5H2BB

Structure of a novel antibody g196
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
211
Chain Sequence
NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title G196 epitope tag system: a novel monoclonal antibody, G196, recognizes the small, soluble peptide DLVPR with high affinity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords G196 antibody Heavy chain
total genus 47
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2016-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bB01
5IFHH 4DZ8A 4OB5L 5E9DB 3TEUA 4MJ2A 5GS2D 5D6DA 3T3ME 4APQA 2ICEA 2VUOA 1V3MA 3UTPD 5IGXH 5E08L 4HIEA 2DICA 4OUOA 3MJ7A 3Q5OA 4AM0A 3QIUA 5TF1H 5IW1B 1F2XK 1MCOL 4FXLA 1QA9B 3SPVB 3QULA 1F58H 3PWUB 4ZDHA 2PCPA 1DVFB 1A14H 4K3DL 5FYKD 3I2CL 5I1GH 3EYOB 4D0CA 5BMFL 2I9LB 2X1XR 2Y23A 5CAYB 3DYPA 1NGPH 1T83A 4UB0L 1C5BH 2W9LA 3D2UB 5FYKE 3RIFK 1ORSA 3T4YB 2CK0H 3M1BA 2X10A 1A6AB 3QJFB 3JUZA 3ZO0A 5ITFA 3F8UB 1PKOA 1CGSL 4Q9BA 2A9NL 2ZOLA 2XN9A 2F54B 2J3SA 2O5YL 1IGFL 4LLYA 4GRMA 4DVRL 4X9BA 4UT9H 3IAGC 1H3VA 3VD3A 1XCQA 5KSBE 1NGXB 4K94C 4XNUL 3RUGF 2YC1A 4AEIH 1KT2B 1YJDH 1ZVSB 4X9HA 5HSFA 2P47B 2YPLD 3CD4A 1IGJA 1MCSA 3ZE2E 2PYED 4JO4L 1NUFA 4I77L 4HIEB 4WU7A 3OB0K 1KPRB 3FOLB 2PYEE 4ZFGL 3O2VL 2R2EA 2JB6B 2HWZH 2YPKA 1N5AA 1CT8A 4DAGH 4PJ8C 5ADPH 5DLML 4OZHA 4JN1L 4XGZA 1L0QA 1ZMYA 4YNYA 4ZXBC 4BZ2H 2BVPB 4XBPA 3G5XB 1IL1B 1WBZA 2IAMA 4XMKH 4MDJA 4NDMA 3MBXL 2OJEA 2ADFL 3G04B 3EJZD 1A7QH 2AQ3A 4PRIE 3ARBC 2VTFA 3BPCB 4Z8FH 5IP4A 5CEXA 5MP6H 2RFXB 4Q6IB 5FCUH 1T1XB 4RQQB 3TBVA 4G8EA 3TN0B 1HINH 2X1OA 3MZGB 1GGCH 5J6GA 1R3IL 2VDNH 4MS8C 4ZNEA 1ZE3C 1ZWIB 4Q2ZA 4RWYH 4RX4D 4QHKJ 3O4LA 3B2UC 4JFQA 2G5BA 3FRPA 5DHXB 5EPMB 1QHOA 4X9FA 3AB0B 1TPXC 4FQ1L 4LVEA 5FYKH 2EC8A 1WZMA 4G80A 3O3DA 4RIRA 2HFTA 3GIZL 5SWSB 4ZFOA 1NJ9B 4JO3L 1S9WB 4RMUA 1AQDB 2OSLB 1BOYA 2YRZA 4F37F 2XN9E 4WV1C 3LN5A 2P49B 3GHEL 4U1IA 3MJGX 5IB5B 3MRPB 4JHZA 4LSQH 4TTDD 3TBTA 4CADA 1AY1H 4D8PB 4PLKC 3Q2CA 4QOKE 3SGDH 4MAUH 3O2DA 4N1HB 3JWOC 3SQBA 5BW7A 2V5RA 5BW7C 2PR4H 1ZT7A 4ODVL 4KK6D 5LGJA 1AQKL 4JM2A 2EYTA 2EXYD 3MRHB 4FFWD 1TCRA 1BZ7B 1N4XL 4PBXA 3EKCA 2A6IB 5EBWB 3KYNB 2FX9H 2PW2B 1KNOB 2ZUYA 3T0WA 4Z77B 1K85A 4F58L 4GH7B 4DVBA 8FABB 2CJUL 4LSSH 1KJ2H 1HI6B 4G8GA 4PRNA 3MCLL 1EEZA 1F3DJ 3ALXA 1QFHA 4LDEB 2Y5TA 1V7NL 4YBQD 5L8JB 3DIFA 3U2SB 4J4PD 4L4TA 2ID5A 4WUUA 5F71A 1DQTA 5C08B 3EYVA 4LPXA 5ESAB 3RNKB 3L3IB 4DKFH 3C5ZC 1FIEA 5E2JA 1BM3L 2P8MA 2NYYC 1WFOA 4R4FH 4ZS6C 2EDKA 3GSUA 3UTZB 3SBWA 4HUKB 3ZTJH 1NFDF 1YMMB 4XAKE 3T77B 3OAYH 3RWJB 5EU7E 4XWOC 4HWZA 4PJGB 5E2TL 1MJ8L 1PYWA 5ADOH 3NPZB 1KEGL 4MLSA 3QPQD 5C0ND 3PJSA 5CZVH 2G9HA 3SDXB 2EKSB 5GGVH 1UCBL 4QWWC 2R0WH 2Q76B 5GGSA 3TVMD 5KOMC 5ANMB 4ONGL 2EC9U 3QFDA 3T0BA 1IGIL 2AV7B 4F15C 3BQUC 4KROB 5T1KD 5JR1H 5HHXH 4ELME 3X11B 3LD8C 5FGBA 4PY8J 4WW1A 4YDKL 5T1MB 4AG4L 4KV5F 1Z5LA 5EOQH 5JA8B 3ZHKA 5BO1H 1YMMD 1UCTA 2YN5A 1ZV5A 1FZKA 2EXWD 3UZVB 1INQB 1DVFD 1IQDB 3FOMA 3GI9H 4IMKC 4NM4H 1Z3GH 4QTIH 5C07A 3TO4B 5JORA 2K7QA 5CZVL 1GGIL 2H8PA 2VH5H 4PY7B 1H0DA 4ETQA 4P3CH 1JI2A 1BQLH 3BKML 5ACLA 4DQOH 1TPXB 1IM9A 1G9NH 1AO7D 1UWXK 2VKWA 3X13A 2BHZA 4HFWA 1L7TL 4M8QB 2MJWA 3OKEA 1KIRA 1NFKA 4OZHE 4DOHB 1WFTA 4OIAA 3O0RH 2P5EE 5EIQA 1T21A 3WN5B 2UZIL 3OR6B 4N0CC 2ADFH 2XA8H 4RSVA 5ALCL 5D1ZD 2DBJA 1RULL 3P3YA 3QUYD 1VGKB 3G5VA 4LSPL 1ZOXA 2W92A 2EIEA 1FFNA 4MD5A 1R3KA 4LCCB 1U8NB 4KK5D 2DM3A 3RHWK 1G9NL 1VFBA 1O5DT 1QFWL 2YMXH 2GSGB 3BW9A 5EA0L 1XGRA 1MCRA 2KQMA 4KRLB 4L8DB 3W5MA 2EO9A 4P46B 3O6FC 1LDPH 1QPPA 4G6ML 4OGAC 4PRBA 3OKDA 2PO6A 3DVIA 5FUZL 1IZJA 1YEIL 3PIQA 2BY3A 2W9EL 1NDGB 1CXEA 4P23D 5DA4A 3LV3B 4OCNC 4UQ3B 1IGFH 2O5YH 5K33A 5KSUB 3K46A 2VABB 4S0SD 3EJJX 2AK4B 2VSDA 3KYNA 2AXFB 4KY1L 4P4KB 1UM4L 1MNUH 4CVZB 5EIIB 4PJBB 5MEPB 4XTRC 5I1LB 5EUOE 5CKGA 4OZ4B 2YXMA 4GKNB 5HGHB 4WFFD 1JPGB 3CH1A 1BBDH 2E7LC 1R3JA 1EEQA 4I3RL 2R0KH 1A14L 2R0ZH 1YC7A 3OXRA 5CGYC 1FBIL 1M7DB 2YD7A 4JO3H 3IS1X 3ARTA 1GCFA 4F8QA 5EO1A 1TLKA 1YECL 5BOPA 4LCUB 4PGCA 4RAVA 4UTBH 1HYRC 4XAWL 4FQXC 4ZXBA 4NHCH 2QQLH 3FAWA 2IGFL 4R4ND 1E6OL 2FHFA 1BWMA 3QCVL 2GTWB 3IJHB 4LPCA 4XPFH 4PJBE 4YXHL 4EXKA 1C08B 1CLZH 1G7PB 1V05A 3DRQA 3EGSB 4LLVB 4WUKL 5EBLB 4PPTA 4BZ1H 3RUGE 5I16A 1XR9A 1GGCL 3VXUE 4F7PA 4WFEE 4JFQB 3VCLB 1Y18B 3G08B 5FB8B 3NVQA 3RRQA 5IJVB 4JQIL 3PDOB 4WCYH 2ATKB 5GS1B 4H1LA 3DMMA 3VRLF 1DLHA 1QLFA 4UZGA 5D1XA 4OLXH 2O5ZH 4UV4L 3WBDA 1FFPA 1FN4A 1OD9A 3C8HA 4PLOB 3H9YA 4Y4KB 4LSSL 3BPCA 4X99B 5DC0A 4NRXA 3QQ9D 5IW6B 2QSQA 5EU5B 1FL5B 3QDMD 4JDZA 4PJ5D 5F9JA 3RHWF 4NPYA 4XBGA 1TVBB 2JB5L 2WINB 3L95B 4C55A 5E2VH 4Y16A 3WNPA 5GPRA 5ERWA 4YAQA 4K07A 4JG0H 3QDJE 5DJ6B 3VJ6A 3B9DA 3OKLA 1B3JA 3HZYB 4S1RH 4XNUH 3WXWH 4DW2L 4QRTB 4B7IA 1OTUD 4OZFA 5I66A 2GW5A 3MV7B 5A3ID 1KC5L 2D03L 1XGQB 3T0DA 1U8LA 3QQ4A 3DX8A 2YEZB 2Q7YB 2M2DA 3MGTB 1XF3B 2NTSP 1CXIA 4XHQA 3T3MF 5DSCA 5EDXA 1U8IB 3V4VH 1JTPA 5J0BA 1CDJA 5L6YH 3HAEB 4QRSA 1KIPB 4NYLB 1CFVH 5E6YA 3QNZB 4L8SB 4GXUM 3FONA 4N8VB 4N0UB 3L9RA 3MACH 5SWSD 3UJTH 3RTQA 5JW3H 