1OAQL

Free conformation ab1 of the ige spe-7
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
110
Chain Sequence
b'QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHLVFGGGTKLTVLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAVY CHAIN
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oaqL00
3QXAB 5E70A 1CI5A 4NQDD 2VQTA 3H6JA 3CMGA 4D8PB 2NY3B 1VFMA 2BOBA 1QR1B 3WLWD 1R3IH 4HW6A 1XZ0B 1CXKA 2CDGB 4G9DB 3EJZC 1J0HA 4K7PX 1AO7E 4MNHA 2VNCA 1JUFA 1T22A 3ES6A 2E6PA 2WZPD 3GMRB 3T08A 5FXCH 1YMMB 3HE6D 5MERB 1EA9C 3AS2A 4TVSa 1EVTC 4FQXD 1JNHA 1NCBH 1FGNH 1FL6B 4I3SH 2C5DC 4HEPG 1IT9H 1TCRB 4LQFH 3E6HB 3CFEB 1L7IL 4M6AA 3KJ4B 2PXYA 4HIHB 1EK3A 5SWZE 1JHKH 3L9RB 4PRBA 4QTHA 2X4QB 5H2BA 5LCVL 4BSWB 2CD0A 2IAMA 5J9PB 2FATH 5CCKL 3EO0A 1URLA 4YBLB 3V0WL 5I1LB 4JM2A 1WZ1L 3SDDA 1WAAF 3WMSA 4TVPL 4QXGH 2YUXA 3VGDA 1IAIM 4LAQH 1RJYB 3SJVE 1XF5A 1S5IH 4Z77B 4LEOB 3FOMB 3SE8H 3PNWB 4JFED 2YD5A 4JFDD 2BVQB 2ZCHH 3RWGB 4NQDB 4YO0A 4IRSA 4WFEE 1EUTA 2D7TH 4IMLB 4I77H 4BFEA 4GRLA 4BH8A 32C2B 3ZL4L 1G7PB 3RL2A 5FCUH 1L6XA 3MRIB 4A6YB 3C8KA 3L1OH 4PJ8B 4J6RL 4LCWE 4Y19D 3PDOB 4F7MB 2EDHA 3OV6A 4AH2A 4AIZA 1KC5H 4LP4A 3B83A 2G9HA 3QJFA 2OQJB 2XICA 5FYJH 4NQVB 4PJCA 3HE6B 3JV4A 1ZHKB 1OF2A 1YY8B 2KZWA 2OXGA 5GGVL 3PP4L 4KK5C 1B3JA 4U0RB 1WUNT 1EEUA 4WU7B 5DF0A 4JPVH 4GW1A 3W82A 3LOWA 4JFPA 4ZTPH 1R3KA 3WFHA 5BS0D 1DUYA 3GJFH 1HXYB 4KK9D 1ZV5A 1QVOB 2YK1H 3G08B 4OCWL 2I9LA 2JJSA 4P2OC 1CD1B 2V7HB 2V5SA 2BNQA 1A6ZB 4KRMB 1MAJA 1B90A 1C5BL 3VI3E 3TO2A 3VI4F 3QQ4B 4JFQA 1DEEB 2XWBA 4MA1C 3K2UL 4MSWA 5EU3A 4JFEB 3EYUH 3OG4B 4JFDB 5MEQB 3DMMD 1WBYB 2OBGA 1FO0L 2MPAL 1U36A 5J3HC 3F12B 4K3JH 2YMXL 3OX8B 1A7OL 4XC1L 3RX7A 5DWUL 1EPFA 3SOBH 2A6IA 1ADQH 3HE7C 1HOCB 1I1CA 4K2UH 3C5SB 3HN3A 4Y19B 2DQCL 3K8KA 4X9FA 1JNLL 1O0VA 1NDGA 4X8XA 4H1LH 5TDOB 2O93L 1S7WB 3BWUC 2KZ1B 2DQDL 3QIUA 5FYJU 2BOCB 5T1LB 3BQUA 2W59A 3B2VL 1OW0C 2E7HA 4XVTH 3DO7A 4TOYH 3FRPA 2R1YB 4ISVA 4M1DH 3TBYA 3HC0B 1CK0H 3S5LA 1PSKH 3MJ9L 4PS4H 5LAXA 5KBNC 4QRRA 4TNVF 2WBKA 4JKKA 5BS0B 1CDHA 4G8GD 1YNKL 4JG1L 1CIUA 2R4SH 2C7UA 5TE4H 3BKYL 3VWJC 5CKAA 2ARJQ 3MNWA 5JOEA 4YHOL 1X5IA 3O11B 5D71H 3NACL 4DAGH 2R2EB 1GOFA 2H2PD 4JDZA 2IQAA 4PR5A 3VDBA 3BWAB 3VFVB 1JRHL 1H3PL 4H26A 2CIKB 4GXUN 3F7YB 2DQGL 1I8MA 4KZEL 5E2UH 3VD4A 3DMMB 5TDPA 3INUL 4BKLA 5ACMA 1LE5A 2N56A 1T5XA 3WSQL 1J0JA 4YXKL 2P5EA 3MSPA 5BO1H 5GZOC 1OD7A 4P2RB 4GAGL 1N4XH 3BJ91 1GAFH 4ODBD 4HUWA 5DMKA 4AEEA 5GGQL 5CD5C 2WWMD 1XIWC 4DCQA 3HCVB 1K9TA 2E7BA 4PRHD 4PJBB 1HHJA 1U3JA 4JFZL 2YPKB 1FJ1A 3M1BB 1VKXA 5F7LB 2VXUL 1Z5LB 4HWUA 3GZKA 4YC2B 3KHQA 2DQJH 3ZYIA 4UOJA 1U6AL 4J3SA 1RZFH 1T03H 4EEEA 5C8JA 5ICZB 5TPWH 4XZUB 4G3YH 4Z7NE 2V5RA 4G8GB 3K80A 5SWQA 1FPTH 4TVPE 5GGSY 4KAQL 1I1AA 3WNOA 4UT7H 3ZHDA 4F80A 4LEXL 4X5LA 5LGHL 2FJGB 4WEUD 5FECB 1JZ5A 3MLYL 5T1DH 2NW2A 1QA9B 3GNMH 2VDQH 4A6YL 1Q9OB 1GGYA 4RA0C 3W5NA 1MHEA 1W0WB 4JHWH 3U2SA 5HHQA 1I7UA 2IEPA 5AD0B 1I3RA 2XFXA 1XF4B 2PXYC 1L9NA 3FFCA 5ITFA 2FL5A 4DN4H 3QQ9D 1CBVL 5D5MA 4X8JA 1BJ1H 1NMBH 5GS1B 4G6MH 1QYGL 1CE6B 2XTJD 2IAMC 2PKDA 4XBPB 1NQBA 5DURD 3SO3C 1ZHBA 3RX5A 3TV3H 2B7DT 1KENL 3WS3B 3CJJA 4X4XA 3PGCB 1MUJA 3GSWA 4RFEA 2DICA 3OAYK 4HWZB 3MOBL 3SDDC 2EO9A 4BQCA 4OD1L 4FTVB 1TZIA 2UUDK 4RA3A 1H0DA 3PUCA 2FB4H 1HWHB 1EAJA 3ROLA 3WJLA 4ELMA 5JO5B 5F89A 3E6FB 3OKYA 4WVRA 4LVOC 4UT6H 2XNAA 5E9DA 2I26N 5ITBH 4ZS6C 1A6AB 1KYOK 3L7EB 4UUJB 5M7QA 4I9WD 3VA2C 3X14A 5CBEA 4I48B 3IDXH 4HCRL 4M7LL 4WO4C 1J05A 3WO4C 3ELAT 5IQ9B 5GRZA 2D2OA 4XCNB 1CF8L 3I02B 1FIGL 4B5EA 5IVXF 4Z8FL 3MYZA 3REVA 1JPFA 2CLRB 5A2IH 1YNTA 3BPLC 5D7LB 4J3OC 4M3KB 5HHNA 1JV5A 5J6GB 3V79C 4X80L 1KJMB 3IKKA 3QISA 1O7VA 1ONQB 2NLJA 1KYOJ 4O9HH 4XAWH 4DGIH 4FFZH 3SKOA 1I9JL 4I0PB 1I3VA 3OKMB 3UJIH 1H8SA 5DS8B 4U3HA 1A7RH 3TFKC 5I76B 3OAZH 3L5XL 4MQ7B 2DQHH 1G7IB 2VZTA 4YPGA 1F58H 2J12B 2XTJB 1BJMA 4LSPH 1ZANL 3HG1B 5HBBA 1MHPH 3MA7A 1HI6B 2R4RH 1FFOB 1QLRA 1C12A 3KXFA 5B38G 1IC7L 1R5WA 4L3ED 4L4VD 5CP3A 3VFPA 2NY5H 4OCLC 2NXZC 5CIPB 3W0WD 4I18C 1WBXB 1MREL 3GB7A 3HC4L 4ODXA 1U8NA 5HDQH 5HJ3A 4W4OC 1N6QH 4MA3A 4XBEH 3PQYE 5KTEH 1NEZA 4KKCD 1D5XA 1KB5B 2OS7A 5F1KC 4WNQB 3OKNB 1RZ8A 3KYKL 2HH0L 2W92A 2KPNA 4FQQB 3AM8C 2WWKT 2HRLA 4TSCL 1F6LL 2VWEE 1SEQL 1U3HC 5D2LB 4R96A 3KPSB 3MRFA 1KGCD 2AERT 5E6ID 5GRUL 4GLRI 3O9WC 3MTRA 2ATKB 3T0XA 3TBTA 3RA7L 4JY4B 4CVXA 1FFRA 2E3VA 3QIWA 1BQLH 4P46A 3FO1A 1MY5A 4JFYA 4GMTL 3QIUC 4ZFZB 5HI3D 4F33A 4EOWL 2A1WH 4NRXB 1IC1A 3VFTA 2X4PA 5KSBF 3QULB 1A02N 2RIKA 4N8PA 5CZXD 4M48L 4Z0BL 1J1PL 3QO0A 4O2FA 5CP7A 4PJEB 4NKOB 1EBPA 2CUMA 2VWEC 3ARUA 3PWVA 4YBHA 4GW5A 5DFVD 2XRAH 1C7SA 4LFHD 5EC1A 1J8HD 4PJFA 3SE3C 4ZFFA 2FBJH 1I1FB 4YFEA 4OZHB 3O2WH 3O3DB 3W5MA 4EBQH 1UJTA 3LSOB 3L3OB 3RNQA 4L3EB 1YYML 5HYJA 3QDAA 4Y89A 3IF1A 3W9DB 5E8NA 3W0WB 1Q1JH 1E6JL 1U93B 3VFMB 4N0YL 3P9MA 3OJDB 3SDYL 2A9NL 4ZQKB 1OP3K 4X0KA 3UMTA 4PJXA 3I6KB 5C0CA 4DZBB 4J2XA 3DUSA 4ONHB 2IPKB 4GSDL 1G9MH 4HC1L 5ICXA 2ESVA 3MRRA 5CZVL 4F7TA 4NDMB 5EA0H 1VFAA 4NQDE 