5BO0D

Crystal structure of human mcm2 hbd and asf1b chaperoning a histone h3.2-h4 dimer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
154
structure length
154
Chain Sequence
MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/dna binding protein
molecule keywords Histone H3.2
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 5bo0D00
1WG3A 1TEYA 5C3IA 2YGVA 4RRPM 5BNXD 4EO5A 2DZEA 2HUEA 5EIIG 2IO5A 2IIJA 1ROCA 2I32A 2CU9A 2Z34A 3AADB 4ZBJA 2IDCA 5BO0D 2Z3FA
chains in the Genus database with same CATH superfamily
1GH7A 4R7LA 1YMMA 4P23B 3AB0C 3I84A 1FVEA 3K7UA 4LCYA 4UTAH 3PWPD 1A02N 2XG4A 1AIFA 1FPTL 1VAHA 3O8XC 4R5TA 2QFRA 3FT9A 2VLKE 1IGYB 2FQEA 1NOFA 4FI6A 4LVOC 4NN6B 1ZLUK 3ZDZB 5JXEA 1ACYL 1AYOA 2H6PB 3BWUC 4LLUA 3QUZC 2VDRB 1BGXL 2X40A 3PWPA 5CGTA 3INUL 1KCSL 5D93C 1NBCA 1XCTA 3GS7A 4IRZL 4NKMA 4S1SH 2XTJC 5KVFE 4BXVA 4W93A 3O4LD 2OZNA 1PFOA 4YHPB 4HCRH 4F3FA 3OMNB 5C6WH 2K6ZA 1Y6KR 3EYFB 3QRGL 2ED8A 3RJDA 1C8QA 2F5AL 2JCWA 3SOBH 3T0WA 3ME0B 1HZKA 1JXFA 3PWJA 1N18A 3AT8A 4YDLC 1EGJA 4ANUA 2UX6A 3AREB 4RNRA 2E7BA 4MMYA 4N2NA 4PV8B 2M8XA 2UZPA 4JVUA 5F9DC 3LH8A 3SQOH 4DVBB 3QNXA 2WQAA 3FN9A 4OFDA 3SE9L 4OZ4B 5C7XH 3IS0X 1OAQL 2XV3A 3S7GA 4BSVB 1JWSA 3IWUA 2VZ3A 4G11A 2WJ5A 2XN9B 3DLQR 2WO3B 3QWOB 1BAGA 3SDCA 4AQEA 3U25A 1QEWA 3TBYA 4PJEA 2BPBA 4Z6AT 3PJNA 1DSFL 4N20A 1CFSA 5ILTH 1S7QA 2ZNXA 4NUQA 3TJEH 4PRIE 1EZSA 3FTVA 4U1KA 3KYKH 1JTPA 2JFCA 4L29B 4PJIE 5TQ0H 4LSVL 5PCYA 1NL0H 2N7BA 3OXSB 3K71B 1X5LA 3FTZA 4HUXB 3JXAA 2ZXCA 2WZ6A 3IGAB 3PHQA 2RQEA 4W6WB 4J3OH 3AZUA 3SDCC 1KMGA 5AAPA 2A6IB 3NSXA 1FLRL 3JT0A 4Z7WE 1O7VA 2AQPA 3MBXL 2EAEA 2JI1A 2X2HA 4GSDL 2R0LL 4YSDA 5KYWB 1Z9OA 5DJYB 2E7LA 1R17A 1LMIA 2ZXGA 3H42H 3LEXA 4KK9D 3R7RA 4OZIB 2Y9RT 4WWKA 2WBXA 1H5BB 3NCYS 2HVKB 4MA7H 4K3GA 3U7WL 2XY2A 3H53A 2MNJB 4MQ7B 1KLUB 2HB0A 5EULV 2IBGA 3NQIA 1I1CA 4F7TA 2Q3ZA 2C9PA 4MNGE 1VEPA 2ATPA 4BM7A 3P54A 2A9ML 3DA0A 2K3HA 5DVLA 5L6YL 4Z7UB 4HUVA 3S34L 5L9DH 2E7LC 1KJ2A 3SKJL 1ZWIB 3GHBH 1KSRA 5HD8D 4QRUB 4WWKC 1RUAL 4K5MA 3WNPA 3KCWA 4FQCL 3UG4A 3D25B 1VERA 3LNFA 2MNWA 4FQXD 4KK9C 5D2LA 2EDHA 4U0RB 5E5MB 5CCJA 4TYUA 3WKQA 3QDGB 4KI1A 1H19A 4K07A 4M4RA 3ZDYB 2MTPA 3LN5A 3WKML 3KJ6L 3QEUA 2X4RA 5EBLB 4DO6A 3LKPB 5I74B 4KO5A 5LVEA 4MA3B 1CTMA 4GSXA 4JANB 3FULA 3LN9A 3PDDA 4XC3H 2DV6A 3A4FA 4XX1G 1CWVA 4RISH 3BSGA 4OLXH 4NQVA 5T1MA 4XBPA 1E5CA 3PUUA 5F3BA 4KVCL 4DKFH 4XC1L 4LSRL 3WO4C 5DQ9A 2MOVA 2UWEE 3ISYA 4HXBL 5D1XE 1T20A 1LD9A 3ZIYA 1OE2A 5T3XE 4Z77B 1BQLL 3KGRA 3CTTA 4O02B 1FFQA 3V4VH 1QRND 4PJ5B 2YA0A 3WNOA 2F5BL 3QXAB 4XX5A 4P2OD 3WE1A 1QR4A 3LS4H 2YPLB 3WKNA 2FCBA 4P2QB 4LKXB 4YLCA 1OT1A 4XRCA 4W6XB 2Z34A 3D0AA 1AC0A 1QRNA 2WKOA 3FRUA 4XNMA 4OR1A 3FB6B 3NABH 1BAFH 4E9SA 4UV7H 1I3VA 2V5RA 1NGPL 5KAQG 3B9DA 3BAIA 2WLLB 3WNJA 3TYFA 5AW3B 1OCZB 5IV2A 4TPRL 1MCHA 4PY7B 4ZOBA 2Y5EA 2YD0A 1WICA 4RGNE 4WK2B 3PV7A 4OJCA 3OZ9L 5LCVL 4P99A 5I6XB 1JHKH 4D94A 4UV4L 2F53A 5ABDE 4EE2A 2ZJSH 1FNAA 4WK0B 2VXUL 1MFDL 1HINH 3KYOA 1TLMA 5G5DA 3VCLA 1F6LL 2V9UA 1L9MA 4PJ7F 5J89A 4OD3H 3BGFC 4XN1A 5DQJB 3LS5L 2P8PA 3C8HA 2ZQKA 3ZL4H 3EDFA 3I3BA 1GAFH 3NACH 3QJFA 1KPRB 4JJ5B 1DLHB 4JFHE 1TU2B 4H8WH 2NXZB 2IMMA 1I8KA 2K78A 3NJXA 3ZZQA 4YHLL 4LP4A 2P46B 4UTBH 3K3QA 3R1GH 5DZ9A 4Z3FA 3JZ7A 4NQDE 1I9IH 1PKQA 1W80A 3CZLA 1TTFA 5TH2B 5DRXB 3TBSA 4G6JL 4Y9EA 3MAWA 4FFZH 2WQ8A 2XWJB 3G04B 3WGVB 5I1AA 5ELIA 2CRIA 2HG5B 4IRSD 4R7XA 3WTUA 4IBSA 3ECQA 1G7PB 4RZKA 3TS8A 5J56B 2G3XA 1NEZA 1IQDA 5FHAL 4BZ2L 4TQEH 4K2UH 1VEMA 1MFMA 5F1NA 3BVVA 3F83A 4GAJH 4LIQH 4IRSA 4MD5B 3C60D 2L8AA 3QIUD 2FX8L 4JKWA 4PRPD 3AUWB 4Y89A 3RWDB 3TEXA 3B9AA 4LCIL 3ZDXE 4OCWH 4C83A 5CLWA 1CFQB 3FU7B 3PQYB 5ESQB 4AQOA 4UMSA 3M7FB 5DUML 5DD6B 4WF7A 2YS4A 5LN4A 3ZW3A 3AWFA 3JT2A 4JG1H 5DVNA 5DZNA 4UANA 4A2MA 2VH5H 4IRSC 4YQXH 1FHGA 1GZPB 4ZFGL 4O2FA 1G43A 4EOWL 3CHXA 4GT7A 1AXSB 4TVPE 2XQYK 2IPKA 2QHRL 3ARGD 3C60C 3QIUC 4KJPC 4C57C 5D1QE 4WI0B 3HHMA 3DROA 5GGSY 1ZK5A 2BVTA 3TNMB 4QRPE 3EOTH 4U1IA 4DW2H 1BXVA 1UD6A 1NUFA 2C9UA 3L1GA 4NJ9H 1YHPA 3NA9L 3LRKA 4L2LA 4OZFH 4JB9L 3PGDB 1XH1A 1LEGB 2Y2TA 1T2QH 3MA7B 4L4TB 4ZUSA 4KH9A 1DN0A 5FO9B 2IXQB 4PJDF 2P5EE 4FQJL 4PB9H 5A2LH 2AJSH 2B1AH 3MROA 3Q5OA 4M00A 2UXGA 1FFOA 4TSCL 4Q9CA 5LWYH 2ZCLL 4N24A 3DOIA 1RQ5A 2VQ1B 1U8OB 3QHFL 1MNNA 4XPTH 4QAMB 2A1WL 3VFVB 1F2XK 1EXHA 1SXAA 4JCMA 1REIA 2VUOA 1PLAA 4FQQA 1LP9F 4FKEA 1V05A 3WDHA 3US0A 4LBEB 3C9NA 3HRPA 1YJDL 2B14A 3H2QA 3U2JA 3WFHB 3X1BA 4Y2OB 5INCA 1R9FA 1D3CA 3IWVA 3L3HA 1CGTA 1KC5H 2Z8RA 3PHSA 4JG5A 1XB8A 4YDVA 1CGYA 2NYYD 1ID5I 4XMUA 2EYSB 4ZPTB 3LKNA 4JRFA 1G4RA 3V9CA 3ZMRA 1JTTA 3FTXA 4W9IC 4FQHA 4PCSA 5A6MA 3ZPDA 2MQCA 4L3ED 3TV3H 2C9VA 4RGNB 1MLCA 3QZWB 4F8PA 1AXTH 3ZXAC 2QBWA 4PSPA 2EEAA 3FUMA 5IMLB 2WTOA 4X7TA 3IU4H 4LVHB 4L3EA 4XVTL 3OKKB 4N26A 4AMKL 1GKEA 5E6YA 4NPKA 1IFRA 2BNRB 3CFKA 4TNVF 4H0LC 3TOPA 2GTWA 2ZP0T 3JV0A 3O45A 5D96B 1MI5B 3BEWB 4M8QA 3ZT5A 1MHEB 5EU6A 3H9ZA 1CD1B 2QZQA 5DHVH 4ELMF 2WXHA 5F0LB 1BBJA 3RI5K 3Q1EA 2NX5B 2B59A 2R4SH 3BH9B 