4X7DC 1MCPH 4LASH 1DE4B 4NN6B 3K2UH 1UACL 4U33A 1D6VL 4OZIF 4G9FE 3ZT6A 3UROR 1KGCE 4PD4K 3QBTB 3ZDXF 4I18B 1IBGL 1GH7A 4OSUL 3DSFH 1V7MH 2R69H 1I7TA 1A7QL 1IC1A 2I07B 1LEGB 2DLEA 4JHBA 5ICZA 1BQHG 1TZHA 2HT2C 3C9NB 5GGTH 5GSRA 4WDIB 4XP4L 4ESKA 4NUGL 3K80A 2WLZA 3BW9B 4G5ZH 4NO5B 2AS5M 4XPFL 1FL3B 4PREA 2HWZL 5MERB 1R5IA 3JV4B 4WI5A 3PGFL 2E5EA 2J2ZA 1E27A 2DL9A 3TJEL 3MLRH 5JIHA 4JFZL 1DN2A 3UTSA 4HFUL 2CDEA 3TPUB 4D0BA 3V0AC 4U49A 3CMGA 1ZLUK 1DE4A 1OW0C 3W2DL 4HEME 1FZOA 3D39A 3KLSA 1KIRB 4K7PX 1QBLL 2NY1B 5SV3A 2R23B 4LLUA 2QV2A 3QEGL 3BGFC 3W0WE 1CGSH 1HQ4B 3HE6B 2ARJQ 2EXWC 4JPVH 1DQLL 1X6LA 4QRQA 1JJUA 1TVHB 4Y0GA 3NZHL 2D4FA 1XF3A 4QCIA 2OL3A 2QQLL 4FXGA 5B38A 3QIWC 1R5VB 2AJSL 1WISA 1G6RA 1H8SA 3V8OA 5I66B 4NBZB 3RUGB 1JYVA 5JDJA 1BJ1H 1EMTL 3ESVF 3QRGH 3X11A 4GBXA 5C6PB 1QOKA 1IAIM 3HNSH 3OG4B 2XNAA 3T4AB 4PJ7E 1VCAA 2BFVL 3QIBA 1XGYH 4DN4L 5CP7A 1PG7H 3GSNB 1CL7I 4C58B 2AJXL 1C16B 3BD3A 3BT2L 5FGSA 2CR3A 2HJFB 5HDBE 2NXZD 1B2WL 4LQFH 2HTKD 5GS2H 1F4AA 4YHML 4EUPH 1HDMB 4ODHH 1U0QA 4I2XB 3KYMA 3TO4D 1PYWB 2JK5B 4WW2B 1GZQB 4Y89A 3BH8B 2B0SL 2EE9A 4R4BB 3SOBH 5IWLC 5KZCB 4LOUC 4RMVA 4NQSA 5D7JA 5J06A 1JZ6A 3PDOA 2R4SL 3B2VL 2Z91A 5HYJA 3BWUC 2VC2H 4JFPB 3U83A 4G6MH 3KPSD 1CQKA 1S5IH 3QG6B 4ZTPH 2ZNXA 1NEUA 1ZTXL 1NLBL 1CGWA 4U1HB 1M6OB 3KWWB 4OCRL 3EDDA 1I1AD 3BEVA 4QHMB 1XAUA 4S0TD 3NIFE 3D39E 3VD7A 4JQVC 4YGAB 3CFEB 1PSKL 4PGCB 3I50L 4IEFB 4HV8B 1R3LB 3NCYP 2C9AA 4WY7H 4XP5H 5F7WC 5C09E 4CU7A 5CEZE 4MJ4A 4OKDA 1A7RH 1CG9A 2PXYC 2H9GB 1OF2A 1E28B 5K9KB 4GJTB 5F7YC 2X4QA 3SDAA 4OM0L 1XMWA 2XWBA 5EC1B 2LFGA 4D0DB 2CRYA 4U6YA 4ZSOE 2FR4B 3AM8A 1CD1B 3RPIB 2XI9A 2MSPA 4LDOB 3HB3D 5DD3L 4Y1AA 1KENL 1JWSB 3IS0X 2ZKHL 2HRLA 1Q0XH 1GYAA 3CFDB 1J8HA 1DN0A 1B90A 3KJ4B 4I13B 2FO4A 3VFWB 2GJZB 4NBYB 3BUYA 4XRCA 3STZB 3QUXB 3TBSB 3MQIA 3LB6D 2OQJA 2FB4L 4PRDB 2BVUA 4ZD3H 3R06B 4YIQB 1AQDA 3KPTA 4YDKH 1I1AC 4HWBA 1NAMB 2VLME 4BQ9A 3FB5B 4JN2A 4WI3A 1ZLSL 1OAZH 4YBLC 4XPTH 5FUOL 3CC5A 3ARFA 1RUPH 2IQ9L 2DRUA 1PZUB 4MCYA 5J9PA 3MFFA 5FO7B 1CXLA 2ZJSL 3HRZA 5FF6B 5F6IB 3ZT7A 2WUBL 1IC4H 1UB5B 3KPSB 4TULL 4WW2F 4F8TA 1JNLL 1IAIL 1QBMH 3T2PA 4LPVA 1T7WA 2FHBA 4XPAH 1ZA3B 1VKXB 1PG7X 4LHJB 3VI3E 4P9HC 1KCSH 1W72L 1JGLL 1RJLA 3MRRA 1H3PL 5HVFB 3ARGD 2MPAL 4WI2A 4MA1B 5GGQH 1JHLL 4YBQC 1W0YT 5DMJB 4GKOA 3G6JE 1LE9B 3VFSB 5JXAH 3T0EB 2ESVB 2AW2A 4NKMA 3IJYA 4YPGB 2JB6A 2G5RA 2XPGA 5C0GA 3STZA 4IRJC 1AD9B 5C0BD 2FO4B 3MUJA 4KDTA 4YDIL 2J8UE 2WBJA 2Z35B 4P2QB 3LY6A 4U6XA 1FHGA 5KTEL 1R5VA 5GISL 3CCHB 3DMMD 3QIWB 4XCFH 2IADB 3S35H 3QA3A 3QUYC 5C0DB 4G6KH 1J0JA 1J8HE 4N5ED 3FO1A 4F33A 2FX7L 2DQIL 1KF9B 1JIBA 4PUBH 5D1QA 2DYPA 5F7HA 2AK1L 3BMVA 3HI6H 2F54A 3T0EE 1UXSA 5F3BA 2A6JA 5C6TH 4M5YH 3U36A 2Q76A 4TRPH 3PQYA 4KPHH 4R96B 4LLAA 1K4CA 1TCMA 4F3FA 1AIFA 1NH6A 4AZ8A 4NZRL 1OY3B 5IVXB 1G6RH 3B3IA 1AY1L 2DQJH 1T66C 1NUGA 1HWGB 4GAJL 4IDJH 4D9RD 2CDEB 3TPUA 4D0BB 1I1RA 1LO5B 1T89C 4JO2L 1CE1L 2DQGL 4PJGF 5I1KL 4F9LC 2BOBB 1S7XA 3KXFB 3TA3B 4Z8FL 3SPVA 4Z7QF 4TOYL 2PW1A 4NKOA 5L7XH 4OV5A 4GXVL 2I9TA 4HLZG 1J5OL 4DUWA 1FC1A 3A6BL 4AM0B 4ZOCA 2H2PD 2KKQA 3V5HB 2OM5A 5HYJE 5DQDL 2Q7NA 2KPNA 4MA7L 3RWFA 2JK5A 4WW2A 4WFFE 3DV4A 2V6HA 4HX1A 1V3LA 5FHAL 4TSAH 2IH3B 3HLAB 2XA3A 3HG1D 5IT2L 2BDNH 2C7UB 4QWWD 2ADGA 1EEZB 1YYLL 4ZTPL 4PJFF 2KUTA 5FCUL 3MV9B 2PO6D 3B2VH 2BMKB 1D9KC 1R5WA 3ROLB 2D7TH 4RFNB 4F33B 2E7CA 5HTSA 3CFIC 2G60L 4TUJA 1UACH 4EIZC 2V2TA 4LAQL 5I76B 3SY0A 5CCKL 4GMSH 1T0NA 4CNIA 3RZCA 5B38B 2AEPL 2YD1A 4BFGA 3DTXA 5L2KA 5D93C 1IKFL 5H37G 4UB0H 4P5KA 4K7PL 3F62A 3ZKNC 1LO4L 3MUZ1 5JIPA 3MLUH 2FX8H 1I3UA 4FQXB 4GKZA 2W60A 3PV7A 4ZUWA 2CLRA 1JK8A 5HGAB 3RWIB 2VXUL 2R1XB 1ZHBB 1T22B 1FPTL 5TGBB 3VFSA 2L7UA 2V5YA 5AG8A 7CGTA 3HZYA 2VZ3A 5IW3A 5E8DH 3OKNA 3W11D 3W11C 2D9QB 5E6ID 4K9EH 3GMPA 5E95B 4Y5VB 4NZDA 3MROB 2IAND 3MLZH 1MREL 2GK2A 4NPYB 4P2RD 1DFBL 4DGYH 2DQUL 4RGMB 5E99H 3KS0J 2WIIA 2B1HH 4U7KA 4ZFFB 4HUVA 1GPOH 1L4IA 2ICWJ 5F9AC 3R0NA 4NRXB 5EOTA 5F6IC 3HHRB 5IB3B 4UTAH 4F7MB 4JRXB 3QUML 3KVQA 2NTFA 1TJGL 4R7DA 3UZEA 4PJ7F 1HHGA 2NLJA 4Q9QL 3HNVL 3L3OB 4PJ9A 5CZKA 4QKXB 1A1MB 1BVKB 1U8KA 4GAYB 3RPKA 3S8WA 2ADIB 2QQKH 5F96L 2LE9A 1IM3B 1J87A 1YQ2A 1JHKL 3CSGA 2RGSA 5IHLB 3CFKB 5IVOA 5C09B 3PDDA 4YE4H 3QUXC 4HZAA 2HH0H 3BUYB 3T65B 3OR7B 2GJZA 1RIUH 1RZIA 1KPVA 3MNWB 1S7SA 4XWOD 5IB1B 3RVXC 3U7WH 3NAAL 3UMTA 3S5LA 5FO8B 2Y6SC 1KXQE 3BRFA 4MA3B 1KFAH 5C0RH 3X3GL 2A6DB 4L8SA 4G8GE 3CK0L 5TPWL 3C8KA 2XFXB 3ES6A 3D5OF 4JANA 3I02A 4XVJL 3H9SE 4XC1L 2Z93B 4H5SB 4UNUA 2APVA 1F4YL 3C5ZD 1U2HA 5JW3L 5HXMA 1CCZA 3ME0A 5D7IF 2OLDA 1EDQA 3CDGA 1BLNB 3QJHB 2AK4A 3QRFM 2Y72A 4I0PA 4H0HB 4EQ3A 3OKLB 1GRWA 4O9HH 1WC7B 2X09A 4G7VH 5FHBL 1I7RB 4OGAD 1JF6A 3FO1B 1OTSC 2A9ML 1EO8H 4Z7VB 1J0KA 1Q38A 1WCBB 3RVWC 5HHMB 1N2RA 4OCMC 3LD8B 1KJ3H 5HI5D 2IADA 4NWUH 4OF7A 4WENB 3MLYH 3V6BR 3O2DL 4LCIL 3BQUB 4TYUA 4NGHH 5K9JH 1HHGB 5A43C 3H9HB 3ABZA 1YQVL 4P2QA 2GJ6E 4R4BA 1JCKA 1UA6L 4L4TE 4DEPC 1MI5D 4M7LT 3VGGA 4LLMA 4I8DA 2WBKA 4OZGE 2CDFB 2CIIB 3UBXG 3K4ZA 