5H2BB

Structure of a novel antibody g196
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
211
Chain Sequence
b'NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G196 antibody Heavy chain
publication title G196 epitope tag system: a novel monoclonal antibody, G196, recognizes the small, soluble peptide DLVPR with high affinity.
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2016-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bB01
1U0QA 3S37H 1MI5D 2P24A 4QOKD 4J4PA 4P5TC 4X8JB 3PP4L 1CFQB 4OCXH 3DGCR 1AO7B 4LVOB 5TQ2H 4NO2B 1E4XI 3SE3A 3W11C 4RWYH 5C3TA 3QDHA 2CJUH 2XPGA 2EDKA 1MI5E 4QOKE 3ZTJH 3VFSB 3GSOA 3QPQC 4QOKB 4Q7DA 1LVEA 2OJZH 4JFYB 4ZAKC 3AXLB 1QTYT 3OKMA 3ARDD 1Q9WA 2BNRA 2H32A 2YUWA 5JO5A 1JZ6A 5C70A 3V7AG 3PWUA 5D4QA 1D5ZA 3QWRD 3MJ7B 5JPMA 3UP1A 1JFQH 1S5IH 1QLEL 3ARDB 3PP3H 4PTUB 1TJHH 1INDH 3QZWA 3S36X 4QTIH 3DIFB 3KJ6L 4FQQA 1OSZB 3RWHA 1IGCL 1H3UA 4UAOB 3T2NH 1DE4B 4KPHL 3VD4A 3V79C 5CD3B 5DYOB 1R3JA 1X5FA 4PBVC 1KTDB 4HCRA 2ZUQC 1P7KB 3Q5YA 2CLVA 1LNUA 3L5XH 4RMUA 2DN7A 3ZLQC 4QXGL 3CGTA 3SGEI 4PRAA 1SEQL 1S78C 2QTEA 3QCTL 2AGJH 2L0DA 2E7BA 4F9PC 1U2CA 3AM8A 4M6MH 1BWWA 3VFVB 3T0BA 2ORBL 4HWBL 1F5WA 1JWMA 1U91A 4XNZC 3A0OA 4Y2DD 1BOGA 2FJHB 1OB1B 1UM6L 2M26A 4MQXC 3G6DL 3A67H 1JN6B 1KFAH 2V9RA 4PJBE 1YEFL 5HGHB 4Y2DB 1UGNA 1U8HA 1L7TH 4F7PA 4JZJB 3N9GL 1A1NA 1JGUL 4XXDB 1MFDL 3H3PL 3KDMB 5DR5L 2Q76B 3VD5A 3FQUB 1OQOA 3WXWL 1BJ8A 1TZGL 4OLYL 3LN5B 2J4WH 2VXTL 4NQDB 3IVKB 5B22A 3DX6A 1EH9A 5D7IE 2CKNA 1NCTA 2NY5H 1OAQL 4OV6F 1WGOA 1PZUB 1WFTA 4WI6A 1W72B 1CXEA 4X6DB 5JXAH 3VFUA 5BQ7B 4LF3B 5H2BA 2NY1D 3W39A 5FKPA 5HVGB 2IG2L 3PJSA 4I9WD 4W6WB 3K81A 1MNUL 4RAHA 4KJQC 1GZPB 5IHZB 2OTPA 1RUQL 5E1HB 5JUEH 1FIEA 1QFWI 2DQJL 3EOTH 4NZDA 3HZVB 3SGJA 4I9WE 4YPGB 1PG7X 4ZFFA 3W2DH 2GCYB 2Z31C 1X4XA 4Q9CA 1F3JA 1UH4A 5HHQA 4JY6B 4QGTA 2HWZH 3BN3B 2XWTA 4Z78B 3GSRA 2FIKA 3PV7A 3TA3D 4HH9B 5EZOL 3SOBH 1V3MA 4JR9H 2VKXA 4ZUWB 3WFHA 3OG6B 4HXBL 3BDXA 4M62H 4P2RA 2CUMA 2FR4A 2DWEB 3IF1B 2R2HA 2VYRE 1G9NL 4OIIH 4EN3D 2XNAB 4QRRB 1GGCL 1LP9F 3I50H 5FA3A 4RGNC 5IW1B 3ZTNL 2VJXA 2P47B 1IAIL 1VEPA 4Z77B 3Q6GL 3D2UB 4M03A 1WCQA 3QEGH 3RJQB 5HXMA 2WLYA 1JVKA 4PGBB 4EN3B 4HS6A 4CBPA 1RJYA 2V2WA 1HSAB 1UH3A 3A6BL 1G7LA 4PJDA 3GK8H 4YH6A 4NHUA 3FOMB 4G9DA 4K23H 3BW9A 4G8EB 1CLYL 3ULVH 2UY7A 4OD3H 3FONA 3LKSB 1MFCH 3B2VL 4UU9B 2DIAA 3O3DA 4RCAA 1AXSB 4WO4B 3IXAA 4DGVH 3SKOA 1BEYL 1NCWL 4ZDHB 4CUCA 3P4OA 3BESR 3MXWL 3UTZA 5ESVA 3HAEB 4BKLA 4NO0D 4X8XA 2O61A 2ID5A 3ZYIA 3NIGF 4ODVH 4IOIA 1JL8A 4LU5L 43CAA 5AZEL 4LSSL 1V7NL 5ALBL 1UENA 5EA0H 4OCWL 1IKFH 5BXFB 4OCSL 3TT3L 2VWEE 1YPZF 2OQJA 3PIQB 1F42A 4JRXA 2ARWA 3TFKC 4XB8A 5AYQA 3MROA 1J05B 1MQKL 3DMMA 3I6GB 3MLYH 3GI9L 3NVQA 3E2HB 2QL1A 2AEQH 5EH1A 3OPZH 4KMTH 4MNGB 4WU7B 3ZKNC 4PJEA 2YD7A 3X12A 1U8NB 1UWXK 3ILQD 2VDRL 4XVSL 5E1AB 4YHZH 2XICA 3MACL 3V5DA 3NPZB 4ENED 2V5RA 2R4SL 4GAJL 4R8WL 4TSBH 3F8UB 2VABA 1I3RB 2NXZB 2VDQH 3KXFA 4O00A 3X14B 4XP5H 4YHYB 1DSFL 1NUNB 4MB5A 2H1PL 5KANI 3FB8A 5LWYL 1JHLH 2YMXL 5TJWK 3S5LA 4O4YH 1J87A 4TUJA 3NH7L 4Z7QF 3MRQB 1HDMB 2FWOA 1IM9A 4M9PA 2AKRB 3MV7B 2FGZA 4M00A 4F7MA 1P69B 1M7XA 4B7IA 5L8LB 4C59B 4QY8B 4GRLD 3E3QC 3MZTA 4KUZH 4UZGA 1S9KC 2AABL 3L6FB 3WDJA 3FT4A 3MLZL 2D4FA 4A6YA 1RUMH 5FYJD 1KIQA 3OAUL 3FQTB 4DTGH 3HNSL 1TQBC 2X4QA 3MRFB 3HS0B 2AEPL 2ADGB 5IBLC 1DR9A 5FYJE 4KZEL 4PJXF 4Y8AA 4WW2C 3LB6C 4WWKB 1BVKA 1EBAA 3BH8B 3IFLL 1QSFA 3D85B 4Y4FA 2VLRB 1FL6B 3MGAA 1ZHKA 3QNXB 3MLRH 1INQB 2A9NH 2EO1A 4ZO8A 3O4LD 4IRSC 3O2VH 1RK0B 4LHUA 4Z7OE 1KCRL 5C86A 1VHPA 2OZ4L 1FO0A 5CGYC 1HH6A 3O4LE 1P6FA 1GC1C 2HP4A 5HPOA 3RNKA 3QXWA 1RIUH 3GMQB 3HG1D 1T1YA 5F21B 1DDHA 2VXUH 3GMLA 3TJEL 3LIZH 3MRMB 3BHBB 4Y5YC 1ZVHA 2B4CC 3HG1E 1HSBA 3NIFF 4PJ7F 1D5BA 1RJCA 2FJGA 3QIWC 1GJIA 4MDIB 5JOEA 3P11L 2V5YA 2H2SC 1JPTL 1X5HA 4Z7UB 2KH2B 4NQED 4YX2L 3QIUD 2YRZA 4RQQB 4KTEH 4L5FH 4JO1H 4WHYG 2IPKA 4NZJA 1B90A 3IDXH 4NQEE 3DRQA 1VKXA 4BH7B 2OL3H 2P48B 3L3DB 1PKQA 4PGZA 3BKCL 4LRIC 2IPTL 4K3HA 3O2WL 4ODBD 2XN9A 1UQSB 4Q0XL 5DD0H 3WLBB 5DRZA 2EYSB 2PYFA 2EXWC 1XGRB 1N3NA 1M4KA 3D0LA 1U58B 4F80A 2NY4C 3BZEB 4EZMA 3QO0B 2VXSL 1UJ3A 5DEFB 4LLAA 4PPTA 2Y23A 4GKZA 3MOAL 4YDLB 1FV1B 3DROA 4O58L 5KVMC 4JHWH 5J11B 5ICZB 2DM7A 5D71L 1G7JA 5JIPA 3O11A 2VLLA 3TZVB 2D4DA 5K9KB 1ZTXL 2VC2L 2ITCB 3CVIL 2GFBA 3U1SH 1F4XH 2C7UB 1MELA 2UYLB 1IAII 3QUYB 1YY9D 3T2PA 4LSRL 2B7DT 2DDQH 4XP9L 3QG7H 4NN5B 5D93C 5KSAA 4HJGB 1CFBA 3QXAA 4TQEH 4ZS6D 1J8KA 5EBLB 2XFXB 2GTWB 1LQSR 1R24A 3N1FC 3UTOA 1P7QB 3PGCA 2NY6D 4I3SL 5J13C 4XAWL 5EU5B 3RVTD 4KHXH 2XZZA 3V0WL 2NY3C 3QH3B 2VUOA 4WCYL 3KLSA 5EDXA 3F12A 3VFWB 2P8PA 3GMPB 4DEPC 3MLWH 4XTRC 3QULB 4U7MA 4GLRH 4J23A 4JFQA 4R90H 3RAJH 5IROA 2ZOKA 4E41A 1A0QH 2BY3A 3MPCA 4Q97A 1NAMB 2AP2A 4TNWK 5J12C 1BJ1H 1ULVA 5FUCC 3BH9B 1SYVA 5LGKA 2Y7QB 4JE4B 2JELH 1ZLUH 2E9BA 3O2DH 3C5ZA 3C8KB 4IS6A 1KLUA 2X89A 2AJVH 3FO1A 3I75B 4Y88A 3O9WD 2XV6B 4OBSA 5KJRH 3TBTB 1L9MA 3PWPA 1UZ6E 4IRZL 4GG6F 4GAGH 2ZCHH 1LEKA 2DIBA 3O9WB 5CWSA 