5BO0D

Crystal structure of human mcm2 hbd and asf1b chaperoning a histone h3.2-h4 dimer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
154
structure length
154
Chain Sequence
MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/dna binding protein
total genus 26
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 5bo0D00
2Z34A 5BNXD 4ZBJA 2HUEA 2IIJA 2Z3FA 4EO5A 2CU9A 3AADB 2I32A 1ROCA 2IDCA 5C3IA 4RRPM 5BO0D 1WG3A 1TEYA 2DZEA 5EIIG 2YGVA 2IO5A
chains in the Genus database with same CATH superfamily
5E1IA 5T3XD 5DGRA 2CGRL 4GKNA 2C3XA 3AREA 2QZ5A 3DPDA 1XIWA 1BF2A 4YQXL 2AV7B 2UZXA 2W9DL 3SKJL 1RSYA 4N6QA 3NYKA 5IHBA 3P30H 1RMFH 4BSVB 2FQDA 4XPAH 4QXVA 3QDGD 3PWPE 2DDQL 4XNQA 4GG6B 5GRVL 4LCCC 4ONFL 4QCIB 1S7WB 1VFUA 1JGUL 2BOCA 4LMQI 4I1PA 4U1IB 5CSZA 3HOGA 4XN9A 5I19L 4P46A 5IM7A 3ZE2F 1H6FA 3RVWD 3V7AG 5KYXA 5JDSA 3RGVB 1HINL 1VERA 3WLBA 1KUMA 2KQMA 4WFED 2NYYD 3KWUA 2PR4H 3DBXA 3P77B 1CDIA 1S9XA 4MTMA 2MPAL 1W9XA 4IIQC 3BT0A 4B95C 3F85A 1G7HA 1QABA 3QCTL 3NZUA 2YJLA 2RBLA 3V4VA 3TIEA 3GPSA 5CJXA 2OP4H 2VMEA 1SJHB 4OCSL 3U25A 1XCQB 3BVXA 2HJKB 3KL3A 3ISRA 1IV8A 4DZ8B 1RL1A 4N2NA 4U6YB 2BH0A 1E7VA 1NBVL 3T77A 4ETQA 5J13C 3GMPA 2AMGA 4OQ1A 5IMOA 1NFIA 4OIFA 1ZXKA 3OPZL 4MAYB 3CC1A 3F6LA 1NDTA 3QAQA 4EOWL 4OLUH 1IBGL 4PV9A 5C07A 4A2GA 4KNUA 3QIUA 3VWJC 2KC0A 5DURD 1A02N 4CVUA 4M1CC 4KKAD 4WFGD 4PG2A 4S0SD 5D72H 1JPFA 2BP5M 1TEYA 2EEDA 3T3PF 1BA9A 1EEYB 1D6VH 3L3KA 5FYKD 2SODB 3K1DA 1I9IH 3MOAL 1AQHA 4MMZB 3B2MA 3JTTA 1W6WA 1OTTC 2LV4A 2WCSA 5T1LB 3LNIA 5CBEB 4MA1B 1XEDA 5JZ7C 1M71B 2VDLL 3N04A 3HG1E 3U4EA 1AIFB 4J2XA 2VERA 3WFHA 2VABA 2VN3A 2PCPA 1CGUA 2I32A 3N40P 1ONQB 4OB5L 4X50A 3KZ8A 2P5EB 2XWRA 1MJ8H 1HIMH 1QZ1A 1JWUB 3PFQA 1EAPB 3LKQB 3OXSA 4L3EB 5DVMA 5FHAH 4YWGL 1YPZB 1U41A 2QQNL 4MLIA 4L1TA 4Y16A 5HJ3A 2YQBA 1A1NB 3VMNA 5KAQG 2VMCA 4O58H 1R3JA 3EDFA 4UIMB 3QG7H 4YUEL 1PY0A 4KK5C 1MPAL 1WQVT 3RFZB 2TSBA 1WWCA 1LE5B 1JYWA 2GG1A 4JFFD 4ODVL 5KZCB 4EZJA 5ENWB 4W70A 3VXSD 1UH3A 2FX8L 3WAKA 4HISA 2MOVA 3T08A 1WEJH 1KGUA 3T8VA 3MUGB 4MXQC 3GRWA 2V4LA 3G08A 3MA9H 1O7DE 2CXGA 3EG9B 4LCYB 3RKDC 2UYLB 3K8MA 4CKVX 3SQRA 5T3ZE 3NFPA 3SE6A 5F3BA 4R5XA 4D3CL 1F00I 4WUUA 5B3JF 5HHNB 3ZYOA 2MH4A 4ZMTA 5IW1A 5F3HB 3OKKB 4M7ZC 1KF9B 2J6WA 1XGPB 5C0GA 3RWDA 3D12B 2FIRT 5AZUA 2BVQB 4LHUA 4PS4L 1X7QA 3DYOA 5BZZA 3LEVL 1YG9A 4MX7A 3LH9A 3MODL 3N5AA 2E7MA 4QRRB 4YXKL 3GSWB 2A6JA 1P4IL 2HT4D 3MXWL 4GQRA 4OCRL 2DMBA 2QKSA 3DTDA 3JUYA 3BIKA 4IBTA 5HGBA 2ICWJ 2GC7C 5LNEA 5E4IA 2HG5B 4FZ8H 5DHMC 1NDGA 1PFCA 1MCCA 4LLYB 1BHGA 4BQ9A 2ZKXA 4XB3A 3WHXB 4NRXB 5K9JL 5C0CA 1JGLL 1HXYB 5IOKA 4MYPA 2EECA 3BPLC 2VLLA 5IFAH 2IBBA 1FHNA 4OZGE 1IEAB 1AGDB 5JA9A 4XXWA 3AQDA 3QIWC 3I2CL 1ADQH 4BV1A 4OV5B 4Z8FH 3TPKA 1R5IB 3X2QB 1A1OB 4X4MA 1AQKL 3QRBA 5AW0B 1K6QL 2DW5A 5AWNH 4H88H 4QXTA 5EZOH 2F53D 4ZW3A 5DVLA 2OMBA 4AT6B 4WHYH 4YJZL 3IJEB 5M7QA 1DQLL 1N0XL 5I8OH 3VDBA 4PRHD 2X09A 4DF9A 4PCYA 1IM3B 2CRZA 4RH4A 4F5CE 4ZMAT 4F8NA 4J3OH 1K8IB 4M7LT 1QLRB 1MHCA 2JKTM 2JKXA 5HYSG 2WTPA 5ECGA 2VDPB 1S8DA 4X9FA 1O7SA 4WSGA 1KN2H 2JB5L 1WTGT 1N0LB 3G3LA 3VWKD 4PPTA 2DM7A 2W5PA 4CBPA 1TQWA 1JN6B 5E70A 1QHPA 3IE9A 2H32H 4M7KH 4PLJD 4XCEA 4KTYA 1LO0H 1UATA 3QZNA 2WQVA 3APDA 4JZJB 3MNDA 4Z7NB 3SYPA 2MCMA 3MRIA 1NINA 4WLCA 1TYJA 1ZIBA 5LLIC 2BLFA 2WBJD 4NKIH 4L05A 1BM3L 4Y2OB 1HYRC 5HHME 4B9FA 2AEPH 1KACB 3WSQL 2WXPA 1YYLH 2AJUH 3HFML 4GQZA 1RJZA 1LO5A 1LEKA 3VFTA 2ATPB 2JCCF 4Z3GA 5F88A 1SOQA 1QOKA 3OHXA 1CL7H 1F4WH 3K80A 3K2UL 4FFWC 1FL3A 4ZSOA 2AAVA 1UM4L 4LAQH 5KW9L 3CZFB 1ICTA 3O2WL 4UT9L 1J8HE 1OXYA 2IH9A 4RIRB 3QUXA 3K2IA 4J8RB 4F2MB 4P5TB 3VH8G 1ZCRA 4LPYA 5I0DA 3ZKND 4PJ9B 4X80H 3CVDA 1WG3A 4P49A 1F6LL 4TNGA 2LT9A 1UD4A 3LZNA 5L4MA 2ZPKH 2BM3A 1MCPL 3FYIB 3QO1A 2ADJA 3H53A 4N2LA 3HG0A 2CLVB 5G4MA 2OXHB 2JLLA 3GXFA 3LPPA 3ROOA 3JV4B 3EFDL 4PRPA 4I0PD 5TE7H 1Z6JT 3QZWA 2DWTA 1JPST 4N2HA 4MJIB 3EKCA 4F7KA 4LQ1A 3E38A 4MD0A 4J23A 1PMYA 4XTRC 3TFKD 2GT9B 4C55A 4FERA 1HVXA 4G7SB 4HEPG 5EIVA 3S35H 3ZT6A 4N8CL 3ZSTA 2Y22A 3LS5H 2VAAB 1MFEL 4HAGA 1TU2B 3HW7A 1NIAA 2APVA 4R3SB 3FL7A 4LCWB 1IC7L 1NAMB 3M86A 4DP1X 5A3ID 3ECQA 1NUDA 3LZLA 2N7SA 3IGAA 3D06A 1FO0H 2B16A 4Z78B 4FL4B 4LNRA 3HMXL 4WI0A 2A4EA 3OX8B 1AGCA 3ALWA 2R2BA 1W8OA 3ZDYB 4G71B 3L1FA 2VMJA 4BK5A 1HKLL 3AAZB 2A0LC 5EEWA 4DAGL 1V27A 2X4QA 4JREC 3IJSB 4DVRH 4X6EA 2EDRA 2QPSA 4N0FA 3ULUF 4HIPA 2IGLA 1TPXC 1ZLDA 2CO2A 2IIJA 3BESR 2L7JA 3QI9C 4F37K 4XOBA 4DHLA 5D7EA 5C0BA 2X12A 5FR3A 4PSPA 4L5FE 2NR6C 3DK2A 3FZUC 1YEEH 3HLAA 3IAPA 5KSAC 3B5HA 4C59B 3OHMB 5E4OA 4QOKB 3BXNA 2IXQB 2DI9A 2A9AA 4R2GC 1MUJB 2NXZB 3SB3A 2VN5A 3WTTA 2A3TA 4AH2A 4KRPC 4Z7OF 5I8CA 1MWAA 12E8L 1IE4A 2C9RA 3M46A 2CBMA 3N55A 3ZGIA 2B1AH 2WIMA 2ZAHA 4LSUL 4YX2H 5D7LD 4AKQA 1DANT 2O6FA 1JPGA 1F1GA 2DM4A 3IJ8A 1S7XA 4RAUB 