1OAQL

Free conformation ab1 of the ige spe-7
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
110
Chain Sequence
QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHLVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords HEAVY CHAIN
total genus 24
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oaqL00
1KIUA 5D96B 5DJZA 5C09D 4FQPA 3KYMB 5DFTA 4XZUA 3QAZB 4LOUC 5J6GA 3PP4H 4XNXL 2P8MB 5IVXF 3CH1B 4HJ0D 2F58H 5C0DA 4GKOA 1DUZB 2BJML 1A64A 4OQTL 3TIEA 5T1MA 2VB5A 3DO7A 5DRNB 2W9DL 2FGWH 4D0BB 4FA8A 4NQDB 2F74B 5F7YC 5HYJB 3TBYB 4YH6A 1JRHH 3O3DB 3BRGC 4NQED 5KSVB 4Y7MA 1LVEA 5C0JA 2CH8A 3LIZH 4YXKL 3ZE2F 3TWCL 2C7UA 4P48A 1MCBA 4HG4K 4C56A 4IRJD 3CVHB 4K9EL 3GSWB 1G7JA 1KLUB 4Y19D 3PV6B 5KW9H 5KSBB 2JB6B 3PWUB 4U1KA 5E99L 1KXQE 4Y4HB 5CJ8A 1DL7H 1P5UA 2P42B 1RY7B 3VWKB 3AY4C 4JO2L 4YE4L 5JW3H 4MA3B 3O3EA 1OLZA 1TVDA 4R90H 3EYFA 4DQOH 4PJBB 3QCUL 3M07A 1J88A 3O9WB 2Q86B 5DEFA 4K55A 4BQ6A 4NRZA 1FZOA 2FHFA 1DEEA 2HLFD 1HHKB 1F3DH 4G9DA 5DRXA 3N50A 1OM3L 3VFGH 5IBUG 3FT2B 1F4YL 1S5HB 3QIUB 2VL5B 3IF1B 1G6RA 4M5ZL 5DEZA 3BP6A 4L8BB 1E4KA 4AEHL 4QNPE 3QAZC 4NO5B 5CBAB 2Y6SC 2F19L 2AERT 3ARUA 1WWCA 1MRDH 1LK2A 4TPRH 3EBAA 1VB9A 4XRCA 1A7QL 3DYOA 5D5MF 2F19H 3P0YH 4C83B 4OGYL 5TDNB 5K9OB 2EKSB 4OD3L 4NBXB 3L3GA 5MP6L 5HGBB 1SY6H 1WWWX 3IKKA 1JZ8A 1OW0C 1AXTL 1U8NA 3ARWA 3BP5B 4K8RH 2H2PD 4U6YB 1JF5A 1ETZB 1QP1A 5C0BD 3UTSA 3MMEA 3EDFA 2VR5A 3PWPE 1RPQA 5FYKH 5F6IC 2ARJQ 3OB0H 3GRWL 3G9VA 1T7XA 2A6IB 2E27H 4XAKD 4M8VA 5BV7H 4JM2F 1BQHA 3PQYE 5CMAA 1CXKA 5J6GB 3L3IA 4HEME 4ZUVB 5BVJA 1GGBL 3CCHA 3CH1A 1I9IL 3KPSB 4JY5L 3MRIA 4XI5D 3RZCC 5IMLB 4KDTC 1A6ZB 3ULSA 3MRLA 3RTQC 1K85A 5IQ7L 4Z8FH 2VERN 3ARDB 3KNBA 1BREA 1EH9A 4V2BA 3UTPE 3V7MA 3QIBA 4LLYB 1J12A 4Z0BH 5D1XB 3VJ6B 4WHCA 4Z5RA 3HC0B 3IJYA 2WQ8A 5JO5B 2YRZA 4O02L 1FRGH 5ETUB 1QBLH 2AABL 4I8DA 4I5BA 3QHZH 5DLML 3W39A 4F8QA 5DUBA 3HE6D 3KPNB 1FNSL 1GIGH 4I77L 4DOHB 5J0BA 1EEUA 3H9HA 4PYHA 1YA5A 2D0HA 3L3JB 3ARVA 2K7QA 4JDVA 1AKJB 5E6ZA 1U8MA 1N64H 4N8PA 4HUUB 2AJYL 2NY5H 3SY0A 1QRNE 3WDHA 1YZZA 4ONGL 4ACPA 2CLZB 5IKCA 3TBVA 1UZ6E 4LVOB 2EIZB 2NY3C 5DRXB 5K9JL 4XWGL 4C4KT 4PRHA 4MD4B 5GJTL 5GGUA 1MIMH 4X6DF 1C12B 2A74B 4PJ8B 4YZFF 2DDQL 5IG7A 5C7XL 5ID0B 3BYYA 4XNQA 1AJ7L 1T04B 4RQQB 4NUJB 2WUCL 3QUZB 2BDNH 4PJ9D 5HI5D 2DQIH 2CSPA 1Z2KA 1B0RB 2R39A 5L2KE 3LZFL 4AIZA 2YC1A 2AV7B 1J1OL 2B39A 2BSSA 2VUOA 3B9KA 3D3VB 4Y8DC 1FNGB 1IAIH 4MS8C 3I75B 3MMEB 4W6YB 2FR4A 1YY9D 3FMGH 3G04B 5JA9A 1BVKA 4PJDB 4ODUA 2XRAL 2YPVL 3MJ9L 3MNZB 4X99A 4NPYB 2BNQA 3IAPA 5EU6E 3QQ3B 1HK6A 3QWOB 3K2UL 3VXTB 3T0VA 2UZYB 5IB3B 2CGRL 1VACB 1PX3A 5C9JB 2IG2H 1Z5LA 3PV7A 1R5VB 5D71L 4QHLA 4GOSA 4MQ7A 5IB2A 5GZND 3RWGA 2C5DC 4WDIB 5F7DB 3S35L 1EJ6A 4AQ1B 3A0OA 4Z7UB 1VFAB 3QFDA 4UV7L 3S5LA 5IWLC 5IK3A 1HHJB 2FIRT 5DFWH 3VG0L 3GGWB 3DVIA 2NY3B 4KC3B 4M5YL 5GQBA 1WIOA 3HPJB 1EMTL 4JCMA 2GFBA 3UTOA 4KV5F 5GRXG 3CDCA 4PS4H 3DO3A 3SKNB 1NGYA 1ZT7B 2YD4A 3DBXA 1YUHB 2O93L 4RGMC 4XPGL 4XNUH 5LWYH 2EDLA 5F3HA 3CUPB 3IFLL 1QO3A 2R29L 2YBRB 1WZMA 4LGSB 4OCWH 4CAGA 4EI6A 1M4KA 2K9UA 4LDOB 3S6CA 1VKXA 43CAA 4JREC 5A2JH 1R5IB 3Q6FA 4Y16A 5DK2B 1KTDA 3CFJA 4XTRD 2PUQT 5EWIL 4QY8B 5JUEH 1MCIA 4MDIA 1CIUA 4N5EC 4NOBA 5J6HA 2EC9T 2WUBL 3RL1B 1CXIA 3UZEA 3V8OA 4D2NA 2XT1B 2VQ1A 1AD9A 4EQ3A 2E5EA 5GS0D 4GW5A 1MCFA 3O2DH 1UM5L 2X70A 2WBJA 3U79A 4AEEA 1JGEB 4OI7A 4OZHF 4PJHB 1VENA 3UZQA 1TCRA 3DYMA 1IKNC 5GS0H 1JFQH 3LKOB 1H15B 2VR4A 1WIPA 3VXUE 3WKNA 2R4RL 4NUGL 1IKFH 5EDXA 2N1KA 4MCZB 4Y5YB 1QNZL 4RAUA 1U8HA 3WD5H 1QEWA 1G7LB 4D0DB 5ISZD 2X4QB 4TUJA 3I3EA 4XP1H 1OLLA 3FONB 1HYRC 5K9QI 1G7PA 5C0RL 2KZ1B 2FR4B 1JYXA 4RCAA 3BZEA 2CK0L 4HS8L 2CKBH 4FFZL 2DQCL 3QDJA 3ZKMC 4S0TD 2EE2A 2HJKA 3QQ3A 4X0KA 3FN0L 1JPFB 3SKJL 5C9JA 5CJ5A 4RBPK 1BD2B 4M6MH 4MD0B 5ITBL 2B7DT 4XXCA 4MS8D 4PJ7A 4X7SH 1IFHH 2O61B 5IB2B 1LWRA 4OF5A 4Z7WA 4WJ5B 3WFZA 1J86A 4OUUB 5E6IA 3FB6A 5ID1A 4YXHL 1RFDL 4FFYH 3DX6A 1IGCL 2APXA 3PWLB 1LP9E 1FFOA 1I8MB 2PR4H 2VLLA 4DVBA 1MIEL 3ILPB 4Z0XB 5DJ2A 5IBLC 2EICA 1RZ8B 2EEBA 3VXMA 4I3SH 3EJZD 4AEHH 3M1BB 4XB7A 4I3SL 2ZCHH 1ADQL 5CJBA 3BPOC 1M7IB 2CDGB 1MWAL 4YIQA 3UBXG 2DBLH 3QQ9D 4OT1H 3SDAC 4XT1C 1XZ0A 4Q9RL 1NAKL 4LPYA 3LKSB 3SCMA 4U31A 4APQD 3QRFM 5AWNH 3MFFA 1NC4A 3RWFA 4FNLH 5FCUH 4L9LB 5FA3B 3WSQH 2OMBA 4GKZA 2JJUA 4MVBC 1H3VA 5GISH 2E9IA 4Y5VC 3GRWH 2ZUUA 2W0KA 4NSKB 4PJCE 5E9DA 2WINA 2LE9A 4P46A 1FHGA 3L5XH 4HX1B 4NO3B 5BS0D 3N1GC 4M43L 4X6CB 1OSZB 2MHAA 4JM2D 2NY6B 4XCCL 3BKCH 3QHTC 3KYOA 3CSGA 3JV4A 3DXAB 3MLPA 4EN3B 2BZDA 3UTZA 5GS0C 1NAMA 3SDAA 1NEZA 1YEJH 5SWZE 3KS0J 4OLYL 1KIQB 2APFA 3BZDA 5FDWA 3T0XA 4HXAL 4M7LL 2QBWA 5IVXB 1FL5B 2DM4A 4HUVB 3VGAB 2UWEB 1J8HE 5CCKH 4LLQB 2VDNL 1JPFA 3P4OA 1VADA 3ARBC 5T3ZL 2E9BA 5JHLH 1P53A 2H32H 2Y5EA 3TYGH 5T3ZH 2JJTA 3V0WH 2AJUL 1S7WB 3BIKA 4L4TE 4HDIB 3CNKA 3X12B 2FDBP 1M7DA 1T5WB 4K2UL 4NP4H 5HGDB 3RGHA 3B8YA 1JJUA 3FKUS 5ALCL 3JTSA 1ZGLP 2ERJB 4NCC2 3ARSA 25C8L 1HHHA 1PX4A 4OZGF 5L2JA 1XGQB 1LP9B 3NCJH 1R0AH 4N8VB 3MZGB 