5KN5B 3DURB 3QISA 4G8FB 4Y4KB 4EXPX 3CCHA 5F7DA 3ZTJG 3LN9A 4EDWL 5E6YA 5DD6A 4OFVA 4JFXB 4N0YH 4MXVE 1FNGA 1GAFH 5DXWA 5L8JB 4R4NC 3SDCB 4CU6A 5E4EB 3L3HA 1KLGA 3RZCD 1YEEL 4XHJD 1F3RB 12E8H 2VQUA 3ARZA 1JZ3A 3NABL 3PDGA 4LQFL 2Y9RT 4PRDB 4OFYA 4YFEA 2DBJA 5C9JB 5T1KD 4OGYL 5T1LA 5IIEB 4MXWL 2DMCA 1WTLA 3LQMA 2AK4A 1S5HA 1I1AD 3QXTA 3H0TA 3AU1B 1MVUA 3UJTL 2ILLA 5T1KB 1FP5A 5EO0A 2QSCL 2BY0A 2MTPA 3WUZA 4K7FB 1T04B 2F54A 4Y0GA 3KPRD 4NSKA 1EJOL 1I1AB 4GAYA 5I1IH 4NRZA 2W91A 4K9EC 4M7KH 4XC1L 3NZ8A 2VH5L 3AB0C 1HK6A 5HDQH 1DCLA 2HVKB 4HKZA 2WAHA 3KPRE 2BCKA 1EJ6A 3TBYB 3KPRB 1QFUL 4ONFL 2XTJB 1YQVH 1CG9A 2AXJA 2D31B 1T2QL 5E5UB 1I7TB 1CIUA 1M71B 1QO3A 1TENA 3RWGB 3UBXI 2WINB 4KUCD 3RDTA 2I25N 3U6RB 4JY4B 4J2XA 2ADIB 4HBCH 3CMOH 1LK3H 4UNTA 3U83A 4LOUC 4JZNA 5HSFA 3DX8B 3EO1A 5IEHB 2LU7A 3W9EA 2CQVA 4LKCB 1T2JA 4XPBL 3OKOB 2GSGB 2VRAA 2EDFA 3BOVA 4O51B 5EZJA 5I1KH 5MP6L 5E00B 3FTGB 3VXUB 3QHTC 5CZVL 1N2RA 2GYSA 4YO0B 3B9AA 1EFXA 2VL5B 2VR5A 2FO4B 1YYMH 4NKMA 5ITBH 1OGAB 4WUUB 1F3DJ 5I0DA 2A83B 1GPOL 1QR1A 1FZMA 2BVOA 4Q6IB 2FYYB 4BFIA 3OJMB 4ZPTA 3PHOA 3G5VB 2JCCB 3EGSB 4JFZL 1SVCP 3WIFA 1U3HD 1QFOA 5A3IC 1I7ZA 4FQ2L 5HYJD 3ZKSD 3MLUH 2EDRA 3EYQC 1AD9A 4WEBH 2OP4L 2IALB 4JJ5A 4LSTL 4MVBC 5JORA 3X13A 1XF4A 1KTKE 3LS5L 1WSST 1EPFA 3QXDA 4HPYH 4JG1H 5HYJE 4CW1B 1DVFD 4DFHA 5GS0H 5F9JA 4M5YH 3MLSL 2OXGA 3WKMH 1CBVL 4R0LB 3VI4E 4FXKB 2WWKO 5FKAB 2GITA 2FBJL 3HUJF 4O2CB 2HG5A 5DHYB 1MUJB 2J8OA 1VGKA 1PYWA 4WFHE 3OG4B 3WMSA 2E7LA 3DHJA 2VIRB 3NFNA 5E2WH 2FGWH 4TPRL 3GSXB 2Z8VC 2HFFB 2HKHH 5F1IB 3ALPA 4NNXA 3VG0H 3ORJA 1YJDC 2GK0A 1UM4L 5CMAB 5DMKA 2VLKB 3GSNA 4P59H 4Y4HA 3C2SA 1DQQB 1FQ9C 1QHOA 4A6YL 3VG9C 3VXMA 5HD8D 1YY8B 3WXVH 5HHVL 4L4TA 3QAZC 2Y36L 4Z0XB 1W0VB 4F3FA 3H2WA 4KQ4L 2MJWA 4LEOB 1IRAY 1CLZH 5DEZA 1GIGH 1Q0XH 1RZGB 1XFPA 2GJ6D 4FQXC 1G7IA 5D9SB 5T3XL 3OKNB 2YPLB 1P5VA 3EJYC 3S35L 3L3IA 3L95A 2GJ6E 5IWLC 5DDHB 3P77A 5KS9F 1JGDB 5I1DA 4JJHA 1WFOA 1U8JA 3VXNA 4Y16D 4BQ8A 2BSTB 4OZHB 4I48A 3F7YB 4EVNA 5C08D 1RIVL 4UT7L 5I1CL 3EYUL 2FX9L 4LCIH 2P8LB 2HTLD 1YECH 4GS7C 1A22B 1FAIH 1JWSA 4GKSB 4X9GA 5C08E 3VFGH 4KZDH 1EA9C 3TVMC 4K8RH 1Y6NR 1QPXA 3ARWA 3HFMH 4X6FB 1MY5A 1MCEA 1MFAL 1ZA6A 1BM3H 1OTSC 5GRYA 4LIQL 4CJ0A 2CDGA 1PJ9A 3AROA 1A2YA 1ZEAL 4L9LA 1I7UB 1CU4H 4JRYA 3ULVD 2IQ9H 3ARQA 2PXYC 3G5XA 2ICWA 2R4RL 2HT2D 1GGBH 2PCPA 4JLRB 5I1JL 3P30H 4MA1C 1BD2D 3ULVE 2ITDB 2EH7H 3GKZA 2R56L 1CFVL 5L88L 3ARGB 3HNTH 3UZQA 2ZCKL 3ALXA 1BD2E 1RK1A 5A2FA 3A6OA 6CGTA 1KIRB 3QFJB 5IR1B 3G6JF 1PW3A 1OSPH 1CR9L 2CIIB 3LDBB 4PYHA 2JTDA 5L2JA 4XT1C 2B2XH 4D3CL 2KQMA 5ICXA 3IU4H 4TSAH 1I4FB 5ECJE 4M48L 3VH8G 4RIRB 1VACA 1BVLA 3EYOB 4F58H 4NQSA 2PN5A 5EU4B 4HIEA 2ZJSL 4LASL 3JTSA 1IM3A 4P2QA 3V4VL 3ZE1F 2AW2A 5DC4B 4P57B 3EDKA 1AQDA 1KUMA 2W92A 4Z8FL 4ZFOB 2BRQA 4GRWH 4OFKA 1MJUH 3RA7H 4OLVH 1HKLL 4PJ8D 4BFEA 3IS0X 2GY7B 3WFBL 4F15B 1X7QA 4PJ8B 5ISZD 1TCRA 4XVJL 2OTWA 1CDBA 5DRXA 3RGVA 3MV9A 2MQCA 3IS1X 4OGAD 5IHUL 1ETZB 2AJYL 5ISZE 1NLBL 1MRCL 1J9CT 5B8CA 4FG6D 5FECA 1A6AA 4OLXL 2CUHA 4E5XA 3DVNA 4NM4L 1IEBB 4OI8A 4NZTL 3FRPG 3IDGA 1CE6B 1MCWM 3CX5K 3O8XA 2ZKHL 4QXWA 4M6NH 2ZUTA 1QOKA 4ZXBA 4YAQA 4GRMA 2MHAB 2R2EB 2EDXA 1KEMH 1XR8B 1EUUA 3DXAD 5ID1A 3MZGB 3RWDA 4GMTH 5KG9A 4WV1B 2Y06L 4K7PH 3G5YA 3BEWB 2ADJB 5DMIL 3BMWA 3HE7D 4PJIF 3QSKB 3DXAE 3REWB 3VH8B 3UTTE 1A7PH 3B8YA 4YHNA 3HR5B 1TCMA 2HRPL 5IQ9A 5I30H 3IDIA 4OQ1A 1T1XB 5J6HA 2VLJD 3C60D 1BIIB 3HE7B 1Q38A 1A21A 3BDYH 1HYSC 2R1XB 3HC0A 3ZE0E 5I1EL 3LN4A 5AWNH 5FGBA 2VLJE 3HRZA 4Y1AB 1CD1A 1B0GB 3C60B 4OZGA 1GVIA 3NFSH 4PY8J 5JLZB 1BZ7B 2R0WL 1QBAA 3ULSB 4BZYA 3QDME 2EE6A 3MC0A 5EZLB 2QSQA 2XRAL 2DQIL 4JY5H 4LLWB 4I3GA 5D5MA 1EEZA 1KJMA 2GIYA 1RZ8B 4PJCE 2E3VA 3RVWC 2X44D 5EOCH 3IKCB 4OM1L 4X8JA 2W07A 1U2HA 1MCIA 3ZE2F 1AO7A 1T80A 4NO2A 2FH8A 1BQHG 1LO0H 3MJGX 5DD3L 2NY7L 4KMLB 1ZLSH 1KYOJ 3TT1H 3VFOB 4NQVA 4JFYA 2BNUB 3AXLA 1CTOA 3GSVB 3V6FB 5C2BL 3UAJD 4GUPB 3T65B 5E95B 1WBZB 4PRPB 3TESA 2XZCL 2ATPB 1GGIH 3MJ7A 3ARBB 5GS1B 2VN4A 2J8UA 3HN3A 2FHBA 2P5WA 3LSOB 4XP1H 5L2KB 3ARDA 4PTUA 2B1HL 3LQAH 3ARUA 4HV8A 5TE4L 3DIFA 5EUKB 1OSZA 2A74B 2ED9A 5I6XC 3IJSB 2AK1L 1S7TA 1KELH 5JA8B 1FYTB 3CVHB 3F7PC 1OM3L 5CD3A 1KCLA 5I8KL 4AM0A 5DZOA 5DYOA 3OR6A 1IGFH 2OL3B 4ERSL 3LZFH 2D0GA 4J6RH 1KTDA 3SJVD 4OTXL 3LKQB 1GZQB 1P7KA 5GPRA 2X4NB 1S9YB 3TO4A 3S36H 3MGOB 4G6AD 4TNVK 5DT1H 3MV8B 3SJVE 5C09D 3WYRA 3SJVB 5GGVY 2J6EA 3VFVA 1HEZA 1D9KD 1J7VR 3MCLL 3BPLB 2FJHA 1OB1A 5C09E 3O6KL 3GKWH 3SGDI 3NN8A 2JB6B 1JN6A 2QQKL 5FV1L 4I18B 5HGHA 2OX5A 3FQRA 3EFDH 5HI3D 2K1MA 3KPNB 3TBVB 4MQ7B 1EHNA 1JNHB 5I19H 2F53B 3H7LA 3NOIA 2V5MA 4XXDA 3TA3C 4ZS7H 3KDMA 4J4PC 2EDLA 2Q76A 4F7TB 3FQUA 1E6JH 3TV3H 3NIDF 4HAFA 1NL0L 4KRPC 1G0DA 2FEDC 3GJFB 3L3JA 4PJ5B 1BQHB 5TDNA 3LN5A 1S7XB 5JOPD 4NQDA 1RZ7L 2X42A 3IVKA 1U6AH 5ADOL 3QIBD 4N0UA 5FO7B 2AJZA 3E6FB 5JOPE 4XC3H 2C3GA 5C7XL 5FGCB 2L7UA 4JM2D 4X6DA 1JI1A 1I7RA 1X6NA 4LF3A 3QIBB 4HQQL 5H94B 5FM5O 5IVXE 2R1WB 3TLRA 1R3IH 5J6GB 1GZPA 5IHZA 2DQEL 4OF0A 1JCKA 2BJMH 