1A7NH 4XHJC 1A14H 1WWBX 5GXBB 5C6TH 1QP1A 4P59L 5KAQF 5E6IB 5AZ2L 2X70B 3WDIA 1A1MB 5FK9B 5L88L 2CH8A 4WJ5B 3ARGB 4YBLC 1IGMH 1CLOL 3TT1H 1PKQA 4D0CA 4R7NA 1ZVYA 5K9OB 2A0LD 1P5VA 5IQ7L 2QQKH 3ULVC 2R0WH 3D85A 5DJYB 1HH6A 1CXFA 4LCYB 1QFWM 1T66C 3I3DA 3TGXA 1N7ML 2DQFA 4KWUA 4CNIB 3MNZB 3MJ7B 3D9AL 4UQ2A 5JQHC 4CKVX 4U1NA 5ISZA 2NNAA 1IGFL 2GTZB 4NQXA 2ADGA 2FH6A 2B1HH 3FMGL 3FQNB 3WLWC 1CGTA 4AM0A 4JN1L 4XVUD 5M94B 1EIBA 4YFLI 5BVJA 1WGOA 1CXEA 5B3JF 5H94A 1XCTA 3ORJA 2XV6B 3C9NB 3O6FB 4W6YB 4R0LA 5I1JL 4JE4B 4M43L 1T7ZA 4X5XA 3HE6C 1TMCB 4FQXC 4U0RC 5EBMB 4LASL 1QPPA 1A4JA 3TCLA 1LO0L 5I1HL 1JWSB 2F54D 4JFEE 4JFDE 5K93A 4MNQD 1LP9F 3LQZB 4LU5L 2X2YA 5HD8D 1JPTL 1FSKB 4GKZA 1S7UB 2BMKA 2YPLD 2G5BA 3LEYL 3GI8H 3RKPA 2WIIB 1MFNA 4Y8DC 4U0QB 2FX7H 4Y19E 4L3CA 1J7VR 1LD9B 4K07A 4IOIA 4UILH 4P3CL 1YYLL 1JZ7A 1UXWA 4PG9B 2GUOB 4MS8D 3KNBB 5C2BH 1JGEA 2DAVA 1XMWA 5DEZA 4OZ4A 1X5HA 5T33L 1V7MH 3BOVA 3MBEC 4NN7C 2AK4D 1NBVH 3SCMA 4JDVB 4KMTL 2BRRH 4X4MA 4GAJL 5INCB 3GSNH 3PABA 3CLFL 1F97A 1RIHH 3P4MB 5BS0E 5T1KD 2OTWA 1KB5L 4HWBA 2Z4QA 1UM5H 4EXPX 1QBBA 1VGKB 3GMQA 4HKZB 3DIFA 3B5HA 1IE5A 1SJXA 1I4FA 3V5HB 2X89D 4G9FA 1K8DA 2OTUA 5IKCB 2ATPA 2A6JB 3O4OC 2MCPH 3EYSL 1NGZA 1V5JA 3HB3D 3IFOB 1U3YA 5I9QB 1HSBA 4PGEB 3D3VA 5D7KE 2NR6D 4IHOB 1L4IA 2F54B 4NRYB 3EGSA 2A74B 5IT2L 4MNQB 5CUSH 4Q9RH 1DBBH 4X99A 2IALB 4OFDA 4KJYA 4I4WA 3C5ZA 4KHXL 4KK9C 2Y25A 4P2RE 5E00A 3MLUH 3CX2A 2R0KL 1BZ7B 1MY7A 2HRPL 1ZA3B 2GHWB 2HTKD 2HLAB 3FO2A 4HH9B 1KJ2L 2OX5A 4RZCB 1SVCP 1HHIB 4L8SA 1FE8L 4HIEA 4M1GL 1LGVA 1WFUA 3C87A 4PJBE 3JWOH 5C3LD 2XACC 1U8OA 4YE4H 2ERJB 3GSUB 2RQ8A 3RX8A 4AYFA 5DQJA 2JCCB 3DMMC 1QNZL 3P9LA 2EDNA 1MFCH 2D7NA 3V6BR 4AK1A 5GZNC 2PW2A 5T1KB 1JMXA 1GOHA 1MCWM 5DJAA 2KH2B 4G8GE 4NKDA 5ABDE 3AGVA 2R29H 1CGUA 3T2OA 4KRPD 3IFNL 2Y23A 5BOZG 3QH3B 4YAQB 3P4NA 3RIFF 4HGWB 1BIIA 1BD2A 1FVCA 2VR5A 4XC3H 1FC1A 3O8XA 4RQQB 4KDWA 4S11A 4N5ED 4YIQB 4MVBD 1X5LA 3N9GH 2IANB 2VN4A 4S1SL 3HNTL 5TQ0L 5SV3A 2ITCA 4KQ4H 4R6UA 1JIBA 4PIRF 1ZLUH 4Z7NF 4MLSA 5EOQH 1IM9A 3MV9A 3PL6A 2AJXH 3OKOA 3NTCH 5AAWA 4NP4H 2OJZH 4EI6B 5D2NA 4NKMB 1NGWB 2HA1A 2R2BB 3W2DH 3MXWH 5KSAA 4HWNA 4Z78A 4M6MH 4B50A 5JPMB 4YHIA 5F9JA 4JFFA 4EDXB 5C0IA 3O2VL 3L3IA 5BW7C 3U6RA 1KIRA 4PRHE 4ZFGH 2H2PC 3ZKQD 1A6WL 3U4BL 3D18A 1CTNA 4JZOB 1FNLA 1AGCB 1PAMA 1JFQH 2AKRA 4X98A 1ZLSL 2OI9B 4HAGA 3VFSA 3MLZH 3QCUH 4POZC 3JUYA 3F6IA 3U79A 3DSFL 4B7LA 1AC0A 4YDVA 4ZPVB 3P3YA 3N06B 2GFBB 1T83A 4F9PC 3O4LA 2I5YH 2WWMC 4U1IA 4M7JL 2EDWA 3R1GL 3RNKB 5F1NB 4QWWD 4RNRB 5D7LE 2YPVL 2LVCA 5EU5A 3GIZH 4ZSOA 3KR3H 5F9OL 4DFIA 2X7LA 1RIVH 5DDHA 5GGUA 5GS2D 2ZSVB 3FB6B 1BF8A 5IBTL 3CMOL 1IVLA 4PBXA 2CGRH 4UIMB 5I73B 1LK2B 1NFIA 4OFKA 1N64L 4DQOH 4OLUH 4WCYL 5IV2A 4K3EL 4CN1A 4L29A 5DD6B 1G9NH 1DUZB 2IMMA 3RGVD 2XTJE 2MHAB 5HPMA 1MCOL 4R0LC 3CDGA 1NC2D 4OM0H 2J5LC 3S4SG 4PJHA 1HCVA 3ALXA 4RMRA 3FB7A 5EO0B 2HFTA 5E1AA 1P69B 1Z2KA 1U8IB 4GQPH 5HTSA 2C4XA 5BXFB 4NUGH 5I1IL 3D2UA 3SN6N 1YN7A 2AS5M 4KK6D 1CR9H 1RJZB 1J86A 4O02H 4GS7B 4GRMB 4Q9CA 1HE7A 1I75A 1XCQB 1DL7H 3QQ9C 3LKQB 3M17B 4M7ZC 1JGDA 2YKLH 1IAOA 2YD7A 4X4YA 4I9WE 3P40A 1CDCA 1BVKB 5D2LE 3V2AR 4HPYL 1NMAH 3QQ3A 5HYQA 5GS3A 1AQDA 2DBLL 4JREB 3BKCH 4NGHL 3UYRL 2EH8H 1R3JA 1I9IH 1ZT1B 4JO2L 5I71B 2DJSA 5CJQH 3VMNA 1VA9A 4ONFH 1QKZL 1AO7A 5IESH 4PG2A 1LO2L 3CVHH 1FH5L 3BEVA 3P0YL 4QRQB 4WTXA 4PJEE 4LSRH 3ZDYE 4OKVA 5B8CB 5LVEA 4XCCL 3C60B 5LXGL 5IW6A 4HFWA 1JE6A 2XYCA 3K7UA 4MDJA 1CDYA 3RGVB 1WIPA 4OZHE 5BVPH 3TVMC 1RQ5A 5F7YC 4XPAH 3CPLA 2XY2A 5I2IB 1G7HB 3LS4L 2J88H 4L3EE 4L4VE 3ULUH 2C3GA 3W0WE 4URTB 1BZ9A 2D0HA 1CLYL 1S9WB 3CAFA 4HH8A 5F7KC 3RIAF 1KN4H 3V4UL 3O2DA 5JQ6H 1V3KA 1K3ZA 1PG7W 1ZEAL 2Q3ZA 2EYTA 4Y5VA 3DV4A 5D96C 3ULSA 1V8HA 1IILE 4P4KC 3TZVD 1FVEB 1OGAB 3Q3GB 5DZNA 2GSGB 1NJ9A 3C5ZC 2B5IB 4O5LH 4WUUD 4ZUUB 4DUWA 3PV6B 3BW9B 1KXVC 2KQMA 4XPFH 3TYGH 2QEJA 3GJFK 3RZWA 4QTIH 2A77H 5DRXA 1KGCE 4AMKH 1GXEA 4L8SC 5HY9B 3TPUB 5C0GA 1I7ZB 1U8PB 2BSTB 3AVEA 4YR6A 1FCGA 3V5DA 3V8OA 1UH3A 5F3BA 1LEIB 4IOSD 3IFLH 2HVKB 3H0TB 5BJTA 5DK0B 4K94L 1XF2A 1JCKA 5DVKA 2N1KA 5L7XL 4Y4HA 3GSXA 5JHDA 1EZVY 5DEFB 1RK1B 4LCWA 2DQIH 5ILTL 5CKGA 1S78D 4OLVL 5FM5O 1EEYA 3UJJL 3SKNA 4KV5E 3I9GH 5L2KA 3QDMD 4D9QD 4N9GB 5DYOA 3DRTA 5GRVK 4U4BA 4NPYB 1CFQB 1NCUA 2ZG1A 4C56B 1M71A 1RZIA 5E6IC 3PXJA 3LN5B 5I1GL 1S7SA 4UOW1 2G2RB 5GS0D 4XB8A 2AV1A 1S9YA 3QUYD 3WFCH 5D7JD 4CU6A 3BUYA 3ZKXB 5HI3C 4NSKA 5DHVH 4Z5RB 3I6GA 5C0AB 4DUVA 4GKSA 3CUPB 4CW1B 3SDXB 5H37H 1Z3GL 3OR6B 3PL6C 1EHLH 4XXCC 3VXUD 2UYLA 2A6KB 4XNZB 3FHAA 3MGOB 4LCCA 4WW1B 5DFVC 3QRGH 3TZVB 1NCNA 1NAML 5IMMA 2ZUYA 4F15C 4WUUB 4RISL 3BDYH 3IDJA 4M93C 2I25N 2ARJB 3IS1X 1FNEB 3FTGA 3LH2H 1GSMA 3IFPA 1GC1L 4P5KB 1LNUA 1OGTA 5T5FH 2DIAA 4AZ8A 4PLKD 3U30B 1GGIL 3DX6A 1MIML 3ZKMD 3WEXB 1QEWB 3C6SB 5D1ZB 3WKNA 3UBXI 3K46A 5CSGA 1ES0A 2VABA 2FO4A 5C0FB 5F88B 1QHOA 3UYPA 3FQTB 2D31B 5H35A 5CINH 3QDMB 2ICWJ 1KBGL 2J1KA 4NYLA 5IF0A 1KIUA 2GIYA 3QUZB 3H7LA 2RJMA 5I6XB 1MLBB 2VLLB 3FN9A 