5H2BB

Structure of a novel antibody g196
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
211
structure length
211
Chain Sequence
b'NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G196 antibody Heavy chain
publication title G196 epitope tag system: a novel monoclonal antibody, G196, recognizes the small, soluble peptide DLVPR with high affinity.
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2016-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5h2bB01
2EKJA 2BVOB 1FQ9C 5KSAA 1YMME 1DSFL 4WV1C 1IGFL 5JW4M 3CLEL 2GTZB 1JNJA 3B5GA 1ZT4B 1U8KB 1DDHA 3KPRD 2HLFD 4OT1L 2OMNA 4HCRA 3ARBB 4JAMA 1JGUL 1OTUD 4GMTH 4M48H 1MFEH 1ZT1B 3L7FA 4CN1A 4F7TA 4J7RA 4CW1B 3ZTNL 3STZA 2KQNA 4AJ0A 2OZ4A 1RU9H 1UKTA 3VFVB 4CL7A 1S7WB 4L4TB 4I0PB 4NKOB 3G5YA 4Q0XH 1U8IA 3LD8C 4K7PL 3PF2A 1BLNB 1G9EA 1NEUA 5FK9B 1N5YH 3TVMA 1B6UA 1TJGH 4V1DD 3L9RA 3KPLA 5FDWB 4PLKD 5C6WH 3C60D 4M6NL 3FO1B 2VR9A 3IXAA 4XP9H 4DFHA 4HHAB 3ULUE 3U4BL 1UVQA 4QYOA 4X83A 3ARYA 5C0GB 4M5ZH 1D3CA 3QJFB 5IQ9B 5F7EH 2CUMA 4H0IA 3WO3B 2CRMA 5F7WC 4FFZH 4X6FA 5FO7B 4AM0B 3GSRA 1DBAH 3LZFL 2BSTB 4PJBB 4ODBD 2FJGA 3V4UL 3VWJD 3RZCC 1G7JA 4Y4KC 4ZFZA 5IHZB 4DOHB 1KOAA 2V7NA 3G5XA 4ZXBD 4RFOL 4AH2A 1KB9J 3MLYL 3O2DH 1HH9B 2GFBA 3GI8H 3T65B 5J1SC 3STBA 3N1MC 4U1NB 4XNZB 3S35X 4WFFE 1M6OA 3FOLB 5IT2H 4LKCB 3CMOL 1CDYA 1AD0B 5DK2A 2VB5A 5D2LE 5DURD 5A43C 1U8QA 1XH3B 5TPWL 1KCKA 3FTGB 1FN4B 1R3KA 2IPTL 3MO1B 1CXEA 4BQCA 4IOIA 2FYYB 5AYUH 3QO0A 1MVUA 2PXYB 1JK8B 3GMRA 1I85C 2EH8H 4OF5A 2DQDH 4NHCL 4HS6A 2CLRB 1S7TB 4MNHB 1NMAL 3OKOA 1LO3H 3Q6FA 4KKCC 1R3LB 1EUUA 3HE7B 5D1XD 3G08A 4NBZB 3VD7A 3NOIA 3EHBC 4C4KT 4X9IA 1G9MC 3CFKB 3IDUA 1DVFA 1JPST 2FRGP 1LNUB 2X1PA 3UTPE 2ADIA 1DQQB 4V1DE 4Z76A 1FLRL 3QA3A 4RQQA 3K2UH 1NGZA 3GHEH 1BEYH 3MUGA 3DV4A 3P4LA 4WI6A 3GMPB 1FH5L 1R0AL 4HGWA 4PRID 3BWAB 4JQIL 4P9MH 4XAKD 2I5YH 3PDDA 4NKIL 1T0NB 1RHHA 3RAJH 3MLVL 2PYFB 2P49B 4AEFA 4R26H 4DN3L 3QUXC 4KTEL 1DBKH 1GZQB 2VE6B 3S36H 3BXNB 4F9PC 4L1HA 1XIWB 1RVFH 5E5MA 4ZOEA 4CVXB 1H3XA 4PJGB 3DETD 3P73B 4Z7VA 4PJEB 1JL8A 3ZE1F 32C2A 2NY7L 3EO1A 3RVWC 2WINB 3TV3L 1CK0L 2E6PA 3AS0A 2V5SA 5E4EB 1R5IA 2HKHH 2HFFA 4RX4A 5D71H 3IAQA 3ROOA 2IWGA 4JG0L 1CLOH 1BZQK 1WVZA 3LB6C 1DEEA 1C16A 2HVJA 4ZTOH 3MCKA 4TULH 2HJKA 4P2QA 4XHJC 1MRFH 2NTFA 4KRPD 3CSYA 4NRZA 1W8NA 4I2XE 2EICA 2B1HH 3EO9L 3PP4H 3TWCH 4LMQI 4YHIA 1VFBA 3P9LB 1RSFA 1LVEA 1HH6A 3DWTA 2UY7A 4PRAA 1NBZA 1NDGA 1UCBL 2P47B 1ZAGA 2IAMB 3QIWB 1J10A 3QXWA 1YEGL 2V2XB 4YBQC 1BAFL 4MYWB 2AERT 4BH8A 1RZIB 5DHVB 1N5AB 2GSGA 3MQIA 5FCUH 1ACZA 4FZ8L 3TO4A 5CJXA 1QRKA 3HC0A 3BHBB 1NC2B 2B1AH 4PRIE 4MNQA 2GUOB 4YWGH 4XAKE 3UTQB 2HTLD 3T2PA 4JVUA 4N8VB 4YBHA 2BY2A 2OXHA 1U42A 3D25B 1AKJD 5ADPL 3S96A 3QQ9D 4XRCA 3FO0L 2D0HA 4LCUB 5JUEH 4ZUTB 4HUVB 5GS1A 4PJAB 4YDLB 1XGUA 4HCRL 4ELMA 2MNUA 1NFDA 1I1YB 1I9JH 5E99L 3G5VB 3PWJB 3T2NH 1P7QA 5H35A 1IGML 2GK0A 2X7LB 4ZAKA 1UB5A 2OZ4L 4TOYH 1A47A 1ND0A 3C6LD 1KYOJ 3JWDH 3GBML 4JFEB 1NC4A 4LRNL 3GBLA 4M00A 3VFOA 3R8QA 4S10A 2AEPL 3MRBB 1Q9OB 3EYQD 3R0NA 3LS4H 3O8XB 4L8DA 3O3UN 4LPYA 1HHJB 4I3RH 2KH2B 4KK6C 4J3UA 4HEME 5TE4H 4N9GA 1S3KH 2DM2A 2B8OT 4JO4H 5HVGB 5DT1H 1XGTA 4HWUA 4R4FH 4OV5A 4GRLC 4YBLB 1PX3A 5F7HA 4OM1H 4PJIA 2ORBL 1OTTD 1IQDB 4DVRH 3MOBH 2ARJA 3HZYB 3SKNA 3VFTB 3BFOA 3FB7B 4HIXL 2X4OB 1F11B 1KB9K 2YKLH 5I1JH 1X3DA 2MWCA 1ZA3A 4GG8A 4RWYH 3WFEL 4P5KA 4Z7WA 4WUUA 4ZMAT 3BDYL 5IROC 4PBXA 4KK9C 5E2UH 2JJWA 1FJ1A 1CE1L 3HCVB 1MI5E 3D3VB 5LAXA 3I50H 3WJLC 1U8OB 4ZD3L 4K71C 3L3HB 3OKKB 1JPGB 3FONB 4XVTL 2KDGA 3SDXE 3IKCB 4XC3L 4NPYA 4QNPF 1QFWH 1J7VR 4K7FB 1S7SA 5DJAB 5HHOA 4Y1AB 1WWWX 4OBSA 5EORH 1U8MA 4HJ0C 4APQD 2EDJA 4HH8A 4FQHB 3D39B 2M8XA 3MRDA 2HVKB 2D7TH 3GI9L 3GEWB 4MCZA 4QY8B 3LY6A 5D9SB 4D0BB 4NO0A 2IAND 3MLRH 1H15A 2CKBH 3I2CL 2AJUH 5CBEA 2ENYA 3MLTB 4MNGE 4QCIA 3AS3A 3EOTL 4GW1A 4WWKC 3ZO0A 3CIQA 1Y6KR 3RRQA 4PJBE 2F58H 1GHFL 5I76A 5DZOA 2HLAB 2Y23A 4N8CL 2YUXA 1AGCA 2VERN 3SDAB 2E27L 4JO3L 3EDKA 2CK0L 4DTGL 2X1OA 1DCLA 3RUGF 3I85A 1RUPH 5FYLL 3KYNB 4BKLA 4ZFGH 3MJ7B 1QQDA 5HI4C 4W70A 1MHCB 1ZHNA 2MHAA 5CJ5A 4QRPD 4G7VH 3W0WE 2Q7YB 3UDWC 4Z9KB 3V8CA 5HGAA 3RWIA 5ESVA 3DVIA 4NNYB 1UZ8B 2F53D 3VFRA 2XY2A 4YUEH 1DUZB 3C6SB 3L5XH 4Z7NF 1HILA 3IXTA 3IETA 4LLVA 3RX7A 2BY0A 1EGJH 4QRSB 4GKOA 3B43A 4HULB 4LARL 2FX7H 4ORZC 4R0LB 4X6EA 5GRJL 1KT2A 4GRWH 1U8PB 2J8UB 3F7RA 2IQAA 5FA4A 4FQPA 1AQKL 1T89A 2H9GB 3X3GL 5CZVH 5BS0A 3MRRB 1GC1L 3MJ6A 3KJ4C 2KQMA 1KPRB 4JFOA 3A6CH 1FFPA 1U92A 4LU5H 4MJ2A 5IHLB 1BFTA 3UJIH 4NP4H 4TUOA 5FYKL 1ZLVK 2PYEE 3GMNB 1QVOB 1K2DB 4BZ2H 5JTWA 5T1LD 2OX5A 3VW3L 5D5MA 4GBXC 3OHXA 1BBDH 1F42A 5C0CE 1DBBL 3T0EB 4NUJB 4K3DH 4BK4A 4HSQA 4G8EA 5JORB 4FA8A 3RWDB 5IJVA 1RJLB 4MXWH 3BP5A 5GRZA 2JJTC 5FYJD 2D7OA 4ZUSA 4XNQB 3MRGA 3BH9B 4Z5RA 1QFUH 2C3WA 2X4QB 1P7HL 3S3PA 4HZAA 5DJDA 5DJZA 3VXPB 1SEQL 2QLVB 2DIBA 4ELKB 2EXYC 3DTXB 5LGJA 1V7NH 2YD8A 5I1CL 3QCTL 4L3ED 4HBCL 5IVZB 1OAQH 3DBXB 4H8WL 4PR5A 1A6ZB 3GMQA 3RZCD 1INDL 1LO0H 4HAGA 5CKGA 4QHUA 1E27A 4J4PD 3IDMB 5T3XL 