1OAQL

Free conformation ab1 of the ige spe-7
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
110
Chain Sequence
QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGNKAALTITGAQTEDEAIYFCALWYSNHLVFGGGTKLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HEAVY CHAIN
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2003-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oaqL00
3QWOB 4JKPL 2PW2A 1S9YA 2BMKB 4NRXB 2CLZA 3ULSB 3ARQA 3ZLQC 2DQGH 1T21B 5M7QA 3VXNB 4NO5A 3DGCR 4GRWE 4I0PA 3SDYH 1DLHA 2J4WH 2ZCHH 4M6OH 4G5ZH 5T1DL 2D7NA 4CN1A 1IFHL 5CEZD 4KMQA 2J3SA 4AEEA 5DJCA 3O4LA 3KPQA 4I5BA 4N8PA 4GKZA 3TYGL 3DVNB 2BY2A 4MA8H 3L3DB 5DT1L 1MIMH 2DQTL 3C09C 3IDXH 3L9RA 2VSDA 5F70A 5K9JH 1EO8L 5FIEA 5FYJH 3EOBB 1MHHA 1FCCA 3BGFB 3RBGA 1QLEL 5KVDL 1MI5A 4XP1L 2F58L 2LABA 5GS0C 4IOSD 3SE3A 2BOCA 4NUGL 5HHXH 1OM3L 1X4ZA 1NMAL 2DLGA 5DO2D 5A43C 1XGQA 4JHAH 3TESA 2NXZC 2OL3H 3PWPE 3DWTA 1JHKH 4TPRL 5IW1B 1TFHA 3KLSA 2CDEA 1C12B 3TNMA 2DS4A 4MNHB 4TVPH 2RQ8A 3AM8A 4C56A 2GY5A 4J23A 3LH2L 4P4RB 3QUMB 1MH5A 5I73B 1M05B 4U4BA 3CFDA 2MQ0A 4LKXA 2HYMA 4PJ8A 4GLRH 1AQKL 2X4UB 3CFBB 2R0KH 1WITA 5F1IB 4HCRA 3C5SA 2NX5E 1CLOL 4X4MA 5HVFB 2XKNA 3O9WB 4KK5D 4PGEA 4M5ZL 1EHLL 3UJIH 5C0JB 3BGFC 3NPSB 1ONQB 2AJYH 4PJGA 4RAVA 1A3LL 1KXQE 1VESA 4MJIE 1MFBH 4L1HA 1UM5H 5JLZB 5CJBA 4LVOB 3TPUA 4ELMA 4XBEL 1A9EA 2F8OA 3QNZA 3W11C 1A8JH 3HE6B 5CD3B 2WBJA 2GW5A 4YNYA 3QEQD 1OP3K 1YC7A 4KUZL 4NWTH 1J10A 3DV4B 1FNEA 1QBMH 5EFIA 1I7ZA 3SCMD 4XWGL 2BCKB 1DVFA 2NY2D 4MB4A 3D2UB 3CXDL 3IDMB 2VLMD 2ZPKH 5D8JH 3Q1SH 1OGAD 2VQUA 5E8PA 1FV1B 1KTKE 2CIKB 3PWUA 1TZGL 3VG9B 1NC4B 3TA3D 3RTQD 2AK4B 3RKDD 4U1NA 3B9KB 2XKSA 4P57A 4U0RC 1A6PA 4J2XA 3D9AH 5FV1L 5FOBA 3RGVA 4HS3A 5IVXE 5GRVL 4QRUA 2HN7A 1EDQA 5DJYB 4FABH 4DK6A 2F9BT 1AO7D 4MQ7A 2Z8RA 4Z7QE 5GZOC 3LB6D 4YHPA 3NPSC 3CU1A 3UTPE 4O2EA 3DXAA 4HGWA 1BMGA 1DQDH 2VC2H 1KBGL 3QRGL 4LVOC 5DR5H 3TP4A 3GMMB 2AJUH 3HE6C 1MWAL 1AGCB 3O6KH 3HUJE 2XQYG 3IS0X 4WO4A 1KJVA 5HDQL 3UBXG 4GAGH 4RZCB 5IVZB 1CTOA 3TN0A 5ITFA 4UT9H 4RSVA 4YR6B 2GSGA 1U2CA 3N9GL 4UIMA 2B5IC 1T66D 5CEXA 2OR9L 1JF5A 5DHVH 3KNBA 2GIYA 5HHVH 5JW4R 1QRNB 5IB5A 1WCBA 1U8IA 4PJDA 5EZIL 4JFOB 4WUUE 4HSQA 3I50L 2XWTB 1LHZA 3SE9H 4K8RL 2MWCA 3E2HB 1OAUH 2YUWA 3RNKB 1ORQB 2JK5B 4ONGL 4PPTA 5A16A 1FJ1B 2KQNA 1FC2D 2ZSWB 3NABL 1RZKL 3EBAA 5D7LA 1GZQA 5LQBL 2NY4C 5DC0A 4KY1H 1G7MB 4OFPA 5HGBA 1HYRC 2MSPA 2FZ3A 1YZZA 2V9QA 3WKMH 4LBEB 2XN9B 4JEGB 1A1OA 4LCIH 1C7TA 3MV8A 4A2MA 3U46B 2HKFL 5MI0C 3RY4A 5EU5B 3V5KB 4YO0A 5IBLD 2R56H 3LIZH 1HWHB 2K3TA 4P46A 5IR1A 4LCUA 1MLBA 5I30H 3RUGF 1MFCL 1MHEA 1AD9A 4FQJH 4R96B 5BVJA 2BXYA 1F5WA 1JK8B 4WI5A 1DL7L 2QR0A 4NHCL 1AGFB 4KHXL 1OWRM 2NCMA 3G5VB 1RULH 2CKNA 2IFFH 2XFXA 3NVQA 2VLRA 4JY4B 4W70A 4L8BA 3KPRB 4JFQB 2V5RA 1XGUB 3K0WA 1A4JA 4H20H 1WWWX 1IAOA 5ID1B 5E5MB 3WFHA 5KBNC 1KB5B 3QIWA 1T7XA 3JWNC 5MP6H 5IROC 4ZOEA 1NLBL 2H45A 3VWKC 3E2HC 3S8WA 32C2B 5EBMA 3VI3F 4JFEE 1U3ZA 5HPMB 3K46A 4OLWL 4DW2L 2D7TH 2Z93A 1EMTL 3O0RL 3TZVB 5FM8A 5EOCJ 1OAQL 4PY8J 4G6MH 3V0WH 4ALAH 1H5BB 5EIIA 4EQ3A 4LHQB 2DQGL 3FTGB 1NCCH 2JB5H 2X4SB 4P2YA 3PV6B 5HI4D 4CVZA 1JGLH 3SDYL 3QDHA 2J4WL 1S9XB 2ZCHL 4M6OL 3FZUC 5E9DD 1R3JB 1T22A 5C08A 3ROLB 1CL7I 1QQDA 2YBRA 1J0IA 2CK0H 2WWKO 4PJFA 3DX8B 3IYLW 4PRHB 1DUZB 4ZMAT 4MA8L 1GGTA 3HE7B 1M6OA 2FEEI 2OI9B 1FORH 3C5ZD 4JY6B 1N2RB 3IDXL 3ZSTA 1UXWB 4K23H 5K9JL 2FIRT 2VB5A 3BO8B 5TDPA 2Y6SC 3KPSD 5FYJL 3AFLA 3FB5A 4LSSH 3ZT5A 2I9TA 5K9OB 1N5AB 5J3HD 2X05A 3Q3GB 4QYOA 1XZ0B 1TZIB 3MLZH 5HHXL 2NNAA 1WAAA 4NO0D 3X11B 3LEXB 4JHAL 1TDQA 2Z35B 2OL3L 3QUKA 4U33A 3EDKA 1JHKL 1GGCH 4WFHD 1JGEA 1H5BC 1XR9A 3MRCA 5E99H 2W60B 5GZND 3QI9A 3PDGA 4LPCA 2X4TA 1NGXB 3WDIA 5HYQB 1JWSB 3H42L 1CVSC 4U3CA 2Z8VC 1KIPB 1Z9MA 5FK9B 5DJDA 3BGMB 4HZLB 2NY0B 3QCTH 4WENB 1R3LB 1SEBB 2R0KL 4FNLL 4QRTA 5KJRH 4KROB 4OM0H 1ZXQA 1ZLWH 4QWWC 2ZCKH 2PXYD 1UB6B 1MJ8H 2QQNH 1YMMD 3MGOA 3HE7C 3U7YH 2OI9C 1FZOB 2A6DA 2FIKB 3SE4A 2BSTB 2DJUA 2DOCA 3WXVH 2ZUUA 5DD6B 4JHZA 3SEPA 1E6OL 3DSNA 2IH3B 2XWBB 1VEOA 2OZ4A 1FFPB 2BNRB 4MXVE 5IWLC 4JRXE 1MJJA 4JZNA 3WS6A 1MFBL 1UM5L 5KS9F 3UBXA 2QL1A 3ARGD 1AY1H 4MGXA 4MVBD 3WUWG 3SBWA 1IGYB 1JZ7A 4NWTL 4RMVA 4C54A 3SKMA 2X4OA 4AEHH 2DD8H 4HFWB 1QBML 2FSEA 2AJVH 3O3DA 2Y7QB 1DJSA 1DQLH 3PWLA 4P2OD 1MRFH 4OUUA 1YPZF 2ZPKL 1KGCE 1WVZA 3V2AR 4F15C 3Q1SL 1KV3A 4K7PH 4DKAA 5DVNA 2R69H 2NY0C 5JOFB 2XPGA 5DA4A 3WL9A 4KROC 3FB7B 4PRPD 5FAAA 1ETZA 3D9AL 3GSWA 3CXHK 2FECL 4R4BA 1NGWA 2FJHA 2Z31B 3BP4A 4WNQB 5CMAA 5IUSA 4U0QB 1OGAB 4JZOA 3D3VD 3H3PH 2HJKA 1DQDL 2R2BB 3EW3B 4LSQH 4FXGA 4Y4FD 4FFVC 4N5ED 6CGTA 4AK1A 1J8HE 3KVQA 1GJIA 2I25N 1JFQH 2WUCH 2PYEB 5F9WB 2AJUL 4XX1E 3NA9H 2CO7B 1UXSB 5E8NA 1YMHA 4M62L 2GEEA 3O6KL 2P47B 4F8TA 4GAGL 1TMCB 2P45B 4UU9B 2NTFB 3Q5OA 4UT9L 4IRJD 1U58B 1J0ZA 4PGDA 4UQ3A 1U3HD 2ITCB 2HLAB 3C6LD 1QNZH 4NZRL 5HHVL 3HAEH 3GSOB 3TO4A 2AEPH 4KQ4H 4QOKA 1DZBA 2B8OT 3CUPB 3HMXA 3RL2A 4XNQA 4F7PA 3UC0H 5IVOA 1NC2A 2DWDB 1DBKH 2D0HA 5EZLA 1OAUL 2EXWC 3ROOB 4O51A 