4JANA 4OGZA 3VGBA 1G6RB 1WVZA 1CDBA 1T83C 2DLFL 2XA8L 3T8XB 1YPZB 1FSKC 1UB5A 2GSIB 4G8FA 4NZUL 4BZ1H 5EU7E 2J8UB 3LQMA 1QTYT 1KACB 5BOPA 4CN6A 4Q74A 4F7PB 3QUYB 4GXVH 3D0VB 1U95B 4QHMA 3CVIL 1PGRB 1Q94B 1ZWIB 4FQ2L 1IFHL 3L3KB 5IFHH 2H26A 4L8BA 4QXUH 3H9HA 2YR3A 1T04B 5EB9A 3LRSB 2E9JA 1BAFL 4GFTB 1INDH 3MRBB 2FBOJ 3QXUA 4ZUWA 4WTZA 2BNRA 3ZL4H 2F54E 1YECL 2R69H 4JKWA 5JOPD 4MNQE 2Q8BL 4WW2A 1KNOA 3T1WA 4WEBL 3RWEA 3CFDA 5DJCA 1V3LA 3FFDA 3ILPB 3MZGB 4QHKJ 1H5BA 2YPLE 1ZT7B 2VTFA 1UCBL 1DFBH 2WLYA 2ZCKH 2Z91B 4QHLA 4HQQL 4KROD 3LKSA 4NO3B 1LEKA 5IB5A 2IWGA 5DRWA 1I7TB 3BGMA 3NIDF 2JCCE 1X4XA 3MRGB 3TA3B 3MREB 2AK4E 2P47B 1PLGL 5HD8C 3CC5A 3T1FA 1P4BH 3QNXB 5IHZB 2AV7B 5HGHA 4OB5H 2NW3A 2ENYA 2F53D 1HNFA 3RVVC 4V1DD 3WUWA 1DQJA 1WWCA 3MYJA 2ZUQC 1CT8A 2LQRA 4MS8C 1ZAGA 1BJ1J 1S9VA 4Z7UA 1QD0A 3OZ9H 2MPAH 1DBJL 1FGVL 5D7IF 1QUNA 2H32B 1MELA 1G1YA 2XKSA 5EIIA 1U41A 2ADFH 3TBVB 5GPRA 3T77B 2DQCH 1KG0B 4R8WL 1IGJB 1S9XA 1MCRA 4XBGB 3MFGB 4Y4KC 2BHZA 3MLRH 4PJXF 2DLTA 1ZHNB 3KYNA 4KTDH 2RHEA 2AEWA 2GQHA 2DQDH 3GBML 1KFAH 2CQVA 4IOFD 5TGBA 1GGTA 4Y5VC 5FDWB 2N7BA 1JF6A 1PQZA 3MRQB 2P44B 3QUMB 4Q6IB 1NGPH 2NTSP 3MA9H 1YNKH 7FABL 4J3WA 5F7EH 1EH9A 3DSNA 4RAHA 35C8H 1A3RL 4KVNH 4K94C 4OI7A 2Y72A 1CFVL 3TWCL 2FJFB 1A1OA 4X7FC 3MRMA 3VE0A 2X1PA 5CBAA 4PY7A 2F53B 5C1MB 2CLVB 1KCLA 5J1AA 1JPST 1F4YL 2HTKC 3OJMB 4APQD 4Y1AD 1YNLL 3QCTL 4JZJB 4PGBA 4N0UB 5FB8B 3BZFB 1DBAL 3OKDB 2APWA 2DQGH 3NCCB 1RI8A 3H8NA 3OSKA 4XHQA 4KZEH 3L5WB 4LPUA 5EOTB 3QUKA 4ZOAA 4YDJB 4ZTOH 4BA8A 1RK0A 4LIQE 1I1YA 1PVHA 2D0GA 3IGAA 1QFOA 4ZOBA 3SDAD 3ZE1E 1D5ZB 4GAGH 3THMH 1S7QA 3HRPA 5HYSG 1QOKA 5DO2C 4J12A 4PV8A 2B4CL 5EWIH 4D0DA 2Z31A 4JJ5A 4ZUTB 4HDIB 4FQCH 5ESVB 2D3VA 2PW1B 2VH5L 5JW4N 2AABL 2DMCA 4G7YL 5I1CH 3CZJA 4KRPC 1S7VA 1G6RL 2FJHA 2X4OB 4JHBA 1YC7A 3X13A 1VSCA 3QP3A 2VXUH 5KVMC 3NAAL 2BSSA 3GIVA 3G5ZB 1Y6KR 1UWXH 4LHUB 5F3HB 5GS0L 5E2JA 1P7HL 1E27B 1KIQA 1VEPA 4MQTB 3VCLB 4LNVA 3ULVH 3IETA 5CEZH 3MROB 3I75B 1OTUD 2F5AL 2HG5B 3ZSTA 4BQBA 4IDJH 4JFOB 3F58L 4XWOD 3ARDA 2QQNH 4OFYA 2H2SD 3QXAA 3NA4A 4APQB 4NQSA 1CE1L 4OZIB 1SVZA 4D8PA 5DQ9B 1QSFD 5JMOC 1V3JA 4B0MM 1NSNL 4OAWB 5BV7L 2IG2H 3IJHB 1XZ0A 1VENA 1SYVA 4CJ1A 3BD4A 4XI5C 3G6AA 4YHPB 5JHLH 1QYGH 1NGQL 4OZFB 3X3GL 5TF1L 2NMSA 3GMRA 2DRUA 3FQRB 1YMMA 5DUBB 4KTYA 2LU3A 2YD3A 1NBYB 3IJSB 4X9IA 4JREC 1TCRA 4NCC1 3E6HA 3CFEA 4ODSL 3STBA 4PREB 4QWWC 5I71C 1WSST 4JGUA 3B6SB 2E9IA 3L9RA 4PJEF 4XCFL 5AG9A 1JI1A 1PY4A 3BAEH 3H7BB 1RVFH 4NZTL 1QBLH 4BSWA 5DSCB 2IF7A 1MCDA 5F7DB 2EEBA 4OZHF 5I1LA 4WW2C 2MWCA 1WC7B 2WUCH 1ZS8B 1AQKH 5CAYB 1OGAE 1CF8H 4RSVA 3VGFA 1RJYA 5DVNA 2NX5D 4Z8FH 3FOMA 1H5BC 4HJJH 5DD1H 1T1YA 4F58L 1T21B 3MXVL 3VG0L 1MOEA 1WT5A 5DZLA 2BVQA 1VB9A 1R24B 3TJEL 1QSFB 2AJSH 3H9SB 4NO0D 5ESQB 1JHLL 5T3XD 4YPJA 5FO7B 5DQDL 3RTQD 3BP7A 4ORGA 1T20B 1QFPA 1ZXQA 3MRIA 5I1AB 2XWTB 4KK6C 2EDTA 4PJ8A 3N1MC 1B0WA 2ZG2A 4F7MA 1D5MB 3Q0HA 2VN7A 2FX8L 3D5OF 3TN0D 3MRJB 4ZO7A 4LOUD 2OQJA 4EUPA 2PNDA 2CDFB 2C3HA 4PD4K 3PE9A 4UNTA 2B5IC 4NQVA 1MEXL 1YEEL 4HLZH 1T1XA 4R97C 1YY8A 1TPXB 3HNVH 2HKFL 1IC7H 1A6VL 3QUML 4WU7A 5KVGH 2HFGL 3T4AB 3QWRD 4NFBA 4S1DC 1FZOA 1ZLWH 5IR1B 4XX1E 1MRFL 1MRCH 2W9DH 2RCSL 2DB8A 1ZA6A 4YDIL 5CP3H 2RGSA 1EO5A 3UTZA 1R6VA 4LARL 1CLZL 3ZE0F 2Q20A 4LGSB 3FB8B 1HXYA 4FXLA 3DUUA 4P4RB 3G08A 3KYKH 3GSRA 2R9HD 2FWOB 2C26A 4HUVB 4QRTA 1CD1A 1NAKL 3WXWH 2ZUXA 2V7HA 2DM4A 4OD3H 3KJ6H 3U9PH 2WM0A 3NFNB 4GG6F 1EO8L 5GRUH 1SBBA 1JHTA 4LLUA 4RFOL 3O3UN 3RA7H 4WUUE 2IGFL 1MQ8A 2NX5B 1PYWB 4JZNB 3LZFL 2EDFA 4JRYD 2OM5A 1C16B 4JFDA 5IB1B 2VO5A 5FCSH 5MEQA 3ZE2E 4L9LB 4BZ2L 3F12A 4NO0B 4N1HB 3ZKXC 3OX8A 5AWNL 4Z0BH 2FEEL 1J1PH 2XZCL 3MV8D 3RTQB 5C6WH 2Z8VC 2EEAA 1HOCA 2V5MA 3C5SA 1FV1A 4Y19A 4FS0A 1G7QB 4BFIB 5CWSB 3TN0B 3LHPL 1FRGH 1VACA 4IEFB 3DX9B 3QDME 5TDOA 1KCRL 4D9QE 1A8JH 5ALBL 1VADA 1Q0YH 2DD8L 1YJDC 3S36X 3KPTA 5E08L 3PDDA 3WCYA 2B1AH 3K74B 5T1LA 4NNYB 1AE6L 1G0DA 3NZ8B 4JDTH 4KDTA 1JPGB 2DQTL 5D1QD 1YPZE 5EU6D 4NC2B 3VXMB 4N0YH 3HC0A 4BK5A 2BY3A 3WBDA 3K4AA 2EDKA 3QG6A 2RFXB 4JO4H 1R5VB 5L6YL 3MO1B 1NCWH 4U6XA 2B4CC 2DIBA 4U1JB 4J4PA 3HZYB 1S78C 1WEJL 4XTRD 3SDCD 5IEHA 1X5JA 4P59H 5I6XC 1GGBL 3HZKB 4JRXA 2ILLA 2R1XA 2R2EA 4JEGB 2D03L 3QPXL 3G5XB 4GG8B 3BWAA 2GJ6D 3SGKC 4ODVL 5TJWK 2CIKA 4JRYB 2QSQA 5DVMA 1RZ7L 3CSPA 2VJXA 2LABA 4Z6AT 2BVUA 2E7CA 5D7JC 4XAKD 2IPUK 3SE4C 1L0XA 5F9WC 3D9AH 4P2RA 4X6CE 4BUGA 5C0JA 5FO9B 2BY2A 3WN5C 1HXMB 1BBDL 3KLSA 3T65B 4QRUB 1ZLUK 4XPGH 1HDMA 3HCVA 4FZEL 1RFDL 3WLBA 4U1GB 4PJBA 2VKXA 3A67H 5ANMB 5T5NG 5BV7C 5IVNA 4AQOA 4QT5B 2YPKA 3M1BA 1AR1D 4HKJB 4HT1H 1Z5LA 2VZSA 1UVQB 2Y36H 4PLKC 5EU6B 1IEBB 2HLFD 4LRNH 1SJEA 4XVJL 3ZKMC 4WI3A 3ZTNL 4JO3H 4BFGA 2R39A 2D0FA 3QEQD 4JQIL 3HMWL 4BZYA 1LO0H 5I1HH 4BQ9A 2IFFL 4G8GA 3RI5K 1B2WL 1ZGLA 3K8MA 3V4VL 1YEJH 5IHBA 3KHOA 4WI4A 1S5HB 1XR8B 2CMRL 2F5BL 4U1SB 5ICYB 1JPTH 5C08B 3I3EA 3RVTD 2FJGA 3QHFH 1A6UL 1BQHG 4NKQB 1QA9A 2ZP0T 2ITDA 2GJ6B 4RMTA 5A2JH 1RUQL 1CU4H 5AD0A 1YYLH 4Y16A 1T7YA 1OLZA 