1CFTB 1XAUA 3HZVA 4KK6D 1MFNA 2CRZA 3FT3B 1A3RH 2GCYA 3T0WA 3ZT5A 1IT9H 3CIQA 1HWHB 4AIXA 5C6TH 4JY6A 2BNQD 4Z78A 1UXWB 5CILH 3AM8C 4ZO6A 2VWEC 4HH9A 1HI6B 4ZUWA 4NKIH 3RKPA 4P2OB 2Y07L 2ENSA 2YHGA 4KDTA 2BNQE 3CC5A 1CDCA 1FL5B 2DWEA 3IF1A 4XI5D 1LO2L 2XNAA 4QRRA 2ZPKL 3K80A 1AGFA 3D69B 2J7LA 4G80B 1MF2L 3QJFB 2ZOLB 4Z77A 3D2UA 3K8MA 5DVOA 2B1AL 4PGBA 4EN3A 4X98B 4MA8H 1UJTA 2V9QA 4H26B 1HSAA 4QRQB 4J3OC 3FOMA 5E99H 2NYYD 5D2LA 4EQ3A 4G8EA 3T3MF 1K8DB 4GFTB 5DK2B 4ENEC 5INDB 2FLRT 5GRJH 3BAEH 3LKSA 4Z95H 5B39G 1U8PB 4JZOA 3BRFA 4UU9A 3GMMB 1NQBA 2JB5L 3WS3B 4K3JH 4WO4A 1AXSA 4UDTB 4ALAL 4ZDHA 1V5JA 2UVEA 3UPRB 2R8SH 5IVZA 3ARPA 3HAEA 4M43H 4OM0L 3IGAB 2EEDA 1RUAH 5J1TC 3DBXA 4TVPL 2CLRB 1T1WB 1VEMA 2VDLH 1GGUA 1KCSH 1A7NL 2EDJA 4S1RL 5BXFA 3SGJC 1YEJH 1HXMB 3PIQA 4M93B 5GGVL 1RZJH 2F8XC 2MPAH 4H0HB 4LLUB 1J05A 5I73B 3I6GA 2A77L 4H20H 5IBTL 1N4XH 3KR3L 1Z2KA 3JV6B 4MNGA 2OR9H 1U8NA 3TH4T 2I9LB 5B3JF 1RIHH 5IG7A 3FO0L 4HT1H 5E1AA 2EE2A 1D5XB 1X5ZA 3PG2A 4HUWB 5F3BB 5KVFL 1Q9KB 2D7TL 2X6MA 1PAMA 1I3RA 3I9GL 5F70A 5LGJB 1CE1H 3X14A 4JPWH 4X80H 7CGTA 4YBQC 3AS2A 5DJ2B 1S3KL 5ID0B 4KHTL 1MJ7L 1CVSC 4KVCH 3W9DB 1AY1H 3MXVL 1QYGL 4ZQKB 2BDNH 4WHDA 2Q8AL 2YZ1A 4DUXA 3GI8H 2FX8L 1I8LA 3MRQA 1P2CA 3FRUA 3WNLA 3ZDXF 5B39B 4YDVB 2AKRA 3MV7A 2B20A 1NC4D 5FO9B 4FNLL 3P0YH 4QXUH 3H7BB 3THML 2DKUA 5HPMB 3BN9D 5T5NF 1RMFH 4HKBA 1JNLL 1AQKH 3L6FA 1IGYB 1NC4B 4Z76A 5E8NB 1YC7A 5FV2A 4JFFD 5GS0D 1JP5A 2IGFL 4FFZL 4NFDA 5E7BA 3BSZL 2IMMA 3FQTA 3SKMB 3C09C 3MRFA 2LABA 1MFBL 2RBLA 4JDZB 5IKCB 3HS0A 4P9HL 1DQJB 4JFFE 2ADGA 3NZHL 5EC1B 3ZKMD 1X44A 4JFFB 4ONHB 4XPGL 3TNNA 3U0PB 3BP6B 2I07B 3I6LD 4NWTH 3BH8A 4WWKA 2X7LA 5DJAB 3WNMA 3D85A 1IEAB 1OAKH 3MCG1 1KBGL 2VLRA 5LCVL 1KB9K 1FL6A 1EUTA 3QNXA 3WUWA 3I6LE 4D0BB 1INQA 2VQ1B 1RK0A 3GBML 5MHSD 4N0RA 4WFFE 3KPSE 4C4KT 1IQWL 3RVXD 1FNSH 2VR4A 1XF1A 4YFDB 1IARB 1NLDL 1MAMH 5MI0C 1CL7L 1MRFH 5MHSE 1JRHL 4TUKH 1P4IH 25C8H 3GMQA 4QNPE 1WIOA 5CD5C 1AE6H 2YA2A 5IFHH 2EDHA 2BX5A 3SDXE 3MRMA 1MAKA 3BHBA 5K59E 3GHBL 3K74B 4XCEB 5IV2B 4LCWD 1OTTC 2X4SB 1F6FB 4MDIA 5E7FA 2GJJA 1YY9C 4WFED 4UTBH 4WUKH 3F62A 1WF5A 4XPFL 1F90H 4Z7UA 4LCWE 2FB4L 3MFGB 4ZS6C 5DVLA 4YEEA 2XOTA 4U1MB 2N1KA 4PJ7B 4RQQA 4WFEE 1OP3H 3V4PL 4GMSL 2QHRH 3C08H 4YQXH 1O7VA 4FFYL 4AEIL 4V1DB 2NY6C 5HDBF 3KYOB 2CKBH 4AENB 4BH7A 4MXQD 2VDPH 3L3DA 1MCHA 4K8RD 1UACH 4URTB 2RCSL 1UQSA 4NHCL 4ODSH 4GSDH 2EYSA 4S10A 4MX7B 1XGRA 4J1UA 1W8NA 5EUOF 3T0DA 1YMME 1U58A 5GGSB 1QFHA 4DVBA 2ZUUA 2E9WA 3BZEA 3QO0A 4K3EL 5GJTH 1NUDA 5I1GL 2X40A 5ITFB 4M7JL 5DEFA 2VAAB 1C8PA 3VJ6B 2VDOH 4Z5RA 5F6HJ 1FV1A 2HKFH 4YDIL 5ICZA 5AZ2L 4YZFE 1VB9A 5C0ND 4ZUUB 1PLGL 2V2TB 3IRZA 3UZEA 1RFDL 3TZVA 4R26L 4I0PD 1N5YH 1N6QL 3RWEB 5K9KA 3DUSB 3VGFA 2ITCA 4OZ4B 4XVUC 4LPUA 1XEDA 1MY7A 3ULUC 2C7UA 2UYLA 2HMIC 3QUYA 3BRDA 5KANG 1H8OA 2W0LA 3B9KD 1AR2A 5M95B 3FO9B 4RDQG 4X99B 4XCYB 4I0PB 4HJGA 1YNKH 3CJJA 5EBLA 4LCUB 2XFXA 3EJZC 2BOBB 2GTWA 2PTUA 2HJLB 3ZMRA 1FPTH 4U1HB 1P7QA 3B9KB 1F4WH 1F6AA 1WWAX 1CICB 3VGAC 3MSPA 5EU5A 2J6EL 3QH3A 5JMRA 1L4IA 4YHML 1AFVH 1PX4A 2FHFA 3GBNH 1RUKH 3VFWA 3GMPA 5DK0B 4Z7VE 3DSFL 3QULA 1FLTX 5JQ6H 3FQWB 2IH1B 5CZXD 5HVFB 1J1OL 1NAMA 3SQOH 1PDKA 3BH9A 3CPLB 4GRWE 2Q6WB 2Y7QA 4XAKD 2FZ3B 1LMKA 3T0EB 3NGBC 3D25B 3C8KA 2DTML 1K4CB 2ED8A 5DMJB 3OXRB 3I75A 5BOZG 3R06B 4JHBA 1JIBA 2APFA 2YN5A 4XAKE 4HMDA 4ODHL 4JPVH 3TBTA 2X1PA 1VGEL 1DBJL 3VXRD 4H0IA 4NYLB 1DQLH 2P45B 1LEGB 3WHXB 5KN5A 3DURA 4G8FA 1FCGA 3GJFK 4Y4KA 4LLVA 1W72L 3VXRE 3STZB 5F9OH 2IBGA 2W65B 4RFOH 4U6XB 3RTQB 1KJ2L 5GJSL 4AEHL 1LE9A 2E7HA 4NP4L 3SDCA 4ZPVB 1E28B 2X1QA 5KSAC 1T7VA 1OPGH 5F44A 1P84J 4MA7H 3D0VB 2EH8H 3C6LB 1XGTB 2EKSB 1T03L 1NSNH 2PETA 1ES0A 1WIUA 2E6QA 1WQVT 1H3WM 1RHHB 2BSED 5E2TH 4UV7H 4HHAB 4PRDA 3RU8L 1XMWA 4HGKC 1JGLH 4HMEA 5C9JA 1A6VL 5IIEA 4UQ3B 1HYRC 4BJLA 5HI5C 4WHTA 3AU1A 1N0LA 3LCYA 3P9LB 4I0KA 5FB8A 1BJ1J 5T1KA 4YIQB 5B3NA 3NCJH 1MCFA 1HIML 3CFKB 1OTUC 4WGVB 4K7FA 1NCUA 1T04A 3E8UL 1AP2B 1I1AA 4W4NA 1GHFL 1S9XB 4N8VG 4X5WB 4KAQH 4DGYL 3CSYB 2HVKA 3C5ZC 4M7LT 3RY5A 3SDDD 2VN7A 1UKQA 4GAFB 3TBYA 4PLKC 4NJAH 2N7BA 1EHLL 1HNFA 4N8CH 2D31A 4JO2H 4GT7A 2XZQH 4DAGL 4RWHA 1SJEB 4UTAH 1J1XL 5C8JA 1I7TA 2G60H 1M71A 2VDNH 3RWGA 2WINA 3U6RA 4FQLH 4JY4A 1U8KB 2ADIA 4XVTL 2WQRA 2NX5E 5IEHA 3N0PB 4YC2C 2C3WA 5DF0A 1AR1D 1P9MA 3OKOA 5DWUL 2GSGA 4G42B 3B9EA 2FDBP 2PUQT 4O51A 1CL7I 4YK4B 1A3LH 4OAWB 4X4YB 5E00A 3FTGA 3VXUA 1BHGA 5FFLA 4YO0A 1XGYL 2VL5A 3QRGL 2FO4A 3TBWB 3QQ4B 1OGAA 5L9DH 4WUUA 3TCLB 2A83A 4XNQB 1FIGL 4P3DA 4JGJA 2B5IC 5KVGH 1TZIA 4Q6IA 2FECI 2FYYA 4KRNA 5LXGL 3JVGA 1I1YB 4DZ8B 4OCYL 4XPTL 1J88A 5IUSA 3G5VA 2BHYA 3QDJE 2Z91B 2JCCA 3EGSA 1RD6A 2NXYC 3OKEB 2Y4SA 5TFSL 4M1DL 2W1NA 2NY2D 3ZDYF 4FQJL 4YHIB 3OAZK 3Q48A 3CFJA 4YEFA 3VW3H 2IALA 3BKJL 5TQ0H 1EAPB 2OMBA 2IFFH 3F58H 3JV0A 3MOQA 4HFUL 3ME0A 4CL7A 3MLTB 1D6VH 3KG5A 1FC1A 3GFUA 2R0LL 4R0LA 5FKAA 4MCYB 4Q58C 4HWZB 4O2CA 1N6VA 3VMPA 3N1GC 4O2FB 4ZFGL 4I4WB 2E8YA 5AYUL 3OZ9H 5DHYA 3WBDA 1MUJA 5FYKH 1T89A 4YHLH 