5H2BB

Structure of a novel antibody g196
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
211
Chain Sequence
NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords G196 antibody Heavy chain
publication title G196 epitope tag system: a novel monoclonal antibody, G196, recognizes the small, soluble peptide DLVPR with high affinity.
pubmed doi rcsb
total genus 47
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2016-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bB01
4GAYB 1LO3H 1KPVA 3DV4B 4U6XB 4KJWD 3UJJL 3VD3A 1AKJD 5F6HI 5IVOA 4ODWA 1JGUL 3KJ4C 4JHAL 3VFTA 4J3WA 4LOUC 4P2RD 1P6FA 1ZA3B 4E0RA 4F9PC 4IMKC 3RP1A 4UMGA 4DOHB 4DFHA 3MRNA 4IOIB 2VLME 1DZBA 2HN7A 1NCDL 3CH1A 5IKCA 4U05A 3SCMD 1KULA 1XF1A 1T7WA 1DQJA 43C9A 1BVZA 4YUEL 3PWVA 2BVQB 3HR5B 2VL5A 4F37K 1LEIB 3TCLB 1ZT7B 2HFTA 1NL0H 1WBXA 3WLBB 1RUKH 3GKWH 3NFPA 4MB5A 3OKOA 5GS1C 3PGDB 5EZOH 5HHME 1DBBL 4Q9RH 3V6FB 4GKNA 4HS6B 3DYOA 4KVCL 3BXNB 3ARGD 1S8DA 2Q7NA 3GKZA 2OR8A 3VD5A 4KDTC 4RAUA 1NSNL 5HHXL 3V5HA 5DRWB 5IVXB 1P53A 2ICWA 4YDJA 1IC5H 5FUCC 3C08H 4ONHB 4LSVL 3LS4L 4WGWB 3EHBD 1Q94B 3VJ6A 2CJUL 5BO1L 4ODVL 4KK9D 3K4DA 5JOFB 3U1SH 4FQPA 5EZJB 4ZXBB 1U8LB 4HPOL 3L6FB 4X5LA 1NFIA 5FECA 5IJKA 3OHXB 3SDAC 1KJVB 2DD8L 3WNLA 1TZIA 2OZ4A 2YC1B 3SBWC 3T0EC 1EPFA 1QA9A 3UYRL 3DVNB 4Q6YA 3DNKA 4Z7WB 2E9IA 3U46A 1R3IL 3CXHJ 1TMCB 5F6IC 1WTLA 1MHEA 5DSCA 1ITCA 4HFUH 2X7LA 4GXUM 2JCCB 2BNRA 2HT3D 1JWUB 1M05B 1KEML 4X6BB 1N0XH 3TFKC 5JLZB 4MVBD 3EOTH 5GS2D 4B7LA 1D5IL 1J7VR 4JY6B 32C2B 4XX1G 3KPPA 2HYMA 1UM6L 5ITFB 2BX5A 4PJCB 1F4XH 4QRPA 5DJYA 4B7IA 5TE4L 1G9EA 3G6DH 4QHMB 4LEOA 2J8HA 2R2HB 4FQQA 4X4YA 4YWGL 5K9JL 3MUGA 4BSWA 4J23A 4K3HA 2Q86A 2CDFA 5FA4B 3S7GA 4B53A 1YEKL 1KJMB 3WXWL 5KANG 2HKHH 4LL9A 3FB7A 3RUGE 3VFMB 1J10A 4XCCL 3VXPA 5I9QC 4A2LA 5IMLB 5FK9A 3LD8C 3S5LA 5BS0B 2A9NL 4CL7A 4N8VA 3T2QA 5KSUA 5KN5B 1MCNA 3KPTA 4KRPB 2CGRL 3TIEA 3EDJA 1WC7B 3BYTA 1ZOXA 3SGJC 2J4WH 3FO0L 2QADC 3MLYL 4LRIC 1KENH 3I3EA 1I1AA 5ALCH 1NMAL 1BFSA 2AV1A 1RZIB 1KTKE 4QTHB 3I6KB 3WHXB 2XA8H 1AGEA 2DQIL 3MRHA 1NUNB 5D2LA 4KQ4H 1MQKH 2HFGH 5IT2L 1JGVH 2YD5A 4OLXL 1NAKH 4MWFA 3W39A 4RFNC 4AIZA 5D93C 2W0FA 3O6KL 4P57B 2IH3B 2NMSA 5KJRL 3H7BB 2IMNA 3F7YA 2DQEL 4R8WL 4OF3A 1BLNB 5J6GB 4NBXB 4C56B 5GZOC 3IDGA 4WWKC 3JUYA 4R7DB 1PQZA 5DUPL 4MD0B 2HTKD 3HG1A 5B3JF 2VDLH 3MOBH 3IDIB 3DETC 4YK4B 4TUOA 1VKXA 5J13B 1SYVA 4YX2L 2W92A 4FABL 4HEME 2WWMC 4OCRL 5I1DB 4UU9B 4Q0XL 3D39D 5EOQH 3MO1B 2VXVH 3HI1A 2R0ZH 4N0RA 4I8DA 3F58L 4L4TD 4PRBA 3DVGA 1A3LH 4JR9H 3BQUA 3E1F1 4U6HB 5JORB 4I3RH 2ICWJ 4UQ3B 2DQUH 3LRHA 1KACB 1JZ3A 2YPKB 3VFWA 5CSGA 2DWEA 1REIA 1PKQB 2AJZA 3EYOB 3QUXD 3OAYK 3NZHH 1JHLH 1HSAA 2D9QB 2OZ4H 4QOKE 3TZVA 1OQXA 5I1AA 1R3JA 3RA7L 4MNQA 4D9LL 3BJ91 4R7NB 4ZOEA 3SKNB 4MXVE 2IPUK 3O0RH 1YYLH 4XNUH 1IKFL 4NM4L 4WVRA 3H3PH 1G0YR 4K8RL 1C1EH 1RJZB 2AV7A 4H1LA 4EKXA 2J3SA 3RTQC 3UZVB 4Y19E 4WHTB 5I1EH 3VCLB 4F15B 4UT7H 5DYOB 5HDBE 2P49B 3EGSB 4D0CA 2DYPB 4G5ZH 2X42A 1NBVH 1MCOL 2FBJH 3HPLA 3CCHB 5HGDB 2H3NB 5I8KH 1CU4L 1L9MA 4NKIH 5I1IH 1FE8L 3ZSSA 2GTZB 4PJAA 4NJ9L 1T66C 4K23H 1HQRB 2OMBA 2E7LC 1T1ZB 1SVCP 1JPTL 1M1SA 3KYKL 3IFOA 4QYOB 3EYUH 4O9HL 3NPSB 4JHZA 1ZHLA 3OX8B 4XBGA 1IM9D 3VWKA 4EI6A 2APXA 3PP3H 2DM2A 4TSAH 3D2UB 2A6JB 2EE6A 3NGBC 4WCYL 4WRLA 1FIGH 3M8OH 1J0JA 5TE7L 5I0ZA 4PRIA 4KROB 4Y4HA 4X0KA 4JM4H 4PR5B 4UTBH 2F58L 4YHPA 3V4UH 4IDLA 5D1QD 3S35H 3HE6B 1HI6A 2R29L 3MRFA 1X5KA 2ARJA 4BH8A 4BSJA 3DUUA 4PJGE 3W5MA 4MZ3A 1S7XA 3E3QE 3G08A 1NAMB 5L2KD 4OZIA 4NKMB 4JO2H 5F93C 3U48A 2V5SA 4ZS6D 2X09A 1AE6L 3BPCA 2WQRA 3KLAB 3CFCL 3HZYA 1S7TA 3CFEB 3HMXA 4EOWL 1UM5L 3UJIH 2LFGA 4KKBC 4W68A 2XWBB 5FDYA 1PAMA 3ILQC 1G7IB 4WEMB 3CVIL 3PIQB 2KKQA 1H3VA 3DTXA 5ISZA 3MRPA 2ESVD 1EDQA 2AJUH 2GFBB 4Y5VA 5K9QI 1AQDA 4LCYA 1PG7H 1D5MB 3CDYA 4NKDA 4PJIE 5DVKA 4LKCB 3V9FA 1I8MB 3HNTH 1XEDA 4LVEA 1S7VB 3FT3B 1W72B 4R2GC 5KVDL 1FNEB 2DQHL 2VLKB 4R4FH 3BKML 1QSVA 1P1ZA 5JO5B 3UTSB 4KHTH 1I9JH 3QJFA 4L3EB 4LMQE 3GEWB 1OPGL 3BI9X 1WIUA 2MWCA 3TESA 1G7PB 4KJPD 2YHGA 4PGEB 3TVMD 2WBKA 3MACH 1EO8L 2AXFB 2G5BA 2H41A 3AB0B 3R0MA 5D71H 3F5WB 3JWNC 5J6HB 5BRZA 3U0WH 1IGIL 3CX5J 4LCUA 3RKDD 3D0VA 3VXTB 3I50H 2Q7YB 3LMJH 2EH7H 4YHIB 2DLFL 4QRRD 5DURD 3IXTA 5DS8B 1CLOL 1HHIA 2V9RA 2DMCA 4JFZL 4AEIH 5ESVA 3KDMB 1QFWM 2LU3A 4G9FA 5FDWA 1T4KA 1A22B 3FOMB 1FCCA 3OR6A 5FB8B 1UEYA 1NC4B 4PRNA 1AHWB 4NQCD 1RK1B 1Y6NR 5F88B 3QHFH 3TN0B 1KYOJ 1CF8L 5DEZA 5JHDB 1C5BH 4EN3C 1UACH 4HK0A 2GJJA 4JRYE 2WAHA 4XP9L 4E5XA 4X9GA 1MH5B 1KLGB 1JN6B 3IDNB 1KF9B 2F54A 5IOPA 4NRZB 4JM2F 1BGXL 4HG4K 1HILB 4E9LA 2PUQT 5EC2B 2D3VA 4X5XA 4EXPX 2EXWC 2BNUA 4S1SH 4UTAL 5I15H 1H3WM 2ZP0T 3RWFB 4NP4H 4Y8AA 5GRZA 2GUOB 2MCPH 4QXTB 3VWJB 4RAHA 4OQTH 4YXHH 5IWLC 1TPXB 1QBML 5C07D 1J0ZA 5F7YC 5HHNB 1PY9A 3QYCA 2CXKA 2OTUB 2WUCH 4H5SB 2IPUG 5L9DH 1EZVY 4WUUE 1YC8A 1UWEH 4UIKH 3SDCD 1MCPL 4BFEA 4WI3A 1QRKA 4X6DA 1DUZA 2NYYC 1MJJB 3VXQA 4V1DD 3UDWA 2OTWB 1BQLL 4M8QB 4I2XB 5MEND 5KSBB 1W8OA 1TETH 1XIWD 5A1AA 3W0WD 1QHOA 3KR3H 