3B9KC 1J0YA 3T0XA 1P6FA 5I19L 2AV7A 1RZKH 4M7JL 1KYOK 1U95A 2VMFA 4WW2F 4P48A 3HMWL 3N1PC 3VRIB 1CL7L 3IJYA 5KSBE 3TYGL 1YEHH 1OWWA 5IMKA 2PTTA 1MJUL 4JPVH 4JRYD 1FVEB 3OJDB 3TPKA 2A6KB 1I8IA 5DJYA 1GGYA 5CP3H 3VH8A 4Y4FC 4ZUVB 1TDQA 1UQSB 5CBAA 1NLDL 2VLKD 2Q76A 4OGYH 1YNKH 3X13A 1BBJA 1QEWA 1O7VA 4L9LC 2VKXA 3HUJA 3N9GL 1XF2A 4KKCD 4F33B 2AJ3B 1KXQE 4OLWL 2WANA 4KHXH 4YK4C 4AG4L 4JZOA 1Q9LA 1INEL 1SY6H 5B3JF 3FT3B 2VDQL 1UXSB 3EHBD 3MLPA 3RNKA 2W1NA 2F5AL 3MLWH 2ZUUA 2DOCA 5CSGA 1LEKA 4EOWL 3EFFB 3ECBA 3RTQC 1JF5A 2MCG1 3T4YA 4DUWA 1T80A 4MD4B 1G9NC 3QXUA 2Y9RT 3ILPB 1HHKA 2ZOLA 4U2YA 4XPBH 4FQQB 4JDVA 3UO1H 2PO6A 1ITBB 5AAMA 3BSZL 4GKZA 4NUGH 3RWJB 2P5ED 4ZO8A 4U1LA 2EEAA 2GW5A 3RQ3A 3IJHA 5ACZA 4BA8A 1PLGH 4MLIA 2QQNH 3HI6H 3QUXD 3I3BA 1A2YB 4NWTH 3D9AH 1NGXA 2D7PA 2L4OA 2H8PA 2BDNL 1OAUL 5GSVA 3HS0B 5DRXB 1NJ9A 1SJEB 5GISH 3RVWD 4OLUH 4GRWB 1JYNA 4KTDL 4KPHH 1MLCB 1MUJB 1YMHB 2YK1H 4JRYE 4LLUA 4S2SB 3PP3H 4EDWL 5B8CB 1OAZL 4AQ1B 5J8OA 4F9LC 4X0KB 5BCAA 2OQJB 2VLKE 1CG9A 2DTML 3LB6D 3H42L 5J12C 1BD2A 3VWKB 4K7PX 3WIFA 3BP4B 5TQ2L 4XHJD 1PVHA 4XGZA 3P4MA 4ZG1A 2IC2A 3H7BB 3V52L 4WDIA 1XGQB 5B22A 3NCEB 3SBWA 3LRGA 3SE8H 4X99A 4MQ7A 5DJXA 5FHBL 3D85A 4KAQH 2I9LA 3BPLC 4KY1L 1AO7B 3S4SG 1F90L 2J88H 4L29B 4PJ5B 3TIDB 1NMBL 1AJ7L 4NRXA 1YECL 4J12A 1XZ0B 4G80B 3RA7H 4YBQD 2X4UB 5C0RL 3P3YA 3VXUB 5C0AD 2CDGB 4H88H 3FT2B 3WLWC 3INUH 4LPWA 5GZOD 3X3FH 4D0DA 5F3HA 2B7DT 4PJDB 4I3GA 1I7UA 4PJ9B 2ZSWA 4KRMB 3SDDA 4RMTA 2HH0H 3D39E 3TA3A 4OZGB 1F02I 4MQXC 3TJEL 1IC4L 5JXEA 4ONFH 3AREC 2AJVL 2R23A 5K9KB 1BGXL 1HEZB 2IBBA 5F7LB 1PQZA 4PG2C 3CK0H 1Z0MA 4X7EC 4YDIH 1WC7B 3FN0H 4XWOC 2ATKA 3VFSA 4AEHH 1G7IB 1JE6A 4U1GC 4JPKL 5DDHA 5HY9A 1W72A 3BZEB 1EAPB 3WHXB 5EB9A 5C7XH 5IVXE 1NANH 4NC1C 3ULVF 1NGPH 1VENA 1DANT 3O4LB 4ZYKA 3PGCA 3R06A 1T2QH 4PBWD 1MELA 3IU3A 4DQOL 1H3GA 3B4NA 1QHPA 3HAEA 4GG6A 1BQHA 3V7AG 1U93A 4KK6D 5J56B 1XF3B 4CAGA 2RCSH 4C4KO 1M71A 1BWMA 4JRXA 3NCJL 1FNSL 4C56B 4GRLD 4YGAB 3WDHA 3RWEA 4PJ7A 2MOVA 4NT6A 4BFIB 3WNOA 2NXYB 1VEPA 4TSBH 3G04A 4NQEB 5BXFA 4JY4B 1P7KB 4CVZB 5EO1B 5JXAH 4TVPL 2H26B 5EUKA 1K85A 1YMMA 3QUZA 1MCKA 1MPAL 2GI7A 3IF1A 4LSTL 5C0AE 5B38G 4LSSL 5I16B 1HCVA 5JNYA 3RWFA 1IE5A 4KJPC 2R1YA 4XX1E 4HF5H 1ZS8B 4RA3A 2UYLB 5E6YA 4GXVL 2W59A 1QLRA 4KK9D 1AGBB 4MQTB 3EO0A 4KROC 3BT2H 5C71A 3MJ9H 2Q87A 2E9WA 1YEIH 1TXKA 4WEBL 3HE6A 1KIRB 4KDWA 4ISVB 1KTLB 1WEJL 4WU5A 5F96H 5HGHA 3I6KB 2OTPA 4EKXA 5C70A 5MHSD 4DN4H 3D18B 5IGXL 4KV5F 3T3PF 2Q8AL 4TYUA 2YN5A 2D9CA 1G6RB 2JF1A 4P9HH 4HJ0D 5IM7B 1Z9OA 4JFPB 1IRAY 2HP4A 3T3ME 1I4FB 2IALA 4MA7H 3NIGF 2AJXH 3QI9A 1F3JB 3D0LB 5CHNB 5FM8A 3IJSA 4UMGA 3QCUL 5C08B 2EH7H 4POYA 4NO2A 3TNNB 4WWKD 3V0WL 2NYYC 4OCSH 5FV2A 4MD5B 3ME0A 3QO1B 5JO5A 4PTUA 3JTTB 4PRPB 3U6RA 4YH6A 5C0DB 3PV6B 2XRAL 1WFUA 3BKJL 4A6YH 3H6JA 5ALCL 4YHZH 1D5ZB 2FSEB 5LBSL 4D0CB 2VL5B 3CDCA 1SJHA 4XC1L 2GSIB 5IMLA 2A77H 1XCQA 1CIDA 1ZANL 5EOCL 1EK3A 1K5NB 3QIBD 5HI4D 5GPRA 1T7VA 4J8RA 2YWZA 3BQUA 1YEKL 2AW2A 2FD6L 5CEZD 2VC2H 2KZWA 1I8LC 3F6IA 2OTWA 4Z0BL 1DEDA 2A6DA 1UH2A 3UPRB 1YJDL 2BOBA 4L3CA 2N4IA 3SJVE 1KPUB 1U41A 5IHUH 4WTWA 1YN7B 2OXGA 1VPOH 4V1DA 4Y19D 1ES0A 3C60A 5I8OH 1FP5A 4GQ9L 3MRLB 2QR0B 3WJJC 2DQCL 1R3IL 5IW1A 4OLXH 3S98A 4P2OA 4PY7B 3PQYD 1V3MA 5AWNL 4JM4L 4Y88A 4FP8H 4LSRL 3VG0H 3TO2A 1ZLSL 3VWJA 1PAMA 2IBGA 5FFLA 2WMPA 3DIFA 4FQCH 4GBXD 4GLRH 4LHQB 4YDJA 2W60A 5IBTH 4BK5A 3OKEA 5D7SL 2CDFB 1CT8B 3WKML 3NZHH 2GJ6D 4X5XB 1F6LL 3OKNA 4XBPA 2XZQH 1AY1L 1TPXB 1ZWIA 2VQTA 3C08L 3ZE2F 4NC2B 4LHJB 3O3EA 2QSCL 4YXKL 3EYVB 3C8KA 2EXYD 3FB5B 4R2GC 5J11C 1NAMA 1D5MA 3B9VA 5CEZE 4GW4A 1OF2A 1F5WA 5JQHC 1KCSL 1W8OA 1HQRA 1MCOH 5SX5H 1JMXA 1UACH 4I2XA 2H6PA 4PJFE 3B9KD 1ONQA 1W72L 4OZHE 5F1NB 3QQ3B 1RIVH 4NZUL 3LEXB 1BIIB 2OP4H 3UZEA 4NKDA 2FX9L 3MNZA 5L2KB 4W68A 3HNTL 4JDTH 1AIFB 1TIUA 3RWCB 4HIEA 1AGDB 1GYAA 2JELH 4U1JA 1IBGH 5I1IH 1AO7E 3NCFB 2XZZA 2DDQL 5JW4N 1IL1B 1LGVA 3BPCB 4Y4FD 1OPGL 2BC4A 1RIUH 2OCFD 1FNEA 1UXWA 1FYTB 3CZFA 3L5WB 3LKPA 4P46C 3MLZH 43CAB 4M1DH 5AG8A 4PRIA 1A3RH 1MLBA 1NEZA 2NX5D 2A73B 2A83A 3AAZB 4CU6A 1GZPA 1QA9B 1BQUA 1HIMH 4OUUA 4AMKL 3MREA 5ICZA 1HOCA 1DQTA 1MRCL 4RISH 1CXHA 1MHEB 4PJDE 3L95B 5AZ2H 3HR6A 2X1XR 1I3RB 1T03L 4RGMC 5IMMB 1JV5B 4YZFF 5A2FA 1YA5A 4MJIB 4NOFA 3FJTA 1P2CB 2I24N 5KSUB 4GLRI 4Z7VF 3RTQD 1WLHA 4X7CC 2XFXA 5IB3B 1IQWH 4JVPA 4LF3A 5C9JB 3UTTE 5HVHC 2E9BA 4LGSB 4OZFG 2CXKA 2VISA 4WHTB 1WFTA 2RBLA 1F4YL 4KH2A 1BVKA 1KC5L 5EOQL 4EDXA 5DRWB 3NA9L 5EUOF 1UM6H 5D2NB 1DR9A 3AFLA 1CFBA 4C59B 2GJZA 3I84A 1Z3GL 5JPMB 4LAQH 2D7QA 2YN3A 3O4LE 1TVBB 5E8PB 3MLUH 1I7ZB 1SM3H 2G9HB 3DURB 3HPLB 3DX6B 1SEBA 3MV9A 5J6HA 1W0WB 1VCAA 4YR6A 1VDGA 4Z7QF 1YPZE 3PWPD 3RIAK 3WN5A 1SMOA 4QF1A 4HWZB 2EDBA 4Y5XA 1FCGA 2J6EH 1JPFA 3BJLA 2AKRB 5F1KC 4CJ1A 2YPLB 3RNQB 4UT7L 4IMKA 4JQVC 2C4XA 3HFML 3MXWH 3I6LD 3PL6B 2BVOA 1J1OL 4PG9A 4XCCL 3O4OC 5DK0A 1I8MB 3BEVB 1C8PA 1ZT4A 1IGCH 3IFLL 4QOKD 2NX5E 2PR4H 5ID0B 1U8KA 3MV11 3DO7B 1KIUA 4JM2A 1MI5A 4HJJL 3WBDA 3ARBA 3O9WB 1ZT1A 