4ZDHA 2Z31C 3DETD 3UTSE 1KJ2A 3DX6B 3RAJH 4ZUVB 1OP3H 4HH9B 2IADB 5IMOA 4NQCA 1MFAH 2ZUVA 4Z7VB 2HRLA 1QPPA 4GAJL 4KY1L 4XMLH 1AI1H 3IKCA 5BV7B 3QDGB 3STZB 1F4AA 3VH8B 3WKML 1BZ7B 4LCIL 4XBPA 2ADFH 5GGRB 5B39B 5F9WC 1N6QH 3GSRB 4R6UA 3H9ZA 4Z7UA 1VFBA 4IOIA 2R56L 4Q9RH 3LIZL 5DYOB 1I8MA 5SWSE 5I30L 1CICA 4FQJL 4Q58C 4MX7A 4ZUUA 4IM8A 1KTLB 3O2DH 1A7PH 5L2KB 1RULL 5IM7B 1XGPB 2IFFL 4MJ6A 1OQXA 2GKIA 2P4AB 4IEFB 4Q74A 4YBQC 1I8KA 4H20L 2D7QA 2ZOLB 5IFHH 3GRWA 4HUNB 5MP6L 1WSST 2IPUK 2BVEA 3DRQA 1P5UA 1Q94A 1IC1A 1HOCA 3OV6A 4JG0H 3EDDA 4XCCH 2LAAA 3ARXA 3LS5H 1S7VA 2D7TL 5LGHH 4NKOA 1TNNA 2EE9A 3T3ME 4G6ML 1F3JB 3V0WL 4ALAL 4M8QB 1KIUA 1IAKA 5I1KH 1NCCL 4POUB 2JB5L 3CVIH 5JIPA 1JGLL 3ZDZE 3L3JB 3F7VB 1L6ZA 4RGNB 5AEAA 5HD8C 2X40A 2BDNH 1UADC 4WHCA 4PRAA 2FB4H 3PL6D 1MHCA 4EVNB 2W9EH 1JYNA 1I85C 4WV1B 4NJ9H 4JFFE 1M71B 2ARJQ 5H35B 3B6SA 1E0OB 4KMLB 1YEFH 3VFMB 4Z7OE 4V1DE 3QQNA 3ZE2E 1XF4B 3O6FB 2V9RA 4X5LA 2NPLX 2OTWB 5J1AB 4LCYB 2YOCA 1T83C 3MLZL 1A6TB 5HYJE 1AGDB 3GNMH 3TH2T 4ORGA 3BYYA 3CVHA 4RMUA 4PJHE 3VRLF 5E2JA 1N4XH 3ARSA 4OF6A 2W9DH 3ALPA 4G80A 1FZKA 1VSCA 2VABB 4TSBH 1GGCL 5ESQA 5J13B 4HUVB 5E00B 2PCPB 3SPVB 3QB7C 4RGNC 1RIUH 4J4PC 4HWZB 5TF0A 4KRLB 2NW3A 1QFUL 3TBTA 3QCTL 5BRZA 1CN4A 2AXFB 5KJRL 4V2CB 2FDBP 3RWEA 1NANH 4HUKB 2H1PL 3SDCA 3FO1A 4FFYH 5EN2A 1DUYA 2ZCKL 5CJ8A 3K7UA 1XF3B 1MJ8L 2QQNL 4WV1C 1WF5A 3U7YL 4MD0B 1YEGH 2X9YA 3OJDA 3ZDYE 4U6YB 2VZUA 3MROB 1F11B 5CZXD 4IOFC 2BHZA 2R23A 3WXVL 5C08E 3O6FC 2ARJB 5ERWA 2J12B 3GJEA 1QEWB 4KVNH 1GGIH 3VJ6B 1Q9WA 3GMLA 3HZYB 4NFBA 1ZHLB 3G9AB 1F4HA 3KWWA 3CSYB 4UBDC 5HI5C 1P2CB 3FFCD 1R5WA 1XGYH 4GUPA 3WS3B 5HHOD 1AY1L 1X5LA 4UTBH 3VXUD 3U83A 1K8IA 4AT6A 4WHYG 4ODVH 1FZJA 3P4MB 5C2UB 4PRIE 3H3KA 5ICYA 1KTDA 1KJMB 4QHMB 4AEHL 2DD8L 5J13C 5EO0B 2AJVL 1EPFA 3QHTC 2Y5EA 5D2LE 1HSAA 3QXAA 1GXEA 1MRFL 2VDOH 1HCFX 5I19H 4EUPA 1K4DB 2R69L 2QHRH 3FRPG 1LDSA 1KULA 4G9FD 5T1KD 4X8XA 2PW1B 1BREA 3T04D 1LE5B 1MVUA 3PNWA 5DRWA 2PO6D 4OQTH 1R6VA 5IQ9A 4ZAKB 3QQ4B 1G7QA 1BBJA 3P9LA 2EXYD 3FQTB 2APXA 2CIIA 4Y4HA 3S3JA 2FGZA 4LSQL 3SGKC 3T4AA 4JLRB 4I0PD 4F7MB 1JFQL 2WUCL 1BVLA 3NA9L 3MLTA 3V6FB 5E95B 2EYRA 4ZUSA 3P9MB 3KLAB 4X83A 2MHAB 2A6JA 3O4LD 1QLFB 4AMKH 1GZPB 5GGUB 4Y4KA 3NCEB 4NT6A 2BC4B 4E41E 2X41A 3S96B 3WJLC 5TQ0L 1QNZL 4X5WA 5IJVA 4CUCA 2FR4B 5I1GH 4AQOA 3SJVA 4FQLH 2AEPL 2X4RA 4KQ4L 5DMIL 3S3PA 3UC0L 4GW4B 1MI5D 4IRJB 5D4QA 1DBKL 3P30H 3QUMH 1P4LA 5EUOE 5KVEH 1LNUA 3OSKA 5GGTH 1QSEA 3DARA 4ZAKC 3RAJL 3C6LB 1OTUD 1K2DA 1LO3H 1MFAL 1ZK9A 2JIXB 4KJPD 1ES0A 4XMLL 1AI1L 4RA3A 4H1LG 5D1XB 3O6MH 5CILH 5GXBB 4JAMA 4X4XB 5TH2A 4OKDA 4C56D 1N6QL 1WEJH 2EH8H 1INEL 4PJ8D 1CIDA 3RWGA 3H3BC 4DQOH 4PREA 2FYYB 3GSVB 5F3BA 3O2DL 3BT2H 3V0VB 1A7PL 3L3KB 2DYPB 4XNMB 2FLBT 2XWJA 3T0ED 2NY1D 1NUNB 1B3JA 1OSZA 5GIRB 4NYLB 2P8PA 2L0DA 3PJSA 1FLTX 5IFHL 4LHJB 5CWSB 4MZ2A 5IOPA 1FVEB 3OPZL 3N1PC 4QRQB 4H0HB 4IS6B 5E6IA 3WIFB 4XCCL 5JNYA 1RVFH 4RNRB 5GQBA 4NCC2 3LS5L 4JFXB 1TIUA 2ITDB 4NO3A 5LGHL 1SVCP 1T4KA 2WBJD 4DUXA 3V0AC 5C0AE 3HPJA 4ZUWA 2APVA 2FX9H 1OB1B 5D1XC 3HI1B 5I1KL 2N7BA 3BIBX 5FKPB 4CN6A 3RVUD 3B43A 4BYHA 2KBGA 3IGAB 3X12B 5DTFB 2Y36H 3ET9F 1DVFD 4GXVL 3BESR 4JANA 5ALBH 4JDVB 2G2RA 3BH8A 3VFGH 4Z7WB 2BDNL 5F3HA 5C2BL 5JXAH 2W92A 2FB4L 3ARFA 4OF3A 4C83A 3O81A 4EI5A 1PW3A 2W9EL 4NQTA 4GJTB 5KN5B 3C8HA 3QAZB 3L5HA 4NJ9L 3RGVD 3BD5A 1YEKH 4LGRB 1RQ5A 1IAII 3EIFA 1M1SA 3IJYA 2YWZA 4DKDC 2V5TA 5JW3H 4HG4J 1CWVA 3KPOA 5D7JD 3MLXH 4XB8A 1XGTA 2V9TA 4H0IA 1EEUA 2ICWA 3PWJA 4LGSB 1IKNC 3KYMA 1KELH 3VXMA 2GT9B 5ESVA 4ZNCD 3DXAD 1U8JA 3VFVB 4NSKB 1SYSA 3GNML 3MV11 4LCWA 3PF2A 3D48R 3RWJA 5CBAA 2H8PB 2UY6A 3FQXA 1JI1A 5DK2A 4PY8I 4DOHB 1NGYB 1IARB 3DMMA 1N4XL 2EZ0D 2W9DL 1ULVA 4LDLB 1JPFB 1KOAA 3EYVA 2UY7A 4WO4D 4Z78B 3IKKA 1UB5B 2C5DC 3TN0D 1NCTA 1EHXA 3FRPA 1RIUL 5CS7A 3NH7L 4X7TA 4LHUG 3NZ8A 2IPKB 4MNGE 1EHAA 5FO7B 2ZUWA 1MWAA 1D7FA 1ZAGA 4UOJA 5SWQB 1U8LA 5JHDA 4LRIC 1ZT1A 4FFYL 1DFBH 5DVMA 4ZQKA 3QAZC 1YEGL 4N0UB 1T1YB 4MLSA 1IAIM 1QLRB 1VGKB 4S0SD 3OGCA 5AYQA 1DANU 1XF1A 4WW1B 1S7SA 5ETUB 5MEPB 3VMOA 3GK8H 3STLB 1N3NB 1NEUA 5D7LD 3CU7A 4B0MM 3I6KB 2A6KB 4KVNL 4ZFOL 1GGIL 2APTA 4DAGH 1P7KA 4I18A 5ISZA 1XGRB 4MWFA 4WW2B 5B22A 3SE8H 5IB1B 3U0PB 1XR8B 1CXEA 2JB6B 2GK0A 1YYLL 3MV8D 4XHQA 5HHNA 4AY0A 3BIAX 2LU7A 4HDIB 4ODVL 3HG1E 1KB5H 4JO3H 1KLUA 3NN8B 5E94B 1U91A 3D0LB 1LE9B 1BD2A 3L3GA 3NBNA 4P46D 1KEMH 4LEOB 2W91A 3TBWB 4AM0A 1I8LC 1TVBA 5EO9A 2R0ZL 2VDOL 3LKRB 4P9MH 3MJGX 3TT3H 5CP3H 3KG5A 4I77H 5I19L 1UJTA 2QHRL 1PZUB 3LZFH 2VLRD 3DBXB 3EO1A 5CBEB 3QH3A 5D2NA 1RJLA 2JJSA 1ZT7B 3O11B 2AXJA 3QIWD 4GKSA 2NLJA 1WFUA 5BZDB 5FO9A 4H1LA 4LLQB 1MFNA 4D94A 1EGJH 1ZVSA 1A6WL 4ELKB 3B83A 1VKXA 4WW2F 4RMRA 1H8SA 3C60B 4WW2C 1R3IH 3G6JB 4ZG1A 5B8CB 2I26N 4HJGB 4PJAB 3BH9B 5MEOA 1GGYA 3B4NA 4XP4H 4F3FA 1JPTH 5E2UH 2BX5A 1I1AA 1NUFA 1DQJB 2RAMA 4AMKL 2A0LC 5DGRA 4F37F 1S7WA 4GW1A 3IXAA 4NOBA 4FQCH 3H9HA 1G6RB 2PYFA 1JHLH 1FH5H 3GI8H 2W59A 1ZT4B 3BFOA 5I1GL 2K1MA 3IDNB 3MJ9H 4WI8A 3T0DA 