3PWPE 4X99B 3PHSA 2DAVA 4P5TA 3TYFA 2Z35B 3KNBB 3KPLA 1J0YA 3P9LB 4AIXA 1J8HA 3S36X 3NMEA 4MDIB 1WBZA 3EO9H 3NCYP 2J88L 1QSFE 2NXYD 2AEWA 3K46A 4YIQA 1EHLH 1UGNA 2D4FA 4J8RA 1E4XH 2BJML 4NO3B 3TBWB 4OM1H 4U3HA 1FL5B 1ULVA 3ZLQC 2GTWB 2BY1A 5DQJB 5SX4I 4LMQI 2ERJC 5DA0B 3VXMA 2ZUYA 3HZVA 2B1HH 2VQ1B 2X4PA 4KRNA 2R8SL 2OL3B 3RNQA 4ZTPH 4IJ3B 4BFBD 1S9VB 1AXSB 4BM7A 1ACYH 4HJ0D 5GGRB 3VXRD 1H15B 2J8UF 3L3OB 4B5EA 1K8IB 5H2BB 3QO0A 2AJYL 2IBGA 5F7EL 2WZPD 4I0PA 1YYML 2LVCA 5JPMA 4RBPK 5INDA 3MBEB 1WZMA 1UWGL 5C0RH 1IMHC 5IEKB 1JFQL 1QG3A 4K94H 3SDDA 3UPRA 3BW9B 5B8CC 3ZTNH 3WLWC 1G0DA 2EE2A 4JFFB 5DD6A 3BP6A 3NH7L 5CWSA 1DBAL 4LLVB 2DLIA 3E6HB 4K3JH 1QLFA 1HWGB 3U9PH 4LLUA 4PJBE 3LN4A 1UCBH 4BFIB 1CN4A 2QKIB 5EU5B 2NZ9C 2EDEA 1NUGA 2JJWA 4FQLH 4YJZL 1FYTE 3IDXH 3MCKA 4HIEA 3SE9H 2H1PL 4NGHL 4XNZC 2X05A 4CJ0A 1D7FA 4Y4KD 3MV8D 5F7WC 2VLRD 3A0OA 4LHUA 5FGBA 4YBHA 2QLVB 2Z4QB 1FNSH 1UZ6E 4AYFA 1HHJA 2P7TA 2Y5EA 3QIUD 5GIRB 4ZDHB 5JOEA 2VERN 4LSUH 4U1KB 5DD1L 3QG7L 4FS0A 1GGCL 2A77L 4WV1B 3U83A 4LF3A 2B2XH 4NN7B 5DVNA 3MRGB 3RDTC 3FT2A 4N68A 5CINH 5IM7A 1MCQA 1YMMB 4NKQB 4PJDB 4OD3H 1CICA 3VFRB 5MEQA 3BZ4A 4KHXL 1R3LB 3PDGA 5DTFB 3RPIB 3OAYH 4H88L 3VG0L 2C7UA 5ABDE 4Y4FA 4S2SA 1D5XB 5FM5M 4GW4A 1DDHA 2E9JA 2YD6A 5F3BB 2ZJSL 5HGAB 3C8KA 5EC1B 3GSRB 1V7NH 2Z31C 3C5SB 1A1NA 3PNWA 2D7TL 4NOBA 4M3JA 4YNYB 3MRLA 4HUUA 4IRSB 1HSBA 2R1WA 3WFZA 4X80L 1QNZL 2JK5B 3IVKA 4FQ2H 4RX4D 1T5WA 3IJSB 4CMMB 1N64H 1OF2B 1CQKA 2AJXH 4FFWC 2PO6D 1Z0MA 2DQCH 1OLZA 1EHNA 4J7RA 3QH3B 2EC9T 3WDIA 3NIFF 4MAYC 2VXTL 3MLTA 3C60D 5ID0A 4M7ZB 5E5MA 5TQ0L 5DMGC 5C70A 3ULVD 5IVXE 3S96B 1A7RH 1ZGLP 3P4LA 4M7KH 3F6IA 4PJ5D 4S0TD 3C6SB 4PY7A 1A7PL 1TNNA 3KPRE 1PJ9A 1HXMB 1NCAL 1FL3B 1Z2KA 4K71B 4L29A 4KJYB 4IIQB 1E6JL 4Y16A 4HT1L 4Z95L 3FTGA 1I9IL 4XMPH 5HI3C 3VH8G 3SE3C 5HSFA 5TDNB 2Q1EA 3L1OH 4R90L 1BJ1H 4RISL 3QI9A 1ZGLM 4QGTA 4LFHD 2ADGA 5T33H 3GFUA 5J3HC 1I9RL 3MLXL 4L9DA 4A6YB 1BJ1J 2JCCE 1LEGB 5DJ0A 5FYJH 1S9WA 1ZVSA 1FLRH 1WZ1H 2CRZA 4PRHA 4TVPL 3RWHB 4WI9A 5A3ID 4YDKL 1A7QL 4HK3J 5FOBB 4L8BB 2VR9A 3V5DB 3U0PA 3G04A 1E28B 4P3DB 3HB3C 4K3EH 5BW7C 4OF8A 4JJ5A 1MPAH 4WW1A 2G2RA 1CGSH 3MV9D 3V4PL 2ZCHH 4ENEC 5I0DA 1J1OL 3TYGH 1ZTXL 5F8RC 1FVEA 2ADIA 4U1GB 1Z5LB 3J8F7 3JZ7A 1I1FA 3DOSA 5KBNC 5ID1A 1MFBL 4UV7L 2FWOB 4RNRA 2OJZH 2NCMA 4X5WB 1XGRA 3HE7A 2I60L 1T0NB 3RVWD 5C0DB 3BIKA 3DHMA 3VGHA 5I1LA 2OJEB 2EEAA 3Q6FA 2VDRH 4PGCA 4RFEB 1F11A 2NQCA 3TEUA 4JPIB 1RZ7H 1MFDL 4P2OC 5E8OB 2YRPA 2QQNH 5EU4A 4D9RE 5DRXB 3X12A 4M7JH 3NCCB 2AK1H 3E3QC 1EUTA 3MOAH 3EYSL 3D25B 3OPZL 1WZLA 3H9ZA 5TF1H 5E8DL 1JGDA 2PYED 3VGBA 2VDQH 2GW5A 3SJVB 1KSRA 2GT9B 3DSNA 4KPHH 1YPZA 4ZUVB 3QUYD 5E8NB 2M2DA 3JSSA 3GO1H 4KGLA 2NW3A 1BWMA 3LQZB 2GCYA 1OP5K 4ZSOB 4KH2A 4OB5L 3FRPG 1QQDB 1T20B 3RY4A 3UJTL 3TC9A 4JO4H 1OAYH 3FRPA 4UDTA 3MV7D 5GRUL 3UTTD 1U8IA 2W65A 1ZHNA 1ZA6B 4FFZH 3G5YB 2BRRH 1O7SA 4MB3A 3ZE2F 1HINL 4RSVA 2H2PD 1DBML 2PW2B 1MI5B 1D9KA 3B2VH 4G43A 4M5ZL 3PQYD 2AQ2A 1KG0A 1TCRA 1TCMA 4JM2D 4C4KO 2XPGA 5EWIL 5AD0A 2JELL 1MHPL 2FATH 5DR5L 1NDMA 4L8SC 4N0YH 1OTUD 2PKDA 4GKSA 2V17H 4ZYKA 3SDXF 4KZEH 3NACH 4N9GB 4OIBA 1P84K 4FQXD 2P5EA 1MAKA 1A4JB 2F74A 5C2BL 4Y5XC 4JFQA 1NMCB 1NJ9B 3BKYH 5C08B 3ILPB 3PJSA 4AG4H 2R1YA 1IAOB 5SWSE 5ICXB 4XP4L 5CCKH 5D96C 1QO3B 3PGCB 5KTEL 4BFGA 2AXHA 3IS1X 5CIPH 2BVYA 4FTVD 2A9MH 4LLMB 4MJID 1XR8B 2O5XH 4LARH 2G5RA 3AREB 2AEPH 3I02A 2YMXL 3K1KC 4L9LC 4M1CC 4N90D 1ZLUK 3X3GH 1L6XA 3N85L 4BH7A 1FNGB 4YEEA 2GJ6A 4X98A 1XF2A 3FONA 5E8EA 2X4QA 2NY2B 3IXAB 5CEYA 1AGBA 3V4VH 4XP1H 1IM3A 1KNOA 1FGVH 2BSRB 4F7CB 5GS2H 1R3KB 2BHZA 1DLFH 1WV7T 5DO2D 3IU4L 2NY5L 4GG6B 2WSKA 2FLRT 3LKSA 4JDZA 4XPAL 5FYKL 5JW4N 1KPVB 1RUML 5HI4D 1Q1JL 5EU6E 4X7SL 3S88L 4W81A 4ODWB 4Z8FH 3E2HB 4Y1AD 1U2CA 3VFTB 5EUOA 2X4NA 3NOIA 5FHBH 3QNZB 2XN9E 4E0RB 1YNKH 4GRLB 1FG2A 3RL2A 2X6MA 3GMMB 1AGDB 5D1XD 4RBPH 2WK2A 3O11A 2YKLL 2HN7B 3CH1B 5IKCB 2HH0H 4JY5L 1DLHA 4RZCA 1FNHA 5DK2A 4OLUH 4KZDH 5HHPA 43C9B 3ARWA 5AZEH 2DS4A 3PWVB 3DX9A 2VL5B 2PXYC 4GSDH 4OUOA 1T83A 1WBXB 2OLDA 1XAUA 2E6PA 4CU8A 3NFPB 2VISA 3OKOB 1DFBH 4KK6D 3MLZL 4YZFF 5E9DD 4WFED 3ZKMC 5FFLA 2NZIA 4GKNB 4Z7UF 4M6MH 5CGTA 2W9EH 4Z7OF 1T03L 1S8DB 3INUL 2R69H 4XPHL 3RVTC 4D94A 4OKDA 5KS9F 2IADB 3V5HB 4YDJB 1IT9L 3UC0L 4K8RD 3VGGA 3VJ6B 5GGVY 4IMKA 1A7OH 4FQJL 3D3VB 4LSQL 2AAVA 3U7AA 2HKFL 4KKLC 2X40A 5C7XH 1CVSC 4GJTB 3JUZA 5F96L 3O2WL 4QRSB 5E2WL 3LS5H 1TZIB 3QUZD 1C08A 5DUBA 2XZAL 5IB4A 4XAKD 1QA9B 2VLJD 3UTSE 3WD5L 2OK0L 4P46D 1SJEA 1WVZA 4L3EE 3U46B 4RMVA 3BPLB 5T1MA 2HLFC 3P40A 1YEFL 3PWUA 4UBDC 1JK8A 4HXAL 1MHEB 1PLGL 4PB0H 1A9BA 5IMKA 3LIZH 5T1DH 2NY7H 5CBAB 4JHBA 2X7LB 3BISA 2FEDD 1R6VA 1G7JA 3DXAD 5DVOA 5FYLE 4JKWA 3IU3A 1ZWIB 3KPPB 3FO9A 2BVPB 1J9CT 3R06A 1MRCL 2GEEA 3BD4A 2Y6SC 4GBXB 5DJYB 1SJVA 1HH9B 3KHOA 1MEXH 2ZNXA 3SGEI 4KK5C 2Q20A 4ZMAT 4FQQB 4X4YB 3ZKXB 5T3ZH 3LB6C 1GHFH 3MUGB 1LP9A 4LGPB 3TT3L 3ZT5A 3IFNL 1QHPA 4CUCA 2RR3A 2Q86B 3U4BH 3LH2H 3SBWA 3BDYL 2MNUA 3P9MA 1G6RL 1IAMA 1A6UL 1UA6L 3KPSA 3VXPB 2MMXA 