5KVGH 4XXCC 4O02L 3SDXA 3FQXB 3VFVA 3LKNB 5K9OA 1S7WA 5JIKA 4NKOA 5C6TH 5TDPA 4KWUA 3NIDE 1IFHH 4GXUM 2XTLA 3WEXA 1VFAA 1TQCC 5T1KA 2GAZA 3EDEA 5FK9A 4Z18A 4DZBB 4LVNB 1CI5A 3WLWD 3RIFF 5HGGS 2Q3AA 1N4XL 3QEGL 4EN3B 1T0MA 4BJLA 3EDJA 3HRPA 3FO1A 1QPPA 5E94B 5EBLB 4U6VH 2BXZA 3MACH 4WU7A 4X6DE 2VZ3A 5C0GA 2CIIB 4HUMB 1OW0A 4BUGA 3QULA 4MNGA 4MQXD 4FXKB 5FO7A 4D9QE 3ARED 3KXFB 3MNWA 1Q9WB 2BSTA 2BSRB 4PJBA 1JNLL 4L8SC 1FL3B 4X8JB 2PTVA 3ZDYE 4YHOL 5I8KH 4WIQA 2W65B 5HYSG 1RUMH 5FHAL 4KVNL 4AENB 2VIRB 1BHGA 1HH9A 1JPSL 4M93B 4R9HA 2F5BL 5FV1L 1XMWA 3V7MA 1L6ZA 4NQCD 4QGTA 4U1NA 3F58H 4R7DA 4KZEH 1YC7A 5FGBC 4FABL 3WXWH 4BELD 3SY0B 5JDSA 3SKJL 1RK1B 3WFDH 1ADQH 3W0WA 3I6LE 5C6PB 4EIGB 5ESAA 1XH3A 2FEEI 3FTGA 1MEXH 3PIQA 4TRPH 3C09B 3MO1A 4UU9B 4QOKE 4M03A 1CLYL 4RGOL 1VB9A 3JTSB 4RRPA 5EC1A 5F3BA 1XFPA 3UTZA 2PXYA 1JK8A 1WT5C 1MFBH 4LSDA 1IGTA 2CLRA 1S7TA 3EJZC 1YNLL 2CGRL 2EYRB 5CEXA 4Y16B 2EIDA 2LAAA 3K2MC 4H26A 1XCTB 1KELL 2P24B 1JHLL 4EXPX 3GMOB 3VRJA 3UAJC 1T20B 3CFKA 4NQXA 2VABA 3FAWA 5E6ID 5AYQA 5AZEL 2PYEA 4AZ8A 4KJPD 1CFTB 4TSAL 3MRNB 5E9DB 1P9MC 3IRPX 2CPCA 5DMKA 3GSXA 3IDJB 4KROD 4ZUUA 1J1XL 5LKNA 2V2TB 5LGHL 3DUSA 4YBLC 5C0CA 4Z8FL 4GKSB 4D2NA 5I73B 2NPLX 3PUCA 5CD3B 4P3DA 5DMGC 2LQRA 5B4MC 1RUAL 2PYFA 3R1GH 1S7UB 3RY6C 1NBVH 1GZQA 1BM3L 2VE6A 2A1WL 3BXNA 2CK2A 2E7MA 1FIGH 4XPHH 1XIWA 2BNRB 3HRZB 4RMSA 4NQCE 4CVXA 3ARGA 4Y5VB 2X09A 1RIHH 2VO5A 4NC1E 1QUNA 2QADD 1H5BA 1GAFL 4RBPK 2QKIA 1MRDH 2HG5A 4U31A 4EVNA 3FRUB 1XGPA 4K3GA 3WSQL 3KPNB 3WV0A 4JN2B 4LSPL 4WI8A 2ARWA 1A6TA 5DQ9B 2NYYD 2Z93B 5KAQF 1SJXA 1B88A 3AB0B 3LVEA 1CD1B 1X5LA 1QBMH 4UNUA 2IPUG 1OP3H 4FQJH 5EBMB 5KSBA 3FOMB 4UT6L 3OAUL 1J8KA 4MQSB 1U3HB 3O3AB 3B3IB 4QTIH 1JRHI 2VXTL 4L4VB 3FO9B 3GRWH 4M7LT 1JWSA 4WV1A 2IAMA 3QIWA 4OSUL 4HK3J 1XGYL 1LHZA 4JKPH 2DIJA 1I9RH 4MWFB 1JFQL 4Y5YC 1DFBL 4Q6IA 1OAXH 4OFVA 4Q7DA 5DHVA 1N5AA 5DD6B 3BKYH 1MCSA 3UJJL 2AK4D 2WBJB 3TBYA 3BHBA 3G6JF 1CXFA 2GUOA 3HPJB 1FDLH 3BP7B 3UTQA 4BQ8A 2VDRL 4N8VA 5DRNA 4XPAL 1KJVA 1T5XB 3EOYG 3GGWA 4YNYB 3U4EA 4X5LA 4LCUA 3K4ZA 4H1LG 4HUVA 3G6DH 4MJIE 1A5FH 3PWJA 3SO3B 4AIXA 2D4DA 2NCMA 4PP2B 5FUOL 1NCBL 2PCPA 5IK3B 2X7LA 5E2JA 4KK5C 4GSDH 4Y4KA 1XF1A 1P69B 3RKDC 4JFEA 2X70B 4ORGB 2FJHB 4HIHB 3S5LB 2R69H 4JFDB 5I15L 4S1SH 3ISWA 3RWHA 4NN7C 5ILTH 1Q9OA 1KEGH 5LXGH 4HS8L 4FHBD 1QLFB 2VLME 4LCIL 4UTAH 35C8H 3TFKC 4KZDH 4OFYA 2DM4A 2YXFA 1KGCD 4I18C 4KGLA 5KZCB 1FO0B 3SKMB 1IQDA 5HHQB 2I07A 3JWDC 5IESL 2VLKA 3WXVL 4L1DA 1DSFH 4R2GD 1IGFH 5EBWA 1RZJL 3CLEH 1KG0A 2PW2B 2VYRE 1WBZB 3EGSB 3H3KA 1J1PL 1FHGA 3TBSB 1BZ7B 3LHPH 1B4JL 4TNVK 1HE7A 1JGUH 4L4TD 5ICYB 3HUJF 1A7QL 3VRLF 2VKWA 3ZTNH 5H37G 4CRPA 3GSOA 1GXEA 4NSKA 1YC8A 4OZ4B 1KLUA 2VLJB 3MRFB 3OXRB 1CDHA 4KDTC 1U8OA 3DMMC 2A0LC 5EU6E 4OFDA 1F3DJ 1SBBA 1JTPA 1KCUL 4MD0A 3SKUD 4M6NH 2DWEB 4OUOA 4K7FA 5I1KL 4P46D 5L2JB 2RAMA 5DJAA 3U4BH 2I9TB 2E7CA 2H1PL 1BJ1J 3QP3A 3C9NB 5HHPB 4N1HB 3D39A 4UAOC 3LZFH 3D87B 1LO2L 1BQLH 3V4UH 3QUXA 2GKIA 5D9SA 4D0BA 3S6CA 5ITFA 4AY0A 5HDQL 5JDJA 1GGBL 4RFOH 3MLYH 1K4CB 1RK0B 4U1IA 1ACYL 1NMCB 4XP6L 3MV01 3KYKL 3U46A 1CFQA 3L3JA 2XPGA 3H9SB 3QUYB 2OR7A 4YE4L 5E8EB 3RI5F 3BP6A 1F4HA 3CMOH 3SDAA 1QSED 2WW8A 1KTDB 5DHYB 2M1KA 4O4YL 1OTSC 5TPWH 2C3XA 4KC3B 3KYNA 4N1CA 2IPTH 2NZ9C 3LMJL 4MJ5A 2FO4B 4WW2B 3TCLB 3HE7D 4OM0L 4NHCH 3QIUB 2Q7YA 3QFDB 5DLML 1NMAH 3MCG1 2RFXB 2ESVB 4FFWC 4NNYA 5IIEA 4F7MB 3I6GB 2HWZH 4QXUL 1A1MA 2R0ZL 4RIRA 2AGJH 3C6SA 5EU5A 2R29L 3ILQC 3IDGB 5BQ7A 4H1LH 1A02N 3NTCL 4X7DC 3U30C 4KUCD 1F2XK 3CFCL 1CDJA 1FE8L 1N26A 1N6QH 3RDTB 3G6AB 4WWID 2Y06L 1AGFA 1G0DA 1FLRH 1TFHA 5F9OL 2R2BB 4B53A 3UBXG 1AR2A 1E28A 1FH5H 1R0AH 1KPRA 4G5ZL 4KI5F 5HGDB 1NCNA 3BJ91 4FG6C 1V7ML 4JQIH 3CX5J 4NKIH 3GMNA 1BX2A 1J05A 3MLVH 4NWUL 4WI5A 1QVOA 1K2DA 4OZIF 1ZEAL 5JR1L 4DN3H 1S7QB 5E9DE 4KTEH 4FQ1L 4U0RB 4PD4J 4K3EH 3OMZA 4JZNB 3UEZA 3K74B 1MWAA 4UNVA 5GHWL 3IDNB 5JORA 2NY7H 4LKXB 3RWDA 1KACB 2F54E 3TV3H 1QSEE 3ARRA 1CK0H 3LPWA 4NZJA 5JZ7C 2E7LC 4M9PA 3UXFA 5C09B 3OG4B 4XNQA 3BH9A 2BHYA 2XXMB 5C9KA 4QXGL 1FL6B 4G3YL 3DTXA 5TE7L 3C5ZB 4KDVA 5SWQA 4LOUC 4QHMA 5H37H 4Z95L 4XCEA 4MAUL 4QT5B 3ARVA 2VLRD 1A6ZA 3EO9H 3MBEB 1AP2B 4GRLA 3QXVA 1U8NA 1FSKB 1UA6L 4MLSA 2NQCA 1JGVL 1UCBH 5JPNB 2OLDA 1G7QA 3QH3A 3VRIA 1YEGH 1R5VB 1BAFH 4G6AC 5F9JB 2QJDA 1W0YT 2CKNA 4MGXA 1FVEA 3CFJB 3Q48A 1R24B 5DJ2B 4L4VE 3VD4A 4ZUVA 4FZ8H 3F12B 4YHKL 4XP4L 5DMIL 1Q0XL 4MX7B 1KPVA 2VZ1A 1ORQA 4OLZH 4WENB 2J7LA 1KJ2B 4HIJB 1A1NA 4PB9L 1RZKC 3ARUA 3B5HA 1XGRB 3SJVA 4J2XA 5ADPH 5E70A 3U36B 3FO0H 2DN7A 3T08A 4F33A 2AJ3A 4Q9QL 4M1CC 4QNPE 3EYFB 5KVDH 3B5TA 1WGOA 4HCRH 1UXSA 4LGPB 5E99H 3FAXA 2AXFA 4M02A 5F8RC 1K8DA 3UAJD 4I0KA 5D1QA 2CMRH 3WIHA 3ULUF 1P5VA 3IT8D 4QRRD 1IGMH 4FQ2L 3EFFA 5E00B 2OZ4H 4HS3B 3QNYB 2EIBA 4IMLB 3RJDA 5INDA 4YDVB 4MD4A 5GGRA 3MGTA 4LRNH 3ILPA 1W0VA 5CZXC 4X9BA 3B2VH 4FQQA 2AEPH 3GSWB 3DV6A 3MRIB 3BGMA 5DFVC 2MMXA 4WWKA 5CAYB 1H0DB 5E8NB 2NXYC 5LG1A 3CFBA 5FGCB 5DMGD 1QFOA 4EIZC 1A2YA 5TFSH 4ODSL 1S7RA 1FAIL 4E5XB 5D4QA 1OGAB 