2UUDK 2J6EH 4K94L 4NHCL 4LGPB 4LPTA 4JHAL 1XF5B 1Q38A 4JFFA 1CLYH 5JQ6H 3FO0L 3PHSA 4NC0B 1KBGL 4OD1H 4M6ML 2H26B 1TZHA 4KXZI 4Q97A 4M7KL 5LGHH 1U8IB 5FEBA 1DUZA 2YD2A 3TWCH 3GSNA 4AEIH 1GGIH 5DO2D 5FM4A 2V5TA 5K59E 4NO5A 3CU7A 3BPLC 4UQ2B 1BZ9B 4MJ4A 4O2EA 1OY3B 4K71B 2DJUA 2I24N 4IOSD 5DDHB 3L9RA 2P48B 3C6LA 2D7TL 3R0MA 3L3GB 4CGTA 5INDA 3C6SB 4HUXB 3KLHD 2AK4B 1X5AA 1Q72H 5SWQA 3NTCH 3OPZH 1U41A 3MV8A 4FTVE 2WK2A 4PPTA 4I9WE 1NL0H 4XAKE 2IMNA 1FH5L 3RGVA 1I9RH 3TJHC 1RHFA 2X9XA 3P0VL 3MOBH 4JKWA 3KPTA 4LSDA 4ZD3H 3OGCB 3F5WB 3KR3L 2ZJSL 2FLRT 4KK9C 4Y4HD 3TV3L 4ISVB 1JV5B 5DQ9A 2FO1A 3RI5F 3V5KB 1K9TA 2BCKB 2XV6B 5IVXA 1ZK9A 4MHHI 1BBJB 4YQXH 2EYTA 3U46B 4OKDA 1DE4B 3NABL 1S5HA 3KPSD 1U8OA 1M6OA 4RGNC 3KPMA 1AD0A 5DMGC 1IC1A 4GJTB 1JF6A 2H32B 4H5SB 1H8OA 4QYOB 4U49A 5IFJB 1CD8A 4LSTH 5IHUH 4YO0A 4L29A 5CGTA 5LWYL 1VDGA 3V5DB 3BEWB 3FZUD 4J3XA 1A1NA 2AEPH 3C5ZA 2FX9H 1JMZA 4RAHA 4BFIB 2RR3A 3OAZH 4LLWA 2OL3B 3V6OA 5ACZA 5JR1L 2Q8AH 3KPNA 2I60H 4UV4L 5GZOC 3V95A 2B4CH 3GBNL 5EBWB 5ANMB 1R3IL 3IXTB 4H8WH 4EEEA 1P6FA 5CKGA 5T33L 2V2WB 3FO9A 3ETBF 2DLTA 4Y19E 4HUUA 5BZDA 2F5AH 5D2NA 5HDLA 2O5YH 3OBAA 3B5HA 3IAQA 1CG9B 4B7IA 4YHYB 5JIKA 3BJ91 5BO1H 3QUKA 2X4PA 3S97C 1HYSC 5IMLA 3MRNA 2FRGP 2J8UE 4MB3A 2G60H 2ITCB 4FXKB 3SGEI 2H9GB 2XN9B 5IW1B 3TPUA 2QQNL 1YEEH 4L3CA 3KPRE 3QZWA 2IADB 2PXYC 2D2OA 3V52H 2IAND 1B0GB 1WAAA 1GL4B 1KJMB 4H0GA 4NDMA 1M1SA 2F54B 5E94A 1JHLL 1B0RA 2Q6WB 4RAVA 3VWJC 3ILQD 4ZFOA 3VD7A 4F33B 1R0AL 1CVRA 2X1WL 4J1UA 4LCIL 1S9VA 1H3PL 4WFHD 3QHFL 5D1QB 4YHLL 2EEDA 3BKMH 2OR7A 1FNGA 2MCPH 2OZ4L 4ZG1A 5I2IA 2H41A 1EHNA 3WFEL 1F4HA 4HGWB 4PJDF 4W6XB 4WUUA 4WCYL 1XR8B 1Y6KR 1FG2B 3ZTNH 3QEGH 4XX1G 3C08L 2VABB 4TULH 1B6DA 1E27B 4PV9A 3S96A 1QYGH 3EO9L 3ES6B 4MNGA 1KPRB 4WTZA 2NX5E 2B2XL 4PJ9C 4PRNB 3R06A 3IDNA 5EBMA 3ZYJA 4YXHH 4CVXB 3MA7A 1Q0XH 5ESQB 2DMKA 2ARJB 4XPBL 4MX7B 3H9SB 1NANH 4XGZA 5JHDD 2A6IA 2C1OB 2QR0A 4ODHL 5I71B 4NUJA 4GRWB 5H35B 1YN6B 2AI0L 5EBLB 3WHE0 4EDXA 3EW3B 1U36A 4E41E 5TGBA 5EH1A 3DMMD 4HLJA 1KYOK 2OL3A 1J0YA 1L0YA 1PG7H 5BOZG 4U1NB 3MRMA 3VWJB 5I1KH 4KVCL 2EZ0C 2Q7YA 1OGTA 4LKCA 3V0AC 1P4BL 4OCLC 3SO3B 3FQWA 4LLYA 3HI6H 1CR9L 4L4JA 5IEKB 1W72B 5FYKE 5HHXL 3LMJL 4DAGL 5C0EB 4FQLH 3MLTA 4XCEA 1C16B 3V8CA 1CG9A 4JFDD 1HH6A 5FUZH 3UP1A 5IJVA 4QT5A 4FQLL 2CO7B 5FGCE 3IKCA 4NRYB 4JANA 3TVMC 2VQ1B 4EI5A 3Q5OA 3K2MC 1TJGH 4JFDA 4PJIF 1A1MA 4R26L 4LPXA 5F1KC 1R3KA 3MREB 5C0IB 5EN2A 2NY3D 4NFBA 4PJHF 1HHIA 2VXQL 4WV1B 5EIIB 2Q76A 3ECBA 3HPJA 5E6YA 4HT1L 4F9LA 4IDLA 3OQ3B 5D2LF 1KT2A 4RISH 4KZDH 4M7LH 1FAKT 4AMKL 2XACC 1ACYL 1KF9B 2JJVA 1PSKL 1NLBH 2WIMA 5DD6B 3MLWH 4U1JB 3QUMA 3HLAA 2QEJA 2O5YL 1G7PB 4KGLA 4LIQE 2RQ8A 3OKDB 4HWZB 3U9UA 4GBXD 4UB0H 2QSCH 1T7WA 4JCLA 3QO0A 3VI3E 4Y16B 3DIFA 4XHJC 1DLHB 2ZG2A 4L4VE 2V7HA 2IAMC 4OZ4A 2X2YA 4PJEA 3TA3A 1BFVL 1DLFH 1OTUC 3VFOB 1RURL 1MHEB 2CRZA 4JRXE 3KPLB 3MRPB 2O5XH 2R23A 1ZHKA 1ZLSL 3WD5L 4ODXA 2XZAL 3OB8A 3RY6A 4GW5B 5CGYD 4YPGA 1PY4A 2XZQL 4P2CG 1DDHA 1EAPA 1YC7A 3F65A 4I0PB 5I15H 3IDYB 4PBXA 2NTSP 1T2QL 3S37H 4KMTL 1TETH 4H88L 4YHMH 1X6NA 1U8HB 4HJGB 1URLA 1I3RB 3IETA 4Z7UA 2VJXA 2D03L 1VFAA 5IBTL 4X4MA 2A6DA 1GAFH 4H20L 5IBUB 1GJIA 4P9HL 5TF1H 3L3KB 4MWFA 2DQHL 2YN3A 5J4MA 4LAJH 4WI3A 3DI2B 4OGZA 1I4FB 2DN7A 4X9GA 4OLVH 1QFWH 3ULUL 2J8UF 2VDML 1RFDH 3GBMH 2WW8A 4IMKC 4XCEB 3KLSA 2ZSVB 1KGCD 4G6JL 4WHYG 1QFWL 4UUJB 5JDSA 1RUQL 3CFBB 2Z0BA 2PN5A 3KWWB 4DCQB 2V2TB 5IHZB 4KDVA 1VA9A 1G9EA 1YDPA 3B9KC 3VW3L 4XVJH 1ZHBB 1QFUH 4ZFZA 5EN2B 4M3JA 1UWGH 1BLNB 1JK8A 4I0CC 3D87B 4GO6B 1CYGA 3DTXA 3BIAX 1FNFA 3HMXA 4P2YA 2YXFA 2Y72A 3JV4B 5KSAB 3MGAA 3LDBC 3U4BH 4OGAD 4YGVB 2V9QA 2Z92B 4DZBB 4M6AA 1F45A 1P7QB 4QXUH 2IPUG 2I9LA 5GHWL 5L7XH 2WBWB 3MRBA 3CMOL 1QD0A 1OTSC 5JORA 1NGWB 4P23A 4E41D 4XI5C 2ADIA 3RZCD 4XVSH 3E6HB 1YEFL 2PCPA 5JOPE 2X1OA 1ZGLM 1QKZH 4XH2A 1ZT4B 3ZDXF 4P57A 4KUZH 3I6LD 4AK1A 1JHTA 4KUZL 1U92A 1G9NL 4OV5B 2Z93B 2O26U 3FMGL 1CL7L 2VSCA 3TGXA 2PW1A 3OR7B 4QRPE 4LKXB 3U7YL 1H5BA 3TH2T 4KV5E 3D39D 2AAVA 3G5XB 1N2RB 2BVYA 3O2DL 1ZVHA 4ZS7H 4JFFD 3BKJH 4PJ8D 5GS0L 3WO4B 1CGVA 2NY7H 4LCYB 4FABH 4FQHA 3ULVE 2CRMA 3TPKA 2WAHA 5GPRA 5CEXB 1N64L 3GMQA 2VLLB 3A6CL 4PRHE 5BMFH 3R0NA 3C5ZC 4X98B 4RRPG 5ALCH 5I1HL 1L9MA 2NXYD 5D6DA 5B21A 3HR5B 1YY8A 2V7NA 1MI5D 3SBWA 2EDDA 1UJ3A 3BDYL 3GSOA 4JFFE 1QR4A 4MHHG 4XXCC 3BXNB 4M93C 2ZUTA 3MV9A 5DJ6A 3HPLB 1DTUA 1WISA 4LU5H 3VJ6A 4EBQL 2OK0H 2OTUB 4X4YB 2ZUQC 3QEHA 2P5ED 3PGFH 3P77A 1CLYL 3B2VL 1JK8B 3LS4H 1ZHNB 4U7KA 1KIPB 1D5IL 2ZOLB 3SCMB 3TM6A 2R9HD 3WE6B 4QRTA 4RX4A 3MLRH 4HH8A 1KN2L 3TA3C 1F4XL 3DETC 1EEZA 5JOPD 1MHCB 1B88A 1BEYL 3HE7C 3DV4B 3HG1A 4GFTB 4MD5B 1RUQH 1FNSH 2VO5A 3SGJA 4Z6AT 1FFNA 1UFUA 4GG6A 3LKNA 1FFRA 3S4SG 4NO0D 4M62H 1UG9A 3IU4H 4ODWB 2H32A 4H5SA 3FO2B 5C0GA 5D71H 3LSOB 2R56L 3CGTA 2QQQA 1NC2D 3G6AB 1AGBA 5C6TH 3QP3A 3LN5B 1QBBA 3MROB 2FATH 2SEBB 5TH2B 2NTFA 2YD3A 3DRQB 2AK4A 1VFBB 3QPQD 2NW3A 1KEGL 3BWUC 4J23A 1TJHH 1ORSB 1U2CA 4P49A 3EO0A 2XKUA 1B2WL 2WP3T 