3I85A 1RZ8A 3BPOB 1X44A 3U6RA 5FK9B 1I3UA 1S7WB 1RY7B 5D70H 3S5LB 3MLVH 4N0CC 5I73C 1BBDH 3PL6C 4Q9BA 5KSUB 4BZ1H 1EAJA 1JRHI 3G9AB 5AZ2L 4LGRB 4KY1L 4M1DL 4XCFL 2H45A 3TIEB 2R0LL 4ONFH 3O8XB 5GS0C 2DN7A 4P23D 3RQ3A 4IRJD 3SEPA 1OAZL 2AV1B 4NQDE 2ED8A 1HZHL 4N8CL 4QHKI 2ZCKH 4YQXH 1NMBH 1MF2L 1X9QA 1AGEB 3VW3H 5E2VL 3MRHB 5EBGA 4GLRI 2EDJA 4S1RH 3NBNA 1U8OB 2X1WL 1B4JL 4EQ2A 4XC1H 2BZDA 2R0KH 5CGYD 3W39B 5J56B 2QQKL 4ZOAA 4AIZB 4Z7NE 5F44A 2CKBA 3W9EA 2W0FB 4I5BA 4I2XE 4GUPA 2IANA 2DQGH 4ZODA 5KSBE 3F7YB 3P4OB 3RGHA 5EIIB 5HGBA 3BO8A 1XMWA 3AM8A 3EJJX 5ACMA 1F3RB 4OQ1A 2DQDH 3O9WD 4MD5A 3HG1B 2P8LA 3QDJE 1KCRH 4KKCD 3FB8A 4TUOB 4M1GL 3RVUD 3TLRA 5C0IB 5SV3A 1VKXB 3CDGA 1HHHB 1M7DA 1SYVB 1AO7D 2ORBH 2Z8SA 3THML 1CE1L 4D8PA 3BKJH 4HMEA 1QSEB 2UWEB 2ADFL 4XMKH 3HI1B 4YO0B 3BUYB 3BT2L 3DVGB 3BQUB 1YY9D 2WIIA 3DI3B 3NA9H 4XVJL 1Z6JT 3VFWB 2DWEB 1IRAY 1TVBB 5F70A 2AJZB 1YDPB 2ZKHL 3AROA 1E0OB 4ZXBC 1HSAB 3OGCA 3V0WH 4LP4A 5IB1A 3TZVB 3QDGA 1N7MH 1R3JB 3RJDA 4MNQB 5E95B 1AY1H 1TTFA 4FXGA 4XXDB 5GJSL 4YHLL 2AV7B 4UINH 4U6YA 1K2DB 3CZFA 3MODL 3R1GH 4KK8D 2FX7H 3WJJC 1IAII 3L3IA 4ODBD 4OKVB 4NN5B 4D0CB 1B4RA 5GRVL 3QIBA 3QRGL 1K85A 4TULH 5C1MB 1R5VB 5M7QA 2APWA 4U1NB 1IGTB 2XTJB 3PXJA 4RWYL 1VHPA 3IFLH 4HZLA 4PJAB 3HI5H 1FFPA 1MIMH 3KXFD 3RWIB 4Y2DD 4FA8A 2MJWA 4HCRH 5BVPL 4OCSL 3K80A 3BN9C 3L7FA 1ZHLB 4XBGB 2VLLA 3VWKB 5L88L 5DUML 3QCTH 3TJEH 4KAQH 3WUWA 2VDPL 4LRNH 1U0QA 4N0FA 4PRIB 4ZQKA 1EEQA 2CO7B 4X0KB 1DL7H 1OTTC 4YHPB 4HC1A 4U2YA 4ETYA 4KI5F 4PJDE 3QCVH 3ZO0A 2PTTA 2ARJB 4BH8B 3DUUB 4KRPC 4Z7VA 1XF4A 2XNAA 3QQ9C 2K3TA 3OSKA 4JG1L 1TVHA 3G08B 1F58L 3CFJB 2NY3B 2J5LB 2HJLA 1FO0L 1YN7A 2EH8H 5T5FL 3BPCB 5C71A 2GK2A 5CJBA 3P3YA 3HZYB 3RKPA 4UT9L 1NANH 1UH3A 1A7NH 3WFEH 1N4XH 1P84J 1TLKA 3UBXA 4HQQH 1A7BA 3ZE0E 4CN6A 5IW1B 2E7LA 5CAYB 1FRGH 5DMJB 3S36L 3LEYH 2I27N 3EO1B 5ISZB 3MRPB 2RCSH 1ZLUH 1F6LL 1Y0LB 2D7QA 4JZOB 3JWDH 2BY2A 3WIIL 2BHUA 5JXAL 1AQDB 3MYZA 4LCYB 4NO0D 1XCQB 3EFDH 4TRPL 4DGVL 5FUOL 4RMWA 1MHCA 2X9YA 4NKDB 2PCPB 2BFVH 4MZ2A 3VXUD 1W0WB 4H25A 4CVUA 3VXOA 1Z9MA 5FV2A 2Y4SA 2BSSA 1DVFD 2Y07H 4OD2B 5EU3B 1P1ZB 3CPLA 4YK4C 3B6SA 1JZ5A 4TNWF 5J13C 3MLPA 3Q2CA 3TJHC 4M6OH 5J1TC 1BFOA 4FFVC 2J12B 3DX6B 2ILLA 5L2JA 1OW0A 5BRZB 2DTMH 3OKKA 1R3HB 4TTGA 4LCUB 5AEAA 2H32A 5JOPE 2RQ8A 2QHRH 3I2CL 4D9QE 3DGGA 3IXTB 1HHIB 4JFDD 5ESVB 2V2WA 5JUEH 1KELL 3H9SD 1BBJA 5FDWB 1UKQA 1T4KB 3DV6A 3UYPA 4GT7A 5DDHA 1JPSH 3OR6B 5I30H 4QHLA 4PRNB 4P4KA 3O4LD 4DTGH 4PRAA 4XP6L 3ME0A 4LFHG 1UM4L 5FCUH 4XAWL 4HK0B 1UVQA 1Z3GL 4X6CA 2Z8VC 1OAXH 4PJFF 2PETA 5E6IB 2WWKT 4E5XB 4F15C 2F54B 3MRBA 1GIGL 3FN3A 4OLWH 5IV2A 2YR3A 1DJSA 5D7IE 1T80A 5LCVL 4IEFB 4YHKH 4X5XB 5EZIL 1JUFB 3HC3H 5EUKB 4D0DA 3V7AG 1A9EA 4UAOB 3VFUA 1KFAH 3SKOB 3QPXH 5C0CE 4HXBL 2C4FT 4DUWA 1S7UB 3VRLF 2NY6B 2QSTA 3NPSC 4LIQE 2C3VA 3REVA 4P2QA 3TCXA 3QA3B 1S7QB 3NCYS 5LGHH 5KSVA 3QUMA 4M5YH 5C9KA 1T6VN 1NCCL 1YECL 4R26L 4C83B 4HC1H 4EN3A 4KROC 3LAFA 3IETA 2DBJA 3DROA 4X6DB 2FZ3A 3SQOH 4MA1B 3GMLA 3C6LD 3HE6C 5EN2A 4DGIH 4QRUA 4ELMA 4PJ9B 1A2YA 4YH6A 1JL8A 3D9AL 4PJHF 4EJ1C 2D7MA 5IB5B 5IB3A 1TJIL 3QISA 3TYFB 4X7TA 5IIEA 3KPLB 4ZO9A 1J8HB 3AY4A 4TVSa 1CXIA 2VN4A 1QRNE 1A1OA 1VPOH 1NFKA 4HWZA 1WBZB 5GGTL 5I19L 3SJVE 2FX9H 1CCZA 1VESA 3S37H 3VXNB 3FHQA 4YIQB 3PGFL 4HUVA 4J8RB 1TQCC 3PF2A 3LOWA 5C09D 3LHPL 4L4VD 5EO0A 1WCBB 1CI5A 3MGAA 3VXMB 1FG9C 1QPPA 3HZVB 4YHZH 1SYSB 4ZSOE 3G6AB 3WDHA 3QFJD 4TVPD 1YEHH 3RNQB 3F7QA 3BGMA 5IROA 4NQEA 5MEOA 1AXTH 1GZPA 3QO0B 4PJXF 2YK1L 1MI5E 3ZL4H 1FORL 2KQNA 5EO9A 2F53A 5JPMB 1T89C 4D2NA 3FZUD 1J11A 5IG7A 4R97B 2IAMA 3SDDB 3UPRB 4XRCA 1YMHA 3JWOC 3HS0A 3HZMA 2IQAA 2Z9TA 4TOYH 5C07E 4Z0XA 1KIUA 5DD6B 3BP6B 5CWSB 3O2DL 1KBGH 3PV6B 4G7VL 1J88A 1QLFB 3AB0C 1FVDA 1X5YA 2H32H 5D7KE 1GGBL 2OR9L 3LN4B 4TUKL 1M7IA 5C08E 2B4CH 4QWWD 4HIEB 4OFYA 1NC2A 3IF1A 4JFOA 4PB9L 5D7LB 4OT1H 3F7PC 1UYWL 4MDJA 1IC7L 3RWCA 3QXUA 3B9VA 3B9KA 3G6JE 5CJQH 3GB7A 5K33A 4MXWH 5L8KB 3QDHA 2XXCB 1AHWC 5FKAB 1HHJB 2P7TB 4AL8H 4FFYL 4UT6L 3TN0C 5DMIL 1WWCA 4XXCC 4LSDA 3P30H 5DZNA 4LF3B 3NN8A 4ZUSA 2BP3A 3FT2B 3MRDA 4NC2B 5LXGL 1I9EA 2VZSA 4JHAH 5GGQL 5IM7B 2QJDA 3AFLA 1IVLA 5JW4R 2V5TA 2HLAA 5F97E 1G7MA 1CICB 1FV1A 3GBML 5MEQB 3BZ4B 2JLLA 1CDCA 3VXRE 3CSBA 4FXKA 2OTPA 1KB5L 3JXAA 1LE9A 1JTOA 2C7UB 1NCDH 1LGVA 2UVEA 4Y4FB 1OAKH 5E70A 4S2SB 5H94A 4AMKL 3VWJC 4G6AC 1MFCL 2EXYC 3FT4A 1CL7H 1DDHB 5IW6A 1TPXC 3BP7A 1AKJB 5EO1A 3QUMH 2YRZA 3C8KB 3PNWB 1A1NB 1D6EB 3FQUA 3PWLA 2R1WB 2R9HC 2BOCA 5JQ6H 5BOZG 3IVKB 5CD5D 2F15A 1T5WB 2FO4A 3CU1A 3SDAD 1NSNH 5HHXH 3CFDA 4DN4L 3T0ED 3WNKA 2DLHA 5E6ZA 2YPVL 4JLRA 2CJUH 5E5MB 5BO1H 3RGVA 3GHEH 2ADJA 5ACZB 3GIVB 4HPOH 5KG9A 4P2CG 4PY7B 2NTFA 4OCWL 1YN6A 3P9WB 1P7QD 5TH2A 3MJGX 3UYRH 2H2SC 1GAFL 1RZJC 3CX2A 4L29B 3F6LA 1TJHL 2Z31A 4JRXA 5GGVL 4IJ3C 4QY8A 3VH8B 2B1AL 2PTVA 4N8PA 1KEMH 3BE1L 3HUJA 4PG2C 1D5IH 1UXSA 2YZ1A 2PTUA 3KGRA 3FFDB 1UM6H 2DQFB 3MBEC 2BNRE 4I3SL 3MA9L 4N1EA 5TE4H 5E0QA 4BSVA 1GZQA 4R3SA 3G04B 4QRPE 5IJVB 3QULA 4JJ5B 4WW1B 2G2RB 