1HHKA 3BZ4A 4R97B 3G5VB 3SKJL 2XZCL 3FQTA 4ZFFA 1TFHA 2C1PA 5C0FA 3EYFB 3LKRB 3F7YA 3T3PF 2X44D 5DVLA 4NUJA 3JVGA 1X5HA 5JOFB 5F1IA 4JGMA 5H94A 3E2HC 3GMPB 1CFTB 4YUEH 2XXMB 2FNBA 5EORH 2FJGB 1J5OH 4KTDL 4U1SA 4WIQA 3CFCL 5IHZB 4YDJA 5JDSB 1PGRB 4KRPD 3MXVH 1ZHLA 1JGUH 5I0ZA 1FLRL 4MGXA 1RZ7H 4PY7A 5KJRH 1A47A 4U1LA 2CLRB 3DI2B 3HRZB 4EZMA 3JWDH 5J9PB 4Y2DC 4BZ1L 3NA9H 3HPJB 4MS8D 2DWEB 4E41E 1CDGA 5L2KE 4A6YA 1JYXA 2JCCB 3HI6L 3MBEC 3ULUE 4OV5B 5KS9A 3DPBA 1X5JA 4NKOB 4LEXH 3VGAB 5C86A 3RDTD 4MD4A 3KPOA 3LIZL 2XTJB 5HD8C 2DQIH 2HT3C 4L4VE 3PWVA 4YHIA 5GGTA 1E0OB 4DK6A 1LO5A 1QYGH 1JTTA 2DI7A 5DA0B 3TH4T 4MSWA 1G9EA 1VERA 3SCMD 3IDGA 4RFOH 5DGQA 4XRCB 3S3SA 3OQ3B 1T1WA 4E42A 4ERSL 1ZA6B 3VXNB 4NM8L 2G75A 3STBA 1B4RA 4HX1B 3ZE1E 4G6AC 2B4CH 3ARQA 3EUUA 3MCKB 5CEYB 1FNFA 1A4JA 5DI8B 3TYFA 4K8RH 3BAEL 5EH1A 2J88L 4PREB 3H3PL 1SEBB 1XGRB 1T2QH 5HPMB 3QI9B 1DEDA 1Q9OB 2X9YA 2NMSA 3V5HA 3MNVA 3GK8H 2IQAA 3WDIA 1JZ5A 2KBGA 4KHTH 1U8NA 1GIGL 5FDYA 2IH1B 1I8IB 1AHWA 1CTNA 1NAML 3ILPB 2I07A 2IAMD 3TA3A 4KQ3L 3CFEA 3SJVD 4HKZB 1WZ1H 1G7HB 2R0LL 1GAFL 4NO2B 2BVOB 4OCXL 1IGTB 3SBWC 2MWCA 4FN0A 1AD9A 3BEVB 1QG3A 5FKPA 1QBML 1QSED 4NN6C 1CD9B 2GY5A 2NW2B 4YFEA 4LU5L 3SCMA 4F3FB 1L9MA 2BY0A 5IVXF 3TLRA 5I19L 1BJ1J 1UVQB 3UAJD 2AABH 5DURB 5HVHB 3L9RB 2KL6A 4PJXA 3U0TB 2JJSC 3F5WB 5HYQB 4G3YH 1VA9A 2APXA 4EI5D 4M43H 4NQSB 4IRSB 4AH2B 2EIZB 4LVNC 1J1OL 1J0YA 5FYLD 1WBXA 1UG9A 5EUKB 2R39A 3WKNA 3VWJA 5CJ5A 1UQSA 1C12A 1G7MA 4EIGB 3R8BB 4W6WB 2WP3T 1IGMH 3WYRA 1YPZF 1RZGA 3IJSB 4JFDA 5DMKA 3MV7A 4POUB 2J7LA 4XCYB 1S8DA 4NNYA 5DFWH 1N0LA 3FO2B 1RJYA 3SJVA 3F7PC 4QXWA 1FRGH 4QRPE 4BYHA 1FQ9C 3TV3L 3W5NA 3N1FC 1KTRL 4WV1B 3NH7H 1AGEA 4OT1L 2QR0B 3Q48A 3D85D 4Y16B 5KG9A 3MRCA 4OGZA 4POYA 2HT3D 1MLCA 3CU7A 1X7QB 2DOCA 4JM2D 4X4YB 5IW6A 4S1QH 4D9LH 4K8RD 3RX8A 4DCQA 5EO9B 1FFPB 5ITBL 2A77H 3DXAE 4HDIB 1MQKH 1L9NA 1T89A 2NNAB 5LG1A 5BCAA 2NCMA 1FFOB 1IGIH 1AI1H 1JWSA 2X4UA 2FO1A 5JUEH 1HH9B 3C2SA 3MV7D 1TJHL 1UCBH 3IFLL 3PWJA 5HGDA 1M7IA 4OLUH 4NQEB 2V9QA 2P7TB 1N0XL 4ZYKA 2C3VB 3FQXA 4GKSA 4P4RA 3MLXH 3L7EA 4U4BA 1C5CH 1UZ8B 4M62H 1HINL 3P0YH 3QT2A 4P99A 5E6IC 3H9ZA 5F9WB 2AGJL 3C60B 4EN3B 1FVEA 5IESH 3KPRE 1CICA 4LL9A 3WLBA 4X98A 2F53E 3CXDL 2BNRA 1FVEB 4G8GB 2Q8AL 1A1OA 3CSYA 1QHPA 1YNLL 5JQHC 1FSKC 5E1HB 5CD3B 5FYKU 5JLZB 3KWWA 2KDGA 4R3SA 3WFCH 1CTOA 4YGVB 1FH5L 3LAFA 1B2WH 4WU7B 5AYQA 5B4MC 5CGYD 5KSBF 4O51B 3NIDF 4FQLL 1IGJB 2HN7B 4Z9KB 3OV6A 2WQRA 2CMRH 3IDMB 3LEYH 4MXVF 5BV7L 3LRGA 3Q3GA 2I60L 3D9AL 1G1CA 3VXMA 2FR4A 3IDXH 3OX8A 3KPQB 2CPCA 1DUZA 5DJ8A 5I8CA 4R90H 2AI0L 4G6AD 4A2MA 4KKBD 1OF2B 2C5DC 3I3EA 4N0CD 1KCVL 2VAJA 3QRGL 1MCLA 2B20A 4FA8A 4CMHC 4G42B 3SKMA 4HV8A 2HT4C 2H26B 1CYGA 4MD4B 1J11A 2VDPL 5TFSH 4LAJH 5EZIH 3W9DA 5CJ8A 5I1AA 2W0LA 4FMFA 1D5ZA 3HI5H 2X4RA 3QDGE 1IFHH 3QNZA 2NY6D 4TTGA 4WU5A 4ZPVA 2R29H 3PQYD 1HHIB 4XPGH 2VXTH 5J13B 2AEQH 1DVFC 4QNPF 1NGZA 5DD0L 3UTTE 4JREC 3D6GA 4M7KH 4XWGL 3PQYE 1A8JH 1AXTH 5DMIL 2NY1D 4NJAL 3FFDB 4OCXH 2EIDA 4G7YL 2IFFH 4XCYA 1GAFH 1U91A 4XHJD 2A6KA 1INDH 1PKQA 1VGKA 3NACL 1I4FB 4JHAL 4MAYD 1KOAA 4L3ED 4GG6A 4OBSA 4WHYG 5A3IC 4KTYA 1FIGH 3GK8L 2BNUB 1J1PH 4YH6A 5E9DD 1JZ4A 3ARBA 2X2YA 5E6ZA 2GCYB 3I3DA 5BS0E 1E4XL 4HGKC 2IBZY 2VLRE 2XQBL 4UV7H 4LLUB 4NDMB 3VGHA 4PJXB 3GJFB 1TVDA 4N8CL 1ZVHA 1IM9B 3EDEA 4GUPB 3QWRA 1JRHH 1RVFL 2BNRE 2GFBA 4YFLF 2H8PB 1EA9C 2YPKB 2Z31B 2PTVA 1MHPL 3Q5TA 5ELIA 4R26H 1XF5B 1CXFA 3LZFH 2R8SH 1XH3B 3MLTA 4R7NB 3X14B 3ZMRA 1MHEA 5INDA 4BA8A 3BDXA 3BQUA 5FHBH 4P59H 1KT2A 5JPMB 4QCIB 2SEBA 4KROC 2HLAB 2R9HC 1KN2L 5ADPL 1REIA 1OB1B 1OTSD 5J1SC 3EFFB 3EIFA 3KGRA 3GBNL 2Z0BA 1FRGL 1QSEB 2DDQH 1DANU 1F4WL 5F44A 4HMCA 3V9FA 3WNOA 3Q6FB 2A73B 3IKCA 3L1OL 4PJXF 3TBWA 4RMQA 2DQFA 1NCTA 4PRPB 1RPQA 1RZ7L 4JR9H 4M93C 3HMWL 2QBWA 5MENE 3H42H 5DUMH 4M6ML 4OI7A 1JF5A 1IAMA 3ARGC 3VE0A 5DVKA 3BN9C 3AY4C 2WM0A 4ZUTB 1RUQH 2FIKA 4QXTA 4N0UA 5AZ2H 5FCSH 1BBJA 3DLQR 1BIIB 3NFSL 5IW1A 4WI9A 3GBNH 2A9NH 4OZ4A 2CRZA 3NOIA 4NOBA 4L9DA 1IE5A 4EN3D 2F53B 5IROC 4QRPB 1KPVB 4PLKD 5ETUB 5HHME 2OS7A 3O6ML 4RAUB 3IFNL 3WJLA 4OD3H 4MHHI 4I0PC 2Z8SA 2FYYA 3T2OA 3G6DH 2W91A 5GXBB 4XP6H 1ZGLM 1E4XI 4H8WC 1U92B 3HNVH 4W6YB 4LSVH 2DD8L 3ZKMD 1IM3A 2GSIB 1MRFL 2F8VA 5E8OB 1F13A 4PJ9D 4WEMB 4JY6B 3MLYL 4LIQL 1YMHB 2BNQB 4L1DA 1HSAB 5H8DA 3KPRA 3MRLA 4X4XA 4X7TB 3LQAH 1EO8L 3SE3A 3LKNB 3TT1H 5DRXB 2NTFB 2KZ1B 1SBSL 3CLFH 3MRGA 4X6CB 35C8L 3PF2A 3DO3A 4JB9H 4PJFA 1TCRB 2AJXH 3D1MC 5BJTB 3QQ9C 4K3EH 1OAUH 5I18H 5GRYA 4O58L 4NYLA 1KV3A 4QRSB 2GEEA 3MRFB 3QUZA 4NQEE 3PL6B 1YEJH 8CGTA 2NQCA 2VZSA 5TQ0H 1MWAL 1OGAB 1F4YH 3B9KC 2BJMH 1KLGB 2YPLA 4XVJH 2PYEA 2MKWA 4XAWH 4NO0B 4UTBL 2ATKA 3PABA 3LN5B 1T1YA 2AJSH 1CDIA 3GJEA 5EBGA 4PJHF 1JGEA 5K9QG 3HCVA 1GXEA 1NJ9A 1LO4H 2X05A 4L9LA 1PD6A 3UJJH 3MUGB 1NC2B 3VXUB 2R1XA 5DD0H 1BJ8A 1I3VA 4XI5D 4LMQE 5IFAH 3TZVC 1OB1A 5ALBH 5F9OH 4G80B 1OP3H 1N7ML 1IFHL 3MCG1 3OBAA 5C07B 2VLKA 3AXLA 3QZWB 4RMTA 1VFAA 2PUQT 4UT6H 5AZ2L 1UM6H 4IRSD 5JPMA 4XCNB 4GBXC 1VPOH 3N0PB 1UM4H 