2VAJA 3G5WA 2CIIB 2P52A 1JXJA 3IFLL 4AYBA 4A7SA 2HLEB 4UTAA 1CFTB 4A7QA 3OWEA 3IJ9A 4PREB 1G9NL 4UQCA 1E5YA 5DUPL 1A1MA 3UTQB 4PRDA 1EAOA 5AVZB 5AB2A 4L5FE 4AGLA 4XHQA 3MBWA 5DMKB 3TBBA 4YZFF 3FT2A 1RSFA 2FQFA 1CBJA 3NRFA 3ULAB 3BAEL 4Q52A 3KH3A 5JA8B 4A37A 1JS4A 1ZT7A 2MNUA 1G7JA 5C0NC 4PRHE 5G4MA 1BZOA 1FZKB 1INEL 3GBNL 4HUUB 1WF5A 2J8UE 1QBMH 3I9AA 1GPOL 3R7QA 2VMFA 3E6HA 3PDOA 4KXAA 4LLQB 4FXLA 3GMLB 3N9GH 1IGCL 1PG7X 3SE8H 2YR3A 1A14H 2XCMC 3PREA 3I50L 1YEJH 3QDMD 3NFPB 2VIRB 1MRFH 3UMNA 5EEWA 4MNHA 2R0KL 1ZHKB 3KPLB 4LESA 1YEIH 4M5ZL 1Q9LB 3COOA 2GW5A 1IFHL 2E47A 3G5ZB 3LRGA 3M7OA 4G59C 1CE6A 3VB8A 5D1QB 3QDMA 5CILH 1EZVY 5DD1H 1BFSA 1MQ8A 1ILUA 4PGCB 2JIXA 4KTYA 3RWHA 5IM7A 1HQRA 1IBGL 1MFEH 5I0WA 3OJVC 1TQSA 1QACA 2NY6D 4PHZA 4J4PD 4AOFA 2IG2L 3D51A 3MX0B 5FYLL 3CN4A 3TM6A 5IMMA 2HJKB 5AW8B 1A6ZA 1ECYA 5EZJB 4XPGL 4MCNA 2WW8A 2AC0A 1MJ7L 2DWDB 2OTUA 2VERN 4A67A 1QKZL 2NOYA 1RJYA 4JKLA 32C2A 3GLZA 3HN5A 3PP4H 3K6FA 5AOLA 2A6DA 2DB8A 3BP4A 4G6MH 1CLYH 3QIWB 3IJSB 4OF6A 3U4KA 5FYLD 1JNHA 4MJJA 3VI3E 3ZL1A 4ANVA 4HS8L 1PZ2A 3KPRD 3VRJA 2G9KA 4S11A 5FUCE 3GMMA 2E7DA 1SHXA 4AENA 2KH2B 5SX4I 2NY6C 4N0FA 3V9FA 3WIIL 3ASWA 4HUNB 4X9FA 4LP8A 4HIJB 3KPRA 2UXVA 4ODSL 3APFA 1CK0H 1UB5B 2IH1B 1PX4A 1YEKH 2R7EB 4YDMA 4MJ5B 2J5LB 1KYDA 2O5XH 3HPJA 3IJYA 5FIEA 4TUJB 4LLWB 3ZQXA 1YC8A 1RZGA 5CO1A 1ZA6A 3C09B 2F7QA 3JUZA 4PGBA 5LJYH 1EDHA 3CZFA 3WNLA 3D0LA 3MLXL 4BFNA 1KDJA 5E6IA 5C70A 1CDBA 3FQ4A 3U4AA 4FMVA 4ISVB 1IGML 1SRDA 2YD9A 3RWJB 3VDBA 4BKLA 1L6XA 2P8MA 1AKJB 1YMHA 4M9OA 3X3FH 5AD0A 2EICA 4ZOAA 3B5TA 2X4PB 1H6FA 5C71A 1QQDB 2D4DA 3ALXA 2HJFB 1GYAA 1S9XB 4K8RH 4UQ2A 4EMZA 4N1EA 5JPNB 5E6IC 1NCGA 1UWEH 3RRQA 1RURH 1RUPL 2ALWA 1UC6A 4GIPD 5DYFA 1NZRA 3NBNA 3GSNL 4ES8A 5I2IB 3PY9A 2QEJA 2ZKHH 2IAMB 3IE9A 2XQ0A 3FT4A 1RP9A 5D72L 5I76B 3N91A 1NBVH 1XIWB 1THAA 4TUUA 4DP2X 5EPMB 3V4VA 5ICZA 4XOEA 5F7AA 1B2WL 3OHXB 3DBSA 4GG8B 2YA2A 3TYGH 1Q1JH 2ZCHH 2ZF8A 3ULUE 2EDJA 4KPHH 3VXSD 1D5BB 3AGWA 3Q05A 3N55A 1CF8L 4JW3A 4TM9A 4NLHA 2HT2D 3SO3B 4G8EB 4ZOEA 4G80B 3L8QA 3C2SA 2VDNL 3FPXA 5D7SL 3VXSA 4PTUB 2BHUA 2ZG1A 3P3TA 1DBKL 1NC2B 3FU5A 5MENB 2OL3L 1JPGA 4Z5RB 3SYQA 3GIZH 4JDTL 1I7RA 3SODB 4DH2A 4GIOA 2E27H 4FNLH 1NBZB 1DZBA 3GKWL 3K1KC 2AV1B 4Z76B 5FX3A 5ETUB 1HXYA 2ZYHA 1S7RA 1N3NB 5C0DB 1EVTC 3V5HB 3S4SB 4F57L 4NQSB 1NFDE 2I25N 4K0OA 5ACMA 2I26N 3ZKNC 4H26B 3MBED 5IGXL 1WCBA 1IRAY 4RDQF 4MB3A 4KJYA 4JPIA 4GS7C 1KJ3L 3NZ8A 4UTBA 5C07B 1JPSH 5ECJE 3CQFA 4OAWA 2ADJA 4ADJA 5AVRB 1U33A 1NFIB 3MBEA 4AV0A 4Z3IA 2VN6A 4AEIL 3ZE0F 3RUGE 3UJJL 4ACTA 4A7TA 35C8H 4FFZA 5I6NA 2QSVA 1R24A 1KG0A 4ENEC 3MV9D 5IHLB 3RIFF 2X4NB 1IE5A 3FQWA 1PDKA 3ARBD 4EI0A 1ZV5A 2ESVD 1XR9A 2HLAA 2AJUL 2OULB 2QPUA 2H3NB 2JTDA 4H8WC 4P59L 2NY7L 3CVIH 4P9HH 4L1BA 1MCWM 5DRZA 5GGSA 3ULSA 3MV9A 2ZCKL 4U3HA 2WLNA 4X5PA 5GGUB 2YXFA 3MBEC 5T3ZH 3JV5A 3VUAA 1KUMA 3QI9A 3QPKA 1TT6A 1GYCA 4J3OG 4UDTA 1RK0B 1FNSL 2GSIA 4ORGB 4U3SB 4F15B 1J5OL 3OPZL 3KWWA 2R2BA 4NSKB 1SEQL 1TG8A 3OAYH 2WVVB 3C5ZB 2PYFA 5FUZH 3T2LA 1NDMB 4R9HA 2G2NA 2DQHL 4HS3B 3UROR 3UTTE 3ZTJG 4OM0H 5KOMC 3V4PL 3QCUL 4Y88A 3BJLA 3Q0HA 4KX9A 4HCFA 2BK8A 4JCLA 3L95B 3QI9C 1QTYT 5BZZA 3VXME 4OU3A 5J06A 3MTRA 4XCEA 3MJWA 3UBXB 3EYSL 3NESA 3CFMA 1C08A 4GRLD 2YFNA 3RA7L 4PY8J 1E6JL 5HHXL 4JG0L 5JLZB 1A1NB 3RY6A 3LDBC 2CLRA 3IDXL 3ZYJA 3S96A 2CJ3A 5HY9A 5DGRA 2GJ6E 4PJCB 2WKLA 1UB6A 4KNTA 4MQXD 4WFHE 4G7VH 1DQQB 4DFHA 4YDJB 5F7DA 3QXDB 3E0GA 5C0JB 2JB5L 4OZFA 2YFOA 2SEBB 3MJ8A 5DJCA 1RPQA 1WBYB 1T6WA 4OZGF 3CC5A 1K8DB 1KTLB 5EIIG 5LLIC 1AGBA 2PWEA 3FB8B 3RY6C 4X6EB 2V3EA 1G7MA 1MCEA 2EEDA 1EXGA 2X3CA 4GAYA 4N2CA 3QO0A 4FFVC 5FS5A 3JV6A 4JO2H 4MD0A 5CWSB 4QRTB 3CVHH 5GS3A 2NY3B 3BHBA 3KPMA 1OPGL 4AC4A 3T09A 4GG6F 4XMKL 1BD2B 3EF4A 3CDYA 3GMOB 1Y07A 1SOSA 2AVFA 2Q20A 2YGQA 5FO7A 1BQSA 5DHYB 4XTRD 4B5ZA 5HYJB 1YY8B 1SPDA 3QCTL 2QVMA 3A21A 1L7TH 3KNBB 1XB6A 1XO8A 4RSYA 4CU6A 2IQAB 1VKXA 4RMRA 4MSWA 4CJ0A 3S5LG 5BXFB 3RTQA 3C8KB 4PGEB 3CFEA 5KANG 4ZI8A 2W0LA 2VC2L 1QO3B 1J5DA 3B2UC 1NSNL 4WFFD 4ONFL 3P1VA 4AIXA 3OR6B 4HG4K 1FZJB 1N7MH 3QG7H 1HHIA 2NY5L 2QTVA 3CDFA 3BVXA 5CKAA 2K3TA 2VITB 1BXUA 1SNRA 1TZGL 2ZWNA 4WDIA 4X9GA 2OX5A 4MWFA 5IHUH 5HVFB 1AQDA 4TSBH 1A5FL 1N2RB 3K6DA 1KIUA 5HJGA 5F1SA 1LO2L 1JI1A 3RNKB 3RTQC 2A9AA 3FO1B 3ARYA 4B9GA 1CC3A 5FUOL 1BMWA 4K7FB 3RHWF 4OB5H 1IC4L 1PU0A 3TT3L 4KKNA 4M4PA 4XAKD 3QUKA 5DHVA 1SM3H 3NCMA 1OM3H 2X4SB 2XUWA 3EGXA 1A6UH 2JKLA 3BSHA 1AQ8A 5TDNB 4AIZB 2E3VA 3RUGB 1S2EA 5C2BH 4MZRA 5JW4Q 4L8SB 3GXNA 5KVDL 3IETA 1E9QB 5KZCB 3SYOA 1DJHA 5IFAH 3ASOB 4PBVC 2GYSA 3KWXA 5KVGH 2CCVA 2P44B 4N9GA 5TE4L 1S6NA 5AW2B 2FJGB 2JELL 3DX6A 3H6AA 1GXEA 2K0RA 3Q2CA 5GSVA 2VNCA 3WFDH 1RZ8B 3DKHA 4LU5L 1GZQA 3EUUA 3L3OB 2X9XA 1UWGH 3H56A 1D5MA 5BRZA 3WJMB 5AYQA 3LRLA 1WBZB 4HCGA 2VM3A 4N87A 4CC4A 3REWA 1ZK9A 2W9DL 2P80A 2KQNA 1NGXA 2QVTA 4NRXA 1HILB 3GI9H 3KPSE 5E2UH 1OARH 4QOKA 1HEZA 1E28A 5BUPA 5F3HB 1R0AL 4JKNA 1QTPA 4X9BA 4XXCA 2Y5TB 4X6CF 4EQ3A 5D8JL 5D5ME 3UCRA 3P3SA 1TYEB 2FZ3B 