4R97C 3RUGE 5JW3L 2ORBH 1I1AC 1C08B 5D2LF 3Q1SH 2Q86B 3HS0A 2BX5A 5DRXA 5LWYL 1SJEA 2C26A 4HIXH 1B0GB 4UUJB 5I1HL 2R0KL 4MAYC 2JCCE 3H2WA 1UWEH 2OQJA 3D3VD 4MHHI 2EDLA 4ODHH 3C2AL 5ICXA 2UUDH 4YIQB 5F7UA 2CIKB 3BP4A 1X44A 3NA4A 4QKXB 3BDYH 4Z78B 5DUPL 4X9FA 2HJLB 3O6KH 1CE1H 2O26U 2YUZA 5ISZE 1XGQA 2DTSA 2EE3A 4ZD3H 2JJSC 3NCYP 4WW1B 2JIXD 4XVTH 3ORJA 4OKDA 1AO7A 1DQDL 2VLJE 4MB4A 3TIDA 2DI7A 5JOPD 4OKVB 3WS6A 3L3OB 1XZ0A 3MRCB 4YX2L 1BOGB 3FHAA 1LE9B 4UIMA 3MV8D 5DS8A 4KI1A 3Q5YA 2CDGA 5CP7B 3GI9H 3FT2A 2VDKL 4XVJL 5CKAA 2Z0BA 3BDBA 5IFJB 2Z31C 4PJDA 3I2CH 4LNRB 5I1DB 1REIA 4PJ9A 2H2SC 3F7YB 3EOTH 4QXTB 5CILL 5DWUL 4RAUB 1YEFL 2VXQL 2N1KA 3KHOA 1GHFH 1NBQA 5MERB 4N8CH 4O9HL 1HEZA 2E27H 4JO3H 3ARXA 4DTGH 2LU4A 3UTTA 3CX5K 5FYLH 1JWUB 5CSZB 2BP3A 1OAYL 4HGMA 2B5IB 4PD4K 3BZEA 2DWDB 3FB6B 3OKLB 4KK5D 1EAPA 1MWAL 3RKDD 1QSFE 2QEJA 2OL3B 3O4LA 1VESA 5EPMA 3DX9B 3GDBA 3B9KA 4OD1L 1AXSA 1A3LH 4HWBA 1T6WA 2DM3A 4F2MA 1D9KC 3C87A 4ZO9A 4LFHG 2A6JB 2FNBA 4GAYB 4M8VA 5KSAB 5A2KH 5DA4A 1LILA 1YPZA 3TFKD 4LARH 1CFVL 2R2EA 3O41B 5SWZD 3LSOA 1WF5A 5GRJH 3O6FC 3FB8A 4EI5C 5D6CB 1CWVA 3MRKB 4DKEL 1AQKH 4JAMB 1TVHB 1P7KA 3TP4A 4F7TB 5EULV 3STZB 2H26A 3SCMB 3DYMA 2GT9A 2VSDA 1IC5L 2NX5A 3G5YB 5FYKH 3QNXA 1U8IB 5C0BB 5I16A 2BNUB 2Y25A 3T0ED 3U79A 1MCWM 1PYWA 4HLZG 1PG7W 4JCMA 2FL5A 3VW3H 5B3JE 3L9RB 3ALXA 1DBBH 2ADGA 3IXAB 3DMMD 3LN5A 4QYOB 2BMKB 1CGTA 2A0LD 5KS9F 2JB6B 4NO5B 4X6FB 1X9QA 4ISVA 4QHNB 2FJGB 3FFDA 4OCXL 2ZWLT 3I6KA 1KCVH 4ZFZB 1DLHB 1NCTA 2SEBA 1B3JA 1SEQH 2V7NB 3D18A 3G5XB 4NNPL 1EJOL 1E4XL 4GMSL 12E8L 1G6RA 3IFNL 4I4WA 1T1YB 4X6DA 1FG2B 5I1CH 4YO0A 4JFPA 4HBCH 1RUKL 1QYGL 2J1KA 2C1OA 2F8XC 5GXBB 1A7OL 2GY7B 3WIHL 3D0LA 4IOFC 3F62A 5I19H 3TNNA 3LN9A 4TN9A 4M7JH 4FQXB 1S7VA 4MD5A 3FQUA 5D93B 5IOPA 2HJFB 3JTTA 4PRPA 2EDTA 3OGCA 4IOIB 1CYGA 1CL7H 3PV6A 4AT6B 4NQSB 3CSBA 5CIPB 3TYGH 1MCRA 4P9HC 3VMPA 1MJUH 4D0CA 3WO4B 2VL5A 2UVEA 2GSIA 2NZ9D 1YQVL 1NLDH 1A1OB 1BFSA 1K5NA 4A2LA 3SDCA 1T83C 5IR1A 3PWVB 3CX2A 4CN4A 4KRLB 4QOKA 5F7NC 4J1UA 5J89A 2ERJB 4DKDC 2CH8A 1VACA 2BVEA 3N9GH 1DVFB 1F45A 4FOMA 2WK2A 4TPRL 2ADIB 4OLWH 1NUGA 4Z76B 4AG4H 3QA3B 3A67L 1INEH 4RQQB 3ILQD 4XWGL 1KXVC 4QHKJ 2A9NL 1U36A 3BUYB 1HWHB 1P84J 2VZTA 2F5AH 4GFTB 3GIZL 3MUGB 3DV4B 3TNMA 5DQDL 4EOWH 3FFCD 3GJFB 4HGWB 1L6XA 1YN7A 3MV7B 4NOBA 3MLSL 4NDMB 4Y2DC 4M7ZC 1EHXA 4JB9L 3MRLA 1VFUA 3CJJA 1UB6B 5GZNC 3CMGA 3SGKA 5F7YC 4FG6D 1HQ4A 1CD0A 1CVRA 1MFDL 4PY7A 1J5OL 4P2RD 1EFXB 4Z7VB 4NN5C 2YUVA 4X9HA 3L5IA 3EO1B 4PG2A 3CSPA 4NJAL 4KMLB 1J8HD 2CRYA 2O5XL 1I3VA 5GGSB 3ROOB 2BDNH 1OAUH 1B0RA 5I74C 1VFOA 3IDYB 5FGCE 2HVJB 2R9HC 4NQCA 3MCKB 2ADJB 3ZSTA 5JZ7D 4M3KB 4KTDH 3ULVE 2NTFB 3MA9L 4EDWH 5C86A 3ABZA 4NRZB 1OAZH 4PJ8B 5TE6L 3NPSB 1CL7I 2DF3A 2DTMH 1GJIA 1WTGT 1K3ZA 1VFBB 3H42H 2P5WD 3EYVA 4HLZH 3T0VA 4X7FC 5TQ2H 3ZKSD 3FB5A 4LOUD 2D0GA 4PRAB 4YQXL 5DQJA 3PE9A 5ITBL 3OKDA 3V52H 1M7IB 4PJ5D 2Y5EA 1G7MB 3RZWA 5FHBH 3DVFA 4IBLT 5C07D 4KY1H 3GSVA 3QQ3A 4HWEL 2RJMA 3LEXA 2GSGB 5ETUA 1NMBH 1MAMH 3VXUD 2X2YA 6FABL 3SO5A 4WO4C 1AJ7H 4U7KA 4B41A 1JF6A 1YECH 3TO4B 1FNHA 5L2KA 3HC0B 3FFCE 4NM8L 4HWBL 1AIFA 4MNQB 5C0RH 4G6AD 1ORSA 3A6OA 3VXMB 4JFHD 3QHZL 1N7ML 1V3JA 2DQEL 4NKQB 3W39A 4P57A 3S96B 2O5ZL 4I9WD 2C1PB 5KVFL 1FYTA 2R15A 3L5WA 2DQHL 2ZSVA 3IDIB 1CU4L 1EFQA 43CAA 1A6WL 4HC1A 1Q94A 5D7LD 3TJEH 4DUVA 1IC4H 2A73A 1X5IA 3AAZA 2AJVH 5DD0L 5GGVL 3RGVC 1BGXH 2GK0B 1AE6L 4PJHF 2CRZA 1J8HE 1KB5A 4M1CD 1ND0B 3VFOB 4JZJB 1NC4B 4BUHA 2R2HA 3T3PE 1JV5A 3CDGB 1VEOA 2XTJB 3D2UB 3HMXA 2R1WB 4MJIA 5DJ0B 4JPKH 4I77L 2BSED 4L8DB 2HMIC 4OV6F 3BKCL 5IB3A 3AU1B 4HT1H 3NIGE 4MA1B 2E7HA 1U58A 3DXAE 5CZXD 1XGTB 2ITDA 1ZOXA 4WHTA 2P5WE 1FZOA 4C56D 3C5JB 4HMDA 2ZUSA 4M62L 5BMFL 4N0YL 4P59L 3T09A 3ARFA 5T5NG 1WUNT 2NXYD 4POUB 3K80A 4OLEA 5JHDE 3SKNB 4NQED 1EXUB 5JPMA 1UYWL 3QZWB 5KG9A 1FNSH 3UYPA 5E8PA 4PJXF 5BO1L 5MEND 5C07E 1I7ZA 1AHWC 1NQBA 4X4ZA 1G6RL 2G9HA 3DURA 5KSBF 1DQML 3L3GA 1W0WA 3BVNA 4TVPH 4HWZA 1CXKA 4P5KB 1MPAH 4LSTH 4OF8A 3RNQA 5EA0L 4LSSH 4CDHA 5LAXB 4MAYD 4WHYG 1NSNL 4I9WE 5DVNA 2O61A 3MJ8B 5I8CB 3PL6A 5I1EL 3GB7A 4GXVH 3VXRB 1I8MA 3VXQB 3BEVA 3CXHJ 4NPYB 4XVSL 5D7LE 1HINL 5ID0A 3MODH 1S7SB 2ZCHL 3DO7A 4WEBH 2E5EA 4IM8A 1A6UL 4LLQA 1U8MB 3O9WA 4PS4L 3PABB 5FO9B 2DLIA 5D72H 3HNSL 3WYRA 1GGCL 1WEJH 5IFAL 5EU6A 4MCZB 4LP5A 1DJSA 1UEMA 4RAHA 3GSUB 1H15B 2APVA 3HAEG 5IGXH 2Q8AH 1ZKAA 1BQHG 2ZNWA 5CBEB 4XVUC 4F15B 1VGKB 4GW1B 1KBGL 5C08D 4B50A 5IEHA 4HQQL 2EECA 3BKML 5I9QB 4I5BB 1CZ8L 4WFGE 3NN8B 2Z31D 5B39A 5E94A 1WCQA 1SJVA 2EDWA 2H2SD 1A6AB 5CD5C 2AABL 3DHJA 4HXAL 5ALBL 4BKLB 2QQKH 4IRJC 4GW5A 3ZKNC 1ED3B 1J88A 1QQDB 4LLYA 3WDIA 5MENE 2MHAB 4YXHL 2XRAH 2BSRA 3BKJH 3GBNH 5ALCH 4S0TD 5LBSH 4MXVF 3MPCA 3LCYA 4K9EL 4YLQT 3ZE2E 2N7BA 2W65A 3HG1E 4D9LL 3IVKA 4XC1H 3SDYL 3UJTL 2VIRA 1ZANH 5EOCH 3IS1X 2EC9U 3WNMA 3JSSA 3W81A 3LPFA 1T7WA 1HILB 4G9DB 3DX8A 4B7IA 4G8GD 2W0LA 3EDFA 2FD6H 2WBJC 4LLVB 1RK1A 3ZKQD 4X6EB 2F8VA 4Z0BH 4NBXB 3NIFF 3PG2A 1NFIB 1D9KD 5BVPL 3K4AA 5FA4B 3MGAA 5MEPA 