1SHXA 5DFVD 5C9JB 1J5IA 4X9YA 3L3IB 1OY3B 4C56B 3GMMA 1ZTXH 3CFKB 5BQDA 1HSAB 5HHQB 2EVHA 2M26A 4V33A 3K74B 3HPLA 4TSAL 5E8DH 1I7TB 3Q43A 2VQ1B 2EQDA 3CG8A 4K5OA 3QQDA 4IRJD 4P2QD 5CILH 4Y2DC 5ALBH 3V0HA 5LQBL 1N59A 2HUHA 2EO1A 1Q9LA 3SBQA 4ZS6C 2VDPH 1TEFA 2UY6B 1R5VB 4NC1C 5F7MC 3UABA 3H2WA 5EV7A 4EDXB 1PZ5B 3K6OA 2F61A 3GIZL 1RZQA 5F0JB 7PAZA 5HYSA 3CDZA 3UBXI 3RZCC 1R47A 2F58H 2BNRB 3D85B 4CSZA 1IGTB 1PVHA 1CDHA 4WO4D 3KPOB 3C6LD 2NY3C 4QYOB 4NKMA 3ZE0E 1EBPA 2KL6A 2X2HA 1OEZW 1HI6A 4TTGA 4FN0A 4B9ZA 1KB5L 2GTWB 3CZEA 4BK8A 2VISB 1W80A 5FUZL 2W0FB 3I9GH 3FB8B 1A7RL 3ZE1F 2X38A 4MNGE 3MUUA 2G60L 1DQVA 1MLBA 2FUTA 4GAAA 1G5GA 4YDZA 1RD6A 1OB0A 2F54D 3WNPA 3OAZK 3LQZA 2ETWA 3U9UA 1X9LA 4UTBH 5DVKA 5J89A 4GI9A 1F42A 4L29B 4QAMB 5L8KB 2GCYB 2WLIB 3KM1A 4M1GH 4FG0A 4YDJA 1RHFA 3QDJB 2ICEA 1WA1X 5I1EL 2DWEA 5DK0B 3TEWA 5GHWL 4X8JA 5C09B 1N8ZA 3AREC 3N91A 5DRXA 2AAAA 1XIWC 3Q01A 4PS7A 4Z6AT 5AAWA 1I31A 3FONB 2LLGA 4F9PA 2D0HA 5LO7A 1LWRA 4PCKA 4A2MA 1BFSA 1RZKL 3M17B 4NQTA 4H2AA 1EAQA 4HD5A 3M45A 4YHZH 4BFFA 2YUWA 2BWDA 5JQ6L 4OCYH 3D4GA 1NCBH 4EQ2A 5IF0A 1QPPA 3RGVD 1WJ3A 4XMKL 4J3OD 5G4OA 4BH7A 1AY1L 1JXKA 2C9VA 2EYRB 2JELH 2B4CH 3JSSA 1BX2A 3L4UA 4HUKB 3FUJA 4GRWH 1E28A 4NNYA 4XX1E 2I24N 5EO0B 1SEBA 4FULA 4KZEL 5BV7L 1MAML 4CSTA 2CWRA 3MUJA 4AGNA 5SWQA 3BFWA 3O41B 3V4PH 4BKTC 4R26L 2CHZA 5J6GA 2CGZA 4BFNA 3LKRA 3EBGA 2FR4A 1ERNA 5CJXC 4IW4C 3C60D 3PXJA 5I1JL 4PJCB 3PDOB 1OSZA 2P5WB 4MAYD 5IUSA 5L6YL 1ORQB 3D3VB 4NRZB 3MHZA 2PNDA 1AD9B 1WZKA 5F7BA 3MLUH 1IEBB 3TO4A 4HUCA 1SZNA 3ATDA 2OZ4L 2FJHB 5DJZA 4UANA 2P3YA 1WWBX 3PL6A 5SX5K 2EH8H 4Z1PA 4U0RB 3KPRE 4TQIA 1A9EB 3IK2A 1WCBB 4ELMA 4JPIB 3QIUC 1LD9A 5ICZA 3DPBA 3BVDB 1YNTB 3H9ZA 3FPYA 2C9QA 3DURA 1BVKA 4IKJA 4PG2C 5T1LD 3R7QA 3UDWA 1KYDA 5I0YA 3OAZH 5E5UB 2ODIA 5FA3A 4I0KA 3OM3B 1M3IA 1C1EH 1PG7W 2P5ED 4DGIH 1GZPA 3RVUC 1QNZL 2EDJA 1HHKB 2XTJC 2X0WA 3FFDA 4PMEA 4QY8A 4HMCA 2BSEA 3B6SA 2P52A 2N01B 2ZXGA 3F7KA 1DQJB 1JV2A 1I9JH 3S3SA 4H8PA 2WCGA 4GRLB 3LKSB 2HRLA 1B2WH 3DO3A 3ASNB 4NPYA 4Y16C 8FABB 1C5DB 3WFDH 4ICWA 3J07A 1TVHA 3Q1SH 5TPWH 4JHAL 2YAEA 1HCZA 2CLZA 3MGTA 2DY2A 2CUHA 2H2PC 4MB3A 4QTFA 2XXCB 3TU6A 3HRPA 3LH2H 3F7VA 1O7VA 1TJIH 4OIIL 1SUHA 2XWZA 4JM2B 4ZUWA 3ESNA 5EN2B 4FCAA 4HXBL 4DGUA 3IFNH 1OARL 4L8CB 4KKCC 3OZLA 1MFBL 4KTEH 1A5FH 1SVBA 1PLGH 5TGBB 1UYWH 4Z7AA 3NSFA 4Z23A 5HDBB 2OJZL 5FGCE 2K6WA 3AADB 3PAZA 5HVWA 2ED6A 4ACPA 1L9PA 2VDML 1FSKC 2OMXB 2GBAA 4M61A 3OQ3B 4FQ1H 4UYQA 1R1CA 1RXLA 4YDVB 3PGFH 1S7SB 5ACZA 2NY5H 3WMPA 4NFCA 1B0RA 5TDOA 3TBYA 4MKMA 1YNKL 4L4VE 1MREL 4TVSa 5EU4B 1Y6MR 4KXZH 5AW4B 1P7KA 4K7PH 1FZMB 4JJOA 4YSUA 4R4BA 2P45B 4TULH 2EXWC 4HZLB 4PGDB 3OKNA 5A6LA 1ET5A 5TJWK 3STBA 5FUOL 3BPOC 3H9SB 1H5BA 4ZJ9A 1CMOA 1FVDA 1T89A 4B9CA 4CSSA 1CFBA 4LL9A 1UJTA 1Z5LA 2A6DB 2E9GA 4AI7A 1VFAA 3S37H 3NOIA 2ZOLA 2WWMD 3OF6A 4YPGB 4HFUL 2AANA 1OL0A 1WBXA 4YHML 4JKMA 3N85L 1MCQA 4K7PY 5EF1A 3CZKA 1IGML 2EXSA 3GGWA 3EO9L 1BAWA 2B2XL 2OI9C 5EORH 5F9JB 4HHAA 4ODXA 4ZDHB 4NENA 4FABH 4XXWC 5DS2A 1DCEA 1P7QA 1PG7X 4H0LC 3U4BH 3T2QA 1D9KB 2HKHL 4EZKA 4XO9A 3AUWB 4F15C 3V5DB 1GGBL 4PREA 3D1MC 1E4XL 2NLJA 2PWDA 4LVOB 4ODBD 3JWNH 1IM3D 2GSGB 4PJ8A 1OAXL 2EIZB 2BCMA 1SDAB 2IH3B 4YH6A 2ZSWB 2ZOKA 4F20A 1PAZA 2DQEH 3DV4A 4I2XE 3HHRB 3FO9A 4LEXL 5I1AA 2R0KL 4Q9RH 3QXUA 4OJCA 4OLEA 3CVHA 4YLQT 1IGIL 4RFNB 1WZAA 1JMZA 5KANG 1QFWL 4DP9X 2ESVE 3SY0B 2OX5B 3BAEH 4S0HA 2F9BT 5KBDA 2GJZB 1INDH 2BP3A 4PBXA 4W9KC 4OAWA 2VITB 1NJ9B 3BMVA 1CE1L 3MLWL 1G9HA 3BYYA 3DX1A 2F53A 4HS8H 5KVEE 1T2JA 4MJ6B 4GBXB 4ZOCA 2ZUUA 4JGUA 1NC2B 3LS4H 4PRHA 2IFGA 5JHDA 3HUJA 2AVGA 3BT2L 5IROA 5JHBA 2FJFA 5EDSA 1WO2A 5HI3C 1Z5YD 4G43A 2DIEA 2PCFB 1G84A 3UAEA 2MWCA 3WTYA 8PAZA 1JCVA 1X7SA 1Z9MA 4LF3B 2WLJA 4HBQA 3ARQA 3LNFA 3GI8H 2B14A 1OQOA 3OLEA 1JNLL 2AQ3A 3QXAA 1URLA 3OHXC 2IAMB 4GNKB 4HH9B 3VXUA 5A43C 5DS1A 4IJ3C 1Q8MA 2DJSA 1T1XB 1RK1A 3U79A 3T4AA 4P5TD 3WY3A 1RURH 4XMZA 2WBJA 1JXJA 3NK4A 4PJ9D 1A1MA 5ACMA 3CXDL 3QUXC 1SUJA 4X6DE 1J5OH 1U8KA 1PEZA 1S9KC 3VJ6B 4R7NA 1FNLA 4GG8B 4AQEB 5EU6B 1V05A 5D1ZD 3BLPX 3WIFB 4D7BA 1MQ8A 2G2RA 3ETSA 2PTTB 1BJ1J 2Q20A 3QJTB 5CD5C 4Y4KB 4FQCL 4NO5B 4KMTL 1AJ7L 4HT1L 5TH2B 1D5BB 3E8VA 4M6NL 4MJID 3CDCA 2ZE0A 2F5BH 5D4QA 2EDDA 2ENJA 1UOKA 3DXAE 5LN4A 3MRCB 2XWTB 4L1LA 4GW4A 3DX0A 4YC2C 4C57C 4Q9QL 1T1YA 3MRGB 3NIFE 2CDFB 1D5IH 3QXWA 4FXKB 5L2KD 4LMQE 3FTXA 1HHIB 2A73B 2WP3O 1H15A 3KBEA 4OKVA 1A7NL 3UZQB 1TVBB 4LCWD 3G6JB 3KJ4C 5LDUA 4LE8A 1QI4A 4X9BA 3CFEB 2E3VA 4EXKA 4LOEA 1M7DA 1MRCH 1O0VA 2LAAA 4L18A 4XBGB 4V11A 4UNUA 1I1FB 4DCQA 2EIJB 3T0EA 1UQSB 1QMUA 4N90E 5LUMA 3SGDI 4RRPG 4BH8B 3L4XA 1AZZC 1EHXA 2D03H 4ZOEA 3SKUD 4TQ8A 1G0DA 4HIQA 2IOIA 1DVSA 1OE3A 2AJZA 3PWPB 3QQ9D 3C5SB 4LVNB 5DD0L 4BK5C 5A2LH 1O6VA 1QG3A 1NKRA 3MV7E 2KLSA 4PJAE 1NLBH 4KXDA 