3C6LA 4N0UE 3TH3T 5IFAL 1JUFA 1MHEB 1I75A 4EUPB 1Q9LA 1NGWB 1F45A 3REVA 3VDCA 3QUZD 1AFVL 3G6JA 4BKLB 2HT2D 2MQ3A 1PKQE 3RFZC 5F1KC 5F89A 4NQCA 5ANMA 5BV7H 3MX0A 1XF2B 3GSWA 3DO7A 3SDYL 1UGNA 3RX7A 1NDMB 4KMTL 5D5MB 5AUMB 5IWLA 1FVCB 2Q1EA 5FYJH 1DDHB 1QSFA 1CN4A 4D94A 1J05B 4LVOC 4MCZB 1DP0A 2EDTA 1YNLH 3MRLB 4X7TA 1OAKH 4MQSB 3VG0H 4ZFOL 5E24E 1SY6A 5HYFA 1AE6H 1I8MA 2VQTA 2Z8VC 2HG5A 3T77A 1Q0YL 5AAWA 4K9EL 1WSST 4LRNL 4JDVA 1AR2A 1EJOL 2R8SL 3LZFL 1FNGA 1SQ2N 5F1OB 1VEOA 2EH8L 1DBKL 4PBVC 5FYJE 4J1UA 5E4EC 1S7XB 4X4ME 2Q20A 2NY3C 4ODUB 5AYUL 1HHIA 1M4KA 3S3PA 1KJVB 5HYSB 4PV9A 2FECI 1KB5B 1NC4A 3CH1B 3HE7A 5C9KA 3QAZB 2LV4A 4MJIE 1IEBB 1ES0B 4DQOL 1FE8H 2C3GA 1CFSB 4ZG1A 2MNUA 1DUYB 4UINL 1I9EA 5I1LA 4ZUSA 2Y5TB 1YYMH 2VDRH 3DNKA 1RI8A 4X5XA 2XY1A 1QFUH 3IFPB 5L8LB 2EC9T 4JE4B 4LRIA 1HI6A 3I9GL 4JVUA 4KHXH 5SWZE 1QNZH 1MCKA 3ULUH 3NACH 1KJMA 5I8CB 4OUUA 3RU8H 1A22B 2BNQD 2CO7B 1AXTL 4HFWB 3GSXB 4LGRB 2V7NB 5FOBB 1CDUA 3GUTB 3HC0A 2XZAL 2DIBA 3M8OL 1K5NA 5LCVL 4H8WH 2W60B 2VL5B 5DJDB 4BFIA 2A0LC 3VXRE 3DUSA 4R3SB 1TXKA 2V2XB 3H0TA 5C0AE 3MRPA 2P24B 3JWDC 3HFMH 12E8L 4CNIB 1FNSH 4I48B 4CU6A 4A2LA 4K7FA 5IM7B 5I17A 4HCRH 3UAJC 1IT9L 2VITA 3CLEL 5CIPH 5D96B 4P5TA 3DROB 1A7NL 1MI5B 4QNPE 3T8XA 1BZ9A 1IC4L 1BF2A 1V8HA 3CVHL 4RGMC 3QWOA 2H32A 5JTWA 5DJZB 4R26L 5ABDE 2DLTA 5GGSB 5DT1L 3VFGL 3EO1B 4YBHA 4G6FD 2AABL 3QDJB 1U36A 4U1GC 5E7FA 1PZ5A 2GCYA 4LNRB 1FFOA 3F65A 3SKOB 5LVEA 2DQUH 4XPTL 1XR8B 3TF7C 2JJSA 3DX7A 4GG6B 3RWHB 3V5KA 1CR9H 4L5FH 1RK1A 5E8PB 3P0VL 4X4YA 2A6KB 2FB4H 1E4KC 3GRWH 4QYOA 2NYYD 4X7FC 3RZCD 1SJEA 4Y5XA 1HWHB 2LVEA 3DXAD 2X70A 5IHUL 4R2GB 1INDL 2P5WA 2AV7A 2LTQB 4PG2A 2HAZA 4J4PC 4XNZB 5C0EA 3UYRL 4P5TD 1WT5C 4B53A 1QPXA 3N1QC 1IC5H 5I6XC 2NY0D 2NY7H 4PLJC 1J12A 4HSQA 1RJZA 3CX5K 5JXAL 5TDNA 2CRMA 2M26A 1QZ1A 4U1NB 3SDCA 1JN6A 3FT4B 2K3TA 3HS0B 4POZC 3VWJB 4PRID 3PP4H 5EU3A 4AY0A 3A6OA 4MJ6A 1K6QH 2AI0H 5I74C 4KJPD 4MNQE 4WHDA 4RISL 4NC0B 5IV2A 5D8JH 2NXYB 5ANME 4K3HA 4NC1E 3O9WC 2FHCA 4UAOC 4QHMA 5C0EB 3LH2H 5GRVL 2BVOA 4U1IB 3MOBH 3HR5B 3IJYB 2ADJB 3BJLA 1FLRH 4F2MA 3BESR 3HI1A 2YWZA 1EHLH 5B3JE 5D2LA 3V7AG 3ARDC 1R3IH 2VDNL 4MQXD 5JQ6H 1MY5A 1JBJA 4GXVH 4YEEA 3ILQC 3Q1SH 3EO0B 4LRNH 2ZPKL 1L6XA 3B9KD 4LARL 3O3BB 3UEZA 1EHLL 3SDCD 2ICEB 2OMBA 2DQGH 4LFHG 1NGQH 3FN0H 1ZA3A 3GSRA 1L7TH 1KCUH 2MTPA 3RJDA 1WEJH 1ZANL 2DQJL 4WO4B 3A6CL 2C3WA 4BZ2L 2W9DL 1Z2KA 3T2QA 2XZZA 4HIXH 5A2KH 3U4BL 4JFYA 3T08A 4KPHL 4S1DD 1LNUA 3JBG7 5EU6A 3RA7L 5ACZB 3SE9L 3V4UL 1UYWH 3TBVB 4PGBB 1CZ8H 1MIEH 5EO9A 1A3LH 3VXMD 1AGDB 5FYLH 3SDXF 4YWGH 5L0QC 4K3JL 3L3JB 4P5TB 2BY2A 3FO0L 4KKCD 3WIHA 1SJHA 1FGVL 4IRJA 5ITBH 5HHNB 3VXME 4Y4HA 3GHBH 4OIBA 4L9LC 1FC2D 1A7PH 2X89A 3RUGA 5DHYB 3I50H 3O6FD 5FO9B 4KJQC 4ELKB 1T2QL 2K1MA 3FJTA 5AZEL 3V5KB 1N5AB 4M9OA 1TZGL 1WAAA 2J5LC 4KJYA 5GRUH 4TVPE 1XR8A 4ZNEE 4Q97A 2GI7A 4LHUB 4X7SH 1QRNA 4OCRH 1ZWIA 3BGMB 3UYOD 4QRRB 4QTHB 5DR5L 4Z7UA 4LSTH 3E1F1 4G8EB 3AS2A 1CK0H 1MCHA 1NGXA 1T1XA 2JKXA 5KSAB 1AKJB 4K3DH 3U9UB 1JGDB 3JUYA 1YEDB 4U1KB 3G04A 3FT3B 4BZYA 2VXQL 2EDNA 4BUGA 4N90D 3CZJA 2CUHA 2V2WA 5I17B 2UWEB 5TE7L 2ZOLB 2QHRL 4JZJA 2FIRT 4M43L 4XBEL 3MGAA 1KB5L 1DUYA 1ORSB 3PWNA 3T4YA 5I18L 1HHKB 5DGRA 3S88H 1BPVA 4QLRA 3SE4A 1R5IB 2Y1VA 5CWSA 4YE4L 3H0TB 5D2NE 4DN4H 4AL8L 3CDYA 3EYQD 4OLZL 3BHBB 4ZOAA 2FRGP 4OIIL 4LLWB 4WGVB 5D7JC 2DQCH 3BYTA 3JSSA 4HUMB 4P9MH 2WV3A 1HILB 4WJ5A 5LGKA 3VRJA 2BRRL 3GSXA 4JFPA 1P4IL 4Z6AT 4LSUH 1MEXH 1JVKA 2Y7QA 1MRFH 3MNVB 5D7JB 4X6CE 3MUHL 3TCXA 2V17L 4NN7B 5SWZB 5BQ7B 5D7LE 3JV0A 1LO2L 2XZQH 5T1KB 2XN9B 5FKAB 3CDGB 2AJUL 4QXUH 1RJZB 3LDBB 3H3PH 4I3GA 1QFWM 4JRYD 5D2NB 4HS8L 1CQYA 1W0VA 1A7OL 3KR3L 4MAYB 4DK3A 5HI4C 2I9LA 1MLBA 4MVBD 3WS3A 5KVEL 4KJPC 4PJBF 2AV1A 4CBPA 3BIKA 5DMGD 3B6SB 4J7RA 3MV8E 3ZHLA 4J3WA 1S7VA 3CVIL 3U79A 4NP4L 4HFUH 3EJYC 4EUPA 5TQ2H 2JCCA 3S5LB 3S4SA 5FO8A 1G6RB 1HHHA 4QHNA 3AAZB 4B0MM 1S7QB 2NXZB 4JLRA 2NY6B 1NC4D 1HIMH 3LN4A 1PG7W 5MEQB 4G9DB 3ULVC 1MH5B 2IANA 4G5ZL 3RVUC 4UDTA 5ERWB 3AROA 5IQ9A 1NLBH 3UTSD 3L3KA 3R1GH 1S9KC 5A40E 1U8KB 1DLFH 4YPJA 4KKLD 4C56D 4PJCF 5IR1A 3M17B 2XYCA 2AQ2A 3RWGB 5HYIA 5MP6L 4PB0L 4HIJB 4NRYA 4Y4KA 5BV7C 5KSVB 2B5IB 4QHLA 4EI6B 3CFCH 3D0VB 3GI8L 4KTDH 3U4AA 5DC9B 2XTJD 1DLHB 1MPAH 4PJAF 3OAUL 2BHYA 1JL8A 5C0FB 2PETA 1N3NB 1OL0A 5GGVY 3O81A 4U7SA 4FXKA 4XX1E 5DLMH 1BOGB 2YHGA 4KMTH 1MFEH 4YZFE 5FECB 4O5LL 3GSRB 2HKFH 2DJUA 4WWKD 1J88A 4BH8B 4X6CA 4M03A 3I84A 3P9LA 2NW3B 5ISZB 1ETZA 3EOBB 4JO4H 3BKCL 1ZSDA 3ARDD 1ODAA 3RVWD 1RFDL 5C3TA 3SE8H 2IEPA 1KLFA 3KPMA 4E0RA 3L3KB 4PJCB 3V0WH 4KZDL 3DGGA 5CP3A 5GRJH 4UDTB 4UUJB 4E5XA 2HVKB 4ZUWB 4LCIH 4PTUB 5E00B 1UM6L 2YPVL 1P5UA 1XIWC 1Y6NR 3P40A 3QXTA 3SGKA 2P1YA 4JPVL 4OFVA 3ROOA 2HRPL 1V5JA 1C5BL 4QXGH 1EHXA 3HC3L 1LGVA 3HAEA 3BIKB 3GMMB 4P2OD 5B22A 1KTDA 4HJJH 1FCGA 2P4AB 1MJ7L 5IOPB 4UQ3A 1DEEB 1RK0B 4JY6A 5JZ7C 2WUCL 3VFRA 3S96B 5C8JB 4LLDA 2ZG1A 1RV6X 3FCTB 2DMBA 1U92A 2DTSA 3WHXA 4NQUA 1Q72L 5IEKB 4O5LH 4XNZC 1CGYA 5F1NB 1ZHNA 4LF3A 1QSFD 3SE3C 3S88L 1ETZB 