4NDMA 2BRQA 1IEAB 2BNQD 1YEKH 1IFHL 3I3BA 1FVEB 2ADIB 3H0TB 1UJ3A 2W38A 4KUCF 1SMOA 4WHDA 4HJJL 5DQDH 5ID1B 2JF1A 2A9NH 5JW4M 1PZUB 1KCLA 3LKRA 3SE3A 4RNRB 1T5XB 3MUHL 5DK3A 3PXHA 3HE7B 5BZWB 1TXKA 5E99L 3BIKB 3LPFA 1H3PH 5I1LB 3EYQD 3DLQR 4QNPE 3FO0H 3K0WA 3MLYH 4PGCB 3WIFA 1F11B 3T2NL 3OXRA 4WV1C 2QR0A 4NN7C 2ENSA 1CE6A 4AJ0A 2DQIH 5EU4B 3VMNA 5GRJL 4JZJB 3QWQB 3X12B 5IT2H 2ITDB 4OLXH 4F9LA 4WWKD 2HVKB 2SEBA 3O4OB 1F6AA 4N9OB 1ORSA 2BVOA 3CSPA 3DETD 1FL6A 3OKYA 3O6KH 5D2LE 4OI7A 5KJRH 1HNGA 4JVPA 3RUGF 3RFZC 2IFFL 3OKDB 1F00I 1J05A 2DQEH 5HGHB 4HIIB 3DECA 2WWMD 2Z0BA 1LO0H 5CSZA 1AR1D 2YUVA 1YPZB 5F1IA 2OBGA 2UUDH 1A47A 3K3QA 1OSPH 5DUPH 2OXHA 3IJHA 2NW3B 2JKXA 2ICWI 2VABA 4IRSC 4YXKL 3IAGC 2GCYB 4YDIH 4YX2H 5ITBL 2EKSB 5JMOC 4FABH 5T3XD 2R4RL 4UDTB 4NQVA 1U8IB 2W65B 1ZHNB 3F58H 5I8CA 4YHOL 1D9KB 4G43B 2BK8A 2XFXA 4OBRA 1KG0B 4J3VA 1TCRB 1U8MA 1W0VA 4H26B 4M7ZC 1G7HA 4HWBA 1NDMB 3D85A 3RTQD 3KG5A 4ZYKB 5GGRY 3ULUE 4MA3B 1FZMB 3RA7H 4D9LH 3D39B 2E7CA 1GGTA 4XHQA 4DCQA 2P5EB 3RWDB 4R4ND 3PWNA 4K71C 3ARQA 4JFQB 1JWMA 4K8RH 1WFTA 4IIQC 5C0AA 1C12B 3PJSB 4PJ8A 2R1YB 4MNQE 2VZ1A 2X9WA 1ED3B 1T66D 3QUXB 3OB8A 2OXGA 1JF5A 4YHMH 3K81A 4F7EA 3S4SG 2YD4A 5DD3L 1QLEL 2DMBA 1ZKAA 2O5ZH 1JMXA 3C2AH 5FF6A 2GJ6B 4X98B 3MRMB 3FONB 5E8EB 2PYEE 2X4QB 1CU4H 1R5IB 4ZS7L 3GI9L 5CEYB 5D6DA 1FE8H 4G9DA 3WKNA 5HD8C 4NJ9H 3EYVB 3U36A 4YFDB 3RWEA 1IM3B 1KNOB 1RURL 4L8SA 3IT8D 3MGTA 3WFHA 5E5UB 2BDNL 1JPTH 3KYKH 2XTJE 3VFGL 1WT5C 2Y5TA 1DQQB 1U8NA 2DQTH 4N0UA 5BCAA 1YEIL 3LKSB 4JDZB 3BJLA 4RA3A 3JTSA 1S9XB 3WO4B 4WCYH 3MV7E 3UTPD 4H0IA 4U1GC 4NKOA 5TE7H 5HPMB 1XGYL 1W8NA 5ETUA 2HJKA 5AAWA 5GGSB 3KJ6L 3PQYE 1UB5B 3L7EA 4OZHA 2R29H 4CBPA 1FG2B 3MJ7B 5HDBF 3RL2B 1WTGT 15C8L 4KKBD 4PRIE 3HR6A 1OTSC 3RZCA 3O11B 4L9LA 2NR6C 2HJFA 4OTXL 5C0BD 5DJXA 2YPLA 5GS0L 1AE6H 2I9LA 2FB4L 1QFOA 3CFCH 1DLHB 3HAEG 3QNYA 4RZCB 3GJFA 2XACC 1A4KA 5F9OL 1RVFH 5HHPB 3I9GL 4NHCL 3RI5F 3B9AA 3WJLA 3DX9B 4PGDB 1EA9C 4JFHE 4EOWH 1UM5H 4OZIE 1BVLA 1F90L 5D1QB 2R56H 3NTCL 3CVIH 2LABA 4OI9A 5CJXA 4G6KL 1VFBA 1MFEH 2APFA 2X4SA 4C54A 3SDXA 1NBZA 3HZKA 4F8QA 1U36A 4KI1A 5ISZE 43CAA 5L7XH 4Q97A 4WFGE 1XZ0A 4XH2B 1A21A 5DJ2A 3T08A 2DQHH 4FQ1L 5GJTH 4PJGF 3BKMH 1U8JB 3GIZL 3GJEA 3EZJB 1KN2H 3O6ML 4XVTH 1OPGH 1BMGA 1MFAL 2JB6B 2NX5D 2P5WA 3D0LB 1C08B 5DUBB 3RIAK 2EYTB 3BP5A 1IBGL 3MLRL 4CW1A 1JNJA 2VDMH 2VIRB 3HLAA 2YD1A 3V6OA 1F6FB 4HLZG 2DLEA 1F4HA 1U6AH 5T1MB 3PWUB 3BIAX 4I18B 4WUKL 1A9BB 4UDUA 4UOJA 3CLFL 1P4LA 2DLFH 5EZLA 2AABH 1CLOH 1AI1L 4Y5YA 4BA8A 5BRZE 1LNUA 4PJIF 2FBOJ 3IU3B 3VE0B 3FO9B 3H9HA 4G6FB 2GHWB 1CF8H 1NMCC 5MEPA 3OKEA 1NBYA 4G9FE 4NYLB 1BIIA 3CK0L 2EXWD 5GXBB 4XP9H 4YHNB 1UENA 1LP9B 2EYRA 1FSKC 5DURB 1VACA 2V5YA 1BX2A 2CO6B 3AREC 3CZJA 3P9MB 1PEWA 1P69B 2IBZX 5CS7A 2I9TA 1BGXH 3SGDI 1XH3B 3KPSB 2X4OB 4RMRA 1RZ8B 2HT2C 2A74A 3U6RB 2NY2C 3U82B 4P5MA 1F4WH 4I13B 5JXEA 2R0WL 4UTAH 1R0AH 2F54E 3AMLA 2DQJL 3SY0A 2NYYD 2ITCB 4BQ8A 4PJEF 4Z7UA 1QBMH 4JREB 5FUZL 4CAGA 1L6ZA 4Z77B 3L5XL 2E6JA 5KS9A 1MCPH 3QO1A 5KVEL 5HHQA 5DJAA 1OP9A 3QHZL 5TDOB 2L7UA 3VGAB 4RGNE 3E2HC 1BQLH 1YQVL 1FFNA 2AJ3A 4GRLC 3S9DB 1U8QA 1ACZA 2ZUWA 5E2TL 4X6DE 3DXAE 3W9EB 1PW3A 4Z0BH 3GJFH 4GUPB 4JG0L 3VRIA 2VQUA 1JZ8A 4RRPA 4LLQB 5HGBB 1VDGA 3BO8B 1E4XI 4JPKH 5ANMA 3FQWA 2J88H 4R6UA 3WYRA 5I1CL 4LCWD 3FOLB 4WW2A 4MD5B 1J8HE 2BJMH 5H35A 5MENB 4DKFL 1NEUA 3FB8B 3T77A 2CKNA 1QVOB 1Q72L 3CDGB 1M7DB 1LVEA 1J18A 4D8PB 2R8SH 4HKBA 2N7AA 1VFOA 1C7SA 1D6VL 4AM0B 5LQBL 3WLWD 4XGZA 3TBYA 4KUCD 4CN4A 2YUWA 3VXME 7CGTA 2AJYH 1IC4L 4HIHA 2C26A 1K6QL 1YYMH 2QV2A 2R1XB 2G9HB 3H42L 5JPNB 1UWGH 1SBSH 4ZFZB 2NZ9D 1JFQH 3MPCA 3OGCB 5IJKC 5IB1B 5D1ZA 3QDGB 3TH2T 4MMZC 3UAJC 2KPNA 1P7KA 3QDMA 4NC0B 4PGBA 3V5KB 3NCEB 3NH7H 1DBAH 4HLZH 2G60H 3OGOE 4LSSL 4FXGB 3ECBA 3DO7A 2Y06L 1JF6A 3HR5A 4OF5A 4PYGA 3BPLC 1GH7A 1UT9A 4YAQA 1Q9LA 4S0SD 2R39A 5TGBA 4U6YB 1XT5A 4QKXB 3REWA 2E7MA 1D5ZA 3L3IB 2H1PH 3ARDD 3BXNA 4K3DL 4NGHH 4Q9QH 4OJFL 4TNWK 4QHNA 3DO3A 1H9VA 1JCKA 2D0FA 3RDTD 1BIHA 1OWWA 5DRWA 5FKPB 4GBXC 4OZGF 3GI8L 3K1DA 3K2UL 5IFJA 4HZLB 2AS5M 1FFPB 1SQ2N 4G80A 1K9TA 1BREA 3T0VA 5DD1H 5EZJA 4ZXBA 1IGCL 3QG7H 3ZKXC 1GGCH 2A77H 1KJVA 2E5EA 1JYNA 1XCTA 2EECA 5C2UB 4AQOA 4EI5A 2YC1A 5CFHA 4M7LL 2OP4L 1DEDA 4PJBF 4Z7WA 4F80A 4GG8A 3K8MA 4KHXH 4N0FB 3BPOC 2IWGA 2KZ1B 3WE6B 2A0LC 1U3YA 1XF5A 4F33A 3O6FA 4NWUL 1CIUA 4H88H 3VG0H 2G75A 5B4MC 1RUAL 2M8XA 1KIRA 2PTTB 3DRQA 4J6RL 1M05A 4TSBL 5JLZA 4Z7VB 1FC2D 1XF4B 1MCCA 5FM4A 1TVHB 4JY6A 2EDWA 5DVMA 1X4YA 2ZJSH 1UZ6F 5ITFA 2DKUA 2HJLB 4Z9KB 4PJCA 1YN7B 2VAAA 4JGMA 1BF8A 2OMNA 3MXWL 4MAYD 4FQIL 4YDVB 3UBXB 4KTYA 5DMGD 4X80H 1HDMB 1IE5A 1CT8A 4M4PA 4PLKC 1G9NH 1U8PA 1NKOA 4F2MA 3RX8A 2EE3A 3ESUF 1KJMA 2VXTH 4H0GA 4IOSD 2DDQL 1NAML 5HYJA 1MHCB 1OOAA 2C3GA 1BZ9A 4KTDL 5IMLA 4PREA 5BS0A 4H25B 3QEQA 2C1PA 1Q38A 4QT5B 5HI3D 3C09B 4ZNCD 5KSAD 1AFVL 4O02L 3KXFE 4GRWH 1S5HB 2X5PA 4QOKD 3CPLB 1N0LA 2GI7A 1NCAH 3KYOA 3S3PA 1WC7A 3B6SB 1OT2A 3MLSH 4LCIL 5J3HD 3CSGA 2MPAL 1N8ZA 4AZ8A 1AQKL 1PG7X 4P59L 