1QTYT 1HEZB 1B4JL 3IJ7A 3QC5X 2XA3A 3DJTA 1F6AA 4HKXB 3ELQA 4JKNA 3WIIH 5BO1H 4TVPH 2R0LH 4QOKD 4JAMA 2IPTL 4AIXA 3SIKA 2NXZD 5DEZA 3L5WA 3MLPA 1CBVL 3O4OB 2Y23A 3DWTA 3GM0A 3WS3B 4P59L 1CLZL 1U8IB 1I53A 4PB0L 1ULVA 1JV5B 3MI6A 5FW6A 1OAYH 4U3HA 1FVCA 2VIRA 3PWJB 3HS9A 2BCKA 1CK0H 1YY9D 1AQDA 4PW3A 4WENB 4UTAH 3UBFA 1BVLB 4LLAA 3FU8A 1JERA 3GDCA 1RZIA 1WZ1L 2C7FA 4PI2A 5B39B 1IC4H 3WTUA 1QPKA 4JGNA 1IC1A 1IRAY 4KUCD 1KEMH 3NCXA 3NCJH 3W11D 5HJBA 1ZPLA 1CGYA 2VR6A 2PP9A 5ID1A 2X6UA 3OB0H 3VU1A 2R69L 5KSUB 2WXMA 3T0DA 1ZHBB 2BNQE 4HOZA 3O2DL 4NJ9L 4NP4H 3ARSA 3WKPA 4FZEL 3HNVL 5C08A 3L1OH 3UJIL 3ZRCC 1A66A 1YUHB 3ME0B 5D6CB 5A2JH 5F8RC 1I3GH 4MA8L 1E6JL 1YQ2A 3DSFL 4D0DB 7FABH 1Z9SB 1EV2E 2BNRD 2OR9H 3D85D 3MRKB 3PWUA 4GSUA 4HKBA 4DK5A 1GGCL 2DN7A 3X14B 4EDWH 2PXYB 4JO8A 2ZYHA 4I3GA 1T6WA 1R3KB 1NGWA 5EUOA 4J3WA 4UB0H 3TA3B 1IC0A 5KWYC 4E9RA 3F7LA 2R27A 2HVKB 4PJ6A 1V8HA 5LXVA 3S34L 2X4OA 4ABQA 5EEXA 4XVSH 2ATKB 5HYIA 1JZ3A 3T6VA 5DRWA 2XBZA 3C8DA 3ZE2E 5ANMA 2NY2C 3RVTD 4P2QA 3FHEA 4MDJB 3ARGA 1J0IA 2VDKL 1J5CA 3OAUH 4IOSD 1PJ9A 3FQYA 3ARBD 3LN9A 4HUMB 5TDNA 3V0FA 4AGOA 2OLDA 1TJXA 1JGIA 4MB5A 3L3DA 3LPFA 3QDJD 3P9LA 3APCA 4I89A 5DJAA 5DJXB 2W1NA 2Z8SA 4HCIA 5T5NG 2IDTA 3TNMB 5HDQL 5GPRA 4FQIH 5C09D 2DLTA 3CSFA 2EXYC 4PJBA 2OSYA 4Z76A 3TF4A 3QB7C 2Y2WA 2ICEC 5KVGL 3TEZA 1MNUH 3FMGL 3OKEB 5DU7A 5D4JA 3MLZL 4OCNC 3DVGA 3NN8B 2F5AH 4MRBA 3S88H 3D4CA 5D2NB 5AAWC 2GJ6A 1UG9A 5DD1H 2WXFA 4F9PC 1PLAA 3B7SA 4WWKB 4JMNA 3WJMA 4QHMA 1HCVA 2VDRB 3LXBA 1FC1A 5DTFB 5EZJB 3T0WA 2WJ5A 4CADA 2V5RA 4QRPD 3UCQA 1AZUA 2FEJA 3BGMB 4TN9A 3QPKA 5GRWA 2Z1PA 1N68A 5K1JA 2EH7L 4ZFZB 3FRPG 5CCKH 5ILTH 2D3JA 5BCAA 3GUTA 1ADQA 1N26A 2B9AA 3T3PE 4ZNEA 2UUDK 2LLLA 4P3WA 2OTUA 3WKYA 5KVFL 4MCZB 4WW2F 1JL8A 4MXVF 5K93A 2Z35B 1QHQA 1S7WA 5I71C 3MBXL 4U1IA 4APXA 2XPYA 3EHBD 2P5WD 1CURA 3LEYL 2O6PA 4XP6H 5D5MF 3DI3B 3QDHA 4NC2B 4S1QL 4YDIL 4X8GA 3IDXL 2GK2A 3PABA 3SQBB 3WFEH 1OSEA 4JFWA 3MJGX 3EF4A 1PKOA 3U7AA 1MSPA 5DUML 1R24B 4L1BA 2R2HB 3BWUC 3IMSA 2W65B 4Q0XL 1ZT4B 3CN4A 3KVDD 4AKPA 3TO4C 3EH4B 4UINL 1QRNE 2H32A 3CXFA 1I8IB 1VFBA 3ABGA 3PL6C 4OZGB 4K7FB 2XXMB 3B2VL 1XCQA 3QFJA 4LDEB 4TUJB 2HJKA 2VM9A 1IAIM 5DJCA 3X12A 4DZ8A 1AFVH 1T2XA 2ATAA 3NVQA 3LKPB 4S1SL 4EEEA 4AZ8B 4ETYA 2BY0A 2RB8A 1BYOA 5F7UA 4RMUA 1KWKA 5D8JH 3V10A 3DIFB 1BXAA 1K72A 2OL3L 2R59A 3ARTA 3UDWC 2IPUG 2Z6FA 4LLWB 4GIOA 1I9EA 3SE4A 1TQBB 2A74A 4O5LH 1RJCA 4UILL 5GGQL 4MZRA 4U49A 5B3JE 2JB6B 3O0RH 1R0AH 3SSGA 3LPWA 2I9LA 1S78C 1NUNB 1N2RB 5IQ7L 2ITFA 1UB5A 5C6TL 4MMZA 1T2QH 4I9WD 4N25A 3SQOL 4KKAC 1AH1A 1N6VA 3DTXB 1DJWA 2R2CA 3QUZA 1DEEA 1M71A 1AP2B 2OPCA 4NZ8A 3GSNL 3NZ8B 5GGRB 3R7RA 1AIFA 5AVRB 1QWNA 1UWYA 5K9OB 5EEYA 3V7MA 3NFSL 3FT1A 2JKNA 1KYAA 1ONQA 4KDTA 2VXUL 4Y88A 1NPUA 5ETUA 2Z3FA 5DZVA 3LKQA 4L3EA 4DW2H 4QEGA 5KG9B 5HHMB 1YPZA 3ZL1A 5E6IB 1HXKA 2CUIA 3ASOB 2XVLA 2YAMA 2LFGA 4BHUA 2W94A 2WNKA 3DO4A 2UUDH 4UIMA 1MI5B 4NT6B 2PWHA 5I0WA 5FLUA 3EYUH 3S98A 5DD5H 1VACA 3SOBH 1LE5A 1BXVA 2CCVA 2H3NB 4GFTB 1DQML 5TFSL 1MW0A 1A6WH 1WSST 2BOLA 1KCVL 3WO4B 3M6DA 1FORH 1LP9B 3ZT5A 4JFZL 3MRHB 3IKKA 1XGUB 1TXKA 4ORGA 1WC7A 3EBIA 5LAXA 3ZHKA 3MUGA 9PCYA 1PZUB 3DBSA 1A9BA 2K4AA 4LCIL 2ZWNA 4M6OH 3JTSB 4N4YB 5FOBB 3EG9A 4LCYA 2UYLA 4H0IA 2XWJA 3BVNA 2IDSA 4TVPD 3H9SD 4XBMA 2WUBH 5DJDB 2R9HD 1FO0A 5I1LB 4MCMA 3UTTE 5HHNA 1CD1B 3OKKA 4TNEA 1KELH 3EJZC 1CFSB 1XGPA 1IGYA 5I82A 1UZGA 4W9ZA 1H5BC 2OMUA 1T89C 1EJOL 1EERB 2XZQL 4WW1A 1XFPA 4CN4A 5BRPA 2AI0L 4EI5B 4GXFA 1GYVA 3RPIB 4NJAL 4PJ5A 4QRRA 43CAB 1AG6A 3GSWA 2G75A 2IH8A 1M7XA 3HBZA 1JZ6A 3QJZA 1XGQB 1ACXA 2ZKWA 2P44B 2ZNWA 1NIDA 1BBJB 1EFXB 1IIIA 3PWVA 3BDXA 4OI8A 2VDRH 1DUYB 2AKRB 3V9EA 5T3XL 2A9CA 2HT4C 4J4PD 1U8LB 1U91A 3BO8B 2HX7A 3WHXA 1A14L 1LQSR 3T65A 2VJ0A 1HXYA 4DGYH 5J1AB 1NGQL 2JCCE 4PJ8C 4UT6H 5AKSA 3BN9D 2B77A 4F7CA 1RSFA 5G4NA 1AGDA 1C5CL 2DQHH 1WT5A 4MD4A 4P9ML 4OV5A 1OP4A 2P43B 1R5IA 4FNUA 4KKNA 2D31B 2ZG2A 3VFNB 1I8AA 1DLFL 15C8L 5FO7A 4AT6A 2YD6A 3VA2C 5KSBF 5CO1A 1NC2D 4GSQA 5F7WC 4LSQL 4FMFA 2X88A 3DETD 4J6IA 4U2ZA 3GT6A 4LBEB 4CN1A 4ECNA 1I1AB 4BWTA 1XWVA 4PVLA 3PP4H 1XB8A 4PP1D 2R0WL 3HI6L 5MHSD 4ZMQA 3QUML 5K9KA 3HAEH 1P6FA 2IDUA 3CMOH 5IROC 3GUFA 1XF5B 5IGXL 1N0LA 3DX6A 4YHPB 4PP2B 1E9PA 4J28A 1JXGA 4NIYE 1R3HB 3Q6GH 4HIIB 3ULVH 3IF1B 4F8TA 1TCRB 4JZJA 2D73A 3RX5A 2B08A 4X6FA 3IPEA 1KPVB 2XPGB 2WO4A 5FX3A 3ZO9A 3LQAL 3S4SG 1ZKAA 3APNA 3CVIH 3VQMA 1WBYB 4DEUA 1KWGA 1YCSA 1XGZA 1XMWA 1JTPA 5D7KE 4AMKL 2OSLB 4ZXBB 3T4AC 4F8OA 1E2VA 2ITCB 4PJFF 2VDNH 1IKOP 1MFAH 2ZP9A 3TV3L 5IQ9B 3A6BH 4UTBA 3IMUA 4E5XB 2WBJC 1SLWA 2ATPA 1ZLSH 5B3NA 1T0NA 2A83B 1F4YH 4WGWB 1QUNB 4Y4KD 2DQTH 4JEGB 2VOTA 4ODTL 2W88A 5FYKL 3OJMB 4IU2B 3ZR5A 3IU3B 1NH6A 5A6IA 3B7RL 2PPCA 2NQ3A 3L45A 1KZQA 2OYMA 1W15A 3BD5A 3O81A 3OJ2C 3ESMA 3GJFB 