1OAQL

Free conformation ab1 of the ige spe-7
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
110
Chain Sequence
QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHLVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAVY CHAIN
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oaqL00
4FFVC 1TQBC 5IR1B 5DD1L 2HFTA 3LN5B 1AFVL 1MCHA 5JOFB 3CSBA 1HCVA 4MDJB 4K3GA 3B9KC 4AYFA 4PGEB 5HHOD 4M8VA 3QO1B 5E5MB 2NY4C 1DFBH 1LP9E 1WC7B 2JJTC 4RGND 5SX4I 4CGTA 2WAHA 2O5ZH 1IAKB 2VSCA 3TBTA 4PLKD 2O61A 5ICYA 1MQKL 5MENE 3DETD 1MUJA 3LV3B 1WBYA 2VWEC 4WUUD 4U31A 5EBMB 3DGCR 1S7UA 5JW4Q 3BKYL 5EN2B 1WQVT 4JFXB 5EZLB 5CJOL 3V4UL 1OAYL 3OG4B 5FGBA 4H25B 3SOBL 1KV3A 3D0VB 5A2LH 1IAMA 5D7LA 2XN9D 3GHEH 2AABL 4D9LL 2IAMD 5D1QA 4OFPA 2BSRB 2G75B 1C5DA 2PO6B 4HEME 4LSPH 4XX1E 4POZC 4LP4A 4P2QE 4OZGF 3HI5L 3QDJD 2CIIB 4S1DD 4P3CH 2RBLA 3MRLA 2ED9A 4LLMB 3K7UA 4PV9A 1LDPL 4PJ5A 4JRWA 2YN3A 2Z35B 4RWHA 3N1FC 3WXVL 3WHE0 3PV6B 5FCUH 1RZFL 2WINB 3OKOB 5CJQH 1LEGB 4X80L 5HYEA 3JXAA 2XZZA 2I24N 3IFLL 5CJXC 5IK3B 4PTTA 7FABH 1PBYA 1BQHA 5H37G 1RK1A 1CGUA 1YPZE 5EC2A 3DYPA 4OLYL 5T1DL 4MJ2A 3MV7D 5B8CA 3LKNB 3GB7B 1UCBL 3IGAB 3DVGB 5HHMB 4FQ2L 2C3GA 1NBYB 4QNPE 1RZKH 1XGYL 5IB5B 3F7VA 3MUJA 5LJYH 2EDYA 1X3DA 3GIVB 1QFHA 4YDKH 3FO9B 1KIRB 1KIPA 3TBWA 1GPOH 5CGYC 1JUFB 5JHLH 4G9DA 3NACH 1AY1L 5EUOF 3ES6B 3I85A 5IB3A 1LE5B 2VNCA 4H8WL 5J8OA 3L95A 2B7DT 3VFMB 3VFNA 2VUOA 4P46A 1EJOL 4OZ4A 2NNAB 4YDVA 2R0LH 5DMJB 3S3JA 1DVFD 2LTQC 4KJQC 3RUGF 2F19L 2VLRD 2DWEA 4XC1H 1U8QA 1F4HA 3CH8A 5C8JA 3RVWD 1J0JA 3I3BA 2QL1A 3AUVA 3W0WE 1QHOA 5HI5D 4LGRB 3ROLB 3NABL 5IBTL 1JPSH 3BP6A 3DOSA 4LSRL 2Z8SA 1AJ7H 1YEKL 1EA9C 5KVDH 3SBWA 4LRIC 3JWDC 3BYYA 4HT1L 1YN7A 3CMOH 1JNLL 2BNRE 4POYA 3OKEA 3MXWL 4JR9L 4LCIL 4EZMA 3G04B 3S8WA 3H9SA 4AEHL 1X5ZA 3FQWB 1UM5L 1A3RL 4ONOA 1JTTA 3G6JB 2AJSH 3SGJC 1H3PH 4W4NA 4YAQA 5F72S 4JY4A 4NQCA 1FFPA 1AGFA 3VGHA 3O6KH 1N6QH 3D39B 3V7AG 3R4DA 1KG0A 1EAPB 5HDBE 1A7RL 1RZ8A 5JTWA 1A7OH 1KLFA 1PKQA 1AD0B 5DJZB 4O9HH 4PRIE 1Z0MA 3BEWB 3CX5J 5B38G 4HGWA 3UPRB 4JZJB 4D9RE 4U6XA 4UIMA 3T2QA 1U3HD 4R3SB 4MX7B 1X4YA 4KQ3L 4N8VG 4Y2DC 4KRPB 3R06B 2HJLA 4LHUD 2VITA 2UWEB 2I9LB 2XRAH 3UPCA 1EERB 1HHGA 3VA6A 1JV5B 1MRCH 3NCCB 1CXIA 1OARL 1XZ0B 4AG4L 4FMFA 3O0RH 1LO3H 1PFCA 3NFNA 4IRSC 1DTUA 4OZFG 1ZAGA 1PDKA 1AKJD 4KJPC 4XAWH 2OL3L 5ADOH 5CIPB 2P5WA 1QR1B 3DHJA 4EN3A 3TA3C 4X6BB 3VXRE 3CGTA 2KQNA 4YNYB 2Q7NA 3RAJH 3MLUH 3GM8A 4ONHA 4Y19D 3WIFA 1WZ1L 3KR3L 4JGMA 1V3JA 2R29L 3ZTNH 1WIPA 2EE9A 4NZTL 2QSCL 1F4YH 1LNUA 5BV7B 5I30L 2QR0B 4EDWL 5DRWA 2HJFB 4U33A 4RMVA 5F7WC 1IFHL 1Q1JH 4JO1H 4ZTPL 2Z4QB 4OLWH 4IBLT 1R5WA 1BEYL 2VZ3A 4OZGA 4PJAE 3TIEA 1T22B 4HMDA 5EORH 2HYMA 2ZCKL 2AXFB 4OCXL 1DZBA 1HZHL 2IBBA 3EOAB 4KHXL 5IIEB 3S97C 2XYCA 4P2RB 4LDLB 3CSYA 1AR1D 4Q9QL 4DAGH 1A7QL 1PG7L 3EYFB 1XIWB 1JHTA 1CL7I 1A2YB 1RUMH 1QQDB 3UYRH 3ZL4L 1JPFA 1FIGH 3OZ9L 1ZV5A 4ZFGH 1VADB 5CLWA 3JV5A 1NFIB 4HBCH 4Y4HC 4PGBB 4QTIH 3FN0H 4M6NH 3VXME 4E42A 4L9LA 5BV7H 2CR6A 2EIBA 3O2DH 4G8IA 3ZT6A 3QDMD 4EIZC 3FOMA 3MOBL 3GMNB 1IMHC 4YHKL 5EUOA 3D85B 3GI9H 4K7PY 1AGCB 1JYWA 1ZA6B 2AJYL 2YD1A 1BX2B 3BRFA 1OLZA 2NZIA 1YEEL 4HC1H 1JN6B 3KG5A 1TNNA 5D2NB 1IEHA 2VZSA 1R3IL 3ARFB 4JFZL 3S96B 3RUGA 4JJHA 3VG0H 4XVSL 3MXVH 4CU6A 3Q48A 3QEGL 3T4YA 3I50H 3GSXA 3U0PB 5ACZA 3BP4B 2YRPA 4HCRH 3GRWA 4DK6A 2HJKB 5HI3C 1XGQB 2GYSA 4MA3B 1TPXB 1QBML 1JK8A 2CK2A 1W72H 3FB8B 5EOQL 1FN4A 4G8GD 3IXAA 3CLEL 4CW1B 2DJUA 1Q0XL 3QRGH 4QRUA 1OTUD 3UTZB 4BFIA 1TVBA 2H26B 3UXFA 2AI0H 5CKAA 1PYWB 2VR4A 4X9GA 4RGOL 2YA2A 5ENWB 1ZWIB 1J0IA 2CPCA 3HC0A 1L6ZA 4WUKL 3VFSA 1HWHB 3RWGA 3QJFA 3JWOL 5JORA 1INEH 3ZSTA 2FO1A 2W07A 1WT5A 2BZDA 3T09A 3FFCD 4RQQA 2W1NA 2RCSH 1Y6MR 1YUHB 3O6FB 3KDMB 1IAIL 3PWUB 2R4SL 2DQHL 2FX7L 2GCYB 4YWGH 1DQQA 4I0PB 4NPYB 2X2YA 1R3HA 1IQDB 5FO7B 4XRCA 4YLQT 5J3HD 2HP4A 1T04A 2ICES 4JRYA 2X4PB 4J4PA 4HUMB 5DHXB 3B5TA 5TQ2H 3U36B 3VGAB 4BH8A 4PGCB 2X89D 2ZCHH 3RY6C 3LH2L 3IJSB 3BRDA 5FO9A 3ZYIA 1S7QA 5ERWA 4KMQA 1BBJA 3RDTA 2J7LA 2O5YH 4ZAKA 3DJ9A 3QUML 2LU7A 3MGAA 3AXLB 3RVXD 1A1NB 3O4LD 2ZUSA 3P4NB 3GSOB 5GGSB 3SPVB 4CVZA 2QSVA 1EEYA 3BE1L 3MSPA 3MV9A 1E6OL 3PE9A 3BPNC 3VXNB 4KROC 3VXPB 2F53A 3Q1SL 1F42A 1NCBH 1P84K 2YD3A 5C7XH 4H5SA 1D9KB 3G5VA 4N8CL 2AJZA 2WWMD 1T4KA 2NMSA 3BGMA 1WEJL 1YMMB 4KFZC 5JPMB 3M1BA 2Q86B 5J11B 1ODAA 4Y5XC 1AH1A 5GXBB 3QO0B 1A4JB 3QIBA 2P8PA 3WO4B 2OTUB 5HHME 1C8PA 2E9BA 1G0XA 2ZSWB 4Z5RB 5DEZA 1NGWA 2R15A 1AHWA 4JZOB 4NCDA 3PWPB 2ZUVA 1CTNA 1QP1A 2FATH 2EC8A 4M62L 4PV8A 4RDQF 5A2IH 5C9JB 5CD3A 3GMMA 4PP1D 3AGVA 2WIIB 1CI5A 3VU2A 1A64A 3P30L 4R4FL 1TETL 3RGVC 1C5CH 4AT6B 5CEYA 5IESH 2PW2A 2EECA 5FA3B 3QT2A 3TYFB 5KSAB 5I1EH 3UTQA 4Z7OE 1NCAL 2CGRH 4IMLA 4P2OD 4G80A 5D71H 1C1EH 4PB0L 1S9VA 4JM2B 1Q94B 2NW2B 3HS0A 1FIEA 4WEUD 4H1LG 4APQD 2EYTB 3IETB 5CKGA 4Z7UF 4ZSOA 3VXTB 4KY1H 2DQUH 5DUBB 1LD9A 3H7BA 5ICXB 3QCTL 1HDMB 4LLQA 3OTTA 4WFEE 3G6JE 4XP6L 5C0JA 1G1CA 4H0GA 1PD6A 3X3FH 1Z5LB 3ZDZF 5HVFB 4PJ7F 3QIWB 2G5BB 1S7SA 