4B53A 3EZJB 3P30L 3QUML 1RZJH 4XRCB 2O93L 1QKZH 2YC1A 5KVEL 4WUKL 5DS8A 2OTUB 2VZOA 3JZ7A 1EO5A 2P5WA 4HGMA 4X8JA 4EN3A 1LO3L 1CD1B 1KT2B 1CFNB 2IBZX 3PQYE 5DQJA 2UWEB 1G7JB 1B88A 4OLXH 3O6ML 3C60C 3QI9D 2HT2D 3EJJX 4PJAF 5CILL 5EIVA 4CADA 5B3JF 5I9QC 5B8CC 3ZE1F 3LKQB 1WEJL 2EH8L 2VXVH 1OY3B 4GG6A 3HC0A 2OL3A 2ORBL 3LPFA 3FT2A 1BQLH 4Y1AE 4JN2A 4ZPTA 3V4VH 4DQOL 1QHOA 3ZTJG 3SGJA 1KF9B 4PD4K 4HK0A 3BT2L 1A1MA 2VDPL 1OD7A 1FNGB 3T3PF 1T5XA 4APQC 4JRYB 4U49A 5SX5K 4YHIA 3Q5TA 4TSAH 4Y5XC 5IEHA 3MRJB 5DRNA 3W0WA 1RZFH 2R29H 1T0MA 4PJEB 3U4AA 2Z9TA 3KDMA 4P2RA 3MXWL 2OS7A 2GJJA 3VGDA 4MCYB 2ESVE 4JM2B 3QA3B 1RVFL 1LP9A 2DICA 2EIDA 5ACZB 5CLTA 3T0EB 3V95A 4KI1A 2NY1B 2FX9L 4LHUA 2DIJA 3O3EB 3V6ZB 1MAMH 5A2JH 2CRMA 3BEVB 1LO4H 1XH3A 4ZO6A 2Y36L 3MLVH 3IJSB 2QSQA 4PGBA 4QRPA 1Q9LB 5ALBL 3PV7A 4YX2H 3VFGL 5ITBH 1RJZB 4QGYA 1JN6B 1BLNB 1A21A 1WIUA 3WJJA 5K9QI 3MYJA 2CDFA 2H32A 5JXAL 2J2ZA 3EYSH 3BQUA 3OWEA 4LKCA 1KLFA 4NQEA 3OAUH 5SV4A 4R3SB 1JGDA 5F1SA 4JCMA 1TITA 5T1LB 5F7LB 1I7UB 4Y19B 1YEKL 4ZXBA 2YPLE 2DMKA 3OBAA 5JW3L 4G42A 1LO2L 4KFZC 3MLXL 5EBGA 5GS2D 5T5FH 2UZXB 2BVQB 1KELL 2NZ9D 5LXGH 4NZTH 2YK1H 1QP1A 5L7XH 1U0QA 4IHOB 4IRSB 3QUZA 4MD4A 4JM2C 2HT4C 3QDJA 4XPHH 2HG5A 1PEZA 1LEIB 1QUNA 3QDME 4MAUH 1OT2A 4LVHC 4U7SA 4AENB 5D7JB 4AIZA 3FFDA 1NKRA 2E5EA 4RGOH 3RWIB 4PJGF 4MJ5B 3L95A 2IJ0C 4EBQL 1BJ1H 4KK9D 4ELMF 3C6SB 5F7KC 2GSIB 2Q20A 1BZ9B 4K9EC 3AXLB 3GSUB 5J89A 5BV7H 1P84J 1QR1B 4NKDA 1I7TA 2AEWA 4UDTA 1NAMB 3C8KA 4X7SH 4QTHB 1DFBL 4QOKD 3TO4D 5HJ3A 1U8KB 1NC2D 3BE1H 5IJKA 5IF0A 2ZG1A 2DF3A 5FB8B 1RU9L 4DWHA 3KS0H 1N0LA 5DHVA 3GK8L 3WV0A 3HB3D 4NQCD 4PJXE 5CSZB 2HVJA 2CXKA 2X4NB 4DAGL 1E4WH 1BJMA 5M95B 3M1BA 3C08H 4IRSC 5CJOH 4GRMA 1IQWH 1RPQA 3F6IA 2ADIB 4LLWA 5AD0A 4ZTOH 4KGJA 3NCMA 4N1HB 1KB5L 4A2LA 4JO3L 1KB9J 4I2XA 4KVCH 1IL1A 4X9BA 2KZWA 4NQXB 5JA9A 2IANA 2V7NB 1KEML 1IM9D 3G08A 4M1CC 1CICD 2BZDA 4LOUD 4Q9QH 2DTSA 3RX7A 5MERA 1TENA 4M5YH 4P9ML 2A9ML 2VUYA 3TT3L 3JWDC 4I77L 4N8VG 4XNUH 3LZFL 4ZS6D 3FO2A 4ODWB 1BAFH 3FCTB 1JL8A 5F7DB 3QP3A 5FYKD 1EXUB 4O2FA 3E6FA 4Z0XB 2Q86A 4YJZL 3AY4A 2HT3D 3W39A 1FYHB 4ZO8A 4QHLB 4CBPA 4PJBB 4EIGB 4OF8A 1GH7A 3KHQA 2N7AA 1EGJL 5C07E 2Q3ZA 1CU4H 2LFGA 4JPKH 3B9DA 4PJDF 5J6GA 1X9QA 5JHDE 4UTAH 1Q0XL 3T77B 1ZA6B 4F37K 1FG2B 2Z8WC 2YUXA 3DX9A 1LD9B 2BVOB 4KV5F 3VXRE 2D4FA 4XH2A 4KWUA 2XTJD 4XP4L 1JTOA 4BUGA 1HWGB 1JPTL 5E2UL 3UJTH 4NM4H 5C9KA 3MNZA 3BXNB 3STBA 4FQCL 2GTWA 2G5BB 1HQRB 5F6IB 1JHLL 5JHLH 1FH5L 2Z8SA 5KAQF 3GI8L 1UC6A 4L4VD 4I9WD 1W72B 2FNBA 4L4JA 4ACPA 2CRYA 4DZ8B 5I2IA 2XV6B 4PJ7E 4YUEH 2V5SA 4X6BB 3U4BH 1S7TB 2FJFB 5MENA 4OIAA 1CGSH 3ARPA 1RZJL 4PJBF 3CFCL 1QKZL 4XPFH 1MNUL 3EHBC 4L29B 3GBMH 3MBXL 2O61B 3WFCL 1F42A 4Y2DB 2CQVA 4DTGH 3QG6B 1WFOA 4LSVH 1EJOH 2VDRH 3MV9A 2QSVA 3F58H 4G8FB 3H7BB 4KDTA 2VLLA 2WBKA 1CFSA 3MA9H 1W0WB 3DO7A 3DVFA 2VXVL 3HZKB 1FVCA 1J7VR 1CR9H 3R06B 1JE6A 2JTDA 3FN3A 3FONB 4FQ1L 5KSAC 1BQLL 2EDRA 2A6IA 3DVGB 3MRGB 5BRZD 1VACA 2LAGB 4NN5C 4UZGA 2H41A 3V4VL 3NFSH 3SDCD 1NFDE 1JWUA 4D9RD 1DCLA 2JJWA 2APWA 1MCKA 3RPIB 3T0BA 1JI2A 1FN4B 5HDBF 5HYEA 4UNTA 5C6TL 5IB3B 5F89A 4I13B 4PJFF 3DHJA 4JREC 3VGHA 5FGBC 3VXQA 5E8OB 1RZFL 2R29L 4OZHA 2I24N 4OB5H 2R1YB 4GG8A 1EERB 1MEXH 5ABDE 2NY3B 2BK8A 5CSGA 1FBIH 1T1WA 1PYWB 3MBEC 1U3YA 4NZJA 2A83A 4Y2DC 3QFJB 3QNXA 1I9IH 3BWAB 3KXFA 4MLIA 1IQDB 1E4XI 5I8KH 2ZCLH 4Y16B 1X4YA 1MAML 1FFRA 1WAAF 1LO4L 4U1JA 3WHXA 3MLVL 4YX2L 5ITBL 1XIWB 5HGAB 4AQ1B 2R2HB 3VCLA 5IB4A 4GQ9H 1DDHA 5AUMA 4QHUA 4UDUB 3PABA 3KPMA 5F6HJ 1GOFA 1ZV5A 4PB9H 4H88H 3D0VB 5FYJE 2J5LC 4OLYH 5EUKA 2M26A 1FNLA 1BX2B 5EBLB 4ZYKA 5HHQB 1W8NA 3X14B 3OKEA 1ED3A 2XG4A 5C7XH 1FYTE 2EDJA 3ECBB 4ZNEA 5FGRA 2YXFA 3TBYA 3N1FC 5FA4B 5IBUG 3QISA 2BP3A 5DJZB 1KCSH 3I3BA 3S6CA 1D5MB 3ZKMD 3RWFB 2EEDA 1WC7A 1R5VB 3GGWA 4K3JH 4NZTL 1C08A 2YK1L 4MJ2A 4P5TD 1SBBA 5AYUH 3KLDA 4EIZC 5TQ2H 1U8QA 1B0RB 5D5MB 3LQAC 1FCGA 4XPHL 3LEYH 4LNRA 4OZ4A 1KIQB 4RGOL 4QRRE 3MUZ1 5C0DA 8CGTA 2P24B 4LLAA 4N8VA 4KJYA 2EYTA 3F7YB 5D1QD 1VCAA 4D0BB 4Y4KD 3UXFA 3EFDH 5SX5H 1IM3B 4FQXA 3VXSE 5BV7L 4HZAA 1YN7B 3BAEH 1QFWH 3LN4A 3BN9C 1OTTD 2YRZA 3OKLB 3SJVD 2VH5H 4WU5B 3F5WB 1KTRL 4X7SL 3TJHD 2OQJB 1P9MA 3MRBB 3ES6A 1J86A 4YPGB 4PBWD 4X6CA 3BE1L 4IIQB 5DO2C 1I7RA 1UVQB 4DZBB 1G7HA 4Z77B 1X5GA 1OTSC 2EIZA 4X5XB 4QRPE 1QSED 4DVBB 1KIRB 4F7TB 1FFQA 3HAEA 2ADJB 1T2JA 1B2WH 1I3RA 3AC0A 3UDWA 3LCYA 5FM4A 3RWCA 4XVTH 3C08L 1BBDL 4JVWA 5LGJA 3U30B 5F9DC 4M1GH 4MYWB 5FDWB 4LQ1A 1HHKA 5CJOL 5CIPB 1IQWL 4ZTOL 3BPCB 1TZHB 5LAXA 4U1LB 4JZJA 4KVCL 2V2TB 5C0BB 3GO1L 4OD1H 4KH2A 5JUEH 4XB7A 5IT2H 4R7NA 4X9GA 4WEBL 4XNUL 1A7RH 1DBMH 3W2DH 1BAFL 3S4SB 2WLZA 3Q2CA 3S88L 1X5IA 4MJID 4XVUD 1QA9A 1IM9B 4Q0XH 4IIQC 3O2DA 2F53B 2MQ3A 2F74B 2EO1A 3ARRA 5T1MB 3H9SE 4MDIA 5E6ID 2GJZB 3CPLA 6FABH 3RDTB 1CU4L 3EYUH 3GM8A 2F5AH 4JPKL 3UTTE 5EDXA 1C5DA 5DD3H 4URTB 4UTAL 1CE1H 3I6GB 5IEKA 2PTVA 3VFUA 1NLDL 3MRRA 2BOBA 1IGJA 1FVDB 4GSDH 2YUVA 4HS6B 1QSFB 4NN6C 5I1DB 5D7IA 2BSRA 1K4CA 2DIBA 3TA3C 2YA2A 