3ARBB 5GIRA 2VAAB 1DCLA 5TE6L 3RUGA 1EX0A 1CE6A 4XBPA 1AHWB 3WS3A 2Y9RT 2OJEB 2EDXA 3BMWA 4XH2B 4R26L 3MV7D 2COQA 4HFUL 4HWZA 4GAJH 1YEDB 3KDMB 5JXED 4GMSL 1VFOA 3RVXD 2F58L 3HUJE 3I84A 1VEMA 4ZFOA 5C70A 4FTVA 2W9EH 4HK3J 4KKNA 4MX7B 4RFNC 1J0IA 2J4WL 5JO5A 4Z7WF 2YS4A 5IVZB 1PZ5B 4HWBH 4OTXL 2NQCA 3EHBC 1M7IA 1UH4A 3QAZB 5J11C 2H3NB 2F53E 1ACYH 4NQEB 3X3FL 1A6AA 4H88L 4KRNA 3QEQB 3L7EA 3MLSH 4X6BA 2I60H 4I48A 4KROC 2EIDA 1JMZA 1IRAY 4JG0H 2OTPA 3QFJD 5IQ9A 1KPVB 1ITCA 4XCNA 2Y7QA 2EIZB 2EH7L 5I8CB 3C5JA 4EN3D 5JDJA 5D1XD 4MA8H 5D7LA 5BZDB 5DMYA 3S35H 5T3XL 4FZ8H 3SQOH 5J6GA 2F74A 1BLNB 3WFBH 1YDPA 1ONQA 2R0KH 2AJYL 1NFDB 4OIIH 2V5TA 5IWLC 3RWIB 4I0PA 1UZ8B 1KJ2H 2BJML 4HBQA 1JF1B 2GJZB 1K2DB 3VXPB 2X4SB 5MP6L 5DS8A 4LPYA 4M1GH 4LNRA 4G5ZL 1PW3A 3OKKB 3NGBC 5I1KL 2A83B 4D94A 2P24A 1NC4D 5E2TL 4EIGB 3HG1A 1A22B 5LBSL 2ID5A 3ZE1F 1EFXD 3FB5B 1DANT 3SGJA 2YC1A 1IAIH 2F9BT 2W0LA 3MV7B 3VFWB 1HI6A 5BRZB 1FFOA 1EEQA 1ZOXA 2P4AB 3GO1L 3GJFB 4QYOB 5CIPA 4LP5A 1TVBB 1WBXA 2YRLA 4C4KO 2XWJB 3K4DA 3R0NA 1II4E 3IFNH 1FFPB 2AEQL 1CICD 3D69B 2VDKL 2FD6H 3SGEI 2GTWB 2PO6D 4DZ8B 4WNQA 2JB5H 5INDB 4FQQA 5CJ8A 4Y1AE 5M95B 5KVDH 5D2LA 4IOFC 4F2MB 3KPSA 2JF1A 3MBXH 3VJ6B 2VC2L 3QFJB 4WHCA 1NH6A 1HINL 3PIQA 4IRJD 4JY4A 4YBQD 1MIEH 1DDHA 5HDLA 1TETH 5EORL 5D1XB 4Y8AA 1IC5L 3STZB 1VPOH 1MQKL 1RURH 4YWGL 5KS9B 4HKXB 4BFBD 4NRXA 1K6QL 1F5WA 1R3LA 4CRPA 1MCKA 4NNPL 1JN6B 4H1LB 3QIBD 2BNUB 2X4RB 4LSQL 2EDJA 2K9UA 1UA6L 2RBLA 3U4BH 4NQCA 4MXWL 3QEGH 1EFXB 3O3DA 5CJOH 1RUPH 4N0CD 4WW2F 1EXUB 2ZG3A 1GZQA 3BZ4B 5E8PA 4L3EA 3RZCA 5ADPH 1NCAH 5C0DA 3SDAC 3W9DA 1FC2D 1YEGH 4XVSH 3KPOB 4PJGF 5H37G 2AJ3B 2EIEA 1KTKE 2VAJA 1GRWA 4XP9L 3G6JE 4GKNA 4ZQKA 5E95B 4M7JH 3PWNA 4ONGH 1F90H 5DJ6B 5KVFH 1I85C 4X83A 4ONHA 2IPKA 5CEYA 1KTLA 2GCYB 3O6KL 1ZKAA 3EOAB 1NGXB 4NDMA 2Q86B 3DLQR 2APBA 1I8IA 4M6NH 1QSFE 3SQBA 2NTFA 4M9PA 1RSFA 1S7RA 1T89C 2X70A 5HI4D 1N64H 5DR5L 4WCYH 5JPNB 1A1MA 1D6EA 5FK9A 4IRJB 2VL5B 3ARGA 3L5IA 5SWSD 1QSED 3RPKA 4HIJA 1HHKA 3S4SA 1MCOH 5K9OA 1OTUC 1P6AB 2GAZB 1IT9L 4MD5A 4LQFL 5CLWA 3BP5A 5CJBA 5DJYA 4G80B 1GJIA 2AAVA 2H2SC 1KLUB 3QIBB 2CK0H 2QL1A 3MNZA 4CNIA 3MJ7A 4ZNCD 2NY2D 3UYOD 2FYYB 1HHGB 2GY5A 2GTZA 1WFNA 2FATL 1YEHH 3FQNA 1CN4A 1FNHA 3TO4D 4KKLD 1T3FA 4Q2ZA 5IB2A 2CKBB 4QXGL 1NANH 1CVRA 4LAQL 1S5IL 3O6FA 5MEOB 4WU5B 4XPHL 1OL0A 2L7UA 2VOTA 4HPYH 4R2GB 5EBLB 3DTXA 2W65A 4UQ3A 3UYRH 5EBMA 2GITB 2X4TB 2D7TL 2NX5E 3NFPB 5FGCB 4I77L 1SEBB 3LD8C 1JWSA 2JELH 5FCUL 3B9AA 3L1OL 2VDRH 4E42A 1MCQA 2F19H 3T3ME 2I07B 2X9YA 1LO2H 1KC5L 3B8YA 4WV1B 3P0YH 5T3XE 1N5YL 4Q9BA 1GVIA 1S7UA 2DTMH 4P2YA 5MEPB 2WIIA 2NY4D 2V7NB 4NN5B 5DTFB 1T7XA 2EC9U 1WWAX 5E4EB 2W9LA 3ARQA 4JPVL 3MRCA 4KQ3H 2GUOA 2XN9B 2D7QA 3KNBA 5I30H 2ED8A 2Q76B 5I75B 4ZTPL 5C0ND 3ZZ1A 3UDWC 4CBPA 5AAMA 2YK1L 2Y6SD 4Y2DA 1CLYH 4MXVF 4POYA 2UY7A 5INCA 3M8OL 3MRLA 1G7MB 1ZEAH 1HNGA 3VXOA 3VD7A 2HJLB 4HUNB 3TO4B 3UZVB 4YGAB 5JR1L 4K9EC 3O2DH 1VGKA 4QHUA 1K4CB 2HN7A 4JB9L 4LOUC 4TSBH 4Y5YA 1IAKA 4E41D 5IVOA 3V5HA 1DVFA 3EYUL 5GRVL 3KPLB 1ETZA 4K3JL 1SYSB 3EIFA 4K94H 4JRYE 2JJTA 2F54A 5L7XH 4JKPH 4NRYA 4AEIL 2A74A 4K2UL 4MNQA 4ETYA 2WBWB 4UNVA 3CDFA 3DOSA 2IALA 2P5WD 4XP1H 4FQ1L 3DVNB 3U0PA 1BZ7A 2AW2A 1DJSA 2NY4B 1ZA3A 2HLAA 4GOSA 1CD9B 2ICEA 1HHIA 4XVTL 5JIPA 3ARED 5I1GH 1MNUH 2V9QA 3HPJB 2XZZA 2H8PB 3KWWB 4PS4L 3GSOB 5ANME 4JFHE 4TNWK 3VH8B 4CVZB 3GSUA 1W0VA 2JCCA 4X6CF 3UC0L 3C09B 5EU6E 1M6OA 4GQ9H 4HJGB 3P73B 3EJYD 2R4SL 5JIKA 5TE4L 3ZT6A 1NANI 5T1KA 2NY6B 3IAPA 3O3EB 4E9LA 1FYTD 1NAMH 5D71L 4DAGL 2FSEB 4MXQD 3K1DA 4YAQA 4HGWA 3OXSB 4E41B 5C08E 1IZJA 5E2UL 1CGYA 4RQQA 5E5RB 1GGIH 4YIQA 1MIMH 1CXHA 2IANA 1QFHA 3CX5K 1XGTB 1NBQA 3P4OA 5D1QC 2GJ6E 5BO1L 1QR4A 3B43A 4LLDB 3TIDB 1JI2A 4Q0XL 1N4XL 1GAFL 1CFSB 4ZXBD 4U6VL 4HUXB 4JCMA 1FNSH 3T0AA 4EI6A 1U8JB 4NKMA 3VFUB 3D39B 5GSRB 3RZCC 5JORB 4DN3L 5E2WH 3SDCC 3DX7B 3OR7B 2ZOKB 2ARWA 3PWPA 3FQWB 3AREB 2XA8H 3U4EA 1J9CT 4U2YA 5IIEB 2DQJL 4NJ9H 4LDEB 4KPHH 4UNUA 4MMZC 1RZFL 3BXNB 1T03L 1Z9SA 4XRCA 4JZOA 4G3YL 2AJZB 3CVIH 1ND0B 4ZAKD 1FPTL 2QV2A 5ESAB 4NQEE 4OF5A 1FZKA 1MFDH 4OUUB 4UT7L 3QEQE 3HUJF 1UWXK 3T0EB 4WENB 1FYTB 5T1DL 4HIIB 1YECH 4YNYB 1UKQA 1M4KA 2VDQL 2J6EA 5MENA 2ORBL 2YOCA 4L8DB 3RNKA 1Q9KA 5F1NA 4BSVA 4JHWL 2BVEA 4WEBH 2VMFA 1BBJA 1IGYA 3UP1A 1BFOA 3S3JA 1DLFL 4PJIF 1AR1C 1NMBL 4NNXA 1NFDE 2ZSVA 3FB6A 2QADC 4UIMA 1P84K 4X6DA 3TV3L 5FYJE 4PBWD 3KS0J 3FAXA 2BFVL 2ICES 3SPVA 2OXHA 3HS0B 4X6FA 1DUZA 4PRPB 3PWUB 2MHAA 2CRIA 5JTWA 3FJTA 3PHQB 2CSPA 2FB4L 1MCNA 3VXRA 3MV7E 5EO0A 3RWCB 1PLGH 7CGTA 1P84J 3R8QA 5T1MB 1U0QA 3BISA 1A2YA 5HVHB 4UT6L 5JW3L 5B39B 2VZVA 3VRIB 5BXFA 1QFUH 1C08B 1U8HA 1G6VK 5ITBL 2RR3A 4I8DA 2FECL 5DJ2B 4KHTH 3IDXL 1RJZA 4Z9KB 2I9TA 3RY5A 4R9HA 5I1EH 3H3PL 5ETUB 1EMTH 3DETD 3D0LB 4ZAKB 4CADB 4KY1H 4OGAD 3VXNB 4PTTB 4CL7A 1DBJH 2O5XH 4W68A 4P2QD 3DXAD 4I13B 1A6PA 2X9XA 5GHWH 3BESR 4O9HL 3QFJE 4XAWL 2AEPL 4DGIL 2XG4A 1QFWH 4FFZL 1FNGA 3OGCB 2X44D 4RGOL 4KFZC 4YHYB 2NY1D 3UTOA 4QHNB 5IFJA 