5KVGL 3RNKA 4ZFFA 2A9MH 3OGCA 4KKCC 2GAZA 2X7LA 3DSFL 3BP7A 3VXTA 4NKDB 1Q9WA 2FD6H 5JZ7D 4TUKL 4UTAL 5KTEL 4JY6B 5HVHB 1DVFD 1OGAB 3QEQD 2JIXA 4UINH 2OR8A 4TUKH 1BBJA 5C0AB 5KTEH 4PGZA 4QRRE 1XGQA 1PLGL 3K1KC 4KJPC 1G7QA 3WNLA 1VPOH 2ZUWA 3GI9H 3FHQA 4QOKD 3V4VH 1PLGH 1CFQA 5JPMB 5M95B 3VGDA 5CAYB 3EAKA 4EUPA 5HYJA 3MLWL 1T1XA 1ZEAL 1CT8A 3GNMH 3O3DA 2C1PA 1TZHB 5C08A 4PP1D 5C0JB 2R2CA 1TPXB 2Y25A 3MJ6A 2KDGA 3PUCA 4YJZL 1ZT7A 5AYUH 3HAEH 5CINH 1AGCB 5ALBL 5FA4A 3PDDA 3ZT5A 4PGEA 3O4LA 4E0RA 3TO4B 3P40A 3QIWA 4QXGH 5M7QA 1IRAY 2Y06L 1JHLH 3P11H 1MFAL 5DMIL 5HTSA 1J0JA 5KS9A 4P4KA 3ZHKA 1S7UA 1ZSDA 3OV6A 2FJFB 3HG1B 4PY7B 3WEXA 4FP8H 2OZ4H 3HNTL 4NJ9L 5J12C 3T4AB 1KXTB 4PRDB 5C0ND 1EZVX 3RWHA 4OZFB 3BZ4A 3C60D 4HZLA 3HNSH 1MRFL 5EPMB 2IWGA 5HHNA 3S36H 4WHTA 2BFVH 3T2NH 4ONFH 2H8PA 3GM8A 1GHFH 2BRQA 3U0TA 3MO1B 5I1DA 4JO1H 4ZDHA 2AXGA 4PJAA 1JWSB 4ZMAT 5HPOA 5KG9B 2IQ9L 3NIDE 4KVNH 4GAYA 2D31B 2BNRA 3W2DL 2PW2A 4U6YA 5FIEA 1BGXL 3NAAL 1JTPA 4U1NA 4Y5XB 1OB1B 2G5BB 4G6JH 3WV0A 4KTEH 3T8XA 3NZHH 2NY2B 5GXBB 2YMXL 3E8UL 2N56A 4YHIA 4N68A 5H2BA 2VDPL 4IOIA 2GI7A 3FT4A 3QB7C 4OZHA 1EVUA 1MQ8A 3QDGA 5IVXE 3AAZA 4CU8A 3O3UN 3MNWB 5I9QC 4WJ5A 2ATPB 4F37K 1QHPA 2EH7H 1PG7L 2V2WA 2UY7A 2W9DH 4LARL 1DJSA 4ZTPH 3ARDA 4N0FB 1QRNA 5D1QC 3PNWB 4I13B 2X89D 1DQJA 1AFVH 4LSSH 5EBLA 4EDXB 3CMOH 4N8VG 3IJYB 4HK3J 3MRNB 5GRZA 2P1YA 1AGEB 35C8L 5E8EB 1HILA 1VGEL 2GJJA 4L3CB 1AIFA 4P46D 1KTKE 4HULB 1A21A 3T08A 2DLFH 1SEQH 5T1DH 4BQ9A 3BN9C 4P23C 5FAAA 4WO4D 5EA0H 1A3LH 3H3PH 1ZSDB 3TIDA 3LB6D 2V6HA 2DOCA 3CFDA 3SCMD 4XCNB 4XMKL 4I3RL 1CIDA 2D7PA 3QEUA 3PV6A 2NY0D 1UZ6F 4HGWA 4LCWD 5F70A 1A9BA 1ZHKB 1WQVT 1FVCB 1KJ3L 4NNXB 2VIRA 2R2BA 3JTTA 1NKOA 2HTLC 4RWYL 3D39A 5E95B 5KS9F 2IJ0C 2R15A 2DQGH 5HHNB 4JPWL 4GS7C 5E9DD 5DEFB 4LLAA 4WHTB 3S88H 3C8HA 3QQ4B 4U0RC 3MNVA 3DVNA 1PD6A 1SY6A 4RMWA 3CLFH 2ADFL 2GTWB 4K2UH 1NCBL 4PGCA 4U7SA 4L9LC 5DD0H 3SDXE 1OQOA 1BQLH 4LCUA 1JN6B 4EVNB 1AO7D 1JGDB 1XF3B 4PB0L 5EU7C 3NA4A 1FO0A 3FOMA 1P9MC 1BQLL 4O00A 2BHZA 5E8OA 5FK9A 1SYSA 3IGAB 5IESL 2RAMA 2IFFH 1SBSL 1MCDA 4X6DE 4DN4H 2V7HB 1VACA 3RL2B 2HH0L 4JHBA 4OIIH 3K0WA 5MHSE 5LQBH 1DN2A 5E8NA 3CFBA 1J05B 4LSUL 2W59A 1I9IH 4KFZC 4MQ7B 3VFNA 2V2TA 3NFPA 3O2WH 4BZYA 2B4CL 4GRLD 4ZO7A 1ZHBA 1M7DB 1NEZG 5DT1H 4D9QE 5DJXA 3C2SA 4HS3B 2J1KA 3QSKB 5TJWK 3QIWC 1XGRB 5IJVB 4IRSB 1UJTA 4Y4FC 4NFCA 4QHUB 3HCVB 5DGRA 3VMOA 4XPBH 1EHAA 4N8VA 1RMFL 1IGMH 4CU7A 4WWKD 3HI1B 5FGBC 3VDBA 4KGJA 3TBWB 2FEEL 1HIMH 3NCEB 4QO1A 4F7EA 3BIBX 4RWHA 1NL0L 4Z78A 1U8KB 2Q76B 2AJXL 4OZIF 4ONGH 3UTTE 3MRDB 1QFUL 1INEH 5DUPH 4Z7VF 1R5IA 2EIBA 2YUXA 2R69L 5CD5C 5J6HB 4JGJA 1T66C 5AD0B 2ICWI 4JQXA 3ULUC 5C7XH 1V3JA 4GLRH 3U9PL 3SQOL 1S5IH 4ZNCD 4LCCB 1U3JA 5K9JH 1A2YA 5ESAA 2B20A 3RUGE 2E7LA 5F3BA 4HQQH 2XN9E 1CDBA 1ODAA 3FQXA 1VCAA 3IAGC 2GHWB 4PRIA 3GMOB 5T1LB 3SY0B 1JF1A 3WS6A 3MRGA 2HRPH 4WFGE 3DVNB 5BJTB 3KPLA 4NZJA 5CGYC 2YD7A 2APBA 2EIZA 4MAYD 3CSYA 5D72H 4LSRH 1BM3L 2A1WL 2XRAH 5EC2A 4HEPG 4YNYA 1N4XL 4PJ8A 4ZYKB 4L3ED 4JLRA 2OS7A 4GXVL 1A3QA 1Q9LA 3QNZB 2HLAA 5D2NE 1T7ZA 3WN5B 1JZ7A 2HAZA 4BZ1L 3QUZA 3H3PL 2A77L 5I17A 2FLBT 3OPZL 2IBZX 3NTCL 3PHQB 1KCVH 4GMTH 5T33H 4NWTH 2H6PB 4OFYA 5HJ3A 3B9KB 4HPOH 1ZVSB 2B1AH 4PP2B 4X80H 4L8SB 5F71A 3MJ7B 1F4WH 2YRLA 3OKMB 4HBCL 1R3LB 4JPWH 1T21A 3T65A 1IARB 5I30H 5CEZE 4JN2A 7FABL 5GGSB 4NPYA 3C09B 1J8KA 1AXTH 4HIXL 3QWOA 1G9ML 3SJVB 3BP4A 1MAMH 3O4LD 1CFTB 1PZ5B 1YNTB 3BDBA 3T04D 3LVEA 3WS3B 2NW2A 1H5BB 4R0LC 1PQZB 2DF3A 2P5EE 4P0DA 5FB8B 2UUDH 4AG4H 1NDGB 3RWJA 3GHEH 1CGTA 1T2JA 3BKCL 2XQBL 4JFEB 3T1WA 3K81A 1CGUA 2X4TB 4KK5D 2WMPA 4PJXB 1L4IA 5BZDB 3Q0HA 2OXHA 4R2GC 1BLNA 2Y4SA 4R7NA 2OR9L 4HZAA 2LV4A 3RVXD 2J12B 1U8LB 1LHZA 2R4SL 3KYKH 1XR9A 3FJTA 2CDGA 2JJTC 3LQZB 4GQ9H 5DHXB 3WN5C 2YSSA 5I8CB 3MJ8B 3UTPD 4YGVA 5ERWB 1F3JA 4MQXC 4XMLH 2JIXD 3TPUB 3GSOB 4FQ2L 4QRUA 1C5DB 4POYA 4LVHB 3O6FD 3RVVD 2ZUYA 5E94B 4L9LA 1PW3A 2GTZB 5KJRH 3OKNA 2CLVB 2Q6WA 3D85A 3D6GA 1GC1C 3QNYB 4ODHH 1IQDB 5E8PA 1NBYA 1ONQA 2DD8L 5CP7A 1F3DJ 4ZPVA 3QXDA 1ZS8B 3STZA 5I2IB 3C09C 4YEFA 1HKLL 4MJ2A 1G7JB 3HC4H 1XGTB 4X6CE 4XVJL 5KSBF 1OAKH 4PYGA 1CVSC 2OLDA 1FNAA 3UYOD 2OYPA 3KPOA 1SYVA 4NKDA 1AE6H 4N5ED 1C08A 2VWEE 1KPVB 4NFDA 4NKMB 3WJLC 2P4AB 4Y5YA 43C9B 2Q20A 2EDWA 5TQ0L 4NQCA 2AEWA 1A7BA 3DUSB 4DK6A 3CMGA 4UT9H 2WZPD 3NN8B 4X8JB 4TOYL 3BN9D 4MNQA 5F9WC 3HZMB 4MB5A 2BSRA 1MCJA 1YQVL 2EIDA 2JCCB 3HUJF 3SDYL 2YWYA 1RUKL 3H2WA 3AM8C 2HJKB 2V17L 2PTVA 4PJIE 4BFGA 5C6PB 1MVFA 3BE1L 1EV2E 3BAEL 4RGNE 4WO4B 3GBNH 1GOHA 2FX7H 1Q72L 2HT4D 2NCMA 4NBYB 5FA4B 4ZOAA 3K80A 2RCSL 4Z7WB 4W81A 1UWXH 4I3RH 3K2UH 1T0NB 4WI7A 2XKSA 2A6KB 4NQEA 4X6EB 1YEHH 1U0QA 2X1QA 1I3GL 5T3ZE 4OUOA 4Q0XL 5ID1B 1WWAX 1X7QA 4NN7B 1KIPA 2PKDA 5KVDH 1Z9OA 2DIAA 1CN4A 4OI9A 1MFBH 1NBZA 3CVHA 1G0DA 1NC4D 5DTFA 1IM3B 4L1HA 4QRTB 3MBEC 1N0XL 2W1NA 5DI8A 3GUTB 1N5YH 4MJIE 3VXQB 4YHNB 5E4IA 1II4E 2CLRB 5KS9E 1EEZB 5IF0A 4LHQB 1MCHA 5GGRY 2X4RA 3O8XB 2BOBA 4Z7NF 3EYFB 3MZTA 4LHUD 3SDDC 4YBQD 