3QZWG 2IBBA 3B3IA 4Z95H 1I9IH 2EDBA 1BFOB 5I17A 1ZVHA 4GAJL 5L2JB 3WHXA 5T1LA 4HS8L 4R90H 4H20L 3BQUC 4Y19D 4RISH 5ADPL 1C5CL 3HB3D 4PJ5B 3IGAA 3ULUC 2H32B 4DN3L 1QEWA 1QPXA 1E4KA 1W72L 1I9RH 1MLCA 5DFWH 3V52L 1J87A 3DGGB 4F7TA 3S34L 5D7SL 1TTUA 4TVPH 4ENED 4YDKH 2V2WB 3TZVC 3H7BA 5FO7B 4PRPA 2FNBA 3DV6B 5IVXF 2R4SL 4QHLB 1BLNA 5J6GA 4LLWB 4P4KB 4C56A 1IGJA 4PRHE 4KKNA 4PRAB 4R7DA 4ZTOL 2X4TB 3C5JA 3ROOA 3V4PH 1MCIA 4JEGB 1UVQB 5FYLL 1NGZB 1ZTXH 3AAZA 5HHVL 4PUBL 3T4YA 2W9DH 3T3PE 4NN5C 1MFBH 4UV7H 1NLBL 3MRBB 3V8CA 1V8HA 3CLEH 1I3GL 1OY3B 4P2OD 5IV2B 2I60H 6CGTA 4U6HA 5JW5A 2XTJC 2YPKA 5DC0A 4D0DB 5M95B 1IAIL 1A9EB 4ZPTA 4LVOB 1PKQA 2JCCF 3VFUB 4ZG1A 4ZAKA 4CKVX 5E1HB 5T1KD 1ETZA 1MFDH 1OLLA 4HLJA 2PN5A 1Q9KA 2C3VB 4F57H 1WAAA 5TE6L 3REVB 5BZDB 3VWKC 2D7OA 2DM7A 1I8LA 1WITA 1R5WB 3QUMB 1AIFA 4GXUN 1TNMA 4Y4HC 3IETB 2FZ3B 4XNMA 3EYSH 3OPZH 4IHOA 3DSFL 4WHTA 4ERSL 2V2XB 4FP8L 3VCLA 5E8DH 4W6YB 4QRUB 5DYOA 5GRVK 4ELMB 1B6UA 1A2YB 5AAMA 3JBG7 4XWOC 5IB3B 4O58L 4NFDA 5CEZE 4X7TB 2NY3C 5IIEB 3CCHA 1VGEL 1NEZA 1A1OB 4HWZB 2GTZA 4YDLC 4HUVB 5F3HB 1YPZE 1HQRA 3JV5A 2KDGA 4Z7QF 1FC1A 1ZHKA 2VO5A 2ID5A 5J12B 5GRUH 5IHZB 4ALAL 2APBA 1OSZA 5EO0B 1HINH 1DBMH 4DAGL 4M5ZH 4Y5VC 2OI9B 2VZ3A 4RMSA 5D7JA 3SKUD 5EWIH 2JELH 1MHPH 4HIXL 5DR5H 3BGMB 4HWEL 4PR5A 4NQEB 5MEOB 2X1PA 4UOW1 2IH1A 2PR4L 4OCYL 5EO9B 2F53B 3ARXA 2ARJQ 2DKSA 1LE5B 4TSCH 5IG7B 2IAMB 4XRCB 4M1CD 1YMHB 1PBYA 4I4WA 5C2BH 3HS0B 1ZLVH 4KDVA 4X4XB 4AEHH 1RZJL 3WL9A 3KLAA 3LSOA 4NZRL 4Z0XB 5I1KH 1YJDC 3GSOA 3CFEA 4JM2B 5KTEH 5FIEA 2X41A 5EIVA 1NKRA 2CMRL 3Q6GL 3QQ4A 3MNWA 3OBAA 4NQTA 1M7IB 4JRYD 1KJ3L 4OZ4A 2YMXH 3SPVA 3N85H 3O2VL 4HHAA 1DQTA 3IF1B 1TZGL 4JFOB 4POZC 4ZPVA 5TJWK 2GFBA 1BVKA 2VKWA 5T3ZE 4MDJB 4JANB 3OWEA 4WTXA 3RWCB 3B9KB 3GB7B 1YZZA 4GW5A 4LKCA 1I8MA 1FNAA 1ZGLA 2GJ6E 3VFVA 3FB5A 1PVHA 1S7VA 3FT3A 1SJHA 3VDCA 1EH9A 3IRPX 3IU4H 2NY5H 2VLKA 4FTVB 3VFSA 4MJIB 5JO5A 4XPAH 5FYKH 5E6IC 4Q74A 1Q1JH 4X7SH 3MRDB 3S88H 4WHYG 1RK0B 5EDXA 1G7PA 4WUUD 1EFXA 1RSFA 4PGEA 2VWEE 5KVGL 2AXFA 2HLAB 1G7MB 1FV1B 2FIRT 2F5BL 5J6HA 3UP1A 2PXYD 1BD2D 4HUKB 4MB4A 5EOCL 3RPKA 1CYGA 1ZLSL 1LE9B 3QG6A 2YKLH 4UAOC 3ZKMD 5EUOE 3PWPD 2VXUL 4JY5H 5H94B 3FT4B 4JPVL 2EIBA 2NY6C 4QHUA 3EUUA 4OFKA 5FB8A 4Y1AB 1AHWA 3PDDA 1QSFD 4OCNC 3WSQL 1RK1A 3W11C 3BP4A 3TN0A 3WN5A 4R0LA 3MLZH 4X4MA 3FQUB 3PWLB 2O61B 1DCLA 5JHDA 2BOCB 5CZXC 4XXCA 1TIUA 4MA1C 3UDWC 2NY0B 4LCCB 1T03H 4XPHH 4KKLD 5HGGS 1ZE3C 2P42B 4FRWA 2JJTA 1IC1A 3IDNA 4PJ9C 3CFDB 5CGMA 4QGYA 1ZHBB 5ICZA 4HIJA 1MWAL 1IT9H 4P5TC 2BMKB 1N5AB 4JLRB 3UC0H 1XFPA 5F72S 4JZNB 2HWZL 4APQA 1NLDL 3RGVB 2ADJB 2HLFD 4LSQH 4U1SA 1T2JA 1V3MA 5E9DB 5KG9B 2YRLA 2XZAH 1YN6B 3NFNA 4X6FA 3WD5H 2OK0H 2V5MA 3SQBA 5E5RB 2WBJA 1YEFH 2OTUA 4H5SA 2XV6B 2Y6SD 4HXAH 3CU7A 2DBLL 1PLGH 5F7DA 4QY8B 4U49A 3T09A 4KK5D 2OTWA 3HUJB 2Z93B 3B2UC 1FYTD 1UXSB 3LB6D 4I0PC 1T6WA 2AVGA 3PHQA 4QF1A 1X5LA 1MRCH 3WKML 3VMPA 4R97C 3SDDC 2BVEA 3PP4L 2WUBH 2Z35A 3FQNA 1CFNB 4BSVB 4NC1C 1GZQB 4R3SB 2ZUSA 4MDIA 2D03L 5IW3A 3MNZB 3EFFA 2LAGB 1HH6A 3QULB 3CSYA 3PL6D 3TT3H 3K7UA 3IFNH 1JV5B 2ZG1A 4NDMB 5JZ7D 5K59E 1CR9L 3BDYH 2GTWA 2QL1A 4OIIL 4KMTL 2E6QA 1A6UH 1K5NA 5IBUG 4ETQB 4DGYL 5GS0D 1UA6H 1UJ3B 2WMPA 1LP9E 3EYFA 4XHJC 4IDJL 2EICA 3T0EE 4XVUC 2R2EA 4L1HA 5FGBC 4ELKB 5AZ2H 4NZJA 4ZFFA 4KY1H 4M1DH 4XCFH 4S1QH 2R0LH 3RWJA 4NUGL 4LDEB 4M61A 4U7SA 4UB0L 3N9GL 5EPMA 5B21A 3WIFB 1J86A 3I84A 3OXRB 5CHNB 2QR0B 3BW9A 5ALBL 4WHYH 1OAZH 4K7PX 5IBTL 1HZHH 1FO0A 4N8CH 3TA3D 2FHBA 5TQ2L 1EJOL 1XGPA 1CE6B 5AG9A 1JNHB 2XQYK 1MF2H 4JFFA 4OF6A 1N59B 5C8JA 2AKRA 2BOBA 2Q6WA 1B4JH 2VSDA 2VZVA 1MCSA 3WMSA 1CICC 2MHAB 1HEZB 4BFIA 2QKIA 5EU5A 4UZGA 1F6AB 2ICES 2QQKH 1ORSB 2BVOB 1FL6B 3CJJA 1QLRA 3AS2A 3OKMA 4WO4A 1CG9A 4LIQL 1J05B 4Y4FC 4P23B 2C5DC 5CSZB 5F9WB 5IB2B 1VB9A 4NT6B 2QQLL 5F1IB 4BQ9A 3K8KA 1CDBA 2Z4QA 5B39G 2IANE 1A5FL 2YA1A 4NZUH 3LY6A 3IJHB 4KJQC 4HUXB 4PLJC 5GIRA 3ARBA 2VABB 4BJLA 3KPRD 4X6EA 1CE1H 4JKMA 1B0RA 4HD9A 4NQVB 2B5IB 2ADFH 2M1KA 3GSUB 3MRGA 4Q9RL 1KTRL 1ORQA 3TO4A 5F1NA 4XPGL 2YBRA 3BZDA 3RI5K 1YMMA 2XFXB 4XVJH 5E1AA 2BSTA 1W0VB 4PJ7A 1G7HB 1R3LA 4J3XA 4Z7NF 2ZKHH 5DTFA 1YUHA 4U3XA 2FH8A 3U7WL 5KSBF 5IGXH 3CMGA 1D5XA 3LPGA 4OV5A 1NCWL 4DCQB 4J3SA 1KCSL 2VE6B 5I1GL 3PWNB 4JKKA 1JWMB 2KH2B 3GSRA 1JP5A 5GJSH 4YHLH 5C0AB 1SY6A 4PJ8B 4KRMB 3MODH 3TO2B 4W6WB 5CD3A 2B0SL 1CXFA 4CMMA 3TBVB 3QI9C 4YC2B 4F7EB 3ALPA 4HFUL 3QRGH 3BN9D 1JZ4A 2RB8A 2AERT 2BERA 2DJSA 3S4SB 2NTSP 3EOTL 5FF6B 2VYRE 4RWYH 3VGDA 4G9DB 1EXUB 4GXVL 4GH7B 3U36B 3RWEB 1F4XL 1KLFA 5CBEA 4CDGC 3MGTB 1DN2A 1OTTD 4NCC2 2IPKA 3WFHB 4WTZA 5HYSG 4OCSH 5E00A 4N0UB 5CZVL 4G8GA 3HA0A 3FO2A 4KRPD 5L88H 3QQ9D 4AENA 3JTSB 1FL3A 5T3XE 4WU7A 3LRSB 4M9PA 3RWGB 2VDPH 5HHOA 4D9RD 4NKOB 4KV5E 1EGJL 5ETUB 2HJKB 5I75B 1FJ1A 2HKHL 4Y2DB 4OZHB 1DANT 3HE7C 3NAAL 3VU2A 3GHBL 3PE9A 3RZCB 3TGXA 1NANI 1F58H 1V7MH 4E41A 2HJFB 3QDAA 1II4E 5DJXB 2YPLB 4A6YA 1FO0H 2VDOL 2I9LB 2EDNA 5T5FH 1JMZA 3QNYB 5FO9A 3GJFB 3RWHA 4Z7VE 3LEVH 4UT9H 2P44B 3G5ZA 4D0BB 