5F8QC 2DQGL 5IJKA 1N26A 2VIRA 3RDTC 3BO8B 2XZAL 4R4FL 1OARL 3V4UL 3GSXA 1OQXA 3HUJB 2HFFA 5F1IA 4PJFE 2BVPB 3OV6A 1ZT4B 5DS8A 5B38B 3CZFB 4XWGL 3TBSA 4QXTA 4YHPB 1MIEL 4N9GB 5CMAA 2HJFB 1W0YT 1A1MB 2VLKA 4LSPH 3K2UL 1OCWH 4H8WC 3EOBB 3HZKB 3SE8H 4H88L 1YY8A 4PRNB 2F58L 1FGVH 4Z0XA 1W0VA 2D03L 3TYFB 1H3TA 1ZANH 3EYSL 2FL5B 4MAYB 2NW2A 4LEOA 5DFVC 3C8DA 3TYGL 2EYTB 5D9SA 4FZ8H 3K7UA 3OKNA 2YPLA 4LSQH 1CLOL 3N85L 4X6CB 4PJGF 2BXYA 4N8PA 1WISA 1XGPB 4O9HL 3KYMB 3WIIH 1Z9SA 3I3BA 3PV6B 1N64L 5DDHA 2YPVL 3JTTB 1JGDA 5C0AD 1BQSA 3U9PL 2BSTA 4OZHA 5FK9A 4LLQB 1NCCL 2VXVL 2YOCA 2P7TB 4P23C 1CQYA 5C0AE 3QR2A 2P8LA 1U8OB 2VXQH 5KS9B 1Z3GH 4GKSA 3NCBB 2C5DC 3MRIB 3GZKA 3OAZH 2P5ED 3S8WA 3CLEH 1T3FB 4R4BB 1BQLH 1GC1H 1OAUH 3PF2A 3LMJH 4LCCC 3M8OL 1OP5H 3C8HA 4LAQH 2P5EE 2PO6B 1QA9B 4MMXC 4OIAA 4ZTOH 1QRNB 4OGXH 3UBXG 2OM5A 1I7UA 2E7LC 2B4CH 4Z7NE 2CR3A 3RBGA 3HMXH 3IDMB 4ZUSB 5DQDH 3IDYB 1AIFB 3VXSD 4JLRA 5SWQB 2ITDA 1SJHB 2Q8BL 4D9QE 1SMAA 2OI9B 4GW1B 4NZUH 3ARGA 4Y4HC 3VXSE 5DJZB 2LE9A 4FOMA 3OQ3B 4OSUL 1JYWA 4U6TA 1AJ7L 1KIRA 2J12B 5GISL 4JB9H 1JTOA 4KDWA 3QFJA 5IR1A 1NAKL 4K94L 5FYLH 3JWNC 1LHZA 1MHHB 2CIIA 4OKVB 4LBEB 4P46B 3IETA 3ZSSA 4GBXA 5I75B 1I4FA 3VA2C 4HIIB 2DJSA 1NC2D 3BKYH 4RIRA 4XZUB 5B4MD 3CH1B 3G6JB 3EYOA 4RX4D 5EU7E 1B2WH 4FTVA 1OAYL 1C16B 4P57A 5DD1L 3ABZA 1PQZB 3NCMA 5GHWL 4ONGH 5ACMA 2E8ZA 4MMZC 3H8NA 1H3XA 5JZ7C 4N90D 2GEEA 4HJJL 4LVHC 1IGML 4NGHH 3GMNB 5IW3A 3FMGH 1DUYB 3EUUA 4N90E 2DQUL 4PJ8A 1E6OL 1L7IH 2DD8H 5E4IA 4YHOL 4HC1H 2H2PD 1CDGA 4L9LC 3UBXB 1P4LB 1BECA 4WI9A 1BBDH 5D1QD 1ETZA 2ARJQ 4XCFL 4PD4J 1XZ0B 5AEAA 3KWWB 1SHMA 2Z8RA 3B6SB 3RRQA 2CSPA 3GO1H 3A6CH 1YEIH 5D1QB 5DUML 3ZDZF 4MJ4A 4XCCH 2CDFB 5IB3B 1KPUA 1NAML 5D1ZD 1YC8A 1CE6A 5I76B 3Q1SL 4ZYKB 1NGYB 3OGCB 4HS8H 2NQCA 2MHAA 2R2EA 1OAXL 4OZGF 4QYOB 1XR8A 4YNYB 5D1ZB 3RKDD 3ROLB 4LLYB 3V6OA 4WV1A 4AG4H 3BEWA 2ADJA 2CMRH 5E2VL 4KROD 4PJHF 4QCIB 4UT9H 3N1PC 1KEGH 4QRPB 4AQ1B 5D5MF 3REWA 3VH8A 3HR5A 4DKAA 5BO1L 3SDAB 2M1KA 1T1XA 2F5AH 3WHE0 1BIIA 3HE7A 4I0CC 5BVJB 3VGHA 5SX4I 2R1XA 4P5MB 4Y19E 3VXTB 6FABH 1MCJA 2X9WA 5D72L 5LG1A 1TJIH 3QHFL 2WUCL 3HC4L 1G9ML 4I1NB 4Y1AA 1QSVA 5I8OH 1B0GA 5KVDL 1BZ7A 3ULSA 4HUMB 3Q5OA 5C71A 3V52H 2VISA 5JDSB 4IOSD 5EZLA 5F89B 4PLNC 4LLWA 2VSDA 3MUJA 5IQ7H 3MYZA 1ZSDB 2YBRB 2RAMA 1RZ8A 4JCLA 5FDYA 3IKCA 4LRNH 1D9KC 1LO3H 4LSDA 1KB5B 2WBJD 4PGJA 1U9KA 4HXAL 3AVEA 5IM7B 4KTDH 4RA3A 4KKLD 4PYGA 4GW5B 3VFOA 4B7LA 1IGIL 3RX7A 1K3ZA 5D1XD 3GSVA 2WBJB 3V6FA 4CN4A 1JYNA 2UZXB 3MJ9L 5FIEA 4GUPA 1DQDH 5HYIA 3PL6B 1WBZA 1ZXQA 4HK0B 5FM5M 4PRPA 2ATPA 3FRPA 4UV4L 3O45B 3ARBA 5GS1A 3LSOA 4UUJB 4ZXBC 5L2KA 1PG7W 4IOFD 1ONQB 3QO1B 1KTRL 4R97C 5BZDB 4IMKA 1MWAB 5EUKA 4X9IA 3T77B 4K9EH 3OXSB 3QUZD 3IJSA 4I3RH 1MHPL 1FYTA 3CVHA 3QPXL 5KW9H 1D5MB 1GH7A 3KPLB 4PJBF 2OL3A 3TF7C 1GGTA 4P5TD 1K85A 1GZQA 3LKQA 3S37L 3QUZB 5DTFB 2X4NA 4OQTA 1NBZB 4D0DB 4JM2C 1L0YA 3FFCB 3W11D 3MGOA 2NY0C 2YS4A 1WZ1H 3MV8A 4YXKL 3TN0D 4XCNB 1C7SA 3CXHJ 4ZAKD 5FGBC 1Q0YH 2OJZL 5JA9A 2V7HB 5FO8B 1BPVA 1J12A 3WDIA 1KT2B 3U36B 3V5KB 1JGVH 1D6EB 3AS1A 3MREB 2JB6A 4NC0B 3VGDA 1HWGB 1KN4L 2O5XH 4I18A 1JF1B 3KPNA 4HBQA 4JFDD 1JNHA 1TJHL 1INDL 1M05B 4X6DF 2F53A 1ZHNB 4QTIL 3T2NL 4F7TA 4JFDE 5GRZA 3GJFA 4U7KA 4PJ5A 1BQHA 3R8BB 1V8HA 3OHXB 2VZ1A 3O4OB 1S78D 3D39D 4U1SB 3GNMH 5A43C 4MD0A 4M6ML 8CGTA 1WITA 5FO7A 4N68A 3E6FA 3D3VE 4L4JA 3D39E 1DEDA 3NA4A 1MCLA 1FBIH 1RPQA 2KBGA 1P1ZB 3QUMH 5H94A 4XNZB 2R1WA 5CBAB 5J6GA 2ARJB 5BV7C 2C9AA 4UAOC 4MAUH 3MBXH 5ABDE 1L7TL 1CFTA 1JGEB 1G7QB 1IGCH 3FT3A 4ODTH 4KPHH 2RGSA 2HH0L 3TO4C 2GKIA 5DJYB 1QG3A 1B4RA 4RBPK 3HKFA 4K2UH 3FQXA 3U30C 2KKQA 3BZ4B 3T0AA 4G6FD 3O6MH 1MCNA 5F6IB 1UXWA 4G43A 5E6IA 1HI6A 4HUUB 4P2OA 1MCBA 3ARSA 3QCTH 2YR3A 1FL5A 4I5BB 2NY5L 2ORBH 3D69A 4HSQA 4S1SL 1EBPA 4BQBA 1UM6H 3PGDB 4X9HA 3QJFA 5JXAL 3NCYS 3WCYA 3PGFH 1AD0A 4X98A 3SBWA 5C2UB 3S6CA 4H26A 5I9QC 3VWKD 1OL0A 4QRQA 1FGNH 5JUEL 5A2JH 2AJUL 3LKNB 1IVLA 4LK4A 3BP4B 3EOTL 4R7NB 4X4ZA 2Z31D 4U1JB 1K8DA 5DK2A 5INDA 3WXWH 1TZGH 1U8PA 4OLYH 3EO9L 3I6KB 3WS3A 2Z31B 4F8QA 4UDTA 2HFGH 1FVEB 4JR9L 3UPRA 2ZUYA 4ZOBA 4M7ZB 4AY0A 3IGAA 3E0GA 2DS4A 4JFED 4RGND 2CLRA 1IEHA 3FQNB 5GGTA 1K9TA 1T1WA 4PY8I 1FH5H 1G6RB 3BMVA 2J5LB 2IG2H 5SWZD 3VA6A 3QEGL 4O5LL 4JFEE 4RGNE 5CGTA 1J0IA 3L5JA 4JM4H 3H9SB 4JFEB 4RGNB 4FQCL 1HXMA 1J1PL 5C0DB 3C5JB 2DQJH 3BN9C 5SWZE 5SWZB 1FZJB 3RY6C 2XA8H 4K23L 2L4OA 4JVUA 3C5SB 4M8QB 1S9WB 4RSVA 4KDTC 3EDEA 3I2CH 3JV6A 4OD3L 3VI3F 4G9FE 1MFCL 2I9LA 5EZOH 3HHRB 1K8IB 5FUZH 4JRWA 4KVNL 1JMZA 4HXBH 2FIRT 1NGWB 1D5XA 3NPSC 3QUKA 2WANA 3QNZA 5F3BA 1G9NH 1Q9KA 5ENWB 3WSQH 4BA8A 1J5OH 4HIXH 2EDTA 5LGJA 4U33A 4ODVL 3ZTNH 1UB5B 3KPOB 5DJ2A 5EG6C 5ID0A 1NBQA 1NCDH 1YEDB 3W9DA 3FB7B 4JN2B 4POUB 4F57L 1TTUA 4FABL 1IKFL 2BHZA 2KPNA 2OJEB 2YA1A 4ZQKA 4FA8A 3A6BH 5GS2H 1QVOB 1VCAA 4MJ6B 3RVXC 8FABB 1MCPL 3TFKD 5CJXA 2ZSWB 2C4XA 1OGTB 4XBGB 1SBSH 5B39A 4YDVA 1CLYH 3MLYL 4ZFOL 3IKKA 4WO4C 5FO9A 2YXMA 2ADFH 3LH2L 3H7BA 4HUKB 2ESVD 4YHKH 1YZZA 3GSWB 3KHOA 2CO6B 