2Y06H 5DD1L 5C0CA 2E9JA 4WNQA 1MCOL 1F2XK 4MNHB 3DVGB 3C6SA 4GG6B 3G5ZB 1PYWB 1QFPA 4KUCF 5AZEH 1BX2A 1K4CA 5EC1B 2R29H 3RA7L 1I1AD 4XBEH 5JTWA 2HYMA 2OX5A 4Y5XA 4R97B 4KMTH 1EFXB 3LKQA 3O2WL 5D1XC 2SEBA 3VI4F 3J8F7 3QO0B 1I1RA 2LVEA 1BQSA 4HXBL 3E0GA 5IKCB 3LN4A 3S5LG 3DMMB 4JDTH 3QJHB 4PLNC 1YPZA 2NY5C 4NHUB 1QBLL 5DLMH 3RZCB 1AQKL 1OAZH 4MA8H 4EN3C 5I16B 5DWUL 2P24A 3MV7A 3UBXA 3HE6C 5EUOF 2G5RA 4LSPH 1HIML 1K6QH 5FDWB 3HZMA 1DQJB 1C5BH 3CFCL 4Z76A 4HKJB 4J8RB 2VZOA 1EBAA 5HHPB 4AIZB 4K23H 1DP0A 4LLQA 1U3YA 3VXOB 5JW5B 5BZWA 1AHWA 4IIQC 4KI1A 4ELMA 2ZPKL 5E8EA 1B4JL 3OKEA 4PLKC 5LAXA 4M03A 2C4XA 1PGRB 4G8IA 3M17B 1Q8MA 1H5BC 5HSFA 1A0QL 1RJYB 2NY2D 3VGFA 1A7OL 2IBZY 4R6UA 3MR9A 3K3QA 4P9ML 5EU6D 2HJFA 1MHPH 3QRGL 5F1IA 5F8RC 5LJYH 3VXPB 1TVBA 4P3DA 1SJHA 4KH2A 4TSBL 4TTDD 4PJFB 4JDVB 3M8OL 2H9GA 4MJIB 5D1ZB 4MCYA 4L3EB 5KS9B 2DL9A 5D6DC 1A6UL 4UIKL 2NX5A 5FYJL 4LVEA 2F8XC 4G8GB 4JO2H 1WEJH 2GSIB 5CZVL 5HYJE 1VHPA 1WJ3A 4P2OB 4PRPE 3UYRH 3BI9X 2ZZUT 1NJ9A 1WV7T 4LVHC 4AMKH 5EIVA 4ZFOB 1KIRA 4OBSA 3UJTH 4NRXB 4OZFA 5GGUB 5E08L 1BX2B 1K4CB 4JQVC 4ETYA 4YC2B 5EOTB 5IHBA 2WLZA 3VFMA 2V2XB 2ORBH 5KSBE 3TYFA 3G6JF 3MRBB 4HBCH 1DBJH 4K71C 5GRUL 3SE9L 2R0LL 3MO1A 4E5XA 4G6FB 1KCRL 3WIHL 3MRRA 3EYVB 3BQUA 2WWMC 1N7MH 1K4DB 4G42A 4YWGH 2NZ9D 1N26A 4OFPA 4LNRB 3GJEB 4YDVA 3UMTA 5GJSH 3A6CH 3QFJB 4JVPA 4LSTL 5BMFL 1KXVC 3LOWA 4NHUA 5DS8B 4MQTB 1MCLA 2XWTA 2X44D 4HMDA 4X83A 1TZIB 2X70B 2YXMA 3EZ8A 1XIWA 4JRYA 2ZUVA 3S9DB 2AEPL 4IRSD 4QHUA 1CFVL 4ZAKC 1MHHA 3E6FA 2VYRE 1TQCB 3L3HA 5JR1H 2UV3A 3VXRD 3S5LB 1E6JH 3ZT7A 3FOMB 3EJZC 2DM7A 2XG4A 4QOKE 3INUH 3SGDH 4TSCH 3TCLB 3KYMA 2VDLL 1N0LA 3U7YH 2XKNA 1UYWL 4OM0L 4XPFH 4KI5F 1S78D 1BEYH 4NT6A 1NGXA 1RVFH 2DQJH 1CS6A 4PREB 3S8WA 5AD0A 2IC2A 4LIQH 1LE9B 5B39B 5JHDB 2YBRA 1PFCA 2EH8L 3W0WA 2FNBA 3IYLW 2DQTH 3TBYA 3LB6C 1KENH 5KSVA 5C0IA 43CAB 3FQXB 5DUPL 1XGYH 4D0CB 5DJXB 3RX5A 3KPRA 2BC4A 4Y1AE 4BH7A 5C0RH 4OQTH 2XICA 2CDEA 4L5FL 4M3KB 1P2CA 3VXSD 5FYJD 1UH4A 1XCTB 3TN0C 4JFHD 2MKWA 1B4JH 4EXPX 5EOCL 4N0UA 5F8QC 3PWUA 2RGSA 3H9ZA 4LQ1A 4U1KB 4QTHB 4FRWA 3EGSB 4UILL 4H0IA 3HNSL 2VZ1A 5HDOA 4UT9L 3QIBD 4P3CH 1LK3H 3JSSA 1YEFH 1U3HA 1XH3A 2GTWA 2YA0A 4U1HB 3S36L 4YK4C 1QA9B 3SKUD 5JDJA 1F90H 1JUFB 1DLHA 1W72L 4PGCB 4Z7UE 3F7RA 4HF5L 2P5WB 4OF6A 3TA3B 4FS0A 3QDGD 4IEFB 1FE8H 3BUYA 4ODWA 4QRPA 4S1RL 3DPBA 3RHWK 4LNRA 1JPST 4GXVH 3ARFC 4HF5H 5MENE 3LSOA 4JRXB 1DSFH 2W92A 4F58H 4JKMA 1EEYA 3W2DH 1FNLA 3MUHL 2XWTB 1XR8A 2P8PB 5ECJE 5CJQL 4DUXA 1T03L 2PYFB 4YPGB 3DMMC 1VFMA 2PYED 1NCDL 5I8OL 3O81A 3F7VB 4F3FA 1YMHA 5E1HB 1I3GH 3CFIC 4OLXL 4PJ9B 5DD5H 1VGKA 3PHOA 3P0GB 4OM1L 1O5DT 3MRCA 1S9YA 2J88L 5F7MC 1G7HB 1OARL 1LEIB 4ELKB 3IFNL 1NSNL 2PTTA 4MB4A 2NMSA 5HGAB 1MCPH 1NGPL 2BK8A 4FNLL 1YN6A 1O0VA 1DUYA 4OLZH 3QDGE 4DFIA 3W82A 1UXSB 5BVJB 1C8PA 5J9PB 4PJAF 4M48H 5EU6B 3ULVD 4WUKH 2VAAB 4XPGH 5IM7A 2DLEA 3LEYL 5DJ2B 2YSSB 3MJ7A 4MA7H 5GRJL 1R3JB 4DVRH 3S34L 3CSPA 4QRUB 4FQXC 5JHDE 1NFIA 5DZOA 3VXUB 2NZIA 4BK4A 2CLVA 3S4SA 3NIDF 3SJVA 4QRPD 3X17A 2CDFA 3LKRB 3L1OL 3PWVA 1MAKA 1RJZA 3ARBB 3SKOB 4WWID 3FHAA 3WS3A 1TXKA 5DUBB 6FABL 3C8DA 3KLDA 5EWIH 1WLHA 5I76A 4OCSH 4D3CL 2MTPA 1Y18A 4KK6D 5D4QA 5FA3A 1I9JL 1QZ1A 2EDOA 4XP5L 5A43C 2MOVA 4HK3N 1WCQA 1RZGB 4HCRA 1U8MB 2PTUA 2Y7QA 1D5MA 3CX5J 5FYKU 2AXFB 4HD9A 2DD8H 2I9LB 1DANT 2XQYK 2ERJC 5E9DB 4YC2C 3OKKA 5B3JE 1WICA 3FB8B 4PIRF 3U36A 4W4OC 3T4AA 5C08E 4F57H 5K9KB 3CD4A 5DVOA 3NACL 2PCPB 3DXAA 5D7JA 2P5WE 1W2KT 1NGZB 5IJKC 1EHLH 2J4WH 5BXFB 3CK0H 1SMOA 3I02A 1Z9LA 3MSPA 3FQTB 5D7IF 3EO1A 2K7PA 3PHQA 5DSCB 5IR1A 1RZ7L 1J1PH 3KJ4B 3I6KB 3RWIB 1LO4H 4MAUH 2E6PA 3ZE0F 4CN4A 5KG9A 2CIKB 1MRCL 4FQXB 1AI1H 2D31A 4PJ9A 4LPWA 2Q7NA 3TNMB 1HEZA 5AUMB 5E8DH 1JGLH 3MRCB 1ZLWH 4MXVE 5EU5B 4P3WA 1I1FB 1ND0B 5FKPB 4H88H 4YHML 5E1AA 2W9EL 4XBPB 4KPHH 1JGLL 1I7RA 1S7VA 1GAFL 1U95A 4R4FL 4FQQB 5ICYA 1FN4A 4X7DC 3BO8A 4HIEB 3QDGB 3V4VL 3LQMA 3U46A 2CKNA 1KCKA 4PJAE 2PETA 1IGIH 4WDIA 3L95B 4PB9H 2Y36L 2VDRH 1MIEH 5TF0A 5DEGA 4QYOA 3WUWB 4F15B 3D18A 4M5ZH 3ISWA 2DBLL 2BSRB 1WZ1H 5GSRA 3UJIL 4ESKA 5AYUL 1P7KB 4OQTA 1DR9A 2EYSA 4WW2C 2EXYD 5MP6H 8FABB 4WO4A 1U8JB 4X5WA 4OZHE 2L4OA 3CUPA 2Q8BH 3DUUB 3NABH 2GIYA 2GTZA 2DYPA 2UWEE 2ZOKB 1IEBB 5GS2D 5CEYB 5F9JB 2FX8L 5INDB 1HI6B 2IPKB 5DK2A 3DX8A 5J8OA 4RFOL 4L4VD 4G9FE 3SDDD 3H42L 3RL1A 3QXDB 4MA7L 5E2TH 1A7PH 3JWDH 4XCNA 1A4JA 4HGMA 3MA9L 5E2TL 3PL6C 2MJWA 2WBKA 3GI9L 1HQ4A 1JYWA 1LDPL 2BNRE 1BWWA 3CJJA 3FO2A 4KKAC 3WFDH 2J8OA 5CILH 2WBJB 3BN3B 5KSAD 2WWMD 3WDIA 3O41B 2GSGA 2BCKA 5KANG 3INUL 3FFDB 1BIIA 1F6AB 3ZLQC 4PUBH 4KAQL 3MPCA 4P2RE 3U4EA 1U8OB 3U82B 5D7KD 2YD1A 1OP5K 4KAQH 4PJCB 1JGDA 1XF3A 3NN8A 3ZE1E 3OKLA 1JGVH 2OP4H 5CINL 3W81A 2CPCA 4FABL 1DN0B 4JEGB 4A6YA 1FC1A 4XBPA 5DQDH 1I7RB 2F53E 1WITA 1EK3A 1JFQL 4MA8L 5GGVL 1TQBC 1U95B 5D96C 2UYLB 3THMH 2OL3L 4KK8C 4B41A 5L6YL 5ICYB 4P5TB 1IGJB 1BZ7B 2X42A 3GSVB 3RNQB 3FRUB 5HYSG 3O8XC 5F1IB 1V5JA 1A6VH 3P9MA 3O4LE 3QI9B 4L5FH 4G7VL 4XP9L 4PJFF 1MPAH 