5DT1H 3BQUB 3D39E 5F6IC 1B4RA 5JDSB 3QUKA 4MJ5A 8FABA 4G6FD 4LPTA 4KXZH 1G9NC 4OFDA 1YEGH 3P9LB 5E08H 3QWOA 1BJ1H 4L9DA 1MFDL 3KWWA 2OL3A 3VXOB 3EDEA 5CEZE 1MI5A 3MGOA 5I8OH 1QLEH 8CGTA 1K2DB 4X6EB 3K80A 5C0BB 1FO0H 4HJGA 4NN7C 5CSBA 1KXQE 2UWEE 1I9IH 2D31A 5E4EC 3BZDA 4GG6B 2VKXA 3MMEA 1J0ZA 3U6RA 5C6WH 4HJ0D 5C2UB 4XI5C 4OD2B 3HE6B 4XCFL 1QVOA 2YMXH 3LKRA 4UQ3A 1KJ2A 3SKMB 3TBVA 3IJHA 5JW4M 5LGKA 3DPBA 1VFAB 4B7IA 4P99A 3O41B 2DKMA 3SDAB 2B20A 4LEXL 4HWNA 4PJCF 4NBYB 2BNRD 3I9GL 5DF0A 4IOFC 2DQFA 3ZKQD 2VXQH 2BNUB 5ETUA 4KTYA 4UMGA 1MEXH 3TO4B 3VRLF 1YQVL 1FZJB 4LKXB 4Z8FH 4U05A 4I1NB 5ESVB 5TPWH 1JGUL 2AEQL 4PJIF 4NSKB 4CN6A 4KZEL 2CKBB 4OUUA 4OI9A 4XMLL 3TWCH 3MRJA 3V2AR 4P9HL 1H0DB 3PGFL 4NFBA 1T1WA 5DZNA 4PRID 4LCCA 5I18L 1ZLUK 3T0EB 4WFHD 3QEQB 1I3RA 1Z3GH 4BSWB 5EDXA 4EDXB 2C26A 2FHFA 2B2XL 5DK2B 3VMNA 4ONGL 1RMFL 5JLZB 4P2RE 5C0CA 2V9TA 4V2BA 2OS7A 1P4IL 3VDAA 2F5AH 1WAAF 3HAEB 4LLVB 3P4LA 4S11A 1MHHA 2E8ZA 2IMNA 1OGTB 5DFWH 5TQ0L 4PP2A 3TYGL 3G6DH 4JO2H 5A2KH 5GRJL 5E70A 5FO8A 3WNNA 2CKBH 4ORZC 2CLRA 2YK1H 3BW9B 5C0IA 5ALCH 4IDJL 5A3IC 3VXRD 3FCTA 1UVQB 2KBGA 1AI1L 1LK2B 2ORBL 1JZ6A 3MZTA 3P73B 3T65A 4J1UA 2ZUQC 4U2YA 1G7PB 4JJ5A 1GOHA 3RTQB 3SKNA 3D18A 3U2SA 1FNEA 3FO0H 1UFUA 2D0GA 5D2NE 4MAYA 4Z95H 1HH9A 1HH6A 5GRWA 3F12A 1R3KA 2N56A 2GJZB 3IDMA 4P59H 3CNKA 3KYKH 4LQFL 5IJKC 4XCYB 1VFUA 3VWKC 2O5ZL 1DDHB 5IEHA 1QEWA 3AREB 4PYGA 5B3JE 3LEXA 3QFJA 1KEMH 2D4DA 3H9ZA 3HAEH 3O11B 1SJHA 5E0QA 1IKNC 1ZT7B 3HMXH 4UAOC 2GT9A 2EICA 4Z7UA 4A6YA 4KVCH 3LKQB 5KW9L 1UH3A 5DMGD 4WVRA 2BCKB 4DFHA 4PJ7A 3PWJB 3QUMA 1U58A 3HKFA 2H1PH 1T5WB 3GHEL 4HKXA 4JAMA 3ZKMC 4CJ1A 1J5OH 2P24A 3RWCA 2A6KA 3ABZA 2YD8A 3SDCD 5MHSE 1L7TH 1IM9D 4LSPL 3P0VH 4LNRA 4UT6H 2MOVA 2AJVH 1WIUA 3MNZB 4R0LB 1OTSC 3WSQH 4JPIA 2WBWB 3B9VA 1SY6H 5IEKA 3QNYB 1YEHH 4NT6B 1GC1H 4YBHA 4DGVH 5CZXC 3I84A 4PJ8B 4WHDA 3MJ7B 1FL6B 3DHMA 2OJEB 1KENH 2BNQA 5CBAB 3BD3A 4WIQA 4JDZA 4NP4L 4D8PA 5IFHH 3LKSA 3PGCB 1CGWA 2VLME 4MLSA 4MD4A 1JWMB 4D0CA 3OKMA 3RNKB 5D5MB 2L7JA 4KVNH 1MLBB 1EFXA 1CU4H 4FQPA 1OTTD 2BX5A 4K8RD 5TE6H 1GL4B 1N6VA 1RZKL 2X4TB 3E6FA 4PJCA 3UJIH 1R5IA 3WYRA 4QGTA 2GSGA 4MJID 4U1JB 1GPOL 3E6HA 4G6KH 3BD5A 3BKJH 3OKNA 3TT1H 5JHLL 4OCWH 5KVEH 3NACL 5FYKE 4EI6A 1SEBA 1AGDA 4YZFE 1YMME 3K4AA 1G9MC 4LAJH 4P5MA 3KYAA 4ODUA 4PJIA 5DRZA 4WGWB 3RHWK 3MRPB 3S37H 2X44D 3VXUD 2BSTB 4HX1A 2HG5B 4XC1L 1OP5H 3PWPE 2E3VA 4LLYB 3L3HA 5FYJE 2OTWB 4M1DH 5C0AE 1UJ3A 4X6FB 3VWJA 3HPLB 4MB5A 4QRSB 4Y16C 4LVHC 4QXTB 3HRPA 3FB5A 2NY5H 4X0KA 1AJ7L 4U6HB 1U93B 3IDNA 4OLXH 4Y5VB 2DQCH 2IMMA 3QFDA 3CMOL 4JFQB 1DN0B 5DK3A 4NO5B 3D2UB 2VJXA 3GO1H 4BSJA 3W11C 1T1ZB 4XMKH 3FONA 5INCB 4P5TB 4EI5C 3CLFH 3I6KB 3QQ9C 3SE4C 5J13B 1SMAA 1WAAA 3GBLA 2AJSL 2YPLB 4QY8B 4FQ1H 3RY4A 4FABH 3O6KL 2B4CH 4OGXH 1N6QL 4X4YA 1MJUH 4ISVB 2FD6L 1A7OL 2X4SB 3K3QA 2YC1B 1PGRB 1X5FA 1NKOA 2NY1C 3SKOA 1KTLA 3CVHB 1F11B 3HE7C 3PWVA 4O9HL 4NQUA 4X7TB 5FF6B 3S37X 2H9GB 3WHXB 1UWEH 4I5BB 1WWAX 4RAHA 1FNAA 1I3GL 4X9BA 3VRIA 4K7FA 4C57C 1V7MH 3L3OA 1S78C 1GXEA 3X14B 3E2HC 2GHWB 2XRAL 1MRCL 4YR6B 2EIZB 5A43C 1KT2A 3KPNB 1FSKC 3MLPA 4OM1H 2HFFB 3O0RL 1LO3L 5KG9A 3F5WA 1HSBA 2DJSA 2CDEA 3BN3B 3S6CA 2VQUA 5H35B 2AK1H 3V4PH 5SWQB 5C71A 4XAWL 2X4RB 4QOKB 4RRPA 4TOYH 4XHJC 1NGXB 4IRJD 5ADOL 5E9DA 2GAZB 4OKDA 2H45A 1LEIA 3G08B 3A6CH 4JB9H 4IIQC 2FR4B 4LMQE 1UM4H 3MJGX 5DHVB 3RAJL 3VGDA 3MLUL 5EPMA 5INDA 5FGBC 4JDVB 3ZTNL 2X4QB 3MJ9H 1I1CA 1TXKA 4YIQA 5SX5H 3GSNB 1TLKA 3VH8B 6CGTA 2WQ8A 3WL9B 2OX5A 4FG6D 3MBEB 4H88H 3LKOA 3E0GA 1S7RA 5IB4A 3MYJA 1Q1JL 4JO1L 1I8KB 1WWBX 1FYTD 4OLWL 1QFWH 1YMHA 3QNXB 3CU1A 1C5BH 4QRPD 4X5LA 5EZOH 3U1SH 3I6GA 1KYOK 3S88H 4F7CB 5EORL 5IW6B 2J5LB 3VXSB 4RNRB 5I6XC 1HEZA 4CKVX 4HWEH 3HNVH 3IFOA 5DVKA 3MLYL 4TQEH 5FECA 1ETZA 1WWWX 1MHCA 3EIFA 1RV6X 3JBG7 2VLLA 3ZHKA 4P4KB 4DAGL 4L4TD 1N59A 1RUML 1Q9OB 2BOBB 3UYRL 2VDLL 4LCYA 1J12A 3CVIH 4K94C 5CEZD 3T0EE 4ZFGL 2Z93B 2EXYC 3QEQE 5DHVH 2E6PA 1VFBB 4XXDA 1RQ5A 4QTIL 5ESAA 1FBIL 3FN0L 4M6NL 1P53A 5BV7L 3O2DL 2IANE 3GSNH 1NEZA 4L4VD 4KKAD 1MFCH 1FP5A 2NY3B 3T3PE 3VMOA 3KPRD 3O3AA 4Y88A 1YZZA 2FJHA 3OR6B 3GI9L 2IADB 3T77B 5LWYL 3DGGA 4DCQB 1NCWH 2M8XA 1MELA 4Y7MA 4HC1L 1QRNA 3EHBC 3MLRH 4QHMA 4Y4KA 4CMMB 3WS6A 4Y5YA 3RVTD 2KH2B 1N3NB 2X1QA 3VG0L 1U91B 3H0TA 3MXVL 4HV8B 4L8SA 2NY2C 3OAYH 1TQBB 3I50L 4OD3H 1FL5B 1OOAA 4G6MH 4HCRL 3DXAD 3V0AC 3N1GC 3B9KB 2JIXD 1W72L 3S36X 1TVHB 1PX4A 3RBGA 3QXTA 2ESVB 5FV1L 2NY4B 2DMCA 3QUXA 5DJ0B 1J11A 2LFGA 3QRGL 3DRTB 4CDGC 3G6AB 3S4SB 2R0ZL 4G9FB 4OCSH 4FXKB 3QSKB 5D7JD 1HHHA 1CBVH 2AI0L 2VISB 4C83B 3VD3A 2EZ0D 1LO4H 4Y4FD 3DARA 2UVFA 5ITFB 3S5LA 2YBRA 4G7VH 3OF6A 3KXFB 1CE1H 3T1WA 5GRXG 1IZJA 2RCSL 3D69A 2G2RB 4U3HA 2GQHA 4HIIB 3X12B 5GGVL 1WBZA 4TUOA 2FJGB 2FH6A 1FVCB 5TQ2L 1MVUA 2OMBA 3DMMA 4KRMB 4OLUL 1LO5B 1HQ4A 2ZCHL 4NKDB 4P23B 2JTDA 2FGZA 4MQTB 4YX2L 5HHPB 4PY7B 3ZE2E 4U6VH 3W81A 1J1OH 3NCMA 4TUJA 4GLRH 5GS0C 4S2SB 4PJ9D 5IF0B 3BSZH 1OSZA 5C6PB 3KS0J 4HG4K 3D85D 4UT9H 2ENYA 3QUYA 