOKB 1H5BC 2F58L 4L4VD 5HYIA 3DXAD 4YDIH 1VGKB 1FIGL 1YN6B 1RULH 4JFQA 3DVNA 3BW9A 1QNZH 4KQ3H 1A9BA 4IBLT 4BSVB 4YXLH 4U0RB 1A5FL 4P2QA 3QYCA 4K94L 4PGDB 2XQYG 3AUVA 2A9NL 3I2CH 3MREA 1EEUA 1HHKA 4L8SB 2YN5A 4QXGH 1AKJD 2MPAL 1GGTA 3VFNA 1I1AC 3TH2T 3I3BA 4MD0B 2VUOA 1PW3A 3NZHL 5AWNH 3HA0A 4H88H 4OV6F 1IGYB 5LGJA 1OAKL 1JYVA 1G9MH 4HUVB 5F72S 2WK2A 4R2GB 1YPZB 4I4WB 3OL2A 3QUYB 1TZIA 2BHYA 4LPYA 1ZLWK 1VFMA 3BPCB 5BZWA 3NBNA 5B39B 5DEFA 4B7LA 3NABL 2ESVA 4U2YA 2XY1A 4OM0L 3RJDA 1J88A 5C0AE 5BZDB 3QNXA 1FNGA 4KZDL 1JF5A 1HSAA 5IVZB 3OKNB 2GSGB 2QR0A 4HPOH 3BI9X 5HHVL 2GEEA 3EDKA 5C9JB 1YEDA 4KHXH 4CJ0A 3GFUA 2AJXL 4CL7A 3Q1SH 2X10A 4NZRH 4PJ5B 1W72B 4LPVA 4U1GC 2DAVA 4CMHC 5FO8A 3U4EA 4HUMB 5C0CB 4LCCA 1H3TA 3RVXD 1N64L 3CFCL 5C0EB 5E6ZA 5B4MC 3BHBB 4XCYB 3SDAD 3T0ED 3DUUA 5T33H 4RNRA 5FHAH 1HXYA 4F3FA 4YHYC 4PJ9D 1GZQA 1ZS8B 3RWDA 5D96C 1DANU 2WLYA 4D3CL 1S7WA 1C5BL 3QI9D 4JRYB 1G7IA 5DD3L 4NQCA 2P48B 3U1SH 5JMOC 4HHAA 2W60B 4R7NA 4NC0B 5KW9H 3V6BR 1OAXH 4UIMB 5IB4B 4WFHE 1U91B 3FB8B 1U93B 3BN9C 2VDOH 1IGCH 3HC4L 3QISA 2CD0A 4NCC1 3RVUC 2IH3B 2OL3B 4RBPH 4OUOA 1PSKL 4X5WA 3N1GC 3EJYD 5A43C 3U2SA 2DQIL 3MV9A 1A7RL 2PTUA 5EZIL 3IF1B 2GKIA 3GJFH 4KVNL 2AVGA 2FJFA 4MB3A 1XGRA 1OCWL 4JB9H 1J0ZA 3BP6B 1L7IH 3RVWC 4JHZA 1IZKA 2DJUA 1RMFL 5I74C 4X5XB 1LO5A 3WIHH 4E5XB 1F3JA 2IC2A 5GGRA 1QFUH 5HYQB 1EEQA 1YQ2A 2QL1A 3S8WA 3L3JA 3EYUH 4ZFGL 1A6UL 4P57A 1J5OL 1M4KA 1MFCL 5FECA 4JANA 4PJBB 4UOJA 2GSIA 2VLJD 2FWOA 5LJYH 2PXYB 1I1AD 4MB4A 4HIHA 4TSCH 1EHXA 4FZEL 1GGBL 3O6LH 2WP3O 5F9WC 3T4YA 1JPTL 1HQRA 5JXEC 2VXUH 4FOMA 1FPTH 2OJZH 4EI6A 2Y36H 4KRNA 5FYJH 4K3JL 4WDIB 1N6QH 1R3HB 3NIGF 4MNQD 4NC1E 4W6XB 5J7CC 1ZMYA 5F7WC 5CWSB 4OB5L 1CD0A 2CKNA 3QIWC 5SV3A 3DURA 5HYSG 1WWWX 4M93B 1KBGL 5IMLB 1EZVY 4XBEL 4LFHG 4W6YB 1HHGB 1CFQA 1OPGH 4HWBL 4M9OA 4DUXA 4RWHA 3R1GL 4JDVB 3G5ZB 1FYTB 2B2XL 2JB6A 1KYOJ 4KJWC 3AB0C 3QB7C 3VH8B 2FO4B 2C3XA 5MI0C 1QFWI 1YA5A 1QRNE 2C4XA 3U6RA 2O93L 1D3CA 1DN0B 3BQUB 2X6MA 3HMXL 1DQDH 3MV7E 4K2UL 3BO8B 5B4MD 5DRWA 2BVQA 4ZOCA 3BVNB 3ULVC 4PJIF 4U1IA 2Y06H 1TVDA 3DX8B 4HGKC 4J3OC 5CEZL 4JO3L 3GDBA 1ZHKB 4KK5C 1ADQA 2V2XA 2D03H 1BHGA 1BGXH 3GMLA 4MWFB 1L0YA 2BNUA 2VISA 4JAMB 4X98B 2IPUK 3B8SA 3KNBB 1JPSH 4B0MM 2AV1A 2EH8H 5FM4A 5EOCL 3BN9D 3SDYH 5E24E 2NXZC 1LWRA 5DJAA 4EOWH 4ODSH 2VLRB 2X42A 5TE7H 3UBXG 4L4VB 3Q3GA 3RVUD 3DXAB 3BZFB 1CLYL 3O0RH 3EYOB 4M1GH 1CK0H 5BJTA 4P9HC 4MJ5A 4U1KA 5IBUG 1FZJB 3UDWA 2NPLX 1BFOA 4RRPA 4APQA 5ICZB 5CUSH 4LHUA 4LLDB 4GKNA 4HCRA 4LLWA 5TDOB 2GJ6D 1JNHB 4KMTL 4NZUL 1AKJB 3ULUD 3O2DH 2UUDK 1AQDA 1XGYH 3GHBH 4C58B 1BZ9B 3U48A 3UTPD 4KK6C 1AGBA 2CIIB 2X2YA 4M6MH 5ERWB 2BC4A 2KUTA 3U46A 1OY3B 1F3DH 5D6CB 1IAKB 3TV3L 3NPZB 5E94A 1JTOA 4HUXB 4RGNC 3C9NB 3TYGH 3D69B 5C86A 1F02I 2W9DH 5ALCL 2DM2A 1JUFA 2M8XA 4I2XE 4G6MH 5CJBA 5CJOH 2DQGL 5AYUH 4DN4L 4IJ3C 3VWJA 1A6PA 4X7TB 2B5IC 4X7EC 3C09C 5JXED 2W9LA 5DT1H 4CU6A 1AE6L 1FJ1B 3QQ4B 4K9EH 1LEGB 3BAEL 2AKRA 1T04A 4WU5A 4LVOC 4RMWA