4GKNB 4FP8L 1CLCA 5ESQA 1J8HB 2AS5M 3D0LA 4FZ8L 3QHFH 4Y5YC 3VWKC 3O3AB 3T0BA 5IW6B 3FO0H 2G75A 4U7MA 5ADPL 4KKBC 4N0RA 4GAJH 4HLZG 2XQBH 5E7FA 1T0PB 1QLFB 2XWBB 2NNAB 1A6PA 4XZUB 2DM3A 2DJSA 1N59A 1H3WM 4M7KH 3CIQA 2HTLD 3FOLB 3MLXH 1HDMB 1AC0A 2NXYB 2Z4QB 3VFMB 4G8IB 2YWZA 3AUVA 2GCYB 4RDQF 5E99H 1N4XH 1LNUB 4RAVB 1KJ2B 4KROC 5HDQL 1RJYA 4JPKH 4JPIA 2BVUA 1RV6X 3OWEA 3ZYOA 1CU4H 5SWSA 3MLTB 4NN6B 3WNNA 2HJFB 3QUZD 4NGHH 4NWTL 5HGGS 3ARXA 1FL3B 1T80A 4L8CB 1MFDH 4K7PY 4NQVB 1Q9OB 3QIUC 3SE9H 3SDXA 4MJIA 1F4WL 2R1XB 1I9RL 3AREB 3RDTD 3IB4A 2NXZD 3I6GB 1KPRA 5CZXC 1YY9C 3O9WA 1DQMH 2X4UB 1AO7A 5ANME 1OD9A 2FJGA 3ZL4H 2MHAB 5D2LB 2FSEB 3MA7B 4HGKC 3AGVA 3BSZL 3RVTC 3WNPA 3N1PC 3PABA 2AK4E 3VFSB 5L2KD 2VN7A 1KLFA 1NCAH 2ENYA 4EN3A 1FYTE 4FTVB 1IC4H 3QNZA 1OB1A 2G5BA 4JRYE 2HFTA 4JRYD 3BH8A 4RMQA 1DN0A 1TJGL 1ULVA 4LSQL 1QSFA 1WFTA 4HKBB 2YD9A 1DBKL 4JRWA 5DJAB 1IQWL 1VEOA 2I60L 5HJ3B 1OAUH 3ILQC 1F00I 5CIPA 2QHLA 3O2VL 3OKOB 4KJWD 2C3XA 5J13C 4LASH 4LP5A 4WI6A 1BBDH 2F5AL 3EJYC 3RKDC 4JB9L 1MCEA 2G75B 4OM0H 4XPFL 1CBVL 1RZKL 3HNVL 3UC0L 3MRJB 3TNNA 5IFHL 4TNWF 3ARDC 1GRWA 3B5GA 3ZHLA 1X5GA 4S0SD 1XCTA 4CMMB 1QACA 3BOVA 5FECB 4PLJC 2D7QA 3QUXB 3MRIB 2VLJA 3QUYB 2EDFA 3MODL 1N59B 2ITDA 1BD2D 3CC5A 4QXTA 3V52L 5I75B 3TBTA 1BZQK 3IVKA 4M61A 2VZSA 1IZJA 1T1XB 3RUGA 1H3PH 5HYQA 1WCBB 2CK0H 4ZOCA 5JXAH 5KZCD 1PY9A 3JWOC 5A3ID 4JHAH 4FQ1H 1AGCA 4F9PA 1RAMA 3IJSB 1J0KA 5TE4L 4ZQKA 2D7NA 5GJTH 5I73C 1CDYA 4ONFL 4ZXBB 4ZSOE 1AHWC 2D9QB 3FQUA 3HFML 4PJIA 4U2YA 4MDJA 4KTDH 1FNEB 3T0EB 5I19L 3KPRB 3CU1A 5EZJB 4BH7B 5I1EL 4OZ4B 1A22B 3BPNB 1A6WL 2FJFA 3P73B 4DKAA 5T3XE 1Y0LA 2Z31D 4JFYA 3QQ4A 5DMYA 1RUKH 2QKIB 1PG7X 4HAGA 3BGMB 4W4OA 5J12B 3U0WH 3DHMA 3E1F1 2IQ9H 2BNQE 5C2UB 1Q0XL 1R3HA 1EFQA 3WYRA 3PQYB 1ZT1B 1CWVA 1KPVA 4ZODA 3V5KA 3NZ8B 5D70L 1FSKB 4I2XE 5DJAA 2B1AL 2UY6A 4IRJA 4HK0A 1WZ1L 1DBBL 1CL7I 5F1OB 1MWAH 2D9CA 3GMMA 2OSLA 5HI3C 5BV7C 3CDGA 3QQ9C 3OKOA 4R2GD 1HHGA 5DVKA 3MCKB 4MNQB 2HTKD 2AW2A 2ICWB 3GMPB 3FN9A 1TTFA 5IFAL 1LEGA 1WUNT 32C2B 4RIRB 5FOBA 3I85A 5T3XD 1SEBA 1MJ8H 3RVWC 1MCPL 4U4BA 2B5IC 4TVPE 4NZUL 3DRTA 5T1KB 1A1OB 5GIRB 3IFPA 4Z7NE 4DAGH 4RFOH 2P8LA 4XNMA 4OLEA 4J6RL 1UENA 3QUXA 5JHDA 3IDJA 4HV8A 2ATPA 5I0ZA 5E4EC 3BEVB 4FFWD 2DLGA 4KJYB 2FD6L 1MJJB 4KHXH 1HHJA 3TZVC 1NGQL 4M61B 4MAYA 3OKKB 4HC1A 3ARPA 2P8MA 4G5ZL 2CUIA 4GMTL 4LF3A 2X4PB 3W9DB 4L3AA 3SKNA 2ENSA 5CCKL 3QDMA 1I75A 3QCTH 2IADA 1CFSA 3NIGF 2JJSA 4POZC 2MQ3A 1OOAA 3CXHK 1U58A 3S3SA 1HXYA 1MFBL 2RFXB 3RWIA 4ENED 1F8TL 4U1IB 4P2OD 4Y4KA 3E6HA 2X6MA 4ELME 3SKMB 1BVLA 1MAML 2HT2C 3AREC 5HHQB 1HN1A 5HYFA 4JQIL 1D9KA 1ZT4A 1T89C 2XXCB 2XZAH 1Y18B 2DICA 2H45A 4GG8A 1JHTB 1GC1L 1V05A 1RZGA 2J5LB 1EHLL 1MCOH 4NQXA 4LHJB 3BVNA 3GBLA 3UDWC 1MVUB 3FN0H 3NCCB 5F93C 1JNLL 3STLA 4DW2L 2HT3C 2FEEI 4QHMA 3PWNA 1JNLH 4OCNC 4LU5L 3SHSA 2IH3B 1MWAB 3HC3H 1UWEL 2H6PA 4U1GB 1FNHA 2ICEA 1XIWD 5CFHA 5I1AB 1QSEE 3RWCB 3KXFB 1W8OA 3ULUD 3OKMA 5FV1L 1EGJH 2AJSL 4WRLA 3BKYH 3HB3C 4WI4A 4RGOH 3QFJE 5IVZB 4NNPL 2LU4A 2B2XH 3RJDA 1IEHA 1YNLL 1UXWB 3BZFA 4Y4FB 4S2SA 1PAMA 3QDJB 4Y4HC 3HUJA 3BE1H 3GMQB 3LN9A 4IDJH 3C5SA 5JW5A 5FKAB 3DRTB 1BD2A 5D6CA 3IDIB 4JZOB 4GKSB 2Y1VA 4Z77B 1XIWC 4K07A 4N9GB 1L6XA 1LEKB 4HCRH 4KQ4L 1RK0B 3WFHA 1KNOB 4FTVD 1E6OL 3WFBH 2X7LB 4DZ8A 1Q9KB 3EDJA 3LCYA 5DC9B 3S36X 3QZWG 1UWGL 3PL6D 1ZMYA 2NR6D 5CMAB 2VTFA 3BPOB 2BNUA 4LCCC 3QUYD 4KI5E 1WBZA 2X9YA 3GJFH 3EYOB 2DL2A 4HHAB 2P45B 4OCMC 3ZT6A 2IPTH 5JPMA 3FL7A 3MUGA 1D9KD 3T4YA 4DEPC 1N8ZB 5I18L 3X14B 1E28B 2Q86A 4WUKL 1FGNL 5I8EA 3A67H 1BIIB 3GKWH 2XNAA 1ZWIA 1S9KC 3F6LA 2EYSB 3GSNL 1QKZL 5C0DB 2Y9RT 4QLRA 4FXGB 5I73B 3B6SA 4NM8H 4PRPD 4PV8A 4RMVA 4D94A 4DGIL 3U2SB 1G9MC 1TTUA 5E7BA 4M1DL 1ZS8A 5C0GB 4RMUA 2VWEC 4I0PD 3V6BR 1KJVB 2DIJA 4XCCH 4U0QB 3WDJA 3BDXA 2EDRA 1DSFL 4C83A 4JZJC 4HWZA 5LCVL 3VA6A 5T5FL 4K94C 1NUGA 2DLIA 3KPOB 2EDTA 3EYVA 2NYYD 1V3LA 3DARA 4HXAH 4WV1C 1DEDA 1WF5A 1ZKAA 1H8SA 3KYNB 5ENWB 1ETZA 1RK1B 4OSUL 4YDVB 4K7PL 5EU5A 4XP5H 3TO4C 2EZ0D 3N0PB 4ODBD 4OZFG 2I07B 4OFYD 4YXLH 1WT5C 3WNKA 1U3HC 2D7OA 4JO4H 4YHOL 5ESVB 3KDMA 2EXWD 1MNUL 3L7FB 3CLEL 1V7NH 2CO6B 4X8JA 1XFPA 1WVZA 1GGCH 4EI5C 1LO2H 1NCBH 5L88H 4NRZB 4Y4FA 1D5BB 1A6TA 4JFZL 4JKLA 5EUKB 1ZTXH 4R4ND 3OAUH 4LLUA 4EXKA 2VL5A 3IF1A 1VADB 4TRPH 25C8H 5DEGB 2MFNA 5SV4A 3WUWA 1HSAA 4FFVC 3VG9C 2NPLX 3AS3A 3VXSA 5E5MB 2W65B 3LS5L 2B5IB 1JNHB 4I1NB 1S7WA 2J6EL 3BIKB 4ODUB 1LD9A 3WFHB 1MRFH 2A6KA 4NQEB 2HJLA 5ADPH 1Z0MA 1NCUA 3I3DA 3HC0A 1WBYA 5A2LH 5IB3A 3CZFB 2WUCH 3MRQB 3JXAA 1D6EA 3J7HA 3C8KA 4S1SH 5LKNA 5MENA 1I8IA 4CN6A 3T1FA 1KCUH 3N1QC 2F5BH 1LP9A 5DUML 4RFEB 3GJFB 3HZYA 1SVZA 4JFEA 4M6OL 3QCUH 3MCG1 1EZVY 4JFFB 2BDNL 5D5ME 3QEQB 1BQHB 1BMGA 2DQUH 1C7TA 4URTB 2CD0A 4Z9KB 4XCFL 4PRID 3RY6C 1T03H 3LQZA 4C55A 1MLCA 3QBTB 4MD4A 4LEXL 1FBIH 3O6LL 3AS0A 5IGXL 3MBXL 1A7QH 1AIFB 1A3RL 4F9PC 4XNQB 1C5DA 1F58H 3O6LH 2ZCHL 3MRKB 4ODSL 2JLLA 5DDHA 1WGOA 1YQ2A 2VITB 3AXLB 4QRRB 3IFNH 1QVOB 3O45A 5A2IH 2ICES 2LVCA 1JZ5A 