3MV8B 4X4ZA 1QWUA 2YUXA 1CT8A 2ZG3A 2CLVA 2VDPH 4ZUTB 4CC4C 3BVWA 1CD8A 3DYPA 5JHDB 2OMWA 4FP8L 3BX7C 2VWEE 1MEXL 1NCIA 2YSTA 4FNSA 4UM9B 4CNIB 1Q9WA 4HIEA 4HH8A 1HDMA 5K9QI 3NUKA 3IN2A 3RGVD 5I73C 3IU3A 3VXRE 3ROLB 4HWEL 3C6LA 3K6NA 4YDNA 3U46B 4R4FH 2APXA 4XXCC 1RHHA 3BP5A 4QYOB 2ODIA 5AZUA 2WSKA 3MOAH 3EOAA 2FBRA 4Z0BL 4IEFB 3RGVA 2BP0B 5M7QA 2IANB 4UILH 2V9TA 5IVXF 4ZMTA 3CXDH 5D7LD 1YLBB 5F7NC 3KPQB 3DURB 2WOYA 1GGIH 5BVPL 3JWNC 5EORH 5ACZA 3RFZB 4YS4A 4L4VB 4MNQE 4P2RD 1HHGB 5T5NG 4LGPB 2R69H 1F3RB 3E9UA 4YUEH 1BLNB 3C6LC 4PJ7A 3FOMB 4NHUB 4XN7A 1HS6A 2N3JA 3QYMA 2PXYD 4P2RA 3RGVC 4EDXB 2LABA 4M3KB 2X38A 4AXWB 3L16A 2R27A 3DVGA 1DVYA 4U1NB 5C6TH 2VSMB 5KBMA 4MDIB 4EJ1C 2PXYA 3TH3T 3B37A 4K3EH 3V4UL 2FQDA 2VDQH 2ZE0A 1U8IB 2XPGB 2Z35B 4N2LA 2PTTB 4KROD 1A9BB 4GI9A 1XF2B 4L9LB 4CVZA 3SBRA 2X9WA 3VD3A 3D3VB 1J8RA 3MLYL 1FPTH 2RD0A 3G5YB 4RWYL 5L2KD 3NJMA 1ZANL 2VXSL 4A6YL 1CGXA 2ENQA 5AL0A 1KLFA 3EF7A 1MWAB 3HOGA 1TZHA 3HBGA 4J3SA 4ATWA 2JQZA 1KCSH 1J1XL 2PXYC 3IFPB 4IRZH 3V52H 1THCA 2VQUA 1JV5A 1GR7A 2DQGH 3BD5A 5I9QC 3VM7A 1I7TB 5F0MB 1Z5LB 4A1RA 1H6UA 1FRGH 3FCBA 1HEJC 2F5AH 5I75B 4R26H 4HGKC 3OGCA 4HKXB 3VI3F 2CG9X 3SZ6A 3ECVA 4RVBA 5HGBA 4KROC 4XB8A 4X6FA 4XXDA 1T7XA 2GEQA 2BS71 1WWBX 3SE9H 2HFGL 2J1KA 2FWOA 1TFHA 4UQEA 3I02B 4WKXA 3T3PB 3QP3A 1UOVA 5J57B 3L45A 4WNJA 3VMPA 2AQRA 3BFQG 1UGKA 2J73A 1IEAB 4ZPVA 3CZJA 2CDGB 3DRTB 2OSLB 1O7DE 4DPRA 1LWJA 1DSFH 4IIQA 4XNZB 2OZ4H 4MS6A 3P73B 3VA6A 5CEZH 3QHZH 4H40A 4CMMB 2YGVA 3VE0B 4N5EC 1CL7I 5HPMA 4PMEA 4XN9A 5IK3A 2W1NA 4X4ME 4OVUA 4LSVH 1OT2A 4JMXA 3L4TA 3A6CL 1KXTB 3VH8G 1HKLH 4BBWA 4YSTA 4G9FD 5J6HA 3DWTA 2VABA 3D2UD 4LNVA 1HVXA 1FLRH 1YNKL 1CZ8H 4HH9A 4IIQC 2QJDA 4L2YA 4FHBD 4GSDH 1BX2A 4PJDA 1EUUA 1SOKA 1G1CA 3FF7A 2JKXA 4N1CA 3LPPA 4KMLB 2X4OB 1T83A 3CFBA 4KY1L 4M7LT 5D5MB 1FAIL 5IP4A 5JOPD 3U7WH 3NH7L 2WAQA 4U6XB 1CQYA 5E6RB 3PDGA 1U8HA 1KN4L 3HCVB 4P5SA 1Y7VA 1W15A 4LMQE 3J8F7 2F15A 4U2ZA 1A7RH 1LP9A 3U2SB 3D0VA 4NM8L 3RGBA 4WTZA 2A9MH 1RD6A 3IXAA 3L08A 3A5VA 4LSDA 3S34H 4X80H 3FQTB 5EUKB 2YD8A 4L8BA 1FL5A 4ZFFB 2DI8A 5CJXA 5HI5D 4MS8D 4KZEL 2FL5A 1S7TA 5F9OL 1BA9A 1T83C 1RUAH 1X5FA 2MHAA 1FO0A 5L2JB 1P2CB 4P9ML 3ZT6A 1PSKL 3KLAA 4XGZA 3HC4L 2QVIA 2VDLB 1KGWA 1C16B 4QHUB 5HYSA 2EVGA 3DOSA 3ZIMA 5DEFA 2AQ2A 3GRWL 4PJFE 3W38A 4M7LL 3JTSA 4JFFE 3KJ6H 3U36A 3FH7A 3MRIA 2CIKA 3BGMB 4QXTA 5CJ8A 5F0JB 4P46D 5CJXC 3A3YB 2IGTA 5I5MA 25C8L 4UT7L 3V6FB 4NKIL 5HDBE 3TESA 2J8HA 4FI7A 3L9RB 1ZTMA 3T8XA 3VXPA 1JNLL 5HHPB 4KTEL 4MS8C 1BMGA 1EHKB 1NFDF 4KVCH 3D69A 4P9HC 1BF2A 1CLZL 1R5IB 5CBAA 4I2XE 4HZLA 3SBQA 1WZ1H 1DUYA 1BQLH 1CU4L 1E65A 4BHUA 1AY1H 3QEHA 3QXWA 3VFTA 4PH8A 4N1HB 7PCYA 4FG4A 1TTRA 2YQGA 5DJ0B 1UD3A 4IK7A 4JDZB 1ET7A 1OB1A 3X17A 3MNDA 3GLDA 3ARFA 2F5BH 4JHUA 1IE4A 4PG2A 5KSBE 4F37K 2C9QA 3MRLB 4DOHB 3QK0A 5KJ4A 1J18A 3SYCA 4ATTA 4KAQL 2N1TE 4Z7QF 4F8NA 1FVDA 1HOCA 2OJEB 1WFIA 3UBHA 2WB1A 1I8IB 1QPKA 2FJHB 1KCRH 2W0PA 5DT1H 3K8MA 4Q2ZA 5AW0B 5KVEE 4D9QE 3RZWA 2RAMA 3PYCA 2GVYA 1NIAA 1G7IB 2Q6WA 3ARFC 3PL6A 4TNFA 4PG2C 4ZUUA 3OZ9H 4UMGA 5LCVH 3LEYH 1JYWA 4Z3GA 3LZQA 3BT0A 4X0NA 2JKJA 1OE3A 1NKOA 3MXWL 3MLTA 1NBQA 2ZOWA 4PRAA 2FHCA 4NKDB 2X4UA 5KVFL 5HHQB 3CVHA 3OKOB 1LE9A 3HB3B 5CBEA 3LS5H 3QFDB 1LK3L 4YSAA 5A2IH 5DJDA 1UH2A 5KS9E 2IWEA 3PL6C 4HIXH 2YARA 1KJVA 3EGDB 1X6NA 3RWCA 5DK0A 1PJWA 1KV7A 2BSDA 3GSOA 4ZAKD 4WI9A 1ONQA 3U6XA 5LGJB 5JW5B 4E41B 2CK2A 4G6JH 5DRNA 1A4JA 3FSOA 3T0EE 3S48A 3T8MA 1OOAA 4KITB 3UBXI 3WLBB 3PLYA 4EN2A 1UOKA 3P3RA 3VD7A 4FA8A 3L4YA 4HIHB 3IYLW 4YFDB 3VD0A 1OSZA 3I3EA 3H3PL 3F6IA 1IAIH 3FUHA 4XCNA 1QATA 1MFUA 4MZ3A 1RMFL 4GLRI 4JFPA 5CEYA 4U6VL 3V0AC 3NIFB 4PWIA 2EDXA 1FL3A 1MIEH 2XV2A 5IB5B 3MGOB 5DUMH 3LN4A 3ZE1E 2P28B 3KZ8A 1TOXA 4IBUA 1S9VA 1Z0MA 2J8OA 4WO4D 5DVMA 5E4EC 1XGPA 3W0WE 4HGWA 1QFPA 1JYXA 1U3YA 1HEHC 4X5LA 5GGTH 4G8FB 3H3KA 3H7LA 2J25A 3D33A 4ZFGH 3SQBA 1XTLA 4WO4A 1SYSA 4EOWH 5F9JB 1F86A 3I2CL 1IM9D 4EZLA 1F1AA 3G6AA 4HU8A 2V7NB 3C75A 3UAJA 5FHBL 1LO4L 2QHRH 4Y2DB 1F3JA 2PCYA 4FG2A 2BNUA 1P1ZA 1YYML 1NJ9B 4E42B 4J3XA 1L9PA 4NO3B 1GRWA 1FYTE 5GXBB 2VN7A 1K6QL 4QRSB 4H8VA 3TZVD 1D2OA 3K46A 4WO4C 3ZBMA 1T5XA 2WQSA 2WLMA 1TQBC 2CJUL 1PL3A 3ETSA 3NA9H 1UXWA 5B3JE 3CSPA 2H26A 2XI9A 5F9AC 1B9ZA 3D48R 3UAJC 1MUJB 4LARL 1FORL 3BQUD 2D03H 3TZVA 1N4XL 2MPAH 5EO1A 4I2XB 1RK7A 5FECA 5CU9A 4M7ZB 1WBXA 4NUJA 4TSCH 2PETA 2ZUSA 1T0OA 3ZU8A 3LIZH 3QHFH 2A1WH 3RB7A 1MQKL 2BH0A 1YG9A 2OMYA 4GUPB 4LCCB 1IM3D 4YLBA 4LSSH 5KSBB 1RIVL 1RZJH 1TUPA 2G5UA 5I1GL 3QEQE 2LFEA 5GRVK 3ZKMD 1YJDH 4BELD 3TZVC 1HH9A 4IRJB 2H0FA 2WGNB 1IM3A 1JK9A 1OT4A 1DJWA 3CVBA 4XPHL 4L3CB 5T3XL 3SE3A 3VFWB 4M8VA 1A7OL 3HI1A 3KL0A 4ODWA 1M71A 2BHYA 3K8KA 4ZX6A 1XDTT 4ZS7L 2MKLC 1DJSA 4MMZB 2W9EH 1DQLL 1CG9A 2NNFA 1J8SA 2YSSA 3UZQB 5E00B 1JPFA 3VD1A 2X0WA 4KQ3H 4NO5B 3FHEA 4JRYD 1GYUA 4CJ1A 3ES6B 3EJZD 2B4CH 4HMCA 5IB2B 1BFTA 4I48B 3BUQA 2MH4A 2M1KA 4QT5A 5D7JB 3VTAA 3LKQB 4XVTH 4RQQB 1ZJAA 1D9KD 3MLZH 5AOKA 5KG9B 3SE3C 1KBWA 3DBXB 1S9KC 4HKZA 4HIQA 