1S9WA 4RFEA 1BZ7B 1OCWH 1NCBL 5IB1B 3C8KB 2BFVL 4F7TB 1BVKA 1M7IA 5C7XL 2HT2D 3VD4A 4PRDB 2H2SC 3EYUH 1BFTA 4LF3A 4YHYC 4AJ0A 4EN3C 2CDGB 2Z31A 5CBEB 1ZLWK 5D5ME 2AKRB 5BXFA 5FFLA 4ORGB 4ZO7A 1PAMA 3FRPA 3RGHA 4M43H 1G7LB 3B2UD 2Z91B 3OXSB 5J4MA 3AAZA 3GMRB 1CS6A 1HNFA 5FHAH 2FATL 1GOGA 2VDQH 2XWBA 1B0RB 4MXWH 2LTQB 5DYOA 5ITBH 4K7PH 5IHBA 2FBJH 4KI5E 4PJXF 1KIRA 3MRMA 4MNGA 1NANH 5DJ8A 1C5CL 5F71A 4F3FA 5IESL 1X7QA 5FA4B 5DC0A 1J1PH 3O6FD 4HIHB 4E9LA 3V5KA 4BK5A 4O2FB 5I1EL 5MHSD 5ILTH 1TZIB 3SGDH 4ODHH 1JMZA 2NY6B 2CGRL 4WJ5B 2LABA 4M4RA 3LKPA 3IAGC 5D71L 5ANME 4MVBD 3HAEG 5C0GB 1OGAA 5CWSB 2UUDK 1ZLSH 1CVSC 4KU1A 4LCUB 4DKDC 2OJZH 2K3TA 1GZPA 3KJ4C 2R1WA 3BO8B 1NC2B 3WLWC 3SDDD 2DQUL 1G7HB 4ZNEE 3MOQA 3QI9A 5B39A 4X4ME 4L9LC 4HEPG 2XIDA 4R96B 2VLMD 1G6VK 4PY8I 4MQXD 4MS8C 3H9YA 3OMZA 2XNAA 5DT1L 5CSGA 2VE6A 4Z76B 4JKPH 2X1XR 3CFCL 4K23L 2DI7A 3K81A 4PRHB 3FOLB 2JJWA 1CGTA 4YH6A 5C9KA 4QCIB 1T0MB 1YEGL 5E08L 4K7PX 1KB5H 1U95A 1YEIH 4K8RH 1CD1A 1QO3B 4RFNB 3BZEB 5DD6B 5FYKD 1H9VA 4LEOB 1JYNA 1QLEL 1VEOA 2VB5A 1IJ9A 2APTA 3REVB 1FO0L 2VLJA 3PWNA 4ZYKB 2E9IA 5HVWA 5EU6B 2A9NH 1A6UH 2EDQA 4YHOL 5E6IC 4HUUB 1RUQH 4WO4C 1I9IL 4ENEC 5DK0B 5IB2B 3SN6N 4QHLB 4TNWF 5D1ZD 5F3BB 5DDHB 1ZT4B 5FYJD 1WTLA 2E7LA 2J88H 5E6YA 5C0AD 2VLKB 4Y89A 3RRQA 3GJFB 3VI4F 1FV1B 2YMXL 1CFNA 3BESR 4U4BA 1FVDB 1RAMA 3TA3B 4F37F 5J12C 4HKJA 3QJHA 4QOKE 2DLHA 1D5BB 1A14H 1SJEA 5FYLD 3DRQA 3QUZA 5C07A 3ZKXB 1DLHB 4Z0XB 4P0DA 2VXQL 3IVKA 1IEAB 1MEXL 4F57H 3F7PC 3RL2B 3BDXA 4JRXD 5D2LF 3NFPA 4O58H 3ULUD 4QHNA 4DUVA 4Z8FL 1FG2A 3RU8H 5TPWL 3KYNB 1A9BB 1G7JB 1FFNB 4J4PC 4MDIA 4FQQB 4ODWB 3V6OC 3CFBB 4M02A 5I2IB 3MRFB 3TWCL 1WCQA 1GCFA 4HQQH 3MREA 1AGBB 2R8SH 1FLTX 2XQYK 2Z92B 1QSFE 3RDTC 1BZ9A 3MR9B 1UB6A 3HZYA 1ZGLP 3VXSE 3OBAA 2QADC 5AYQA 2GEEA 4FQHB 3QIWD 3B6SA 1Z3GL 5DFVC 1I8MA 4KWUA 1CGSH 4U1HA 3JWNC 4ZFOL 5ID0A 2J6EH 4HC1A 4HZLA 2VZ1A 2VZUA 4H8WC 4Q74A 2Q8AL 4JANA 4Y4HB 2F5AL 4JFDD 4UV7H 1C12B 1XH3B 4OQ1A 5EZJB 2GJ6E 1J87A 3HZKA 2C3VA 2FSEA 4F8QA 1W0VB 5DGRA 2H32A 3BP7A 4JO2L 4HCRA 1DN2A 2OTPA 1W72A 2D7NA 4Q97A 5D6CB 2CKBL 2YK1L 5ALCL 1AHWC 4C56D 2K7QA 3U46A 2ZPKH 4LMQI 3ZE0F 4OF5A 3ZO0A 3RJDA 5DSCA 4KK9D 5FOBA 2Y23A 2NR6D 3FO0L 4RISH 3ET9F 4PJXA 2Y5TA 2WNGA 3LQZB 3MA7A 4Z95L 4MXQC 5C92A 2DBJA 4L8DA 1XGTB 4IOSD 3PJSB 1JRHH 4P59L 3KYKL 5CD5C 3OKLB 5I0ZA 5DJCB 4I0KA 4ZPTB 2EDJA 3VFTB 5IVNA 1U8MA 1KEML 1GYAA 1TCRA 5EIIB 3T4AB 2ESVE 5EUKB 1UWXH 4W4OA 3HMXL 4X99A 2WWKT 5IJVA 1QLFA 3C5ZD 1PZ5A 3BH9B 5JW5B 4G9FE 3P9MA 3WUWA 5KSUB 4PRAB 4L3AA 2VWEE 1W2KT 1WFNA 5CHNB 4NQSB 3MNVA 4JCMA 1UZ8A 5E2VH 5GGRA 1A6TA 2H1PL 3SE9H 4Q9RL 1ORQA 2E6JA 4NUJA 2BDNL 3CJJA 1IGJB 2F58H 1BD2A 2R1YA 2IAND 2AEWA 3SGEI 5SWSA 3L3GA 4UT6L 2AJVL 4OZHB 1XFPA 3WSQL 4WFFD 2CJUH 5C08B 1MJ8H 1SY6L 3WFZA 3ILQC 1YNLH 1GC1L 4DGVL 5CEXB 5IMMB 4LSSH 1RULH 4I0PA 1KENL 5F96H 5HD8D 2V7HA 3SE8H 3O45B 5HHOA 3O3EA 3H9HA 1T0PB 5IFHL 3O3DA 2UZIL 4F9PA 3BGFC 2VUYA 5J9PB 5FKPB 3TCLA 3BPNB 2DF3A 4KROB 3U0TB 2X4NA 2XI9A 5EFIB 4ZUWA 3VGBA 4KVNL 1WVZA 1CU4L 5CGTA 4WUUA 5TE6L 1I9EA 5A2JH 1JE6A 3QWRD 3UJIL 4U1NB 3VH8G 2DQTH 2YD5A 2IQAA 3BKJL 5HVGB 4X8JB 3TT1L 5TH2B 5KVEL 4WNQB 5D2LA 2Y36L 3BDBA 2AJUH 1QD0A 3T3ME 5D7KD 2XN9A 5C0NC 4YHNB 2IAMA 3F7YB 4XWOD 3UTSB 3C2AL 5F9JA 2F54E 1VDGA 3S37L 2V2TA 4NQDB 1F5WA 4F15C 1LEKB 2EH7H 3L3KA 4M1DL 3JVGA 4H0IA 3QDAA 5C3LD 3QEUB 3RGVB 3QDJA 4I77H 2NY5L 4LCCC 4N5ED 5E8OA 3MYZA 4OLXL 5I1HH 4LPYA 1CLZH 2DQCL 1FVEA 1YECH 5BRZB 4XC3H 3PWLA 3GO1L 3JV4A 3RI5F 4XMKL 1Z6JT 5DMYA 1S8DA 3CLFL 1I1YB 2VR5A 1E0OB 5TFSH 3SO3C 3GBNH 2GTWA 4NM4H 3MV7A 3TNNA 1A6ZB 3BUYB 4FABL 2B4CL 4OGXL 5IBUB 4N9GA 6FABH 1MJUL 3IDGA 2I07A 4LPXA 3NN8B 1VFMA 1FO0A 2XY2A 1R5VB 5CZVH 5F6IB 1JZ2A 2P4AB 5EC1B 1UWEL 4KZDH 2X9WA 4G42B 4GUPB 4M5ZH 3PF2A 4FZ8H 3CC5B 3WS3A 4ELMB 1V7ML 4YGVB 4NQED 1FZOA 3HG1D 4KDVA 1DVFA 2X1OA 1QBLH 2OZ4H 2VLRA 5EBWB 1WUNT 4PRHE 5AYUL 4QWWD 3BMWA 2D4FA 4MAYC 3FN3A 1PEZA 4NN7B 3WNMA 3H42H 3S4SG 5E00B 3STLA 2F74B 3JWOC 2C9AA 4O02H 4LAQH 3HFMH 3TPUB 5E4EB 2AK1L 3V4PL 3VFPA 1UZ6F 4WTZG 5GRUH 5EU6E 1X5XA 4TOYL 1YEFH 1RJLB 2IH3B 3BPLC 4HDIA 3I2CH 2R23B 4IM8A 5DJYA 1FC2D 3PQYB 2E8YA 1U8HA 1UM4L 2LAAA 1H3XA 2VLKE 4GAJH 5F1NB 2J4WL 3GMPA 2JJUA 4HGKC 5J6HB 1S5IH 3OKDA 3KGRA 3MJ9L 3QULA 4JFPB 5LVEA 1JF1A 3RWJB 2NXYC 3P4MB 4PLOB 2R2BA 4NC2B 3THMH 3L9RB 4O51A 4OD2A 4HFWB 2Q7YA 1QFWL 2ADJB 3IJYA 1KLGB 1GOFA 3LMJH 5EZOL 1C5BL 3U1SL 2OK0H 1IAOB 1U3HA 3S88L 5DMIL 4ZFOA 1I3UA 3KS0H 4HH8A 4HWEL 4FTVE 4LHUA 4XCNB 5DJ2B 4TQEL 1E4XH 1II4E 2EO1A 3FQXB 1AQKH 1YC7A 3LVEA 5GJTH 1ZEAH 2OR9L 1S5HB 3P77A 4NC1C 1I4FA 2W0FB 2XZQH 1AKJA 1HK6A 2RAMA 1XF3A 3JTTB 1HHJB 5MEPA 2A73A 5DJXB 2Q8BH 2RFXB 3BT2H 4WI4A 4NCC2 3WEXB 4GW4A 2XPGA 4F33A 3GSNL 2DS4A 3OR7A 1MFCL 4HSQA 4GQ9H 1A02N 1MH5A 1LP9F 4M6AA 1DL7H 4Y19A 3U79A 4P3DA 3GSWB 2GTZB 4PRPB 4R6UA 1EHAA 5CILH 1NCWL 2QQNL 1N4XH 4NOFA 5C0EA 3EJZC 3MLRL 2ADFH 4IHOA 3C08H 4GT7A 3JV0A 4M03A 4J12A 4NNXB 5AG9A 2ZUQB 1LE9A 1D5MB 5CJ8A 1A9EB 4KK8D 3B2VH 