1XSIA 3MXVH 4J8RA 4GQ9H 3KJ6L 1KB9K 4YHLH 4P5TA 5E7FA 3ZE0B 3ULUE 4OJDH 3TN0A 5E1GA 5IVZB 1LTXA 3BN3B 1LYQA 5L4JA 1UURA 3PQYE 4N86A 1J9SA 1KY7A 1JWMA 1FIGL 3ESUF 4W9DC 4ZMYA 1BXUA 1LK3H 4OI9A 2R51A 3FFOA 3ZMEA 4MNGB 3A67H 4O4YL 1PS3A 3ATEA 4F33A 1TO4A 1CGTA 1GOGA 3BDBA 3HS0A 2FB4L 4UAOC 2HP4A 4U4BA 3PAUA 3ZL4L 4ERSL 3VB8A 4W9IC 2C3HA 1GSKA 1SYVB 5FYJL 4Z7OE 4BKLA 3JV4A 5CM1A 1HX0A 2QQLL 3A3YB 1CCZA 2XKSA 1M7IB 5D1XA 1VFOA 2Y7NA 3EOTL 3SPHA 3U0TB 4AYMC 3I3BA 3V4PA 4XN8A 2XZAL 3QJUB 3T0EC 4ESKA 3IT8D 2XT1B 1UWEH 2OJEA 1N5AA 4L4JA 3WXVL 1D2OA 2QVIA 3DOHA 2GBVA 5F7HA 2LW3A 5AKRA 4H20H 4Y8DC 4PRIE 2A77L 1KIUA 1I7ZB 2Z93A 4R3SA 5DD3H 3RUGB 2JMRA 3SKMB 4PGEB 3IFOB 3SD5A 3GZOA 4MS8D 4NUJB 3GB7B 4K5LA 4E9YA 5IEKB 5E08H 3OX8A 1QFOA 1L7IH 4DKFH 4KZCA 5A3IC 3US0A 2APTA 4JQIA 4NERA 3AAZA 2G0LA 3K6NA 2VXTH 3UTSA 3CFIC 3SGDH 4FNPA 2EEBA 4HUUB 4JFOB 1KB3A 4Y89A 5TE6H 3KVQA 1AC6A 2M83A 5AEAA 4FADA 3T1WA 1A3LL 3AROA 3GJFK 4G6JL 3BRFA 1VCAA 5CKAA 4ZG1A 5IB1A 1F1AA 3EUUA 3W0WE 5AVXB 4HXAL 3KPQB 3MREB 1QKZH 4CSPA 3ZE1E 2O5ZH 4KO5A 2D3VA 5I30L 5HHOD 5DQ9A 3RURA 3X13B 1P5VA 2APFA 4FFVC 4RBPH 2ZUSA 2MNWA 2IXQA 4R84A 5DDHA 5DUPL 4AGLA 3VFSB 1ID2A 5HGGS 1MUJA 2V2TA 5E99L 5IESL 2CALA 4XPFL 1AHWB 5HJDA 2Y7QB 4A66A 1AS8A 3GSVA 2MKWA 1T83A 2WPGA 1ZXQA 4OM0H 3V6FA 2X3BA 2PXYD 3KPRB 1Z9PA 3FCSB 4RAUA 3RWHB 1IQWH 4IRZH 3HB3C 5C9JA 4OSUH 4MNQD 4XNXL 4C56A 3BHBB 4H0HB 4KUZH 3CFKA 3BZ4A 3VXPA 4XRCB 2CR0A 1HSAA 5HHQA 4JZNA 1B4TA 1O9WA 1WWWX 1BIIA 4G6KH 3ULAB 3S36H 3HG1D 1RV6X 1DN0A 1F5WA 3B9DA 4YDNA 3SO5A 1BG9A 1S7TA 2P8MB 1I4FB 2VQ1A 4WNQB 1JJUA 1FF5A 3ILQD 2OV0A 4L5FH 2YA1A 1AAJA 2UY6A 1NCJA 1R5VA 1CPUA 2BP0B 1CI3M 1PZ5A 1TZ8A 3LEXB 3QFGA 4M3JA 4P5KB 4PLKD 1H3TA 3T0BA 3ARGC 3UC0L 3MYJB 4OFQA 3D85A 1IGTA 2GITB 1L9SA 2FVNA 4XNZB 4YS4A 3O6FD 1QATA 5AUMA 1DLHB 2AK1H 3E1ZA 2F18A 1PSKH 1AACA 2GTWA 3EJPA 3QIBB 3LDBC 4XAKE 1MCEA 4XOAA 5DS8B 1HE8A 2W0FA 5IBTL 1DL7H 5JW3H 3D2UB 3M88A 4WWKD 4NZTL 4L8DA 4MA7L 3KWVA 1LK2A 1QBMH 3GYRA 3EAKA 5F97E 3TYGH 5EOCJ 4L48A 2J88H 2ORBH 3GMOA 3GPEA 1F90H 5T3ZD 1J8SA 4NQEB 1K5NA 2AK4D 3QDJA 3D69B 2BSBA 1EHAA 2XETA 1FI8C 4NI6A 3JZ7A 4A2LA 5D7JD 4UQCA 2Q8BH 1XAUA 1FFNA 4N9GB 4X6CA 3O6ML 3GJFH 3RJQB 3WY1A 3NRQA 1NSNL 3LRSA 3AG4B 1PZCA 2NY0B 4ANXA 4Z95L 3FONA 4HKJB 3IAQA 1KLFA 4LIQL 1QLFB 4J5VA 5EIQA 2HFEB 1Q9KB 1OT4A 4ZMZA 1ZEAH 2WXRA 4NP9A 3TLRA 2WCPA 5BUPA 4OLWL 4KGLA 3VE0B 4UZUA 2ZF8A 2DZEA 1AHKA 3IS1X 1MCOH 3ECVA 3ELAT 4H1LH 2IAAC 2AMUA 4NUQA 3V6BR 3KEDA 2VW6A 2E7DA 2JH2A 4GSXA 4YSOA 4I3SL 5EO0A 4N85A 5EDXA 4J3OC 2XWBB 5GISH 6PCYA 1GXEA 3BW9A 1IAKB 2ZYIA 4G8EB 3BQVA 4BZ2H 5BO0D 3ISYA 4AWJC 3P9MB 3A4EA 5D2LF 1T6BX 2PTVA 2MNUA 1FNFA 1SPDA 4HGWB 2EYSB 5EOCL 2ENSA 3D08A 3RB7A 5K1NA 1S9VB 5KSVA 1E67A 4PJCA 5DWUH 4KY1L 4EMZA 2D7PA 5DJ0B 1FJ1B 3T9WA 2QADB 4BE6A 3D3VA 4NRZA 1HL8A 4OLUL 2Y2TA 4I48B 3VXRE 1OAKL 2HN7B 4FP8L 2R1YB 1D5XB 3TIDB 5DVPA 3QZOA 5D1QE 3BPCB 2FJHA 1OK8A 1T5XB 5D72L 4QR7A 3FB7B 3VTMA 3ZTEA 4KVNH 1RUQH 3UBXG 1A9EA 4N8VB 3MROB 2J1WA 4QRQB 4ZPTB 2HJLA 2WNXA 1WCBA 4M8UA 5DMYA 4I2XB 2W91A 3SE4C 2A74C 1LO4L 4U6XB 2LTQB 5EIIB 1SXNA 1YNTA 3J2PA 4UQAA 4ZX6A 4AVJA 3VD3A 2ESVB 4NN7B 4OD3H 4G72B 3LRMA 2X1PA 3UTQB 2IH1B 4MMZC 5IHZB 4EQ3A 2CM5A 2AHIA 1DUZA 3FQ1A 2MCG1 3QUZC 1UZ6F 4MA1C 4D9RE 5M95B 1M3JA 2VQTA 3AG1B 3U46B 4Y5VB 3S3BB 5HHMD 2XSKA 1B9ZA 4DO5A 4F8PA 4J3XA 5IVXF 4ALAH 4TPRH 2IEPA 2QT6A 4KDTC 5IIEA 2WLLB 3GSOB 2D7NA 5E8EB 3DGGA 1JPTL 4GRLA 5AVQB 3LKSA 4RA3A 4JFQB 3WFCL 1TUPA 1PCXA 3S6CA 1KBPA 3M7FB 3ML9A 1V3KA 2WXJA 2J3SA 4M1DL 2AGJH 3AXIA 1FC2D 2IBZX 4OJFH 5A40E 3WFBL 2CJ3A 1YY8B 1A6AB 1AE6L 2DWSA 3RFZC 1WAAA 1J8HD 5B38G 1OTSD 4JM2A 2BINA 2WC7A 5DHDA 5GJTL 3B83A 1A4JB 2HFGH 5D6DA 4DUWA 2HRGA 3MA9L 5BQ7A 2VR4A 5KVDL 3LMJH 4EN3A 4J6RH 3U7WL 1CIUA 3EYVB 4X6DB 2R23A 5FUCE 3VTAA 3ZIYA 1G9MH 5EZLA 2CNYA 5DHYB 5INDB 3BKJH 5JXAH 2X4RB 3NCMA 3VAEA 4PS8A 2OMXA 4QXUH 1EFQA 4YDVA 4NNXB 2WTRB 4BGLA 1S7SA 4B9PA 4CGTA 4H5SA 3O4LE 1E0OB 3WXWH 4EI5D 1PY9A 3M7OA 1V7NL 2NMSA 5FS5A 1BPLB 5ALCL 3TFBA 1CYXA 5C0IB 1DCLA 3DXAB 3O0LA 2P7TA 4J12A 2B39A 4KGJA 5I18L 3F7PC 2YGNA 3I84A 1EFXD 4HZLA 4PGDA 4FMVA 3KBPA 4G7YL 4GP5B 3MJ7B 1ZVYA 4TLKA 1HNYA 1PQZB 5DZPA 5EF2A 4XHJD 1MELA 2FEDD 4Z3TA 4RGNE 5I1IL 4O9HH 4B9KC 3KW7A 1O5PA 1FH5H 4CU8A 4YPGA 1BQLL 3RWCA 1L9RA 2JCWA 1G6RH 4JVUA 1U93B 3PREA 2ENQA 5F9JA 3CX2A 1RFDH 2Y3NA 3FT4B 1G0YR 2FHFA 2CBPA 3PGDB 4ZDHA 3QARA 2VT0A 5BZWB 3RNQB 1FDLL 5EZOL 5CEZE 1R46A 2CBQA 2IPUK 3VUAA 1OOAA 1EHKB 4UTAA 1D9KA 1XH3A 3GMRB 4P2RE 3AWFA 2VLME 2YKLH 5HY9B 4JY6A 1A7OL 3GLDA 4ICXA 4NSKB 4U1NB 4F3FB 3FUEA 2GSGA 4A2HA 5IMLB 4PV1C 5A7BA 1QWUA 2EIZA 4XN1A 5INCB 1JWSB 4CBZA 1CUOA 2IH3A 1I1AD 4B60A 2ZSWA 3ILPA 3NH7L 2ROXA 4PJAB 4BWWA 2IGTA 3Q3GB 2Z7YA 1LMIA 4HJEA 4S1DC 1O9ZA 3VQ2C 4YHYB 3SDDA 5E6ZA 3D0LB 1BZ9B 1TTFA 1NGPH 