3JTSA 2XA3A 4JFOB 2FGWL 3O6FD 5K33A 4EI5D 3TN0B 3QSKB 2W9DL 4J3SA 5D1ZB 3KS0J 1XCTA 4DAGL 4GQ9H 2Z8SA 4P46A 3Q3GA 5D5MB 4I3SL 3OHXB 1R3IH 3G6JB 5MEOB 1DQJA 1KTRL 4JHAL 3RY5A 1F4XL 5AWNH 1OP9A 4JM4H 2NY3B 4G8EB 1IGJB 1ZLSH 4RFNC 5IJVB 4YJZL 1S9YA 2G60L 3CU1A 3BP5B 4PGJA 4MS8C 3WKNA 3VD9A 4JR9L 4EI6B 3QG7L 4WI3A 4UOW0 5E9DA 3BE1L 4Z5RB 1NFKA 1IAIM 3Q5TA 5J13C 1DUYB 2R0LL 5DJZB 2VAAB 2V2TA 1L7TL 5D7SH 3VU2A 4GKSA 3WKMH 5LGJB 2D03H 4C54A 5T3ZE 4YFDB 5CD3A 5EO0A 4M7LL 2BRRL 4K23L 1S7UA 5FB8B 4TTGA 1RY7B 2F54A 1QSEA 1IM9D 4HC1L 4PR5B 3T4AB 3GMQB 5IVXF 3C08H 2BSSB 1E27B 5EUOE 2QSCH 2BNRA 1U3JA 4YXKH 4WHYH 1TMCB 2YPVL 2DJUA 1KB5L 3ZMRA 2AV7B 4G8GE 5D7JC 2J4WL 1KCSH 1T21B 3VA6A 3X17A 3HMXL 3MZGB 3FRUA 4HD9A 3KPNA 4IOFD 4JN2A 5IVNA 3WUZA 4NZUH 1L4IA 3VH8B 2Z93A 3ESVF 2FX9H 3EYSL 2DQTL 3HNTH 3OG6B 1MY5A 1LDPL 1CD1A 3HAEH 3V4PL 1UJ3C 3VGDA 1TITA 4YFLF 1BBJB 1QBLL 1QEWB 2DDQH 2FB4L 4JQVA 3QPQC 5FKAB 4WFHE 1OPGH 3S35L 3HUJB 4CN6A 3O3AA 2B2XL 3SQBA 1XF2B 4L4VA 3FO9A 3RIAF 1BFVL 3VGAC 4JZOB 1Q9LB 3QR2A 5HHVL 2X41A 3VXME 4MWFA 4NQUA 4HFWA 2CD0A 5L8JB 1ZT7A 2G5RA 5SV3A 4AMKH 3KYMA 5EZLB 4RGNB 4N0UE 3DVNA 1MRCH 3TZVC 4XXCA 2DQIL 3T4YB 1E4JA 2G5BA 4PJCF 1HHKB 4UINL 2ZOLB 3QPXL 4JDVB 1IKNC 3M1BB 2R0WL 2PO6B 5H2BA 1VERA 3BMWA 3HZVA 1HDMB 1NUDA 5D7IF 2Y7QB 1T5XA 4U1LB 1LMKA 3IJHB 5ACZB 1XR8A 4YNYA 4IRSB 3H9HB 2CXGA 4Y2DD 3T3MF 4ALAH 4R7NA 1NCWL 1KN2L 4EUPB 5EOQH 2XTJE 1VKXA 3ZT6A 4S1RL 1LD9A 2NY1B 3NA9H 4O58L 5GZND 4RMRA 3ZKXC 1IEHA 4M3JA 1CN4A 3OSKA 3NACL 1T6VN 5IK3A 3UTSE 4F8QA 4PGEA 1TENA 4FTVD 4L8SA 5FO8B 4PRNB 4ORGA 2X70A 1ZLWK 3O2WL 4HIHA 4JFDA 4LEOB 4LLUB 4E41D 1U3YA 3DARA 5HI5C 3RUGA 3VGFA 4YFEA 1CG9B 2R9HD 1QLFA 4FZEL 3WIFB 4FQIH 1ZTXL 1OLLA 4PRHD 1N8ZB 4UT7H 4WDIB 4PGDB 3C5SA 3RHWF 4X99B 4HUKB 3AGVA 4MQ7B 1FO0A 3HFMH 1KTKE 3SKMA 3S8WA 3D85B 3ZSSA 1J1OH 3TT3L 4N68A 3SGDI 3MRQA 3EGSA 1KXTB 3L6FB 1XR9B 4OCWL 2COQA 4L4JA 4PLNC 3VD5A 2C7UA 4PBVC 2DRUA 4OI7A 2VOTA 5ISZA 2E9IA 4HJJH 5IB5A 2DYPB 1U3ZA 3VXRE 4MDJA 5F7KC 3ARZA 4WO4D 4CMHC 2VLJA 2IFGA 1HZHL 3OXRA 4D0DB 5F3HB 3QDJE 1I7UB 5DZLA 3OF6A 4OI8A 4LNVA 2NY6B 2B20A 4EZMA 5IB1A 3QEGH 1N4XH 4EEEA 2R23B 5TQ0L 3KXFD 1PQZB 4NCC2 5C8JB 1VHPA 6CGTA 2ATKB 2B4CC 3VFSB 5EN2B 2EYTB 4AEEA 1AXTL 4WY7L 4G9FE 3C9NA 4FTVE 5ACLA 1A4JB 5HHPA 1YEJH 5HY9B 1T0PB 1XF4A 3A6BL 1JNLH 1W72B 5BZDA 5HDLA 4QRQB 4E41E 2YBRB 4P4KC 4YHOH 5EWIL 3EOAA 3S3JA 5FHAH 3PGCB 4KVNH 3R06B 1DE4A 1JPSH 1UJTA 3WUWB 1YEEL 1JZ8A 3H9SA 4W6WB 1RJZB 3LV3B 4GG6B 4P5TB 2HMID 4PRHE 4FABH 1U93B 2YPKA 4XMPL 3SKJH 4IDLA 1M71B 4LBEB 2AVGA 3V7AE 1RZ7L 4KKAC 4Q74A 2OS7A 1QSFA 3QFJD 3QWRA 3RWEB 1HHIB 3AM8C 5C2UB 5FKPB 4PJFF 4M1GL 4OZHF 2X05A 2XT1B 4HK0A 4X4MA 2FO4A 1CLYH 3PGFL 4RGOH 5HYJD 4WW2A 3SEPA 4K94L 5D1XC 1K4DA 3TCLA 3V5KB 4OCRH 2R56L 2CR6A 5EUKB 3IF1B 5FM5O 3QFDA 5EU7C 2CGRH 5GJTL 2ESVA 1TJHL 4N8PA 4F7MA 4U0QB 1ZGLA 1AC6A 1KELH 1A7NL 1JHLH 5DD5L 3RWFB 1PBYA 2D4FA 3IDGA 2R1YB 5E5RB 1NUFA 2Q1EA 2MSPA 3WNPA 3G9VA 4GS7B 4I48B 3RDTA 2Y36L 4JJHA 3KG5A 1I7RA 3HHRB 2H32A 2R2BA 4TSAH 2YC1A 1S9VA 5HHMD 4WU5B 1P4LA 3HI5L 3G6JE 5HGHB 2OYPA 1M7DA 2Y6SC 1CGYA 1J1XH 2ZKHL 1KCRL 3RBSA 5LGHH 5HGDA 3V0AC 3OB8A 3V6OA 1GRWA 4Z8FH 5SV4A 4UB0L 4O00A 1CF8L 1RUAH 1BPVA 4F7EB 1BM3H 4RWHA 2YMXL 2A1WH 2IALB 4JZNA 3QI9B 4OJFL 5I75C 1L9NA 3P30L 5ABDE 4IDJL 3T2OA 4NO2B 2BNQE 1QO3B 5I71B 1ZVHA 1GAFH 2J5LC 5JO5B 1X4ZA 3QFJE 4IIQC 5T5NF 3WSQH 3X12A 2WWKT 4LQFL 4NN6B 5CGYC 4J6RL 1EEYA 2BY3A 3OJMB 5CD5D 3O45B 1SJHB 2AAVA 5IMLB 1PY9A 5D2LB 5HYJE 1XCQB 3ZKND 3OR7A 5EFIA 3DYPA 4GMTL 2ZPKH 1A4KB 1AP2A 2NY0B 3O3DA 4I18A 5E6ZA 4DGVL 3VFMA 4J8RB 3BQUB 4LIQE 1FFNA 3OAUH 4JKWA 4KJYB 4UT6H 4UQ2A 1ZGLM 2VXTH 2A6DB 2V9QA 2W9EH 5JPNA 5KTEL 4OSUH 4X6CF 5I30L 1XGYH 1N5YL 1UCTA 4DZ8A 4LCCC 1KV3A 2WBJD 2Z8VC 4TUJA 1JFQH 3MYZA 1DFBH 2HFGH 1U8LA 3CFJA 1JRHL 3F12A 3UJJH 3RIFK 4X6BA 4V1DB 4FFZL 3C60B 1NDMB 4CVUA 1KJ2A 4HIJA 2OBGA 1FO0L 1QRND 1EHNA 5DTFB 2VDRH 3RP1A 4TNVF 4UZGA 4XPAH 3ZYOA 5IW1B 1XGRA 4RGNE 3U36A 5E24E 3NIDF 1LP9E 1EO7A 3TO2B 3GI8L 4I13B 5ECJE 3VWJB 3QISA 4O5LH 3DIFB 3P9MA 5E7BA 1Z2KA 4JQXC 4F58H 5HXMA 1WBYB 4ZXBB 2ZG3A 1D5XB 1Q0YL 4YDJB 2V5YA 5L0QC 1NCBH 2ILLA 3NH7L 5AD0B 1ZLUK 5E00A 3UP1A 3QNYA 2ZJSL 4AIOA 4OIBA 1FNGB 4IMLA 2DAVA 2Z8WC 3VXSD 4YDVA 4OGZA 3OKNB 2XQYG 4MS8D 5I15H 5E2TH 3E3QC 5F6IC 4D8PA 2K3TA 2W91A 1ZWIB 5AYUL 5DURB 1T7YA 4HS8H 2MCPH 1S8DA 1H0DA 3O3EB 4KKNA 4YPJA 3C8KB 1JMZA 4LCIH 3VFNA 4L5FL 1NAMB 3FQWA 1D5MB 3OQ3B 4GW4B 5BJTB 4LPCA 1MHHB 4E5XA 3HNVL 3RJQB 2VN7A 1Z5LA 5K9QI 1PG7H 3B2UC 4OFPA 2QV2A 1C08A 1ONQB 5IESH 1FZMA 2Q86A 2VRAA 3WXVH 1RZJH 1AR1C 3PHSA 4NM4L 5D7JD 1CD8A 1J1PH 1QG3A 4N8VG 3TVMC 1B4JH 4JN1L 3K2UL 4MCYA 4ODUB 4HWNA 1YDPA 1PY4A 1A7QH 2FEDC 2MKWA 2BC4B 4YIQA 2CIKA 1FNEB 2VDOH 1A6PA 2FJFB 3BRGC 3LKPB 1MCBA 3FFCA 3IU4L 5F9DC 4PRIB 3S36L 1MLBB 1NEZB 3QPQD 2A83B 4WUKH 1NL0L 1YN6B 1JGLL 1GZPB 1RVFL 1MAJA 2HRLA 1KCUH 4OUUB 3MREB 4N9OB 5ICZB 1QHOA 3AC0A 3SHSA 5I1KH 4FXLA 1G7LB 2H1PH 1CLCA 1BOGA 2RGSA 3HKFA 2HKHL 4B5EA 1WJ3A 4HIIB 1RD6A 3FQNB 1EGJA 4OZIE 