5F9AC 4OD3L 3HMXA 1P69B 1SQ2N 3QQNA 4G6ML 4YBQC 3MODH 4X6DB 5I19H 4ZUTA 1UJ3C 3EFFA 1IGTA 3FQRA 3VWJC 1XGPA 1OAQH 3X3GH 2EEAA 3LB6D 3SQOH 3ZTJG 4M9PA 3VWKB 3GMQA 2EDDA 3WNOA 1NLDH 4OCSL 1KPRB 1CBVL 3TBSA 1NDMA 2PCPA 4JEGB 5I17A 4UAOB 1LO4L 4GBXA 4MD0A 1QSFD 1R3LA 5J06A 1JHLH 3ARDD 4ZXBD 4YHLL 2X10A 2E27H 2YUWA 1XCQA 3UROR 1FJ1A 4G7VL 1CE1L 4L4JA 1DE4B 3EW3B 4AZ8A 4S1SL 5I73B 2OXHA 2P5ED 1SY6A 5HJ3A 4P4KD 4QYOB 2CLZB 4OV5A 4HUXA 1MFEH 1S9YB 4FXGA 1YPZF 2GJ6D 3OX8A 2KDGA 2YD2A 3DUSB 4PR5B 5KOVC 3W9DA 4AIXA 1IGYB 4NYLB 4D0BB 2G5RA 3VE0B 4F80A 5F1OB 1J8HB 4U6VL 1J1OL 4NO2B 4YJZL 3BSZL 1ONQB 5I1GH 2R1XA 4BH7A 3ILPA 2NY3D 4JDTL 1X6NA 3QIUA 1HN1A 4OZHE 1G7QB 3BWAA 5JOPD 4D9QE 4UT9L 3V79C 5AUMB 1ORSB 3V5DA 5C08E 4XVTH 1PY4A 2GFBA 4OIIH 5DRNB 4G8GA 4QHUB 1OCWL 2K1MA 5EU4A 2VTFA 4JN1L 5DUMH 1BOGA 2BHZA 4PJDF 3TVMC 5EB9A 5GRYA 3UJJH 3EYUL 3WLBA 1J86A 3DV4B 4GFTB 1DANT 1RZGA 3BFOA 4ZUVB 1KN4H 1J0KA 1X9QA 5AZ2L 4Z18A 1CG9A 2V2WA 1IC5H 3NOIA 4ETQB 1S3KH 3EGSA 2IQ9H 4K3JH 3FFCA 1CE6B 4P9HC 4M43L 1EO8L 5TDNB 1N2RB 5FHAL 3ISWA 3GJEA 1RZ7H 3RIAF 2VDQL 5J1AA 4QF1B 4LKCA 4P4RB 3SCMA 3DUUB 2LVEA 4MXWL 5GSRB 1FE8H 1X4ZA 3KPSA 5ITBL 5DRXB 3V6FB 2X89A 4GKOA 4O4YH 3GM0A 1HNGA 2J8UF 5T3XH 3UTSE 3RZCD 2FBJL 4FQXA 4GRLD 1UXSA 4NQDE 3UMTA 4AEIH 3DVNA 3Q5YA 4Y16B 1J1PL 4LVHB 5KN5B 1DBMH 1IT9H 4JN2A 5HDQH 5ILTL 5JO5B 3O4LA 3OHXB 4MJ6A 4YO0A 4L8BB 4J6RH 2C3WA 3MLWH 5BOPA 4CNIB 4D3CH 5JPNA 1I8IB 4E0RA 4RBPK 25C8H 1T1XB 4EI5B 3BIKB 5GJSH 1ZLSL 2ATPA 2OJZL 2XFXA 4Z0BH 5SWZB 1REIA 5MEOA 5DD3H 4MNQE 5DUPH 2VL5A 1RJZA 3DURB 1QLRA 1WFTA 5HXMA 1LP9A 1G9MH 2BK8A 1KIQA 2NTFB 3HNSH 1WBXA 4ERSH 4DUXA 4LDEB 2UYLB 3ESUF 1AD9B 1CYGA 4WWKD 3HE7B 4JKPL 5DVOA 4G8EA 1M05A 4Y4KC 1I9JH 1A6AB 4NO0B 1FH5H 1JBJA 3SGDI 5I74C 1KB5L 1YEIL 4K8RL 4S0TD 5JDJA 4BFBD 4L8SC 4V1DD 1DBAH 4ELME 4L29A 1F97A 3IDUA 3WKNA 2OI9C 2A9NL 1A6UL 2F54D 1FSKB 1RUQL 5IV2A 3CDFA 4U1IA 4UOW0 3PIQA 3MJ9A 3QUXC 2J88L 5I16A 3W82A 3RX7A 5EU7C 3QEHA 3TBTB 4P2OA 2JB6A 4CVXA 2O61B 5ICYB 1AR2A 2PTVA 3HTLX 3I02A 2ZNWA 4KJQD 1MUJB 1WBYB 1RHHA 4APQA 1A14L 3CFJA 5HDOA 1S7UB 1NMAH 4GG8A 3WFBH 5GIRA 3CDGA 1GGUA 2MCG1 1NLBH 2ICWA 3PQYE 5KJRH 1S7TA 1KXTB 4F57L 5DR5H 2WIMA 1X5AA 1FFQA 3MRGA 3RWEA 1I7UA 1YPZA 4OI7A 4O58L 5D7LB 4PD4K 4NJAH 3RU8L 3UJTH 5D1QB 5GS3A 1KJMA 1CWVA 3DMMC 4HQQL 4PGZA 3H3KA 1C5DB 4QHKJ 1U8OA 2LE9A 1WTGT 1PQZA 2R8SL 4HXBH 1KTRL 4U1SA 1SBBA 4I3GA 1YYLH 4M6MH 2AJ3A 3TJHC 2J3SA 3MRLB 4KJWD 4BSVA 1RZKC 2A9MH 4PV9B 4PJ5B 2FBOJ 4PJBF 1AQDA 2O26U 1CGSL 1DEEA 5ICZA 1Z0NA 2EE6A 3C9NA 4PJDA 4W70A 1CT8A 2A38A 2J6EL 4PTTB 2XTJD 4PJHF 2PO6C 1BQHB 2ARJA 1ZVHA 1RK1B 4Y2DD 1P84J 5EC2B 4UV7L 2X9XA 3LD8C 5B8CB 2P7TA 3NCYS 1EO5A 3F7VB 2WUBH 2BNRA 4DK3A 1RUAH 1KIPB 5H94A 3TBWB 4O5LH 3O6MH 3FQTA 4G9DB 2VAJA 4IRSD 5IB3B 2NXZD 2ZPKL 4JG1H 3L95B 4KJPD 2VLKD 1UYWH 4P46B 2XICA 4PRPE 3VFNB 4OZ4B 4U7KA 4ODXA 2NY2B 1FGNH 2J8UA 3F58L 4I3RL 4YDVB 4RISL 1BF8A 3Q6FA 4R2GD 3V4VH 2DWEB 1U8QB 3EDKA 5C8JB 4R26H 1CDGA 3HMWH 1N5AA 3IDJA 4K94H 4UDUA 3VFGH 1XF4A 3BP6B 5GZNC 3K4ZA 3KNBA 4BZ2H 2ZG1A 5FCSH 1X5HA 2F8OA 2HWZH 5JIHA 1YN7B 3EYQD 4FTVD 2DIAA 2Z8VC 3OKEB 4X9FA 5IBUG 2I5YH 3H9SB 4R90L 1MCOL 2QSQA 5I8CA 3VD7A 1JFQH 4YAQB 4JY4B 4NQCB 1FFPB 1IC7H 3TF7C 5CSZA 1AGFB 4PUBH 2A77H 5E2VL 5HYQA 1KG0B 3SE9L 3OPZH 1T0NA 1RZ8B 3P0GB 4JPKH 2F58L 1PKQB 1JRHI 2NQCA 2I26N 1GGIH 5K59E 3VXRA 1IM3A 2I25N 3MUZ1 5D96C 4M1CC 2ERJB 4GAYA 3CFIC 4HGWB 4NWUH 4U6XB 4UIMB 3ZKND 2DYPD 1T7VA 1T83A 5DA4A 1FHGA 1MJ8L 2HJLB 3BZ4A 1NC4D 1YNLL 5FV2A 2VITB 4LSSL 1ZLVK 1HHGB 1NDGA 1RULL 2VXUH 3ARGD 5F96L 3SE8L 1J8HE 3SKJH 2PYFA 1RI8A 3EO0A 5HYIA 3ARXA 5D7IF 3DX9A 3OAUH 3NFNB 5T3XE 1KPVA 4OCYH 2E7LC 1J9CT 4S1RH 2W9LA 2P5WB 3UTTD 4YHYB 4P2CG 4EN3B 1IGFH 3QHFH 3LEYH 1HINH 2DQTL 3BVNA 1U8KA 4ONHB 4PBVC 2AJUL 4X4ZA 5DI8A 3WIFB 4DUWA 4Z78A 4BQBA 4JFED 5K93A 4Z77A 1LNUB 2VZVA 4K71C 3PG2A 3O3BA 5DRWB 2A6IA 2AW2A 5EBGA 1NCNA 3SDCA 1NAMH 2YWZA 3PP4H 1IM9A 1R5WB 2EH7L 1M7DA 4OZGB 3TIEB 2EDHA 3U4EA 2N1KA 1NGQH 1K85A 4UUJA 3TNMA 4PJBA 4WHYG 1KPUA 5I1HL 1YEDA 5MERA 2C3XA 3REWA 4ACPA 5BV7C 1R3JA 1CLZL 3CSYB 3IU3A 1Q72H 1F6LL 3TCXA 1F4AA 3FQUA 4XC3L 5DZLA 4HLZH 2DOCA 1JHTB 4PJHA 3P40A 1JPFB 2W0PA 3DSNA 3D0LA 5ESQB 5TFSL 5J57B 1NGYA 3GBNL 2C1PA 1Y6KR 2VDNH 3KJ4B 3NIGF 4NM4L 3ARTA 4P9MH 1KB5A 4HXAH 2F9BT 2KUTA 6FABL 4E42B 4L9LB 5SWZE 2OQJA 4G8IB 1JGEB 1WF5A 1KUMA 3RWDA 1DJSA 3FOMB 4MJIA 1CICD 5E1HB 5CZVL 4GO6B 5EUOB 3CZJA 4KKCC 4UTAH 1I1AD 1RSFA 2R0WH 4KZDL 4M5ZL 4FZ8L 2FEEL 5TF0A 5LKNA 2APVA 1OPGH 2Z8RA 2X7LA 3G9VA 2BSED 1NBQA 3RUGB 3VXUA 4JCLA 1QBLL 2OZ4L 2C4FT 5E24E 2XG4A 2XG5A 3T4YB 3GSXB 3KLHC 3OAZK 5ACZB 1Q8MA 2A83A 3H42L 2BXYA 4HHAA 3TP4A 1C16A 2FJFA 1O7SA 2LU3A 1JK8B 2C4XA 3HRZA 1GGBH 2PR4H 4O02L 4LAQL 3HFML 1FN4B 1NFDF 3IXAB 5BZWA 1BREA 1JNJA 3MLZH 4WU7A 4QRUB 1IVLA 3ARFC 3I2CL 2BRQA 4BFIB 1TVBB 1U8NA 2WW8A 4LNVA 4W4OC 4FP8H 3HC0B 4GAJL 1AFVH 3VFSB 1L0QA 3RWGB 4LHJB 5HYJE 3QJFB 5JORB 5CGMA 1IAIM 1S5IL 5DMKA 2H8PA 5F1KC 4RQQB 1RHFA 1I7RA 1TJHH 4OD1H 1MCRA 