3FH8A 4M03A 1ND0B 2RA1A 4XH2B 1VADA 4AJVA 4UM9B 5IT2L 2HFFB 2FX9H 1NJ9A 2VN7A 4NKIL 5CKGA 1CBJA 1DVFB 2BFVL 2ZOTA 5CIPH 3VFPB 4WI2A 3P2BA 4MJ6A 4GBXA 1QBBA 4R4FL 2IOMA 4JZJC 1KSRA 3UC2A 2Y07L 1KIRA 1NC2A 1WFIA 2AJUL 2FGWL 2WVVB 4XN4A 3QUHA 3QNZB 2P4AB 2ARJB 3O9WB 1IAMA 4UOQA 3DX8B 4NI3A 3ZO0A 2EILB 1H9DA 5BS0B 4F2EA 1TJMA 4GW5B 4WU7A 4AJ0A 2PCFA 3ZKMC 1SYSB 4KHXL 5L8LB 2A9ML 3BH9A 2BNQB 4LF3A 1ZVSB 5L0QB 2DQDL 2YZ8A 3EDJA 4WKZA 4ZMLA 4HH9A 2IAMA 1LILA 3NTCH 4N0CC 3UBXA 2X9XA 4TL5A 3P0GB 3FAWA 1F1DA 2Z4QB 3D25A 1LEIB 4G9FA 1F97A 4X80L 4WDIB 3WE1A 2YR3A 4TSBL 5EEUA 1MFUA 1FE8L 4K71C 1LWHA 2FSDA 3VJ6A 2G5BA 4P5TC 2VDLB 4HZAA 3L81A 3SGKA 1DBMH 4GG8A 3TN0C 3VDCA 3CPLB 2MQ0A 1MCWW 5EU6A 4AQEA 3C08L 2X89D 3ZE2B 2GKIA 4KMQA 3Q2NA 1PZ2A 4OLZH 3WIFA 4ZFOL 2F68X 1TFPA 2HX9A 2V2WB 3NJVA 4NO5A 3O3EA 4XP1H 4D8PA 4L8BA 3II1A 3QHFL 1D5BA 5TH2A 3HS0C 3TX4A 3VRJA 4NCC1 3GK8H 2YARA 1XSKA 3JWOL 5IFHH 1R3LB 3MRCA 2XWTA 5LDSA 5C71A 1QI3A 3TZVB 1U42A 2XYBA 1AXTL 5K1VA 3KLDA 2H5UA 2IAND 4FXKA 3LS5L 5D1XC 2CDFA 5BOZG 1WBZB 4PV8B 2FK9A 1HHIA 1AO7B 1G9NH 5I17B 1BG1A 1TVBA 4AZUA 3S8FB 3G6JA 5ABAA 1U8CB 4DGVL 1R5WA 3CFEA 5EU5A 1X5YA 3H9HB 3ALPA 3NMEA 1S7VB 4ODUB 3SDAB 4XBGA 3UP6A 4Z0XB 1I1FA 1M9WA 3WN5B 5BVPL 4XN7A 1IU1A 1OCCB 1NUGA 1Q90A 1E8YA 1H6EA 5SWSA 1K3IA 4DN3L 4FL4C 4QXGH 1FFTB 1BVOA 3KBHE 1J0KA 4N5UA 1F58L 1NCNA 4YE4H 3PWPA 3PV6A 3QS3A 4MQSB 4CMMA 2HJFA 1YEKH 3KWTA 4AJYV 5C6WH 3GBML 4BDVA 5KJRL 3E9UA 1DVQA 5BMFL 4JPVL 1OSPH 1N18A 3INUL 2BHYA 2VXQL 4U33A 4MJ5A 3QQ9C 4HS6B 3WNMA 4PJXF 3RL1B 1F3JA 1P2CB 4YNYB 3KR3L 1M6OB 5DI8B 1OB1B 1JV5A 4QHKI 2B1AL 4XWOD 5FAAA 1L9OA 2NOYA 2GC4C 1XF3B 3KPRD 3PWJA 4L2YA 2CGRH 4U1HB 2ED8A 3E3QE 4MA3A 1BV8A 1KFAL 2VJ8A 4IHOB 2E56A 4YQXH 1T83C 2DLGA 4LRNL 3GEWB 2NTFB 2J43A 2Q10A 3SKJH 3P40A 5B39A 2XNAB 3ZZLA 1AXSB 2AQQA 3HC4L 1Y18B 1AZCA 4OZIA 2Y6SD 3PUUA 2OTWA 2FTAA 1XGRB 5ALBL 4P2OB 4ONFH 4LOFA 1JGUH 5HHXL 5KSUA 1RLWA 2VDPL 1ZHBA 2YEZB 5I19H 3RA7L 2ZXBA 1IEHA 2R1XB 3QUGA 2X6VA 3R8BB 1FWXA 1YUHA 3ME0A 1HINH 4N6RA 4GJTB 3VYPA 5DHXB 4D0DA 1SY6L 3WKQA 2MPAH 3F12B 1FGNL 2C9AA 3QCTH 4GO6B 1COBA 1R3KA 1ZDSA 2UY7A 4MZ3A 3EBAA 5F44A 5EOTB 1FP5A 3BD3A 3QIBD 3TA3A 2HH0L 1ZRUA 3MLTB 3I9GL 4MXVE 3P0YL 2WZPA 4X7EC 4UBDC 2HVKA 1JF1B 2NY5C 4OCSH 5F89B 2ATKA 3RQ3A 3HIZA 3D2UD 4N2EA 2DI8A 3ECUA 5IREA 3EH5B 4NUGL 5D5ME 2WAQA 1NBVH 2OA9A 3I6GA 4Z7WA 3FB6A 4RZCB 3F3HA 3OPZH 3RY5A 1H8OA 4KH2A 1UB6B 1BF5A 5B4MC 2APBA 5FB8A 2YUVA 5DJXA 4EOWH 3TNMA 2FQGA 2OM5A 1IBGH 2XQYG 3FW6A 2KPWA 4PN6A 3R0MA 4AW7A 2TRYA 2NY0D 5AL0A 2DWDB 1ZY9A 2IVFC 2ZUQB 3H7LA 5GIRB 5K59F 1BVNT 3BFQG 5D7HA 4ANWA 2RD0A 3BZEB 3L16A 2V8MA 3KL0A 5D2NA 3MOAH 3U2SB 2ZX8A 3RIKA 3VM5A 2XKUA 4L4VD 1CC3A 3FNKA 1G7PB 1I9RL 2GSIB 4BZYA 1KBGL 3HZYA 4TUUA 3SGEH 4DVBB 2VDLH 2VL5B 4X5LA 5EZJA 5IV2B 2CKNA 4KJQD 1NQBA 5FM4A 3QSKB 5I8EB 3BGMA 2Z91B 4GRMB 5FF6B 1OP3H 1IKFL 3GMLB 3JWNC 4OB5H 4RRPM 4UT6A 5DD6B 3V4UL 2X6CA 1TMCB 1E5ZA 3FKUS 1SQ2N 3H54A 3LZQA 4YWGH 4EI6B 1IKNA 2QQNH 2PETA 2ODHA 4CKQA 1RIHL 3G9AB 1OM3L 4B96A 3PJSB 1EGJL 1RHHB 4XHQA 1AOHA 4K5NA 4YUEH 3UO1L 2AQTA 4DT2A 3CWGA 3IFLL 1MPAH 3WMSA 1KNOB 3B5GA 3B56A 4ZMNA 4BYHA 5CJBA 3R06B 4ODVH 2XV3A 4P5SA 2QADD 3N50A 4PJ7B 1NAML 3W57A 3KYKL 4ZFGH 2OMNA 2FX8H 3WL9A 3OAYK 3SQBA 5EA0H 3CCHB 1DQIA 1UUSA 2YPLD 3B9AA 4TQPA 1PFOA 2J21A 3HAEA 3MR9B 2R2HA 4FLQA 2W65A 3P3TA 1ZT4A 3MV8E 4JQIL 4ENEC 3VFGL 1T66C 1U0QA 4F58L 4JANB 3EGSA 4W4NA 3DMMB 4QNPF 4XO3A 3N3EA 4OZGA 4KNSA 5H4ZA 1I8IA 4OBRA 4K7FA 4PTUB 4U0RC 5DJ8B 2NCEA 5FCUL 2HX8A 1A2YB 1EVTC 3H8NA 1JDCA 3AUVA 3QWOA 4H4NA 4L3CB 4W9GC 5J0BA 4AZ8A 1GZQB 4PS4H 4KJPD 4OVUA 3TEUA 3SODB 3LEVH 1WA2X 3A22A 3MODH 2QR0A 4YXKH 3ORJA 2CD0A 5JW5B 1UADC 2DLIA 4J2QA 1H8SA 4XZ4A 5EC2A 3TASA 4QHUA 1P4IH 3MXWH 3CXHK 4OCRH 4LLWA 1NBYB 1I9JL 3ZZ1A 4YDKL 2PW1B 2JB6A 4Q6YA 4JPSA 3S2CA 1T03L 1XT5A 2YRZA 5I5JA 4FTVA 4JRLA 3IFPB 3Q1SL 1Q1JH 5KBPA 1KENL 1QFWI 3T2LA 3N43F 4GRLC 1WFMA 3L54A 4POZC 5C0JA 2F1EA 4OKDA 1AP2A 1TJIL 4G8GB 3SOTA 4Y9CA 7PCYA 2G3NA 1T1WB 5K9OA 2W60B 3I2CH 4NQDE 5CMAB 5LGKA 4HF5L 1AQKH 3BGAA 4M56A 1A5FL 2EZ0C 3NFNB 3SKNA 4JM2C 5KG9A 3WYRA 1D7FA 1IAIL 3MCKB 5E6IA 2EDWA 4RLDA 1MFMA 5D6DC 5F7EL 1N0XH 4FLSA 1EMTL 2JFCA 3VXTB 5HSFA 4EN3C 3QJOA 1MI5A 4NT6A 2WXHA 4N5EC 2QSCL 1U21A 2J25A 4WWID 4W1TA 3KLSA 1B6UA 5JW4M 3S9DB 4KV5F 3WEMA 2H3NA 3SPJA 3DX3A 4RSVA 2AVFA 4HIXL 4JQVA 5HD8D 2JB5H 5I6XB 1LP9A 4X99B 3V0IA 2YGPA 3MRHA 4K7PL 3N9GL 3VFVB 1I3RB 1OF2A 3CDFA 5KVMC 2FX7L 3WENA 5E6SB 2Y2YA 4X7FC 4R4ND 2VERN 5AD0A 3DRTB 1A7PL 3A6OA 5KSBE 1UOVA 5DO2D 2K70A 1G7QA 1KB5B 4YHOL 4HJUA 3PQYB 5FA4B 4JRYE 2QMKA 1BM3H 3S37L 3T8MA 3FULA 2FT7A 3ZBMA 4PAZA 1E65A 5HGHA 4XMPH 3WSQH 3HFMH 4X42A 3FC8A 4M93B 4DOHE 2CHWA 4WI8A 2R9HC 4AM0B 5B3SB 2KPNA 4FABL 2BK8A 4N90D 1MN4A 4Z7OB 4DPRA 5T1KB 4XNDA 2HLAB 5F1IB 