1LO2H 3WDJA 4ZTOL 2EZ0C 4FNLL 1X7QA 4LF3B 5HDQH 5IFJA 3BPNC 5I1DA 4KRNA 1ACYH 2VISB 4XP6H 3KYKH 4EDXB 2VZOA 4F57H 4U7MA 4PV8A 5M7QA 1QFWM 5HJ3A 3WO4C 4YE4H 2GJZB 4KRPB 4MDIB 5F6HI 4O4YH 2VZSA 1AXIB 5A3IC 3DXAA 2ERJC 1AGEB 4Q2ZB 1JWUA 3LMJH 2A2QT 5A16B 1SEBB 4XPGH 2P8PB 4YR6B 1DVFC 4N0FA 2DWDA 3NVQA 3X11B 3LRSA 3AXLA 5CFHA 3OKLA 3U9UA 4QF1B 3QUMB 5CJOL 4OM0H 5JHDA 4UV7L 1JPFB 1A14H 2OL3A 3IYLW 4WI7A 3DX9A 1DQLL 2ZUYA 3VG9B 1I3GL 1CIUA 5L88L 1TETL 5HI5D 4YWGL 4QXUH 3ZYJA 1RZFL 2R0ZH 5F9WB 2NW2B 2R29H 2A6JA 1DBJL 4GAYA 3NTCH 5DK0B 4PG9B 1VGEL 4CMMA 3NMEA 3O41A 2F74A 3CFCH 3ETBF 1FE8H 1HKLH 3P2TA 5D6CA 1CLZL 3V9FA 4JM2B 3KDMA 3MRKA 1MI5B 5MI0B 1AKJB 5F9OH 1TVHA 1D6EA 3QDGD 1WWCA 1JZ7A 1EA9C 1UC6A 3SDXB 4UT9L 4G5ZH 3SCMA 4PLJC 1V7MH 2IG2L 3ARDA 5K9OB 3JV5A 4Q58C 3LOWA 5TDPB 4NWUH 1U8JA 5C0BA 3WEXB 1VFAB 2BNUA 1ZMYA 4JCLA 5CUSH 4OD3L 3QDMD 5T1KB 2GAZB 3VI3E 1URLA 5JR1H 4FQ1H 3LS4L 1LK3L 2NW3A 3C6LB 5AAWA 3HB3C 1QP1A 4JPWL 1T0MB 5DHVH 2AK1L 4JO4L 4K3JL 2HA1A 5GHWH 4Z0XA 4WU7B 2EO1A 4G6KL 1C5DA 2BMKA 1FG9C 2JB6A 3QULB 2KUTA 4MNGB 4NO5A 1GOFA 1KJ2L 3MNWB 4QHNA 5CMAB 5KN5B 1DLHA 2GEEA 4RAVA 4ENEC 3MBED 4J4PC 1NGWB 4QXGH 4G3YH 5TE7H 4ZFFB 4OF7A 4ZOAA 1T1YA 3E1F1 1FG2A 4Z95H 4MAUH 5SWSE 5IB4B 3STLB 3FO2A 2ZOKA 4R7DB 3HC3H 1A9BB 2VITA 3VMNA 4WJ5A 4P4KD 4MSWA 4RWYL 5TH2B 5JDSB 5CJXC 5J0BA 2GJJA 3PDOA 3W0WB 1I1AA 1UA6H 5E2UL 3PWLB 4F80A 3MRMA 5ESAB 3HG1A 1JGVH 3DI3B 4FQXA 3PIQB 3BX7C 3FKUS 2HJFA 5ADOL 5EIQA 1P4BL 4DFIA 4E42A 4AT6A 4NQSA 5EZJB 3KPRE 5CIPA 5EC1B 5F3BB 3UTZB 4Z7UF 4KKAD 2EE6A 5GS1C 1QACA 1QFWL 1IGTB 5D70H 3QDGE 3MXVL 5CEXB 2Q3ZA 1A1OA 4YHKH 4H26B 4XP4H 1ERNA 1Q0XH 5DMIH 3PWVA 4U49A 3ULVL 1EX0A 4ZAKC 5J7CC 1QPXA 4UOW1 2CR3A 4HH9B 1FRGL 3KYAA 4KMTL 4M5YH 2ZUQC 3VRJB 3QDME 4NQXB 2VABB 1YUHA 4APQB 2VDNL 2AJUL 3OL2A 1HYRC 4DCQA 5I6XB 4Q9QH 3QEUA 2PYEB 3MROA 1KCLA 4NCDA 4DK3A 4PREA 3BUYA 1ZHKA 3TH2T 2LU3A 5DMKB 3GSXB 4ZUUB 5L9DL 3GJFA 3LQAL 4FQ2H 3DUSB 2BERA 5C0CB 2DLHA 1RUPL 1X6NA 3MV7A 4P3DB 4NDMA 4PJHB 3F7VB 1WBXB 3RI5K 1R3HB 2Z31A 3V6ZB 1YQ2A 5TF0A 1UB6A 2Y6SD 3BPOC 4OF3A 1OGAD 2YD6A 3OJVC 1UADC 1EFXA 2OSLB 3ARGB 3BRFA 4TSCL 3I75B 1DLFH 3LKOA 1H5BB 2XV6B 3AVEA 3C2SA 4ODSH 3TT1L 1FAIH 2QKIB 2HG5B 2FECI 5JW3H 4EVNB 3B9DA 5JLZB 5B3NA 1O7SA 1XGPB 2VQ1B 5GGSA 1EGJL 1XEDA 2F53B 2FX7L 5EUOA 5LWYH 3LEVL 3MCLH 1A6TB 4Y7MA 2ADJA 2FATH 3NCMA 1PDKA 3AMKA 4L9DA 3QYCA 5I1HH 3O0RL 2R0KH 4PJ8A 4ZPVA 4IHOB 2LAGB 5IQ7L 5CGYD 5J1AB 4N90D 5KSBB 3R8BB 3UX9B 3C2AH 1E4WL 3ZHKA 1KEML 1JWSB 4WV1B 4XAWL 4BZ2L 4LVHC 5EG6C 4JFFD 1M7IA 4DEPC 1G7MA 5GQBA 4LQ1A 7FABL 3UYRL 3G5ZB 4Q6IB 2FGZA 1DQDH 3VDBA 5T1LB 3RGHA 3TM6A 2OL3L 5GZOC 2HT3C 3D5OF 3TBYB 1V05A 1DANU 2DQJL 3P77A 3VXMA 1LDSA 4NFDA 5DRNB 1OM3L 4KU1A 1KJVB 2XOTA 2VDKH 4XVJH 3ZHDA 3GGWB 2AI0L 3BGAA 4Z7OF 2A6IB 2C1PA 3MOAL 3U4EB 5KANI 2P7TA 1V7NL 2FBJL 4N0UA 1EVUA 3IDIA 1TQBC 1OAQL 5CILH 5DWUH 1YEFH 2BVPA 2VXQH 4QRUA 1LO0L 4U3CA 1RHFA 4MB3A 5KS9E 3KPPA 2CO6B 2IEPA 4O9HH 1MH5B 2PCPB 4S1DC 3QCVL 3CD4A 1IM9A 1A7RH 2BOCB 1RZKL 4Y4KB 3CH8A 4JFXA 4JZJA 5IJKC 2A9ML 4UDUB 4YDKH 4K8RL 5L6YH 3CDGA 3RWHB 1WAAE 3D2UA 2R1WA 3FZUC 4NQVA 3EFDL 5DJ0A 1OSZA 8FABB 5KVEL 1OAYH 3WLBA 4K55A 5LQBL 5CEYA 1OP5H 3UTSA 3W9EB 3AU1A 1BFOB 5TGBA 1T89C 4OD1H 3C5JA 4JRYB 1I8KB 2VN4A 5GRUL 2I07B 2VLKB 1U91B 4KJQC 5EBWB 1EXUA 5BV7L 3QZWA 1CFVH 1KG0B 4KUCF 4QGYA 1PZUB 2H41A 4KHXL 4NQTA 2V6HA 5CJ8A 4DKEH 3B2UD 3F5WB 1HXYB 2VUYA 5SX4I 3MLWL 2HKFH 1T83A 1AR1D 2X44D 1WZKA 3GSOB 4NSKB 1KLUB 1IC5H 3S4SA 3TVMD 1KLFA 3GUTB 1QKZL 2FEDD 2XY1A 5E08H 4PJGF 3SGEH 3MJ8A 5E8DL 5I8CA 1MJ8L 2NY2C 4ONOA 1FL5B 3VXRA 2AS5M 4MD0B 3VXQA 3BN9C 2EDNA 1A7BA 4M43L 5HHNB 4YFLI 4YEFA 4KUZL 4RZCA 1BECA 5EIVA 2P8LA 3QDJA 2BVUA 1NCAL 4DGYH 3PABA 5FO9A 2A74A 5FUCE 3JWOL 3TGXA 2WWKO 3QUXB 4OCXH 2C3GA 3GIVA 5F1IB 1SBSL 3GSUA 5ITFB 3ZDZE 2XZAL 1KN4L 4NNPH 4GMSH 1IAKA 12E8H 4U1IB 3IFNH 1VGKA 3BO8B 1UEYA 3U46B 1CFQB 1IEBA 2XPGB 3L3JB 4G9FA 4FTVA 1U6AL 3E3QE 1F4WL 3CVHB 2EZ0D 1A7OH 3NABH 4I5BA 3BP6B 4FMFA 1TLKA 3WIHH 5C3LD 4W4NA 3NN8A 3CPLA 1JPTL 5IVXB 5C1MB 1A6AA 5F88B 1X5FA 4PIRF 2GTWB 1GGTA 1E4KC 1ED3A 2P1YA 4MJ5B 3QIBC 2V5RA 1RFDH 1S78C 4PRHA 1GVIA 3F8UB 3Q0HA 4C83A 5A3ID 5F6HJ 3KVQA 5DRZA 3RA7L 1CBVL 2HT2D 1YQVH 5IIEB 3JUYA 2JCCF 5T3ZL 3DO3A 4YHYC 1UWGL 1CS6A 1DVFD 1A1MB 4X5WB 4RIRB 2C3VA 5EU5B 3QWQB 4G9DA 4ONGL 1HCFX 5BQ7B 4YHML 2O5YL 1N64L 1MJ7L 4JFYA 3UTOA 3F7PC 4PJAF 5I0DA 3DPBA 3X3FL 4BM7A 5DFWH 3DRTB 3EYOA 3QDAA 2WP3T 3X14A 4P3CL 1B6DA 5C0AB 4TPRH 5CINL 1NFIA 3BW9B 1NGQL 4URTB 3IKKA 1AGFB 4FXGB 4GH7B 2A9NH 4ONFL 3E2HB 5FYLD 1F2QA 3SGEI 3GIZH 1E28B 5DQDH 5I2IA 1ROWA 3CK0L 3TN0A 4E9LA 3ZL4L 1EEZB 3Q2CA 4NIKB 4AEHL 1BX2B 1J05B 4JGUA 3MLSH 5D1ZA 5M94B 3TIEB 2IANE 5C2BL 3W5NA 4N0CC 4JB9H 3DHMA 3U7WL 2KZ1B 2IQ9L 4JY5L 3G6JA 1WV7T 2BJML 3BN3B 4PLJD 5MEOA 4R8WL 1NGPL 3TEUA 1MFDH 1MWAB 1J5OH 3GFUA 1NBYA 3HR5B 3RGVA 1E4XI 5D7IB 1IGJA 4PJHE 5DVLA 4EI6A 3ARTA 4P2QD 3HB3D 2O5XH 2NY4B 2MQ3A 1LEIB 1DUYA 3GMLA 4HZLB 5GS0L 2VAAA 2VXSL 1OARL 3MRJA 4XMLL 2HRPL 4QRPE 2IPUK 5SWQB 