3THML 3ZLQC 4X4XA 3WNLA 2PXYB 1DQQB 4MNQD 1R3HB 1F3RB 4XRCB 1NUGA 2YHGA 5A16A 1T04B 4JRYB 1NBVL 3LMJL 5IMKA 1IEBA 3W9EA 3FB7A 4BH8B 5D7LE 2J6EA 2OP4L 3GRWH 2JJVA 5CJOH 2KL6A 1J88A 3C60A 5T3ZE 1E4XL 1SHMA 5FO9B 1S7QB 5ERWB 2CO7B 1AQKL 1BBJB 1FNGA 4TSAH 3RDTB 3SOBH 1MCFA 4ZAKB 1ZEAL 3ZYJA 5JIKA 2QADB 1NFKA 2AABH 2AEPH 4I0PC 5D7IA 5LCVL 4JVUA 5DEFA 3M07A 4CVZB 1ZHLA 4G43A 1EEYB 4TN9A 3MV9B 4RGNC 4F9PC 1GIGL 2XZQL 2DM7A 5JZ7D 5MI0C 4PJ5E 1TZHA 2F53B 4U1LA 4PLKC 4IRJA 4XTRD 3T08A 2W0KA 2Q8BL 2ZKHH 4N0YH 3BT2L 3MV8B 4H5SB 3G5VB 3DETC 3L1OH 4ZO9A 2YSSA 5KVGH 2AJZB 4K9EL 1T4KB 3B5GA 2YR3A 3B83A 3HR5A 2GITA 4GQ9L 3BGMB 1T5XA 4JKWA 3M1BB 4BQ6A 4CJ0A 2MJWA 3MCG1 3QIBB 5CILL 1KLUA 2P8PB 1N4XL 4WI9A 1U8JA 5TJWK 5KSBF 1PLGL 1NGWB 2ADFL 1AHWB 3IDIA 3KLSA 3D5OF 1S7WA 2IAMC 3FT3A 3TO2A 3QISA 1FYTA 1D9KC 5JHDD 3KPMA 2IBGA 4PV8B 2ITDA 3B2VL 4ZFFA 1OF2A 4QRPA 5FYLL 5CD3B 3MODL 4XXCA 2EDKA 1VEPA 5I19L 2BERA 2PYED 3QAZC 1F02I 3CAFA 4IOFD 3X3GL 1Q9KA 1TCMA 5K9KA 4UINH 5CEYB 2PW2B 3SQOL 3ULUL 1LILA 3NIDF 1VCAA 3AB0C 3IAQA 3TH2T 1Z9MA 2JCCF 4L4TA 3UTQB 1NLDL 2VXVH 3MRHA 1N5YH 4K3DH 3IRZA 4XB8A 3PL6D 4IMLB 2VXTH 1CGXA 1H8OA 4G80B 3BH8A 1GGTA 4JY6A 4GH7B 1JHLL 1XF5A 1S9VB 4GRMA 4J3UA 2E27L 4BFEA 3FO1A 1Q9WA 4ZSOB 5FKAA 2IPKA 4Z7VF 5FGSA 1HHIA 1LD9B 3H9SE 4L4VA 4GRWH 3H7BB 4N0RA 3CMGA 4NHCH 3TGXA 4OIBA 4LLQB 2P43B 5F9OL 5M94B 3KPRA 5C0JB 1MFEL 1F45A 4CMHC 3ARVA 4NQCE 4DKEH 1S7SB 3ALWA 4P49A 3RBSA 3QUKB 1QHPA 4MJ5B 3VJ6A 8FABB 4GKNA 2DWDA 4XAKD 4OFIA 4X6CF 3NIFF 3QWOB 4JFYA 4J2XA 4WI6A 1DVFC 2YWYA 3KWWB 2OL3B 1ADQH 5I1GL 3RNQA 1MI5B 3DXAA 3MGOB 4WI2A 4L1DA 2JIXA 2MMXA 4YZFF 4HJGB 1NFDA 1AXIB 5HI5C 4OIIL 4PGJA 1KJ3L 3BGFB 2D31B 3AU1A 5DUML 4YEEA 3UJJL 3MMEB 3U6RB 5D7JA 2D0HA 4ESKA 5AZEH 3Q3GA 2I9TA 1QVOB 2JJSA 1KN4L 3LKRB 4UQ3B 1KJ2B 4Y4FA 1IC5L 5IMMA 3TBVB 1KTKE 3B5HA 3IJHB 2IQ9L 4K3JL 3WUZA 2P5WE 2DQFB 5F21B 1ZK9A 4LK4A 3A6BH 5ETUB 3OG6B 1FNHA 1RZ7L 1SYVA 4XB7A 1AC6A 5FM8A 1WLHA 5K9JH 5F7KC 1FE8L 2AVGA 2OL3H 3ULUF 3VD9A 3MFGB 1HWGB 4URTB 4O4YL 4F15B 2M1KA 4OUUB 1U3HC 4I8DA 1J05A 3IT8D 5GGVY 5GZOC 5GSVA 3OGOE 1WFOA 3MRJB 3UO1L 1VHPA 3QWQB 4FS0A 4RGMC 4AEIL 3G5XA 1W0WA 4PJ9A 1IT9L 1T1WB 5HDQL 4NGHH 1DUZA 4LCCB 3RPIA 1E6JL 4OZGE 2DMKA 2VYRE 3ARPA 4J6RL 3MLWL 4N0UE 1BQHG 2R2EA 5GGRY 4D3CL 1I3RB 1KJ2H 2QEJA 25C8L 5GJSL 4NNYA 3HZMA 4Z0BL 5C0CB 3FZUD 3MRKA 5DD3L 3SO3B 4R7DA 5DUPL 3NGBC 1JZ8A 1J8HD 2Q76A 2AQ2A 5L88H 2Q3AA 5F88A 4LSQH 2BVEA 2OZ4A 2VMFA 1PKOA 3HNSL 1MHHB 5CZXD 4ERSL 4PP2B 1CVRA 4XVUD 3PNWA 5KSBA 5FO8B 3ZL4H 3TJEH 1J18A 3WJLA 1QA9A 2CLRB 5C0IB 3UCRA 3FCTB 1R6VA 5DS8A 3V6ZA 5EUOE 2HT4D 1R0AH 3T65B 1DCLA 4J1UB 4JJ5B 3SKNB 4JHAH 3D18B 1DBAL 3FAXA 3U2SB 1FNEB 4AK1A 4MAYB 2DD8H 4I48A 4IOIA 1HH9B 1HH6B 1XR9A 3F12B 3RUGE 1R3KB 1XMWA 2XZAH 3ARYA 5HVHC 2KQMA 2ZOLA 3IDMB 4DVRH 2JCCA 1F3JA 3IYLW 5LBSH 4NZRH 1AR1C 2OR7A 4HUVA 5IEHB 1QEWB 3TC9A 4ZS6C 5EULV 3BPLB 3LEXB 4JFZH 2D3VA 3QFJB 5I66A 3RTQC 4WGVB 3EFDH 1JNNH 1ZOXA 4Y1AD 3OJ2C 1SJHB 4ELKA 3QEGH 5DO2D 4GBXC 2GT9B 4Z7UB 4A6YB 4Z7VA 1NMAL 3WFBL 3SDDA 1K6QH 3UBXI 5KJRL 3UC0H 3CH1A 1ED3A 1MY7A 4LIQH 5DR5L 2ZWLT 2NXYB 4PJ7B 1KCKA 3QUMB 1U58B 1GC1C 1Q0XH 2F15A 4HKXB 4JAMB 1KIUA 2GUOA 4NJAL 2MFNA 3UJTL 1A1MA 1KULA 2P24B 3RWCB 3UTPD 2A6KB 2FRGP 3I6LE 1BIIA 4X6CA 3UZQA 4OBSA 4HBQA 1F4WH 4LNRB 5DJDA 3M17A 4HXBL 2ZNXA 4WUKH 3O8XD 1FCGA 4Y8DC 3JWOH 4JRYE 4LBEA 4DVBA 4JPIB 3WJJA 1B0WA 1YYLL 3V6OE 5IEKB 4JZNA 4M6ML 3WO3B 3MRDA 4NRYA 4RFOH 1RUPH 1IAIH 2A9ML 3QIUC 2R4SH 2NY1D 4I9WD 3VRJA 1ZHKA 2BNQB 3HE7D 4HLZG 4JDZB 4D8PB 3LKSB 2GJJA 5D1ZA 2C7UA 4A6YH 4DN3H 2PNDA 4PG9A 5C0AA 1X6LA 4NO0D 1OTUC 4MD4B 1MCNA 4D0CB 3LH2H 4EQ2A 5F93C 2O93L 3OKMB 5L6YH 1EFXB 5F44A 4FRWA 5LQBH 3MV9E 2NYYD 3VFWA 1IRAY 2F53E 4CRPA 4PJCB 3E6FB 1KB9J 4HPOH 1A0QH 1R5IB 2WUBL 1D5ZA 1RUAL 2GSGB 5ADPH 3CCHB 3E6HB 4M3JA 3O6ML 4X5WA 3OKNB 1KCLA 4TVPD 4EI6B 1KJVA 4NRXA 1SEBB 1AGDB 1QSED 4JRXA 4WEBH 3U7AA 2RIKA 2NY5C 4JG1L 2FX9H 5FIEA 4P5MB 5I8KH 4ODUB 2NY0B 1UYWL 4PJIB 3QR2A 4PJEF 5J3HC 5DRZB 3TT3L 5HYJD 2HKFH 1FGNL 1V3KA 1WZKA 3SCMC 4CVWA 1Z9OA 4HX1B 3O4OB 4HLJA 4HFUL 4PLJC 3V4VL 1DSFH 1Z9SA 1FRGH 2MQ0A 3PHSA 3L3HB 5L2KD 1B9ZA 4KKBD 5E5UB 4R26L 1UJ3B 4FQXC 2JELH 3HMWL 1ZLUH 2AXGB 3VWJB 3T2NH 3VFGL 12E8L 3PDOA 1F00I 2B4CC 2D2OA 3FB5B 4X0KB 3IDNB 3BD4A 2HWZL 2E9JA 2ATKA 2F5BL 3MZGB 3QFDB 2VRAA 3ZMRA 5FDYA 5T3ZD 2RB8A 1RJCA 3P3YA 2I5YL 1KOAA 3ECBA 3FONB 3ZHLA 3MFFA 2CUIA 4JFDA 1JFQL 3RVVD 3EOYG 1IC7L 2WWMC 1JTOA 1KGCD 2A77L 4PUBL 4PREA 1CDHA 4X4YB 2X1WL 3FFDA 1NGZA 3OPZL 4UOJA 3T0BA 4PJ5D 3BMVA 4JPKL 4ZSOE 4TNVK 1NCAH 3SKOB 1KTLB 3PWVB 1GGIL 4LP5A 4C56A 2IF7A 4NHUA 5JA9A 4NWUL 1FZKA 3QPQD 3AROA 1BFVH 4QTHA 3X13A 3VRIB 4K7FB 3L3OB 3VFUA 5HBBA 1T03L 1HXMA 1QFUH 4JFFD 4PP1C 1F3DJ 2FECI 1KT2B 4DN4H 4XP6H 4YHMH 3SKJL 3D3VA 3ESVF 5KG9B 3F5WB 1MI5E 1HSBB 3OAUL 2PW1A 2CDEB 1UQSA 4S1QH 4JHBA 2YN5A 2XA3A 5KAQF 2NY2D 4P2OC 1KSRA 3LCYA 2YA1A 5E9DB 4NKMA 4OF7A 3C5ZA 1LEIB 3LEYL 1HINL 1K5NA 5I1DA 4APQC 1CIDA 3DSFH 4JQXA 4KK5D 1T2JA 5EPMB 