5KS9E 2Q8AH 4OF3A 2DQHL 2V6HA 4OD2B 1MCSA 1UG9A 3SBWA 1I8LA 1QZ1A 1F58L 4PRIA 4HLZG 4LSPL 5IGXH 4J23A 2GK2A 2OSLB 4QRQA 4U6HB 4OIBA 1UYWH 5DGRA 5B8CA 2GK0A 2R4RL 4YDKH 3BN9D 3C60A 3V4PL 2WW8A 4KZDH 2C3VA 4LSSL 2Q6WA 2NY5L 3RGVA 2VB5A 3VD9A 5DRNB 2K3TA 1HILB 3QWOB 5KSVB 1LHZA 5T3ZL 3QI9D 1DVFC 5HDQL 4EN3C 3GSNB 1G7HA 3B2UD 5EPMA 5IEKB 1B6DA 2UV3A 1N6QL 4XBEL 4JY6A 5KTEL 4XNUH 2PYED 2DBJA 1MHCB 4U1KB 5KN5A 3AROA 1S9WA 2QSVA 4L4JA 4YHNB 1QBMH 3QCTH 4MAYD 1AXSA 3F7PC 2G75B 1YJDH 3QDGD 4TRPH 1ZLWK 2AP2A 5FF6B 4OT1L 3U0WL 1OGAA 4MMXC 2GSGA 4G42B 4ODHH 4XCEA 1I9RH 3BW9A 4UDUB 1F45A 2AVGA 4P2QB 3DXAB 1BQLL 4F7CB 4EIZC 3IB4A 5IROC 2A1WL 2KKQA 5HY9A 1XGYH 4NHUA 3G6JF 3TPUA 1U8PA 2BSTA 2ZKHH 2VLKA 1LEIA 4NWTH 3SHSA 2O5ZH 3BRFA 5IB4B 3H0TA 5DK0A 2NY1B 3HR5B 4P23B 2AABH 3BPNB 3HAEB 4GW4B 2YZ1A 2XRAL 1RK1A 3NIFE 1T6WA 4YH6A 1CICC 1D5BB 4YGVB 2PO6C 2YWZA 1F02I 4FN0A 4QNPF 4N9GA 2YEZB 4EBQL 5ALCL 3GHEH 2EDEA 2V9TA 3NMEA 1F4WH 1CFQA 4XNMA 4C56A 2LTQC 2OCFD 2Z8WC 5DFWH 2VZ3A 3LN5A 1JTTA 3PF2A 1EAPB 3TBSB 2G2RA 3QI9B 4MWFA 9CGTA 4CMHC 1YEIL 3F58H 4OCNC 1X6NA 3LY6A 4K71B 4WDIB 4Z5RA 4BSJA 2FR4B 1G9ML 5C0AA 4CW1A 3SDXA 1CE1H 4PGDB 5EA0L 4NQTA 5TE7L 4YEFA 3OAYH 4MAYB 1A7NL 3OR6A 4X5WA 5K9KA 4DK6A 1A14L 5C6TL 4ZS7H 3QDGB 5FGCE 1NSNH 1JZ6A 3MGOA 4WW1A 3TZVA 4LBEA 4U6YB 2BVOA 3V6FB 3QFDB 4PBVC 2UUDH 2WQRA 1IGML 1AGDB 2QQLH 3TT1L 5HGAA 1IKNA 2WV3A 3X3GH 4UV4L 1FNEA 3LKRA 4N0CC 5FYKD 1YUHB 4MLIA 3RWFB 2QQKL 3GGWA 2R0WL 3H9YA 4EXKA 3WEXA 2SEBA 1QEWA 4LDLB 5KG9B 4J3XA 1HIMH 3C6SA 5D1ZA 5HVWA 4UIKH 4RX4A 1XF3B 2R56H 5C0FA 5F88A 2H6PA 4CDHA 2XN9E 1CGWA 1RIUH 5F7WC 4MNGA 5FUOH 1B4RA 1B0GA 2VSDA 1WJ3A 2B1HL 3FQTA 4LSUH 3QDMA 4XCFH 1FZMB 3GM0A 3QUZA 2BY1A 4ZMAT 3CSYA 4NZTH 4PLJD 5IM7A 4OCYL 4DW2H 1YY9D 4KK5D 5HI4C 2Z93B 1J8KA 1RHHA 3T8XA 2GSIA 3IXAB 2J8UA 2EXYC 5KSBB 1QQDB 1DQQB 1I7RB 5B3NA 3QUYA 3VXSA 4CUCA 2FZ3A 5CSZA 3D0VA 1U95A 4OBSA 2R23B 4NKIH 4H0IA 1ZWIA 3VG0H 4F7EB 2XQBL 5I75C 1T04A 3WFDL 3LRSA 2YD1A 2NY2C 1A0QH 1F3JB 3MRBA 1L7TH 4P2OD 5DQDH 3DRQB 2C3WA 4M4PA 3UPAA 5HYIA 5DJDB 3UZQA 2FX7L 5ENWB 2QKIB 4UILL 1OARH 5IG7A 5K33A 4OQTA 3B9KC 1MEXH 3ILPA 1YEEH 4UU9A 5C2BL 2AXFA 2VXTL 3U7AA 2HKFH 2A9ML 4YXHH 5SWZB 5F7HA 4EUPH 5J3HD 2Z91A 4P57B 1V7ML 1UACH 3REWA 1NBVL 4NO3A 2BRRL 4YDIH 3MUZ1 3HE7D 1AIFB 2YN3A 1JL8A 3ULUD 1RIHL 3CFJA 4NFDA 1I7TA 1DQML 3LRHA 1UM5L 3MRGA 4PJ5B 3TA3A 3IU3B 3RHWK 1MHHA 1WQVT 2FHBA 3RY6C 4I2XA 3KYMB 2HFFA 1NAKH 3QNXA 1BQSA 3E3QE 1EO8H 2MCPL 3FOLA 3CSGA 4LLWB 1RZKC 1DE4B 3BRDA 3KYOB 1YQ2A 4P2CG 3DI2B 3I3BA 1AC6A 4RAVB 4E41E 2OR7A 2CO6B 4WEMB 5CMAA 1T1WB 3ARZA 1MF2H 4HX1B 4Q9RL 2NY5C 2CXGA 1DBBL 5C0NC 3RWHA 1X5YA 4BZ2H 3A6BL 4PGZA 5D9SB 5E6ZA 2H32A 5LG1A 2Y6SC 4P2OB 4K3DH 3MLUL 2WQ8A 1JTPA 1UM4H 5GGSB 3CVHB 2UVFA 4CN4A 3GKWL 1XFPA 1CXLA 5F7FA 4XBGA 4MA1B 1YQVH 4NBXB 4H5SA 5ALBH 5IB3A 2DD8H 2EE2A 3JWOL 1ZHNA 5GGRY 3U7WH 4YE4L 3QUXA 4ZYKA 1G1CA 5FOBB 5GZOD 3BKML 5FDWA 3V7AG 1MFCL 1LP9B 3HE7B 1U8LA 3FT2A 4O51A 3MRQA 4Q6IA 3SGDH 2P49B 2WP3O 4IIQA 3QT2A 4KK8C 3S3SA 5HDBF 1ZT4B 3WNLA 1MVUB 5CD5D 1DQLH 3MPCA 4Z7VF 1T5WB 5C0BD 4X7TA 1VFBB 2CK2A 1KPUB 1SJHB 4AENB 3MOAH 3DURA 3A6OA 4DEPC 4XC3L 1K8IA 1GGBH 3MCKB 4ETQB 1FYTE 1OCWL 4HHAB 4HSQA 4JZJA 2D03H 3QPXH 4KQ4L 4N0UA 5FOJA 5FB8A 2APVA 3BZFA 4FFWD 4K7FA 1YA5A 4ODVH 1EDQA 3L5WA 5EOTA 2AJXL 5FKAB 3NTCL 4NP4L 1XGRB 2IBGA 5BMFH 2OJZL 3U9UB 4YDJA 5I66B 4LHJB 2X05A 3HNSL 4KU1A 5H8DA 3AY4A 4TYUA 3W2DL 3MXWL 1CFTA 1D5ZA 2FX9L 3VWJB 2K7QA 3EJYC 1JPSL 1BBDH 1HZHH 4M6ML 3VWKC 1A7PH 4Q7DA 2OL3B 5LGJB 1G9MC 4PRPE 4HDIA 5ESVA 1IBGH 2PW1A 2PXYD 4MXQC 3UO1H 4S2SB 3VA6A 2X4OA 5ID1B 4G6AD 4UDTA 2DLEA 4UT9L 4P9MH 1JFQL 2IAMD 4Z7OE 3RWJB 1MI5A 3G5ZA 4LHUA 4P3DA 5F3HA 1Q0XH 3EZJB 3MLZL 3QCUL 1FZJA 2DDQH 1E27A 4JM2D 3SDDD 4YK4B 5DHVB 1IMHC 2AQ1A 1XIWB 3ZHKA 1E4KC 4J8RB 4ZXBC 5C0BB 1P1ZB 3MROA 1B2WH 3I75A 3OL2A 2I5YL 1FORH 2CMRH 5F8RC 4J1UA 2F5BH 3N1GC 2C4FT 1TZGH 3ROOB 2P8PB 5EO9A 2YSSA 5SX4I 3KR3L 1A6UH 5ID0A 1SY6L 4WUKL 4IRSD 5CHNA 1NLBH 1RIVL 4APQA 3TBWA 5C0EA 4OZIA 4GRLD 5DQ9A 1D7FA 5FAAA 2R1WB 4GBXA 1AP2B 3IJHA 5FYKL 4DQOL 4W81A 4MNHB 3RQ3A 4D3CL 4LVHC 4OF0A 2FEEI 1T22B 3MV11 1H9VA 1G9NL 4U1MA 3VDCA 1X4ZA 4HK3N 4YHPA 4OZFA 3RBSA 4ZAKC 5FIEA 2AXGB 2X40A 4HXAH 2HWZH 3WJJC 4P99A 5DUBA 2OYPA 3T3PE 4ENED 4GMSH 2EDDA 2F58H 3WNPA 1HEZB 3L3JA 1NBYA 4NUGL 3EO9H 5KS9F 2PXYB 1U2HA 1EVUA 4PREA 1JBJA 1X6LA 4QTHB 1CR9L 1EHNA 4O02L 3BIAX 2IAMB 5DK3A 3SY0B 1DL7L 3EO0B 3H7BA 5DSCA 3CU7A 3TYFB 2PCPB 2YKLL 4H88H 5D70L 3SDDB 5F7DA 4WWKC 2Q3AA 2BNQD 1CGVA 3U83A 1NMAL 1WC7A 3ET9F 3MRHA 4FXKB 2AJVH 3BKCL 4AL8H 2EH8L 2EIBA 2EH7H 4TTDC 1UH2A 4KDVA 4P2QE 3DXAE 2AQ3A 1T21A 3RGHA 3GRWA 4ONFL 1MFEH 2XQYG 4EI5C 5IESL 5D72H 4W6XB 3CVHL 4K9EH 3H9SA 1CDGA 4BH8B 4FMFA 3I2CH 4HEME 3C8KB 5F1OB 5MP6H 5FO7A 4WO4B 4AH2B 4LSRL 3NCJL 5J13C 3WO4B 4G43A 1INQB 1TXKA 2XWTA 3QJFB 5I1AA 3TT3L 3IAGC 1D5MA 2VL4A 4PJCB 5C07B 3E2HC 3DETC 5IJKC 3BPLB 1O5DT 1CZ8H 4LPWA 5IW1A 3QIUD 3BQUD 5EZOH 2J88L 1GGUA 1XGQA 2XQYK 3ULUL 1OM3L 3T4AA 