4L8BA 4XPBL 3QWOB 1NGWB 1WSST 3UTOA 5GGTA 1BVLB 4P3DA 4JZJC 4DEPB 2Y23A 1LK3H 3O4OC 2GQHA 2V9QA 1MQKL 3WIIH 5JXAH 2X4SB 3MUY1 5JNYB 3SDXB 2QHLA 1NBZB 3HZKB 4I0KA 1CXKA 4KDWA 3BESR 3TBSA 4LPCA 3TJHD 43CAB 2FWOA 1XZ0B 4PJDF 2XZCL 2H6PA 4FFVD 5DJ2B 2XICA 4OZFG 3GJEB 4JHWL 3GSWA 5K9QG 2XYCA 5HJ3A 2P5WB 5IFAL 1E6OH 3ZZ1A 1GGUA 4JFEA 4JKPH 3BP5B 4HZAA 4NQSA 4CW1B 4TTDC 2VQTA 2XQYG 3ZE0F 3MLWH 4OGAC 4H8WC 1CZ8L 1D9KC 5SWSD 3NIGE 3W2DL 1NCTA 5EOQL 5DRXA 4PLNC 4UDUB 3ZKSD 4BKLA 1P4LB 3A6CL 3I2CH 1A3LL 4KXZI 2FSEB 1Z9SA 3FFCA 5EZLB 3GMPA 2RJMA 4I3RL 4Y5YB 3D25A 3A67H 1KELH 1LNUB 2NXZB 4ZFGL 3H9HB 3KLHC 5DXWA 2DYPD 1MCEA 2FJHB 3G5VA 5MEPB 4XP6H 1WFOA 1NBYB 1UM4H 4XAWH 4PV9A 1Z3GH 4XNUL 1JHKL 1DSFH 2DM3A 2EYRB 3EDFA 3QUXC 4JGJA 1T20A 1VACB 1BX2B 4JFDB 5I1JL 3P0GB 4UQ2B 1ZA6A 1GIGH 2NY1D 1C16A 4X6CE 2I9TB 5DJ8B 4IM8A 1MREH 5LCVH 4RWHA 3FO1A 4TQEL 5EZIH 4P5MB 3O4LB 4PTTA 3D2UD 3BGAA 1U3ZA 2DIBA 2V2TB 5F7HA 3SY0B 4KROD 1EHAA 5I8KL 3DRTB 2Q8BH 5I1IL 3HE6D 3WFDL 4P48A 4Z7UB 4CMHB 4I0CC 2CSPA 1V3LA 1BOGA 4C59B 4N9GA 1A6AA 3QHTC 5K9KA 2VWEC 2EYSA 3EYUL 5KS9B 3QO1B 1NCCH 5HHQB 1YECH 4R26H 1KC5L 5LWYL 3ILPA 3ULVL 1IAOA 3U0TA 1Y18B 3HMWH 1FFNB 4P2QE 3MFGB 2AJ3B 4PJGA 1U92B 4HS3B 5L0QB 3MC0A 1U8QB 4JM4L 4GMSH 3UBXI 1RZKL 4K3GA 1OARL 1CXEA 3VRIB 5D7IF 5DEFA 3B9DA 3VDBA 2VN7A 4ELME 5GGTH 5ANMB 3FQWB 5I19H 1GC1C 4LBEA 4JO2L 3PGFH 7FABL 3SE4A 1BQHA 1KJ2A 4WW2B 4ISVA 2BSRA 1T83C 1CIDA 3C6LB 4F7CA 2VDNL 3LHPH 1I8KA 4GRWB 4AT6B 4GG6A 5B38G 4NUJB 3UJIL 4CJ1A 5B38A 3OXSB 3UTSD 4X4ZA 4HKBB 4Q9CA 1FFOB 4PJIA 4L3ED 5GSVA 2WP3T 4ZS6C 4XGZB 2VDKL 3TBYB 1KTDB 3OMZA 4K55A 3WHE1 4HIHB 2YK1H 1PG7L 1FORH 8CGTA 3QNZA 2FJGA 4GRLA 4OZFH 5E56A 2I24N 5F1KC 3HNTL 3MYJA 3GMMA 1VEMA 5C09B 1AGDA 4NQEE 5FYLD 2H8PA 4GW1A 3RHWF 5D1ZB 1OAUL 1P7KB 3QDMB 3C5ZA 2F53E 3NCMA 3QFJB 4PGBB 3V7MA 3BHBB 4G7VH 4XC3L 5EOTA 1WZKA 4M43L 2N1KA 3OR7B 3ECBB 3DO7B 1GGBH 2OR9H 1T0PB 4TUKH 3DUHA 4GKOA 4EUPG 1NC4D 4YAQB 1Q9LB 4I18C 3MACL 3GDBA 4MSWA 5A2IH 2E9WA 5TGBB 5H37G 3ULUL 3REWB 4NO2A 1GOHA 1D5ZB 4PJEA 4XNQA 1PYWA 4QHNB 1OB1B 5FHAH 1IC7H 3I50L 1KPUA 1KCVH 4KJPC 2IADA 2XY2A 1QR1A 5DC9B 4FFYH 4UT6H 5IFJB 1MCRA 4JDTL 1CQYA 4G80B 2X89D 4JQVA 5DMIH 3D3VA 3RL1B 4LCWE 4OD1L 2FEEI 1NUDA 3MRIA 4QRSA 1Q0XH 1XCTB 5LXGH 4EI5B 4P99A 5GGQH 4NQDD 4G6AD 3VWJD 4X9FA 2EXYD 2HFEA 3B5TA 3GBMH 1UJTA 4GG8B 1XF5B 4F33B 3O6FB 5CBAA 1S3KL 1CL7I 1DEEB 2G75B 1KIRB 2R9HD 3DRQB 5GGSY 5ESQA 4AMKH 4S1SL 1MFCH 5E94B 4JREC 3G6JF 1ZWIA 2MCPL 1YNTB 1RULH 2BVPA 1M71B 1N3NB 5JIIA 4GBXA 2VAAB 1BHGA 4YXHL 1HH9A 3QT2A 3FRUA 3CMOL 3VGAC 3QDJD 5FXCH 4J4PA 4G8EB 5GS1B 1CT8B 2YD9A 4N5EC 1U8PB 2LU4A 4F2MB 4U33A 4DN4H 3CXDL 5BV7L 2H2SD 1H8OA 1TETL 1FNFA 2YPVH 3DMMA 2Z91B 3JWDC 5DQ9A 1MY5A 3N0PB 5HYJB 1BZ9B 2D0GA 3AM8C 1EO5A 1KJ2H 1S7WA 4PREB 5HDQL 1Q0YL 3QEQB 2C1PB 5DHVA 2BY3A 1T1YA 3HMXL 4OCWH 3C2SA 3KYOB 1F8TH 3O8XA 1GAFH 2J2ZA 3RIFK 3S6CA 4XBPA 1N8ZB 3MBED 1TJHH 2MTPA 3BDBA 3B3IB 3T0XA 4JCLA 5I17B 2B1AH 3DVIA 2JJUA 2B1HL 5T1LB 3BE1H 4OZGA 4OCXH 1UADC 3ZT7A 3IGAB 1U8OA 3P77A 4JRXE 4M6NL 1QEWB 1XR9B 1WK0A 5JW3L 1MLCB 2HA1A 1U8KA 1UQSB 2XWJA 4I3SH 4F7TB 4PBVC 4NNYA 3QIWA 1BZ7B 3HUJE 3MA9H 1MAJA 4GMTL 3Q0HA 3P4OA 4PRPB 5EIIA 3LVEA 2O93L 4OGZA 1YJDL 3ZTNL 1IGJB 2NNAA 4EUPH 3KAAA 1PFCA 3C5JB 3ROOB 3CD4A 1JGLH 1HHKA 1G7QB 5C0IA 1HHHA 2JJVA 3AAZB 3BWAB 3T4YB 4FQLL 1U93A 1L7TL 1QSEA 2UWEA 3QIBC 3LKQA 4YO0A 3BUYA 5I66B 4LSPL 5JW5B 5E99H 2JJSC 5SWZA 1T0MB 3EDEA 2FRGP 4ZPTB 1TVBA 4KRLB 1YDPA 4ZAKB 2J1KA 2BNQB 3P4NB 1KB9J 2W0LA 4J1UA 4RIRB 1ETZB 1AC0A 4WFHE 4H0HB 3MV01 1Q9KB 3GSVB 3OJ2C 5DLML 2NLJB 4NM8L 5GRJH 2B2XL 1R24A 3RBSA 1AIFB 1GYAA 3CIQA 4XXDA 1ZLWK 5CINL 3UYOD 4XNMB 3QWRD 3T8XA 4IHOB 1K2DA 4IRSD 4QXGH 4QXUH 5D2NA 4OKVA 5I6XB 2E3VA 4JQIL 1NFDA 3T1FA 1OGAA 5IHUL 1R5VA 3ULVF 2FL5B 1NEZB 1IGTA 4U1NA 5ICYA 4ODUB 2AJVL 4ODTL 4JFYB 4QNPF 1I4FA 4YXKH 3RWIA 4OUUA 5ADOL 4WGVB 1ZHKB 2R4RH 4YHYB 2GKIA 4O2EA 1FZKB 3HTLX 2XT1B 1OSZB 4JN2A 3CUPA 2D7NA 4P9HL 3GBNL 4YHOH 4OQTA 4O00A 2AJXL 1FZJA 5D7JB 3E8UL 3UTQB 2DQCL 4IMLA 3P2TA 3S37X 5DHVH 4KU1A 4XMLL 5JOPD 4LK4A 5D2LF 4JVUA 2GY7B 3C09C 2IH1B 2VOTA 4D9QD 4LU5L 5GRXG 4G6JL 4KC3B 4I4WB 3CFJA 2VAJA 3O3AB 3WL9B 3LSOB 3GSOB 3K2MC 5HD8D 1CFSA 3QQ4B 1OW0C 3MNWB 1QFUL 5IW1A 3RTQB 4XMPL 1JBJA 1EZVX 3JV4A 4ORZC 4OZ4B 5C0AE 1C7TA 5DD3H 3SPVB 2C3WA 3EO1A 3O3DA 1QLEH 4HHAB 4EDXB 3OF6A 1Y0LA 4JZOA 4OIAA 4ZPVB 2B4CC 1OP3H 1BVKB 1LILA 4ZS7H 2XWTB 3GI9H 4MCYA 1XCQA 5T33L 3RU8L 1MAMH 2E8ZA 2EIZA 2PCPA 4GW5B 3AS0A 1OGTB 1W0WA 4P4KC 3VFVB 1ZGLB 3FB5B 1SJHB 3VFGH 3ULUF 1MIEL 4Q6IB 3MGOA 3VFSB 1Q9OB 4OD2A 5EU3A 5C0CD 1YEIH 3B8YA 5DD5L 2UZXB 1OTSD 3MTRA 3ARFA 4M8VA 5ESAB 2VMFA 1X6LA 3OAZK 1XGYH 4OGXL 4N0UE 1OVZA 4PJHB 3MJ9A 1EFXB 3N06B 1GPOL 3KJ6H 1VADA 3DX6A 2CIKA 4K7PL 15C8H 4X7CC 3TM6A 1R3HA 2OSLB 2OJZL 3QG6B 4OTXH 4UOW0 4LVOC 1O7VA 4OZHE 3UTZB 2FB4H 3Q5OA 5I8EA 3VGEA 1TITA 5F9OH 4F7MA 1EERB 2ARWA 3I9GH 4NHCH 3GMQB 4QHUB 5JIHA 1QRND 3TNNA 5DJDA 1CBVL 2YPLE 3AS1A 1F90H 3SJVD 4GAFB 1A14L 3BP4B 1RZ7L 4R0LB 3WN5B 2QQNL 4JFPB 