4NM4L 4YIQB 1AXIB 3OZ9H 4L8SB 3RKDC 3DPBA 4HLJA 3ARFD 4P23A 1ROWA 4PJ9A 1WBYB 4EI5D 5C09E 5DC9B 2APFA 3BOVA 2MQCA 1OWWA 2A74B 5JHLL 4YFEA 3GMQA 4PRDA 5IK3A 4N0FA 3WFZA 4JFDB 5CD5D 2FO4B 5F88B 1WIOA 4BSWA 3U6RB 1H9VA 1SJEA 2GUOB 5DURD 2Y07H 4YUEL 3U4BL 3VXMD 4ZOBA 1CGSL 4WFED 4XPFL 4W68A 4YXLH 4LCWD 2VITB 3HI5H 4P48A 5T33H 2I07A 3WDJA 4CGTA 1I1RA 3DMMD 3IXTB 4NUJA 2M8XA 1ZLUK 3ME0A 4L4VB 2AERT 4DTGL 2Z91B 5EU6E 3BJ91 3RWHA 2N4IA 2VDRL 3UZEA 2YD7A 4J1UB 2BY0A 4KRPB 5BS0E 1HILA 5ICXB 3BKJL 1N6UA 2RFXB 2ZKHH 3MA9L 3K4DA 1T66C 4LLDA 1ZOXA 4WJ5A 4YDJB 4POZD 1NEZB 4MQTB 5DFTA 2FEDD 1LVEA 2HLFD 2RHEA 3G6AA 2HFFA 2VLJB 5A2FA 1YEEH 1ZSDB 4NRZB 4KTYA 4L8SC 5DJ0A 4WUUD 3GB7A 3NFSL 3OG6B 3O8XB 3T4YB 4PJCA 4LDOB 3CH1A 3G04B 3FOLB 3QZWG 2X9WA 4JQVA 3DUSA 1BVKA 4YEEA 4NQSB 5GSVB 3MLUH 2ZG3A 4MNQA 2GAZB 2BVTA 1AXSA 5L0QB 4K71B 3SN6N 2F54A 4XVSH 4EQ2A 2ICCA 4YGVB 3GEWB 1JF1B 3PWNB 2ICWJ 3MRKA 4OB5L 1YNKH 5ISZD 3SQBA 4ETQA 1FBIL 5KSBB 4HKZB 2EYSB 3VXTA 1KENL 4UV4L 4J8RB 5IBLC 4C59B 4CJ1A 3OR7A 5JZ7D 4QGTA 4O2CB 2MCPL 5GGVL 4U1KA 5ESAA 1RJYB 1EEYB 5DDHB 3EO0B 4ZFOA 3ZL4H 5I8KL 1BD2D 4KRPC 2ZCLL 1JWMA 1XCTA 3QXDA 4Y5YB 2EO9A 3RQ3A 5I1LA 2JCCA 3L7FA 1PGRB 5SX4H 3ORJA 1E27A 1B0WA 1BP3B 1PKQA 4GQ9L 3W9DA 4Z18A 2AS5M 2IBZY 5E5RB 2ADGB 4NPYA 3OKDA 4H88L 3PHOB 1T0NA 4OLYL 1AHWC 5I8OH 4G43B 4PJ5B 4XAKE 3AGVA 2Q7YB 4GAYA 4JFED 4U3HA 4LPXA 4W6WB 1TTUA 2NY5H 3MLWH 4Q6IA 4XHJC 1ZWIB 5C7XL 1GL4B 5DHYA 3QWOA 2BMKA 1A5FH 4NRXA 4K71C 3ULSA 1T21A 3VXNA 1KCSL 1N0XH 4HAFA 4K3JL 2YEZB 5C0FB 1T0PB 3OXSB 3DIFB 1G6RH 5AYUL 2XQYK 5TQ2L 4OQTA 5DJ8B 2E6PA 5GGSY 3LEYL 4BZYA 4OZGB 5TE4H 4TUKL 3DVNA 5EC2B 3L3DA 1I1AD 1RZ7H 4GRWB 3NAAH 1UQSB 4P5TB 3GMOB 4Y5YC 3C5ZC 1MCCA 1RUKH 4YHKH 1J11A 3EFDL 3EOBA 4U1SB 1J12A 4XNYH 3LOWA 4JQXA 3C9NB 1SJVA 1QFWL 1D9KC 1CXIA 2VH5L 1EUTA 1YY9C 2M2DA 2H3NB 5INCB 4QHNB 5D1QB 3IFPB 4FRWA 3DX7B 1CDJA 1R5IB 5J12C 4Q6YA 4U6HB 5I1IH 3BD3A 5IW1A 4Z7NE 3GSNB 1CQKA 2VQTA 2P5WD 4ODHH 5MHSE 5LKNA 3D1MC 2CKBB 3RZCD 1C12A 3U9UB 1B2WL 2J1KA 2QQKH 3LS4H 4MNHA 4ZOAA 4KI5E 4XVTL 3T1WA 3ULUF 1UEMA 4P4RA 3ZT6A 3QUMA 5D6DA 1M05A 4OZGF 3UBXI 3FO0H 4HV8B 2OYPA 5EU7C 2EEBA 5GGTA 2X4UA 3CFBA 5F1IA 3U36A 1VENA 2XICA 4OD1L 2V6HA 4QNPE 5C0NC 3O9WA 2R39A 5JUEL 5BZWB 2ERJB 5F72S 2YPVH 2AV1B 3GUTB 4OI7A 3WIHH 5IT2L 3MACH 4TVPD 2N1KA 5C0JA 1DBML 1LGVA 3ZO0A 1FGVL 1ONQA 2XIDA 3JSSA 3W2DL 2EDYA 2NX5B 2FATH 5T3XH 5JLZA 5LCVH 1RUQH 3VGBA 2ED9A 3W0WD 3N85H 4Q0XL 1F8TL 1D6EB 4F7EB 2IQAB 2J8UE 3HE6A 4P2RD 5CD3A 2CLRB 3TBVB 2DQUH 3DV4A 3EYUL 1WFNA 2F5AL 4BA8A 2BCKA 4XBGB 4F58H 4LHUD 4HKBB 1CE1L 4MJIB 4PJIE 3D2UA 4I8DA 3IDMA 3P3YA 1IC5H 4NHUB 1FV1A 5HHPB 2CIKA 3V5HB 3PGDB 2CR3A 1NC4A 2FJGB 2AK4A 1J8KA 5C6WH 3B9KA 3EOYG 1IC4H 3OZ9L 3BQUD 5JMRA 4KKLD 3U4EB 4NQED 5HTSA 2ERJC 3Q6FB 5DJYA 3HR6A 2OR8A 4U7MA 1BFTA 4ZXBD 2DQJL 5EO1B 3LRSB 2CXGA 2Y07L 4Y4FC 4NBZB 5IVXB 3BP6B 3GMMA 3N1MC 3JWDH 4BFBD 1KN4H 1AGCA 1EIBA 4D3CH 4OIIL 1NAMH 4WVRA 4RZCA 5IVZA 1IGCH 4YR6A 4N0YL 4DGYH 4CMHB 2ZKHL 3OJVC 1U3HC 1IGTB 3Q48A 5HGDB 5I1AB 4I0CC 1QRNA 4QXUH 3SO3B 1II4E 4XPTL 3HUJB 5C0EB 3VE0B 1YEEL 2NW2B 4D0CB 1E28B 2GFBB 4JFOA 1MCQA 1U9KA 4XZUB 4NM8H 2XWTA 1C7SA 1RZGB 3ILQD 3RNKA 1ORQA 4L9DA 4F2MB 2JK5A 1FJ1A 3WFEH 4I0KA 4Y5VC 2ZSWA 1VADB 3MLUL 1G7MA 2A38A 2VXSH 3ULVD 4DCQB 4XVSL 1UWGH 1IGFH 4WUUB 1P6FA 1DE4B 3CAFA 2XN9A 4LBEA 3QHZL 4L3EE 5I74B 3A6BH 1DQML 4XPGH 1YNKL 2EDLA 1CK0H 4FHBD 3U46A 4Z7QF 1OGTB 5EU5A 3V5KA 4G6JH 2P8LB 3EDEA 3BKCH 4R96A 3ZL4L 1JK8A 4CMHC 2IAND 1AGFA 1JNHB 2BHYA 1A1NB 5C86A 3G5VA 4J3TA 3MRQB 1J5OL 3O4OB 3MTRA 3HUJF 4JY4A 4P49A 3KPRA 4JFQA 1XGUA 4R2GB 3VMNA 4G7VH 4OGYH 3SO3C 5ID1A 1MCIA 4GFTB 5E5MA 2EDWA 2P5EE 1KB5A 4Q2ZB 3ZMRA 1QR4A 2HAZA 5HYIA 3TFKD 1RIHL 5GRYA 4PLOB 4YFLF 3ZSSA 4DVRH 5I8OL 4Z95H 32C2A 5BVPH 5HPMA 1DBAH 2NY5L 3MLWL 4BFEA 5CP3A 3TZVA 4RA0C 1GAFH 3TNNB 3MO1B 1H5BA 1ZLUH 1MFEH 4R4NC 3WNNA 1ND0B 3A6CH 3FTGA 2E7MA 4F57H 1EV2E 2X4SA 4N0CD 3PV6A 1L0XA 5EZJB 5FF6B 5I74C 1G6RL 4LPVA 2VQ1B 4K7FB 1R3JA 3ROLA 4KKBC 2JELL 4JFEB 4QT5B 3CK0H 4LASH 3QIUB 1W72H 1ITCA 2L7JA 5B39G 1EGJA 1B6UA 3DX8A 4PRHA 1DUZA 3OKKB 4FQIH 2LVEA 1RZ7L 3HE7A 1RUMH 2EDQA 4JY6A 3NAAL 1N2RA 4GBXD 1BQSA 4ODUB 4G6FB 1UXWA 3BPOC 3O4OC 1RUKL 4NC1E 3BO8A 3VFOB 4ISVB 3VFNB 1SY6H 4R2GC 2I9LB 4XNYL 1YUHB 5K9OA 1N5AA 2GYSA 3Q3GA 5JPNB 1HXYB 1TZIA 1XZ0A 3KAAA 2X70B 3MV7E 5IWLA 2DI8A 4HEME 3X11A 4LPYA 5MEND 3LEXA 3MCKB 2GK2A 1ZMYA 2NYYD 2AV7B 3E3QC 2Z35A 1JPST 1HINL 5EC1B 5I1IL 5FXCH 1QBLH 2GJ6E 1EHNA 2W60A 4ODHL 1MCPH 2DRUA 4P5MB 1NGXA 2WP3T 3MJ9A 4LEXH 2QQKL 3LS4L 5HHMD 3IS1X 5HYQA 4Y2OA 1GIGH 1JWSA 3BI9X 3MV9D 4YDKH 1KIPA 1X7QB 5FK9A 4GW5B 3BGMA 3FO0L 4HZLA 5JR1H 1R3LA 1SEBA 5DK0B 5FYLE 4N9OB 3BISA 4HCRL 1UB6A 1GRWA 3RZCB 1I1FB 4KAQH 1NGZB 1FZOA 2FIKA 2YPVL 3O45B 4HIXH 2BSTA 3G9VA 3WIHL 3MACL 1ITBB 5DD6A 1QFHA 1TPXB 1PVHA 1BFOA 3VWJB 2IH3A 3EYQC 2CGRH 3P40A 1YEJH 2XWBA 4N8CL 4QHKJ 1B4RA 1FFPA 1ZS8B 2BNRA 2CLVB 2FX7L 4HK3J 2MJWA 2FATL 5T3XL 3EJZC 1RUQL 1T3FB 3N85L 4H8WC 4AH2B 1IGYA 5D71L 3IDIB 2VO5A 