4YWGL 1RZ7H 4WFFD 3OTTA 5JO5A 2CKBL 4FFZH 5ICXB 1S7SA 4ODVH 3LIZL 4XAWH 3CFDB 5CIPB 2F8VA 1FO0L 1KB5L 3SE8H 4L8CA 1MLBB 1QSFE 1FZKB 3G04A 5L7XL 2C3HA 3EOAA 3LRGA 4TSBH 1EGJA 4FN0A 2R1XA 3OR6A 3WL9B 1UGNA 4GRWH 2WM0A 4MGXA 2IH1B 4QOKA 2X4UA 4R90L 1W0WA 1BZ7A 4O2FA 3RNQA 1NBVH 4I18C 1VGKB 2CXKA 5EUKA 3O2VH 2HKFL 1NBVL 2I5YL 4MJ5A 3VXOA 4NZTL 3VFSA 3VI4E 3GI8H 3DOSA 4YLQT 4DN3H 1QBML 5HGAA 4L29B 3MYJA 3BEWA 4E42A 4JG1L 5D9SB 3MFGB 1VERA 5F1NA 1JMXA 4JFED 2FWOA 2J8UA 4BFIA 1IBGH 4K3JL 1IAKB 5L9DL 4Y1AA 5GGVY 4ZS7L 1X4YA 1D6EB 4U3HA 1B3JA 4LDEB 1BJMA 4O51A 2HP4A 3TT1H 3T1FB 4QWWC 4BK5A 5E00B 4Q9RH 3IXTA 3HZYB 4LOUD 3EFDL 5TE7H 2VLKD 1C7SA 2R8SH 4JPIB 1IAIM 5IHLB 2CDFB 3UBXI 3P11L 1ZVYA 2FYYB 1MREH 3VFRA 1Y0LB 1XGRA 4NC1C 2CRYA 4PRPB 3HCVA 4G8EB 3IDXL 4F2MB 5DMKB 3HI1A 4WU5B 3ABZA 1CDCA 1X5HA 5LG1A 1GYAA 2MCPL 4LVNB 4MMXC 1CGXA 3WIFA 4ZFGL 3WNMA 3KG5A 4XPTH 1I1YB 3LZFH 4JFXA 1YYMH 5DRWB 1TCRB 5SWSD 4F8TA 5D93C 1MJUH 4OZIB 3MRDA 4MNHA 4KVNL 3SOBH 5DQJB 4Z0BL 3OG6B 4X7TA 2VXUL 3I50H 3MOAH 4YDKH 1QEWB 5B4MD 4C57C 4X6BA 4MYWB 4ZQKB 1N3NB 3FO1A 3MCKA 1RZIB 3G6AA 3U1SL 5DHVH 2V9TA 5FUCE 3TT3H 4KTEL 1LEGB 32C2A 5FOBB 1F6LL 5TH2A 4PRIB 1TZIA 3JV5A 2FHBA 3P73A 3Q1SH 1T1ZB 4LEXH 5FV2A 3HE7D 3RL2A 4ZAKD 4DGVL 1C5CL 4OKVA 4X7FC 1AR1D 4LPCA 4DUVA 2FBJH 1OSPH 4NYLB 5FOJA 1Q1JL 3EO0B 2YA2A 3UAJD 1U3ZA 1K8DA 2CR6A 4NWUL 4CMHC 1YC8A 3QXAB 4NHCH 5I1KL 2H2SD 1P4IL 3VDAA 3QA3A 5JMRA 3TN0A 2IBBA 4XAWL 1OD7A 1FN4B 4PS4L 1H15A 3GZKA 3NZ8A 2I9TA 4UOJA 1A0QH 2XKNB 4HG4J 2XIDA 2YPKB 1JTOA 4PTTB 5GRJH 2N7AA 1G7IB 3LHPL 1BHGA 2C3VA 1IAKA 4MMZC 4I4WB 4CW1B 3CXDL 3UTQA 2OSLB 1IKNA 5DD3H 4G6ML 3IJHA 3D18B 1KCSH 3DSFH 1NGQH 2GK0B 4PJHE 4NNYB 3LV3B 3BD4A 1BM3H 2A1WH 4P2OC 1Z9MA 5CJXC 3RI5K 2MKLC 4RRPA 3QDAA 1YEJL 1CFTA 1PZ5A 1YNTA 3JTSB 4X5XB 4HIHA 3TCXA 5DA4A 4PY8I 5IB1B 5E70A 4KROD 2I25N 5HHMD 4H26A 2JB5L 1PQZA 4JANB 4OLXH 5FB8A 3O0RL 3C60A 4JZJA 2ZUSA 2YUZA 4WU5A 1O7VA 2DQGL 3S98A 2QSCL 3VRJA 4AL8H 3BVNB 2VN4A 3D69A 4JO4L 4YHOH 4PR5B 4MA1C 1WSST 3IDYC 3MV8E 5DJ8B 1U8LA 3VG0H 5HY9B 5KVEH 3OGOE 3BPCB 1CE6B 2IH3A 3MLYH 3VI3F 5FM5O 1T1WB 5FYKL 2NR6C 5ERWA 8CGTA 4IRZH 2VLKB 1IE5A 1RURH 4JLRB 4RSVA 1KEML 5FO9A 1OP9A 2KL6A 1IC5L 4GRWE 5C07D 4XCYB 1NCAL 3NCJL 4UZGA 5IEHB 3V7AG 2VSDA 5IVZA 1ZLSH 3OKDA 4V1DE 3GK8L 3KPQA 4S2SB 1I1AC 3NPSB 1OCWL 3ARZA 2UWEA 3C60C 1TETL 4OTXL 2HTKC 4JGMA 2OR9H 2KUTA 3B3IB 4ALAL 4X4ME 4I0PC 2BVPA 3L1OH 3PJSA 3GJEA 4JZOA 1GGBH 1I7TB 3IXAA 3OKYA 5KN5B 4S1SL 2AQ3A 4UT7H 2R0KH 1REIA 5B38A 4ELKA 4HMEA 4LL9A 6CGTA 1RJLB 3ULUF 1KNOA 2FL5B 1ZOXA 5ISZB 2VDNH 5HVGB 5MEQA 1M71B 2I27N 4K8RC 1CBVH 2YKLL 4G7YH 2WINB 4P46B 4QHMB 1BPVA 3D2UB 3PDOA 2NY1B 1SJEA 4W4NA 4EDWH 2AJUH 5JNYB 1MCWW 4P4KC 1IKFL 4KMQA 1R3JA 1IGML 3LRSB 4IMLA 2FGZA 4OF7A 1JPGA 4N0FA 4NNYA 4P5TC 1KOAA 1X44A 4R4NC 3PDGA 3NMEA 1OT1A 1ZANH 1LO5B 3DXAE 3B9VA 3A6BH 4HIHB 3SKOA 4GXUM 4LLWB 4M6NH 2QQLH 5JDSB 3F7YA 3FT3A 3LY6A 2AKRB 4WWKA 3NPSC 4HKZB 4N0YL 2QQLL 1KG0B 3C2AH 2Z4QA 1JPSH 3S3JA 3C60B 4WY7L 4YFLI 5J57B 3L9RB 1J10A 1Q0YH 4X6EA 2VZ3A 4YK4B 4Y4KC 3C08H 3GRWA 4FQJL 1BOGB 4TULL 5FM5M 5SWZA 5I66B 4QGYA 4LLDB 5KW9L 3CXDH 5E6ID 3ARFB 2C26A 2ZSWB 1T3FB 5GGTL 4F9LC 3ZDZE 1RQ5A 2VMFA 3K46A 4Z7OE 3WKML 1AY1L 3VXQA 4HJJH 2ITCA 1NAMH 4XVUC 2QHRH 1FE8L 1IAIL 4NO2B 3ZDYF 4R0LA 2ID5A 2X4RB 3O8XA 3GI8L 5SX5H 1MELA 4GS7B 4LGRB 4GRWF 5CUSL 5E2VH 2X4SA 1OWRM 1NUNB 4RISL 1IC7H 3RUGF 4Z7VA 5C0CB 5CSZA 3CPLB 4P23B 1U8IA 1R5WA 3TZVA 3S35H 3VRLE 1T4KB 3GKZA 5T1LD 2WWKO 4NQCB 3BUYB 3D25A 4PJXE 5DD5L 4LCUB 3K8KA 5C0NC 4K9EC 5BO1L 2AJ3B 1UKSA 1HSAB 3L5HA 4JRXA 3P0YL 1BZ9A 1FO0B 1KJVA 4O2EB 7FABH 3RVWD 1K8IB 5GZNC 5I1JL 5F7KC 3LRHA 2VRAA 5K93A 5E6IC 4JRXD 3EFDH 4ODTL 5TE7L 3DETD 4KRMB 4YQXL 4XP6L 1BFVH 3IRPX 3OB0K 1IILE 5HHXH 4PJ7F 4U33A 4D8PA 5IMMA 5ACZB 1EMTH 1K2DB 4ZO9A 3BO8B 1K5NA 2BXZA 4Z77A 2EYRB 5JLZB 4B5EA 1FDLL 5F97E 1I8KB 2GJ6B 3U6RB 3W11D 1LEKA 4J3OC 2I07A 5JXAL 4K7FA 2F53D 2UVEA 1RK0A 3RA7H 5CD3B 1CTOA 3SPVA 3F5WA 4MNGE 4F80A 1U93A 3V2AR 3PGDA 1MF2L 3IFLH 4ISVA 3GB7A 5JUEL 3EOTH 3T0DA 1OPGH 4OF8A 1Z3GH 2Y07H 4KK9D 5FECA 2YPLD 5EZIL 5DTFB 3HKFA 1A4KA 2IANB 4AM0A 1DE4A 4X98A 2Z9TA 3SJVE 3GUTA 1A6WH 4AIXA 5T1MB 3TFKD 3TBTB 3FT3B 1U8JA 2FEDD 3MUGB 5T3XL 3MRMB 3K1DA 1CZ8L 4AT6B 1KELL 4Z95H 3ARGA 4MJ6A 2F74A 1TTGA 3DUUA 4N5UA 2CMRH 3X14A 5BQ7A 3V5DA 4Y4FD 3HPLA 2DQUL 2Z35B 3V0WL 1FL6B 2XNAB 1IEBA 1HINL 1G6RL 5B8CC 2FECL 1ES0A 4WTWA 4M62L 4M7LT 3VGHA 4S1DD 2BSTB 3PP4L 4XBGB 4XNXH 5I76B 4K3GA 2EDJA 1MQKH 1WK0A 2P46B 5C07B 1IAII 1E27A 1OAKL 4QNPF 5C70A 1F58L 1JP5A 4KKLD 1HHIB 4WV1A 3O3BA 3MV01 4XHJD 1KB5H 1TJHL 1YYLL 1NJ9B 4Y2OA 1LO3H 1INQB 3U4BL 1A7OH 2L0DA 5K9KA 1UZ8A 5T1KD 1T2QH 4DGYH 4G6AC 1TFHA 2G2RA 1HCVA 1YNKH 1MFEH 1AI1L 1U8QA 4N90E 1NFDE 4IIQB 2YEZB 5I16A 1A8JH 2VXTH 4QHKJ 5CLWA 1FC2D 2D03H 3QPXH 2IAMA 1RIHL 3FQTA 5HHOB 4P2QE 1KJMA 2O5ZL 3EOYG 3TYFB 3AXLA 3G6JB 4QRRA 4R7DA 1KB9K 4ZSOA 3DURA 4E9LA 4WTXA 1TZGH 1A6UH 2J8UB 4JR9H 4UIKH 4L8SC 1AC6A 1K4DA 4G42B 3U30C 2H3NB 4RFNB 