5I0ZA 5E8NB 4NAMA 2EE9A 3THMH 4FJ6A 3GD1C 2OM5A 1HH6A 4YSEA 3WUZA 1AD9A 1N5AB 2Y7QA 4KRNA 4JFYB 3QWRD 1V54B 4ZFQA 5HGGS 5EMYA 3RPBA 4EUPA 1KULA 2CGZA 2CJTA 4H8HA 1AJ7L 1IEBA 1SOQA 1BF5A 1N64L 3WE6A 1NCOA 1N8OE 2UVEA 3CFDA 5L7XL 4PWEA 4NP4L 4HHAA 5EZOL 2EH8H 1UXSB 1TZIA 2C7UB 3WV0A 4F2ME 3EJZC 1G9NH 1URZA 2ICWB 3RVWD 3MLRL 5DUPH 2ATKB 4YEEA 1J9CT 2CO7B 1P7HL 1D9KC 3L9YA 3AQYA 3U0TB 4B0MM 4WWNA 4A2DA 3OJDA 3NSDA 4UTCA 2Z8VC 1HYSD 2VM4A 2EDFA 2IBZY 4U2YA 4YVNA 1I7UB 3B6SA 4GP5B 3BAEH 3X2QB 3BSZH 1XH0A 3C8DA 4TN9A 4IGBD 3TO4A 2W9LA 1J0IA 1INEH 3GBNH 4OCRH 1AHKA 3BESR 4Z7OF 1GPOH 4ZQKA 4FCAA 3PXHA 2EP6A 1H8LA 3MRJA 4XT1C 3W0WB 1QLEB 3BW9B 4CMHC 1I3GL 1RJCA 3MCLL 3RVWC 3SJVB 4NQDD 1PGRB 5LBSL 1MJJA 4HLZG 4BH7A 3FB5A 1U8KA 4HALA 3WUWA 3DGCR 4J8RB 4O4YL 2R0KH 2NQDA 3TO4C 4EKXA 2DJ4A 1COBA 3H54A 2I69A 1IFHH 5BVJB 3FC8A 2OZ4A 1K72A 4ZQTA 5AKVA 1Z32X 5DJ2B 4K7PY 1ZT4B 4PGZA 3WU1A 3IMUA 5IF0B 1A7NL 1IGIH 1BQHA 3S6CA 4ERSL 3N43F 4JFEA 2DRUA 2IG2H 4YLQT 5DHDA 1SVCP 5JDSA 1TVDA 1U41A 3NT0A 1Z9SA 3AABA 3BJ91 4NZUL 5GS2H 4XMZA 5T8IA 5IQMA 1F18A 3LZFH 3Q8BA 2A0LC 4TVPL 5KYNA 2C8NA 3HI6L 2K4AA 2YRPA 4GXUM 1ZVYA 5C2UB 1QKZH 4OZGA 2VMDA 1I75A 4LE8A 3I6KA 2BY0A 3ZSTA 4K23L 1T1YA 1U8CA 1QABA 3FTGA 2BCKB 3GI8H 1E9OB 2XICA 3NK3A 2YRZA 4HS8H 1OCRB 5IREA 3C5JA 4XVOA 2B1HH 3CMGA 4XZUB 4ZSOE 2YXMA 6FABL 3OKEA 4J1UA 1S78C 1SDYA 3OZKA 1P69B 4ZDHA 5DHMC 2UXTA 3GSUB 1T21B 4GG6A 4QGTA 3WIIH 5F6IC 4ODSH 1HXMA 2ZXAA 3ZTEA 1GS6X 2EDRA 4FQ1L 4QRPD 4Q9RL 2XZZA 4LEBA 1M4KA 2CHDA 4JR9L 4KZDL 1U8JB 3IDJA 5EEZA 3OVUB 1G1YA 1L9OA 1CXEA 1HI6B 1KENH 1AO7E 4HEME 2BVUA 4TUKL 5D4JA 5IFJB 1OZTG 1WFMA 3QDJE 1KTJA 3EG9A 3MLXH 4OVVA 1M57B 3CCHA 4XE5B 1ZLWH 1GGCH 4JFOA 4Y1AB 4IOSA 1IGMH 3AT9A 1KTDB 1OPOA 3EBAA 3VYNA 1J1PL 4LOVA 3NRQA 1DBAL 2QSQA 3H1ZA 4RMVA 4PG9B 1I85A 2DKUA 2A9BA 5LGKA 1WEJH 1LQBC 4NRYB 3E3QC 3BRFA 5HHVL 4AEHL 5T1KB 3S2CA 4FNQA 4ELKA 4RAHA 2J1XA 3NJJA 4NUGL 4WUUA 4X8GA 1VGKA 1RUPH 4ZUVB 1OAUH 4U05A 4X8JB 4Z7VA 3ROOA 3RKPA 3ZK0A 4PJXE 3MUY1 4ACPA 5BS0A 3HNVL 1KBKA 5D72H 2G60L 5J1AB 5ICUA 5JYLA 1UA6H 5C09D 5DVOA 1M1SA 1MCCA 2I9TB 3L7EA 4X5WA 1B2WH 1I85C 2OTWB 3VFGL 1VADA 4KKRA 1N6UA 5I0DA 2NY4C 2Y3NA 5C09A 2RFXB 5C97A 1CF8H 2DQIL 1JGEA 1G9ML 3BRGC 3CMOL 2R1WA 4WFEE 4DZBA 4KFMA 5D7SH 1KGYE 4U1JA 1CI5A 1DBKH 4XB3A 1J5IA 1ML0A 3UPRA 2Z92A 4KUCF 2OL3H 3LKOB 3HZKA 5I1KL 2PO6B 2GY7B 2YPVL 2OXGA 2XY1A 4JDTH 4KO6A 2KZWA 1CXLA 2B5IC 4AVKA 2CO1A 1EV2E 4IBTA 4XNBA 3KWVA 4MA8L 1OQOA 3A4EA 3N50A 4WHYH 5LCVA 2A7BA 1BG1A 4L5FL 1PLCA 2WXGA 1P7QD 3GKWH 1UKTA 3G08A 1XGQA 5B38A 1OCCB 4E0RA 4DK3A 3FF8A 2NY0B 2QKIB 4X6CA 2VSKB 5EB9A 5EIIB 1M56B 1P7QA 4HD5A 2F54D 3DI2B 2CO6B 1BVLA 1Z0NA 2GITB 4MFHA 4BZ1L 1PYWB 1I9RL 5IGXH 3ARQA 2F68X 4K3JL 3MRFB 4KTDL 2VLLB 3MUGA 1PNDA 1V27A 4PJBA 4QKXB 1ZVNA 4FS0A 2F54A 4M6NL 4KWUA 2W95A 1QUPA 1YEHL 1Q0XL 3EOYG 4N6QA 4NQQA 5A16A 1SZNA 2MFNA 4LSTL 4QEGA 4AEIH 1E8ZA 4OJAA 3V9EA 4XMTA 3TJHD 3CNKA 4GKSB 5DC9B 4JDEB 1EVUA 2QADD 4OD2A 3HIZA 2BWDA 4P5KB 3KD4A 3T08A 2VLRD 1F4WH 1YN7A 4LCVA 4HEPA 4MCYA 5IVXA 2GJZB 4WU5B 4JFSA 2BNQA 3NCCB 1QNIA 2NY7H 3BOVA 4P59H 2DZEA 5CZRA 1O6SB 2WO4A 4APXA 5E9DE 1I3RA 4QXGL 2AEWA 3WSQL 2VLRA 1VB9A 1M05A 2EIJB 4CKVX 3T4YB 3KXFE 3E7JA 5IBLD 1NAML 3F84A 3SKNB 1AR1B 2DF3A 1P4IL 3GSRB 1G5AA 3TBWB 3G6JE 5JIIA 3AY4A 2BX5A 2R56L 4R5XA 1SYVB 3MACH 3OPZH 2D7OA 1SEQH 2VN5A 4N8CL 3OAYK 2TAAA 3ZDZF 4OI7A 2F8IA 1T66D 4JPWL 2XACC 3TJHC 5JQ6L 5KYYA 3VI4B 5ITFB 2QADC 5F7WC 2DQHH 3IF1B 3ECBB 3V4PH 1WS7A 3ZO9A 4E5XA 5KS9F 5GGTA 1E3ZA 1CLVA 1TVBA 2VXQH 4L1LA 1SN2A 3QA3B 2R2HA 2JLPA 3MRRB 4EI6B 5IMOB 4GBXB 5T1LB 2YEQA 1DQDL 1R3HA 3AY4C 3EYSH 1XF4B 3QUXB 3ZY7A 4LKCB 4Y16B 4OJDH 3RA7H 5AKSA 5HHXH 1E6JH 2NCEA 4NQXA 3EFOA 1E5BA 4JG0H 5DS8B 2I07B 3BO8B 3CLEL 5IBLC 1HWGB 2MCG1 3ZVVA 4DAGL 4YHML 2B16A 2VDMB 3AJ7A 5HDQL 5ICXA 4LOEA 2PCFA 3O6LL 5DJ8B 2LT9A 4CBZA 3RX8A 2PW2A 1ES0B 3DHUA 2EYTB 1E40A 2XWDA 2WINA 3STZB 3ZN6A 5HI3D 4H5SB 5IUSA 2ADGA 3O6MH 2OMBA 3WFBH 4L0YA 3FUJA 2UZYA 4P04A 3DARA 1XHHA 5CR8A 1SEBB 2LU7A 5LG1A 4C58B 4TNGA 1SFHA 2A5UA 2X2UA 2NW2A 1BZQK 1AFVH 2X2JA 4KK6D 3LQAL 3SE4A 1OAJA 1S5IL 1I7ZB 3ZE1F 2ZCZA 4AQAA 1U58A 1VF5C 1EK3A 3LIZA 4YE4L 3JVGA 3NJNA 1RP8A 3BD3A 1HE8A 3T1FB 2WXIA 5E1GA 3BP6B 2YAQA 3ESPA 1OL0A 4G8GE 1OPGH 1JWUA 3GPSA 3WG7B 3ZRFC 3JV4A 3F7YB 3F65A 2CUIA 4RWHA 1HZHH 3N41B 4I13B 1DVQA 2DKSA 5CJOH 3RX5A 4TNWK 1U36A 1MVUA 1MFVA 2RQ8A 2O61A 4OZIF 3BZFB 2IO5A 3SE4C 3QCTH 4H20L 5EA0L 1MCDA 4KI5C 5ERWB 5F93C 2BO0A 2Y6TE 4HUWB 4PIRF 4D3CL 1TR7A 4NQEA 3F01A 1K8IB 4W70A 4MVBD 3JVGC 4JFXA 4B53A 12E8L 3BPNC 3FSAA 2DL9A 1E6OH 2DQFB 2KMWA 1O9ZA 5C0BB 4BCXA 3W81A 1RZJC 2I27N 3WCYA 1NSNH 3ULUL 1MFBL 1YJDC 2VMCA 4ONFH 3NSJA 3UX9B 1DZ0A 1FE8L 5B3JF 4Z7UF 3V0VB 1L3WA 1SF5A 3S3BB 1HU8A 1WHOA 4R8WL 3EJYD 1BREA 1KLGB 3FQRA 1XGTA 4IJTA 4E9RA 1A5FH 3DX8A 1LO2H 4ABVA 4RBPH 5FUOH 5GIRA 3ULUD 2C5DC 1IC4H 1YPZE 5F89B 4FERA 4P4KD 1L5GB 3TT3H 5C0AA 2X4TA 3A23A 2ZOKA 2NY1B 4MVBC 5EEVA 3ZDYF 2B4CC 4M1GH 3B2MA 3EH1A 4TUOB 3S5ZA 3HI5H 3BWSA 