3H9SA 4W70A 3UC0H 4ORGB 4CVXB 3GSVB 4HUWA 1VFBB 1DDHA 1EJ6A 1QSFB 3QUKB 1Q8MA 5CD5C 5ALCH 5DRZB 1TMCB 2AJ3B 4ZSOA 5SWZD 1U8PB 4NQCB 5EU4A 2R69L 4F7TB 1JMXA 3O6LH 1X5KA 4LSVL 4U1MA 2WSKA 5EG6C 5GGRB 2GK0B 2BY1A 5DJAA 3GBML 3I6KA 1ZAGA 4JRXA 4PJEB 4GBXD 1NGWA 1UB6B 4EI5C 4TSAL 5DK0A 2VH5L 1BECA 4L29B 4NC2B 1NCWL 2ZJSH 5I73B 4U3HA 1IC7H 3Q6FA 3MSPA 4NM4L 4LRIC 2WLYA 1OCWL 4O2CA 2VLKB 1ADQH 4DWHA 3QR2A 5HPOA 5AZEH 4FQQB 4F7EA 4K3GA 5D96C 5F88A 1CS6A 5F72S 3VFTB 5KSAA 2OTUB 3TO4A 2Z92A 1NC2A 3VXUA 2A77L 5ESVA 1MREH 2BSRB 3AMKA 4IDLA 5C0DA 1IJ9A 5LXGL 2E3VA 3WO3B 3GMQA 2ORBL 5HVWA 5I8KH 4N0FA 4ZD3L 3BISA 2W9EH 4I48A 3S4SB 3HB3C 4M9PA 4PRIB 4EVNB 2DYPD 4M1CC 5E1AB 2F19H 4ONFL 3UPRB 2OR9H 4P5KB 1LO3H 1ONQA 5T1DH 1B0GA 1A6PA 2GJJA 5DRWA 5EIVA 1TTFA 1YNTB 4GW5A 2F74B 4JZNB 5D7KD 3L5WB 1A7BA 1EEUA 3L6FA 4K8RC 1H15A 3E6HA 1XGUA 2XZQL 4K7PH 4NQXA 1KCUL 2D7NA 4GXUN 3U4EB 1P9MA 1WFUA 2NX5A 4LHQB 5GS1C 4P9HL 1R24B 4N68A 1RJLB 3MRRB 3QIBC 3WNMA 3RWEB 4L4JA 3L5XH 5HD8D 3VD4A 1TJIL 3NCMA 3ARWA 1HH6A 1KBGL 3PWPD 4TNWK 4P48A 3NIFF 3FN9A 1A21A 2BOCA 5DFVD 1UB5A 1CFQB 3KPNA 1U91B 5LAXB 1ZXQA 4JFXA 4MCYB 4Y1AD 3BP4A 4X8XA 3SHSA 5E5RB 1E4XH 3QCUL 1CLZL 3O3BA 5H2BB 3BHBA 4KRPB 4DZBB 1UADC 4WU5B 3QCVH 2VC2L 4L4TB 3EZJB 1ZEAL 4FQJL 1KJ2L 2NXZC 3VXQA 2X1PA 3DYMA 5E7BA 3HUJB 4GQ9H 3H2WA 1FNLA 4XCEB 4PRNB 1MHCA 3VFPA 4KJWD 4MNGB 4LSTL 5DZNA 5C70A 3HZKA 5EZJA 1J05A 1R24A 2R0KL 4P4KC 5FK9B 4M8QA 4HK0A 4NQXB 3DVNA 3HI5L 1G7QA 1NANH 4KGJA 1RHHB 3DV6A 4ETQB 3WMSA 3PHSA 3MPCA 3IDIB 5J1TC 5EC1A 1OWRM 5FUOH 3QUZC 3OJDA 3IKKA 1CLCA 4LHUA 4M5YL 1IQDA 3FOMB 2XN9D 3UP1A 5KVGL 2Q8BH 2EH7H 1EMTH 3SDCC 3QA3B 2IBZX 1AHWC 5I1EH 4X98B 1JUFB 4HGWB 4NQTA 2HVJA 3IAQA 3WUZA 1YEIH 5J6HB 3AUVA 5GGUA 2VDOL 2WWKO 2HKHL 5A16A 3T3PE 4EN3A 1RJCA 4PJFE 5ESVB 4IMLA 1LDPL 4WTXA 4IIQC 4S2SA 3VFTA 4R8WH 4ZUVA 3M45A 5B39A 2Y36L 1NBQA 5KTEH 3L5HA 3H8NA 1BGXL 1OWWA 4BQBA 3H7BA 4L4VB 3MUGA 1HKFA 1H3XA 3D39D 3UDWA 4XP9H 3WN5C 4P2OB 3L3GA 3HE6C 2E27L 5DK0B 4ODSL 3ARYA 4R2GD 4AT6B 3CZFA 5GZOD 1YN6B 1FNEA 2ICWB 1MWAA 3BH8A 3IB4A 2NY1C 1X5ZA 4WEUD 3UZQA 3ZL4L 1QD0A 5D7SL 2VXSL 1MJJA 3CU1A 1KIUA 2CLVA 3X12A 4OCLC 5IKCA 4O4YL 5CIPA 4PJCE 4OM1H 4TVPD 2D7QA 2QJDA 4YX2H 1BQLL 1PVHA 3HG1B 3QWOB 5FM4A 4GW1A 4I77H 1DL7L 4XAKD 4NO3A 1Z3GL 2KH2B 1G7JA 1CIDA 4AMKH 5IBUB 2DIJA 3GDBA 4AIZA 1UM5L 2XWJA 3DSFL 5J6HA 3R06A 4YIQA 5C8JA 4K2UH 2JJUA 3S96A 5DQJB 3NCYS 2ORBH 1U8HB 2OL3B 1K8DB 3FB7A 5TJWK 2XIDA 2X42A 1P1ZB 4WTWA 1Q1JH 2DIAA 2MMXA 2N4IA 1MCDA 4PB9L 5JW4R 1Q9OA 3RP1A 4GRLD 1MHHA 1DUZB 5DJ8B 4IRSA 4O9HL 3VRIB 4HULB 4Z7QE 3GRWA 2E9WA 1BZ7A 1L0YA 4PD4J 1OCWH 2IG2H 5IMKA 1Y6MR 5CEYA 5K9OA 5MEOA 3UYRH 3BN9D 4BSJA 2R1WA 1KXTB 3G5ZA 1KJMB 2NY4B 3SKNA 5DDHA 1E28A 1TQCC 3OGCB 1U3HB 2WIMA 5J1AA 2PCPB 1CR9L 4C57C 1KEMH 4TSCH 2AJZB 1M05A 5SWSA 3BD5A 3X17A 3CIQA 5KSBB 4JJHA 3QSKB 1K3IA 5D7LD 1BHGA 1TTGA 3MJ7B 2W07A 1KB5A 1NC4B 3NAAH 4RMRA 2NY5L 3UC0L 5MENB 5DEGA 1DR9A 4KK6C 1VADA 5E9DA 4P49A 1G9MC 2YXFA 3DX6B 3MCKA 4KMLB 1MRCL 3O45B 1YPZE 4BELD 4JFFA 2FJHB 5D7IE 2W65A 5GS0D 2A83B 5TDPB 5EO0B 5CINL 5IHZA 4FFVD 1LEKB 4U1SB 4WHYH 3OJMB 4HJJL 2VR5A 3QQ3B 5ESQB 1RUKH 4XVSL 3PWVB 4ODWB 2D7MA 1QKZL 1C1EH 4PJ7A 2NX5B 3TP4A 4ENEC 4GFTB 3QUMH 1R0AH 3ARUA 1XGUB 1A2YB 3K74B 5HDOA 4QXGL 2QSTA 1T6VN 3MO1A 1QSVA 1WWCA 2CKBH 4A6YB 2IANB 5E99L 4AJ0A 3LKOB 5I71B 2R9HD 4D9RE 2GJ6A 3QQ4B 3FMGL 5BS0A 3S37L 1NCBL 4CMMA 1AO7B 4OZGA 1LD9A 4JFDB 2MKLC 3DXAB 5BS0B 4UOW1 1QNZL 4YDJB 4MXWL 1HEZB 5DTFB 5E5MA 4M7LH 4NNPH 3EYQC 5TQ0L 2GY7B 3OAZK 4QRQB 4MZ3A 1WAAF 2EIZA 4JRWA 1NCBH 1I7RA 5FGCE 1CLOH 6FABL 1MLBB 4FG6D 3WS3B 4NZJA 5INCB 1X5IA 1MOEA 2EECA 1F6LL 3NFNA 3MXWH 1W0VB 1XFPA 2FH8A 3NZHH 1F3DH 1ZLWK 3ARED 1TIUA 1M7XA 2G2RB 4XVUC 2EH8H 1AKJD 5JW5A 5HYSA 2JJVA 4LIQH 3TO2A 3VGDA 4YUEL 4DN3H 3DOSA 3KPQA 4M3JA 2Y7QB 5CUSH 2XFXA 4PJAB 5F6HJ 1M1SA 1I3RA 4OI8A 2IH1A 1U3ZA 4JFFE 2APFA 2QKIA 3ZKXB 1IEAB 5HI5C 5MENA 5EUOA 1WC7A 2NZ9C 3MRKB 1MRDL 4OM1L 1NANI 3TYGL 4Q9RH 4N0YH 3O2VH 1BD2E 3O6FB 5KSBA 4OQTH 4U0RB 3PWNB 3MJ8A 4AK1A 3QHZH 3WLBB 4HHAA 5J1AB 3HZMA 3Q6GL 4QRUB 2P5EB 3MJ6A 4I0KA 4C4KT 3CVIH 2HA1A 4I5BB 4H88L 1KJ3L 3FQWB 4U1KA 1YEDA 3BJ91 1N6QL 3Q0HA 4W68A 2C3VA 2QADB 4DN3L 1D7FA 3QHFH 1A4KA 1CU4H 3QNYB 2ED8A 3LS5L 1GL4B 1A7OH 2UZXB 4PGJA 5IMKB 5F97E 3OWEA 4BH7A 1MAMH 4PJIA 1DBJH 4JQXC 4C56B 1BGXH 1HNFA 1NPUA 4TVPL 3C08L 1FORL 2E6PA 2P8PB 4M6NH 4XP1L 1NEZA 3OKKA 5BRZB 4P5MB 4IS6A 1CGXA 4X9IA 3WIIH 1XGQA 4PUBL 4P59L 2VR9A 3I3BA 3S36H 2HVKA 1AR1D 5IVXE 4AG4H 3D0LA 1MFDL 1ZHLB 2VLLB 2D4DA 4XB7A 3UXFA 1BVKA 4GAYA 1JRHI 5IK3B 1G7LB 2DQDH 1YY9C 2I25N 4ZMAT 5B8CA 3PABB 4NJ9L 1YN7B 3KLAB 4Z7VF 3C09B 3DVGB 43C9A 4OIIH 3FFCE 5SWSE 4JFEE 4N8CH 2CIKA 1FNHA 5I1HL 4NZUL 3EYFA 3LKRA 5F9JB 1WTGT 2X7LA 1BQUA 5DMKB 2WIIB 2DQEL 4HUVB 5D1QC 2GAZB 3ULVH 1XH3A 3MLTB 3VWJD 2X4OB 4O4YH 4GLRH 1U42A 2VZTA 2EYSA 5IHBA 1CICD 3CZFB 5D9SA 2VDMH 5J89A 1IKNC 2IALB 2VXSH 1RZKL 5DD5L 2NY2C 3EOYG 2J6EA 3KYKL 3EO0A 3B8YA 2XKUA 1KIQA 4PJEF 5IJVA 5CJQH 1EH9A 3ZE0F 2C7UA 3IFNH 3DRQB 