4KMTL 3GDBA 1CD9B 2DLHA 5I71C 3V0VB 4RAVB 1Q1JH 1QPPA 4LDEB 1IGYA 1BEYH 1NCWH 4BUGA 2ESVE 5E8NA 1V7MH 1D5IH 3MXWH 2APTA 4YHZL 1NGPL 3WO4B 5DJXB 5BS0A 4JKLA 4YXHH 5CHNB 5GZOC 4TSBL 4G8GA 3QRFM 4U1KB 4CMMB 3SKMA 4Z7OF 4LU5H 1ZS8B 4DKEL 4JDZA 5IKCA 2VDQL 2WW8A 4LSSH 4XP5L 1DQJA 1V7NH 5EC1A 5ALBH 1CCZA 4WI3A 2XY2A 4JFFA 4ONHA 4X4XB 5FYKD 3U0PA 4OLUH 4OCWH 4OCSH 4O4YL 3BP6A 5DJAA 3E2HC 5BMFL 5GRWA 3VWJC 1QACA 2P42B 5FYKE 2H45A 3BJLA 5FHBH 4MWFB 4U2YA 1MQKH 3GI9H 1AC0A 3S96B 4D0BA 2VQ1A 1MH5B 3O6FB 2BSRB 1LP9E 2QKIB 4KUZL 4Z7UF 3QFDB 4C4KO 2VDRH 1U3JA 2NZ9D 3E3QE 3MACH 2NXZC 2R1YB 4NFBA 4R8WH 1RUML 4JQIH 3IDJA 1SM3H 3T3PE 1DSFH 1U8IB 3DETC 2H1PH 3TC9A 5IBLD 1HH9B 2YMXH 4XCEA 5IV2A 2X4SA 1TQBB 3CDGB 3LB6D 1ZT7A 1A7QL 3NH7H 3MUY1 2NZIA 2FJFB 3SCMB 5LKNA 4MNHB 5D7JB 3DX9B 5AUMB 4Q9RH 3MLRL 4PJ7A 1A64A 4U1MA 4LCYB 4L3ED 4PG2A 3L7EB 2Z8SA 3QDGD 3O2VL 4V1DA 4PR5B 3KYOA 4YDKH 4TULH 5CGYD 1NCNA 1I9IH 2AABH 1N8ZB 2ATKB 4L3EB 4IRSB 3QDGE 1ZLVK 4QKXB 4PRID 4MX7A 5LGHL 1YPZE 3HNSH 4X4ME 5GGSA 3AS0A 5HHOB 2VXUL 1JWUB 5CZXC 4Z6AT 4WWKC 3LIZL 4PRIE 1N59B 4CMHB 4QHLB 2VZVA 4U0RB 2VAAA 2HAZA 4PRIB 2Q3ZA 3QIWD 4L4VE 3ARFB 2EDWA 4NFCA 2H2SD 3IFLH 2ICES 5EUOB 4Y5YB 5JIIA 4ZUUA 2DB8A 2V2TA 4HG4J 3QIWB 5DHVH 3RWEA 3DUSA 4OZ4A 1TETH 1LE5B 5FYLD 3CVHL 3PWVA 3FO9A 4MNQD 4X99A 5KSVB 2OZ4H 2YZ8A 4I0PA 4MCZB 4XCYA 2OL3L 4LGSB 1KLFA 4G3YH 5DD0L 2BOBA 4PV9B 2EXWD 4OQTL 4U1HA 5FYLE 4MNQE 4LP4A 1CFNB 1CICA 2NY4D 1IAKA 1DTUA 2AAVA 4EDXB 3TJEH 4Z7QE 4FQ1H 5A2LH 2GAZB 5E5MB 3P0VH 1R3KB 5KZCB 2NY4B 1UZ6F 3P11H 5IEKA 4U6VH 1WZLA 3FQWA 2IH1A 4DQOH 2MKLC 4JHWL 5HGDB 4YX2H 4U1LB 2IAMA 1ND0B 1X5AA 1MREH 1EERB 1TVBB 3OJDB 2EZ0C 2FLBT 2EXYD 4ZSOB 2Q6WA 3U1SL 1U8QB 1S7VA 1IGTB 1MJ8H 2FZ3A 3QCVH 3UYRL 3T0EA 4MXVF 2E7CA 2JJTC 5C0CD 3BKCH 3N50A 3D25A 4X5XB 1K4CA 2IPTH 3OXRA 3R06A 5JIKA 5DO2C 3U0TA 4CRPA 4BYHA 2X4TB 4G6KH 3W0WD 5C0CE 5C0CB 4NYLA 1BMGA 1LEGA 2NY3D 3W0WE 3WHXA 4D9LL 2EDQA 5FA4B 4NRYB 5TDOB 3PQYB 3STZA 4XTRD 3MOAH 2UWEE 5J13B 3MGTA 2W65A 3TZVC 3MLWL 4O58H 5AD0B 4U6XA 3LEYL 2NY3B 1ZT1B 3RTQA 5D71H 2PKDA 5EC2A 5EFIB 3WJLA 3QUYC 1RURL 1A0QL 1E28A 3CVIH 3DGGB 3RBSA 3KS0H 2MCG1 1Y0LB 2JELL 3D0VA 3C6LA 1XGTA 2EKSA 4R9HA 5J12B 4DN3H 4HGMA 4APQB 4HCRH 4KXZH 2AJVL 1RHHA 3NIFE 1T5XB 2PF6A 1FSKB 2V2XB 4HHAA 4HWNA 4XMLH 3TWCL 4I3SH 1WBYB 3PDDA 5IFAH 1TNNA 4GAGL 4UQ3A 4XAWH 2BC4A 2ZCHL 4HX1B 1FDLL 1P4BH 1RULH 3ZKXB 1CDUA 3CK0L 4PRHB 1UCBL 3P9LA 1CGUA 5E9DD 5H37G 3PNWB 4OD2B 1W2KT 4HDIB 4YIQA 3CFKA 1II4E 2EIZB 1AP2A 3S98A 3CFCH 2DBLH 5E9DE 1S9XA 4X5WA 2X4UA 4KUCF 4JANB 3F7VB 3CSYA 4ZNCD 3TH2T 1V05A 5T5FL 5DQ9A 2NY2C 4XP4L 5GGUB 4X9BA 4A2MA 1SJEA 4HWBA 1IC5H 3MFFB 4OZIB 5C0RL 2IAND 3HTLX 1U8LB 4IRZH 5F9AC 3MRGB 4HLZH 4Y4KC 4QRUA 5HY9B 2UUDH 1XF5B 3FFDA 1H3PL 3QUXB 2IANE 2JCCF 1UB6A 1G9MC 5EU6A 1FCCA 2E7MA 2IANB 5C0JB 4G42A 5F9WC 5GGTL 4F33B 4OFPA 4KI5C 4EDWH 4FP8L 5DSCB 3SDCC 4Z9KB 4X4YA 5JHDB 3PABA 4FMKA 4EOWH 2XKSA 5SX5K 3ARYA 3KGRA 4PJAB 2AQ2A 2PYEB 3QQ4A 3TCLA 4XNQA 5TH2B 3KPPB 3VMOA 4PJ9D 4UIMA 1I1YA 5GGSY 1A5FL 3AB0B 2EICA 3PHSA 4RMTA 2Z91A 4LQFH 1EV2E 2JJVA 4GXVH 5A2IH 5IP4A 3OKEA 4LOUD 4HBCL 3RY4A 4OGYH 5TE7L 1LK3L 4IEFB 3CMGA 1YYLL 4YHIA 2AV1B 4MXWH 5F6HI 1EAPA 4X6EB 3MUGB 1Q72L 2DMBA 4S1DD 1ZOXA 3WNPA 5I1KL 3MLTA 2OMNA 2QSCH 2I27N 1E4XL 2XQYK 4W6XB 3HE6B 1EJOH 3GGWB 1N0XH 4XC1H 3BGFB 1YYML 5D7LD 4GG6E 1X5JA 3MX0A 1CFSB 3BO8A 1S7UA 1T2QH 3HUJA 2BVPA 1ZT4A 5J1AB 3DHMA 5D7LE 5B38A 5CP7B 3CZFA 5T33H 4YHPA 4N9GA 5A3ID 1P9MC 1A1MA 1AHWB 4QHKJ 5ANMB 1MLBB 3MBEB 2R2BB 1ACYL 5TPWH 1E4KA 1JPST 3EYQD 3EOBA 3WIHA 3HZKA 5CFHA 4MVBD 4PRNA 4WEBL 4F7CB 3BE1H 3HC3L 2HFTA 3MYJB 1NGXB 2YD5A 3TYFA 1ORSB 3ZT6A 3GMRB 2FL5A 3M1BB 4JFPB 4MAYA 5LBSL 4JG1L 5AG9A 5GS0L 4M5YL 4LPCA 3QUMB 3WKML 4ZNEA 4Q6IC 3JXAA 4X6CA 1CXFA 2DYPB 1XGPA 4ONOA 1GPOH 3KYMA 3G5ZB 3PV6A 4KKNA 2RIKA 4FMFA 5EOQH 2YKLH 1JMXA 3KHQA 3O6LH 2FGWL 5E2WL 5FM4A 3DX7A 4MA3B 4OZFA 4PJGB 5DJ6B 4JFZH 1WZKA 5JXED 3VG0L 2P7TA 2W60B 5EU7C 2JJWA 5KS9A 5CIPB 4FQ2H 4UBDC 5CCKH 1FLRH 3MRIA 4C56E 3ULVF 1UC6A 2OP4H 2EYRB 1T66D 4R4BA 4LSTH 3WXVL 2VZSA 5CBEB 5J56B 2QR0B 4R7DB 1A9BB 1HHIB 4UILH 2C3VA 1HHHB 5D2NB 3VG9B 3P4MB 1CBVH 4FQXD 1GIGL 1S7SB 4FFWC 5FDWA 1T89C 1Q0XL 1QA9A 2FBJH 2PO6A 2MNUA 3QAZB 3QYCA 1QRNA 2XXMB 3EJYD 2Z92B 1DP0A 1F4HA 3IDMA 4ZUSA 2YPKB 5SWSB 1AIFA 2Y5EA 4PB9H 1YEHH 1I9JH 5SWQA 3LY6A 4X9FA 1SJHA 4HJ0D 3E1F1 4GW1A 1WWBX 4GLRI 1NGQH 5EWIH 1BFOB 4IRJD 3HNVL 1UM4H 2QADD 4EI5B 3P2TA 1T7XA 4XX1E 3TO2B 1FAIL 3OB0K 3TVMD 4A6YH 4KZDL 3VFGL 1MHHA 1TITA 4G5ZH 4K8RL 5CEXA 3AFLA 4X7TB 3OAYH 4P46A 1I3UA 4GS7B 3W5NA 2ZUWA 4JHAL 3DO3A 2CRYA 4P4RA 2UY6A 1OTSD 4NM8L 3JV5A 2JJSC 4HIIA 1BM3L 1HINL 4TOYH 1LD9B 4XZUA 5T3XH 3CH1A 3G6JA 1MHEB 3SDYL 4Z7WE 5MEND 3S35H 1CU4L 1BAFL 4DKFL 2IQ9L 1C16A 2JKXA 4I2XE 5ILTH 3QEQB 2FD6H 1PQZA 1GGBL 4DW2H 5MENE 3WJJA 4G6MH 5F97E 4KROC 2PXYB 1A02N 4UT7H 5I1CH 1WC7B 3HNTL 3MODH 2XG4A 4JVPA 3V6BR 1FO0H 1BOYA 1JJUA 3ULUH 3VE0B 5E8OA 4JO4L 5LQBH 3GMNA 2VDKL 3MV01 1DUYA 3D6GA 5I15L 4ZTPH 3AS3A 3VRJB 3B43A 3RWJB 