2VISA 5JIMA 5ANMB 4V1DE 4ODUB 2ERJC 3CZKA 4JDVA 4N2AA 1PZUB 1CFMA 4NHCL 4P4KA 4AGQA 5KVDH 1CD9B 2HTLD 3VXUB 3FXIC 2KKQA 2IJ0C 5C3LD 4TF4A 1H3UA 3VXTB 4Y19B 3HE7D 5FW8A 1SXSA 4XPBL 4M61B 5LAXA 1SLWA 4HDIA 2YMXL 4ZT1A 4N2DA 5EUOB 1ZDQA 2JWYA 5TE4H 4NKQB 2KPNA 1YNTF 4OM1H 2JELH 3VGAC 3HE7A 5D7KE 1ZS8A 5KSAA 2R1YB 1SGKA 2EYRB 2LE9A 2F7IA 1BSIA 4ZTPH 2BVQA 3BSZA 2VN4A 4F5CA 2Y1ZA 3DV4B 1NQBA 1UD8A 1M3JA 4N4YB 1KGXA 4P4KC 1AP2B 1B0GA 5IUCA 3SDXE 5I0VA 1DO5A 4JFDD 2WWOA 1JV2A 3LSOA 3S98A 3K8LA 2WBWB 1KNOB 1PLGH 5I8OL 5KBKA 4ABWA 3RL1B 2OR9L 1OGAB 1F4YL 3LZRA 5DJZB 4UM8A 4GKNA 4JFDA 3HE7C 2J1YA 4BJLA 5KSAC 2E56A 1HNYA 2EC9T 1R0AH 5HJ3B 4JFZL 4YNYB 5D8JH 5T33L 2PLTA 3WY2A 2CKBB 2WZ0A 3EHBC 3FQXA 4PWKA 4J2XA 3UJTH 1TEYA 4CVWA 2DBLL 4NZRL 4OFYD 2O1AA 3TFBA 8FABB 1MEXH 4LCWD 4OFIA 2ZOLA 1A6TB 1IUZA 4R4BA 1JPEA 1U8QA 3EYQC 3LYRA 4KTGA 3TVMA 4XMPL 5DYOA 3ZE2E 5K9OA 1OP9A 1BIIA 4HWEH 1MLBB 1U2CA 4OFYA 2VGLM 1FDLL 4LCWA 2CQVA 4OCYL 1J8HB 1XH3B 4S10A 4ZYKA 4Z0BH 3QG6A 1MSPA 1ZRUA 4X0KB 2ICWI 2QLVB 3X12A 1RXLA 3R06A 2WLZA 4LF3A 5EC1A 1EUTA 3A24A 3VH8B 3FCTA 5BVPH 5K59F 4M29A 2A6KB 1NH6A 3UTTD 2DWSA 1DEEB 4AE0A 2QGDA 3F12B 1FI8C 3KGSA 5IVOA 1SUHA 3TVMC 3GINA 3N1MC 3BUYB 1A7QL 3GK8H 5GHWL 5CNHA 2RALA 5ECGA 3Q8AA 4FTVA 4NZTL 2AXFA 3VXMD 1X9QA 4TQIA 1Z5HA 4G8GB 1QA9A 2H45A 3QNZB 5F2FA 4QD2E 4FNRA 1QHPA 2A73A 2J2ZB 5BW7A 3OZLA 4FHJA 1OK8A 3PJSA 3CFUA 2GJ6D 1OXYA 5JUEL 1JWMB 1RZKH 2WAHA 4FNTA 4C56B 3O2DA 4JO3H 2H8PA 4WFHD 1KIRA 3BXNA 3E9TA 4LAJH 1VGEL 3ECWA 4S1QL 1FH5L 3MLYH 3M86A 3IPFA 4RWYH 5FF6A 3HUJE 3NDYE 3C6SA 4YHYB 2O6PA 2VXSH 3VWKD 5IJVB 1KPUA 1UM4L 1SJEA 4A6YH 1S9WA 2LTQB 2WWNA 3HBPA 3FFCE 4PJAB 4NO2B 5BW7C 2EZ0D 2R23A 1NEPA 1WC7A 1NMAH 3B2PA 4M5YL 1ET5A 1X7QB 1UCBH 2EADA 2BMKA 4WW2F 5HHOE 5DLMH 3JSSA 3WS3B 4UDUA 3RDTB 3X11B 4YOKA 4DSYA 1F42A 4U0QB 5MEOA 3NCYP 1H6EA 4DQAA 1YAIA 5DUBA 3ETBF 3GJFA 3U1SH 1JP5A 3VD9A 2R0ZL 2W94A 1XF3A 2HFGH 2FBOJ 4LEEA 5C7ZA 2Z8SA 4D0BA 3GXUB 1LQSR 3ARPA 1CDUA 1KGCE 3MRNB 5SX4H 1FNGA 1L9SA 1CFBA 5FFGA 3FCSA 2IWFA 1XXFC 2HKFL 4X2UA 1YEDB 4GW5B 2HJLB 3OX8B 3SPJA 2AQNA 3S3JA 4JQVA 4PJGB 3ZHNA 3A6CH 3QQ3B 5EZLB 2O93L 3J2PA 2OL3A 3LD8B 1OP3K 5MI0B 3SDXB 4DEPC 1JGDB 4IIZA 4F80A 2WLIA 3KVDD 4JE0A 3BQVA 3O9WD 4KOCA 2W80C 1OCWL 4ICXA 4O9HL 1YNKH 5D1ZB 2J88L 2FT6A 3WNIA 1ZVHA 4CL7A 1VEOA 1R5WA 1J11A 4ODBD 5IIEA 3WFEL 4BXSV 4QF1B 2W0FB 5CSBA 4KY1H 5EBMA 1BCIA 1FAIH 4JQVC 4KKLD 4YGAB 3NH7H 1A9EA 3QC5X 5I66B 2JQMA 3SKMB 4HK3J 1B6DA 1KN4H 1J86A 2C3VB 1UA3A 3Q3GA 3WD5L 5BZXA 1NM4A 5D6CA 4NO0D 4Z0XA 2FDBP 4NM8H 3KPNB 3PAZA 3L17A 3V0WL 4DVRH 1S8DB 3CQQA 5HJBA 3ZE2B 3RJOA 2DQCL 2NXYB 2EIEA 1RK1A 3MCKA 3PAVA 4C4UA 1RU9L 1M9SA 4XMXA 1WTLA 5HDRA 5FV1L 4I4WB 1CE1H 2IV9A 3CQPA 4XO8A 4YPGB 2BSEA 4C4KO 4FQPA 4G8IB 5J12B 4P9MH 2Z0BA 1PSKH 2WD0A 5B1AB 3JTBA 4OZHE 4R3SB 5AYUH 1QBLL 3AWEA 2BZCA 4NWTL 3QSKB 4Z7AA 5C08A 3WO3B 4GP8B 3Q06A 4KKLC 3O6KL 3ASNB 1IGJB 4JFUA 3GDCA 4LGSB 4XNYL 3VFMB 1JZ8A 4M7LH 1OIOA 1I82A 3D7PA 2HPOA 2P5WB 3MOBL 4TQ8A 3U30B 5EEYA 1FG2A 1H3PL 1KCBA 4QHNB 5CJQL 1N6QL 2XA8L 5JHLL 1ZE3C 5SWSE 25C8H 4J6RL 1DANT 2Z91B 4WY7H 5AVYB 4QCIB 3SY0B 2VTFA 3HG3A 3ZHLA 2FTAA 4R90L 4HJUA 2DYPB 3CAFA 1Q0YL 4KTEH 2P43B 1MPAH 1CLZH 3HLKA 4JY5L 4OH2A 3V4PA 1CBVL 4LPCA 3IFNL 4XOBA 3VQMA 1J8KA 5L88L 1FCCA 3GZKA 3OQ3B 4FEIA 5I8EA 3NPSB 2VXQA 3DMMB 3VXRD 2BFGA 1CU4H 4F58H 3FUDA 3PWUB 2EE3A 3MNWB 2GJRA 1LMKA 1QG3A 2L3BA 4ZG1A 1P9MA 4PS4L 5FW6A 1GGBH 2AANA 4GAGL 2NUPA 3GSWB 4U6HB 1F00I 2HH0L 4KAQH 4I7ZC 1DDHB 1OANA 2DQDL 2X42A 1BW8A 5TJWK 3PGCA 4MNQD 4DNLA 5DK2B 4TNEA 3QC6X 4U1MB 2EXWD 2F74A 1AQKH 3FW6A 1M6UA 5G55A 4O02H 2GIMA 4JRXE 3MLSL 4WEBL 1CDIA 3H0TB 1TKWA 4HAKA 1ROCA 3VVWA 1P9MC 2VZTA 4WGVB 5T1JA 3GHEL 1ITBB 2NZ9D 4OQTH 4U1HB 3BMVA 5HHNA 2ZD0A 2ZSWA 3L5WB 3MLVL 1Q0EA 3FQ2A 3O3EB 3PAUA 4Y4FD 5H94B 3VSTA 5KANI 3MXWH 3GM0A 3PV6A 5L4JA 4KRPD 4RFNB 3BWAA 4R2GD 1BM7A 3AU1B 2XBTA 4KJQC 4TQPA 3EDEA 3IPBA 2V8MA 3IDYB 1CVRA 3PIQB 4YHIB 5E6UB 1SJXA 1LK3H 2KZKA 5MP6L 1TFPA 3HG5A 4I1RA 4QRBA 3W5NA 4WHCA 4JFQA 4OKVB 4Z78B 5IOKA 1T0PB 5ICYB 2VKXA 3CZGA 3WJLA 3ILDA 1A2YA 5IW6B 1WWCA 3BZ4A 1H9VA 3L3KB 4B9KC 1RUML 4BFIB 3CH1A 1BIHA 5IB4A 4AITA 4B9JA 2XN2A 3O0RH 5I1DA 3JTTA 3BVTA 3VTMA 2IH3B 3BDXA 2FBJL 3VX0A 5HHMB 3LZNA 2O6FA 1WA1X 1BZ8A 2CO3A 4KRPC 4NNPH 4G1EA 4XO4A 1U3ZA 4NCC2 3WJLC 4R2GC 1Z1WA 3GIVB 2BSCA 3H3PH 3IJEB 5DZVA 3RY5A 4KXBA 5GSRA 1RMFH 5KSUA 2IPUG 4U6VH 3L4CA 3VFUA 4AKPA 43C9A 4NN7B 1L9TA 3VXOB 4IMLB 1T1ZB 2X09A 1CXKA 4MJIE 4WFGE 1E90A 3KYNB 1ORSB 1QBAA 4RFOL 4JJHA 1BPVA 1OP4A 3IJHA 3V5KB 2F61A 3GJEB 1RUKL 4XNAA 1Z3GL 5F72S 2DN7A 1YMME 5J0BA 4NBXB 1R47A 3DUHA 3FRPG 3H9SD 3I2CH 1WGVA 4D8PB 3D39D 3Q8FA 3PWVA 4XP6L 1N5YL 1LO4H 2OK0H 3VG9B 3AADB 4LLDA 2TRHA 2PR4L 1YYMH 2IDSA 3NRPA 3H9SA 3PWPE 4AUYA 1ZLSL 4N68A 1KT2B 1VDGA 2EILB 2ADIA 4FFWC 3CUPB 5I8KH 2EDTA 5C9JA 3FO0L 3IRCA 2HKHL 1WA2X 2WQWA 2YBRA 4OLEA 1TCRB 2QPFA 2BZDA 2C3GA 2AXGB 2DD8L 2AK4B 5EN3A 1ZLVK 3MREB 2E9JA 5SWZB 1Y18B 2Q8BL 4JM4L 4LARH 4HV8B 1FORH 1L0XA 4NT6A 