3EGSA 3TZVA 3TN0D 1QRNE 4MQ7A 3SCMB 3U7AA 2VXTL 5KOVC 1KN4H 3G9AB 5E6IA 5CBAA 1I3GL 1INQA 1IGTA 3QHTC 1ZKAA 3IDJA 3DUUB 1FZKB 4LBEA 3PNWA 1D5IL 5DD1L 1RUQL 1II4E 2ZCKH 1VESA 1OAZL 5TE7H 43CAB 1X9QA 3IDUA 3SGJC 4Y2DA 5DUBA 3EYUH 3O3AB 2VDOH 4M4PA 1LILA 1SYVB 4X5WB 5CKAA 3QI9C 2XKSA 1I1YA 2HFEB 5DJXA 3N9GH 1SEBA 3FQUB 5I30H 1CK0L 2H6PB 3MLUL 1QR4A 1FFQA 4Q9CA 5AD0A 3BWAA 2A6DA 2IG2L 1FBIH 5IVXA 2VERN 4FQLH 1BX2B 4PYGA 4OD2B 2AJVL 2VYRE 3GSNH 1JP5A 4V1DB 4X7SL 2OYPA 3U36B 3GI9L 4NQDB 4LAQH 5T1KA 2VABA 4LSQL 5IF0A 4HWZB 2V7HA 2YBRB 4UU9B 3I75B 2EDQA 3CXDH 5IMLB 1LK3L 1G9MH 2FECL 2NZIA 4WWKB 3BRDA 2AEIT 2VAAB 3PIQB 2UZYB 3DWTA 1AGFB 1OTTC 3CMOH 3NFPA 2EE2A 1KULA 1DSFL 1OP9A 2AGJH 4PRBB 3DYOA 4S10A 1RUML 1GGTA 4PJ9B 4JFDD 5E8PA 4K3JH 3VFUB 2FLRT 3GO1L 1KTKE 5FEBA 5DD6A 2VO5A 1TJHH 1FG9C 3SE9H 5GS0L 3CSYB 4NKDA 3V5DA 1EIBA 1P7HL 3U4BH 2GFBB 3S7GA 2E6JA 4YX2L 1J0ZA 3GBMH 4JY5L 3NIGE 1TQCB 2A74B 1NSNH 3FQRB 2R2HA 1FO0B 1UT9A 3V6ZA 5C0JA 3MROA 2ED7A 3WN5A 5D1QB 3MOAL 1N59A 2JCCE 3BZEB 2AVGA 2EEAA 2DB8A 4ZYKB 3MYZA 5I1KH 5I8OL 3ULUC 1HOCB 4S1SL 4YHNB 2R2HB 5J11C 1FG2B 2HLFC 3F7YB 4H25B 1HH9A 1H15B 3E6HB 4N5EC 4M93B 3CCHA 3QIWA 2X4TB 4P2QE 4YHYB 3SDDD 3BZ4B 4ZNCD 4L8BA 1L7IL 1F2QA 3PXHA 1Z6JT 4O2EA 3GMRB 5JORB 3NABL 3MFFB 2DBLL 1MCJA 2DKMA 4AEHL 2V2XA 3U7YH 4NFDA 3B8SA 3DHMA 5J12C 1BVLA 3DTXB 5EZIL 4OGXL 4OLYH 3U9PL 2CLZB 3G9VA 2O5XL 2C1OB 1INEH 4LHUD 3STLB 3DUHA 2N1KA 2JF1A 2IJ0C 1LE9A 3AU1A 4XXDB 5D71L 3Q5YA 1WCBA 5KG9B 3MGOA 2CJUH 4XCFL 2OTUA 4LP4A 2BVQB 1TQBC 3PXJA 4WV1A 4UIMB 1A6ZA 3KJ6H 2H26A 1I85A 1U3HD 4G6JH 1A6WH 4NSKA 4KQ4L 4C83A 3VFWA 3QJHA 1B6DA 2Z31C 3HLAA 2BSTA 1P6AB 4C56A 3VXMB 5FF6A 3EO9H 1MUJB 3DV4B 1CLYL 2EEBA 4Z0BH 4TPRL 4PJGA 25C8L 1D5BA 5KVDL 4WHTB 3QAZC 2P5WE 3FQUA 4PGZA 4IRZL 2MOVA 3ARSA 1FFRA 2MPAH 1XZ0B 4Y88A 4F7CB 1I1FA 3ES6B 3VXSA 3TM6A 3PHQB 4N5UA 3WIHH 1FNGB 2AXHA 4MDJB 3VFVB 5IUSA 4L3EB 5D1ZC 3BKCH 1FZJA 4IOSD 4F2MB 4WWKA 4FQ2L 2FEEI 5F9WC 4OB5H 4I3SH 5E6IB 4JM4H 5LQBL 3LB6C 4RWYL 4Z7WE 5B39G 3KLDA 3O3EB 4EDXB 3RGVC 5J13C 1EAPA 1FVCA 5GGTL 3PQYB 5DFTA 5D1XD 1AHWB 3ILPA 4WI7A 3P4MA 3TPKA 4MJ6B 2DQDL 3RPIA 5E5UB 5F89B 3O8XD 2Z91B 3MLSL 4PYHA 2OMNA 1UWEH 2DI9A 4U6YB 4ZO8A 1Y6KR 4P9HH 1I1YB 2PW2A 4OBRA 3QZWG 5K9QI 4KHXL 3TWCL 2OR7A 1A4JB 5EOTB 4IRJD 1DQML 3DRTB 5T3ZL 4GG6E 2VQ1A 5LBSH 4U6XB 3VXNA 1K2DB 2QQQA 1BF8A 1CGUA 3KNBB 4UDUB 3AXLB 3M07A 5IVZA 1OP3K 2DJ4A 4PG9B 5C0GB 1WWBX 4HKXB 4HPOH 2Y4SA 3QWRD 2ZG2A 2W59A 4H8WL 3F7QA 1YEHL 4FFYH 3M8OH 1QEWA 3V0VA 3SEPA 5I8KL 1M71B 2FCBA 2YPVH 1YJDL 3DURA 3EYUL 1FSKB 2PKDA 4AEIL 2XV6B 2QSVA 1JNHA 3GHEH 3LHPL 3C2AH 4QGYA 1ZSDB 2ENSA 2VR4A 4JAMB 5B21A 5EU6E 2ZCKL 4HF5H 1Z9OA 4OAWA 2ICWI 4GKZB 2DLHA 2NW3A 2YD6A 3WSQL 4APQB 1ADQL 2E9IA 3GIZH 4JFOB 4EN3C 1C12B 3LPFA 3QFJD 1OGAA 4CKVX 3B9KB 3IFOA 3TYGH 3VI4F 5J56B 2BCKB 3DJ9A 4Z78B 1HDMA 5D5MF 5C0IA 2C4FT 3HE6A 4JG0L 4NN5C 4UINH 4PJIB 1T03L 5FO7A 3THML 4KKNA 2VZVA 1BEYH 4HBQA 2WW8A 1JPFB 1T20B 5IJKC 3CSPA 1FV1A 3HR6A 1NCWH 4X6DF 2P44B 3HUJE 1MVUA 3BZFA 2DM2A 2ZSWB 3QIBB 1MI5A 3KYKH 4LPWA 4P2YA 4XMLH 3WFEH 1RZKH 2BX5A 4WFED 5DD5H 5DVMA 4AEEA 3PWLB 4ZODA 5GHWL 3M17A 3D87B 3IDYC 5CJOH 4OLXL 5LGHH 4NO2A 2A83A 5TDPA 3O6LL 1HXYB 5IQ9B 1JNNL 4JQIH 4OFYD 3O45A 3PHOA 4YC2C 4G7VL 1VPOL 2CIIA 1DLFL 4RGOL 5DEZA 2PYFB 3BAEH 4XMKL 4P5MA 2IQAB 4M8VA 4Y16C 1WCQA 2P8PA 2VL5A 1IEAA 4JO1H 3E0GA 4NM8H 4UILL 1OP5K 2XQYK 4FQIL 3HE6D 2FEDC 2H32H 3S3JA 3ZE0E 2J8OA 4WTZG 1UC6A 4Y5YB 5CP3H 2B39A 3OGOE 4Z7VA 4ZUTA 4XVTL 2XWBB 4CVUA 4LP5A 3MRJB 3LIZH 5I9QB 3ULUD 1YA5A 3ZDYF 3P4OA 1J0IA 1MJ7H 3BMWA 1YEFH 2ESVD 3B3IB 4I5BA 3B9AA 5DDHB 2O61A 2BHUA 1IGCL 1BLNA 4KC3B 2H1PH 3M1BB 3QJFA 5DO2D 4B50A 5B3JF 2ESVE 1UJ3A 4EI5B 4DVRH 5ID1B 4N8VA 3MBEB 4EOWL 5BZDA 3IU4H 4N9GB 3BH9B 1NCAH 1CU4L 3V6OC 4NO5A 1NL0L 5DS8B 1RU9L 3IVKA 5JW4M 1DVFA 2EDJA 3TIEA 3PWUA 3MXVL 4ZDHB 2SEBB 1KELL 3VW3H 4HC1L 2HJKA 3SE4C 5CJOL 1I3RB 4K7PY 3WFBH 4MA3A 5DQJA 3FO0H 4FQHB 4C59B 1AH1A 3O3EA 5EZOL 3TO2B 1RMFH 2B1AH 2N56A 5IIEB 4EKXA 3SJVE 5D4QA 5GJTL 4Q9RL 2DQCL 3MLVH 3KYMB 2F8XC 3E2HB 3P0GB 3C8DA 3SDXE 1KJ2A 4M48H 5BOZG 1X3DA 3MO1B 2NY5H 2NPLX 1FYTD 4PJHE 5E2UL 1NDMA 1UEMA 4QF1A 5D5MA 1TVBA 3FN0L 3GSWB 1NGYB 4RAHA 1T5XB 4PJ7B 5JW4N 3FQTB 4HUNB 2GTZB 2P45B 1XEDA 1J1XL 1ZT1A 4OSUH 1BD2A 1IBGH 1T5WA 5KW9H 1YUHA 4WTZA 3DXAA 5FYLE 1EO5A 3R1GL 2PTTA 5C0AA 4Z95L 4JAMA 4RGNC 2ARJB 4KI5E 1CFBA 2IWGA 4HPOL 1XIWB 3WFDH 4JY4A 1T03H 3FAXA 1KCRL 3IT8D 2JCCF 4JPKH 2NR6C 1RUAH 4G8GD 4C4KO 1EVTC 1WZKA 2BVQA 3V4VL 1CDBA 4PJEE 1LP9F 4QRPD 2J4WL 4HWNA 2YZ8A 4PRAA 4PP1C 3W9DB 4AIXA 2ERJB 2GUOB 2D03H 1RZJH 3T0VA 3MA7A 4G42A 1AGDA 1LO0H 2FGWL 3FFCB 2EDRA 5JR1L 3T0XA 1MHPH 3SO3B 3KJ4C 1DTUA 3SKNB 5GRZA 3WS6C 1TETH 4FP8H 2CKBL 2NY7L 3WKML 5FB8A 2B8OT 5I76A 1ZS8A 4WWID 3JV4A 3LQAC 2V2TB 3DVNB 3V4UH 2GITA 3EOAA 4O51A 1CWVA 5GGVL 5FK9A 3VRIA 1OP5H 1EGJH 3AY4A 3VXOB 4JFEA 3ROLA 4XVSH 1RUKL 1HQRA 3T65A 5CD3A 2PXYB 1UWGH 5C0JB 1U8MA 3BP7B 1QQDB 1YY9D 2BNRB 2DLIA 1SMAA 3HUJA 3CFKA 4FNLH 3NN8B 5CJXC 3HI1B 1HHJA 1U2CA 