3RPIA 1ANUA 3ZKXB 4WZ9A 1MF2L 3CU1A 3KYNB 4QGTA 4X9HA 3WUWA 4DNLA 5IZ7A 1IO4C 5KW9H 3K4AA 4UT9H 3O2WH 2D7TL 2AQ1A 1A3RL 4JM4L 3WIHL 2ZF9A 1WFJA 4HU8A 1EAJA 3RDTB 1DUYA 3TBBA 2AKRA 1D9KC 2G2PA 4CA4A 4PJFE 5GS3A 1KLGB 1KJ2L 4G8FA 1U8LA 3MV7D 3BO8A 4LVOC 4HJJL 5HBBA 4GINA 5H37G 4AQZA 1MCPH 1WAEA 2UZIL 1L6XA 5C0AD 3U36B 1HOCA 2GFBA 1FRGL 5M94B 1M05A 1RH8A 2EDNA 1FUNA 3PUCA 1VPOH 3BN9C 3HVDA 4KJWC 4IRZA 4P3DB 2J7LA 3I9PA 4L3AA 3WV0A 1DVFD 3EFDH 4NQCA 4H25A 4GSRA 1KG0B 3MLRL 5K39A 3C6EA 4OIBA 3LS4L 2OMZA 4HDIB 1HSBA 4OM1L 5EN3A 4YO0B 2PP8A 2DD8L 3VFRA 1HQRB 3E80A 5GS2H 2YSSA 3O9WD 4LBEA 3W0WB 1I1AA 2C3VB 2MKLC 4GBXC 3ZE1B 2EIBA 2DIAA 4N8CH 5FECB 3PXLA 2VLKB 3V6OE 1U8PA 4DGWC 2FJSA 1YMHB 2BNQD 3BUYB 5LG6A 4OFKA 5CHNA 1IC7H 2AITA 4YHPA 4PP2A 4Y19B 1OHZA 3VI4B 2JTDA 4PP1C 4PCTA 4JR9L 2IWFA 1R3HA 4BQBA 4WTWA 1D7CA 2PO6B 3HMXH 5ADOL 4UQEA 1TCRA 4W9FC 2XACC 2XG5A 4TNFA 3CSGA 3VI3B 2NCMA 3L1EA 3UZEA 3BAYA 1HKLH 2IAMC 5E4EB 4DAGH 1O75A 2Z8WC 5C0EB 1XL4A 2W07B 4BSWB 4UCFA 5A2AA 1A7QL 2OSLA 3SKOA 4ZXBA 2Y1AA 3H3BC 5IQ9A 4B0MM 5GZNA 4E5XA 5FYJU 3MA7A 4XAWL 3IAGC 4BJLA 5CLZA 4ONOA 4JN1L 1UT9A 4FQQB 3MFGB 4XVTL 3VFUB 5BRZE 1Q1PA 2XHNA 1QUNA 4FQXB 4NKDA 2IBGA 3OR6A 3SGKC 1PZDA 4IU2A 3TCXA 5TE4L 3ZGHA 3HZVB 1SN0A 2AFNA 3GJFA 9CGTA 4HG4K 4Y4KC 2UXVA 2DQGL 4PYHA 1VCBC 3QR1A 12E8H 3UERA 2YEVB 1VKXA 2E9IA 2WUCL 4B6ZA 4P23D 4F93B 3GRBA 1U8OB 4LSUH 1I1YB 5IVZA 3JT0A 1XD1A 2Z31A 1MW1A 4PGCA 4G6AD 3OPUA 4H1LA 4FI7A 4JDTH 4N0YL 1TCMA 4FXKC 1T4KB 4D8OA 4IEFB 4B9JA 1MVFA 3SDAD 1G1KA 4BFEA 4TSAH 3GHEH 4L0ZA 5ITFA 1SYVA 2FYVA 5LQBH 3SYQA 4AV5A 3LOWA 1QTSA 1F4AA 1X5GA 3GSQB 1M7IA 5CU9A 3SY6A 2VXVL 3IDUA 5FO9A 5J1SC 1WAPA 3RYMA 3KXFE 3GIZH 3KPNB 1UKQA 4KKQA 2NQCA 3DYMA 3CFUA 4E9QA 1M9SA 4DIXA 1T4WA 1SXBA 1I7ZA 4GS7B 4RMRA 1ILSA 2UV3A 2NX5E 1D6EA 4K8RH 1FYTE 3VGAB 1KB5H 4TVPL 4YK4B 2QTEA 4HUNB 3RUGA 2RGSA 1OAZL 1E2WA 1YNLL 3FQXB 3IFOA 4IOIB 5EZIL 5FUZH 3GHBH 3EDKA 1I8UA 1A7RH 4XCCL 5TDPA 3SCMA 5JPNB 3ZYZA 2G60H 4K07A 5IEKA 3MRJB 2IFFL 4N2BA 1ZJBA 4S1RH 3FO1A 4QD2E 3D09A 3O6LH 1L9NA 4AQAA 2KMWA 4XCNA 4QRTA 4JB9L 1MG3C 1NC4B 3CHSA 4KFZC 2X9ZA 3C87A 3KM2A 1E4HA 3O4OC 3PWLB 4EVNB 4HUUA 4F8LA 4ZTEA 4JFOA 4UDTA 5I1EH 4KK9D 1HNFA 2D3NA 3OKOB 5FW7A 3V0WL 1WFTA 1OIOA 1QRND 3LB6D 4GQPH 3OVUB 5GHWH 3H4FA 3GTTA 1KIQB 5I26A 4I1NB 3HRZB 3BOVA 2RHEA 3MREA 2CRYA 5HI4D 3QYCA 4P2OD 1JOIA 2HLEB 2GPZA 3HE7D 1RZKH 5IW3A 3ZTNL 1JZIA 3VG0H 1BJMA 5JQ6H 3NRPA 3DX7A 2ENYA 1HJCA 1I3GL 1BMWA 4G42A 2V5YA 4QO1B 4XMKH 2CU9A 5DT1L 2WV3A 7FABL 2EKSB 4TF4A 5D1QB 4FAAB 3FTUA 4AYFB 3TTSA 4KJYA 1HT6A 3FCSA 3RWHA 4YEEA 1KXTA 1X5KA 3KGSA 4Q7DA 5I0XA 3BHBA 4EIBA 1ZGLB 4KZEH 4KVCL 1MAMH 3FO2B 5BV7H 4XRCA 3S35X 3ARDA 3TBVB 1LDSA 4WKXA 1DDTA 4UQIM 3CZGA 4U6HB 1XF1A 4I0CC 5IEHB 1EANA 4R26H 4HOMA 3BWAB 3TA3C 1BQHG 1I4FA 3GSXB 1KYFA 4WNQA 2BRRL 3RKPA 5IR1B 5I1JH 4HGKC 1Z1WA 2WVUA 2C4FU 5D7SL 4F7MA 1TZGL 1YEWA 2BP0A 4FQIL 4YDLB 2LU7A 1MCJA 2YXWA 5KN5A 5LJYH 2ZAIA 2GITA 2OZ4H 2P48B 3NCBB 4RX4A 4UF7C 3ZDZF 3MLXL 3QR0A 5BZDB 2QGEA 1HEJC 4PLKC 5D2LE 1RZJL 4GMTH 1DVXA 5AKVA 3KBFA 3OR7B 5DJ2A 3L5JA 3OKLB 3F5WB 2LE9A 2K4WA 1FPTL 3DX9B 3B7YA 3E6FB 3D2UA 3QJRB 4AE0A 4PLOB 1DVZA 4AITA 1CXIA 1FFOA 2BWQA 5D2NC 1J5HA 3JT2A 4KK6C 3PXHA 4NQEA 3SZ6A 1QNZH 3D69A 4LXFA 3UTTD 4PD4K 4HJIA 2K7QA 4N9GA 4ELMF 3QRLA 4N0UE 5IFJB 1G6RA 2BSSB 3L8QA 3I6KB 1F0LA 5CBAB 3KMDA 4XOCA 2I07A 3OWEA 1QLFA 1PNCA 3DYPA 3OBAA 2HFEA 1IKNC 3O4LB 1L5GA 4ZI8A 5DZAA 5FPIA 1XF2B 2ZX9A 3VE0A 5EEZA 1SOKA 4JHAH 1GY1A 4MKTA 2NYKA 3Q9QA 1OQXA 3GBDA 4NAJA 4LPCA 1F41A 1UZ6E 2BVPB 2GEQA 5C2UB 3J27A 3QCUH 2R7EB 2X4TB 2OMTB 4OIIH 4YBLC 1UD3A 1RPKA 4OZFB 1OARH 2ZCZA 1S6NA 2CXKA 5IVXE 4LL4A 3K72A 1TYEB 1JXFA 4MMXB 1MFBH 3CE1A 2XWBA 1BOGB 1FL6B 1TQCB 5AVYB 5G2NA 4JFDE 3DMMD 5IB2B 2CO7B 5C97A 1ESOA 3B37A 1EDYA 2VDMH 5GRUL 4FFYL 4EF3A 1I7RB 4WTXA 4FI6A 1T21A 1XX9C 4G1EA 5CIPA 2DQFB 3CBKB 4K3JL 1GS7A 4TTDC 3B2UD 3ULVC 4A7GF 5CZKA 1L4IA 5DLML 6FABH 1FJ1A 4UDUB 1U2CA 1VAHA 1YNKH 4P2RB 5MI0B 5MEOB 1MREH 2FJGB 1MIEL 2HN7A 2YD4A 1D5XA 5GSRB 5E5MB 3BPCA 3HNTL 2HLFC 5HDWA 5BW7A 5T1JA 4LEEA 1SQMA 1EEUA 3CZUB 4N8VA 4Q56A 4QRQA 2DKUA 3LKOB 1LNUA 4I2XA 4UTCA 5FUOH 1QSFE 2VKXA 3UACA 1TQBC 3IXAA 4PJIB 5DHVH 2DMKA 5EIIA 1N7ML 1HDMA 2PYFB 1NGXA 1AGBA 1U3ZA 1YLBB 2ESVA 2KLRA 5TF1H 1QR1B 5AOZA 5BVJB 2YOCA 2OJ1A 4HFUH 1PGRB 4YHMH 3N85H 4ZMVA 2IH1A 1IGMH 4M7JL 5IHZA 3EO9H 2B2XH 3F2LA 3EJJX 2O72A 4R5TA 1DFBL 2K7PA 5CLXA 4U7KA 2XLLA 2XQYK 4GLRI 3U46A 4Y5VA 4Y5YA 2HKHH 5HYQB 2XTLA 5D7KD 5EFIB 3TVMB 3FT2B 5CN2A 1E4XH 1IUZA 4GP4B 3FUIA 2WLLA 3VFMB 3GSOA 4P5MB 4HJGA 4NQQA 5E8EA 5BZXA 1OAXH 3DUUB 3MC0A 1JNHB 4JG5A 2E75C 3IYLW 1EH9A 3H56A 5E6IC 1AR1B 1XZ0A 4PJEA 1N5YH 1A4KB 2Q7YB 2V7NB 2R0KH 3GXIA 2JI1A 4N2GA 4IRSA 3CK0L 1QFWH 1YY8A 3VXMA 1NBZB 1CG9B 4N1HB 2WO3B 3TPUA 3DGCR 5I2IB 