3O3AB 1N4XH 1NDTA 5J13B 4L8CB 4BDVA 4N0YH 2EVHA 3IKCB 1FH2A 4ZMZA 3UO8B 2DIBA 1UZGA 2B2XH 4F2FA 1U3JA 5DFVC 3MV7A 5CSZA 4F8OA 1MQKH 4OIBA 4P5TA 4IHBA 3LRSB 1XGRB 4B6ZA 1RIVH 1OAKH 1QFHA 3IDIB 3UIYA 3UTZB 3C12A 3U0WL 5ADOL 2IADA 5I1GH 2BWQA 1YEEL 2DOCA 1QI5A 2OYMA 5AAWA 2VL5A 1MCBA 1U95B 3MRHA 1R19A 4KUCD 3EOBA 4P5MA 5TE6H 2GKIA 4JFFD 2CDEB 5I71B 4XPHH 4ZMQA 1U93B 1MY7A 2JXMA 3GXIA 4UWQB 3SDDD 1GJIA 4G3YH 4QIRA 2TRYA 1INDL 5KJRL 2VAAB 1SJHA 4FQ2L 1UYWL 2FSDA 3QS2A 4ZS7H 4L05A 1DQLH 4P5TC 1KPVA 3QIBB 4F1ZA 4Z7IA 1H3TA 2VZ1A 4YR6B 3L1OL 5I1EL 1E4WL 2YUZA 1H6TA 1SDDA 4LPYA 3T77A 1QR1B 3QUHA 4AM0A 5AAWC 1R3JB 3QPQD 4L37A 3S3DB 1TVHA 2X89D 3GEWB 5INDA 3GXDA 5IEKA 2OV0A 3R4DA 1J48A 1WDAA 5KVEL 1ODUA 3ESUF 4UYQA 5T1DL 3DPBA 3DVNA 4QTHA 3JUYA 4WKZB 5DJXB 3MDJA 4ZJ9A 5B4MD 1ND0B 1SBSL 2A6JB 1C7SA 1OSPL 1F90H 3ZRCC 2Z3FA 4Y1SA 1TJGL 4KQ4L 1T2JA 1NINA 3IBOA 5FM5M 2NY2D 4LPXA 3X13A 2WLJA 3UTOA 3INOA 3WIFB 2Z1PA 1E42A 4HISA 5IB1A 1ECZA 3Q2NA 4QRQB 4NP4H 4FG6C 1MCNA 5J11B 3UACA 4NM4H 2DMBA 1DE4B 3QQ4A 3A47A 3MLRH 4ZX5A 5D2LE 3QPQC 1AS6A 1UKQA 4A6YA 1T5KA 4X7SL 3JYCA 2CBQA 2YD4A 4QTIH 2YUWA 4DFIA 4GRMB 4X8XA 5MHSD 4JN2A 4JZNA 2V9QA 3UP6A 3QFJB 1L4IA 2VQ4A 1EEZA 2YQBA 5EN2A 5CP3H 1RZKC 5C0FA 4X7EC 1JZJA 1S7UA 1YEGL 4OBRA 1YEFL 1MHHB 4GY4A 1N0LA 2XRAH 3FB8A 3NJIA 4UT9A 3D52A 2XG5B 3MMEA 4H0HB 3KYMA 4NCC1 5T5FL 4I3RH 4P23A 1ORQB 2CZNA 3Q2VA 4M93C 5CGYD 3SDYL 1O5DT 1XGZA 2NY2C 4OFQA 1ZV9A 2XXCB 2Q76B 3QJUB 2K6WA 1AGDB 1IGYA 1AVAA 3GZOA 3B3IB 1DL7H 5DO2D 3KLLA 3RPIB 1U3HB 2H6PA 1I3GH 2KHAA 2R2EB 5E0FA 2OA9A 3MCLH 3FAWA 3RVVD 2CBOA 5LBSH 1OD7A 4UINL 2AQTA 1VA9A 4J27A 4O4YH 4F8TA 3VXNB 1DBBL 4YHPA 3ZTDC 2ZONA 4P23C 3EYFA 1QLFB 1CICB 4YDLB 4KKZA 5TK4A 3ME0A 2PABA 4Y7MA 4HX1B 3WL9B 3PWPB 1QRNE 4NN6C 1MJUL 1AQMA 5CD5D 3IDNB 5I1IL 3AREA 1A7NH 4PV8A 1F1DA 1N70A 4OCNC 4DVBA 1I9JL 4ERSH 3WEOA 5J1SC 1BAWA 4OZ4A 4BSVA 1ZMYA 4ODVH 3T6ZA 1XR8B 2ZXEB 4NZUH 2XN9A 4GQQA 3HPLB 4HWNA 3QWOA 4YXLL 4TVPH 2PTUA 3RVVC 4ZX4A 3O4LB 1CO1A 1UADC 5LNGA 1DBML 3NVQA 4RNRB 1X5JA 2BIOA 2BSSA 2F53E 2OLDA 3FONB 3K80A 4QNPE 4K23H 3AREC 3GF8A 2BY2A 1BFOB 5GS0L 4IBYA 1IV8A 3GNMH 4L29A 4HPOH 3OXSA 3K71A 4HUXA 3T2PA 1MW2A 1DCLA 5EF0A 3OV6A 5E08L 4K9EC 2HRLA 1JGVL 3IGAA 4HA1A 3AGVA 3HC0B 4BYHA 4JPSA 2A6IA 1QPPA 1X7SA 4GIAA 5L4FA 1LK2B 5IEHB 2O5YL 5KYWA 2APSA 5EZIL 4Q9BA 5DJYA 4FQ1H 1K5NB 4FZ8H 1FYTD 1ZLUH 4JR9H 4OZIA 4KZDH 2DTMH 1ICTA 1H5BA 4AVHA 3TH4T 2HVKA 4M3JA 2YZ8A 2BWIA 1DTUA 1WZLA 3W9EB 4TUKH 1ROWA 4MQ7A 3OG6B 1F6FB 1KLUA 2FEDD 3S36H 3EFFB 4AL8L 5SV3A 3N0AA 4OLYH 3BVUA 5B3NA 4G6FB 1ZLWK 1OGSA 2BS8A 2WNKA 4D0CB 4N8VG 4Z7UA 1WIPA 1J1PH 2CHWA 4NERA 3RVXD 1CL7H 1ZWIA 5LBVA 1DBAH 4HWBA 1WFNA 4QRUA 4M62L 2KS0A 1H5BC 4KVNL 1A3ZA 2HT4D 4GSRA 3WNKA 5EWIH 5D55A 4PP2B 4F7TB 5HHVH 3BKJL 3D25A 3QEQD 5E5MA 3CXFA 4FYQA 4JZJB 4NUGH 2BSTB 5D1ZI 3QDGA 4YK4B 3OGOE 2WUCH 4CUCA 2QTEA 2FE0A 3I85A 1UTDA 5FXCH 5DURB 2O5ZL 4ODTH 3V95A 1GJWA 4A7GA 2JVUA 3AAZB 1A3RL 5I19L 2LLGA 2JB6B 3AS1A 3HNVH 3FZUD 2G60H 5EBLA 1HHJB 1PAMA 3LKPA 2WLHA 4S1DC 2EUXA 4Z3TA 1QSFD 1D5RA 2XDHA 4I9WD 4AGNA 4F7EB 1NMCB 4GRWE 5DHXB 1URIA 4N85A 3VFGH 1SQMA 4PYGA 1C12B 3L4ZA 4U0RC 1QSFA 9CGTA 2DQIH 1G9MH 1UT1A 3CMOH 2HT4C 4PJ5D 5E5UB 4FQXB 4OZHF 4QO1B 7FABH 3CFIC 4JY6B 4QHMB 2J43A 4Z77A 2VMEA 3MI6A 3POHA 4HUMB 1E7UA 4P2QD 5I74C 4O02A 3BZEB 2G4EA 1TO5A 2EIBA 2YPVH 4PJ5A 1SLUA 2IPUK 3QXAA 3D30A 2YPLA 4OQTA 3FZUC 4OY9A 4P2QA 5FA3B 4LKXA 2ZWSA 4L5FH 1L9RA 3QCVL 2DMGA 1VPOL 3FB6A 3FU3A 3ELAT 5F1IB 2EDEA 2QLYA 3JWOH 3RI5F 4UB0H 1J9QA 2WLLA 3CLFH 4HU2A 5B39G 4RDBA 1J0YA 1MCRA 2MMXA 4FLRA 4ZD3L 1YYLL 4BZ1H 5B7FA 5H37H 1B4JH 4L9DA 3PS6A 4K3JH 3ZGHA 4PY7A 4AQ1B 4XRCB 4KTDH 1QRNB 4OFKA 3PNRB 1I1RA 4GMTH 5CEXB 1W16A 4P2OB 1ZT1B 1YEHH 1Q0XH 3EJQA 1LEKB 4LSTH 2MRYA 4LEXL 2ALAA 2A83B 2GSGB 2ITEA 3X3GH 1ETB1 1P4LB 4JO8A 4ZMVA 4R4ND 4HWUA 4JQIL 1BZEA 4TV3A 5B1BB 2W59A 2PPEA 2OXHB 2RCSL 3IEAA 1Z2KA 2YGPA 1BZ7B 1KPRA 2W0KA 1DLHA 3TN0D 1TU2A 1S3KH 1JDDA 2O6DA 5EH1A 3PGFL 5I6XC 3WSQH 3RWFB 5BUAA 4L3EE 4ILDA 4YSQA 3KYOB 1I31A 1S7VB 3A67L 4N2HA 1IFGA 4ELDA 1XQ4A 5A2FA 1X4ZA 2ZWKA 1P4IH 5DTFB 5TH2A 5DRXA 3ZQ9A 2R56H 3KVPA 2XWJA 3G04A 3C5XA 3GBLA 4Z3EA 2HG5A 3MJ9L 4G9DB 4N8CH 4XCCH 4EZJA 3EFDL 5EU6E 1G7HB 1P7KB 1G7PA 2QDWA 5EU3A 2ZKYA 5CZXD 2NXZC 3GRGA 4ZK8A 2AJVL 4NNYB 4H8QA 4MXWL 3KLHD 5EO0B 4GYBA 2KERA 4MD5A 4RIRB 2V17L 3QXUA 3RWDA 5LDUA 1Z9PA 3HR5B 1V3JA 2A4CA 2Z7UA 4LB8A 1T1WB 3NMEA 4B3EA 3NGBB 1KB9J 3CFTA 1AZBA 1DQDH 5J8OA 4QRFA 1CDHA 1CFQA 2BC4B 3FU7A 3PQYA 5ESQA 3VWJD 1F56A 4NJAL 3SGJA 1IQDB 5DD6A 1TYRA 2XV0A 3CLEH 5AB1A 4YHMH 4H1LH 1CQKA 4IRSB 1KEGL 1JRHL 1KGIA 1P4BL 4LHQB 5J4MA 2R29L 2K8QA 4YSCA 3T3PF 1GZPA 3NCXA 3UXFA 5AW9B 1AYRA 3TA3D 1AD0B 1DQML 5A3IC 5AB0A 3P0YL 3C60B 5L0QB 1MZZA 3QIUB 1KCUL 1AXSA 4PRPB 3IGKA 3KLHC 3BDYL 2EDLA 5AWNL 5GJSH 3MNZB 2ZWYA 3SGJC 4OGXL 4WI0A 3HLAB 3TA3A 4UZSA 4KX8A 3LQAH 5FYKU 1S5IH 3TNMA 6TAAA 3F5WB 2JSFA 3ZGIA 3A6BL 4N25A 1FLTX 4XBEH 3NTCL 2EVJA 3MJ7B 2Z9TA 4L4TD 4GLRH 3AM8C 1SXCA 4AT6B 1AO7D 