4L1HA 2FHCA 2WBJA 4GAYA 3OB8A 2W07A 1R3KB 2VDKH 2ZUVA 1A64A 8FABA 3FB8A 3VG9C 1Y0LA 2ZPKH 5KAQG 4O5LL 4QF1B 5FA3A 2BHUA 4XPFL 3TYGL 4QTIL 5TDNB 2BNQB 3QDGE 2X1WL 1GYAA 4Y4FA 2V2XA 3TO2B 4AMKL 1E4WH 4I18B 2XWBB 4QOKA 3MOQA 5FYLH 3MGTB 5D7SH 2UWEE 4JZNA 3IFLL 1B88A 1Q9WA 3KPPA 4I3RL 1NPUA 4DKAA 3QI9C 1TJGL 1MQKH 4YWGH 3QXDB 1C16A 5IB1A 5FM4A 2DQIL 3T0VA 3T04D 4NNPH 3I9GL 4JQXA 4K71C 1U3HB 4XHJD 4ELKB 1S8DB 3P0GB 4IIQC 1ZGLP 4MAUH 4M6OH 3EYFB 4OLZH 3O9WB 1NDGB 1Q9LA 1G7QA 1FAIH 5CWSA 3GBNH 4MXWH 3DX9A 2H9GB 4IBLT 3PGFH 4EQ3A 3QIUB 3QXVA 4K8RL 2GJJA 3ULVD 4BJLA 2HAZA 2VDOH 5CEZD 1UZ6E 3TBYB 5EUOF 3CFBA 3IDYC 1Y18A 3JVGC 3S5LB 3VXMA 3AMLA 3BYTA 4LGRB 5KSBE 4XP9H 2L4OA 3EYQC 4V2CB 1EHLL 2RFXA 1GHFH 2UZIL 4MD0A 1N8ZA 2QSCH 2Z35B 1R5VA 3QRGL 1I1AD 3MO1A 3V6OA 1M7XA 3O6KH 3BDYL 3HZYA 2C7UB 4NT6B 2WK2A 1X7QB 1TDQA 3MNWB 3LH2L 3OXRA 5T5FL 4JDZB 5DR5H 4PR5B 1SMOA 3KPQA 1V05A 4YX2L 2ZUSA 4H26B 4XP5H 4LLVA 4GG8A 1I8MB 5I19H 1YN6B 3ILQD 1LVEA 5TDPB 2VDNH 3JXAA 1WISA 1X5GA 4N9OB 4PJ9A 1E4JA 5TH2B 5CINL 2YRZA 3ARRA 2FDBP 3FO0L 3TPKA 3NCEB 1JGLL 1MLCB 3LIZH 4AQ1B 5DC0A 4NJAH 1CFNB 2J3SA 3L3HB 3B4NA 3T65A 4QRUA 1C1EH 5KANG 5CJXA 4FABH 5DRZA 1U8KA 4BZ1L 1F6AB 3G5VB 3JTTB 1FJ1B 1VKXB 4PJ5E 4TN9A 4GXVL 2ED9A 1MH5A 4FFVD 4QT5A 4R4FL 5E9DD 4XPHH 4HKJA 1UVQA 5EU6A 5IFHL 1IEBA 1G9NC 3EUUA 5C8JB 1AGBA 2V2TB 4QXUL 2YRPA 4YFLF 3MBED 2EDBA 2E27H 4B7IA 2EICA 4PJAF 5SWQB 1INDL 5AG8A 4OCRL 2H41A 4J3VA 2MJWA 2X1OA 5SX5H 3ECBB 2R69L 1K3IA 4JFXA 4LLMB 4WTZG 1XR8A 1AGFB 3MUGB 5ICYA 3UCRA 5C08A 1N5YH 1H3GA 3MMEA 4PLJC 1MHEB 3ALPA 5HHQB 3L5HA 1I7UB 1YY9C 5B3JE 4FQXB 4LRIC 3FRUA 1DFBL 2ZCKL 2FL5B 5KOMC 3RP1A 1EJOL 4X8JB 3ARBA 4UMGA 1D9KA 2VAAA 3MC0A 5DJXB 3OHXA 4DKFH 3S34H 3H42L 4DFHA 4X4XB 3X12A 2ADIA 3RKDC 1MUJB 3GSWB 1AJ7H 2OJEA 3KXFD 4XH2A 1IC4H 4H0GA 5DMIH 1PG7X 2DQUL 4S1RH 1LP9E 1YEDA 3M8OH 3KDMA 1TJHH 1A1NA 1F3DJ 1TZIB 1P4BL 1N5AA 1H0DB 2C1OA 3CH1B 5HSFA 4OB5L 3RL1B 4O58H 3WKMH 4MB4A 3ROLB 5JR1H 4S1QH 1HHHB 5E1HB 4QCIB 3PHOB 3MCLH 4JB9H 3GKZA 3QPQC 5E9DB 5IVZA 1PZ5A 3WUWG 1U8MB 3OTTA 4M5YL 4ACPA 4JPWH 3C2SA 4NQEA 2CPCA 3MBEB 3AXLB 2OP4H 2Y5TB 3OZ9L 4NN7B 4W6WB 1QO3A 1PFCA 1TVDA 4I5BB 4LF3B 1J05B 3RDTA 3VGAC 5I74C 5HGBB 2BVTA 1EGJA 5GZND 4ZDHA 2EECA 5FM5M 2ADFL 4AEIH 3REVB 1KPVA 1PBYA 5J56B 1YNTB 3QIWD 4P46D 5HHNB 3ULUC 1JV5B 2BY0A 4HLJA 5BZDA 3SKOB 3MLRL 5C0RH 1BLNA 4FQ1H 3IS0X 4HV8B 3HI1A 3O4OB 4KTDL 1FNAA 2CRMA 1NFDA 4Z76B 5C7XH 2WBJC 4MB5A 1UZ8A 1JF1A 3R8BB 2A73A 1KFAL 2GJZA 1K2DA 1MAMH 3VXPA 1OAXL 2X4SA 3O3BB 4NHCH 3NABL 4FG6D 4YPGB 4JCLA 4N8VB 5GISH 4MHHG 2VDLH 2A83A 2MTPA 1IL1A 4OF8A 1NGPL 1UB6B 5F44A 3JV0A 2NCMA 3KXFB 3MA9L 3UC0H 1HK6A 3FQUA 5F7EL 5HYJD 3VFPB 4Y4FC 35C8L 2DWEB 4KVNL 5BRZA 4P5TA 5JXEA 5EO1A 3P2TA 3GB7B 3DROA 1U8NB 5HJ3B 2QHLA 5C0BE 2IQ9H 2XWJA 1NEZB 4MJIA 5C0CD 1D5XB 3KPRD 4P5MB 4I1NB 5JW4Q 2GI7A 1AH1A 3D69A 5AUMB 1RZ8B 5F7NC 3PJSB 4Z7OF 2EKSA 2ESVD 2GTWA 2WWKO 4DZ8A 2LV4A 4JQXC 3AS1A 4X7SL 5C09A 2N4IA 4R96B 3FT3B 4UTBL 4KC3B 4OZGA 4ZTOL 1I9EA 4QXWA 4POZD 4F2MA 2FIKA 2KL6A 1BX2A 4K8RC 3VJ6A 1MCEA 3OBAA 4Q0XH 4CVXB 3THML 2HKHH 2FLRT 1UKTA 1KT2B 4P46B 4YK4C 4U6VH 5EWIL 4HBCL 1IEHA 2APXA 4TUOA 5D1XA 5FGBA 1KSRA 2X4PB 1ADQA 4FQCL 3STZA 3WIFB 3D85D 2O26U 6CGTA 4DN3H 5I1CL 4HKXA 4D2NA 4O2FB 5CP7B 3CDYA 2XA3A 3L95A 3Q2CA 3QZWB 4H1LA 3PWVB 5ISZD 5DXWA 1MWAA 2X4RA 1W0YT 4PJFB 4ZFFB 2VISB 2PTUA 3OKLA 4QO1A 1CLCA 2BC4B 4FFWC 4WRLA 2AI0L 3ULVL 5D7IB 1JWUA 3UTTA 3V9FA 5CEZL 2M2DA 2EO1A 3RNQB 3VXQB 1U92B 3T3PF 3S37X 3IF1B 1EXUA 1JYWA 2DF3A 5E8NB 4IDJL 1QLFA 2QQNL 2CR6A 3KPOA 4PJXB 5DJZA 5E5MB 5I8KL 5C0CB 2EYSB 3KPRB 2ORBH 3DUSB 5DJ6A 2NYYC 3OG6B 2IG2L 2ESVB 4F7TB 5E2VH 1VFAB 3V0VA 5JA9A 3L6FA 2XOTA 5JA8B 2J6EH 2GCYA 1KOAA 4G6AC 1DLFH 3EOAA 1NGXA 1W72A 2Q86A 5JHLL 3CH8A 4PGCB 4OGXH 1VERA 1A9BA 1XEDA 4PJ7F 4HGMA 2QJDA 1PKQB 5CJXC 2BFVH 4JM2C 5JPNA 5HYFA 1GIGH 2X41A 1BQUA 1TQBC 2LFGA 4PJCE 5C07E 3IU4L 2GAZA 2XZAH 1HH6B 4PRHB 3QJHB 1JZ8A 1KCUH 1JNJA 1K5NA 4UQ2B 3P0VH 4U1NB 5ISZB 1TJIH 3SCMD 4IRSC 4DJMA 5JW3H 1P4IL 4NQXB 3BAEL 2FYYA 1RVFL 1HHGA 1QBLL 4GRLC 3LS5H 2NZIA 2FH8A 4PRNB 5GJSL 2ICWI 1OQXA 3H3PH 5H94B 4PY8J 3VMOA 2WUCL 3EDFA 1AQKL 4R0LB 3TVMD 1T4KA 2CKBA 2J5LB 1KN2H 3NBNA 4X5XB 4G9FD 5MEOA 4WU5A 4UZGA 1GCFA 4HJJL 4RRPA 3U36B 4RGMC 5DD1L 2BNQE 3CXDL 2QQQA 3WFEH 4ENEC 2HT2C 2AEPH 5EBLA 5EOCH 1A4JB 1I8KA 6FABH 2AJSL 2X4TA 4NUJA 1D9KC 3NFPA 4G6JH 4RGOH 1OPGH 1IAMA 1SEBA 3MJ6A 1ZLVH 4QLRA 1NCCL 4P4KD 3EFDL 3K0WA 3Q48A 5MI0C 3C5ZD 4M7ZB 1FNFA 1RZKH 2JJSC 4IMKA 4R7DA 5DURB 1H3TA 4U05A 4WV1A 4OCSH 2CUHA 1XH3B 4JVPA 3LN4A 4EUPG 2K7PA 1BFVH 3HNVL 5MEPA 2UWEF 3V4PH 2V7NA 4LSSH 5DTFA 3IDMB 1NUNB 2WLZA 5KVGL 3F5WA 1MRCL 2XN9A 4OZ4B 4QHKI 2W9DL 4NCDA 5T3ZH 3FONA 2Q76A 2VITA 3DYMA 3Q5YA 3SCMB 4YHZL 3WNKA 1QSVA 4JPKH 4YHLL 4NO5A 2Y4SA 3PABB 2XKUA 3DUHA 4TUKH 4XNQA 2R8SL 3LKOA 3WXWL 5F9AC 2HJLA 3GMQB 4OD3L 3KJ6L 3U9PL 3TO4A 3FT4B 4XGZB 4OT1H 3RI5F 3U0WH 1OTSD 1EHXA 3TVMB 3CD4A 4PYHA 1BD2D 4G9FB 3OPZL 2OTUB 3GMNA 1UZ6F 3TLRA 3O8XD 5T5NF 