4XCFH 2DQUL 3ARBB 5F1NB 4HFWA 3DROB 3K1DA 2EDTA 4MAYB 2Y7QA 4F58L 4P99A 4PLJC 5DVOA 4JRXB 4P3WA 4KTEH 4N90E 4A6YB 3VFPB 4NFDA 1IC5L 3LY6A 5JOFA 3CX5K 4L8CB 1ZGLB 3D39E 3FB7A 2XI9A 1IC4L 3T08A 2XQBH 3H9YA 4JQIH 5AZ2H 3VD7A 2EKSB 2Z31A 2VXQL 4WNQA 3U7AA 1OGAA 3O3UN 4GG6F 4OZIE 3VWJC 4IMLB 1TJHH 4HUMB 4LCCB 2R2BA 1G9MC 1QO3B 1A7NH 5LBSH 4JO4H 2EKJA 5DMKA 3WLBB 1PQZB 5HXMA 1DQQB 4YWGH 3OGOE 1RV6X 2PYEA 3MCLH 1INDH 1UXSA 1KN4L 1H3GA 3MUGB 4D3CL 1Z3GH 2OK0H 1NAML 3ARBC 4MXVF 4UU9A 2NTFA 1IGCL 3TO2B 4Z8FH 5DEZA 2BVPB 1U58A 1NCAH 1PDKA 3FN0H 1N7MH 3Q5YA 3CDCA 2ITCA 5DI8B 2HLAA 1J8HB 3UPCA 1KEGH 2AXGB 5F8RC 1LP9F 5FUZH 5CINL 3MLRH 4EKXA 4QXUL 2IEPA 3GSOA 4CN4A 2QADC 2O26U 3CUPA 4FQXD 4J3VA 1RK0B 3BDXA 2DWDA 3GI9H 4NM8L 4TYUA 1T7VA 3ROOA 4EOWH 3CMGA 2UYLB 4UIKH 3SE3C 1HYSC 1PJ9A 3WFEL 3DX6A 3OKNB 4ZUVA 5DLMH 3WEXB 4HH9A 2IADA 4Z7VA 2VR4A 2WSKA 4PP2B 4PTTB 2C4FU 1NSNH 2VXSL 3ARED 3QDGA 3STZA 3RI5F 3VH8A 2KKQA 1UWGL 4TTDD 3REWB 2QKIB 1BZ7A 3QR2A 3A6BL 4GXUM 4XPGL 5GGRA 5B39A 1SMAA 1CK0L 3GSRA 4OQ1A 4LVNB 2OLDA 3UTSB 4DFHA 2F15A 1BVZA 1J18A 3F7PC 4U6XB 2QEJA 1KLGB 4KK6D 4YK4B 5DYOA 4HWEH 5E08L 3DI2B 4G8GE 3RX5A 2Y9RT 2AW2A 2V2XB 4ENEC 1KTLA 1MCJA 5D93B 4ZODA 5L2KA 4WTXA 3V6OA 4OGZA 1O0VA 5IM7A 3WFDH 1V3MA 1BEYH 4G7VL 1ZHKB 4OGYL 5F7UA 4E0RB 1VHPA 2CSPA 2X4QB 1K85A 2ZOLA 3I75B 4NNPH 5SWSB 1T83A 1TTGA 3DURB 2MMXA 4DVRL 4Z95L 5BVPL 3RUGE 2H9GB 1OT1A 3HNTH 5CP7B 3T0WA 1TCMA 1GAFL 1F3JA 4M8QA 5C0AD 1MFEL 1JMXA 4HBCH 3A6CL 2ICWI 4F57L 1CXHA 2HJLB 3L3JA 3F7VA 3MV01 1CGTA 4J4PA 2DWEB 5EOCH 3HA0A 3CK0L 4YK4C 2W38A 4LASL 3ULVF 3TH4T 1IKFH 5JW4M 3VI3E 1QZ1A 1MCRA 1J1OH 4FQIL 4MMZC 4WV1A 5D93C 1RUML 2YR3A 1T20B 1M71A 4PJ9D 5H35A 3MRIB 3VFMA 4FTVE 1SY6L 3AS0A 1XF4A 3O6FA 2OTWA 5J1AA 4LCYA 4JKKA 4L8DB 2ARWA 4HUUB 1A6TA 2BNQD 4AIOA 1AGDA 3T2NL 3L5XH 4GBXB 4JFFB 5J11B 4ZFFB 3KJ4C 3OTTA 3JWOH 4AJ0A 4O9HL 2VABA 2DQDH 4V1DB 1RUPH 1MCPL 5E00A 2PCPA 1IVLA 3ARVA 3PDOB 4LEXL 4M93B 3SPVA 3MZGB 1GIGL 1I75A 5HYJB 4HWZA 4PJHB 1MCSA 3TCXA 3HI6H 3HR5B 4TNWF 3T3MF 5KOMC 5JR1L 4LNVA 2AXFA 2D9CA 3PGFH 5FEBA 2YPKB 4MS8C 1XF3A 2VE6B 4MD0A 1KCUL 4KAQL 3GJFB 1UG9A 4U6YA 3MROA 4HIXL 1BPVA 1U95B 1F11A 4OLEA 4PP1D 3SKOB 1U8HB 3SKJH 2ARJA 2CGRL 4MNQD 1YEJL 1QEWA 3B5TA 1IBGH 2YD9A 3VJ6A 2DQCL 3HZYA 5KTEL 1ZHLA 2F54D 1CZ8H 4HLZH 1DANT 3CSYA 1P2CA 3WS3A 2VDQH 1CGVA 5T3ZD 1ZE3C 3IDJB 3ZE2F 1KJ3H 3P4MA 5FV2A 3B8SA 5I75B 3ZHLA 3NCYS 1KJMA 4QHMA 4XCFL 5DXWA 4IBLT 5EO0A 5CEZE 4XXCA 4M93C 3O3BB 5IHBA 1FLRH 5F7MC 4KTEL 1CYGA 1M6OB 4HIIB 2AABH 2EC8A 2DAVA 3WJLA 1K4DA 1BZQK 4LSPL 4EUPH 5KS9E 4PRIB 4NFCA 2MKWA 2PW1A 1LE5A 1H3VA 2Z0BA 5CJXC 5EU3B 4YDVB 2XQBL 5EORH 5D2LB 3ULUH 3AAZB 2NNAB 4ZAKA 4JO1H 4ZUTB 3QQ4A 4XXDB 5I1JL 4XCYB 3FQTA 2B4CC 2NXZD 3TCLB 1YPZE 4M00A 1TJHL 3UTQB 5LBSL 4JLRA 4JO4L 5J6HB 4F7MA 1QTYT 3MCLL 3V6FA 1I9JH 2YUZA 4RQQB 3EKCA 5I75C 3P4NB 5HGGS 3P9MA 3KLAA 4LFHG 3RFZC 3HLAB 4JPWH 2MHAA 3P77B 1QLFA 4Z8FL 4W4NA 1GZPA 3I2CH 5GGUA 5DJAB 1NCAL 3VD5A 2Q1EA 3FN0L 4U6TA 4N5UA 1WBZB 4OZHF 3NPZB 2BC4A 1R0AH 2IAMB 4F33B 1IEAB 5TFSH 3S96A 1KEGL 3GSNH 1NUDA 5FUZL 2BXZA 2FR4A 2W07A 3MLRL 2CKBH 1G9NC 4S1QH 3K4ZA 1SJHB 4WEUD 3VFRB 4MQXD 5FO8B 5D2LF 3RI5K 4GW4A 4IRJA 3HMXL 3GI9L 3QIBB 1F13A 1H15B 2FD6H 2XRAH 1R24B 2X6MA 4UIKL 4E41B 3C6LA 5DLML 5JQ6H 3W11D 4TSCH 2CO6B 2G60H 2YZ8A 2JIXA 5F7EH 3QEQE 1NSNL 1J0JA 4GLRI 5D1XA 3TIEB 4WFFD 1S7RB 4HKXB 2I60H 3BW9B 3MYZA 4X4XA 5BMFH 5GGSB 1F3DH 2VKWA 3C2SA 5EUOB 2VLME 1E6JH 2IGFL 1EAJA 4QLRA 1JVKA 1OGAE 4HWEL 4EXKA 2FH6A 1S5IH 4HIEB 3AREB 2FYYA 1U2HA 3K81A 5EBWB 35C8H 3RJDA 5IB2B 1I9RH 4HXBL 1U8MB 3GSVA 3V0VA 1BM3H 3L3KA 2IAMC 3WFDL 2Q8BH 2DYPA 4XNMA 5F71A 5K59F 1IZJA 1AO7E 5GIRA 5GZOD 2VMFA 4NYLA 1D5XB 3FB8B 1GC1H 4NNPL 4U2YA 1CFTB 5CWSA 5K33A 4KRNA 3QIBC 1FVEA 4NN7B 4QRQA 1WJ3A 1F3RB 4IS6A 3WIFA 3VW3H 4RNRA 4KDWA 4JFXA 2ITDA 1PFCA 3HE6D 4BH7B 1OB1A 4HBCL 3HI1A 3K4AA 3C2AL 5FKPA 5GSRB 3IGAA 2SEBB 3MOAL 5I8EB 3X12A 5DTFA 4X6CF 1UM4H 3D2UD 4JDVA 5C0GB 1J0KA 2XACC 4Z7WA 1ZHNB 2FECI 4JGMA 3BRFA 1IKFL 4P3CH 4X80L 1HHGB 2AEQH 4CL7A 3CH8A 4HULB 4DN3L 4P5KB 3E6HB 5C0AB 1NC4D 1J1OL 3UPRB 2AK4D 2IQ9H 5KN5A 3B9KD 4S1DC 4X6DE 2MFNA 4M3KB 1YNLL 3T8XB 1A2YB 3FQNB 2QSCH 1OAZH 4WI4A 4HUWB 3BUYB 1OOAA 1F02I 5GRJH 1L0YA 2GT9A 2OXHA 3UZQA 2NZ9C 1ZVHA 3VFVA 4NSKA 4NN7C 4HMEA 1CFQB 1BFVH 2VERN 1AXTH 3L5XL 2H8PA 1NGYA 4YQXH 3V6OE 3JWOL 4UT7L 4TNWK 3QPQC 4EZMA 4KJWC 1JPFA 3CXHJ 2DQDL 1AJ7H 3IB4A 1RUPL 1S7UB 4Z78A 1UB5A 5C71A 4XMKH 4JG1H 2BNQB 2RCSH 5DMYA 1PG7L 5DMGC 4YHLH 2IPKA 3HI6L 4MXQC 5FO7A 3IRZA 4LPWA 1A64A 2E7HA 5SWQA 1SQ2N 1QRND 3VRLE 1UZ8B 1YEHH 1FPTH 3LMJH 2V5MA 2Z92B 5HY9B 3TO4C 1H3TA 1NDGB 4X6EB 3QXWA 1NCDH 2BERA 1T1YA 4N0UA 3FJTA 3VWKD 1QLRA 1VGKA 4WW1A 3LRHA 4MNGB 5ETUA 5MEPA 3SKJL 3KYNB 3STLA 1N3NA 3KYOB 3HB3C 2A6KA 3I6KA 2VXUL 5A2KH 3MRMB 1CD8A 1MFDH 1XGRA 1KUMA 1CZ8L 1JZ3A 4WW2A 4X7EC 5IB1A 1IAKB 3U0PA 1XR8A 3VXOB 2JB6A 2XN9D 2VDQL 5E1HB 3RU8H 4HDIA 2PR4H 1KJ3L 5E9DE 5E94A 3NN8A 3D0LA 1LE9A 3JTTB 1YY8B 1C16B 3GJFK 4LEOA 3TBWA 2DKSA 