4R97B 4UF7C 5A2BA 3QDJD 2ZUTA 3PGDA 1LEGA 3O2WL 3QDME 2IH9A 3MA7A 5FYKD 3SCMD 4L4TA 5ALBL 4FN0A 3Q6FB 5FO9A 2IXQA 2MWCA 2X4QB 3MLWL 4I0PD 3TA3C 4W9GC 2XXFA 4U1IB 3U0PB 3ARGB 4H20H 5EA0H 3PWLB 4P49A 4D3CH 1CCZA 3CX2A 4GUCA 4UYPA 1U8OA 12E8H 1RV6X 1IC0A 2E5EA 3VFVA 5IKCB 15C8L 1WIOA 3PE9A 2ZX5A 5AW7B 3WI9A 4XMLL 4WU7B 1IGTA 4O58L 3BISA 1DN0B 1E67A 1MFBH 4LBEA 4PWJA 3AG2B 3WFHA 4Y2OA 4WJ5B 1JMXA 1W0VA 2E6PA 4DTGH 4LSQH 3FFOA 4R8WH 2EYSA 1NOLA 4LL1A 4W81A 1BWWA 4ZPTA 1ZJBA 3CG8A 3NYKA 2AMUA 3TASA 2GT9B 2J72A 4RBPK 1U8PB 3UGUA 4F7PB 5JA9A 5JHBA 2J6EL 3CHQA 3OSKA 3QZWA 2EO7A 4IHOB 4MB4A 2BNRD 3KPRE 3FK3A 4KHXL 4PJEF 2YRLA 5IMLA 1JIBA 1MI5D 1OD9A 2D8KA 2VJ8A 3WTTA 4PS7A 4NHCH 1OB0A 2BNRA 2HUEA 3HNSH 5BRPA 3SE6A 1MI5A 2RACA 5CIPB 5DD0L 1R75A 3BEWA 2YMXH 1S7XB 4TKWA 5KSVB 1WFTA 1MHEA 1DVFD 5K69A 1UQSB 3ARDD 1CD1A 2HTKC 4IOIB 1KN2L 2AF2A 4QI3A 4M1CD 5BV7L 2NX5A 3KE0A 1AI1H 3OMAB 3BH9A 3CFKB 4LVHC 2CIIA 2J20A 3N04A 3MCYA 1R5VB 3CU7A 3WJJA 5LQBL 4F24A 1GCFA 4KOBA 1PZDA 3W11D 1CFTA 3UOAB 4PREA 3DDFA 1QWHA 1BQRA 4H13C 4WI8A 5D96C 3UTQA 1EX0A 1XSIA 2XIIA 4YPJA 3QUYD 3LPGA 2OR9H 1BBJB 5DMKA 3FSVA 1F4YH 2D31B 2WWKT 4ODXB 4FTDA 4LLAA 4W4NA 3HZ3A 2ENSA 2CBTA 2BXZA 5T33H 3WEBA 3WJJC 2PUQT 1FZKA 5E2VH 4HUUA 1ACXA 1PZBA 2D7PA 5IESH 3LJ3A 3MBWB 3WN6A 4NZRH 5DC0A 3FT3B 4LLQA 3GMLA 2AXHA 4LNRB 5E9DD 2ARJQ 3MXVH 1ZSHA 1RIHH 2NLJB 3PG2A 4FYSA 4XMPH 5D2LF 3WELA 1XZWA 3B43A 4GO8A 3VXSE 5HPOA 4RX4A 3I75B 3EBIA 3KXFD 2P3YA 4NFBA 3NFPA 2VIRA 1A6PA 2R4RH 2N7AA 4IU3B 4OCYH 4PLOB 1MCLA 3T2NL 1ZHKA 4V11A 1A6WL 3KPLA 2GQHA 5TDOB 4LP5A 3DSFL 1Q9LA 2VRQA 3G5ZA 1KBBA 5D1QA 4KXDA 2WUBL 4HJJL 3FU9A 3MUUA 2L7QA 1UUNA 4PGCA 5CJ5A 2OTPA 2KLSA 1JCVA 3GQFA 4F7CB 4NZTH 4MNHB 5CUSL 4G6KH 5DA0B 3VACA 2AFNA 2HJKA 4LQFH 5K1JA 2YBGA 3GPEA 4P4RB 2PP9A 1SQ2N 4QDGA 3QIWD 5EG6C 4L8DB 2GJJA 3MRBB 1DFBL 2DWDA 2MQ0A 5EO9B 3TCTA 1HQRB 3V6OA 3R4RA 1TYJA 2Z6FA 1M2VA 3B2VL 4D9RE 4LFHD 1PBYA 5ITBL 3JBG7 2O72A 3QIWA 3P4OA 3RNQB 1A66A 1VGEH 3EYUL 2CPCA 1FH5H 3EH2A 2D9QB 2X3AA 3KBFA 3LZLA 4HJ1A 4YBQC 1CYWA 1BLIA 2WIMA 3N3EA 5LB1A 1UM4H 1GGUA 4NI3A 4WZ9A 3CN3A 3CZUB 2G9HB 3MV9E 4LIQE 2IDCA 5C0GB 3V6OC 2IH1A 2R7EA 1MCOL 1MAML 3N0PB 2H9GB 4MJ5A 2P7TB 3QZLA 4Y5VA 2YKLL 3OG4B 4XNXL 4TUJA 4LLWA 3QIWC 1MRCL 5JORB 1H8SA 1LO3L 5DVPA 1FP5A 3FO9B 3MRCB 1K9TA 5AKTA 4JO5A 1EEYB 3ZMEA 1JNNL 2UUDH 2XWTA 4ISVA 3RWJA 2BVOB 3P9MB 3L9BA 2GK2A 3BAXA 1KYOK 1MWAH 1N10A 4GI8A 1TEFA 2R0ZH 1AKJA 2OMTB 4Y5VC 2J5LC 2N4IA 5IQLA 4ZMOA 4XP4L 1ZTXH 3VG0H 4X7CC 2NNCA 1HKFA 3O3DB 4JAMA 1QQDA 3U4BL 3CIAA 2BXYA 2Z64C 2WZPD 4PVBA 2HJFA 3QPXL 2H4EA 1S9XA 1XB3A 2IAMD 3NCFB 3S37H 5BCAA 2YD7A 2F7RA 4D7PA 1FFTB 5JPNA 2P8MB 2HKFH 4WNSA 1Z7JA 1YMHB 3CK0H 1U8NB 5I2IA 1BHGA 2IAMA 4NLAA 2W07B 4XP5L 3WEMA 2UV3A 3ZYIA 2EXYC 1XIWA 2FB4L 5EPMA 4DKEH 3K2IA 1SN5A 4LHUD 5DI8B 2ARJB 4GG8A 3UYRL 1NGYA 1IAOB 1OCWH 4O9HH 2HMID 3Q43A 2RMNA 1D5BA 3M17B 1PY4A 1G9MC 5FGRA 1MHPL 4OLZL 5JPNC 5MEND 4LHUA 3IFOB 4G8EA 4FF9A 4PRNB 4G80A 1BXXA 1PX8A 2IBBA 4QY8B 2J3SA 2IAMC 4HUKB 4PTUA 3SSGA 4A7VA 5JPMB 1NLDL 1MNUL 1NC2A 1YECL 5KVMC 4BZ1A 1XIWC 1FNEB 5MENA 4Z5RA 5H37A 5ALCH 1MFCL 2D4FA 2ZUYA 3DHMA 4JFWA 1ADQL 2JMRA 2F1BA 2WK2A 4GRWF 4JZOB 5CMAB 3V0WH 1NBZA 1RZ7L 2DM4A 2GUYA 1EFXB 1P5UB 3IDGB 5D7KD 2AV1A 3SO3C 2AJZB 2X87A 1RU9H 4PRBB 3JWOC 4Z76A 2HMIC 5I18H 1OWRM 3GSNB 1FQ9C 5C0DA 3V5HA 3S4SA 4NQSA 5C0IB 4BKSC 2H1LM 1A3LH 4HC1L 3ZO0A 1TZ8A 4H26A 1LM8V 3LCYA 4QXVA 4BGLA 1QBLH 5KBDA 1S46A 4NC1C 2DMCA 4HKJB 4OD1H 3MRMB 4XNYH 4UNUA 4QXUL 5C07A 3EJJX 3MOBH 1VHPA 2VR5A 2ZXQA 4EZMA 2V5MA 4Y4KD 5IT2L 1H3PH 1GC1L 2XA8H 2EIKB 3F7VB 2BCMA 2VDNB 4HYTB 2X4NA 2VW6A 4KJYB 2AP2A 4JPIB 3V6BR 1Q0YH 2E74C 2VZVA 4JY5H 2H3NA 1TSHA 4OAWB 1KTRL 3IFNH 4BRVA 1CBVH 3CBRA 1JBJA 4UOZA 3UPAA 2F8XC 5DHEA 5GGUA 3QDHA 3FCUB 4A55A 2JTYA 1KG0B 5EBWB 4UZUA 3KPTA 3OBAA 4XODA 4B0MB 1IKFL 1PF3A 1RK0A 4APQB 4ORGA 4U3SA 3SY6A 1VFBB 4YSSA 2HLAB 4EDWH 2GUOB 2WVVA 4GAGH 3C5ZA 1CVSC 4I85A 1C5DB 5FGCB 1NDMA 3FRPB 1Z9NA 2DQDH 3BKMH 4HS3A 2YEVB 3ARBB 2ESVB 1UCTA 5BRZE 3SKUD 2ZF9A 5IHZB 4N0UA 3L95A 5DD5L 2XHNA 2YXVA 3NIDE 4OLVL 5AVXB 4WEBH 1NEUA 1UD4A 3MLSH 5JXAL 1QP1A 3UBXA 4GP4B 3NJGA 5DR5L 4F15C 4ZX3A 5DMYA 4W4OA 5FEBA 2NQCA 3GHEH 3U7AA 3C5ZC 5JLZA 1A1NA 1IB5A 4QOKE 2BRRL 1HSBB 2DLFH 4PJCA 1H15B 1NKRA 4ZO8A 2N0KA 2VR4A 4UT6H 5F7LB 3G9AB 1DQQA 3UAEA 5E03A 4YDJA 3QXDA 1Q9KA 5C0JA 2WIIB 4N2FA 3WS6A 3GO1L 3QJXA 5MP6H 2SEBA 2FD6L 4DGIH 1RIUL 1X9UA 2WTPA 3JWNE 4W4OC 2FR4B 1K8DA 1B90A 1KTLA 5EU5B 1UENA 4C59B 2DDQL 2YUVA 3LQAC 5E8PB 4KXZI 3HFML 3QNYB 4GRLB 2NY3D 5DJ6A 1TZAA 1RUMH 4UIKH 3S3CB 4MAZA 3B7YA 5CWSA 1HCYA 4QRTA 1KB9K 5HYJD 2HRPH 4LAQL 4MZ2A 4UU9B 5KTEL 3WS6C 2FBJH 2VR3A 2BY1A 5LN8A 2ZPKH 1BD2A 1LVEA 1QI3A 1AGBB 3GMOA 1H3GA 5BMFL 3GC3A 3AY2A 3BZDA 5AZ2L 5DHYA 4LSPL 1KF9B 1FCGA 5E9AA 5HYJA 3NDZE 1YY8A 4X99B 4XN8A 1H9DA 4GAYB 3V5DB 2J1ZA 3KNBA 2IQAA 4PJ7E 1OQXA 3OAWA 1OM9A 2UVFA 2XPZA 3BHBB 5BXFA 3C8KA 2R2CA 4P2RE 4PGEA 3SBWA 2D7QA 2IOOA 2NY3C 3Q9PA 1QO3A 3OC8A 3DIVA 2XQYA 3IN0A 1G7LB 3OR6A 