1CD8A 4R7NA 2AV1A 5INDB 4OFYD 2WLZA 2AQ1A 1CF8H 2FEDD 1HYRC 4YIQB 2VH5H 4TVSa 3IDYC 4BYHA 4ALAH 4JVPA 3LKOB 1S7RB 5IB4B 3MYJB 5EWIL 1NAML 1JIBA 3PP4L 1P7QD 2IANA 1YMHB 3L3IA 1JGDA 1YQ2A 1OWWA 4XMPH 3I6GB 4U3CA 1P7KA 5ISZD 4FZEH 5CUSH 3F7QA 4NQCD 1HEZB 1NGQL 3B9DA 3IFOB 4LEXH 5EA0H 2FCBA 5FECB 4YHZH 1ETZB 1MHCB 1DQLH 4EIGB 2VLLB 5L8KB 1Q72L 3KVQA 1YQVH 3KYMA 5F7EH 1N59B 4HZAA 4M7KH 5K33A 4LCYB 1J0YA 1FNFA 2XY1A 2CQVA 2IGFL 4QRTA 1BOYA 3WNKA 5I1CH 4P9ML 1EHLH 5J89A 5F9WC 4XXDB 4HXAL 5ESAB 4RA0C 1QYGH 5GS0D 2FH8A 3RPKA 5C0CE 1NEZB 2PETA 1E27A 4JO3H 3O3AB 3U7YH 4MXVF 2FJHB 4UTAL 2R0WL 3DGGB 3DWTA 2YD9A 4PJEA 3W5MA 5I1KH 1RMFH 4NWTH 1EAJA 1QRNB 1A21A 4QHMB 4Y4KB 5L8LB 1OPGL 5I74B 4Y5YB 3U4BH 1OAUH 1A5FH 3IAPA 1P4IH 5KZCD 4ZD3H 5F7DA 3H0TB 5F97E 4L8SB 4ZO8A 5IOPA 1DANU 3QH3A 4GW1A 1P7HL 1JPTH 2H6PA 2OI9B 2NW3A 4HUNB 1GGBL 1OLLA 1ULVA 4KUCF 3P9WB 1MFAH 1MJJA 1RIHH 3QUXB 2OCFD 3QXWA 1OT1A 4Y2OA 3MLZL 2EXWD 5GS1A 2DI8A 3LPGA 3RP1A 4DZ8A 5IG7A 5FEBA 5T1KD 1HHHB 1HOCA 4FP8L 2GSIA 3BKML 3RKDD 1BJ1J 3N1MC 3QFJE 4OQTA 3S5LB 2YBRB 5TF1H 3SO5A 3MRIA 2XQBL 5E8PA 3D69B 4Z7UE 4LQFH 1EGJL 4ZQKA 1TJHL 4OD1L 4YHIA 3SDXF 2HTLD 4KPHH 2DKSA 1WBZB 3RY5A 1LK3H 3KPPA 4TUOB 4PJ7E 1MVUB 3DMMB 3GRWL 4JO4H 1FZMA 1HQ4B 4NQEA 3HG1A 1IARB 5KW9H 5ID1A 4TSAL 3B4NA 4TUJB 4K07A 1OP9A 1OSZB 3WKMH 2AEPL 4L3EA 1H3GA 3SJVA 1T7ZA 5CMAA 3QUYB 2A74A 1S9WB 1W0YT 4RFEB 1URLA 5KSVA 5GRVK 4F2MA 2YA0A 4U6TA 4KV5F 3MJ8A 4FQLL 4P23C 1BVKB 1M7IB 2EDWA 2ZKHL 1RK0A 4N0YL 4NC1E 4OUOA 4QRRD 3LD8B 3L1OL 4LF3B 5KVGL 2H2PC 2VQTA 3GSVA 4MCZA 3O9WD 1Q0YL 3BPOB 5GS2H 3OAYK 4LCWD 2Z31B 4W81A 5BXFB 5E6ID 5JQ6L 5ANMA 4WO4D 1YN6A 3F6IA 2M2DA 4ENED 4NP4H 1B4JH 5HGAA 2ARJQ 4PJCE 1DUYA 2Y07H 3AAZB 2AK4A 3ZE1F 3VRLE 3BZFA 4E41D 1XR8A 2XWBB 1CFVH 3SDCC 5DYOB 3O2WH 3OGCA 1AO7D 3EYSH 3MJ6A 4PJIE 1ZA3A 4G6JH 1WITA 2CUMA 4EUPH 1SM3L 3MRMB 1E4WH 4MNGB 2FO4A 2XKNA 5DJ8B 4UINL 4F3FB 3KPLA 2R2HA 3I6LD 1X7QB 2DLTA 2C5DC 1SVCP 3V5KB 3IU4H 2VXVL 1N5YL 4K3DL 5IM7A 3AM8A 4CDHA 2VXTL 3LKPB 1G0DA 2YZ1A 2D7TH 3FN9A 1OGAB 2DLIA 5E2JA 2NX5D 1QBBA 4OT1H 1GZPB 2R1WB 3P2TA 1OTTC 4K8RC 1JWUA 4F7EA 3T8XA 3QI9B 5B39B 4NHCL 2JE8A 2V7NA 1INQA 2V6HA 1WAAE 2QADD 3TN0D 1KTDA 3DO7A 3PP3H 2BP3A 2FYYA 1V3MA 4RDQG 2HN7A 2NY6C 4LFHD 3HI6H 3IFNH 5F8RC 4DKEL 2XNAB 1I3VA 1EHXA 1EXUA 3MV9D 2VE6B 3MPCA 1MSPA 5D96B 5EO0A 3ZYOA 4WFGE 4YE4H 3AS1A 1U95B 1CD1B 1ADQL 4LSDA 4YPGA 4FA8A 1INDH 4N1HB 5C09D 2HTKD 1WJ3A 2WWKO 2FD6H 2VLJB 3OL2A 3PWNB 1CD9B 4HIEA 4TVPH 4PGDA 3T2PA 2LVCA 2BVTA 2JK5A 1DQMH 1I3GH 3WXWH 5I1IH 4G6AC 4ZOBA 5AZEL 5BS0D 1HQRA 1CFNB 4RFNC 1QSFA 1NAMA 4EXKA 2O5XH 2GKIA 3ARDA 2CIKA 4ZXBA 4AIZA 2PTTA 2FB4H 1BQSA 4HKJB 3QJHB 3WFDL 1SJEB 2IPTH 3DRQB 3MBXL 3QUZB 4N1EA 5C07B 5E9DE 2P5EA 4HK0A 4NO3A 3IVKB 3SDXA 3A6BL 3Q5TA 4NM8H 2BVQA 4K71B 2EKSA 4AIOA 3NFPB 4QHNB 5DA0B 1FG2B 2GJ6A 5K9JL 3D9AH 4RX4D 3UZVB 1CCZA 3GSRA 3FAWA 4KKLC 3NA9H 4MDIB 3ROOA 1YY8A 4QKXB 5GGTH 3L5XL 1A1OA 3MREB 4ZS7H 3C6LD 4AL8H 1Y6NR 3ZKXC 4Z7WF 3C60C 4NGHL 1J7VR 1BZ9B 4LPCA 2GY7B 1UB6B 1A22B 3HZYB 4KRNA 5AAWA 3WCYA 4GRWF 2HLAA 3B6SB 1KJ2L 1WV7T 3NCYP 3UYOD 1I8MB 3T0AA 1BF2A 3ULVD 4U1HB 1QSZA 3X11A 5ID0B 4HZLB 2KPNA 4IRJC 4JANB 5L88L 1CLYH 3ILQD 3HA0A 4LSQL 4QHKI 1ZLWH 3MLYH 2IWGA 3HZKB 2C3VB 4HIJA 4N0FA 2FSEB 3CZFA 4JLRA 5IMOA 2H32B 3BP7B 3NZHL 1N7MH 3TJEL 2VDLH 1W72B 3IS0X 5ESQA 3T04D 4RAVB 1U42A 4HWUA 3U46B 1R0AL 3FT2A 4XBPA 2EDFA 1P1ZA 3CSPA 5DSCB 4JHAL 1FBIH 2BVUA 5FOBB 1YNKH 4PJXB 3RZCA 2Y5TB 3QA3A 1JGEA 2DD8L 4XXCC 3MA7B 2XZAL 4B0MM 4GRLA 4L8DB 1SEQH 4WI8A 4DVRL 3LHPH 5LWYH 5LBSL 1G7IA 3TIDA 4NZRL 1YA5A 5C0ND 1QZ1A 4FFZH 3IB4A 2D7MA 5B4MD 1EGJA 3U82B 1U8MB 2KZWA 3OJVC 1TCRB 1JNNL 3EFDL 4X83A 3GEWB 3U9UA 4X99B 3IF1A 5IJVB 1QLFB 5HYSA 3L5WA 2YUVA 2H32H 1A47A 2VC2H 2CRZA 1LGVA 1PZ5B 2WUCH 5EU7E 1K6QL 3P9MB 1G6RH 1CDJA 3MROA 3WUWB 5EH1A 1RD6A 4YDJA 3VDBA 2FIKA 3UC0L 1T1YA 4LIQL 4KKAC 1CLOH 3MNVB 5GGUA 1AGEA 1UZ8B 1CQKA 5GGRB 1A6TB 2P8MA 3B8YA 1ORQB 2V17L 4WWKA 2R0ZH 1FAKT 4NUJB 2I60H 3GJFK 5FM5O 1BD2B 1GGYA 2R1YB 3WIIL 1F4WL 3ALXA 1TFHA 5SWSB 3RVTC 3C2SA 1EMTH 3L3GB 4QO1A 1F3DH 3CFEA 3ZYZA 4V1DA 4RFOL 1RUPL 4AY0A 1IILE 2F54A 2PXYA 2V7HB 5HHOB 4RRPG 5H2BA 3O3EB 4IJ3C 3H9HB 3WIHA 4CU7A 3O3DB 5GGVH 4NQTA 4A6YL 4RGNB 2IALA 4XGZA 3ZSSA 1CFSA 5MI0B 4DN3L 3TCLB 1YNTA 4OLUH 5I0DA 2X4NB 4ZUWB 4P5KA 5D7JC 2QTEA 4YX2H 5L6YL 4N90D 5LQBL 2VKWA 2JJSC 4WUUB 4KMLB 4Y4FC 2C4FU 2DL2A 4HPOL 4I18A 1A0QL 1XGUA 1G0YR 3AS0A 2GK0A 2ICWJ 5ADPL 2IQAB 1UM6H 3T0DA 4HIXL 3RIFK 3MOAL 5D2LB 4WEBL 4MB3A 4LLWA 1OL0A 4FXLA 2FX9L 2XN9B 5I8KL 3RX5A 1IAII 2BFVH 4P2YA 3QFJD 2IAMB 5F9JB 2HKFL 3MV8A 1OQOA 2V2TB 4AENA 1DSFL 1FRGL 3O2VH 3GSUA 4Z7WA 4EKXA 5HYFA 2CK0H 3L3KB 5EU3A 4OTXH 5MP6H 2JELL 4P3WA 1B2WH 3QAZB 5J56B 2AXHA 5SX4H 3T2NL 3QDJB 5MEND 4PJ9C 4OM0L 3AB0B 3BP5A 5E8OB 4U1MA 5EO1A 4F9LC 1MFBH 1W8NA 4CUCA 1FVEB 4MNGE 3PWLB 4WV1A 4DTGL 3JV4B 2ID5A 9CGTA 4OLZH 5FUCC 1S8DB 1MHEA 1NEZG 1U8LA 1M4KA 2GTWB 4HWBH 3I75A 5M7QA 4NQVA 3MV7B 3TNNB 1UH4A 4PBXA 4N0CD 1OGAE 1CZ8H 