1X5XA 1B0RB 3BQUC 3KYAA 1HSBB 3KPLA 1WCQA 4NZRH 1MRDH 1H3UA 5EUKA 1SYSA 1IM9D 3EGSB 3MV9D 3PL6D 3F7QA 5D96B 4X99B 4LCUB 2HP4A 4P4KB 4KJYB 4NRZA 4DKDC 1KJ2B 4I4WB 3C5ZB 5C3TA 3UAJD 3WE6B 3GJEB 5JZ7C 1FRGL 2PN5A 4M5ZH 4OJFL 4BELD 1WAAA 1R0AL 3FO2B 5ALCH 1Q0YL 2ZSWB 4JFFD 2X10A 4OLYH 4L8SB 3T2QA 4IDLA 4L4VB 1KUMA 2YBRA 2B1AL 3BD3A 4JDTL 1UWGL 4C59B 5HI5D 3NCBB 4HF5H 3HPJA 3CK0H 3KWWA 1RU9L 2H8PA 2APTA 2LU4A 1YEIH 5DQJB 5E8EA 3VH8A 4CVZA 3ULVE 4JO4L 5CEZE 1NCWL 3HHRB 5FHBH 3RJDA 2FECI 3FO9A 4OM1L 1ITBB 5TE7H 1FBIH 4LMQE 2LU7A 2X5PA 4YZFE 3O4LD 4NKDB 4FA8A 3O3EA 5IFAL 2VLRA 3OF6A 1M7DA 2FSEA 3P4NB 3W9EA 1BIIB 3MRDA 1FVCB 5DJ0B 5EZJA 3O8XB 4UV4H 3OXSA 4C58B 3BH8B 3BP6B 5IJVB 3L3GA 4O2CB 1CCZA 2CJUH 3MV9B 3PL6B 5IK3A 3G6DH 5DUPH 3B5TA 5E8OB 4LLDA 1BHGA 4YQXH 2DIJA 5IW3A 4WI8A 1CFSA 5GRXG 2EDYA 1J8HB 2VIRA 4HUXA 4F15B 4V2BA 4XPGL 1I1AC 1U8JA 1A6TB 3EOYG 4HUUA 4M93B 3QDJD 3GHBH 4GG6B 3D39A 5GSRA 5I8EB 4Z78B 5JORA 1F4XH 4YHIB 3T2NL 5C0IB 4JFFB 2NZ9D 1FVDA 5F9JB 3A67L 5K59F 43C9A 3OR7A 4OCYH 2ZOKA 4L8CB 3FQWA 1KIRB 4NN6C 1X9QA 1N59B 3D2UD 4HT1L 5DD5H 2Y36L 5DLMH 4LRNL 1S7XA 5IIEA 3LCYA 3DV6B 4CMMB 1NCTA 4JO3L 3ILQC 5D6DA 3LPWA 1MJJA 5E9DE 2AJZA 4BH7B 4FQHA 1ND0A 2W0PA 4GKOA 2Q7NA 4JVWA 1YEJL 2XQBH 3WIHA 5ESAA 3TM6A 2QR0B 5HGDA 3WFDH 4M62H 4YDVB 3PP3H 1A9EB 4RCAA 3ULUF 2IMNA 2IBZY 4OGYH 1A4KA 3QHFL 3T0EA 2I27N 5DD3L 3S3PA 4M9OA 4HIIA 3BO8A 4U7SA 1VDGA 3RVVD 1XT5A 2CIIB 4L8DA 1BEYL 4ZSOB 1NL0L 1CU4L 5KOVC 2X7LB 5DDHB 3WJLC 2Z0BA 3LMJH 4FFVC 4LSTL 2NY0D 2VXTH 2A9MH 3MLTB 3VFRA 4OQTH 1IQDA 2P43B 1P5UA 5SV4A 3CCHA 4L29B 4FQIH 3ZO0A 1M05B 3K81A 3VXTA 3BP4B 5HPMB 1IKFH 3HS0A 4KH2A 4PJHB 2E6JA 3PWUA 4PRPA 5HHXH 3QDJB 5E5UB 1DQMH 4MD4A 2VQ1B 2VLJA 2W9EL 3PHQA 1IQWH 3KXFE 4Y4KD 4FOMA 4PJDF 5T1MA 5D8JL 4HWBL 1TTUA 3VRIA 2H1PL 3DHJA 1ACYL 1WBZA 4Y5XA 3MZTA 4MCYA 3MLSL 3HC3H 2ZCLH 5DJ2A 2I60L 1YEKH 1JGDB 4JG0L 5ETUA 1IAOB 3D0LA 4WFHD 2DS4A 3O6MH 4X7CC 3A6BH 4MA8L 5HYQB 3S35L 3SQOL 1AQDB 4FZ8L 5F7UA 5DD0H 4GXUM 3NIDE 3WFBL 2YA2A 4KTEH 2YPLB 3P77B 3OQ3B 1D6VH 2JJVA 4ODWB 4OIIL 5F70A 1TENA 3GKWH 2XPGB 2H32H 3OGCA 4S10A 4Y4HD 5JHDD 1GZPA 2P7TA 4PUBH 3ZYZA 2ZUQB 1XGPB 1D5IH 2BSRA 2C3XA 3BEVB 1CL7L 1GH7A 5L2KD 2IADB 3N1PC 4OKVB 4U6HA 2AK4B 2HJFB 3BKMH 5IW6B 2PTVA 1IAIL 4PJFE 5E4IA 4POUB 2EYRB 3DGGB 1WIOA 4ODTL 4Q6YA 1J88A 5DO2D 4GO6B 3GUTB 1OAKH 5D7IE 5DRNA 1T1ZB 1TVHA 3QIWC 1HILA 1J0ZA 3QWOA 4P46C 4Y4KB 3PGDA 4NC0B 1OOAA 3GSNA 3LEXB 2FD6L 4TQEH 1MHCA 2X6MA 3LDBC 3T2PA 4U1KA 2JB5L 4TULH 1AD9B 1A7QH 3S96B 4PJXE 1OCWH 5DA0B 2EYTB 4H20H 1NDMB 3DV4B 1UWEL 4Y5VB 3ULSB 5C0CE 1RJLA 1X5AA 3KPRE 5KVDL 1W8NA 2G75A 5EBWB 3MBXL 4FG6C 1P9MA 4XCYA 2ESVE 2JIXA 4MJ6A 5FUZH 4G42A 4U1LA 1MIEL 5DRXB 4JM2F 3BX7C 1TETL 2P46B 3SO5A 4UDUA 1NBZA 3HNSH 1VPOL 4K7PL 1RURL 2FX9H 1PKQE 2EC8A 1JPSH 3VGEA 5GGTA 1XF2B 2J2ZA 4QRPA 4Z7WB 3UTQB 1MSPA 3BSZH 5JHDB 3QSKB 4KI1A 1RY7B 5EFIB 5L9DH 3HR5A 1WLHA 4P23A 3HAEA 4GW4A 1EEYB 3SKNB 3C08L 1CDIA 4L4TA 4PLOB 5L2KB 1CG9B 3DRTB 4ZOEA 3RY4A 4YGVA 4XI5D 4UT9H 5ISZE 3QEGL 2YD4A 5CJOL 2YEZA 3F62A 1RUPL 5DFTA 1M71B 4P48A 3KLAA 5IVXA 3ZHLA 5ADPL 1NCAL 3VW3L 1U91A 4PJCF 5ACZA 1YEGL 4XVSL 2IPTH 1S9YB 1EAPA 3O45B 3TBSA 3BH9A 4LLYB 1UJ3A 1U9KA 1N26A 4KRPB 3DYPA 4E5XA 3FZUD 4NSKB 4ONGL 3QEUB 1F90L 4UAOC 5KVFL 1NAMB 4XMKH 3WS6A 1SY6H 4WUKH 1T7VA 4MJ2A 1OAZH 3FCTB 1P2CA 4MAYA 4M6NL 5I16B 2BNRD 5IMMB 4U33A 3TNMB 1BIHA 5FYKH 4U6YA 2HJKB 3CSBA 3IDJB 4D3CH 1U3ZA 3V6FA 3QFDA 3R06B 3FTGB 1BOGB 4HD9A 1TNNA 1KLGA 1OGTB 5B4MC 2OZ4A 2VXQL 3DX6B 5J1TC 2ZZUT 1C7TA 3VRJB 1OAUH 1T0MB 2MOVA 3FN0H 2FO4B 2CK0L 1XF3A 5I17B 1H3WM 1S7TB 2Y1VA 5H35B 2BRQA 5C9KA 1YEHL 4NYLB 4TNWF 5KSUB 4LFHG 5DA4A 4LSVH 4XXDA 5IMLB 1FZMA 3K1KC 4X4ME 1KB9K 3HLAB 5FA4B 3ETBF 5D93C 4CJ0A 3Q6GH 5D70H 1UB5B 3ARXA 4KUCF 5DUML 5AEAA 2Z93A 3IXAA 5HHMD 1QQDA 1DQQA 4QEGA 4S1DD 2X42A 3GEWB 4RAUA 4AIOA 4Y0GA 1UQSA 2HFEB 4G9FE 2R23A 3OB0H 2H26B 1KB9J 2W60B 2LAAA 3LPFA 5IOPB 2JELL 4KKAC 4F7EA 2VDRL 2F19L 3VFNA 4ZUWB 3SCMC 3WIIL 2HT4C 1F3JA 4OLWH 3IDIA 4X7EC 3C8HA 3GRWH 5L8KB 3MQIA 4WW2B 4PP2A 3DRQA 3NCJH 2DTML 1E6OH 3X11A 4OFPA 3TT3H 5ENWA 1YMHA 2M8XA 3FFDB 5FYKU 5FKPA 4LKCA 4PJGB 4KQ3L 1H5BB 5F6IC 1NC2B 5SX5K 5IMOA 3U1SL 5I30L 1YEFH 3JTSA 4QHLB 2HVJA 4DTGH 5SWZA 2HT3D 3LKSB 4Y5XC 2X09A 3DBXB 1OM3H 2N7AA 4P57A 3OWEA 5DRWB 1BECA 4R4ND 2GT9B 1AIFA 1EZVX 3CFKB 3HMXA 4OCXL 4G7VH 4M00A 4PV9B 4W70A 2PR4H 3O2DL 3LAFA 4PJ5A 3CC5B 3T1FB 3IU3A 1U42A 3SJVA 2HYMA 4R97B 3BHBA 3KYMA 5J89A 4TSBL 2CDEB 4XP4H 3WUWB 1WCBB 3IXTB 4L9DA 3MYJB 4LLWA 3ULVF 3KYOA 4DGVH 3IDNB 5E0QA 1P53A 5J1SC 1S9VB 4Z7UB 3D48R 5FGSA 4I3RH 4RAVA 3WO3B 1T1WA 4JKPL 1TJGH 2MCG1 3NIGF 3MR9A 4XP1L 4NZJA 3AAZB 4OI9A 1KJVA 4YZFF 3MV9E 2VERN 2KQNA 3ZE0E 4PTUA 3UBXA 1S9XB 2Z31D 5GGSA 5D2NE 4MZ3A 4Q9QH 1J8HE 1ERNA 2Q1EA 3LV3B 2OK0L 4YLQT 3RJQB 1MNUL 1OTSC 3WHXB 2X4NB 4GG6E 4QXTB 4K8RH 5B21A 1CYGA 4JFFE 5I1DA 1MPAH 1ZTXH 3O8XC 1H8OA 3NCMA 3FAWA 4H8WL 2GEEA 1PQZB 5D5MF 4JHAH 4HMCA 4OKDA 4GQ9L 1LP9A 1P9MC 12E8H 3HE7A 1FG2B 4DVRL 