4G6KH 5F9AC 5C0BB 2AK1L 5E6IA 3MRRA 4TUJA 5ICZB 4WI5A 1DTUA 4HIJB 5MP6L 1AD9B 5TF1L 2F9BT 4M6AA 3SDXE 4FQ1H 2JIXD 3AY4C 5DD0L 1X6NA 3GIZH 1MI5D 3O45A 3PHOA 4APQB 4KPHL 1JUFA 2UYLB 3AUVA 1Q8MA 4U1SB 5EUKA 3O6MH 1X5HA 1BM3L 3SKOA 1IQWL 3NFNB 5J12C 1GJIA 3MLRH 1IBGH 1MVFA 4X6FB 3WS3B 1S7UA 4ZNEA 5HVFB 4OZIF 2FDBP 2DJUA 4JO4L 3QA3A 2P5WE 1A6PA 2WBJB 4XWGL 2OI9C 1S7QA 4FFZL 5GSRA 4WUKH 5F7DB 5IVZA 3GUTA 5D7KD 3GBLA 5F8QC 4C83A 1ODAA 2O5YH 3V6OE 1RIHL 3TT1L 5IROC 5C08D 3LN5B 3AU1A 1AI1H 5L6YL 4G8FB 1BD2E 1YEJH 4G6ML 1CLZL 1INQB 1WJ3A 3PHQB 5CLTA 4QF1B 3V8OA 4N0YL 4PJ9A 3ARED 5EA0H 1KEGL 2IAMC 3D18A 4PD4K 5IB5A 2WLYA 4XCYA 2EDFA 4XPTH 3RAJL 3FQNB 1M4KA 3MMEA 2HT2D 2VITA 3CK0H 2NY2D 4JM2C 4MJ6A 3VXNA 3EFFB 1HH6B 1TZHA 3CSYB 1I3VA 3WUZA 1OTUC 1KIPB 1KV3A 4FQCH 1ZS8A 5J11B 1X7QA 4WFFE 1A6WL 1K5NB 1WCBA 1VEOA 5D8JL 1BPVA 1SYSA 3EYFB 4XP5H 3G6AA 2NW2B 3X3GL 2R0WH 2EKJA 2DQJH 2R2EB 2AGJL 3B9KC 4ZFFB 5E2UL 4NWTL 4MNGB 3RWJB 4M61B 5FUZH 5F7MC 5EPMB 3L5XH 5EU6A 2CUIA 3HRZA 5KVEH 3MJ9H 1FO0B 1XGPB 3QHZH 3MROB 5IFHL 2XN9A 5C8JB 2AKRB 1ZVYA 2BOBB 3PV6A 2Q6WB 4F7PA 3MRQB 1RD6A 5E2JA 5IR1B 1VFMA 5E2TH 4IRZL 5DO2C 1QLRB 2Z8RA 1YNKL 4JG0H 3OKMB 4WO4B 1CG9B 1QFPA 1U3HA 5D7LA 4XNXL 5HYQB 1J5OL 1MLBA 4LLAA 2HG5A 2EZ0C 4YR6A 1QYGL 5I1CH 1JGEB 3OKLA 5HHMB 4IBLT 5FKAA 5AUMB 4JE4B 4DKFH 3ARBB 5AZEL 1BOYA 2AK4A 1Q72H 3VXSA 4X6EB 4M03A 2NY0C 2QSVA 1B0RB 2RBLA 2EDDA 1D6VH 1IAKA 3L5HA 5CEZL 5LQBH 4XI5C 1ORQB 3TO4B 5F1NB 4GRWE 2W9EL 3UAJD 4HULB 3BZEA 3OL2A 2YBRB 1IC4H 3L3KB 4R4BA 5E1AB 2BSTB 1CXHA 2CLZB 5I1HL 4PJ7B 3I6LE 4Z76A 3ET9F 3RGVC 4X6DF 5INCA 1BF2A 4DVBA 1YUHB 1RI8A 1DQDL 1PY4A 2BNRD 2NY4B 4K9EL 1AH1A 3QXDA 4CDHA 4OV5B 4DOHE 1MFNA 4LSSH 4K2UL 1AKJA 3LS5L 2Y06H 4L8DB 4LHQB 4QRPD 2D2OA 3QDME 4H8WL 4P2RA 1ZLWH 1D6EA 3H2WA 1LHZA 3QEGL 4K8RC 5J8OA 1W2KT 3W9DA 5CD3B 4K3DH 1N2RA 4OJFH 5T1DL 1CD8A 1QBAA 1G9MC 3NCFB 3LIZL 4URTB 2NY7L 3SE8L 3KPOB 5FA3A 1S78C 3SCMA 3M45A 4PY8I 3K2UH 2COQA 2D31B 2Q76A 3PABB 1B90A 5ACZA 5CBEB 5JHLL 1ADQA 2A0LD 1NCNA 3GIVA 2IPKB 5TDPA 4LAQL 5JDSA 1U95A 5E00B 1SEQL 5B4MD 5HYSB 3ARDB 4G8GB 3IYLW 3WNOA 2KBGA 3ARGA 3FO2B 2CLVB 4NN6B 4AENB 5T3ZL 2XZQL 4M7LH 4MQSB 3RUGB 4WU7B 2OP4H 5J89A 3U4BL 5HHOB 1IL1A 1UJ3C 1WF5A 2VKXA 4HUMB 2MQ0A 5EBLA 1I1AD 1RU9L 1FJ1B 2BXZA 2DI7A 2P24B 4HUWA 1F97A 3VH8A 1RUAH 4J6RH 4Z7WE 2LTQB 1SJXA 5TFSL 5D70L 3IAPA 3PV7A 1EVTC 1BBDL 1LO4H 5CIPA 4E41B 2YEZA 4BZ1L 2FHFA 1BFTA 3FFDA 2DQFA 2I07A 3EAKA 3ZDZE 5FO9B 4LDLB 3MXWH 3HC0A 1IILE 4FQIH 1MJ8L 3G5ZB 3UMTA 2ZUVA 8FABB 4HX1B 2QTEA 2UY6A 3PWJA 4PJCE 1KUMA 1LD9A 4MA8L 5IJVA 1KLUB 2VZUA 5DZOA 3HNSL 2MCG1 4F9LC 3EKCA 1NMBL 4G8IA 1UEMA 3DI2B 5CJOL 1IEAA 3HG1D 1GOGA 3R8QA 2ZG2A 4JO3L 1MJUL 4PGZA 2LU7A 3MUJA 4JPWL 3NFSL 2DDQH 3H0TA 1NAMH 3BZFA 4P23C 3TBSB 3MCG1 4GLRH 4KTDH 5F9WC 4JRWA 1T5XA 2H6PB 1GC1L 2X9XA 3V6ZB 4O02H 5BZWA 4FNLL 5A2JH 3BQUD 5HYJE 3GSWB 3ULUD 4OLYL 4LCIH 4Q58C 5BS0E 3QEQE 3MLUH 2VRAA 5HJ3B 5CGYC 3UO1H 3RJQB 1AQKH 3C8DA 4JFEB 4C57C 4NQSB 2B5IC 3ELAT 4GAJH 3TZVD 2UVFA 4DK3A 5KZCB 3BKJL 4HS8H 4H20H 4MNQD 3HPJB 1C5CH 4JZJA 2ITDA 4DN3H 5KSAB 4BKLB 1W72H 2HVKA 3T2OA 5ECJE 4YXLL 3FFCB 3GMPB 5DMKA 4OF7A 3ZSTA 5CJ8A 1NGQH 3RVUC 2Y1VA 4ONOA 3TBTB 5KVMC 3BD5A 3OKDA 1I8IA 4OM0L 2VZOA 5HGHA 4HIIA 4O4YH 5D72H 2R4SH 1CDHA 3G5VB 4ZTOH 4Y19B 3C9NB 2Q8AL 3UZQA 1SHMA 4PRPE 2XTJD 4PJ8C 1VENA 4F58L 4PV9B 5HVHB 4OV6F 1KXVC 4ODHL 1EEUA 2EKSA 5HHVH 4C56E 4PUBH 1RMFL 4ZO6A 3ZKNC 3RHWK 4YC2C 1PKOA 1NLBH 5EFIB 3R1GL 1C16B 2DWDA 1JIBA 2FX7L 4NZTL 1I3GH 3EOAB 4HKJA 1QFWI 3CFBA 1T2XA 3VWKD 3FO1B 6FABH 35C8L 4PTTB 5D6DC 5FYKE 4HPYL 3VDAA 1ADQH 4TULL 4H26A 4MHHI 4L5FL 4PRID 4Y4HD 5CKGA 4HG4J 3Q3GA 2ZSWB 4KK8C 3HI5L 3FQTA 4MA3A 3T04D 1FZMA 4YGVB 1BOGB 5TE6H 3RX7A 1PKQE 4WJ5B 1A6AB 4U1HA 3D39A 5K9KB 3RWDA 2QQQA 4XWOD 2EYSB 4JFHD 4L4TA 2NY3D 5DT1L 1OT1A 5F9JA 1C12A 5C0NC 1WAAE 3U0TB 5I75C 4DW2L 3DSFH 3TP4A 4Y2DC 1ED3A 1IKNC 4FP8H 4PJGB 3T0DA 3QUXA 3T3PF 4LSTL 3RZCC 1JI1A 5LBSL 5DK0A 5DEFB 2OYPA 5ISZD 1VGEH 2FCBA 2YD7A 3MRMA 4WFGD 3BPNB 1R5IA 4EBQH 4M48L 4PV8B 4LBEB 3EYVA 3WJLC 3L5IA 1G7LA 2EH8L 5C6TL 1BQHB 1KJ2B 4ISVB 4HBCH 3P0YH 2ATPB 4ALAH 4DEPC 4HQQL 1I8KB 1MRFL 1DQQA 5CJXC 4OSUH 4OAWA 5B38B 4DAGH 1LMKA 1PDKA 1S9XA 4PJIB 5GSVB 2CKBL 2E27L 5HPMA 4HIXH 3MJ8A 1FYHB 4HWEH 5HTSA 3EFDL 5GGSA 1BEYL 1U2HA 2HRPH 3IDMB 1UB5A 2NPLX 5EBMA 2PR4H 2JB5H 4OCYH 2FJGB 5FEBA 3MJ7A 5FM8A 3MYJB 4HFWB 4HGKC 5CZKA 5BRZD 5KVFL 4MS8C 2H8PB 4GW1B 1QBLL 4Z6AT 3W81A 1IM9A 3C5ZB 4POZD 5I71B 4OLZH 3HNVL 1XGUA 5EOTB 3V6OC 5E08L 4PGDA 4G9FD 3Q6GH 4DQOL 3WIHA 1A0QL 1KJ3H 5D1QA 4AY0A 4EUPB 4MSWB 1VFUA 1JHTA 1GGYA 4I48B 3O2VH 3AXLB 4NO2B 1TZGH 2DTML 2EC9U 4PJEB 4XNQB 1PYWB 4Y5YC 5F7LB 5IQ9B 3DBXB 5L2KA 1KPUB 1IEHA 2NXZC 4DFIA 1QR1B 4WY7L 2F54D 4I77L 5JUEL 4FN0A 4XH2A 1HCFX 2CRYA 1JPSL 4BZYA 1U8JA 1V05A 3STLB 5D5MF 2XKNA 1MNUH 4XZUB 5C0JB 2ESVA 4OFDA 2JB6A 3MRIB 3D0LA 2FD6L 4O2CA 4NJAL 1EMTL 3E0GA 2VLKE 2IQ9L 2EYTA 5M94B 3QXAB 1OAXL 3GRWL 2VIRA 1N26A 2HFEB 3V6BR 4NZDA 1NCUA 3I6GA 5JDJA 5KVGH 4RGND 2AW2A 2F5BH 4LGSB 