1ADQA 4N9GB 2B1HH 3IDGB 2I07B 4CMHB 4NFCA 3BX7C 3SGKA 1FO0B 2ED8A 4P2QD 1KXVC 1GHFL 1P6AB 2N4IA 4IRSA 3WJLC 1OW0A 1YY9C 2PTUA 2ZUTA 5F1SA 1BFVL 2IFFH 2R9HD 4QRQA 3WS3B 4WI7A 1FZOB 1CFTA 3LIZH 4L8CA 5J1SC 5E5RB 5T1LD 1DVFB 4XZUA 4NOBA 1QFUL 2VLRB 2DIBA 4DN4L 4YHML 2NLJA 1XT5A 1IGMH 2VZTA 3STLB 1KN2H 5DURD 3EJZD 3MRNA 5E8DH 1RUKH 4K23H 1ND0A 3CFCH 4S1QL 2UZXB 3VFPB 2VLJE 3BKCH 35C8H 3N85H 4FTVA 3TPKA 4HDIB 4V2CB 4I3SH 3S5LG 3DI2B 1H15A 5DJYB 1FYHB 2FZ3A 3OB0K 3ME0A 3EDDA 1Q38A 1U8HB 1HKLL 5JNYA 3DSFL 3LEVH 1I1FA 1UWGH 2AV7A 3SDDC 3ZKSD 3GMPB 4YHOH 2ADIA 1CF8L 3OKDB 2HMID 1SMOA 3QULB 2VH5L 1JF1B 3GK8H 4MQXC 2WSKA 2NCMA 1QFWM 2BVYA 2R2BB 4ALAL 4O51B 5FOJA 4WTXA 3CXHJ 1MCWM 3W0WD 3BIBX 2Q7YB 3IJYB 4GXUN 4PB9H 4XMPL 1T2QH 4MQ7A 5DHYA 1U3HB 3H8NA 2DYPA 4ZFOB 4FZEL 5CUSL 4RGMB 1NC4A 5EA0L 4LHUB 4YHZL 3WJJC 3LRGA 1DQLL 4KTDH 3ARGA 2DQDH 1ZXQA 4K9EC 2MQ3A 1SVZA 4EVNA 2P46B 4ZFZA 1L0XA 3L3JA 3P77B 5F7EL 4UI2A 5E94A 1VPOH 1EEQA 4M7KL 1I4FB 1A7BA 1WIOA 4KK6C 4KGLA 4KQ4H 1AKJB 4ODBD 3LS4H 5AD0A 1P4LA 2P8LA 3RX8A 4A2MA 2MCPH 3NGBB 5I1CL 1EHLL 1XF3B 5MEPB 2A73B 5JXED 1QYGL 4IMKC 4RIRA 3UTTA 4NZDA 3FRPG 3TZVD 4GW4B 4PLNC 2XPGB 4F33B 4PTUA 3OR7B 3CPLA 3J7HA 5I76A 4D9RD 1MH5B 4JO3L 3U7YL 4Y19B 4P3DB 3A6OA 5B3NA 1IE5A 4JFEA 1J1XH 3UDWA 5C0EB 5I1KL 4NWTL 2L7UA 4OAWA 2BSSA 4IHOB 2EO9A 4WRLA 3TVMD 3ULUC 3DROA 3U4BL 3QXUA 1OAUL 1A5FL 1U3ZA 2BOCA 2Q8AH 3ARRA 1LE9B 4NKOA 4ZD3L 3DTXA 1UA6L 1D7FA 5BJTA 1KC5H 4LL9A 1YDPA 1JPTL 4ZUTB 3MRQA 5HVHB 2LAGB 4UBDC 3EFFB 1IGTB 3FQRB 1XGPB 5ELIA 1QFOA 4PJXE 4PRNA 1MFAL 1RIHL 2HT3C 1UB5A 3QQ3A 2BY0A 4MNHA 3GMQB 4DWHA 4JVWA 4AQ1B 5DTFA 3TBSB 1D5XA 1NDMB 5KS9F 2J2ZA 2PCPB 2W60A 5I17B 5B39G 4GBXB 4L3CA 2YEZA 1R3LB 1U36A 4MD0B 2D7OA 4AM0A 4YK4C 4XNZC 2EEDA 2VDKH 5FUOH 1XCQB 1FJ1B 5TF1L 4KHTH 4FNLH 4YFLF 2OXGA 4H26A 4HKBA 3HZVA 2X4OA 1ACYH 2WM0A 4FQCL 5HJ3B 4OV5B 1ZS8A 5EBLA 1CICA 1EUTA 1OB1A 4HUXB 4KPHL 1J0HA 3ULVH 1I1AA 3OB8A 3EOTH 4XP9H 1LK3L 4FXGB 5GRZA 5KANG 4F7PA 3BPCA 3ARBD 3K74B 4GW5A 3OX8B 1XAUA 1L7IH 3W2DH 5JXAH 4JO4L 4XBEH 4MCYA 3W9DB 1ZVSA 4M9OA 4U1GC 1NL0H 2QHRL 4KK9C 2NR6C 3DX6A 5I73C 5TDOA 2J8OA 1J10A 1N8ZA 5D1XD 5SWSE 3WKML 4Y5XA 2R1XB 4BH7B 3ILPB 3BN9D 3QIUB 4JM4H 1CL7H 5LAXA 3BWAB 4Q9RH 3A0OA 1HHKA 1GH7A 3V5DB 3EYVA 2BDNH 2GFBB 4R9HA 4TRPL 4G8GB 3L6FA 3VXMD 1D5IH 3QQ4A 4DOHB 5EU4B 4ZUSA 4HULB 4NIKB 1BOGB 4I0CC 4WW2F 5HHOE 5I75C 4XVJH 3RHWF 1A6WL 3WLBB 5IKCA 4RGNE 1RZGB 2E6QA 1Y18A 4UZGA 2RGSA 1CG9B 2V2WB 2X1PA 2FLBT 2ZSVA 3EGSB 4JQXC 4ZUUA 3FFCB 1B4JL 2UZIH 2X6MA 4X5XA 2Y07L 2WBJD 4MNQA 1CDYA 2XT1B 2CDFA 3GJEB 1U92A 5D2LE 4OCRH 4LKCB 3SCMB 1CFVL 5J1AB 3G9AB 5H37H 3KPSB 3O2WL 5CP7A 3EYSL 4F8TA 2EDBA 4G6JL 4FQXB 1B3JA 3OF6D 1E4WL 3CCHA 1UXSB 2Z8WC 1JI1A 3DVNB 1KCSH 2Y36H 3R0NA 4FHBD 2XTLA 4JN2B 1C08A 3O4LB 3I3EA 3IU4L 4MJ6B 4YO0B 4CADA 5HD8C 4HS3A 3C2AH 3QDJE 3D6GA 2IBZY 3IDXH 5JPNB 4E0RB 2D7TL 3CSGA 3L5JA 3DMMD 4M5YH 1U8IA 3TLRA 3EOBA 2ATPB 2XFXB 1OAZH 4OT1L 2APXA 1FFRA 5MEOB 3KLAA 4DW2H 2AXGA 2VL5B 1K4CA 1RJZB 3TFKC 1DBBH 3EO9H 1QLRB 4DQOH 5KVFH 1LP9B 1KIQB 1MY5A 4UB0H 4JQIH 1WBXB 1JGVH 4RZCA 4C4KT 3MV7E 3HI6L 4UDTA 3IFNL 2VDRH 2HA1A 2YPKA 4MYWB 4M8QA 5LGHH 5HHNA 2R0KH 1OP3H 4XPBH 2FNBA 5E56A 4G8EB 1M05B 3C5JA 3HUJF 2PO6D 2GI7A 4XWOC 4YE4L 2I27N 5JHDA 5FGCB 1F2QA 2YZ8A 4OIAA 3ZE0E 1INDL 1KCRH 5EOTA 2PYEA 5D72H 4L29B 4EXPX 3DYMA 1T7WA 3EJYD 3QDGA 3HC3H 4TVPL 4TSCH 5IV2B 4U1IB 3PIQB 2R69L 1QFPA 32C2A 4N5EC 5GS1C 1EVUA 1DQML 1VGKA 3WXWL 5I1IL 1ZHNA 3PL6A 5I16B 5KS9A 4BA8A 3QEHB 4NC0B 4P2OB 2JB6B 3WUWG 4CVXB 5HHMD 3WHE1 3I02B 2O5XL 4B53A 1TZGH 1MAJA 3MRCA 5AYUH 2FB4L 3A67L 5JIPA 5HTSA 1RHHB 4APQB 3CFJB 4YXHH 2IPTL 4UU9A 4GG8B 4Q6YA 5GIRB 3CDGB 3D48R 2VAAA 2ICWB 4NM8L 5GZND 4C58B 3RWFA 1S7TB 1BVLA 5C70A 1JZ7A 5C0BE 3IDYB 3MRGB 3RWEB 1EBPA 1I7UB 1YPZB 4BKLA 4OCMC 3D9AL 4M61A 4M7LL 4OZFH 3FB6A 3NA9L 1KJMB 5J1TC 3GMLA 4GG6E 5GGTL 4G6FB 1I85A 1WICA 1ZKAA 4ZS7L 1U8OB 1LO2L 3NCEB 1PQZB 2J4WH 4TTDD 4AL8L 2DQGL 4U1SB 1MWAH 3RL1A 4OF3A 4NCC1 4QWWC 2AJ3B 1VB9A 5T5FH 4BSVB 5MEQA 1ROWA 2J1KA 4AH2A 5D1QC 1AQDB 3D1MC 1DEEB 5FDWA 5ICZB 4WW2A 3GGWA 4M1CD 3C9NB 4KH2A 4PJDB 1CT8B 4WFED 2EDTA 2GY5A 4Q2ZA 5DMIH 2ARJB 2IPUG 1CLYL 5F9WB 5KANI 4DKFH 4BUGA 3D39D 4I4WA 2P7TB 4CVUA 4HS8H 2BVPA 1T66C 2VLJD 2RHEA 5F7LB 2CLVA 2OR9H 3GFUA 5L7XH 2BNRB 5IJKA 1N7ML 5H94B 2ZZUT 3K8MA 2A6DA 3FQTB 1HYSD 4MD5A 1DQDH 2ADGB 2A0LD 3HI1A 4Y19E 3OQ3B 4KRPD 5DXWA 2HVJA 4ODXB 1EV2E 1MOEA 2J8UB 1YNKL 4J7RA 5B8CC 3G5YA 4MZ3A 3BISA 3Q6FB 2K9UA 2PF6A 3G5ZA 3ZT7A 4YXLH 1SEQL 2YPVH 4QGYA 1N5AB 3IDJB 3LHPL 1AIFA 1E28A 4UDUB 2QQNH 1XF4B 2DBLH 1P2CA 3DYOA 2XZCH 4FFZL 4XNXH 4RBPH 3KNBB 5CJBA 4LSTH 4P46C 3AM8C 5GHWH 1F6AA 3B9AA 3KYOA 1BVZA 3N0PB 2VC2L 1ZHBA 3PDGA 3ULSA 2WUCL 5E2WH 1HIMH 1G6RL 1OM3H 5I8CB 3FTGA 3FHAA 1J8KA 2EYRA 2Y6SD 1T2XA 4EOWH 4Q58C 1CLOL 4LHQB 5CSZB 5HYQB 2HKHH 4ZPVA 5F89A 1T0NB 3H2WA 1FL3A 4MSWA 1NJ9A 3SBWC 2I60L 3HUJA 1IL1A 4MA8H 1NCDH 2R39A 3VXRB 1IM3B 3BXNA 4GAYB 1EMTL 2VERN 5BCAA 1QPPA 1QR4A 4YHLH 4LLUA 