4JO1L 3MR9B 4QHMB 3V0VA 4ZNEE 5ANMB 2BNQA 3MA9H 4TSBL 4XCEB 2ZCLL 5CWSB 5FB8A 1G84A 4IOSD 5TE6H 2EDXA 5FYKD 2D0FA 4OAWB 3T4AA 2ICES 4JGMA 5JXAL 3LDBC 4GRLB 2DMBA 5DJ6A 4ENED 2BSSA 2F53E 1LO4L 1U8NB 4AQOA 5CJQH 3S36X 3UPAA 4P23A 5ITBH 2ICWI 5HYJA 4O2FA 1K8IB 4PJXE 1G7QB 1T21A 4NKMB 3GKWL 3QH3B 2XWTA 3TO4D 5DR5L 1TTGA 4MNQD 2I27N 4HWEH 3SDDC 3BT2L 3BYTA 5EO9A 3MSPA 1H9VA 2OR9L 4JPIA 3TA3C 2L7JA 5J06A 4QRTA 2EE9A 5A40E 5JXEC 4NM8H 1KPVB 1ORQB 4JY6A 3F65A 4N5EC 3GM0A 4P99A 5F96L 1A1NB 4O2EB 1YYLL 3QHZH 5DC0A 3ZKMC 1N7MH 2DQEH 5FECA 3SJVB 4K71B 4DN4L 5FKAA 2CJUL 1EZVX 2O5ZH 1U8HB 5GRXG 3VJ6B 3L3IA 4LHUA 5CGMA 5KVFH 1P7QD 2DQHH 1CICA 2XKSA 4ZAKD 1CU4H 3W2DL 3O6LH 1A6WH 2AJZB 3VFGL 2AXFB 4Y89A 1K8DB 5D1QB 5GGVH 2OMBA 5FYJE 5H94B 1T3FB 4J3WA 5EZLA 1FC1A 4P2QE 4K07A 3TBWA 1M4KA 5INDB 1TTUA 1J9CT 1PW3A 5GGRB 3MGTB 3RWGB 1W0VB 1Z9LA 2CLZA 4XCYA 2XWJA 3DV6B 3M1BA 5DGRA 3BGMB 2F8OA 4I77H 1HDMA 4L3EE 4WWKB 2EC8A 2Y7QA 3BKCH 3UYOD 2LV4A 1CFSA 2EDYA 5LJYH 3CFBB 1IM3B 3OWEA 4IRSA 2ICWB 3HZMB 3H9HA 4LCWD 4B0MM 3T1WA 4EUPA 4ZO6A 1S7RB 3RFZC 5HBBA 3T77B 3VDAA 3QUZC 4M62H 5BMFH 4N0YH 4P59H 4G43B 1INQB 4IRJA 1MJJB 1UYWH 1YY8B 1T5WA 5FO8A 1MNUL 2DBLH 4MXVE 4PRNA 4WGVB 3OAZK 3VI4F 1G6RH 4LEOA 2DQUL 2EKSB 4WUUD 3MBXL 4BZ1L 1PSKL 2DKUA 2XN9D 3MA7B 2UZXB 4PJFB 1FORL 4OZHB 1J0IA 2UWEE 5ICXB 3HE6C 4ZPTA 5LGKA 1Q9KB 5K59F 1N8ZA 4ONHB 1I9IL 3KLSA 4LFHD 5AUMB 3E0GA 4PGDA 1NSNH 3NIFE 4L8CB 5HHXL 5HHOD 2DQGL 4JDZB 5I1EH 3PGDA 4Y19B 4FP8L 4XVSH 3N06B 3L6FA 1XR9A 1CGXA 1MFNA 3QI9C 4TUKL 4NO0D 1YEDA 1RULL 4RMQA 1A6UH 2FIKA 1QSZA 3OTTA 2QHRL 4UIMB 5DS8B 1Z9MA 2DYPA 3TCXA 1X5GA 3HNSH 2R4SH 1GGCH 4JFZH 3VGGA 5IFAH 2JE8A 2ED7A 3VXOB 2HT3D 4G8FA 2P5EE 2K1MA 1ITCA 2OJEA 4NN6C 1KBGH 1EMTL 4G6JL 4LCWE 4X4XA 4GKNA 3BKMH 4OZIA 4MA8L 1CZ8H 1F58L 4LSUL 1RURH 5C8JA 4YC2C 5DUBA 5DO2C 3UTTB 2AABH 4HXAH 4NQDD 2NY0C 4V2BA 5ALBH 5EN2A 2EYTA 3BQUC 5GS2H 1I75A 4JHBA 4OZFA 2W0PA 1A4JA 2VZUA 3P11L 4YXHH 5GS3A 2W07A 4S1DD 3ZHLA 5F97E 4X7TB 3O2VH 4QRQA 1KJ3L 1OSPL 1MHPL 2YBRA 3DSNA 4K9EH 2J12B 4D9LH 3SDYH 3UJTH 2XN9E 1BOYA 3EZ8A 2PF6A 5EPMB 3B9KB 1AXSB 3FZUD 3BGFC 3WUWA 4F2MB 5I1LB 2JELL 5D7JA 1RJZA 2APXA 3LV3A 4P5TA 3RU8L 1T2XA 1YPZB 4LBEA 4HGKC 2R2EB 3LSOB 2AV1B 5BS0D 3FB8B 4LL9A 1UM5L 1HHIA 5BVPH 5FKPA 5EC2B 3DUHA 3QUKA 2X4SB 4Y4FB 4P2OC 1KUMA 4KJQD 1T04A 3V5KA 5IF0B 1D6VL 4X6CB 1UJ3A 2FGWH 2YD3A 3NGBB 2WUBH 2GT9B 5JA9A 2NX5B 4L9LB 4DKFL 2W9DH 3QNXB 1L0XA 2LTQC 1PYWB 4DAGH 5E6IC 5B39G 3VGHA 2FL5B 4YK4B 4HUWB 1AD9A 4I3SH 4KQ4L 3UC0L 4JHAH 4LIQL 1F4XH 1MCJA 2ADGB 2P45B 4Z6AT 4I48A 1F4AA 3LN5B 4Y4HA 2G60H 3TZVA 5JIIA 2NY2D 4IRZL 4JR9H 3CFIC 4PJCE 3BE1H 4NQDE 4GRWF 3FFDB 3BN9D 5DI8A 2AJSL 4LAQL 2R0LH 1WZ1H 1EBAA 2SEBB 1L7TH 5IMOA 3GRWA 4LLWB 5D7IE 5EBGA 3V6FA 4TVPD 4I4WB 4X6DB 4M7LH 4YO0B 2BRRH 3AS2A 4K23H 1RUQL 2X4TA 3WD5L 4F7EA 2QADC 4HC1H 2C1OB 2C9AA 1WSST 3QEQD 2YPVH 1KB5H 4LAJH 5ANME 3PWPB 2YS4A 1S7VB 2J4WH 1QO3A 3FQUB 5IOPB 5SWSA 3SOBL 3HMXH 3OGCB 4GJTB 1FFQA 2Y07L 2GHWB 1FCCA 2NXZB 1A21A 4LK4A 1JF1B 3QBTB 1QFPA 3QXAB 3O45A 5IB2B 5D2LA 4ETYA 5J12B 3EYSH 5I1AB 3SDCB 1FVDB 5IR1B 5FM4A 3UZQA 2V9TA 1LDPH 1NCCL 1S78D 2FX8L 3V4PH 2WNGA 4QOKB 1A4KA 4J1UB 2WBKA 1E6JH 1QBLH 3CXDL 5M95B 1CTNA 3KPRA 4KJYA 3QAZC 3FCTA 1VACB 3S35H 5HYIA 2B2XH 4R4NC 3ESUF 2F15A 2CLVB 1BFVH 3QDGA 3LEYL 1QBBA 2R4RL 4OCYL 5DMYA 2OJZL 5HHVH 9CGTA 4LVOC 5F21B 1Y18A 2Q8BL 4RFEA 3SE9H 1EHLH 1UZ6E 3TNMB 3QDMA 2PO6D 4PPTA 1HHHB 1EEUA 1HN1A 2DQIH 5BRZD 2VR4A 5MHSE 1BJ1H 3CFEA 1LO5B 3BMVA 4UINH 3QPXH 1NDMA 4Q9CA 4F37K 3BISA 5FOBA 2R0WH 4TVPE 5DTFA 2ZUWA 3U82B 3WHE0 5I8KL 1HQ4B 3AREB 3E6HB 1Q8MA 2CUHA 5D96C 1P4IH 4N0CD 3QEQE 1NCWH 3WN5C 1KN2H 4XNYH 2YA2A 4JREC 4S1RH 4Y5XC 4O58H 1WBYA 2AQ3A 4U33A 4ZXBA 1D5XA 3NACH 4U1GB 4DUXA 2V7HA 5AD0A 3VG9C 1B0RB 1QNZH 1F6AA 4AL8L 4NQCB 1A7PL 1FNGA 5F9WC 2ITCA 2BHZA 1BD2D 3O2WH 1FIEA 2P46B 1L9MA 1FLTX 2F9BT 4JKMA 5C92A 5FCSH 2MQCA 1N0LA 4UI2A 5DK3A 4JM2C 4FZEH 4PGBB 3ARBC 1LEGA 4UBDC 1ZTXH 5DQJB 3JVGA 5BJTA 3OKDB 1MHHA 2EEBA 1IGYB 3OAYK 2WBWB 4LEXL 1S9KC 2AXHA 1T1WA 4I0PC 1JHKH 3GSVB 3I3EA 3TT3H 1O0VA 3SE4A 4PGCA 5ETUB 2EC9T 2Y72A 5D1XA 4OCWH 4HPOL 3REWB 2ICWJ 2IF7A 2NNAB 5KSVA 1JWMA 4ODUA 1ORSB 5BRZE 5HPOA 3U1SL 3SDDD 2LFGA 4Y19E 4LLMA 3W39B 4P57B 3TA3D 1OW0C 1YYML 2BVYA 5JXED 1HZHH 2FJFA 4N5ED 2ZSVB 3KNBB 1FPTL 4KROB 3PQYE 5KVMC 4HDIA 1RZJC 4KK8C 1Q94B 3ZKMD 3WFHA 2APWA 2VTFA 3WNKA 1YN6A 5BOZG 1ETZA 3S5LG 4NRYB 3NFPB 3VXTB 5DUML 1FV1B 5TQ0H 2I60L 1KB5B 1C5BH 1N2RA 2YZ8A 4XNZC 3O11A 3K81A 2R2HB 1G7LA 1RJYB 1AXTH 1QTYT 4FFVC 4WY7H 3HA0A 4HIIA 3FRPA 2GJ6E 2VJXA 3FQNA 3A6BH 1BD2E 5KS9A 3EUUA 2FWOA 1CR9L 5EWIH 1BF2A 2BCKA 1U58B 2NY5L 2ITDB 5DEZA 2PXYC 1YEEH 1JGDA 1FZOB 4G7YL 4JRXD 1WAAA 3ARFB 4M6OL 4XMPH 1F13A 5KG9B 1G6VK 4MDIA 1RZ7H 3HE7C 2NZIA 3LKRA 1IAII 2DB8A 3ULUL 1AGEA 1YMMD 3QUZD 4PB0L 4Q2ZA 3B6SA 4M1GH 1TTFA 5A16A 3WE6B 3L3GB 2P8PA 5DYOB 3OKYA 3PGFH 4K94H 3X11A 3CVIL 5IKCB 1ZV5A 3BVNB 2R56H 5TF1L 1L7IL 3QUMA 1OLZA 2B39A 5J4MA 1FBIL 5GJTH 4Z7UB 1CVSC 1TJHH 4YPGA 4LASL 1IT9L 