5I1AB 5IVNA 3IDNB 4BZ1L 3UBXA 1P4LA 5HVWA 4WJ5B 5GS2D 4LIQH 1WIPA 3LOWA 3KWWA 1Z0MA 2O5ZL 1ZEAH 4YDJA 3B6SA 4XBEL 5D1QA 1NMCC 5F7YC 2R4RH 5KAQG 4OCRH 4KJPC 4WY7H 2DI7A 5C0BD 4RNRB 3ARGC 5HTSA 5I1JH 2CDFA 5IB3A 5JMOC 1EO5A 3IFNH 5I76A 1OAZH 2XACC 4UQ2B 2XQBH 3EOAB 2JJUA 3ZE0F 1CFVH 1NGYA 3OGCA 5EPMB 5C0BE 3KYAA 1MJUL 5BOPA 5C0BB 5T1MB 5HI4C 4OLVL 2ZCKH 3NFPA 4QYOA 1K3IA 4YNYA 5D1ZA 3UTSD 3ROLA 4LLYA 3LDBC 3SPVB 1OWRM 1SY6H 4WTXA 3GB7B 4GBXC 5D1XC 4KGLA 4AT6A 5C3LD 4LGPB 4QRPA 3UTSE 3UTSB 4RGOH 4D3CH 3LS4L 3SDAA 4NJ9L 4PJCF 4NUGH 4KQ3H 5BVJA 1FVDB 4P5MA 4G7YH 3VXTA 4ISVB 4ELME 3UPAA 4ELMB 5DJDB 4P4KA 1KSRA 1U95B 4R2GB 3V4VH 5BRZD 1E27B 3MNVB 4MSWB 2ZSVB 1QQDB 3PE9A 3FZUC 5KTEL 1HKLH 1NBYB 1T21B 5BRZE 4W81A 1R0AH 2YBRA 5BRZB 2ICEB 4LMQE 2BVQA 1MI5B 3BIAX 3TN0C 4X0KB 1WAAE 3WFBH 4GMTL 2M2DA 3MR9B 1KB5A 4NOFA 2ENYA 3W81A 4DOHE 1YNTB 5IM7A 4ETQB 5I30L 4GW5A 4N5ED 5IHUH 5FOBB 4D0CB 1XR9B 4F7EB 1IAMA 1HYSD 3BDYL 5C07D 5MEPB 3MRHB 2EEBA 2QQNL 3PL6A 4HK0A 3BPOC 5AWNL 4F37K 1MCRA 3O45A 3RWFA 1Z9OA 5C07E 4UUJA 3C6SB 2UZIH 3NFSL 5C07B 4NZTH 3DV4B 1ONQA 5HYSB 4L8SB 3QO1A 5BZDA 1MWAA 3V6OC 3OXSA 4WV1C 4U1IB 2LU3A 4KKBC 4JY5L 2JK5B 3SE4A 1D5MA 3R4DA 3KPLA 5J57B 3RVWD 4KI1A 4OLEA 2Y06H 2A38A 4MGXA 3QEUB 2Y5TB 1NBZA 3LQZB 1B3JA 1I9RL 3FFCA 4D0DA 3KLHC 2W9DL 1MFEL 4JPKH 2HRPH 3LEVL 4XCNA 3BVNB 4PJBB 3ZE1E 4PRBB 3TT1L 5F96H 1CVRA 2NW3A 1WV7T 3QQ3B 4WEMB 4AJ0A 5FO8A 4X6BB 1KT2A 3RZWA 3U36A 5I1EH 5GGRB 1D6EA 1YEGH 1WICA 4M61A 4NC1C 3V2AR 1T83A 2R0WH 1JF1A 2MSPA 1M05A 1IL1B 3B5HA 3EIFA 1ZHNA 3LKRB 1RQ5A 2Q7YB 4XMKL 2XRAH 3VD9A 1UM5L 2WZPD 5D7IB 1WTGT 3BQUD 3LZFL 2X10A 1AXTH 4J6RL 4OM1H 1PX3A 2OLDA 5KSBE 1I8IA 3OHXA 2YUVA 2EE9A 5EO1B 3QB7C 5FGSA 1KJ2B 2APXA 2NY7H 4B5EA 3RIFF 3QI9C 4NN6B 2QHLA 2QQQA 1ZKAA 3EFFB 5C2BH 3VWKC 4AL8H 5DRWB 2NY1B 3ARBC 5F7MC 3UYPA 1J8HD 3ES6B 1HOCB 1P1ZA 1QSED 1Z0NA 1NH6A 1JHKH 1KGCD 4IMKC 5CBAA 2ARJA 4NQCD 2CRIA 4L3AA 2HN7A 3S37X 1DBAH 2B1HH 3EFDL 4UT6H 1J8HE 4ZD3L 1QSEE 1KGCE 1T0PB 5I19L 1JGEA 1G7QA 3DI3B 4PJIE 4J4PD 4NQCE 4NQCB 2Z4QB 3WD5L 5I8KH 5DJYA 4KRPD 2FEDD 5GQBA 3TA3B 3BZ4A 1QFPA 3ZHKA 3WNOA 4HUUA 2WV3A 2AQ1A 4KRPB 2BNRD 3BPLC 2FCBA 1ITCA 2R0KH 3WIHL 5EORL 4I5BA 3QDAA 4H8WH 3MCLH 4KKCC 4HLZG 4ZO9A 4XC3L 4I18C 2BNRE 4H0GA 3PGDA 1Q9WB 1DANU 3D87B 3O6KH 4ORZC 3DI2B 2RQ8A 3PWUB 5JPMB 1QLRB 1R3IL 3ESUF 2HVJA 1KNOB 3MOBH 3D1MC 1CGSH 3LKNA 2F74B 1CYGA 3QNYB 3BP4A 3P9MB 4PV8B 4R7NA 1BF2A 4U1JA 3LRGA 4NCDA 4HIJB 1IT9L 2VDMH 5BW7A 4LSVL 5C6TL 2BY1A 3U82B 3OF6A 3WL9A 2CLZB 2CR6A 3I6KA 2F15A 2Z31A 5CILL 4DZBB 3BXNA 5F7FA 1FVEA 4NO0B 3GRWA 1I8KB 1OWWA 1FN4B 5ADOH 2EIBA 4YBLC 5HDOA 5IMLB 4HKXA 5C7XH 4MZ2A 4MYWB 1BOGB 3AY4A 3O3AB 1G6RA 5AAWA 4HQQH 3V6ZB 1YA5A 3H9SA 3RP1A 4MA8L 2O5YL 5JIHA 2DQEH 5C0DA 3C5JA 2DQCH 2VUYA 3CX2A 3C9NA 1ZGLP 5C0IB 1FRGH 5DJ8A 5SWZA 3WFDH 1FZJA 5JOFB 3C5SA 4M8QA 1S9WA 3WFEL 2E27L 4HGWB 5E6IC 1ORQB 1EGJA 4P2OC 2GW5A 4XRCB 4J8RB 5GRJL 2LVEA 4Z95L 2WK2A 5E2UH 3FB5B 4K3JL 3B5TA 3GSNH 2VZ3A 2Y07H 4N1HB 1NGWA 2R8SL 3DX6B 1GOHA 4M43L 3UC0H 5IFJB 1UA6H 2BMKA 4YBHA 1U41A 5FHAL 4MB3A 2ZPKH 1NCAL 3WDHA 4NZRH 2V17L 3QQ9C 3SBWC 1UB5A 3KPOA 4NRXA 4ELKB 1YEDA 4L8BB 3VFUB 3FB7A 3GBLA 4JN2A 2VDLL 2B1AH 5FKPB 1KCSL 3VDCA 3NIDE 2OJEA 1YEJL 2A6IB 1QVOA 2J88H 4MJ6A 3P3YA 8FABA 2ZSWA 1FNFA 1OGTA 2MPAL 1HHKB 3DUUB 4XBGA 4XMPL 3VFNB 2NZ9C 4GRLB 2AXFB 1TTFA 1N4XL 4P2RD 3GSWA 5HYFA 5ICYB 1PFCA 3PXHA 4CNIA 4BSWB 3FN0L 2OR9L 4WI5A 3V0VA 4RAVA 2YN3A 3X3GL 4OIBA 4HPOH 5ETUB 1CXLA 3WFHB 4P2RE 4WNQA 5B21A 4OB5H 4P2RB 4OM0H 3IYLW 1SJVA 1WT5A 3GIZL 5CHNA 4CMMA 1ZS8A 1FZKB 4YBQD 3SEPA 4JPWL 5FA3B 4OI9A 3U46B 4KVCL 1RI8A 2DRUA 2YUZA 4RFEB 1AY1L 4S1RH 4R96B 2CXGA 4QNPF 3I02B 3HRPA 2BDNL 3IFOB 4P99A 2MMXA 4PJDE 1UWXH 5TGBB 1EK3A 3VFTB 4HK3J 4BZ2L 4H1LG 3SDXF 1X5GA 1WBXB 3O4LB 5I74B 3U7WL 3HCVB 3S96A 1MH5A 5IBTH 1UYWH 3O6FA 4QXUL 2BSRA 3G04B 4DVRL 5ERWB 1X3DA 2QKIA 3PWLB 4LL9A 3QFDA 4NKOB 5IMMA 2X2YA 3O3DB 3FO0H 1RMFL 4Y5VB 9CGTA 3IXAB 2F19H 3SKOB 2R1YA 3DV6A 3HG1B 3KPQB 5DGRA 5ESVB 5I18L 5KVFH 1X4YA 3ZKQD 3I9GH 4LNVA 1XGQA 4EJ1C 4JAMB 1PEWA 1U8IA 43CAB 1KV3A 1HH9A 4KHTH 1C1EL 1OLZA 4DJMA 3MXVH 3T3ME 3K4AA 3C09B 5CJXC 3CDGA 3DMMD 5CKGA 3FAWA 4NQEB 2FJFA 3SCMA 5IF0B 4NWTL 4MNHA 5D7JA 3DX9A 4OLWH 3QIUB 1OAKL 2FX8H 5JW4M 5AUMA 4WTZA 1RUPH 3MROB 4LCYA 5HVHC 4FNLH 4AIZA 3RUGE 4H25B 3L7EA 3THMH 3H6JA 3RUGB 3ALWA 4PR5A 3CFDB 3T4AB 4HW6A 4PJEE 5CEZH 4YZFF 2RJMA 4PJEB 1PBYA 5GS3A 1JNLH 2G9HB 2ATKA 3KXFD 3MJ6A 4IRSA 4L3EA 4NWUL 1MAML 5ADPL 5EBMA 3ARRA 4BQ6A 5CKAA 1MRFL 4YGAB 1KB5L 5CD5D 3ROOB 2DF3A 4DCQB 3M07A 1ERNA 5MI0B 3KXFE 5TF0A 1AE6L 4UMGA 5HHOA 3WHE1 1JWUA 3NZHH 1KTLB 1N59A 4XPGH 3R8QA 1T7YA 1OTTD 4NQUA 4PGCB 4X7SH 3HZYB 3TIDB 4CN1A 1IM9D 2EXYC 3ARFA 3Q0HA 4H1LB 5JW4R 1SEBB 3SHSA 5EUOA 4Y5YA 3FHQA 2Y72A 4AK1A 4UTBL 5LCVH 5B3JE 1F90L 3WLWC 2W0FB 4R3SB 3QIWA 2MOVA 4EIGB 5CJ5A 1MWAL 1KJVB 4F7MB 1LE5A 3C08L 2QHRL 4YQXL 5EBWB 1EVTC 1HILB 3K2MC 4LP5A 4NBXB 2CKBL 4WU5B 5KSVA 4MCZA 1UADC 1UACL 2FSEB 3FT2A 1JRHH 3PUCA 1LK2B 2NY6B 4PV9A 4ODSL 