4PP1D 1K8IA 3Q1SL 2PO6B 4BQ6A 1CE1H 4JO2H 2Q6WA 3TJHD 2Q3AA 3BPLB 5L8KB 5DMIH 3C60C 3NZ8B 2FYYB 3B43A 3L7EB 1M7DA 1AGCB 1IQWL 4NT6B 1DJSA 1XZ0A 4JQVA 3PV6B 5IV2B 3BP6A 4KAQL 2N7AA 4JRXD 1ACZA 4LSRH 1UH4A 3TBYB 1EBPA 1BFSA 1WK0A 5K9OB 1IEHA 5T33H 1BBJB 3DBXA 1ZHKB 2CGRH 1B0WA 4FQPA 4JFHE 4Y19E 1ND0A 3PGCB 5E8DL 3B5HA 3ARBD 4RFEA 4KKAD 1CVSC 2VXQH 5HI3D 1KPUB 4JPWH 2E7LA 2Z31D 1AXSB 1FNSL 2DJSA 4OD2A 2HJLB 4AIZB 1XGPB 4YXLL 3D3VB 4XPBL 1UXSB 1Z0NA 4WVRA 3X13B 5F3BB 1EFXD 32C2B 4JKWA 3CSBA 4NN7C 4GW5B 4LCWB 4MWFA 1FH5H 3RZCC 1A6ZB 5CCKH 4MX7B 2AK4D 4X0KA 3FO2A 3SJVB 4XPHL 4XNXH 3AGVA 3QUYA 4XNQA 5HGBA 2D7TL 1T0NB 4GG6F 3I6LE 4JPWL 1A7PL 5D1QD 3HMXL 2FJFB 1MIEL 4JKPH 5I75B 3SGEH 1AGBA 1KCVH 2ZUWA 2IPUK 3FO9A 3QCTL 5DJCB 1C5CL 4M62L 4Z76A 5I73C 4KWUA 5F88B 3IDXL 4IRSC 4P2QD 3MV9A 4KVCH 4MJ5A 2DI8A 1CZ8L 1RHHA 2X6MA 2Y07L 3IRPX 3IYLW 3IFLH 4XCCH 5C0BB 4JZOA 3TJHC 3A6CH 3P4MB 4MA8H 1IAOB 3MV11 3K1DA 1XGPA 1NGQL 4MJ5B 4LIQE 5ENWB 3T1WA 3T8XB 4YJZL 5HYSG 4BUHA 5D7SH 3BZEA 1EPFA 1PAMA 1RULH 2BNUA 2W9DH 4L3CA 1V3KA 1OT1A 1GSMA 5FM5M 4OF3A 5GGRA 1LP9B 4HAFA 5MI0C 4S1SH 4NRZB 4D2NA 3PG2A 3IAPA 4LMQI 4Y5VC 5DJYB 4MQTB 2EDOA 1QLRA 4HWEL 3B2UD 4BJLA 2C3XA 3PHQA 1NFDB 4XB8A 2DN7A 4PIRF 3T1FA 1CE6A 2J5LB 1W8OA 3NCJL 3OXRB 4PRHE 4ORZC 3W82A 3BP6B 1DQQA 2X5PA 3GBLA 1OSZA 4KK9D 3O4LE 1QR1A 3HAEH 5GSRB 5I74B 3WD5L 1X5XA 3FRPG 4PRHD 2AK1H 2UYLB 4K71C 3NFPB 1AI1L 4RISH 3MR9B 1T04A 2VWEE 3TVMC 4IOFC 4ODTH 4CDGC 4I18C 1U93A 3VGEA 1LQSR 1RK0A 1T1WB 4I4WB 3HE7C 1GHFL 2YA1A 3TBSA 4JKPL 1U8MB 4RFEB 3RNQA 3ZKQD 3MJ9H 1U93B 3HNTH 1J8HB 1DN0B 3KPPB 4QT5B 3OZ9H 5A2LH 1BWWA 2NZ9D 1F5WA 5HHOE 3TIDA 1PBYA 3AREA 1ZS8B 2LTQC 3NH7L 3BI9X 5HHOD 1FYHB 3K1KC 4RBPK 1QACA 3IDJB 1FE8L 5CILL 1F8TH 1FDLL 4ZO7A 2NY5C 3NZ8A 2OK0H 2D0HA 5HHMD 1A9EA 2OL3H 3V6OA 4NKMB 1MVFA 2EO1A 3ELAT 5EBMB 1J18A 1NMAH 1LP9A 2UY7A 4YHNA 3IXTB 4WHCA 2X89D 2NXYC 1J1XH 4HK3N 4PJIE 3ZDZE 5EUOB 1D5IH 5DD1H 1KNOA 4Z77A 1CVRA 1YEKL 2OCFD 3VXOA 1FO0A 2ZUQC 2EYSB 4JRYA 4J12A 1SM3L 3RI5F 3GNMH 4M5ZH 2X4OA 2YRPA 3LSOB 3LN9A 4HIHA 4L3AA 4TUKL 3AS1A 4PJAA 2B5IC 3HAEG 2YZ1A 3KPSA 1T1ZA 3V4PH 2BFVH 2EXYC 3E8UL 2ITDB 3KPRD 2PTTB 2RQ8A 3WO4B 5F7DB 1VFMA 3VWJC 4GRLC 4IJ3B 1T7ZA 3NCFB 5DJAB 3UTTB 3V7MA 2F53D 5FM5O 3O8XC 2O93L 4EVNA 4TTDC 2OTWA 4YBLB 2HTLC 2VDML 3GMQB 4KUCF 4Z7OF 4GAGL 3RTQD 5I6XB 4OD3L 5I16B 2VLLA 4LLVA 5EBLA 3ULVL 1UH2A 3HUJF 4XGZB 1S3KL 1HZHH 2LQRA 3T2NL 5D2LF 3BKYL 3GEWB 2XNAB 2DF3A 3QP3A 1OARH 4IS6B 4UT6L 4IOFD 3D3VA 2OJZH 2L0DA 2ZOKA 5F7UA 3ZYZA 3GJEB 3WHE1 2ARJA 4DGVL 4Q0XL 3W2DH 4PTTA 2HTLD 1R3HA 1BZQK 1JGUL 5GS0C 5C0AB 3V0WL 5CGTA 5IOPA 3RJQB 2YUZA 3GZKA 4QEGA 3UDWC 2X4NA 1NEZB 4MB4A 3TIEB 2KZWA 3RAJL 1YYML 2OX5A 1PSKH 3MLRL 1LHZA 3QG7L 5D7LB 5ICXB 1F3RB 1WIOA 3KDMA 4FABL 1R3LA 3KLHD 2BVPA 4U6HB 1YEEH 3MRGB 1A4KB 1NCCH 3QNYA 3LKQB 1F11B 4TVPH 5ACMA 4KTEH 4U31A 1EX0A 2XT1B 1WFNA 3H9SB 1B4JH 2DWDA 4LBEB 5FKAA 1CT8B 3AS3A 4HJ0C 4P2RE 3NA9L 5C08E 2I26N 2YS4A 5CZXC 5IEKA 5ILTL 3QH3B 2E8ZA 35C8H 5SWZA 1S5HA 3IXAB 4PV8B 1T3FA 1ZGLP 5E8OA 2P5EA 3QHFL 4MQ7B 1KTLB 2ADIA 5C71A 4M7JH 5M7QA 4NWUL 1ULVA 2VLRD 5KS9F 3QPXL 4LVOB 4OZFG 3MRKA 2R56H 3J7HA 1XF4A 3QHZL 1KYOJ 3P4NA 1JPSL 2BNRD 1EV2E 4ELMF 2YD9A 1JF1A 2EIBA 4IJ3C 5C6WH 4HUUB 3TC9A 3UTQB 1D5XA 3X3FH 2XZCH 5JMOC 4HMEA 1RHFA 1N8ZA 5KSAD 4OZIB 2WUCH 4X8JA 3AC0A 3PDGA 1OVZA 1H5BC 3PWLA 5CMAA 1Q94A 3JVGC 4BSWB 2V5MA 3MRNA 3DGGB 2IPTH 2R1WB 2FBJL 3A67H 4GBXB 1W72A 4JJ5B 1N7MH 5E03A 4FFYL 2VLRA 3RDTB 1MH5A 5ISZA 2JB5H 1HEZA 5DTFA 5E2WL 5E5MB 1XIWA 1HK6A 3RKDC 3RKDD 3EJYD 1N64L 3LCYA 2AKRA 2NX5D 5B8CC 1VEMA 1SBBA 3FB6A 1NMCB 1F58L 3K4DA 2ZG3A 4BSVA 3EYSH 1YUHB 1JE6A 3ILQD 4PLJD 5IQ7H 4HPYH 2Z31A 3UJIH 4RFNC 1IAKB 3HZVA 3PL6C 4NKIL 1YEJL 3LKOA 5T1LB 5ESQA 5C0CE 3TT3H 4OLZH 1LP9E 3PGFH 4PJ8D 4WO4C 4K3EL 4TQEL 5B3NA 1KACB 4YDVA 2L4OA 5C0CD 4YNYB 2CLVB 3CVHB 3W0WD 2M8XA 1E27B 5BVPL 3D18A 4K23L 4HH9A 5FA4A 3ZLQC 1FYTA 4H0GA 2VLJD 4K71B 3IFOB 4U2YA 2CDFA 5I1CL 3O6FA 2APTA 4Y4FB 3SQOL 1LEKA 1YEKH 3N85L 3P11H 1V7ML 1ZGLB 3LS4L 1NBVH 3ALPA 7FABH 1YMMA 5SWQB 3UJIL 4FQHA 4P2OA 1JNHB 2OK0L 3SDDA 4F7PB 1TZIB 4UAOB 4Y8AA 5GHWH 3GSUB 1EAPB 3CX5J 1XCQB 5GJSL 5L88H 3BQUD 1NCCL 4OJFH 5MI0B 1IM9D 4AENA 1KCKA 1YEGL 3S37X 2VE6B 4YK4C 3U2SA 4BQCA 2AJZA 1GPOL 2A2QT 4XPGL 2FD6L 3LKQA 3REWB 4V2CB 3ULVE 4GRWH 4RNRA 3ARGB 2NR6D 2G60H 1EEYA 2H3NA 2CKBB 3QFJB 3OJDB 5A2FA 3ZKND 5JIIA 4KZEL 3QNXB 4Y5YA 1D5BB 4QY8A 4X6FB 2ZCLH 3VFMA 3BKYH 4B7LA 4OZFB 4BM7A 5IB1A 3LPGA 3O4OC 5SX4H 4JRXE 5IMMA 4MDIB 2VSCA 4CJ0A 4JGJA 5KVFH 2B2XH 4O2FA 4DZ8B 2KQNA 3R4DA 5T3ZD 2BVEA 2VRAA 4Y4HD 4HXAH 1T4KA 4P2RA 2EEDA 4Y5XB 3QPXH 4LSUL 2R1YB 3PL6D 5IKCB 4ZFOB 4H26B 2LAAA 4Q74A 5F3HB 3VFVA 5T3ZE 5C09D 1SJHB 4HWEH 3DARA 4P46A 3WIFA 1A1NB 2DLFL 4UQ2B 4I2XE 3MOAH 1MCWM 3T09A 1FJ1A 4NO0D 2MFNA 4JM2F 3GMNB 5HGDB 3MV01 3IDYB 1KXVC 4DKEH 3ET9F 1D5MA 4MD5B 3FT2A 4WUKH 3SKOA 9CGTA 1MFAH 2H2PC 4TVSa 4Z7WA 1OSPH 4XBEH 1JRHL 1QRNB 2Y36H 4RCAA 1J1PL 3ESUF 2QHRH 3TN0A 3B9KA 3RWCB 3UO1L 1F6AB 4JRYB 3OKMB 4JHAH 1TNMA 4PJIF 