1A7NH 2LVCA 5DD5H 5FGRA 2NW2A 2Z4QB 5JHLL 2O61B 3DUUA 2AK4B 4X6CE 2YSSB 3DVGA 3GB7B 3HE6D 2WIMA 1QLEL 2D9QB 3D1MC 1FVCA 2MKLC 3KGRA 2Z35B 3TPUB 4K2UL 2Y36H 2WAHA 3G6DL 1AKJA 1XIWC 3HI1A 1A5FL 4LLQB 5J57B 3ARGC 4ZTPH 5EU6B 1H3UA 2ZKHH 4NZTL 1KCRH 2YRPA 5E4EC 3QI9D 1M05B 4UB0H 4OLVL 2DLTA 2R69L 1CF8H 1R3JB 1MCCA 1HXMA 5IEHB 4JGJA 1P53A 3DI2B 2YMXH 5IHBA 3C6LA 1JYVA 4JRXE 1BMGA 4OJFH 5CLWA 1OQOA 5DD3L 5BVJB 3P30H 5B39B 4IDJH 1G0XA 4WFFD 4HBQA 5DF0A 5ID1A 4GW5B 1WIUA 4LLYB 5CMAA 5KN5A 4LQFH 5T5FH 1NCDH 1UT9A 4J6RH 2IAMC 4JFQA 3QIWC 5DO2D 1NGWA 3IVKB 2NY0D 3FQRB 3RHWK 3PWPE 3BQUD 4ZFFA 1JTTA 3LHPL 3BYYA 1GSMA 4Q6IC 4R2GB 5IB4A 5IW6B 5J11B 5D6DA 5TJWK 3STLA 1A9BA 2B4CL 3DX8B 3LRHA 4DGVH 4HMEA 5TH2A 1BWWA 3LN4B 4QO1A 4R90L 3UROR 3PWLA 1OHQA 3D48R 3U0WL 3M17B 4JANB 5DZNA 5KTEH 5I30H 3WFBL 1E0OB 5MEPB 3L3KA 5EZJA 3UTPD 2Z9TA 2YRZA 2YD4A 4YDLC 3PWUA 1A22B 2PETA 1JRHH 4ZODA 1MCQA 3EW3B 3U0PB 1NAML 3P4NA 3TLRA 5IP4A 3K1DA 4PUBL 1MQ8A 3EJYC 3GMMA 5T1MA 4P2OD 3JV4B 1FO0H 4P46B 3Q3GB 1BQLL 1OOAA 4HH9A 5DEGA 2IH3A 2VWEC 4W4OA 4F7PB 1DQJB 4U1KB 3UBXA 5INCA 4APQA 2XG5A 2DICA 4HV8B 3O8XC 1S9YB 2IANA 3BAEH 3N0PB 3N1QC 3NFSL 1N59A 1HSAA 3TF7C 5I1GL 1PZ5B 3I9GL 2YEZB 1Q0YH 4RGMB 1RZGA 3NH7H 4PLOB 2LU7A 3PXJA 2ZJSH 3GJEB 4H20L 1U0QA 1TVDA 2VL4A 1MCHA 5EO0B 4PJHA 4ZS6C 3F7VA 4F7CA 1WBXA 1R3HA 3V6ZA 5HVHB 2F54B 3U4AA 1QSEB 1DZBA 1E6OL 3KPSD 2OSLA 1Q38A 4L5FH 2OTUB 2P48B 3CAFA 5GGQL 3BEWB 3I75A 4NC0B 3BH8A 4QRPA 2HWZL 3FQTA 3MJGX 4ZNEA 2AGJL 4NFCA 3HNVH 5JLZA 1LWRA 2VQ1A 3N1GC 4ZOCA 4PY8J 2DS4A 2F53A 5DSCB 5CZKA 4FFYL 1HNGA 4XB8A 4NM4H 1N6QL 4X98A 4NYLB 5KW9H 1KIQA 2KKQA 3DRQB 1JBJA 4JN1H 2ZCKH 5DEFB 3RL2B 5DC9B 1MCNA 4PJXA 4IHOA 4RA0C 5J1AA 1A0QL 4OTXL 4UQ3A 4BSWB 4ZSOE 2CRIA 2HFEB 2PTUA 4C58B 3OB0H 1AFVL 4NJ9L 3O4OB 1QZ1A 4XMKL 4G8IA 4WCYH 4OGXL 3OXSA 1ZE3C 3IU4H 3H9YA 3ZTJH 3GK8L 4K3EL 2EDDA 4HFWB 1NL0H 3G5ZA 4ZFOA 1JGLH 1ZT7B 3OPZL 3FT4A 4XNUH 4R4ND 2DLGA 3QUML 4RNRB 3C8DA 3KYMB 4G6FB 4JLRA 3DVNB 4HPYH 5T1LA 2BHUA 4CU7A 3V5DA 3TYFA 2G5BB 4L8BA 1HHGA 3SDAC 5H2BB 3HZVB 4XHQA 1TQCB 2ATPA 4BFBD 3SKOA 4FNLH 3EZJB 5ESQA 1F00I 1HI6A 2A6IA 1XR8B 2PNDA 1IVLA 2IFFH 1BJ8A 1N0XL 3KPSE 4R7NB 4P5MA 2AP2A 1VKXB 3V5HB 1LD9B 2H32H 4WEUD 1CGSH 1CQKA 1CDCA 1D5BA 4L3EA 1MH5A 3P0VL 1Y6MR 3MV9D 5GGTA 4PGEB 2VLRB 4L8SB 2BOCA 5JW4R 3RZCA 5JMOC 1UG9A 4UDUA 3LH2L 4J4PA 1KENH 2DQFA 5F89B 3RUGB 4R0LC 8FABA 4M7KL 1CQYA 3GO1L 2DMKA 4AEIL 1KLGA 4LPTA 5CJOH 4HKZB 3W9EA 4UV7H 1BFOA 1IKFL 3E2HC 1DQLH 4OLZL 1I3GH 5L88H 1TETH 3FN3A 5CGTA 2R8SL 4JRYA 1RZFH 3C5SB 3PHOB 4ERSH 1I8KA 4H0HB 4NZRL 3IFPA 4DVBA 5L7XL 1DBJH 4JM2D 3ZE0E 1JIBA 2JCCB 3MUY1 1MI5D 4EQ2A 1MCFA 1U91A 1VGEH 2RIKA 3ARBD 3GSQA 4UBDD 2UWEA 4LCYA 3MRQB 4Z7UE 4HUNB 1CLZH 1I85A 2C7UB 4EBQL 5KVDL 4OT1H 5ISZB 3QB7C 4P2CG 5IB5B 3EDDA 3F5WA 1HXYA 1EJ6A 2DJ4A 4I0PD 5J3HC 4KQ3L 3T0EC 2AK4E 4HKXB 2CMRL 4MDJB 5C0JA 1KF9B 2FZ3A 5T1KD 4UT9H 4U6TA 2IG2H 4XCFL 5LVEA 3VXNA 3V6BR 2NY4C 4K7PH 3B2VL 3GUTA 4QRRB 2P8MB 4OD3H 1HNFA 4ZS7L 3QG6B 2BZDA 1LK3H 5IB1B 15C8L 2QBWA 3T0AA 1FL5A 1LP9F 5C0EA 1KJMB 1OAKL 2VXUL 4JPWH 1HYSC 3H0TA 5F8QC 2AK1H 5FGSA 2Y5TB 5HHNA 4K3JH 3QEHB 1TCRA 4MHHG 2P5EA 4G42A 1MAKA 2W9LA 5TFSL 4G6KH 4KK8D 4BQ6A 2DLEA 1BF8A 3MV9E 4XXDA 1KJ2H 3DROB 1ZVYA 1XF4B 4LCWA 2L0DA 3Q1SL 3K4DA 5BZDB 3EJJX 5F1IA 3EOAB 1A9EB 4F9PA 4JO2L 5GRVK 2QQLL 3OKMA 1MF2L 5HDBF 1DE4B 1DL7L 4FFVD 5HYFA 3W0WD 3BO8A 2UZIL 3QXTA 2GITB 4UIKL 1SVZA 1UWEL 2YPKB 3CVHA 1KGCE 4U2ZA 4ODHL 5E5UB 2BFVL 4HG4J 5DHXB 3LQZA 1MIEL 5IVXA 5KJRL 3O6KL 1QSFB 2PXYD 2XN9A 4WNQB 5F88A 1EBPA 1QD0A 2GTWA 3OV6A 5ADOH 1WFNA 1P4BH 2X40A 4HK0B 2E8YA 3TBTB 1K4DB 1FGVL 2CUIA 1AI1L 4L4TE 3KPOA 3MXVH 2JIXB 1Y0LA 5HSFA 5D1QC 2HN7A 4P3WA 1ZGLB 1Q1JL 3ULVH 4X5WA 4QHKI 4JKLA 2IADA 2PYED 4KFZC 4NBYB 3L7EB 1FRGH 2ED9A 3PHQA 4KMTH 4NNXB 4OF6A 1LK2B 2XKNB 5ELIA 4Y5YB 3DRTA 2VLLB 3U83A 3MV8B 2VDNH 5C0AA 1R5WB 3WMSA 3BW9A 5GJSL 4ZQKB 1I7RB 3BWUC 5C0CD 4FXGA 3U2SB 2H32B 3OX8B 1WIPA 2YC1B 1S9VB 1P4LB 5EU3B 1M7DB 4DOHE 2Q6WA 4H25A 5HYQB 5L9DH 3LQAH 2X4PB 5E03A 1EEZA 1XIWD 4Z7OE 3TIEA 1JUFB 3ARGD 1TNNA 1OCWL 1HWGB 5LCVL 1ZSDA 4MA3A 1WZLA 4PJCA 1EVTC 4NQDA 4ZFOL 5I8EB 25C8L 5B8CC 5HVFB 4QEGA 4QHLB 3T8XA 3HR5A 1UM4L 4TSCH 5D7IA 3VMOA 1A3LL 1YY9C 3KPMB 2L7UA 5IG7B 3TT1H 3VWKC 3NCYS 4MZ3A 5IJKA 3X12B 1LEIA 5ERWA 4NN7B 1FZJA 2EDOA 5FAAA 4JG0H 4XP1L 4HZLA 3QRFM 1EEYB 3LEVH 2IH1A 5FYJL 1IAMA 3N85L 1WK0A 3MR9A 3OR7B 3BD3A 5ANMA 2G2RA 5EFIB 3REVA 5CWSA 3O0RH 4PYGA 1NLBL 2FECL 5SWZB 4UOJA 4OAWA 5IQ7H 3U0TB 4I18B 2XG4A 2IAMD 3O3DB 3QIWD 3VFMB 3WS6C 3CUPA 3L1OL 1FFNB 1QFWI 1E4WH 3CC5B 1BP3B 4CADB 4UQ2B 5GGTL 4U1HB 4YHNA 5JW5B 1KEMH 1IGIL 1RMFL 2IBZY 5HGBA 4XAWH 5J1TC 2B0SL 2JK5A 1K8IA 4NKMA 4DZ8B 1JNHA 1S7XA 4TUJB 5I17B 1DBML 7FABH 4W81A 3UYRH 1NC2D 1IZKA 3WHE1 1U8LB 3CDYA 4PJ9C 5EU4A 3BZDA 3ARWA 2OL3H 4UTBL 3KLDA 2IGFL 3BIKB 4X6BB 5IROA 2DQJH 4JRWA 5TDOA 2I26N 4O2EA 3WJLA 1KCVL 1OM3H 3DMMB 2N7AA 4YHPA 3MUZ1 4PJGE 3KLAA 1U8HA 2P44B 2AI0H 3VJ6A 4PJEE 3MOAH 1ZLWH 3EJYD 2FBJH 3VI3F 3SPVA 3ZT5A 3OR6A 4XBEL