1DEEB 5B4MC 2DKMA 3ZHKA 1FLRL 1BJ8A 2Y5TB 2AABL 5HHOA 5DD1H 3DBXA 2B0SH 3KPRD 5CBEA 1AGEB 1NDMB 2Y6SD 3HG1B 3KPSE 4OBSA 1T7YA 4XWOC 1ZT7A 3O11A 3OR6B 3BD4A 5EORL 3U1SL 3NCYP 3WUWB 3IDUA 3UZVB 5BZDA 3ULUL 4NQDD 4LLQA 1CI5A 4JO1L 3N50A 4QHKI 5CLWA 1HCVA 2NR6D 2EDHA 4ELKA 4B7IA 4I4WB 4M8VA 3V7AG 3QCVH 4WFHE 3K80A 2XNAB 5I6XB 3C60A 3IDYB 1ZLWK 4PJCF 5B8CA 4HJGA 3ZHDA 1TTFA 4PJAA 3UJJH 2Q76B 1I9JL 3BH9A 3D69B 1I1CA 3OAZK 2VNCA 2NXZB 2Y72A 1CDGA 1DQJA 4IRZH 4ZSOE 4LMQE 3I2CL 1LQSR 2WWMC 4PRHD 2VLKD 2VDMH 3L3OB 4H8WH 3HE7D 1YMME 4R8WH 1G6RA 1R0AL 4F7CB 3BVNB 5TFSL 5DRZB 3GSNL 4OD2B 4PYGA 4M7LT 1JZ4A 1ZT4A 4OLUH 4LIQE 2CKBL 3IDNA 4S1QL 3FRUB 4B5EA 1A6UH 4E42B 3EJYC 3BP7B 2DI7A 2FD6L 2XRAL 4XRCA 4YC2B 5KAQG 2JCCF 3MODH 2OTUA 2W0FB 4M7ZB 5JQ6L 1CD1A 1KT2A 5BCAA 4OGAC 1CFNA 2G60L 2C3GA 4LARH 3K3QA 2UWEA 4CDHA 1G7JA 2I27N 4XCEB 3U48A 2A9NH 5I6XC 3IDYC 2FWOB 1ZEAH 4JKMA 4KXZH 1L0QA 3LKQA 5BMFL 2DLFH 5IBTH 1E6JL 3ARDB 1WQVT 3IFLH 5CFHA 5IW6B 4IDJH 2KUTA 2NY0D 3PQYB 1S5IL 4JPVH 4KROD 35C8L 1I9RL 5J8OA 4PRPE 1BM3L 1FNGA 3WNKA 4JRYA 2HP4A 3I3DA 1MF2H 4K94H 2UVEA 2BSSB 1Q0YL 1PG7W 4CDGC 3MRJA 4Y1AB 1GC1L 3D3VE 1OPGL 1CFBA 2BNRD 3GMPB 4PJEA 3CFEB 3VG0L 4A6YH 2C3XA 4YC2C 4U0RB 2ENYA 4RCAA 4FFVD 4MCYA 3SDXE 3BZFB 4JM2A 3OL2A 3MRDB 3QA3A 4M7ZC 3VW3L 3WIHA 3FQRB 3MUJA 3FO9B 3PP4H 3BSZH 5ACZA 2ZG2A 3T0EA 5L6YH 4HW6A 3MJ7B 5DF0A 2F5BH 2YA0A 3QUYB 1VEMA 1WTGT 3O3EA 3LEVH 3JV6B 3V6ZA 3FB6B 1RZ8B 3BEVA 1P1ZB 3IJSA 3KPPB 1UM4L 1Q9LA 4ODTH 5KANG 2D9QB 5DWUH 1RJZA 1FFNB 4XC3L 2ESVB 1JN6A 3I3EA 1BLNA 3FMGL 3ARDC 2QQQA 4BZ1H 1YEDB 4P3CL 2H32H 2AEQL 2EE2A 4YHYC 4R3SA 5DZLA 1T04B 2IQ9L 5T1LA 4JFHD 3T2PA 4UUJB 1I7UA 4GT7A 4Y19A 2C1OB 4QXTB 3UEZA 4CVUA 4M1DL 2DLIA 2IF7A 2EXWD 2B5IB 2FGWH 2Z31D 1OAZL 1QBBA 3QXTA 3BDYH 4PR5B 2W65B 2PETA 3NIGF 5GRJL 2BVQA 4XCNB 4MA7H 3OB8A 1F4XH 4DKEL 4Y4HC 4QF1B 4IHOA 4IRSA 1BFVL 4OAWB 1AXTL 4GOSA 3GSQB 1LEIA 2PYED 2YPLB 4AENA 3ARYA 5D7JA 5TDOB 5CGMA 3PHQB 3RWIA 3QUYC 1A7OH 4MJ5A 3G5ZB 4BM7A 2EIBA 2NY4B 3WN5B 1RK1B 5GGQH 5BOPA 5IMMB 4XMKL 3V8CA 3RVXD 4JG1L 2RCSL 4LLMA 3C6SA 2GSIA 4YHLL 2AK1L 1BZ9A 3LKOB 3F62A 3AXLA 3GSUA 1QR1A 5MI0B 5JPMB 3QDMB 3ILPB 3LN5B 2VWEE 4YBQD 3JUZA 1NAMA 2XWJB 5AWNH 2QJDA 1YEHL 4QTHA 3LMJL 4NQUA 3MX0A 1ORSB 4HQQL 1WCQA 5FB8A 4GAFB 2E3VA 4HWNA 3B3IB 1TVHB 3ULVH 5CSZA 2NTSP 3BHBB 1LK2B 2X4NA 3IVKB 2JJVA 3QDGD 1MFDL 4K3DH 5FHAL 4YPJA 3MPCA 3PE9A 3EGSB 2LTQB 3VWKB 4N1CA 2ADIA 3RU8L 1MQKH 2PR4L 5HD8D 4NRYB 3QSKB 5JQHC 4OCWH 4NQXA 3BRGC 3P4LA 2P48B 4PJXB 2V7NA 3B5GA 3WN5C 5K9KB 3S9DB 2CR6A 3RL1B 1CT8B 3DO3A 1KG0B 5EWIH 5L2KD 1WZLA 2AJZB 1OAXH 3CX2A 1H3UA 3QYCA 1OLZA 4NDMB 2B0SL 4ODWA 3KPLB 3FCTA 5F7DA 2X4PB 4J12A 4Z0XA 4UOW1 4OSUH 3PWJB 3GKWH 3WFBH 3X3GL 1ZVYA 2AAVA 4QHLA 4PJBA 5E6IC 3V4PH 3E3QE 5GHWH 1BJ1J 3R4DA 5BW7C 1CGXA 4JKLA 3QCVL 1EEZA 3E8UH 1G9EA 4ZFZB 3T77A 1ZA6A 3AU1B 1FG2A 5IESH 3RVVC 4RISH 3R1GH 2LTQC 4BFGA 1LD9A 2BVOA 2COQA 4RGND 4J4PD 4NQDB 4LSTH 4XVJH 1QFPA 4FOMA 4RX4A 1QG3A 1UYWH 5F96H 5C07B 2VYRE 4IRZL 4K07A 1HEZB 3KS0J 4YXKH 3BXNA 2VDML 4HPYH 2EECA 4H8WL 1JPGB 4R8WL 2G5BA 1HQRA 1Y18B 2QV2A 3X3FH 4G5ZL 1BIIB 3VXRB 4OLUL 1W72A 3P11H 3QULB 4DZ8A 2RR3A 3O6FD 1ACZA 1A6UL 2X10A 5FGBA 1N26A 4X6BA 1S7TA 2FJFA 2VDNH 2VLKB 3LKPB 2J6EH 2DM7A 4NNYB 3S4SG 4L29A 4Y89A 1K9TA 1MIML 3G5XB 3FFCE 1U8NB 3REVB 4F8QA 2O61A 2K7QA 5DJXB 5HHOE 1SY6A 3MREB 3VXUE 2IBBA 3DMMC 4LARL 4Y2DA 3QG6A 3RHWF 1WZ1H 4G8FA 2A9NL 3GJFH 3LSOB 3H7BA 4LLVB 4ODSH 4PJ7B 5BS0D 1NANI 1WGOA 1PY9A 3L7EA 2AKRB 4TRPH 1W0WA 3HZKA 1SJXA 1J05B 2DLFL 3R06A 5GRUH 5IBTL 4X4YB 4POZC 1NFIB 4JFZH 4O00A 4RWHA 3FONA 4HT1H 3IFLL 4RMQA 4O4YH 3DVGA 3MRGA 4TUOB 4U1IB 4JPVL 4G9FE 5A40E 2ILLA 3HRZB 2VAJA 4WCYH 1FNSH 4TVPL 5D1ZB 3RPIA 1QBAA 1FN4A 5IB3A 4OCLC 2DMBA 4K94L 5I1HH 3QHFH 4OKVB 3RKPA 2DBLH 4F15B 4XC1H 5DJ6B 2HMIC 5BQ7B 1MRDH 3KPNB 2WUBH 5F7WC 3N0PB 5E8OA 3PDDA 1LILA 3VXPB 2R1YA 4A6YL 1NFDB 4MA1C 4I18C 3CCHB 2KL6A 3PXJA 1KPVB 1PYWA 3PP4L 4K8RC 3BSZL 3OAZH 3UJIL 2JJTC 5L6YL 3QFJA 3T3PE 3BWAA 4PJ7F 1RZKC 4HUXB 1IQDA 1NBVH 2AJYL 4AG4H 3LEVL 4Y16A 3O4LE 5I17B 2XZQH 1ACYH 2BFVH 5AAMA 3SDAB 4ODTL 1XIWA 5DWUL 5HGAA 2R2HA 1X6NA 1G0YR 4BZ1L 2APBA 1BIHA 1IC7H 4UDUA 1MCNA 2ED7A 4AEIH 3D0VA 1NEZG 5IFAH 4JY5H 1RI8A 2OJEB 1BX2A 5EBLA 1MI5E 5HHQA 3X14A 5D1ZC 3DUUB 4HPOH 2FGWL 3ECBA 5JDSB 5D8JL 3WHE0 3BDYL 4ZAKD 5FA4A 4DGVH 5DJZA 1D5MA 4MA7L 3RWFA 1R5VA 1GOGA 1A4KB 1HHIB 4FFZH 1B0RA 2V7HB 3IFOB 5D5MA 4AZ8A 4FABL 4NNXB 4FQ2H 4C56E 1FYTB 4DN4H 1MCDA 2EE3A 1KIQA 1JRHH 2FL5B 5C0RH 3C5JB 2P24A 1A7OL 2Q8AH 1WZMA 5GGQL 3ETBF 3F7YA 1EX0A 5GRZA 3N06B 1D5BB 2NXYB 2VC2L 3DRTB 3SDAC 4D0BA 3IAPA 1H3PH 2DQEH 5DR5L 2HWZH 4X4ME 1IM3A 4HAGA 1MVFA 4R9HA 1YN7A 5CJQH 4HLZG 4Z0BH 1HKFA 3OKLA 4QRRB 5AWNL 3RGHA 4WU5A 3F5WA 4RBPK 1WUNT 5KZCB 2OQJA 4BQCA 5FM5O 3MRBA 4YPGA 1R3KB 4PJGE 3T1FB 4IIQA 1FZMB 1UVQA 4DZBA 4Z77A 4X5XA 3ZKXB 1INQB 4WHTB 2BY1A 4DVBA 4ELME 3ULVL 1KIRA 4K3EH 4F7TA 3VXSB 4BQ8A 1URLA 4EN3C 2ADJA 2JIXD 4RAHA 2CDGB 5D1XD 2DMCA 3MOBH 5GJTH 4K3DL 4EUPG 4JRWA 