3DYPA 4GRWF 3F65A 1CFNA 3WO3B 2AV7B 1I3GL 1M6OA 5T3XD 4QHNB 1J10A 1KXQE 2X4QB 1F45A 2BRRH 1QSFD 2DM2A 5EIIB 3MA7A 5GJTL 3GHBH 1PD6A 2GAZA 4Y4FD 5E5MA 2DI9A 1R3KA 5T3XE 4F9LA 1PEZA 3FN3A 1T6WA 2NTSP 1QSFE 2HKFL 1JNJA 4PG2C 4U3HA 4XPFH 2G2RB 5HGDA 4U1LA 5F7LB 1I1RA 1ND0A 1TVBA 3OJDA 4XVUD 4GMSH 2HMID 3ULUD 4ZSOA 1MCKA 1U8QA 1IGTA 3DTXA 1EO8L 4U31A 4X5XA 1JPSL 3ULUE 1YNKL 3EJZD 1JI2A 2CK0L 4NKQB 4RDQF 5EIVA 2X4TA 4O02L 1FPTL 2CDEA 3UDWC 4QO1A 5DMGC 1U3YA 4HC1A 3UMTA 4G6JL 1MVFA 4LIQE 3BZFB 4NRYA 5TDOA 3BGMB 3PQYA 1RUKL 4TTDC 4GG8B 2GY5A 1ZT1A 4YDIH 5AZ2H 4HLJA 5EFIA 4BK4A 3RZCB 1R6VA 4LKXB 2X4PB 1NMAL 2FH6A 4NKDB 3SQOL 3DGGA 2XN9D 5BV7H 1Y0LA 1VKXB 1Z9MA 1PKQE 3G08B 4APQA 2XN9E 1T5XA 5DRZB 1IFHL 2V2XA 1WBYA 1U3ZA 4JQVA 3NGBB 4L1DA 3D0LB 3AGVA 1AGEB 1DQLL 3ELAT 4HX1A 2J6EH 2AXGB 4ACPA 4YHMH 4PRHA 4Z18A 3VXPB 3PNWA 4OD2A 2HT4C 2IAMC 3VXOB 1A6PA 2AEWA 2XTLA 3IU3A 5F9OL 5GRVL 4PJ9C 4RFOL 1C08B 1UZ8B 2EIZA 1J0JA 3T8XB 3T2OA 1J1OH 5C0EB 5ELIA 2W9LA 5KSAD 3V5HB 4JANA 4KY1H 1AGCB 3F7VA 2GFBB 4Y7MA 3TPKA 3LEXB 1OPGL 1T0MB 1TVHB 2V5TA 4RRPA 2JIXD 5GGUA 3OB8A 1ACZA 4KJWD 1NSNL 2B0SL 3MFFA 1MSPA 5IW6B 4EXKA 1ZV5A 4OZIA 4S1DC 4P3WA 4ETYA 1VGEH 5E2TL 4RMVA 1U8LA 1NGZB 3REVB 3MRGA 4CKVX 1J0YA 3BEVB 2JIXB 1JGLL 3GRWL 3O0RL 1YN7B 5SV4A 1XF5A 5HI5D 3QUXA 2D7QA 1FE8H 3KLDA 3SY0A 5C0JA 3RTQC 4E41D 4F33A 1OTUD 3KS0J 3NCJL 5IT2L 1A4KB 1G6RL 5DSCA 3WN5C 2X05A 5JHDA 4XNUL 5DZNA 5FEBA 3QHZL 1KPRB 4AEHH 4E41E 4NP4H 4PJAA 2PYEA 4ZOEA 3C5ZD 2X89D 5TH2A 3KPPA 4N0CC 4PLKD 2NR6C 1BREA 1NBVH 2DM4A 4NJAL 4JO3H 4LEXH 4N8CL 1EGJL 4JO2L 2XZQL 1U3HB 2G60L 1TLKA 2VDNL 3RU8H 5HYJB 4FQLL 1G0YR 4PLOB 1OD9A 4KMQA 1A6VH 5L7XL 3RVUC 4WFHD 4HZLB 2AV1A 5F7EH 3CSGA 4X6EA 3MUGA 1DVFB 4Q2ZB 3MJ8B 4U3CA 2DWDB 1HIMH 3NACH 2VOTA 2IFGA 3I84A 4CVZB 2Z93B 3E8UH 1A3LL 1UWGH 3HE6A 1GHFH 3GGWA 5ESQB 4LVNB 1WK0A 4RA0C 5DK3A 3RPIB 2Z9TA 5JXEC 5L9DL 1SJXA 5ALCH 4LARH 4U6HB 4HFWB 5KVGL 1EHLH 4OFYD 1CFSA 1G7PB 4KU1A 1U93B 4X6CF 5T1LD 2NXYD 5J1AA 2B5IB 3T4YB 1T66C 5CP7A 3GHEL 4NC2B 2G5BB 2AK4D 2DAVA 1MRDH 4XVTH 1AHWA 2XKNA 2X1OA 5ANMA 1XCQA 1ZLWK 3RIAK 1LEIB 1CDYA 3MBEA 2R2BA 5I1HH 2ZNWA 3HAEH 2NXYB 3I3EA 3AREA 5CJQL 1HXYA 2F54D 4F7CA 2AK4E 3VW3L 5DWUH 1EO7A 3O3UN 3FL7A 3MYJA 5T3ZL 1ORSA 3GMRA 3F58L 2GJ6B 3M1BA 4JFPA 2YRPA 1D6VL 5K9JL 1BQUA 2F54E 3VMNA 5CLWA 3QUMA 1FHGA 1KJ3L 3L3KB 5FF6B 4HJ0C 1XGYH 5DA4A 3QRGH 5CINH 1IZJA 4KK9C 2DYPA 2FX7L 4WRLA 4IRJC 2WM0A 3RVVC 3G5ZA 2QADC 2SEBB 4L1HA 4Y16B 5LXGH 3RDTD 3U4EB 1NKOA 5C08B 1CG9B 1CTNA 1CXIA 2OS7A 5JW3H 2FATL 4MA3A 4PJGA 1R5IB 5DJ6A 1C12B 3DOSA 3OSKA 5TDPB 4QRTA 2PW1A 1FFRA 2W60A 3RDTB 2HT3C 5TFSH 2V7NB 4LSPL 2XXCB 5CIPA 2APVA 4L29B 4K3DL 1L9NA 3W9EB 1Q9OA 3SE8L 2EYRA 5CBEA 4FZEH 1C5DB 5DFVD 1A9BA 1HHIA 1EFXD 1ZANL 4HFUH 5EZJB 1HHHA 1I3VA 4NCC2 5D2NA 2R0LH 3P4MA 4LAJH 2V5SA 3LAFA 3ILPB 1I75A 4KV5F 3F6IA 2F5BL 4FZ8L 4ZFGH 3WS6A 2AI0H 2Z92A 1FVCA 2YPKA 4NKMB 5SWSA 4EI6B 1G9NC 1BD2B 2DQGH 1LILA 4UIKH 5DFWH 4BFIB 3MRJB 4R4FH 3V4UH 1OARH 3PHOB 2UV3A 4CAGA 3K4ZA 1BFOA 4QHMB 4P23D 2BFVL 1U8MA 1VSCA 1MIEH 2VE6B 4CJ1A 4EI5A 2FEEL 1IC7H 3K2UH 2VXQL 1X5IA 2P43B 1X5KA 3TO2A 1JHTB 1DUZB 4TRPL 4EUPH 4H88H 4PB0L 4P23B 1KN2H 3CLEL 4X7TA 1SVZA 1BQLL 1GC1L 3BDBA 1XF4B 5DURD 3X13B 2VO5A 4L8DA 1KF9B 3LMJL 4GH7B 4LAQL 1MEXL 4OKDA 3TYGH 3CLFH 4ZUTB 1N7ML 1MHEA 1N5AB 1R3HA 4ZTOL 4LCCB 5GXBB 1F8TH 2HG5B 3BYYA 1MPAL 4O9HH 1BGXH 3HMXL 3QEQA 3L5HA 2YPVH 3UJIL 4JN1H 3ZDYE 4M1GH 4UOJA 2PXYA 5GSVB 4Y4HD 1K6QL 2R9HC 1NCCH 4NZUL 3VXMD 1WC7A 4U2ZA 3GIVB 4RGMC 1YN6B 4L4TD 3VFRA 3VE0A 1X4ZA 4YLQT 5A40E 4Y4HB 4FQIH 4HAGA 5ISZB 3VXME 1F4YL 4MDJA 5HHPB 4L4TE 2D9CA 4L4TB 3VRJA 3RWJA 1IBGH 5I1AA 3IDNA 5IGXL 4WJ5A 5GRUL 2X1XR 2MQ3A 1G7IB 3LHPH 4C54A 1P53A 2A6JA 3UTTD 4RNRA 5E70A 5JW5A 3P77B 4ONGL 2Q8BH 3VXNB 5JZ7D 1EDQA 2L7JA 3EOAA 4LLMA 5EPMA 4I48B 4EVNB 2IADB 3DXAB 1XIWA 3UTTB 5C0BA 5T1MA 4C57C 2DQHH 1UEYA 2ZNXA 3DYOA 4N5EC 3SPVA 4P46C 1KIUA 4FXLA 4FFVC 3FMGL 4AIOA 1NAKH 1DFBH 4OGZA 2Z35B 3QDMD 3KYKH 4M02A 1QFWM 2VLJB 4HC1L 3R0MA 4JRYD 3ETBF 4MD4B 1RZIB 4OJFL 1FVDA 4NDMB 3MRCB 2CDGB 1B6DA 1NEZG 3GSUB 4ISVA 3QDMB 4PJHA 1YMHB 3FN9A 1JZ2A 1A2YB 4L9LB 5J4MA 4JRYE 3WJJC 4JRYB 2H8PB 5DJDA 1OAYH 3EO0B 1DLFH 4QWWC 3S9DB 3G5XB 4ZOAA 4PJCB 1E27A 3MNVA 2DLTA 1KYOK 5GHWH 1CK0H 1CFQA 4MSWA 3IAQA 4KJYB 2ZSVA 1QQDA 4QHKI 1NBYA 4HJJH 5BRZA 2ICEA 3VFSA 4ESKA 1MI5A 4QOKA 1NDGB 4X0KA 3INUH 3OKLB 1RJLB 3S88L 3KJ4B 1WAAA 4PP1D 4OFDA 4AG4L 4NT6B 2DQUH 1Z9LA 3MR9A 1TXKA 2XWBB 4YE4H 4UT9L 1KEGL 1A9EB 1YNTA 3CFEB 2NCMA 1RAMA 2Q1EA 1IC4L 5FOBA 4PS4L 5D70H 1XR9A 3Q3GB 4F7EA 2MCPH 3JV4B 4P2QD 5MEPA 3MRHA 6FABL 5EN2B 3QWRA 3HI5H 1OT1A 1DE4A 4GKNB 4U6YB 5E8DH 3LD8C 4P2QE 3VDBA 3JTSB 5D6DA 4JG0H 1G6VK 5CEZD 3BQUC 1H0DB 3DV4A 1NAMH 3CFIC 5HYSA 4L8SA 4O2EB 3Q1SH 1RSFA 4U1IA 4D2NA 2Q20A 4CVUA 2JK5A 1OAXH 2EIEA 4POZC 5CEZE 1UKTA 5IQ7L 3QCUH 1INEL 1FNLA 4Y5XB 4EIZC 1QNZH 2HRLA 4PP2B 3RGVD 2Y5TA 3MV9D 2APBA 3LQZA 1LO3L 1LO5B 5C09B 2XT1B 2ZCLL 5C0GB 2Y1VA 1HCFX 3UEZA 2X4OB 1NEZB 3BVNA 2EC8A 4N9OB 4PJBA 1D9KB 