4MCZB 4PCYA 1FZJA 4HOZA 4JL2A 2UXFA 4PQXA 4KK8D 1RUKH 1Z3GH 4MSWB 4WEEA 2VITA 3HEIB 4IKNA 5E9NA 4HJSA 4XI5D 3UTSB 5EZPA 3D34A 1N2RA 2VLJB 2YK1L 3M46A 3GZQA 4XP6H 3OHMB 1EBPA 2Y2WA 3FO1A 2IV8A 3SBWC 5GRYA 4K7FA 4WSGA 3L1FA 5CR1A 4NOFA 3CZEA 1S3RA 4J3OF 3VW3L 1ZLSH 5J5EA 3HG1B 3FL7A 1O9WA 1KCKA 2HKHH 5TDNA 4AIZA 1AMXA 4BWWA 2NUTB 3AMKA 4L8SA 2OCCB 2E76C 3WEXB 4X9YA 4ZS6D 2DD8H 2Y5QA 1IAKB 4KK8C 2Q8BH 5F8QC 2YD3A 5TTRA 2LOEA 5FB8B 1EZLA 1XGUB 1NCBH 2K9FB 2FJGA 2QV4A 2VC2B 4I0KA 4U7MA 1RZ8A 3WAKA 4K3DL 4MDJB 3L3OA 3WJMA 4ALAL 4G42B 4ANWA 1ASPA 4Z7NE 1WBZA 4PB0L 1A4AA 4L8SC 4ZOCA 1UEYA 2Y2YA 4ZXBD 2CUAA 1LTXA 2DTSA 3ZX1A 2WC7A 4JO4L 4BSWA 4PS3A 3MV8D 5K1NA 1GZQB 1XGYL 1JD7A 2Y5TA 5FK9B 3L3OC 3RU8L 5I0YA 5GGRB 1INDH 5KJRH 2FZ3A 3MV8A 1EZVX 4FQ2H 2R8SL 1VZIA 1ZHLB 5B1JA 4HULB 2F6AA 4ZUTA 2IPTL 5JHDA 3RVTD 4H1LG 4NZFA 4N8PA 3L1OH 5I26A 1E4WH 1UVQB 4Y7OC 4JUTA 4G5ZL 4PJ8B 4PJDE 4DK5A 1EHLH 4CNIA 4WK4B 8PAZA 3UIZA 1PW3A 4ZFOB 1SHMA 2ZUXA 1C8PA 2BVYA 1TTCA 4ZMNA 2IAND 3U46A 1MDTA 2QVFB 2UYLB 3L4XA 3QHTC 1RFDH 5F8RC 4CSZA 5BOZG 2OBGA 1JGLL 1S5HA 2IDFA 3AMLA 3VQLA 4BKTC 2VZOA 4IEFA 5EV7A 5B1JC 2BP0A 1LP9E 3MHZA 1KZYA 1N59B 2OJ1A 3MA9L 2IANA 2C9RA 2C1PB 2G5BB 4IJ3B 5JOPE 3B83A 1Q9WB 4HIEB 3KPQA 3DURA 4KQ4H 4FA7B 4F37F 2A9DA 5TF0A 4F1SA 2NT0A 4L4VA 1HHGA 4I1NB 4JHAL 3REVB 3KM2A 3OLGA 3OXRB 5D2NC 3K2UL 2VLME 1MY5A 1BLNA 5EBGA 2B9AA 4AYDC 3KEDA 3FOMA 2EDMA 4GW1B 4NHUA 4JRXD 1RHFA 4PEEA 4RFEB 2HFEA 1PZCA 1MH5A 4X7SH 4EDXA 1G6RB 5GGQL 2NNAB 5LG6A 2NZIA 4U1NA 3WGUB 1HQ4A 3KLDA 4NAJA 2JF1A 1LJMA 2DI9A 3TV8A 5LXVA 4MDIA 5T3ZE 1TJHL 5D7LB 4Y1TA 1YEGH 3RP1A 1U8IA 2XPGA 1YEFH 2Z35A 2PTTA 1T03L 1XF2A 4L9LA 1NUDA 1RZQA 3M1BB 3NG5A 5T5FH 4N8VB 1WA0X 4P2RB 4PLNC 3NK4A 3D3VA 3PXJA 3BN3B 5H4YA 3ARSA 5ESVB 1G0XA 4Y9BA 2AQSA 3VFSB 4IM8A 5HTSA 1RULL 2EIZB 2NNXA 2ZXBA 2A99A 2VCOA 1MWAA 1B3IA 4PJHB 1OW0A 1INQB 2GBUA 3ATFA 5I9QB 4AYEC 5J7CC 3IFPA 4ODHL 4UINH 1X5AA 1F4XL 4L9LC 1I7TA 1Z5LA 2DI7A 4G70B 2WYIA 2WXQA 2G5RA 5FCUH 2JV6A 5HVWA 1NICA 1HOEA 4KROB 4TLUA 5FFLA 4HKXA 2X2IA 3N85L 3CPUA 1WZKA 2OCFD 1QZNA 4YZFE 4CSSA 5I1IH 4FI8A 5L2KB 3ESNA 3P2BA 2P5PA 2YOCA 3B34A 1HNFA 2CO4A 1I9JH 3KJ4B 1OW0C 1IGFL 1MW1A 4K9JA 3MJ6A 2J71A 3TCLB 2XSKA 3I02A 3V0IA 3O8XD 4R7DB 3OGCB 1YN6B 2BP8B 4AUJA 2CDGA 4MJID 3FN0L 1WGOA 2OSLA 3DRTA 5HGBB 5I75C 2AKRB 3UMTA 1DBMH 2WO2B 2L7EA 3P73A 1CDYA 1YC7A 2DIJA 4MRCA 3FQUB 1MCKA 3KM1A 4PP1C 2WP3T 4CMMA 4ECNA 3H4FA 2XTJD 2WLKA 3VE0A 5JR1L 1GS8A 2WYZA 1ZXQA 5GS0H 5IFHH 1KDIA 1YMMD 2ED9A 4NS0A 4PV9B 4AH2B 3DGGB 1KXTA 3HJEA 5E08H 2EABA 5JXED 1KFAH 1JXGA 3FQNB 4FA6A 2QZ5A 4XNZC 3D8MA 2O5YH 1EGJL 5B39B 5EZIH 1YAZA 1ZGLA 4F7MB 1XXDC 4F92B 4OV5B 3CHSA 2AV7B 5D5MA 2X4OA 1TSRA 1UJ3B 2AQ1A 4XMWA 4U6XA 2W88A 5T5NF 1WUNT 4AL8H 2VN3A 1UHVA 3HAEG 2F19L 2BM3A 4G9FB 3U2SA 4OUOA 3N40P 3OKNB 3MR9B 2Y06L 4OIIH 1EJOH 3D2UB 4UOJA 3WTVA 3X14B 2P48B 4DESA 2L7JA 1WE5A 5EUKA 3CFBB 4KV5F 4J3UA 4KUZL 5E6SB 3LKRB 4ZFFA 3TWCH 3CN1A 1OVZA 5JXEC 2QSTA 4M62H 1GCYA 4KVNH 5BJTB 1I8UA 4B9IA 4CVUA 3SDCD 3UADA 5L2JA 1LO5B 1P2CA 1KCVH 3BKJH 4KZCA 2ZOOA 4DP1X 1C16A 4QHUA 1QZ1A 1DANU 3BPOB 3IMWA 4HIIB 2WY3B 2F08A 4WAFA 1EA9C 2DQUL 1CFVH 2O5ZH 1A3RH 3H7BB 2ARWA 3BD4A 3DVFA 3BGMA 1FO0B 1H3VA 5F1KC 3IVKB 4R5VA 2X1PA 2OSYA 4Q74A 4XP1L 3UDWA 3V6FA 5C3IA 4K5LA 2QQLL 3L9RA 5DZLA 3MO1B 2WSDA 4DQOL 2E6QA 5HHPA 4DJMA 3WN5B 1IC7L 3ULVE 4PW9A 4W1TA 5DMIL 1R5IA 4GB9A 4PM1A 1W2KT 1BVOA 3F3HA 1KJ2L 2HZHA 4ANKA 9PCYA 4WWKD 4E9YA 4M48H 1H0DB 1KXHA 1BJ8A 5PAZA 4DN4H 5CHNB 2IOMA 3DYMA 5DJ0A 3AVEA 1IQWH 3ZTJH 5EU7C 3KDMA 3UDWC 4P46B 3WNNA 2OS7A 3D69B 2CK0H 2X6UA 3DYOA 3MRLA 4JY4B 1BV8A 4OKDA 3SDAD 1KV3A 3QCVH 4UUJA 4FXGB 3L3GA 4ELMB 2IH8A 4PTTA 1AXIB 2OJEA 3S97C 4E2OA 1VPOH 4IMKA 2LU4A 5DZPA 1TETL 4AMWA 4UNVA 5IQ9B 4JNXA 1BYOA 2CRMA 4UT6A 3HW7A 4WTXA 2HA1A 3OKDB 5FYJH 3SDAA 3DI3B 3EBGA 1FUNA 1Q1PA 4ZD3H 1YYLH 1U91B 5IB3B 1IKOP 4PHXA 1G7IA 3OMZA 3QRLA 3CN0A 2HVJB 2X70B 3VQ1C 2YMOA 5A6LA 2GC7C 2RB8A 3CHRA 4MMXA 5IBUG 3LV3B 1K4DB 3HB3D 3DXAB 2W81C 2BVEA 3GTNA 4IMKC 4Q2ZB 3LMJL 3M1OA 4F33B 1RKRA 4NKDA 1AGFB 3L5XL 3W37A 4JQIH 1MOEA 3SDAC 5HHQA 3LRHA 3OKOA 4BQ6A 2RCSH 3QFDA 3TWYA 4ZUUB 3KS0H 4NAQA 2NYZA 1E5ZA 3NIDF 2PW1B 4E41D 1YDPB 3EGDA 4MMXC 3P0GB 4X98B 1DBJL 2CWRA 3A67H 1MCQA 3BYYA 3L13A 4JRYE 1G0YR 2CA4A 1VJSA 5LGJA 3EDKA 4E41A 4XO9A 4S0SD 4OSUL 1KWGA 5IW3A 2EEFA 1YQVL 3HB3C 3VD5A 3WLBA 3IMBA 2VRKA 3EFDH 5I5IA 1JUFB 4FFYL 2GBTA 3OKMB 5F96L 4PJAF 1L0YA 5CLXA 5B21A 1E43A 1PCXA 5SWQB 4HIHA 5FPIA 2VLKB 2IDQA 2XOTA 3GSOB 2A3TA 1CTOA 2FNBA 2V17H 4H8PA 4X7FC 3ZE0E 4XHJD 4RMTA 4ZMAT 5IBTL 1WHPA 1QYGH 3RX7A 5EDSA 5I28A 4YDIL 4HBCL 4ZAKB 2FWUA 2NCMA 3MGOA 3TC9A 3VSQA 1KOAA 1A3QA 5J6GA 2Z93B 2F53D 4EXPX 2E7CA 2VJXA 1JRHH 1P4BH 4XCNB 2R29H 4MJ4A 1VZGA 3WDIA 1DQVA 4G8FA 3ZMNA 2FK9A 5TGBA 4YFLF 1QSZA 4FMKA 5FOBB 1IBBA 5AWNH 5JW4R 4Y2DA 2P8LB 1MCPL 2P24B 4OGXH 1XGPB 4XHJC 2APBA 2LU3A 3GMRB 4HGWB 4Z23A 2XU9A 1U30A 1NJ9A 2VDOL 3UABA 2IQ9L 1T80A 2YC1B 2VDMH 4NO3A 1NGZB 5FW7A 3A6BH 4PJGF 4WO4B 4IDLA