5G5DA 3BKCL 3TBSB 4FHBD 1YEFL 1A4JA 1W16A 2D0FA 3CLFH 4YZFF 4JQVC 3WO4C 3ULUD 1MHHB 1KTRL 2WUBL 3MLWH 1OTUD 1KLUA 1OTSC 3PQYD 5ADPH 1MJUH 3GWJA 4M8VA 2NNXA 2WSDA 2X3CA 5INDA 5L88H 3CHPA 1P4LB 4FFZL 2X4RA 2P24B 3DIDA 5KS9A 1Q0XL 3EYQD 4NNXA 4GXVL 2WQWA 2WTRA 1S7UB 1SNRA 4G6ML 3GLZA 4HWZB 4DKAA 3NBNA 5EOQL 4NRYA 1HZLA 3QNYB 3QNFA 5B21A 3VO0A 43C9B 3DXAA 3VA6A 1JNLH 2XPZA 1NKOA 2BZCA 3RPBA 4G7RB 3RX9A 4KROB 5GGTL 2V7HB 3E8UH 3MJ7A 4HPYL 3CFDB 2H9GB 4PRID 1NA8A 3O8XB 3HUJF 2F08A 5T3ZL 1ZLUK 4BCZA 1MEXL 3B9KB 3ZSSA 1QLEL 3Q06A 3KDPB 1NFDA 4OZHA 4AXWB 3FOLA 4A2DA 1HTYA 4N0RA 5DRZA 3HC0B 4HAFA 3UTZB 4O51A 1U58B 1Q0EA 2AJYL 4O02B 3UCRA 1QA9B 3FT4A 1JZJA 2IMMA 3PGDA 3HE6A 3RNQA 4RMBA 3QRGL 1BD2E 1AJ7H 4KMTH 4HT1H 1KTDA 1EZUA 2JTYA 3IBOA 3L4CA 4GKSA 4WJ5B 4C4UA 3GMRA 1AGEB 4M6NH 1O9VA 1CLYL 4NSKA 4F3FA 2EUVA 1JWSA 4K2UL 3W0WD 1NL0H 4L8SA 4PR5B 4Q9QH 5TF0A 1T5KA 5ITBH 1OP5K 1TNNA 2E74C 1GR7A 3EW3B 5GRXG 2GJRA 3Q3GA 2DRUA 2ZUXA 4DEPC 1A7NH 1SXSA 1MW3A 1I1AC 1FA4A 5ID0B 4ZQTA 2VUKA 4GAGL 2M2DA 3D0LA 1BZ9A 3TONA 5ANHA 1N6QL 4XH2A 1ND0A 1A64A 2CJUL 2OKMA 2XN9B 4OFVA 1GGUA 1CXLA 4UM9A 3UEZA 3MACL 2AJXL 2HFFA 3LNHA 5JYLA 4K3DL 1BQKA 4K7PX 5IJVB 3MRRB 1MHPL 3RVXC 1X6NA 2WXIA 2FQEA 1SN5A 3QDMB 3VQ1C 2CO1A 3A6BL 3ESVF 3QNZA 1U8QB 2LVCA 3UZEC 3O9WA 4PJGA 5DD0H 2X9WA 3DX8A 1BJ1H 2CJTA 5BS0A 1KCBA 3S37X 2DQTL 4ZXBC 2XZZA 3QA3B 4FQXD 4N87A 3L7FB 3W37A 4NXKA 1B4JH 2GTZB 4BELD 5GZNC 1ZVSA 3O45A 3ZJAA 4RA0C 4BRVA 4NQVB 3SEPA 2IPTH 4FXGB 1CBVH 3A6CL 5JNYB 3EYFB 5E1AB 4CU6A 4YHLL 2Z4QA 4AIZB 4P59H 1CLZH 1LEIA 2Q2LA 1LE9B 2IGFL 4XO8A 3UGXA 3QUYB 2HT3C 5J11B 4TSCH 5C7XL 2APSA 3MBEB 5L9DL 4FQHA 4Y1AE 4XAKD 4WW2B 3RWGB 4V1DE 3M07A 3K6IA 1MXDA 2YBGA 4X7SL 3Q6FB 4QRUB 4WTZA 4TOYH 3GSNB 2Z92A 3CPLA 5JIQA 1J48A 1WZ1H 1Q9OA 1Q9WB 4XMVA 3W9EA 4NC1E 4PJXE 2WIIA 4X5WA 2AXFB 5D5MB 3BZDA 2V2WA 3L3JB 1FL5B 1IVTA 5AL8A 5I6LA 2R69H 2WLKA 2X42A 2EABA 2Z0UA 3DOSB 3O2DH 4NJ9H 1YMMB 2PTUA 4AGMA 4FZEH 1QZNA 2BVTA 3SBPA 1AGFB 3UJIH 1BZEA 4APQA 4H44C 3HHMA 3M1BA 5CD3B 4MA8H 1CXHA 1E6JH 3TZVA 3UPRA 5EBMB 4OCMC 3DSFH 3EZJB 4DQOL 3MUHL 1AKJB 3UTOA 1WP6A 1DBBL 1KB9J 1WBZA 1G7MA 4EPSA 3AGWA 1AO7A 5I17A 3VVWA 3K8KA 2VWEC 1KYUA 1WZMA 3UIZA 5C86A 3RWFB 1U8CA 2IPKB 4UYPA 1S2EA 3ZHNA 2B59B 3N41F 3H9HA 3ARRA 3S34H 4ODUA 5KOVC 3QJFB 4Z0XA 1QEWA 2EIMB 2CUMA 3WN5A 4JFXB 1A8JH 2NZ9C 3WGUB 1J87A 1CDCA 2WXKA 2E7LA 1EUUA 2BVYA 4YSAA 2VDKH 3TS8A 3SCMC 2R56H 3L08A 1NC4D 3P4MA 4D0BB 1MCIA 2X7LB 4MLSA 3P3UA 1UVQA 4MWFB 4IMLB 1G7IB 3HFFA 2VTFA 3D8MA 5HDQH 1Z5HA 2HCZX 2EE3A 1NEZB 5EUOF 1ZHNB 5E9AA 3SJVE 4RAVA 3HZKB 3C9NA 3RIAF 5KVGH 2FCBA 3FMGH 1CICD 1V54B 3OMIB 4H8WH 4HS6A 3CJJA 3RL1A 2NQDA 1P2CA 2YQGA 2H45A 4YNYA 2I69A 3FS9A 3VXRD 2O5XL 1A47A 2WZAA 1M6OA 5D1QD 5C8JB 4OM0L 1OB1A 4BZ1L 4IBUA 4Q89A 3FU3A 4G11A 2ZOUA 2I5YL 1XF3A 4ALAC 4O02H 5EG6C 3MV8B 1AOZA 2ED7A 1NCOA 4PJBF 2EH7H 4NPJA 1OV8A 2NTFA 4R7DA 1E42A 5K59E 3L48A 1M56B 1YYCA 3NCFB 4G6KL 4LCUB 4R96B 4HJTA 5I74B 1AXSA 4MMYB 5FYLD 1GC1H 4A7UA 1Y18A 5JIDA 1E27B 5KVFH 1BBDL 1XGRA 1QP1A 4JHBA 5T5FL 1OT1A 2J1XA 1W0WB 2OMVB 1EXHA 4EBQL 1GIGH 2YEZA 4L5FL 5GGSA 1G7JB 1S46A 4D9RD 2R1XA 2Y6SC 1KCUL 3LEYH 5C07E 3ZPDA 4S1QH 4YDIH 4A7QA 3IDXH 5B7MA 3GNML 1WD8A 3P11L 2BZDA 2CA3A 2DEXX 4HWBL 3MRMA 3MCYA 3C75A 4TMPA 1G9MC 3QUMB 4KKZA 4WEBL 1FV1B 5DUMH 4Q0XH 3V0AC 1EVUA 4BFOA 5EOTA 2KKQA 5CGMA 3MLTA 3P0VH 2GY5A 3U6XS 1DL7L 4UINH 4FNLL 3FYEB 1JRHL 2ICWA 3B2VH 4FRWA 2CG9X 4HCRL 2VLJE 1BZ7B 3QIBC 3U6RB 4NQDB 3B2XA 4S1SH 4IBVA 4BUHA 2AEQL 5DC0A 2L3BA 4RZCA 1UB6A 1AIZA 4UQ2A 5A2FA 1QPXA 2BIQA 3FCTA 4DSYA 2OL3H 2E9JA 5GZOA 1CTMA 4XXDB 2EDYA 5LBSL 3RU8L 5GQBA 2PWEA 1GJIA 2HVBA 1I1RA 5ICYA 4UILH 3QFDB 5DMGD 4JFEE 4JRXA 4QNPE 4OFYA 4P4KB 2DWDA 1ZEAL 2FNBA 2H41A 1QAWA 1U95B 2FDBP 3O4LD 4Z7QB 5IQ7H 4ZX5A 1CI5A 4QHPA 4PWHA 3IWVA 4LDCA 3EJCA 1NBQA 4PY8J 5C6TH 3SQOH 1MCOL 3CUPA 1KY6A 2GSIA 1G7PA 4NIKB 1S4IA 5IBLD 2AQ2A 1YC7A 4WFFD 5LGJA 3GSNH 4X0NA 3DJRA 3LZRA 3VFWB 4OGAD 3NFSH 3GSUB 1SMAA 2Z91A 4GRMA 1FH2A 3GMLA 1E9OB 1HYSC 2VXUH 5DD6A 4ZMXA 4LP8A 1RAMA 4RGND 4WHCA 4HCFA 3ULSB 1VZIA 5CEYB 4R7XA 1G4RA 3QRFM 1CXFA 3EADA 4X0KB 2XIIA 4P5RA 3PJSA 4DOHB 1RHHA 5IBUG 1KCKA 3CV5A 3E6HB 2Z64C 4CILA 2E9WA 3W56A 1M1XB 1KNOA 4JFFB 5CEZD 5I15H 2R4SL 3R06A 1DQMH 4U0QB 3AS0A 5TFSH 3ESOA 1IGCL 1RZFL 4PJ7A 4NO0B 3VXSB 1KCVH 4P2RD 4GH7B 2CIKB 1MLCB 2VLMD 3KD4A 1WIPA 4JFZH 5GS1A 2AEOA 1KGXA 1ZPUA 2J2ZB 5KEZA 4QRPE 2QADC 4FNSA 4XVUD 4GXUM 1OCOB 4HHGA 4PJFB 3MR9A 4Q6IB 4HJ0D 2DBLL 2NY6B 1HAWA 5C0CE 3H6AA 1SJEB 3ATBA 4EIZC 1LEGB 5HHPB 4JN2B 2EDEA 2OQJB 3IRCA 4NWUL 4IBQA 5BW7C 1MNNA 1E30A 3AMKA 3HMXA 3QC6X 3ABLB 4KV5E 5DJ8A 1E9QB 2HG0A 3RTQD 3VXNB 2EC9T 1A2YA 2FZ3B 4AJWA 4M48L 5FWRA 2LTQC 4DKDC 4FJYA 1GZQA 1CFTA 3TCTA 2F8OA 1EJOH 2XZQH 5JIMA 2WYZA 1UGKA 2AI0H 4NN7C 4Z5RB 4PJDF 4YL4A 