2VISA 5D8JL 4BUHA 4PJGE 2A0LD 1I1FA 1ND0A 1QFOA 2VXVH 1FZKA 1AP2B 3OAYH 4JN2B 3TVMD 2VABA 5DURB 5GGSA 1N6QL 4BSWA 4RIRA 3DV6B 3ES6A 3WL9A 2ESVD 3VXNA 3BWAA 3UO1H 1WAAE 2PO6A 5ELIA 1I8IB 5CJOL 2WLYA 5EIQA 2HN7A 1RIVH 4P3DB 3RY4A 5KZCB 2CJUL 5A40E 2IANE 3QXVA 4WI5A 1NDGA 3RWJB 5FCUL 3P4MA 2BVEA 3HI6L 1GGCL 1CE1L 2CK2A 3JWOL 2X4TA 4Q9CA 4R9HA 1KV3A 2NX5B 4XRCB 4ZXBD 4N8CH 1BFTA 1E4WH 4R7NB 5JQHC 1UACH 2EKSA 3L3KA 4JKPL 4MWFB 3GFUA 1A7PL 5TE6L 1LNUA 3QIBB 4UU9B 3OHXB 2FZ3B 3PL6B 4DVRL 2BY0A 5T5NF 2ESVE 5TE4H 5INCB 1P1ZA 1IQWH 1L0QA 3UTSB 4CNIA 4X6BB 4RMTA 3LQAC 1AKJA 1YDPB 3RVUD 1T5XA 3L6FA 4PP1C 1UJ3C 3FRPA 1CICD 4UDUB 3H9YA 1KB5B 2R0WH 1P2CB 5ABDE 2VDQH 1RZFH 2D0GA 1X5YA 4V2CB 1J0ZA 4PRDA 1INQA 3SGJC 5C0BA 3UTSD 4NYLA 3BZ4B 2FECI 2HFEA 3VRLF 3MRLB 1HQ4B 1JWUA 1P7QA 1NFDB 3L5JA 3NAAH 4PJ5A 3QXAA 4ERSL 1WFOA 5F9OL 1YEEL 1MNUH 2R4RH 3TN0B 2D0FA 5IBLD 4I18A 1M05A 5BVPL 4QF1B 3FFDA 2EE3A 5GS1A 4U1HA 1JWSA 4YFEA 4OGAC 2C3VB 4GH7B 3TJEL 2XI9A 4ZPTA 1TDQA 5DD6A 2OJEB 3IJHB 1DBAL 2APVA 2NY6D 2WP3O 3TCLA 3MUZ1 1T7YA 3QPQC 3LMJH 1FZMB 3MNZA 2A9NL 4NJAH 5IV2A 2QADB 3H7BA 5F21B 4UILH 4HIJA 1RI8A 1WFNA 4HQQL 5DMJB 2H1PH 1WTGT 4DKDC 4DOHE 3HE6A 1I3VA 4U1LB 1KCSL 3PWJA 1G7HA 1UB6A 2EO9A 4NN5C 4NKIL 4O9HH 4HUKB 5D1ZD 3M8OH 1QSEA 1NAML 1FFPB 4WI2A 1QRNB 5C2BL 2IALB 5JW4N 3RWEA 1E4XI 4RNRA 1YMMA 2NY0C 5CUSH 1RUMH 1Y6MR 5E2VL 1NBZB 2AEQL 5HYQB 1JZ3A 2VDRL 2P7TB 5HVFB 3ZKSD 2LAGB 2BMKA 4WO4C 2YD8A 3VW3H 4PJEE 1L0XA 2AEIT 3TO2B 4XVTL 3IJSA 3BRFA 3WIFB 1MSPA 3BXNA 3PIQB 4HH9B 5EFIB 4JG1H 1I1YA 2HT3D 4R96A 1BVKB 3FCTB 4KDTA 4PJDA 4ZUWB 1U2HA 4IRJC 4QRQA 5I8EB 1QPPA 4KMLB 2OTUA 3QEHB 4U3XA 4PJ5D 1DQDL 1FIGH 4QY8A 2HVJA 4JQIH 4U3CA 4JG0L 5D7LD 3QEQE 1CE1H 4LLVA 1EO8L 1YEIH 4NCDA 2E6QA 1A9BB 3C5ZD 1MFCL 1EJOL 4D9LL 4JAMA 2FL5A 3U48A 3D39B 4ZTOL 1MHCA 2ZUXA 1T83A 2PYEA 2PW1B 2DWDB 3OR7A 1SQ2N 3DI3B 3E3QE 2BVOB 3DV4A 3L5WB 4PJBF 5BRZA 4GRMB 3FB8A 4TNWK 3KYNA 5E2UH 3D2UA 4EBQH 1QUNA 4NCC1 4CJ0A 1N2RA 3DBXB 1FAIL 5A16A 1NGZA 3LRSA 4LSUH 3QG7H 1CLOL 3H8NA 2BFVL 3T2NL 4FXLA 3I02B 1R3IH 3V5HB 1UYWH 3ZDXE 4EI6B 5D7IB 5DXWA 5L0QB 2APWA 4J7RA 4TSCL 3T2PA 5J11B 2DI7A 3QUYC 1LO5A 3Q6GH 1HOCA 4C56D 4FQCH 4GBXA 3BKJL 4WWKB 5E5MA 3OKEB 5LAXB 1S9WB 3NVQA 2R1WA 1KG0A 3TT1L 5J7CC 3LH2L 5J1SC 1P6AB 4OV5A 1FLRL 1TLKA 3EFFA 5HDBF 3FB6B 2DQTL 3NFSL 5JOFB 5ISZA 5J1AA 3NOIA 3UROR 4DGVH 2EDQA 1MAJA 1DQQB 5BRZD 2AVGA 4PJBE 3RIFF 1S3KH 1XGYL 2E7CA 4LKXA 5MENB 2AJYH 3LD8C 1FFOB 1F2QA 1T3FA 1INEL 3G5XA 4P99A 3PF2A 4UBDD 3HNTH 5EORH 4LLMA 2DKSA 2BX5A 1UWEH 2LAAA 3QIBC 4KHTH 4RDQG 5IB4A 3G5YA 3VFUB 1GZPA 3PIQA 4FQJH 1S5IL 5EFIA 2W9EH 1CGSL 5DJ8A 2JE8A 3BUTA 1HKFA 3LHPH 1CE6A 4P2OA 5CJXA 4YIQB 4KTDL 4K9EH 5IP4A 1J0HA 5TF1L 3U0WL 1LK3L 3ZKNC 3ZTJG 1AGFB 2XY2A 4JO1L 1OAYH 1G6RB 2HRPL 4XC1L 4JN1L 1FORL 1RHHB 4YAQA 4DUWA 2Z31A 2O61A 4AIOA 1LK2B 5GS1C 5IW3A 3NA9H 3D0VA 2I5YH 3LEXB 5I1LA 5EO1A 3GIZL 4Z7VE 3REVB 2QHRL 2VITA 4XCFH 3MROA 3SBWC 4W68A 5KAQG 3N85L 1TITA 5CJQH 5T1LA 3D39E 2PYEB 2YMXH 4P4KB 1X5XA 2AI0H 4BUGA 3PWLA 5C9KA 1A4JB 3GO1H 4GW4A 2EE9A 4TPRL 5FGSA 4Y8AA 1IBGL 4K3JH 4Z0XA 3RWHB 3MJGX 1P4BH 5CEZH 1RZ8A 4JE4B 3AFLA 5D7KE 4MA3A 3LKPA 3QULA 5EPMA 2DQFB 3BP7B 2XPGB 1Z0NA 2AP2A 3STBA 5D7IA 1UB5A 1CDJA 4OIAA 4N1CA 1DEEB 3MACH 4ZAKB 5DD1H 1G7QB 3MRHB 2VDOL 1PKQA 4IHOB 5FM8A 5JOEA 1J9CT 3GSNH 3EUUA 1CFQB 5AZEL 2AJ3A 3TBSB 2DAVA 3P9LB 3CVIH 4UI2A 3BGAA 3FAWA 1MCWM 4G6AD 4XNUL 4JO3L 3EOBB 1OCWH 1TVHA 3CVIL 4BQ8A 3P30H 1LDPH 1FL6A 4GLRI 3AMLA 3NCYS 3KLAA 4JHWL 4NT6B 5LQBL 2NZ9C 4PREA 2GY5A 5FYJE 3KYKL 3QCTL 3EYSH 2AV1B 3ZKND 2EECA 4JDZA 1U9KA 3BGFC 2DI9A 1ZAGA 5CD3A 4KKLC 4CDHA 5T3XH 1H9VA 4L1DA 3VFTB 3DX8B 1CFBA 1KIQA 4KY1L 2PXYA 1I85C 3NZHL 4JJ5A 4Q58C 3CVHL 3M45A 4WFHE 2H26A 2JK5B 4FFVD 2Q1EA 1ZWIB 4KZEH 1V3MA 1G6RH 4F2MA 2JELH 2J4WL 1AGFA 3RPIB 4FXGA 3T3MF 3D3VE 5KANI 1IAOA 3NACH 3SQBA 3ZO0A 3LPGA 5HHMB 1BOYA 4UQ2A 5EO1B 3D3VD 5I9QB 4EIGB 3REVA 4MJID 5CSZB 1UKQA 2F8OA 1TENA 4OCYL 4TSAH 2GW5A 5DQJA 5F7EH 5SWQB 5I15L 3WHXA 1L7IL 5TQ0H 4KHTL 4W70A 3SKJH 1S8DB 1B2WH 1UKTA 3QPXL 2BXYA 1N3NA 5AZ2H 1CGYA 1VESA 2BRRH 1JZ4A 3NH7L 3OJDB 3BHBA 4NQVA 1FVCA 1MFEL 4OCRH 3K8LA 3QIUD 2JKXA 1MY5A 4FQIH 2V17H 4KPHL 3V0VA 4LP4A 1CXHA 3I6GA 1MI5B 1W72H 3MLVL 1OAQH 4KJPD 4HIIB 1L9NA 2DQHH 4MXWH 4OZHB 2X1PA 3QWQB 4CL7A 3D9AH 4OV6F 5JW4M 1X3DA 5D2LA 2ADJA 2ICEB 4JFEE 3PABB 1AQDB 1NMCB 1I1AA 5ID0A 3B2UC 1LE5B 1GCFA 4Z18A 4PB9L 4BSVA 4MAYC 3KPPA 1MCKA 3FAXA 4NM4H 1NLDH 3OX8B 5E56A 1INDH 1GGTA 1NUDA 2AV7A 4OD3H 3B9DA 1KB9J 3VE0A 1AGEA 1D5ZB 1UH2A 5INCA 4H1LB 3ZKQD 2AGJL 2VE6A 4YHKL 4DEPB 3AMKA 3SE8L 1AP2A 3OXRA 5GGSY 2W9LA 3VXNB 5C8JA 5FUZL 5SWSB 3FTGB 2E8YA 3SDDB 2BSTA 2OZ4A 1H3XA 3V6FB 1R24B 2IFFL 3IFOB 4WFFE 2F53B 1OP3K 4JZJB 4FXKA 3T2QA 1KN4L 2XN9A 2Q8AL 4JQVA 4W6WB 1MJ7L 1ZGLA 1OPGL 3PP3H 3EDDA 1OF2B 1B0GA 1X5JA 3MRKA 1AO7B 1JZ2A 1MEXL 1S7XB 2ZCKL 3MJ9A 2VNCA 4WIQA 4QHKI 1IM9B 1PYWA 1U6AH 5IUSA 1UQSA 3HE7B 1S9VB 4UNVA 2BVQA 1G1CA 3VFWA 3NGBB 3WHXB 3TESA 5D1QA 1NKRA 3ULVL 5L9DH 