1FHGA 2VISB 5FDWA 3SE9L 5CIPA 2VZTA 1MQKL 5DEFB 4CVXB 1TZHA 2VUOA 4U1LA 3ESUF 3JUYA 2V2TA 2WBWB 5C0BA 5K93A 4BK5A 3IETB 2E7BA 4CJ0A 1AQDB 3NA4A 2NXYC 3WUZA 4WWID 5DRXB 3C87A 5EWIL 3J7HA 4KKAC 2DYPD 3QEUB 4MXWH 2R1XB 3S4SA 3NTCH 5CZVH 1IM9A 1XF5B 4NCDA 4OSUL 3QQ3B 4ONHB 3ARTA 3GKWL 1V3KA 3DXAE 2F53A 4LSRH 1KNOB 2F74A 5T1MA 3ZKXC 3VFTB 2AQ2A 2GJZA 4G6AC 4X6FB 5ELIA 3V4PL 5GHWL 3RDTA 1OAKH 5EU4B 4PD4J 5EIQA 4HS8H 4WI9A 3RVWC 4RAUB 3E8UL 2WP3O 3I6GA 5L88H 1Y0LB 5IESL 4RISL 1P4IH 3R1GL 3OKMB 1FVDA 3NCBB 4LSTL 4XVJL 1AP2B 1QSFA 4HS6A 3H9SB 2R9HC 8FABB 4JO2H 1DBJH 4Z7VF 5I1DA 1UYWL 2PF6A 1QVOB 4AYFA 4YIQA 4L8SA 4FMKA 3WJJC 3UTTB 1AR1C 3UAJC 1Q1JH 3MXVH 1A7QH 1WBYA 2VN7A 4YXKL 4HPYL 4X7DC 4PJDE 2A74A 2Y1VA 1IEHA 4M6MH 4OIBA 4JFDA 4PG2C 3SDDB 2FO4A 5F88A 3P11L 2CK0L 4CU6A 3U6RA 4OFDA 2GUOA 3RHWK 5D7LE 2E9IA 2H26B 2O5XH 4CNIB 4HIHB 1TJIH 2VDNL 5F1KC 2J8OA 2J6EL 3F8UB 4XNXH 4TN9A 2HA1A 5C09B 3LVEA 1V7MH 1FORL 5I1EH 3D87B 2VITA 3QUZC 4NZDA 4K23L 1F6AB 3MV8E 2C7UB 3IXTA 1CBVH 4OJFH 4L4VA 4W4OC 2Z91A 2PTUA 1S5HB 1WZ1L 2DLHA 4LSSL 4J1UA 5ICXA 4ODSL 2RFXA 5IIEB 4TRPL 3UYPA 4YDJA 4XPAH 1NEZA 5GRUL 5JA8B 3D85B 5CHNB 4JFZL 2VLJA 4HT1L 4PJBE 5E8EB 1ZSDA 3HPLB 4NRZA 4O4YL 2VLRE 2ZJSH 3ZZ1A 5EU6B 1PX3A 3O8XA 5E99L 3T4YA 2DM2A 4H5SB 3G04A 3UTZB 5BS0B 3FOLA 1FNSL 4PRNB 3DECA 1MUJB 1BWWA 4UINH 4NQSA 5GSVA 1BQUA 2GAZA 5F9JB 5I1HL 3QHFL 2VSCA 2YD2A 3SDDC 3TVMB 1EVTC 2DBLL 3I6LE 3A67H 4XC1L 2WMPA 3GFUA 2ATPB 3VDCA 2WUBL 4YGVA 1FAKT 4HC1A 1JF1A 3PWNA 4OM0L 3PIQB 2XOTA 1M7DB 3QDAA 1LEKB 4KPHH 2E7LA 3EYFB 5T3ZH 5J1SC 3FKUS 1HH6B 4LFHD 3S37X 1HH9B 5KSBA 1KYOK 2WAHA 4HKZA 2EYSA 4J8RA 4O2CA 1RJYA 1EEYA 5DDHA 5H2BB 3EO0A 4RMSA 5IGXH 1NBVL 1OL0A 1JV5B 1BGXH 3HKFA 3DLQR 4HMCA 3GSXB 2B1AH 2A0LD 2DLTA 4KZEH 4PJFE 2XZQL 4Y5YA 3MR9B 5E7FA 1CLYH 1YDPB 2WIIB 3MA7B 1ACYL 1NBZB 3DNKA 2BFVL 3QFDB 3UROR 2BRRH 1IC7L 3L1OH 2ADGA 4AEIL 1B6DA 3PHOA 4O5LH 5IFAL 4JY5L 2OSLB 5GS0H 2D0FA 4G43A 4PJ5A 3S36X 1C8PA 2D7MA 2Q7YA 2X09A 1DQLL 1A3QA 4HPOL 1ZWIA 5FM5M 3AY4C 1P4BH 3MUHL 3TVMC 1WAAE 1O7SA 1ZKAA 4K7PL 1EUUA 2QBWA 4P4KB 2YEZA 5C0FA 3V52H 3OXSA 3DIFA 4PV9B 3C60D 5DJ8A 3R0NA 4YDLB 3QPXH 4YLQT 3JVGA 3EUUA 4FQ2L 4OZGA 5E8DH 1JRHL 3R8QA 5C0RL 5A2IH 5ADPH 5EC2A 2Q8AL 3H3PL 4XPBH 2QSTA 4P5TA 1UQSA 4NZUH 3GMOA 5F44A 5IMKB 1BQHB 1WT5C 3I85A 1H3PL 2DQEL 3D25B 1H8NA 3PUCA 5TDNB 2HWZL 1U8OB 4U1SA 4APQD 3C9NA 5I16B 4Z0BL 4M61B 1CIUA 3P0GB 1K8DB 2H3NA 3AMLA 4MDJB 5INCA 1NCBH 4QHNA 5D1QA 3IFPA 3DX7A 4ZPVB 1FNHA 1R5IA 1ADQH 4U6HA 1JNJA 5KSVB 3GSNA 4K3EL 5BOZG 3MGTB 1BF8A 3DGGB 4M48H 4M4RA 5I18H 5B3NA 2CKBA 3RJQB 3U9UA 4P4KC 1V3LA 5CGYC 3MOBL 1KPUB 1T1XB 4M03A 4YDLC 4HV8A 1MRCH 5CKAA 1IEBB 2PTTB 3BKYH 1S9VB 5J7CC 5CKGA 4PTUB 3QRFM 2X1XR 3IF1B 5BZWA 3GUTA 1CTNA 2AV1A 7CGTA 1T7WA 4D8PB 2CK2A 3SO5A 2ADFL 2C9AA 2MPAH 4HWBH 4JRYD 2GQHA 1IT9H 4MXWL 1UACH 5C8JB 3HCVB 3U9PH 3NTCL 5CZVL 4Q9RL 4JKPH 2NX5A 1MCOH 1FO0B 4FQHB 4P0DA 1EFXB 2VRAA 1LMKA 4P59H 1D6EA 2XY2A 4F7EA 2IQAA 1X5XA 2VL5B 1HHJB 2CLRA 4JM2D 2HT4D 1ZA3B 1N8ZB 1OAKL 3TH3T 5GGRY 3DV6B 4HS8L 3QUXB 4M7KH 2ZWLT 4BELD 1RURH 4XBGA 4HKBA 4MJIA 2C3VB 5JOPD 3QXUA 5L88L 3L5JA 2PKDA 1P4IL 2J88H 5E2VH 5T3XD 1AKJB 1HXMB 4IMKC 2J8UB 4NHUA 4Z7NF 5HHPA 5I66B 3V5HA 4JG0L 3PGDA 4JO2L 1M7IB 2FJGA 3CZFB 5GJSH 2B39A 4XNZB 5I8CB 4RBPH 1Q1JL 3MXVL 3U4EA 1A7QL 4PJIB 4KI5C 5T1LD 4QOKE 2HJFB 3Q6FA 3VGAB 1V5JA 2IMMA 3VMPA 3CVIL 4Y19D 1O5DT 3M17B 4M6ML 1S7QB 3SKUD 5EO1A 4M43H 3E1F1 3LRSA 2P1YA 1WLHA 1OCWH 4IDLA 5I0DA 2GITB 4MB3A 1GCFA 4NQCE 5E1AB 2O5XL 1TJIL 1UEYA 5IVXA 3BP6A 4I3RH 2CUHA 3UCRA 1BOGB 5KVFH 1LDPH 1T03H 1V7ML 5EB9A 5F7HA 4IRSD 5I1EL 3EFFB 1ZTXH 1EBAA 5L9DH 5L2JB 3LHPH 4ODBD 2YSSB 1YEFL 3QUXC 2ID5A 4P3DB 5BXFB 4Z7UE 5DFVC 4DJMA 5TGBB 5JO5B 5HVWA 2C3HA 1Q9OB 4M1CD 4EJ1C 1IGTA 4XPAL 5HGDA 1RHHB 5I1AA 4FFWC 1JYXA 1P7HL 5C0EA 3HUJA 3L3HB 5JOEA 3VE0A 2NW2A 4D0CA 1E28A 2GFBA 4XNZC 2ZJSL 3EOTH 4FQXC 4PJIF 4TSBL 4XZUA 5DZOA 5FYKE 1RZGA 3VGAC 1DEDA 4F2MA 3T65B 2UV3A 4Z7WF 2X1QA 1VADA 2WK2A 5I76B 3MQIA 3A67L 3PWVB 4DCQA 1J0HA 1J1XH 4WUUA 1DE4A 3VGEA 2XT1B 4KPHL 1A6AB 3T2QA 3SKNB 1OGTA 5T3ZL 1XF2B 5INDB 2DBJA 2P8LA 2E9WA 1IGJB 4KK6C 4PV8A 4KKCD 2XTJE 1TZGH 5IGXL 4G9DB 1BGXL 1JNHA 1A1NA 2B1AL 4KZEL 4I3GA 1CLYL 4L3EB 3BJLA 3MRQA 5E2TH 2VJXA 3HS0B 3JTSB 1XGYL 3IT8D 4UTBL 2BRRL 1J88A 3L1OL 3H0TB 4D0DB 3BWUC 5IFJB 4Q2ZA 3MFFB 4XX1G 4O5LL 5JXEA 1SHMA 4L4VE 4I9WE 5GS0L 2O5YH 5EOTB 4BK4A 2IFGA 1H0DB 1UJ3B 1Q8MA 3GIVB 3WDHA 3EHBD 3TNNA 3PP3K 1IRAY 3MMEB 4HX1B 5FCSH 1HKLH 2WANA 4GRLB 3MO1A 1E4KA 3ZTNH 2HTLC 3T0XA 2P5EB 1MCWM 2ZNWA 3V52L 3ZKNC 1U8PB 5EZJA 1E4JA 1EA9C 2B2XH 5A3IC 4K7FA 4PBXA 4JFEA 4QT5A 4OQTL 1V8HA 3QPXL 5EOQH 4L3CB 1JNLH 2NY6B 3QIUA 3RWDB 5E8DL 4RX4D 5HPOA 3LQZB 1JTPA 5KSAD 3OKKA 4ETYA 1KPRB 4XPBL 2HTKC 3RPKA 5BRZE 4NZUL 4ODUA 3Q6GH 3I50H 4P23C 4S1RH 5GGVY 4D9RE 3FL7A 2OX5A 2WINB 2YD8A 5I9QB 4ISVA 5TPWH 3VFNA 3VFOA 4FTVD 2I9LA 2DM3A 1YUHA 4JR9H 5HYSB 3BMVA 5JPNA 1HXYA 2X70A 1GSMA 3LKSB 1NCBL 3SGEH 3ALXA 3MCKA 3G6DH 2DN7A 1UJ3C 1ADQL 3FOMB 5EC1A 