2DKMA 4Y2DA 3MV9E 4V2CB 4PRBA 1MAJA 4X7EC 2DQTH 2IJ0C 4P4KC 4JZJA 1DJSA 3QQ3A 5EZIH 4X6BA 5D72H 4PLJC 1CGTA 5GGRA 1G9MH 3OJVC 4YPJA 3VRLE 15C8L 3GJEB 1CD0A 1PZ5B 4ZXBD 4MQSB 5C0FB 4IIQB 4E5XB 3SE3C 4FXGB 3PP3K 2DOCA 2EC9U 3LKRA 2Q7YA 1MHCB 5L6YH 4K9EL 5BVPL 5EB9A 5D7IA 5KW9L 3IJHB 1HNGA 3RWDB 4KC3B 1WFUA 1W72A 2X4RB 1QKZH 5DUPH 1YQ2A 5F7WC 2NY0D 5BQ7A 3K4DA 5EO1A 1YEKH 4BFBD 5DJ0B 1KJ2A 5IVXB 4HUVB 3IDIB 4P3CH 1IGIH 3PL6C 2E6JA 5J6HB 4JM2B 3EFFA 2NY0B 4XWOC 5DRWA 2FEEI 4YPGA 2ZP0T 3ES6A 1F00I 4WW1B 4OCMC 4UV4H 1IE5A 4OZGE 1BX2B 1CD1B 4LLDB 5I1LB 4LVEA 4JDTH 1OVZA 4KK8D 2LFGA 4KK5C 2VZOA 1VDGA 3JWOL 2OTUB 1NUFA 3AMKA 5I8EB 1MHPH 5DFTA 1PG7H 3QPXH 2Z4QA 2BNQB 1AO7D 1EEZB 4NN7B 1O0VA 3TA3A 2BOCB 1CIDA 5IW1A 2YK1L 4MZ3A 4XNXH 1AO7E 4MS8C 3O3BB 4YXKH 4FQPA 3GNML 4AMKH 1JZ5A 2OR7A 2Q7NA 4QEGA 4NQVB 1W0WB 4ZO7A 5FUOL 3ARXA 2P5WD 3T09A 1T83C 4PUBH 1FBIL 3QUML 1KN4H 5D7SH 3UZVB 1B0RB 1A14H 1QLRA 4QHUB 4M4RA 2J8UE 3GMOB 2P5WE 2J8UB 2P5WB 1KNOA 3BP5B 3N1MC 4HV8B 4MAUL 4P49A 3MBXL 3D5OF 1Q8MA 2F74A 3QNYA 3P9MA 4PV8A 2EDEA 2K9UA 5BV7B 1S7TB 4MHHG 4ODTL 3TO4D 4HIJA 4AM0B 3O4OC 2I60H 1K5NB 3OR6B 4K71C 4K2UL 1F58L 4K3GA 2Z8WC 1ZGLB 2CLZA 2VSCA 3O6ML 2A6DB 4DZBA 5HJ3B 1FFPB 1ZK9A 2YD4A 3TO4B 5TF1L 4NO0A 2YD1A 3U30B 1TPXC 1I8KA 3CNKA 1FN4A 1YJDL 1S7RB 4WIQA 5F7NC 1VPOH 2AEIT 5IMLA 1M1SA 5KOMC 1HEZB 3NTCH 3B3IB 3WKNA 1H8NA 3O3AA 1EIBA 4JKPH 3NN8B 3V6ZA 3PGFL 3FQRB 3SGKA 4WU7A 2AJ3B 5C0IA 1FGNL 3U4AA 5JOFA 5F6IC 5I9QB 3RWCB 1OHQA 4DFIA 2HH0H 4HGWA 1IILE 1ORQA 4NQDD 4M6OH 4XRCA 4J8RA 5CJOH 1XCTB 2KL6A 4OCLC 3L3JB 1G9EA 5TDNB 2CIKB 1R5VB 3FB5A 5I17B 1V3KA 4NQDE 2HTKC 4NNYB 2HFGL 4JPIB 2AJXH 3V7AE 5IFJA 5JHLH 4N0UE 4N0UB 4S1QH 2G5RA 2AJZB 4S1SH 4U1GC 1F97A 4X6DE 5CUSH 1CGYA 1HDMA 1IAIM 3HAEG 4ELKA 2F8VA 1I7RB 4L8BA 4QT5B 1FH5L 2WSKA 4UB0L 4HF5H 1XGUB 1RZFL 2WQ8A 4AEEA 4QY8A 4IDJH 1BVZA 4JM4L 1SYSB 2DQDL 2A6IA 1UWEL 1CT8B 3D9AH 3N1QC 5JW4N 2AJUH 5SV3A 5BW7C 3X3FL 3G9AB 3DUUA 1HHKA 3VFNA 1H5BB 1KCUL 2XA8L 3BKML 4GRLA 1U36A 3V8CA 5JDJA 2AXFA 3U9UB 1MIML 5ICYA 3I2CL 3MNZB 3EO9H 4BSWA 4M7ZC 3S3JA 1UH2A 4QRRD 3U4BH 35C8L 1J0HA 4LSUH 1A6UL 5GGQH 5ETUA 5GGRY 5FUZL 4HWUA 3CC5B 2DIJA 5FCUL 1EAJA 3AY4C 3D2UD 1YNLH 3DMMC 4AEFA 4QRRE 2J5LC 3WSQL 1J5OL 2AVGA 3N06B 4HIXL 1FZKA 1AGFB 3NPSB 1G1YA 5FYJU 4WFFD 3KPSD 3U46A 4P5KB 1FFOB 5KVEH 1NCDL 4CADB 1JPFB 4RFEA 1S9VB 4O5LH 4R96A 4FQCH 3I02A 1X5YA 3AMLA 2IC2A 1J1PH 3KPSB 3IFOA 5TGBA 3VFTA 3T3PF 2QBWA 4MJ2A 4LGRB 1LWRA 1WBXA 4RISH 3O4LA 2BP3A 5D2LE 3TJHC 1LDPL 1SBSL 2NMSA 3BIKB 3HCVA 5D2LB 4WO4D 1TMCB 4OLZH 1I85A 1XT5A 4P2CG 2ADFL 3BGAA 3G04A 4B50A 3VXQB 4YHKL 1B4JH 4Z0BL 3IXTB 5ERWA 4JZOB 3PWLA 3SE9L 4NKOA 4M5ZH 3U2SB 3SDXB 4KVNH 4Y5VA 4WW2F 1Q1JL 2FECL 3KPQA 3HG1A 1CN4A 5DUBB 1V7ML 1D5IL 5IVZB 4CDGC 5GZOD 5I71B 4YXHL 4JAMA 3DBXB 3FKUS 3PDOB 3ZHDA 4EUPG 4LCWB 2W9EH 3FCTB 4XPAH 4F57H 3DVGB 4OLUL 4PBXA 2Q87A 4FABH 4NQEA 2OSLB 3VWJD 5IF0A 4UNUA 1MCPH 3QIUA 3CUPB 1NANI 1YMMD 2AJSH 3WLBA 5FHBL 2C4FT 3VGEA 3LH2H 4H25A 3VWJB 4C58B 1DBKL 3RUGA 4R6UA 1NFDE 1QSZA 2G75B 3CFDA 3T4AA 1NFDB 4MNGE 3CFBB 1YMMB 3WUWG 3WO4C 1WT5C 1KULA 2G9HA 3B2UD 5IG7B 2NXZD 1FG2B 4Y4FC 1NGPH 4GQ9H 2I26N 3ROOA 1KCVL 4DCQA 4JQIL 4DN4L 4DKEH 3DETD 1SM3L 2ICWJ 3JWDL 4P9ML 2J1KA 1B6UA 1KTLA 2A6KB 1CLCA 2P8MB 2YC1B 1UVQB 2WUBL 3HZYA 4PGCA 2YSSB 3TIDA 3UCRA 4H1LA 1SEBA 3QP3A 1H3VA 3MMEB 4HS3B 2VR9A 3MV7D 5BMFH 3VI3E 3O6FC 2W0FA 4HUNB 4R3SA 4E0RB 1P2CB 3FRUB 5L0QB 3MV7E 4Q9RL 1KJVA 5HYQB 5EBWA 4OD1H 4L9DA 1HILA 4XPHL 1DBMH 32C2B 3K0WA 4YDKL 4WU5A 4TULL 4RMQA 4GQPH 4HKBB 5I66B 3CXDL 1I9IL 2FSEA 4OUOA 4Z76B 1LK2A 2NTFB 4Z7VB 4EUPB 5CGMA 1EMTL 2AV7A 4TSCH 4LQ1A 3D18B 4QHNA 4WI8A 4WWKD 4DKDC 3OJ2C 1AC6A 3D85D 5EIIA 3SCMC 2VLRD 5D7JC 3TNNB 1HE7A 1DN2A 5T1DH 1QLFB 3CSBA 1A7QH 1IMHC 4GRWB 1HQRB 4M7LH 1AXIB 2X7LB 3ARTA 4OF6A 2VLRE 2G2RA 3RFZC 5DLMH 1TJGL 2D0HA 2RFXB 5HGGS 3WUWB 1UJ3C 2PW2B 2UWEF 1TETL 1VEOA 2IWGA 3O9WA 4N1CA 5D6CB 4WI7A 4U05A 1BFVL 4QLRA 2CGRH 4G3YL 5IB5B 3VXRB 5LGHH 2MFNA 1Q94B 4CMHC 2KZ1B 4F8TA 4U0RC 4MJID 3WE6B 4JFXA 2E5EA 1P84K 3ARFC 4M3JA 5AG8A 2R69L 4FQHB 5GZNC 2BERA 3BZFA 4FQ1L 2LTQB 3BGMA 2A0LC 2APWA 4MJIE 2E9JA 3P0VL 4MJIB 1ZWIB 3CSPA 4JDVB 4GG8A 4F37F 1IAOB 4U6VL 1J11A 4Z7UE 5CP3A 4DQOL 3SO3B 4KJWC 5D8JL 4KKAC 3HI6H 2EZ0D 3RZCA 3S34H 1MREL 4TUOB 4LKXA 2X4PA 4NKDA 1TZHB 2R29L 3CVHH 3T04D 1MJ8L 3QCVL 1C5CL 2VB5A 3G08A 1PSKH 1ZLUK 1QBLH 3RIFK 1XF2B 3C2AL 4M8VA 5DO2D 5GRXG 1SY6A 4OQTH 1OP9A 3MJ9A 5IROC 4G6KL 3V95A 4A2LA 3UJJH 4J1UB 4XP6H 3G6AB 2FRGP 4DVBB 4RFNC 4F9LC 1AGEA 3QWOB 2OK0L 2ZG1A 2AXGA 3IT8D 3Q2CA 2DLFL 4IMLB 3VXPA 4OZIF 3D48R 4DGIL 3TZVD 3VXOA 4Z5RB 3KPRA 3CU1A 1C08A 1UZ8A 3QUYD 3RL2B 2NX5D 3GEWB 3T8XA 1CS6A 5C0EA 5D96C 3SDDB 3O41B 3V5HA 5J9PB 1AGCA 3HLAB 3LEXA 1T0MA 3UYRH 2NX5B 3DX8A 1TVHA 1P7QD 2ERJB 3S4SG 4DK6A 4D8PB 4LKCA 4YUEL 3GJFH 5E8PB 4DN3L 4HCRL 4PJAF 1CD8A 5IW6A 2ICCA 3REVA 1NGZA 4XMLL 4GKOA 4J3UA 1F6AB 5IFAL 3BEVA 2JIXA 3HPLB 3X11B 3WFCH 3IAGC 1YN7A 1F2QA 1KENH 4D9LH 1P4BL 4JKMA 3MLVL 1RULL 2Y6SC 3QDJD 3BPCB