1G7JB 2UZIH 1ZT4A 3WNMA 3STLA 1LQSR 5D2NC 1T5WA 1KLFA 2M1KA 2OR9L 1VFBA 3UAJC 1KPUA 1RZJC 2XI9A 4OCMC 1A1OB 4OFYD 5JW5A 4H25A 3MRMB 5KSAC 3VE0B 2WINB 2O61A 3RPIB 4AENA 1MAKA 1LDPL 4GH7B 1OW0A 4PGBB 1AGEA 4ETQA 3DO3A 4ELMF 1P7KA 4HHAA 4YX2H 5JNYA 4NM8L 4ZSOE 2VKWA 5HI5C 1UENA 5J6HA 3ZSSA 4AG4H 5FKAA 3IGAB 1J12A 1FNSL 4MQSB 3U9UA 5I66A 4FQJH 1ZVHA 1YMMD 3PWLA 3FO0H 4J3UA 3H9ZA 5E2WL 4PV8B 3VWJA 1JGLH 5J57B 2GY7B 4JJ5B 5FO8A 3ARTA 2R0LH 2OL3A 1UJ3C 3A0OA 1MCCA 4G8EB 4PJHE 1AY1H 3QDJE 2FJHB 4NJ9L 3SEPA 4KPHL 3X13B 1SM3H 4S2SA 3WS6C 4R4FH 4Z7QF 5D7JB 5F21B 1DLHA 1KIQB 2VDPL 2JTDA 2RB8A 5F9WB 5EC2A 1FLRL 5KW9H 4OIAA 1XR9B 4JGJA 4KJQC 3S88L 3WN5B 1MFBL 1MFDL 3IKCA 4LLQA 4HZAA 4RDQG 3VXUB 4ESKA 1FIEA 4OCRH 1XIWA 5EH1A 2G60H 1HKLH 2J8OA 3EDJA 4J8RA 5C0BA 2IH3A 1QG3A 5GSVA 3JWDL 5BV7B 3ROOA 3TIEA 2P8PA 3BGFC 4NQSB 4U31A 2NZ9C 3FHQA 3EHBD 1MJ8H 3N1QC 1IARB 1OAYL 1HYSC 4U2ZA 1SYVB 2D7MA 3RAJL 4R3SB 1T6VN 2R1WA 1IM3B 1AP2A 4X6CB 4PJ8D 1EJOH 3G6AB 4FFYH 1JK8A 3CFCH 1IJ9A 2EDRA 3LEVH 3H42H 1ORSA 3SKMB 4YHMH 1OTTD 2P48B 4KJWC 8CGTA 4NWUH 3KPNB 5DMGD 2AXGA 4HMDA 3BRGC 2DQUH 4MJ5B 3N50A 1E28B 3MLWL 1WK0A 3EDDA 2VLMD 1HEZA 1QFUL 1R3HB 2A6DB 1AD0B 4D0BA 4KHTL 3WHE0 2W91A 4K7PY 1J5OL 1ZK9A 5I1EL 1FFNA 4PG2C 3SY0A 1EMTL 2FNBA 4M5YH 1LMKA 4PJFF 2NY0C 2DM2A 3ESVF 2WUBH 3QNZA 4KY1L 3TYFA 4OBRA 2PCPA 2O5XL 5DC4B 2YZ8A 4M1CD 4YUEL 4JPIA 2JB6B 1YZZA 5HPOA 5GHWL 3BKJH 1P7QD 3TC9A 4FXKA 3VRLF 4TUJA 1QFWL 4WFHE 4FNLH 2VUOA 5JUEL 1SQ2N 1T1YB 1EGJH 4XPBL 5JDSB 4RFNB 1RZGA 1P4LA 1XGUB 1EEZA 2Q8AL 5J11B 4U7MA 3G9VA 5F7MC 3BP7B 4ORGB 1GGCH 5IGXL 4Z7WE 1OAXH 5JHDE 4KVCL 4JAMB 4KROB 2X4UA 3C6LA 4WO4A 1UYWL 3NABH 3LQAH 4LAJH 4OSUH 3E8UH 4YDKL 1INQA 4EUPB 1KF9B 4KZDL 4CGTA 5L2KE 3HUJB 2YD6A 2VYRE 5C07A 1SMAA 1WTLA 1ZLVK 5B38B 1T1XB 1OAQL 2YUZA 5EZIH 3U0TA 3BIKB 3D25B 1RUKH 3WL9A 2HMID 5T1LD 1X5ZA 1KXQE 1FZOB 2VRAA 4XNUL 5AYUL 3V6ZB 1MCHA 5EOCJ 1ZA6B 3HI6H 3LB6D 2QHRH 3T4YB 5F6HJ 4KUZH 3UTZB 1QBML 3EYVB 4V1DB 4PJIB 4Y4HC 3NGBB 2XXCB 2V2WA 3NPSC 1YJDL 3DUUB 4JQVA 4TRPL 4NFCA 4GRWF 4J4PD 3GSRB 1H3VA 1KPRA 1RULL 4PB0H 4X7SH 4QF1A 4QRTB 1HH9B 4ODHL 3QO1A 1I9RL 4UTBH 4ERSH 3VFGH 1JHTB 4LLUB 4JN2B 5TDNA 1ZHLA 4JRXD 1KTRL 1H15B 3L7FA 1P7QB 1XGYL 4I18A 4P0DA 1FO0A 2ZKHL 5D7KD 4H8WC 1MCBA 3MGTA 3ARFA 3NOIA 4HBCH 4NWTL 2O5ZL 1U8QB 3KGRA 4W4OA 4YDLC 4BUHA 2D9CA 4HK0A 4QY8A 3QXDA 4DWHA 2P8MB 3CGTA 4C83B 4PB9L 3AM8A 2DJ4A 4AY0A 4P2RD 3TJHC 1T0PB 1U3HA 1N0XH 2ZUUA 4ELKA 5HHVL 1S8DA 1FV1B 4JO1H 3GHEL 1F4WL 3EYFA 1T0NA 4LCCC 5D6CB 3O9WA 3S6CA 1VACB 3KS0H 2AI0H 1VADB 1MWAH 3QDHA 2WSKA 4HG4K 2H9GA 2Y07H 3MJ9A 4XX1G 3RHWF 5CEXB 3U46A 3PQYA 2JLLA 1NUFA 1EHAA 4AEHL 1X4YA 1AKJA 1J11A 3QG6B 4Y1AB 2DLHA 5I8KH 3DGCR 5F71A 4HG4J 4P9HL 4ZS7L 4U6XB 3SE3A 1QR1A 2Z35A 3I6LD 4MJ4A 2CDGA 4G9DA 5IEHB 2QQLL 4XNYL 4NT6A 3DI3B 1X7QA 2BNRE 4JRXB 4DKEL 1DANU 2R1XB 3SDAB 4G6KH 2FGWH 4L5FL 5MERA 1W72H 4JR9H 1HIML 1UKSA 4IJ3C 4Y16D 4UIKL 4Q58C 4MA7H 1YN6A 3IU4H 1FL6A 4PJGE 2R56L 1ED3B 4E0RB 1RIUL 3FZUC 5FUOL 1V3MA 5TH2A 5EN2B 2DYPD 1OVZA 3ARYA 4LSUL 1JGUH 1FG9C 4HIHA 5C0JB 4YJZL 4OLXL 1P4IH 2X4QA 4PRDB 4HPOL 3JWDC 1RUAH 1MLCA 4DW2L 1HDMB 5J9PA 1CFNA 3L3HA 4X4ZA 3WLBB 4FTVD 3BIBX 3IYLW 5GJSH 5AZEL 1TIUA 1F8TH 5DT1H 1F6AA 3G5VA 2ZOLB 2BZDA 3JTTA 2PUQT 4HS6B 2X1XR 4YXLH 3G6JB 4R4BB 4JLRB 5DHYB 3HZVB 4GT7A 4Z77A 4NKIL 4LEOA 1SJEB 4EQ2A 1KIPB 3PNWA 3CXDH 2CKBH 4FHBD 4M03A 2V2TA 4GJTB 5HHME 3RWGA 1CGXA 4NQDA 1KTDB 5I15L 2R2CA 4IMLA 1ZGLB 1LO5B 1A0QL 1L7TL 4Z7UE 5TFSH 1NCCH 32C2A 1EFQA 1G7PA 4GLRH 1TTGA 3EFDH 3ECBA 2DQEH 4LLMA 4A6YA 5D7LD 3PDOA 4WI9A 1AGFA 1A47A 3MUGA 1RJCA 1OARL 1RD6A 2ITDB 3ZLQC 4I0PD 3HE6A 1ZHKA 3PP3K 1VHPA 4YXHL 4FQXA 4LPVA 4Y16B 4O4YH 3MLPA 5GIRB 1UACL 3EO1B 3RUGB 1QRND 2JKXA 3LD8B 2DYPB 3WNNA 3HG1D 5DJXA 4JVUA 1NMCC 3P9WB 4QRSB 5FFLA 4YHZH 4YHLH 3HI5H 1QVOA 4XNXH 2AEIT 4NBYB 3U7YH 25C8H 4ZFOB 1J18A 2R8SH 3HZMB 3UPRB 1K4DB 3CH1A 1GPOL 1CQKA 1WWWX 3RL1A 3EFFB 1A6ZA 4XMPH 4LMQI 4HIXH 1HHHA 5JLZB 3EYOB 3QQ4A 3PHOA 4QCIA 4YHKH 3OPZH 1DEEA 1NLDL 4HCRA 5GRJH 1M7IB 3G04B 2XZQL 4PP1D 5DEGB 3BI9X 1MF2L 1U8MA 4JFEA 1ACZA 2EDQA 5FYLD 3C8DA 4X6BB 1WBYA 3MBEA 3AXLA 2Y5TA 2HT3C 3KPSD 3C6LC 4I5BA 4LF3A 5HGBA 3NA9L 2Y7QB 4K3DL 2BSED 2B0SL 4UBDC 4WI5A 1LDSA 4NCC2 4R4NC 3C5JB 4MXVE 1UM4L 2EDOA 2R2HB 2F74B 1YDPB 4OJFH 1YQVL 5FHAH 4TPRL 1R0AH 1S7WA 3DVIA 1F2QA 4HV8A 1A3LH 3U7WL 4Z76A 1A21A 1PX4A 4LNRB 2BOCA 3GSQB 3M45A 5HHOD 3D6GA 3EBAA 3O3BA 2R1YA 1UWGH 1QRNB 4JQVC 1XAUA 4N8VA 2P24B 1RU9H 3MJ8B 4NQCD 1A5FL 1H8NA 3NH7L 5BS0A 2YC1B 1UB6A 4HXBH 1HQ4B 1DQLL 4DGYH 1JYVA 3RZCD 4OM1H 1J10A 4OFVA 2DWEA 2W0FB 4RWYH 1A3QA 5TQ2H 2DI8A 1DEDA 2F15A 3MOAL 5GQBA 4PJHF 3VXUE 1E0OB 1JF5A 4HZLB 5EIQA 3ARFC 3AC0A 5IFAH 2Z31C 3UXFA 3O11A 3AFLA 3P30H 4LVNC 4GUPB 4P5MA 1Q8MA 5CFHA 4CU8A 1UFUA 3VFVA 1UXSB 5AUMA 3R0MA 3PJSA 2DMBA 3F7YA 5DVLA 2Y06L 3DMMA 2VE6B 4BK4A 1OWRM 3FT3A 3DVFA 5BMFL 5I18H 1MJ7L 3MCG1 1X44A 3MV8B 3BZDA 3PIQB 4PYGA 3GSVB 3BDBA 1DDHB 3ARGD 1KCKA 1KT2A 1HZHL 1A7PL 4WGWB 5K9QG 3WIFA 1IBGL