1PSKH 1EEZA 5D70H 3BZ4B 4S1SH 3TM6A 4P2RD 2OSLA 5SV3A 5F6HJ 1NDGB 5EO9A 5IHZA 1XIWD 4KKCD 5T5NF 4HF5H 1UG9A 1CFQA 2FWOA 3EDFA 1UCTA 2PYFB 3LB6C 3V7MA 2MTPA 3EO0B 3DX9B 2ERJC 3OXRA 1CFBA 2BRRH 1KPVB 3S9DB 4XPHH 5IVXF 4Y1AA 1AP2A 1UZ6E 4G8GE 5TDPA 3SDYH 3FMGH 1K3ZA 1LO0H 4ZDHA 3T1FA 4DOHE 2CRMA 5AG8A 3ARDC 3PV7A 1B0GA 4JDTH 3UBXA 1T89A 1OHQA 3FL7A 2MPAH 3EYOA 4Z7NF 3BVNB 2EH8H 4EUPA 1RZIA 1UM6L 1NAKH 1U8KB 4F58H 5DI8B 5EU5A 4JPWH 4Z78B 1WK0A 4Z77B 2RQ8A 2C1OA 3ARFD 4JN1H 3O3BB 2XV6B 2A6IB 3RWIA 4XNQA 1L6XA 2KZ1B 4LHUG 3NZ8A 3SDCB 3O2VL 5AZ2H 1IM9B 3TESA 1IBGH 1M6OA 5I71C 2CK0L 3OKYA 3O8XA 4OTXL 5MP6L 1M7DB 3JUZA 1B2WL 5IFAH 3U4EB 3L7EA 1JF5A 3FT4A 3U83A 2FDBP 3KPSE 4S10A 4YC2C 3L7FA 4UUJB 43C9A 3TNMB 4PJBB 3VGFA 5HPOA 1KPUB 1YEDB 1T6WA 2SEBA 5MERB 2APFA 2W9DH 3REWB 1EO8H 1R3JB 1MFBL 3MNWA 3IU3B 3DV6A 4D2NA 1CDBA 3FQUB 1VKXA 5C0DA 4KJYA 4PJHB 4OLZL 3P4OA 3O4LE 2IH1A 3D0LB 5SWSD 1KCUH 3MQIA 1NGYB 4HWBL 2C1PB 2FHBA 4HUKB 3CFDA 4XWGH 1IKFH 1KB5B 1X4XA 1CZ8L 4M4PA 2B1HL 1JP5A 3KJ6H 2OQJB 2WLYA 1JYXA 3RWDB 4I0PD 1F13A 4MJIB 2ITCA 3NCJH 4WCYH 2VOTA 4HW6A 3VI3F 1QSEA 1P9MA 4BQ8A 2IFFL 5DD5H 1BFOA 3NFSH 5HYJA 2VQ1A 5IFJA 2X7LB 5EIQA 3LIZL 3HCVA 4OF0A 4RMTA 3VXUB 5DJ6A 4IIQA 4XPAH 2PUQT 2CMRH 3B8SA 4H1LH 5L2KA 3RZCC 5FGCE 2YPLE 1IGML 2A83B 4GRLC 4HHAB 4YDIH 1C16B 1MCIA 1KN2L 2FJFB 2UVEA 3HRZB 2E7HA 5E8DL 1RUKL 1QPXA 1NBZA 1KBGL 1XGRA 5BZWB 3BKCL 35C8L 3INUL 3N85L 4WU7B 1RVFH 5E8NA 1D9KD 2XXMB 4CN4A 4I3SL 4NRZA 3RZWA 1U8NB 4HMEA 3FO2A 2HFGL 1FQ9C 1FC1A 1S9KC 1X5JA 1YMMD 5GGTA 3LEVL 2XXCB 1UWGL 3QXAA 4PJFF 3K1DA 4LOUD 5DMKB 4Z7QF 2H8PB 4MHHG 3GK8L 3PWPD 3SQBA 1I7RB 4X4XB 5HHXH 4WWKC 5B22A 3VCLA 5A16B 4PB9L 4PG2A 1T2QL 1IEBB 2R4RH 3W9EB 3GSQA 5IMKB 3FB7B 5C6TL 2Q6WA 2Y06H 3Q5OA 4GJTB 3SHSA 3NAAH 4RAUA 4KXZI 1ZLVH 2F8VA 1VESA 3C60B 2A2QT 1WT5C 4WU5A 3S35H 4KTDL 4JFFA 5KSAD 1FNGB 3PHQA 2DQDL 1TIUA 1BGXH 2PXYC 1VPOL 5D7IB 5DEFB 1ZHLB 3SE3A 4G43B 3BEVA 4PRBA 5BVJA 1MCEA 3MCLL 5D9SA 3DBXA 1UENA 4KQ4L 5IVXA 3DX8A 4JM2D 3LS4L 4ZG1A 1TZHB 2MCPL 4U1LB 2OMNA 4IRJB 4EJ1C 1MHPH 3BRGC 4PJDE 2YSSB 3R1GH 4B5EA 3VA2C 4ZAKC 1A6PA 1U6AL 3HR5B 2GITB 1KEGL 4I18C 1T5XB 1MPAL 2ZJSH 4OFYA 3BQUD 1J1XL 1KLUB 3MLXH 3HLAA 1U8JB 4K3EH 3C87A 4DZBA 3MLTA 3WE6A 3IDIB 5EOCL 1S7WB 4YXKL 3FT3B 3HHRB 5TGBA 3TO2B 1FYTB 1P7QA 4OF6A 3KPMB 2ITDB 4ZFFB 5K9OA 1OF2B 4QRPB 5ISZA 1KC5L 3S35X 1DQJA 3K2MC 3OKKA 5C0BD 5I9QC 3JSSA 1F8TH 4WY7H 1ES0A 1G6RA 2J8UE 3ZT5A 3QIBC 1Q9KB 5K9KB 2V5SA 4U6YA 4KJWC 4P57A 4RAVA 2CO6B 4L4TB 3HE6D 3MRHB 1CXFA 4WV1C 4I3RH 3F58H 3BH8B 4JY6B 3QZWA 2XTJC 4WFHE 5GZOD 1XF5B 4YHPA 4GRMB 2VDKL 5FUOL 3SDAD 2FGWH 3FO1B 4KHTL 4FNLL 3CU7A 1Q9WB 5FKAB 2IPKB 3DX7A 1HHIB 3MCKA 3R0MA 1ACYL 3OSKA 4L4VB 3TO4D 2CXKA 3W39A 5T1MA 2ZUWA 3KPRB 1NPUA 3ULVL 1QTYT 5IMLA 3B43A 3SGKC 4PJGF 4XP9L 3EOTL 3HPJA 5HGHA 1GAFH 1L7IL 3W2DL 2NXZC 5JXAL 1OW0C 4XBEL 4R90H 4DFIA 5E7BA 1FORL 3VJ6B 1MCOH 2FLRT 5DWUH 4GKNB 2DWDB 3RVUD 5FUZL 3JUYA 1NL0L 2E7CA 3GDBA 3OAZH 1JWSA 4JFYB 2EYSA 1CR9H 4R2GC 1PY9A 3GI8H 2VDMH 1ZSDA 3RNQB 3T0ED 3DXAB 1AXSA 4JM4L 1CL7L 1TQCC 1NCCL 3QEQD 4XX1G 2JIXB 4LLDA 3KXFE 1NFDB 4IJ3B 5CEZH 1QBAA 3JTSA 1D5IL 1BECA 1BBDH 3AU1B 1HILA 1L9NA 4NKIH 3ZDYE 3V0VA 4XVJL 3EYQC 2P49B 5D7JB 5T1KA 3Q3GB 4ZO6A 5C0FA 2I9TB 4Y4FB 3PXJA 4PJFA 3FQNA 5LG1A 4N0UA 3AFLA 3BI9X 1MAKA 1K4DA 3LSOA 5E1AA 1IC4H 4M00A 2B39A 5FM4A 3GNMH 2R2CA 4ZS6D 5HHQA 5CIPH 4Q0XH 2ZUYA 1ZGLA 2D9CA 1HXYA 3RTQD 1SYVB 5DVNA 4OCRL 4O2CA 4OGAC 4GBXD 4U2ZA 4JREC 3UYPA 2WP3O 3QPXH 4CN1A 2DAVA 3ZKNC 1J05B 4I2XA 5L2JA 5GSVB 3B9EA 4HWBA 5DFTA 3G5XB 1KCSL 1W0WB 4Y8AA 4PJ9B 5L0QC 4GXVH 3RPIB 1DUZB 3GHBH 3ARGC 3ARED 1OAXH 5DQDH 4BZ1H 3GIZH 2R2EB 3IKKA 3IDXL 4XH2A 2QQQA 2BC4A 4PJBE 3UP1A 4M5YL 4MHHI 3BHBA 3HZMB 4NNYB 3ULVF 3EDJA 1FPTH 1OAZL 1SYSA 3MRKB 4ODTH 4R7DB 4DW2L 4QRRA 4OZIF 3QNZA 5FB8A 2Q76B 1DBBL 2YUZA 4PJHE 3EO9L 4LSVH 1DBKH 5F88B 4DQOL 5KVFL 4HJJH 4HH9A 3O9WA 4UB0L 5JQHC 3IKCA 4JQIL 3QIUD 4LCWA 1JGVL 3LZFH 5E6IA 3PNWB 2VDRL 5DQ9A 4WO4A 5KSBB 4F7MA 4O00A 5LGHL 2R0KL 4JG0H 4YBLC 4XPBL 3UDWC 1QA9B 4OB5H 1FGVH 1WFUA 1UEYA 4XPFL 4MJIE 3ARWA 4JKKA 1A4KA 5E6ZA 5DS8B 3V6ZB 3TEUA 4E41A 43CAA 4XNMA 1AO7A 4OCNC 1KCRL 4NFDA 4PJ8D 5D72L 3QCUL 1XF1A 5CP3H 4I48B 4IOIB 1XR9B 3VXUE 3HC3L 4TSCL 2ZOLB 4G8FA 4ZTOH 2JCCB 1F3JB 2QJDA 5D93C 4NBZB 4JHWL 4NQXA 3VFVA 1V3LA 3L3DA 4HUVB 2Y25A 1RJYA 3MO1A 3AS3A 3AS2A 1WGOA 3SCMD 5I66B 3V6OA 3KPSD 3CXDH 4XP1H 4PLJD 1OSPH 1TZGL 4ELKB 2NX5A 1B88A 2DLEA 3SY0A 1FAIH 2KKQA 4YXHL 4FQXD 1I7ZB 4Z7VB 3O81A 3SDDB 1UJTA 4LPUA 4GKZA 3CH1B 1ED3B 3TN0A 1MLCA 4PJGA 4HWZA 3CUPA 1CICC 2GUOB 2X41A 4KI5D 4DKAA 4MQSB 1A1MB 1I1AC 1AE6H 2X70A 2DLGA 3HB3D 3LRSA 1BIIB 4X6CB 5ALBH 3FRUA 1U8PA 5DJDB 3M17B 5I1LA 1MWAL 4LBEB 4DVBB 4XBGA 2W65A 4HD9A 5C09A 3PHOA 4JZNB 1HI6A 3MRDB 4NRYB 4R4NC 5T5FL 1I7TA 5CFHA 4B7LA 5CZKA 3VRJB 3D2UD 3S3PA 1ZHKB 2IC2A 2QKIA 2YRZA 5CS7A 5JW3L 4XCEA 4P5TD 1NBVH 3WDJA 5D1ZB 1XEDA 2C7UB 1DP0A 3IRPX 4PG9B 4X7CC 5C0AB 2OP4H 5D7IE 2YPLD 5BS0A 2DM4A 1XF2A 3D25A 4DKFL 4BQ