4XPFL 2DLTA 1Z0NA 4I18A 5EOCH 2VXQL 3SO3B 5JXEC 2FX8H 2ZZUT 3BEVA 4OLWL 1ZLSH 4G7YL 4S1DD 1WCQA 2VXUH 1ES0B 1KT2A 1KTLA 2OS7A 5CZXD 5ESQB 5T3XL 2DKMA 2OR7A 4JPVH 3X13B 4F3FA 3VE0A 1WISA 1FLTX 3QPXL 2DIJA 3LZFL 3TVMA 5D6CB 3WSQH 3CVHA 2O26U 4EIZC 4P5TD 3FRUB 1S9YA 3D69A 1J8HD 4U6VL 4NYLA 4KQ3L 5E7FA 5T5NF 3WFCL 1IEBA 4HW6A 4M5YL 4YHNA 4QRRA 5L0QC 4X4ME 4HCRA 1JPGB 5JHDE 1G9NC 1MWAH 3DMMB 1KIQB 4UNTA 1XH3A 2HWZH 5DQ9B 2X4OA 3VXMD 3CFKA 4NQCA 1NLDH 3TH4T 3QB7C 5EUOF 5DHVB 1T1YB 4WW2C 1BFVL 2DM4A 3IKKA 2ITCA 3GMNA 3C6LC 3B2UD 1U91A 2A1WL 3EZ8A 3F7RA 4LVNB 3S37L 4I0PD 5HXMA 4JFXA 4EIGB 4XBPB 4WDIA 4Z77A 1O0VA 2RFXB 2DBLH 3B9EA 3SDDD 1DQLL 4HV8A 5FYJD 3PP3K 4YHZL 5TDOA 4KUZL 5A16A 4OZGB 1HK6A 1RUQH 1UC6A 3P77B 1U8KB 1QTYT 1I1CA 3WKMH 2XWJB 4NNYB 3QIWB 4YGAB 3RIAF 5C07A 4YFLF 5D1ZC 2Z92B 3N50A 1KXTB 4LLQA 2OQJA 1I3RA 2D03H 2OX5A 3SDCA 3WIHH 3ZDYE 2WW8A 2NNAB 2XRAL 3OZ9H 4LHUD 1U58B 3FOLA 4V1DA 1CR9H 1CGXA 4U0RB 5MENA 1HHKB 4OIIH 4KMTH 1XIWA 1F42A 1QVOA 1C5DA 3W0WA 4DGYH 4GQPH 4JAMA 5DI8A 1A1MB 2ZSVA 4KTEL 1U93B 1JPFA 4AM0A 1EGJA 3LKQB 4LASL 4ODSH 5I74B 2IEPA 1JWSA 5SWZB 1OM3H 4NUGH 3MRKB 1EO7A 2R1XA 5CJQL 4UB0H 1CICD 2G9HA 3N9GH 5JPNA 4WIQA 1QP1A 3ISWA 4ZFZA 5F7FA 3BIBX 4J1UB 4LPWA 1EJOH 2VC2L 2X2YA 4Y4FD 4EI5C 3V5KA 4U1IA 3ZDXE 1R24B 3VXRA 2GAZA 1WLHA 3CX5K 5K59F 4MQ7B 4LNVA 2FEEL 4KJQD 4CNIA 3O6FC 4JFFE 3T8XB 4PLJD 5CJ5A 3VFOA 1ZT1B 4LIQH 1LP9F 3FQXA 5D2NB 2HVJA 3VD4A 2QQLH 3TA3B 1NFDB 3H7LA 3T1FB 3CVHH 4PP2A 5IMOB 4JDVB 1OGAB 2A83B 1OAKL 1XF3A 1A5FH 5FKPA 1GL4B 1KYOK 1AXIB 2JJSA 5ICYB 3UX9B 1CL7L 1I4FB 2D0HA 4MAUL 3QUML 3WS6A 4OUUB 1FGNH 3CFIC 1GXEA 3IDYB 1OP5H 4HF5L 4O2EB 4DZ8B 1VGKA 1EAPB 3M17A 3KVQA 4JN2B 3CUPB 2A6IB 5JQ6L 2FECI 2WBWB 4NNPL 4XPGH 2BY0A 3OJDB 4Y4KA 5LG1A 3MV8A 1FZJB 2VLRA 3DVFA 4IMLB 4P5KA 2QSCL 3ESVF 5CP3H 4CRPA 2DJ4A 3QIUA 3WE6A 4Y16D 1YY8A 3R0NA 3KPRB 1YMME 3U7WH 1HXYA 5CP7B 4M3KB 4FHBD 3GHEL 5CD5C 4PJ7E 1NCWH 3QI9D 1KCSH 1HQ4B 5HYIA 5I1GH 5IBLD 4QEGA 2DLGA 5K9OA 5KW9L 3WEXB 4PRHD 4YDVA 3ROLB 1CFSB 2ZWLT 2B0SH 2RGSA 1HDMA 1L0QA 5HVWA 2XQBL 3JV4B 4BK4A 4OLVL 1D3CA 1E4KC 3O3DB 2ZCLL 3NIDE 4G42B 3QRFM 4BK5A 5DEGA 3MRJA 1QZ1A 4ZUTB 1I7UA 1FP5A 4MCYB 2IG2L 2YN3A 4ZFOA 4GXVH 2EIZB 5HI5C 2Y36H 1CD1A 4C58B 2EC8A 4Q2ZA 4QT5A 2GSIA 3LKNA 5AYUL 3OTTA 1LDPH 5CZVH 3MGOB 3HE7D 1S5HA 4RX4A 4WEBL 2NY5C 5DRNB 4KI5C 1TJGL 2PO6A 3ARFB 3MRCB 1EGJH 5GGUA 5E4IA 4G8GE 4GQ9L 1E4WL 3C60A 1OCWH 1VADB 3GSNA 1IGML 3NAAH 3S5LG 2CIKB 1CLYL 5HHOE 1ZV5A 5DQDL 4N8VG 4PJ5A 4W4NA 4JJHA 3GHBH 3GM8A 2W0PA 5DWUL 4D3CL 1PSKL 3MCLL 1BJMA 4ZAKC 2H9GA 2VDOH 1T7ZA 5I8EB 1H3PL 1FPTL 4F7MB 5CEZD 1JNLH 4NCC1 4OFPA 4WI6A 4GAGL 1X5XA 4XPBH 5FO7A 4E41E 3TNNB 3H3BC 4U1JB 5DJDB 3C87A 5DHYB 5E03A 1I8LC 4LLWA 3ALXA 1EEYB 4WI4A 1RJYA 4PS4L 3QR2A 2E7BA 4R96A 2X4TA 3VI4E 3EJYD 4J3TA 4LVHB 3EYQC 1NGZA 3B4NA 5HDOA 3L95A 4TN9A 4KV5F 1L7IL 4Y88A 2AEQH 3MRRB 1N6VA 4TUJB 3L9RA 1KCUH 3EOYG 2XI9A 5I6XC 4N1HB 3FL7A 2XZCH 4TTDD 1I85C 5MHSE 1DBKL 2EDHA 1LO0L 3OJMB 4EQ3A 4OGAD 3PHOB 1D9KD 3HFML 3O45B 1AJ7L 3F12B 4JHWH 2VH5H 4UILL 2ZOLB 1P2CB 3MV9A 4RQQA 1OSPL 1GVIA 3GGWB 5IFAH 1MJ7L 4YHYC 4Z7VF 1KGCD 5DF0A 4RFOL 4YDIL 4XB7A 1T3FA 4HH8A 5BZDA 5JA9A 1CZ8H 1AR1C 3KLHD 3W2DH 1EEZB 3LDBB 2P5ED 1R5WA 5GSRB 5D7JC 4JFEE 5IVZB 5BJTA 3GUTB 4DKEL 4NHUB 3JV6A 3VFNA 3A6CH 2WWKO 1U3JA 5C9JB 3AU1B 5JR1H 4DUVA 2V2XA 1WICA 4EDWL 4ZFGH 5T3ZD 3FFCE 3MOQA 3D18B 3Q1SH 4DVRL 3I75B 4XCYB 5SWSB 3MMEB 4KKAC 2GJ6D 2VITB 3GNML 3N1QC 4MJ6B 1JHKH 5I16A 3KPMA 4H1LG 1TZHB 5F3HA 2YUZA 4XBEH 3KPQA 2AXGA 4EVNA 1WFUA 2ICEB 3IAQA 1ZS8B 1X7QB 5IHZA 5LVEA 5I1JH 1ZT4A 2W1NA 1G9ML 1B6DA 2PYEA 4FOMA 3NIGF 4YHML 4TQEH 1INEL 4X9IA 3QUYA 4R4NC 1CTOA 3BOVA 1L0XA 2JE8A 4XT1C 2O5ZL 3C2AL 3TH3T 5I18H 5DC4B 3BSZL 5TPWH 1P4BL 2YN5A 5IMMB 3WFDH 3Q5YA 2R23B 3ULSA 4Q6IC 1LE5A 3MV7A 5GISL 2P8MA 5KAQF 3UTTA 5DFVC 5EU6B 2PYFA 2NY1B 2DQTL 3HRZB 5BQ7A 4X4XA 1KC5H 1RHFA 2N56A 3GSNH 5LWYH 3PQYA 2FR4B 3ULVH 4XTRC 2XN9B 4JM2A 4MMXC 4LNRB 4F7PB 2R2BB 3EJZC 3FN0H 2UZIH 1J1PL 1CLCA 1RZKH 4I9WE 3FMGL 4X6CF 1OARH 2ED9A 1U3HB 1UH2A 4FQXA 1MLBB 1HN1A 1SMAA 2HG5B 2R15A 4O5LH 4JANA 5LKNA 4YR6B 2ZUXA 2A2QT 7FABH 1FVCB 2FGZA 4AEFA 3OKLB 2A6KA 2IALB 1RVFL 2VDNH 4LOUD 3WN5C 4R0LC 2AK4B 3T2PA 4FTVA 3VXSB 3KPNB 4MJIA 4S10A 1M6OA 1AGFA 1TQCB 4NBYB 4POYA 4QCIB 2R56L 3S97C 3T4AA 1RUPL 1EIBA 3K4AA 1IAKB 4L3AA 2JJTC 3UJJH 2VDKH 1MFEL 1RK0A 3BZEB 3OG6B 4GG6E 1JGUH 4R4BB 2ZUQB 4FZ8L 1YEEL 3DPBA 5J1AA 4Z76B 5L7XL 3QCUL 4APQC 1CS6A 3FAXA 5INCB 3LRGA 4DVBB 1MCJA 5GJTL 1P5UA 1NH6A 5CUSL 1OAUH 2ZPKL 3QXDB 4ELMF 1KN2L 3NVQA 4RMUA 4XVTL 4XC3H 4YUEH 4M43H 1GGIL 1ONQA 2QEJA 4Y1AA 2PNDA 2WBJC 2CLRA 4G6FD 1S5IL 4P2RB 2VDML 3MUZ1 3VRJB 5FO8A 2O61A 1DBBH 3ULUH 2J8UA 3W9DB 1U6AL 4KVCH 1N2RB 5D1XA 4LCCA 1NCBL 4HWBL 4E42B 5FA3B 4MXQC 2VXSL 3SCMB 2CDGB 3U4EA 2AABL 1G0XA 1ZHBA 5F7KC 4PJEE 2BMKA 2CXGA 1N5AA 1DN0B 4JDTH 3LS4H 4L4JA 4LSVH 2GITA 3F62A 3IDJB 4JZNA 3RVVC 4ODVH 2Q76B 3KPSD 5FGSA 5JTWA 5DFTA 3M07A 4H1LH 1ZEAL 4OD1H 5TDPB 5E9DA 5JDSB 2DD8H 3STZB 5MERA 1U95B 3ZT6