1CVRA 4ETQB 1SYVB 1L7IH 4GRLC 4APQB 3WLWC 3MBED 4P5MA 5MEQB 2ZUYA 4M48L 4LMQI 5I18L 4Y2DD 1V05A 4FQLL 1AC0A 3MV7B 3VI4F 1MFCH 4Y5XB 1X7QA 4ZFOB 4GW5A 1DL7H 2EICA 5T5NF 1YN6B 3O3AB 2NY6C 1MRCL 5DEGB 5DK0A 5GGTL 3BKYL 5J56B 1S78C 2GJ6B 1HSBB 3RZCA 1YQ2A 2ZNXA 1I1FA 1NGZA 2AJ3B 3G6JF 1J87A 3O45A 4G8IB 4BKLB 1OLLA 4U1GC 2KDGA 2MPAL 4HWBL 1YEIH 3DTXB 3RY6C 3VWJA 1IT9L 4LF3B 1VFAB 3U9PL 1C5CH 1ZS8A 2CLVA 5JW5A 4LPTA 1MCOL 3U7WH 1TCRB 3RNQB 1T3FA 4P59L 1D5ZB 1FL5A 1RFDH 4JDTH 4YZFF 4NC1C 4KRMB 3T0AA 3NFPB 4AH2A 4OGXH 4AL8H 2NY3D 3IDIA 4ZS7H 5DJ2B 1VDGA 4LL9A 1D5IH 3ARBA 5F1NA 3S3SA 4EDXB 3ESVF 4UI2A 3DROA 4M7KL 2E6QA 1AD0B 4MAYA 3QFJD 1RURL 4HH8A 3HMWH 5FUCC 4JRXA 1HZHH 4Y16D 4A6YA 3VFPA 2J88L 2R2EB 5FHBH 5E2VL 3LD8B 2D2OA 3AB0C 3RVTD 1XIWD 4L8CA 1ZGLA 2YD4A 2VOTA 2BSED 2UWEF 3HNVH 5GJSL 3WMSA 4LVHB 3TYFB 1TETH 4N9GB 3RY5A 1GYAA 1QACA 3BN9D 4NKMB 3SJVE 4P2QD 2BVUA 2EKSA 3MJ6A 1VA9A 4XTRC 5CJ5A 1OTSD 4Q6IC 4CMMB 4M43L 3ZDXE 3D39B 4IMLA 4OLZH 1OCWL 1QSEE 4LCCA 1QO3A 1JYVA 3WLBA 1PQZA 5ALCH 1DQQA 4I3RL 3WO4B 5KVFL 4D9LH 1LDPL 1T03L 1X5ZA 4GKNB 3H6JA 3H42H 3MUGA 1ZTXL 5L9DL 1S9WB 1OP9A 5JMOC 2B1HH 3CFJB 1P7QB 3LHPL 2VR9A 4OZIB 3TO2A 2BVPA 4FNLH 3OMZA 3U36B 1QFWI 4PYHA 4PJEF 1I3UA 2C1PB 5DI8A 1X6LA 1J8HA 2H2PD 4M3JA 3LD8C 4JM2F 5E03A 2B20A 5ILTH 2AXGA 4F9PA 4MA3B 4HXAH 5C9JB 3CSGA 3EOTL 1E6OH 1RK0A 4JQXC 4MQXC 2IG2H 5H94B 2P49B 1EVUA 3VDAA 5TJWK 3M45A 2XXMB 3H2WA 2UYLA 4CU8A 3OHXB 3MC0A 3OKNA 4GS7B 3WEXA 4PP2A 3BIKB 4PTTA 4J7RA 2F19H 3JBG7 1NQBA 1J1XL 3REWA 3QG7H 2QKIA 3NOIA 1SEQH 1Z9OA 5F93C 3WO4C 4JDZB 2OXGA 3UTSA 4TTGA 4U6XA 4OZIF 3QO0B 1KLGA 1JHTB 5I73C 5D6DC 3VFSB 4CVWA 5DQ9B 3OB0H 2LV4A 4OZFB 3T0VA 4JFPB 3S35X 1QFWM 2V2XA 3CDFA 5C0BD 3QZWB 1YJDC 2VIRB 4DUWA 5E2TL 3SE8L 3O9WC 1KSRA 3QEHB 3I9GH 1ZHKA 4E0RA 4WU7B 2X4QA 3I75A 3S5LB 4G8GB 5SWSA 3KLHC 1VFMA 4KK8C 4M6AA 5CGTA 3DURA 3BRDA 1X5JA 1WWAX 1CCZA 4NO2B 2O5YL 4WFGD 4J3WA 2H9GA 2P8MA 2FO1A 5KG9B 3VXME 5CP7A 4GS7C 3TIDB 4YHNB 5D9SB 3BUTA 2A73B 2F53D 2IALB 4R0LB 4WFEE 1HKLL 4FXKB 3GDBA 4LCWE 3ZTNL 4M62H 3RDTD 3U0TB 1Z5LB 1UZ6E 3O41B 2HJLA 1OVZA 1P5VA 3QCUH 4L9LB 2B2XL 2DWEA 4OTXH 1MSPA 3RUGB 2JF1A 5EOQL 2ICEB 1JNLL 1QSFD 4XI5C 4LP4A 1Z0MA 4NZRH 3VG9C 1SBSH 3B9KC 1T20A 1A22B 3Q6GL 4S1RL 1PZ5B 3MRIA 1R3IL 5TPWL 3HAEG 5SWZD 4WWKB 4JR9L 5GS1B 4JFDD 4L8DA 4B50A 3OAYK 4HUUA 4L4TD 5KSAB 4GAJH 4LPUA 4TUJB 4NN5B 1CDBA 4F9LC 5TE6H 4GBXA 4JFFA 4OFIA 4ZFFA 5IHZB 5E5UB 3G6DL 4R0LC 5ISZE 1FDLH 5I1CH 4FTVB 1L7IL 1MREH 3AMKA 4V1DA 2YD3A 3L5WB 1PG7X 1G7LB 1PY4A 3PDOA 1UKSA 4L9LC 3MOQA 3MJ9L 4YXHH 4JREB 3MRNB 5HYJA 3VA6A 1W8OA 1X5AA 4KRPD 1ZLSH 1BD2E 2J6EA 4PJHA 3IAQA 3HR5A 4M9OA 4YHZH 1U93B 2XG5A 4PRBB 3MBEB 1X5KA 2VLJD 2YPKA 5EH1A 5CJXA 1UM6H 2E6JA 2VE6A 4GXUN 1VEPA 3GJFA 5FECB 3O8XD 5D2NE 4OLXL 4MHHG 2MKLC 1U95A 2ZOKB 1EMTH 3SKOA 1U8HA 3PP3H 4WWKC 3SY0B 1YEIL 4XHJD 4I48B 5GS1C 1K5NB 3ZTJH 5H37H 43C9B 1OARH 1C5CL 2YMXH 1CXFA 4JJ5B 4D9QD 2P7TB 3U7WL 2G9HB 5ACLA 2FRGP 2J5LB 2YRLA 3FT3B 2ENSA 1M7XA 1RFDL 4JDTL 4WDIB 3IDJA 1JZ5A 4OGXL 4AL8L 3BZEB 4ZS7L 1TVDA 2VAAB 3QO1B 5SX4I 1D5IL 3GMNB 1QRKA 4Z5RB 3O3BA 3HMWL 4TSAL 4TULH 1HZHL 4HJ0C 2EC9T 4HIIA 4MCZB 5FHBL 5C0CD 5DQDH 2DDQH 4PRIA 3HNVL 1KN2H 5EU3A 4POYA 1ZHBB 2R4RH 12E8H 1TETL 4YDVA 1D9KD 1YY9D 5D2LA 2IWGA 3LV3B 4PJ5D 3AAZA 4XP6H 4ZUTA 5JW4N 4XXDA 4XCYA 4Z76B 2AVGA 4XT1C 5IHUH 1AIFB 3TCLA 3VFWB 2NR6C 5KS9B 1F6FB 3TZVC 4OLZL 1BHGA 3TLRA 3UTQA 3VDBA 4L1DA 2P5WE 3EYSL 1JZ8A 5ALCL 5J6HA 2R1WB 3OAUL 4P2QB 3BGAA 2RGSA 4D9LL 2VL4A 2IH1B 4RQQA 3P4NA 2B1HL 3ULUD 3HLAA 3F7RA 3IAGC 1QFUH 1YPZB 3BZDA 3P77A 4N0RA 4LLUB 5DJAA 5T5FL 3OX8B 4GG6E 1WBZA 2H1PH 4X98B 4UV7H 5F21B 5LXGL 4LRNH 2DQHH 2IAMA 4F33A 5C0ND 1IEAA 5L7XL 2YD1A 3LQMA 5ILTL 3ALWA 3X13B 3FQUB 4TVPE 4H26B 1SJHA 4LQFH 4HXAL 1FAIH 1T89C 2P44B 4MAUL 3VFRA 5FO8A 1BFOB 1F2QA 2IG2L 1FE8H 1NGPH 3QIBA 3WIIH 1H15A 3CZJA 3TM6A 4U1HB 1R24A 4M7JH 4EDWH 4E41A 3W0WE 4UNVA 4CW1B 5IMLB 1CGYA 1DSFH 3H7LA 4P2RE 5F7FA 2F19L 2XTLA 1A3RH 3OG4B 3TIEA 1LP9E 1S7RA 4U3XA 4PS4H 3QG7L 1SEQL 4HKXA 3BW9A 3D18B 1P69B 5GGSA 1NMBH 5ICZB 3OJMB 4BH8B 3VA2C 3ZT7A 5EUOA 1S8DB 2YN3A 5EPMB 1UH2A 1RZJC 2FHFA 3AS2A 1IZKA 3L6FB 1HHHB 3PWPD 3QEQB 4HIEA 3AREA 1CE6B 1FO0H 5EBWA 5IB2A 3A0OA 1U8MA 1YNTB 3ZYZA 1LO0H 3B2VH 5ANMB 1FL6B 1E4WL 3SCMB 4NQEE 5D5MF 2NY2B 3I9GL 4L3AA 3BMWA 4NN6B 1D5XA 3FB8A 1Q9KB 1MJUH 1CFTA 3VRJB 3TA3B 3RTQB 2NX5D 4B41A 5DMKB 5D70H 4Q9QL 4KK5C 4M5YL 4ESKA 1JMZA 4YHOH 4BH7A 1AO7B 3QNYB 3RA7H 3QDJE 5C3LD 5DSCB 5GSRA 1WFTA 3QCUL 2SEBA 2BVYA 5I8EA 4S1SH 3TWCH 7FABH 1FIEA 5C0GA 2QHLA 3NIDF 4OTXL 4HFUH 3MRHB 1ZHNA 3MRPB 3CC5B 2V5YA 2DLEA 1HHGA 2ZUXA 5TQ0H 4P5KA 3E6HA 5C0AA 3IDGB 4XP9H 3UPRA 3KHOA 1SBSL 3QJHB 5DMIH 4H25B 3MZTA 3SCMC 1EAPB 5GS3A 2NY2C 1MPAH 3T8XA 1A2YA 3FQNA 1N5YH 1NH6A 1CD9B 4HUWA 3BUYA 1BFSA 4RMWA 1VB9A 2GCYB 1F3DJ 1X5YA 4WTWA 4OV5B 3ULVE 4KGLA 3RTQC 3OXRB 3UJTL 1CFQA 3CX5J 5TE6L 5DZNA 4X6DB 3SHSA 5FOJA 2CMRH 3MNVB 5CCKH 1FDLL 4LVEA 2B7DT 2EDKA 3CMOH 5I1CL 2AI0H 5SWZB 1MREL 4WEMB 2IMNA 2J7LA