4P3WA 4OAWB 2F54D 1SY6L 3TCLB 5DHYA 2OL3L 5LKNA 4ZXBD 3V6ZB 3MGOB 2DTML 5FOJA 3BPLC 1UZ6F 4QHUB 4LGSB 4ZXBB 1FDLH 1I1AB 1CFNA 4HS6A 2DQTL 3BO8B 4PJ8B 2OQJB 3D69A 3VRLE 4NKDB 2VDQL 4YDIH 5KVDH 4O2FB 3U1SL 3SGDI 3UPCA 1PQZA 4MDIA 2R0WL 3VH8B 1CDYA 3HMXA 3RZCB 2Y9RT 2DQTH 2HVJB 3O11A 1I7UB 4PJDA 4H25A 4GW4B 3TIDB 2YC1B 3C6SA 1HOCA 4UBDD 2VAAA 1R5WB 3QFJA 4YWGL 4Z7NF 4G6KL 1JN6B 3FQRA 3F5WA 3U0TA 5EFIA 3EAKA 1UYWL 1INEL 4PGEB 4HK0B 1BMGA 2APBA 5GISH 3RA7H 2VWEC 5D2LB 1AC0A 1IKNA 4N90E 2XWJB 4UMGA 1OSPL 2BZDA 3QCUH 1D6EB 1BM3H 3NCJH 1FVDB 3BWAB 2OXGA 2D0GA 4H1LG 3GNML 1RURH 3EYOA 3RGVB 3WFCL 4LU5H 1F4HA 3E6FB 5TF0A 1EXUB 5EUOF 1NLDL 1NCDH 4L3EA 4JFXB 3C5JA 3SGJA 2Q8AH 2DTMH 4TN9A 2AJ3A 5JQ6L 4JREB 1EXUA 3MZTA 1AJ7L 1IAII 5H2BA 1A3RL 5T3XE 5HPMA 5JPNA 2EDLA 2R2BB 5C0CB 12E8H 1ZHNB 2V7HB 4UU9A 1U8JB 2EE3A 5CBAB 4OF6A 4G8IA 5T3XD 4MCZA 4PS4H 2PR4L 2Z9TA 3IGAA 3P77B 4TULH 1PX3A 3OPZL 5D6CB 3L3GB 3CVHA 3VXRA 1TETL 4FP8L 5LCVH 2G75B 3QDJA 4RA3A 1C16A 3FL7A 4WI4A 5I1HH 4C83B 4OCYH 3PUCA 5CSZA 4MYWB 2FGWH 5JHDD 1OGTB 1H0DB 1SMOA 1UWXH 2P5ED 4P57A 4WUUD 4Z7VE 5I1JH 1WITA 1IAKA 3HZVB 1RZJL 2HFEA 5TE6L 4ZUVB 3MJ9L 1A6TA 4GQPH 5HHOB 4NHUB 2EYTB 4HXBL 4HH8A 1S7UB 1SJVA 3RBSA 2E7MA 5EWIL 4FTVE 2EDXA 1OAXL 4NBXB 3BZDA 3WIIL 3GGWA 4J6RH 4Y1AE 3W39A 4YQXL 3U30C 4XPBH 3GMRA 1WZLA 1IC7L 2XPGB 3DVGA 4LCYB 1ORQB 4OJFL 3C6LC 2ATPA 1P69B 3PGDA 4YHKL 3T0EA 4PJCA 4R0LC 1I1AA 1ZLWH 2ILLA 1U8OB 1LEIB 5E8NB 2EKSA 2RR3A 5C3LD 1HSBA 1EJOH 4Z7UF 2HT4D 1A3QA 4FOMA 4GS7B 3O2WH 3DX9A 4NFCA 1J1OH 1UJTA 3FRUA 5BRZD 4N0RA 1KPUA 5LXGH 3SOBL 3W9EA 2UWEF 3VFPB 1MSPA 3MBXH 5C0RL 1U58A 1MCIA 1PLGH 1WF5A 2W1NA 4U1MB 5DUPL 5BRZE 2M1KA 3LKSA 4OCWL 2FD6H 1NUNB 4L3EE 5IEHB 4LGPB 2XG5A 3ECBB 5EU4B 4HCRA 4DAGL 5IBLD 1ES0A 4PJHA 4PJEA 3TA3D 5T1LD 1MRDH 5IFJA 5BS0D 3P4NB 3DUSB 3H9HA 3LEXB 2XWTA 3EZ8A 5KAQG 4KQ3H 3V79C 3VFUA 1V7NH 2XKNB 1BAFH 2QQKL 3C9NA 1PY9A 4LF3B 1A1NA 4UQ2A 2WZPD 4FNLL 1TZHB 2NY0B 2C4FU 3F12B 1NAMH 5IR1B 3NCBB 2HTKC 1G7LA 2V7NA 4J2XA 1UWGL 4XBPB 1G0XA 3DIFB 5CUSL 3VD9A 2BVYA 4F57L 5DXWA 3LRSA 2DS4A 3VFRB 3SO5A 4UT9L 1EGJL 3AFLA 3TNNA 3BP7A 5JIKA 1GIGH 1E6JH 5J4MA 4G8FB 4XNXL 4XPHH 4XMPL 4NKQB 8FABA 2EDEA 3U0WH 1NQBA 4JLRB 3N1MC 1F11A 1NL0H 4DKAA 3IU3A 3KHQA 3VFMB 1Q72H 2GITB 3DO7B 1H8NA 4PRPE 3L6FB 4X83A 1YNTA 5I1GL 5GRJL 4PRPD 4LEOB 3WE6A 4MXWH 3TBTB 4CADB 4D8PA 4RFOL 5EU7C 4DKDC 1NCNA 4RNRB 1QFUL 1QFOA 2VDRL 1A6VL 4JFZH 3C6LB 1S7SB 1N64H 3P9WB 4YK4B 3ISWA 4XCNA 1CL7L 4AENB 3TNNB 1I7ZA 3SKUD 5DJ6A 3VJ6B 1RIHH 3LRSB 4NUGH 3TT1L 1MAML 3CDCA 4X80L 1IQWH 3C5ZB 3L5IA 5EPMA 2FDBP 4G43B 4X5LA 3HCVB 3JTSB 3JWDL 3K8KA 2R4RL 3BSZL 1XF2A 1ZVYA 2LAGB 1BOGA 3QXAA 3BXNB 5INDB 3FTGB 5TE4L 2D3VA 1TNNA 2ZCHL 1GOFA 2F5AH 3DMMC 2BNQE 2AXGB 4EEEA 3H9SD 2JIXD 3VG0L 4Y4FA 3REVB 5FECA 5F7DA 1G0YR 4NRYB 2JLLA 3EDJA 4IHOA 3ECBA 2OZ4H 4RBPH 3MACL 4L1HA 2X1WL 2J12B 5I1DB 2IAMB 4MA7H 5CP7B 4HBCL 4QHLB 3NFNB 4EI6A 4HUWB 2OZ4L 2J8HA 2NX5E 2YK1H 1I7ZB 1OGAE 2AQ1A 3IJHA 5HJ3B 3OKNB 4X4MA 1HSAA 3MLZL 1U8OA 1YY8A 4QHKI 4HC1H 5F7KC 1BQSA 3FCTA 2ED9A 4HF5L 2F5AL 1I85C 2ICES 4IDJL 4M6AA 1OAQH 3MA9H 3GGWB 2CKNA 4P3DB 3VI3F 3IVKB 4Q7DA 5GRWA 1S7UA 5CEZH 5B4MD 1MCEA 4KUZL 4TRPL 1K4DB 3WEXA 1P53A 2WBWB 1CF8H 1BIIA 3QEQE 4OFKA 2VLJB 1CFVL 1WLHA 1C5DB 4KI5C 5FGCB 4HD9A 2V17H 4JCMA 1Q94B 4BSWA 3ZTNH 3OXSB 3GB7A 2DM4A 3KPRB 2UUDH 1X6NA 1S9YA 4ELMB 4X8JB 5KW9L 2J8UF 1KC5H 1HCVA 5JO5A 4UUJA 4X4ZA 2MHAA 3FKUS 1WWWX 3LKPB 1WVZA 4FFVC 4WI6A 3LVEA 3V4PL 3QUMA 3VDBA 1D5XB 1H8OA 3ULSB 4LSDA 3OKDB 1EO7A 1KLUA 4S1RL 5DWUL 5FIEA 1KFAL 4M5ZL 5IFHL 1SM3H 2WBJD 5C0CA 5DEGB 1QVOB 1JHTA 1KB5H 1WQVT 1JPST 1MHHB 5IROA 2HLAA 5J12B 2XICA 2QTEA 3KXFE 5GJTH 1NMBL 4QOKB 1NFDA 1MAJA 2WK2A 4PJHB 4XXCC 1U8HA 1W2KT 2IGFH 4PR5B 5GGQL 4LPUA 1JMZA 1A3RH 1GZPB 4H1LH 3QIUD 3GKZA 4UV4H 5GGSY 3RGVD 3OR6A 3OXSA 1F8TL 4GG8A 1PDKA 4GAFB 4RRPG 1JGDA 4GKSB 4ODSH 1QFWI 3WXVH 4PRHA 5IB2A 1AIFB 3PP3H 4I3RH 4ZAKB 1RY7B 2Q86A 1HSBB 4FQXD 2Z4QB 3G5YB 4N9OB 2A73A 3IKCB 4U6HA 3K3QA 1V3JA 2MQCA 2UWEA 3V6FB 4TPRH 2YR3A 1A6WL 4M6OH 2VDPH 3L7FA 2ZP0T 5TFSL 4Z78A 5DHVA 2BP3A 1KB9J 5C6TL 1HCFX 1Y0LA 2X4NB 3AM8C 4BFBD 2JTDA 3DX8B 4HUXB 4Y5XC 4AT6A 1FGVH 5BXFA 1FPTH 1I7UA 4JR9L 4ELKA 5FO9A 4PTTB 1DBAH 4U2ZA 3BGMA 4OLEA 5D5ME 3D25B 3TESA 2BERA 1LK2B 5JHDB 5HHOA 1JWUA 2MCG1 4XX1G 3MRCB 4JFFD 4YO0B 1A6TB 4NNXA 4L4VA 3B5GA 2AP2A 4NO3B 3O4OB 3U9PH 2EDYA 5HJ3A 3WLWD 1EZVY 5EA0H 4P23C 4ZPVB 1KENH 1ITCA 3HG1A 4S2SB 4NNXB 3QXDA 1FLTX 2X70B 2DM7A 2HMIC 4NNYB 3G6JF 3CNKA 4QYOB 1TZGH 3GJFH 3SGEI 5TH2A 1AD0B 3UTPE 2HJLA 4JDZB 1D9KB 1W0WB 2AJYH 4J3SA 1UWEL 4MNQA 4NCC1 5CEZD 1UQSB 4GRLB 4IOIB 3P30H 5T3XL 2JJTC 3MC0A 3DMMB 3QIWD 4K2UL 1H3PH 2FJHA 4XMLL 4RZCB 1UM5H 3OF6A 3OX8B 1ZEAH 4FQJH 4Y4KD 4CN4A 3Q3GB 2CUIA 3UO1H 4WO4A 3C5JB 2D0FA 2X1QA 1A5FH 1MELA 3O41A 2ZUQB 3C5ZA 3G5YA 1VADB 3BDYH 3GMNA 2IPUG 1EAJA 5JA9A 4EDXA 3CC5B 2VN4A 2P8MB 4PS4L 2NW2A 5DO2C 4RX4A 4ETYA 3L3IA 4DKEL 1WEJL 1FVDA 2BVTA 1P4BH 2OXHA 4XI5C 2O26U 5GGUB 3SCMC 5F7LB 3PP4L 4HGWA 1MFCL 2Y06H 1U3HA 3ARDA