1IJ9A 1RVFL 3MLUH 3K7UA 4UB0L 4HUWB 5ESAB 3GIVB 4AEFA 3OJDA 5F3BB 4B7LA 1GH7A 1ZXQA 3IGAA 5FYLL 4OD2A 1CICB 5FHBH 3AU1A 2YPLA 2GY7B 1MI5A 4ZNEA 3QXUA 5DD0L 5TDOA 1AXSA 1JF1B 3B3IA 2O5XL 3FFCD 4G3YL 1BAFL 4YHPA 2RB8A 5FO7A 1J05A 4K94H 4NWUH 1YPZB 4BM7A 4KRLB 1BP3B 5EOCH 1AQDA 1I1AB 5HPMA 9CGTA 4NQCE 4QTIL 2C3WA 3EKCA 2HLAB 1XMWA 3ESVF 4PJHA 2F54A 4ZS6C 5I17B 4LFHG 3D85D 1MF2H 1L7IH 3DX6B 4GAJL 3G5VA 3LKOA 5JQ6L 3QG6A 1IGFL 1YYML 5A2FA 4GAGL 2GITB 2JF1A 1OQXA 5DRZA 4AENA 4KQ3L 4LLUB 3C87A 5F6HJ 1JRHI 1G7LA 2CQVA 4H25B 2YZ8A 3VXSB 1FGVH 1HHGB 3VG9B 4HH9A 2R2EA 1LD9B 4HJ0C 3WXWL 3GMPA 5EA0L 4QRQB 4Q9QH 2YPVH 3MJ9H 4X0KB 4Y1AD 3RQ3A 2WIIA 3CX2A 5CZVH 5IGXH 2RCSH 2VDPH 5E8NB 4KRPD 4P23D 4NRYA 2JTDA 5DJDA 4LCCA 5DMKA 4JFDB 4ZXBA 1FH5H 1IT9L 3MBXH 1RIUL 3O6FC 3MUJA 5F9JA 5CEYA 1HI6A 1DFBL 2HFGH 2GSIA 4JFYB 4LLDA 5AG8A 1N0XH 1S7XA 3BT2L 5F89B 3SQOH 4U6XB 5C0BB 4PRBA 3BT2H 2HFEB 4U1SA 5GGRA 2ZKHH 3RAJH 3MXVH 4R0LB 1HXMB 3HLAB 4IOFD 2WWKT 1U3HD 4G6MH 1B9ZA 4I18B 3NIFF 1X5FA 3VMNA 1OAUL 1W72A 3CPLA 4OD2B 3AU1B 2A0LC 1IQDA 5E8PB 3ZZ1A 2HMIC 1ONQB 3BQUD 4PRIE 1DBKH 5DC4B 1TJIH 2FX9L 1JGUH 1HH6B 3D25B 4H1LG 4Q6IB 4OFDA 5CP3A 4Z7WF 2E3VA 3I2CH 1MUJB 3S35X 2KPNA 4HS6A 2KQNA 2DI8A 2VQTA 4G43A 4LASL 4NQXB 1CLOH 1I9JH 5JOFA 5IWLA 2VDQL 1EAPB 2R2HB 3AS2A 3H7LA 4JRYB 1NMCC 1RZKH 1HYSD 4Y89A 3SE4C 2NY2C 3QDHA 3UTTA 1HHHB 3QI9C 3FQNB 4X6CA 1ADQA 3FB7B 4UIMA 3O6FB 4AENB 4GW1B 4PTUA 5JMOC 3HMXH 4BFEA 3L3HB 4PG2C 4XC3L 1KENL 1TNNA 1MFAH 3KXFA 4ODTH 3SDAB 4ZUSA 3QFJD 5ITFB 1GZPB 3HMWL 2Y23A 4NBZB 2QLVB 4OZGE 3MYJB 2Z8RA 1UXWA 3BZFB 5DZLA 4HWBL 2HG5B 3LDBB 5F1NB 1DQTA 2XQYG 4GG6F 4FQ1L 4BKLB 3RHWF 3C5SB 5I1GH 3SO3C 4F7TA 5I8CA 3LS5H 5D6CB 3SGEH 3QDMB 2NXYC 5IVNA 1BVZA 4GBXB 4TQEL 3FFCA 3VD4A 4P2QA 5I74C 3ZTNL 2IPUK 3T65B 2R1WB 1XCQA 4V1DA 1U58B 4P5KB 5IROA 1NMAH 4BH8A 3D85B 1ZHLA 3Q5YA 3TVMB 3GDBA 3MV9D 5FGBA 4PR5A 3MOAL 2NW2B 1IM9D 1CD0A 4GAFB 1IAMA 4RA3A 3ARTA 3NBNA 1Q94B 1U91A 1OAYL 4JGUA 5HHVL 2YUWA 7CGTA 5IT2H 4DZBA 5JW4Q 4PJXA 1MVUA 5C09B 1AQKH 1OAZL 1YEKL 4KJQC 4LQFL 2BVOA 3OJVC 4JY4A 3O3BB 4KQ4H 4ONOA 3PWNB 3KPQB 5JW4R 4M8QB 5E2WL 1CGWA 1Z6JT 4KROB 5F9AC 1ADQH 5F88A 1OSPL 5JZ7C 1A5FH 2KKQA 1A7NL 2ZSVA 5TPWH 1OW0A 1ZANL 4YDIH 1AD0B 4QKXB 1F6FB 3U4AA 4NQDD 4P57B 3IXAB 5IHZA 1HH9A 1KCLA 2IAMB 3DGGA 5EO9A 3SE3A 3HRZA 3MBED 1U92B 4TVPH 2NX5D 3RPKA 1PKQE 3RVVC 4M48L 3F7VA 1HOCB 5FHAH 4EOWH 5CSBA 3ARGC 4PJ8C 4DK3A 3TN0D 3OAZK 1WZKA 2FH6A 2H1PL 4OKVB 4TVPD 5MI0B 3FB7A 4UIMB 1S9WA 2J6EA 4WVRA 3JWDL 4D9LH 3RZCA 2F9BT 4APQC 5KSAA 1T0NA 4TNVF 3WLBA 4NZRL 2NYYC 1E4XH 1DQLL 5DJZB 4NKIH 3QA3B 4O9HL 3U7AA 4NQDE 4KHXL 4MNQE 2B0SL 3BW9B 3VXRA 4X9BA 1A6TB 4Z76B 2YPKA 4JHWH 3KJ6L 5I71C 4H8WL 1YEGH 4IHOA 5IIEA 1L7TL 4FG6D 4H1LH 1KELH 5EB9A 3QH3B 4IRSC 1QTYT 1L7TH 1K3ZA 2V5MA 2VDKL 2W65A 5LGKA 1H3GA 4M1GL 3LV3A 4JFQA 1G84A 3MLUL 3HS0A 2R9HC 5IVOA 2X89A 1WIUA 5HBBA 4M1GH 1A1NB 1CDUA 4NUGH 2R0LH 4FQCL 5GGVH 3GEWB 3T0WA 4XC3H 4LHUG 1P1ZB 2ZWLT 4JDZB 1S9XB 2OCFD 1X4XA 2QSTA 2KBGA 1A6VL 4AG4L 2HMID 4PJIB 1QG3A 2VLME 3VFTA 4RGNB 1FFQA 3BX7C 4ZTOH 4RGMB 3TEUA 3FB5B 1ZA6B 4M8QA 4GW4B 1BECA 2E8ZA 1I7UA 1BFSA 3BGMA 1R5WB 3REWA 3B2VH 3F62A 4BFBD 1EGJL 3S37L 1MRCH 5D7JB 1X5IA 5IF0B 4XGZB 4G6KH 1FLTX 3LKPB 5IOPB 4D0BA 1JCKA 2XPGA 1K8IA 4A2MA 3ZYZA 4G7YL 1ZT1A 2KH2B 1QOKA 4FFYL 5TDNA 4MSWA 4QF1A 4XP4H 2IGFL 3GSUA 5TGBB 3MRHA 4QRRD 5A2KH 1VFBA 3BGFB 3BQUB 3C5JA 3JVGC 4JPVL 3QJFA 3SDCB 5J3HD 4U6HA 2ZOLA 2DBJA 4HPYH 4OJFL 4C56B 1K2DA 1HEZB 5AUMA 3TBSA 4PGJA 2IFGA 4ERSH 1KLUA 5KSBA 3VWJA 4KK6C 2ADGB 4KDWA 2HKHL 2VLRD 5DS8A 2XFXA 2NY4D 1BQHG 2ZNXA 4K7FB 1UADC 4Y2DA 3PWPD 3BJLA 4HIJB 1M71A 1MH5B 4O4YL 3K4AA 3TP4A 3MR9B 2VC2H 5LXGH 4PBWD 1W0WB 4O2FB 1R24A 1SY6L 2NY1C 3PWJB 1S78C 3BMWA 3VU2A 1FIGL 1MHHB 4PBVC 3JWOH 1T7VA 5IIEB 1IL1A 4GRLA 1KEGH 3QNXB 3H9SA 4K8RL 3SEPA 5D1ZA 3BFOA 2DMBA 2C1OA 2QR0B 4TNVK 1EO8H 1JPGB 1AFVL 4LSSL 4Q2ZA 2DB8A 4BZ2H 3ECBB 1XGPB 3GHBH 4N0UE 4M93B 2EC8A 1AXIB 5DJCA 5C92A 4Z7OF 2BHUA 1NGXB 4LSRL 4I5BB 4BA8A 3VFWB 3VE0B 3Q2CA 4UINL 4X4XA 2AKRA 5EOTA 2XXMB 4HKXB 3C6LD 2VUYA 4JN1H 4OLUH 4YGAB 5T1DL 5J1TC 5LCVH 3D1MC 4WENB 5C2BH 4LKCB 2Q7YB 1AY1H 4I3GA 1FVEA 5E4EB 3FQWB 3W5NA 3U0PA 4KJWC 5IQ7H 2W60B 1BBDL 1HZHH 2YPLB 4PJ5E 4BZ1H 4Y4KB 4WGWB 3L3DA 1YEGL 4X80L 5GRVL 4LK4A 2XA8H 2CLZA 3QYCA 1O7SA 3ZE1F 1MRDL 4PRPA 3VXPA 3W0WE 2VDKH 1MLBA 4O02H 3RDTA 2F53A 4HFUH 3ARFD 3BHBB 3WXVH 4NQEE 4QTHA 3ULSB 1XAUA 5IG7B 1ZGLB 2AK4D 2H2SC 1BFOB 1OGAE 1PEZA 2DWDA 2PO6C 4G8GA 1EX0A 4HIIA 3NCMA 3O8XD 1V7NL 4JG0H 1FZOB 3G6JA 4G3YH 1E4WL 4S10A 1KJ2L 4PRHD 2AXGB 4PJAB 1JUFA 4KJQD 2NY5L 5ETUA 3C5JB 2OL3H 5L6YH 5TFSL 4P59L 1HNFA 2FJHA 5CGMA 4L3EE 3DX7B 3ALXA 4LMQI 2ED7A 1LE5A 5GS2H 3QWRA 4BSVB 1J1PL 4E0RB 1NCTA 2DQCH 4AQOA 3P3YA 4A6YB 1MIML 1ROWA 5D93B 3ELAT 5EBGA 5MI0C 4WGVB 1F02I 2PYFA 1I4FA 3B9AA 4ZFGH 5DK3A 4OB5L 5B4MC 2JJSC 1FVDB 3VRIB 1EERB 3FRUA 3G6DH 1NCWL 3LS4L 3QG7L 3U6RA 5B39A 3QI9A 1KN2H 3RBGA 1HCFX 1CLZL 2VXUH 3I50L 3V79C 2XZZA 5IW6A 5J11C 1V7ML 5EUOA <