2VRKA 3V52L 5JOFB 2ADIB 2VNCA 4G3YL 1CGVA 4NJAH 4JFUA 1IZJA 4WK2B 4MVBD 4ALAL 2EDBA 1D2PA 4KJPC 1NBYA 3GIVB 4AV0A 5ABDE 1NBCA 1CD0A 1JK8B 2PW1A 3IU4L 4XP5L 3RWEB 1EWHA 1SOSA 2UZYB 2WY3B 4MJHA 3V7AE 3X1NA 1HH6B 4AL8L 4Y5VC 1EO5A 2XWEA 1AR1D 3QXDB 2Q8AL 3IFPA 1T7ZA 1A14H 4Z7VA 3KGTA 3UAJD 1QX1A 2N59A 2L0DA 5IJKA 1U33A 1BZQK 1X5FA 3U1PA 3BQUB 4UMSA 2GSMB 1C5CH 4G8GA 2ZXDA 5T5NF 1KJVB 2W60A 4BFGA 4GKZA 4GAJL 1QSEE 4P9MH 3TBWB 4PWFA 1DHKA 4GAFB 2GUOB 1KC5L 2IWEA 2ZOWA 4FXTA 4IRSC 2HB0A 2Z1KA 5CCGE 2W80C 3HG5A 1DLFH 15C8H 4XT1C 5I1CL 1RI8A 1XAKA 4CC0A 3MCKA 1ILUA 3P3YA 3MRBA 3LIZL 3BKJL 3VM7A 1G9NC 1XXDC 4IBLT 1D5ZB 2YMXL 5H94A 4JJ5B 5H8DA 4LSQH 5HHVL 2YPVL 3GMQB 3S3CB 2YAHA 2BFGA 2R2EB 3MNWB 4UI2A 5E8NB 1G1OA 4FXLA 3PDDA 4WHTB 2R0WH 5F9OL 2C7UB 3GS4A 1YEDA 3QUMH 4ZSOE 3DHMA 1SJXA 3VWKB 5IGXH 5F1OB 4X99A 1RULL 3QK0A 3VGEA 3VFVA 1I3RA 1Z2KA 1M7UA 5HDRA 4QTHA 2X4SB 2NY1C 3IDGB 2I26N 4L1SA 4QHNB 3VVVA 5HD8C 3DRTA 1ZA3A 3TJEL 3AWGA 1KB5A 4FYRA 3WELA 4B7IA 3LQAH 3PQYA 4GKLA 5FA4A 5FV2A 1K85A 3UMTA 4W68A 5F0MB 4KI5F 3B9KD 4KTDL 4AMKH 5A1AA 3STZB 3EO0B 4BHUI 3AT9A 3TV3H 3F05A 5JR1L 1IC5L 3AFLA 3DI2B 3EFOA 4AM0A 3MMEB 1CB4A 1IX2A 4XO5A 4MBOA 5T1KA 3HVNA 2XRAL 3FCGA 2ITEA 2G4EA 3HJ0A 3L5XL 3KYNA 4FLHA 5D4IA 4U3CA 5FYKH 1NEUA 4Z7NF 5AG8A 2CSPA 2JK5A 3ARFD 1AZBA 4IS6B 1OGAA 1T0PB 3CIQA 4Y4HD 1QYGL 3F84A 5KBKA 3O2VL 3KJ6H 3RDTA 4O2CB 4OV6F 3AZUA 4U7MA 4UOW1 1OLZA 1ZHKB 4N2FA 1ZT1A 3ZQXA 1XD0A 1EAOA 1IAOB 1FYTB 4K3HA 2YRLA 1DQQB 3BVWA 3RGBA 1FIGH 4HJ1A 3GKZA 2WQUA 4L8SC 3BLBA 3QJSB 2J20A 2V3DA 2YSTA 4O4YH 3SPVA 3P3RA 2FB4H 2FO4B 2A6KB 3D6GA 5A16B 4PUBL 3ZL4H 3P54A 4ERSH 2O30A 3GLEA 3MJ6A 1B9KA 2DQJL 4YHYC 4I0PB 3FT0A 1ZT7B 4E9WA 4FLOA 4F37F 1IL1B 4ZTOL 2DQIL 2AXJA 1KG0A 2QQLH 2VSDA 2FD6L 3DVNB 3EOTH 3FU9A 2BSCA 4X7TB 2XZAH 3QAZC 1NFKA 1HQRA 1F18A 3T0AA 3RX7A 2AXGB 3WXVH 5JW4N 1DSWA 1IJNA 2C3VA 5C0BE 3KWWB 5CZXD 2R4RL 4RGOH 2A77H 4ZAKA 4Y9FA 2VLKA 3KPLA 3GO1L 1EUTA 1MWOA 1YMHA 4NDMB 3BUYA 4GRWF 1WHOA 2VLRA 3O9WC 4JQXA 4Y19A 3VI4A 1UXWB 2O6EA 5HP5A 3WTXA 3V6ZB 1KXQA 2OZ4A 2PO6A 2QGBA 3FUNA 4JFYB 2BMKB 4MQ7B 5E9DE 2DM3A 5L0QC 2H3KA 2DTML 2EACA 3MJ8B 2K45A 2NPLX 3QUYD 3VI3A 1BQSA 2P49B 2ZOOA 2EYTB 5J13B 2DQUL 5KVEL 4BSWA 3NJIA 4HUVA 4M4RA 3DLQR 3A23A 1SDDA 1A3LH 5I0VA 3UG4A 4NPKA 3MO1A 4HXAH 5DMIL 4IGBB 3LHPL 4PYGA 5CP7A 3VFUA 2ZONA 4ZMOA 1GYWA 1U8JB 3VWJB 4A6YB 5I30H 2YN5A 3GJEA 3D05A 1H3XA 3PAVA 5DUPH 3QO0A 3ETBJ 1VDGA 2AJ3B 4UMGA 4YBQD 5E99H 3S5LG 3WFZA 5IESH 3L9BA 4XPFH 1KCSL 5GS0H 1ML0A 2YUXA 1X5ZA 2E76C 1AYOA 3GZQA 3V0EA 1JYNA 1RU9L 2C3GA 2OBGA 4H40A 1U8OA 4LLMB 4N22A 1I1YA 3IDNB 1DTUA 5CGBA 4APQC 3F83A 2VE6B 4KX9A 1C5BL 4XNXH 2BSTA 2JVUA 3TZVC 2H2SD 3UG3A 2OMYA 5CEXB 1KPUB 1KN4L 1T4KA 4P4RB 4C54A 1DBJL 2I25N 3GF8A 1NWOA 1VESA 5DYFA 4LFHD 4AQ1B 4HP5A 1XMEB 2K3HA 4JPWL 3WN5C 5DMKB 5KYYB 1FZOB 2E7LC 1ITCA 4DZBB 2UWEB 3L9EA 3UC0H 2GK0A 4N0UB 4WO4B 3C6LB 3LVTA 3C8KA 2B5IB 3BZFB 3QWNA 1NCHA 5CFAA 4XBPA 5IG7A 5AVVB 4FJZA 3AQYA 3TNNB 4E42B 1ORSB 4E9LA 2H6OA 2N0KA 2HT2D 1PKQB 3ECBB 3FQXA 3MRLB 2XY2A 5IBTH 1I1CA 5JPNA 3KLLA 2RTTA 3B8YA 2WOYA 1QNIA 4MA7H 1CR9L 1HE7A 2BC4A 1JPEA 1UCBL 3DO7B 3FHAA 2CCLA 3FF7A 1A9VA 1KV7A 4NZUL 1QFUL 5DHVA 3MV8D 3KYAA 3OLDA 4DP6X 2V5TA 3PWLA 2XN1A 4EVNA 3ZDZE 1TQUA 2FEEI 4NKQB 2AF2A 2DYPB 4JFDB 2JJUA 5H2BA 3OKOA 4MRCA 5MENE 5FKAB 4KDVA 1KGJA 3QISA 2X2IA 3O6MH 4CUCA 4XCYB 1N10A 1NSNH 2WSPA 3B3IA 1ECZA 1UD5A 5C3IA 2ITDB 3DRQB 4Z95H 4LIQH 1M2VA 2DI7A 4CVWA 4PHXA 1KTBA 5IMKB 4RDBA 1KGCE 4OLWH 3C5ZB 3WNIA 5FK9A 5HI4C 3IS0X 2G3ZA 2EKSA 4DN4L 4KVPA 4HUXB 1SJVA 5F9WB 4AYFA 4E0RB 1NCUA 2IDQA 2V17L 3IVKB 2GW5A 3B1TA 3QEHB 1RIVL 4I3SH 3F8UB 4ELME 4X6CF 2QKIA 2L8AA 2D4DA 3L5HA 1QSFB 4TRPL 4LGPB 1ZGLA 1M6UA 3ATAA 3VRIB 4CVXA 5F96L 3II3A 4XGZB 4U6HA 1NWPA 1JHTA 1OPGL 4RMVA 4F1SA 1WD9A 3BWAA 4NQDD 5EOCH 1PLCA 2J8OA 5CJ8A 5FKPA 5HHOE 3C60B 1YC8A 3TJHC 2WB7A 3DROB 5AFAA 3UAAA 1BGXL 3HI1B 4KY1H 5CFHA 3OC8A 2FECI 4JO2L 1NGYB 1U4FA 3Q8CA 1OOWA 1B3IA 1FFQA 3IRZA 1MCNA 5EC1A 1OAKH 4LBAA 5E23A 5CR1A 2FBJL 4FP8H 3EGXA 3W82A 2FNWA 4EUPH 1BWMA 5BZDA 5AW6B 3MRQB 1GKEA 2E47A 2TAAA 4P4KD 3RLSA 3V8CA 1OPOA 1B88A 2C1PA 1L0XA 4MNQE 5GZOC 1DVUA 1G6VK 4OZ4B 3NJKA 2PKDA 4KO7A 3OR7A 5JHMA 3F5WA 3NUKA 1LO4H 4MNHB 2ARJQ 4FG6C 4LHQB 5EPMB 2Q6WB 5LCVL 2FHCA 1KTJA 4E9TA 5AVUB 2ZUQC 4U1MB 4PJCF 4P3CL 2QLVB 1KGWA 4B3VA 1J7VR 2RIKA 4HWUA 1HZHL 5F9DC 1PAMA 2V5SA 1F13A 5F2FA 5HGDA 1E4KA 4OGQC 3TYFA 2JXMB 5I1HL 2AV1B 2A6IB 4KK8C 4OF6A 3UAFA 4JDZB 3ZLQC 4RISL 5DF0A 4JRYD 2GI7A 1QUPA 3ES6B 3QZWG 4Y4FD 3D48R 1RLBA 1AS7A 2G3MA 5IFJA 4AENB 2OULB 5E9NA 4ZFOB 3ZU8A 5I66B 4ZD3L 4DK6A 1JPTH 2OK0L 5CBAA 1ID5I 1AG0A 3ZKSD 1LL1A 2GVYA 2VW7A 4QF1A 3T4YB 3WFCH 5ESAA 3S36X 3S5LA 1XF2A 4KXZI 3RBSA 4M1DH 2OYLA 4ZFGL 2YXFA 4NO0D 1R34A 3SYOA 5F1KC 3WFBH 1AE6H 3VGDA 2PPDA 2BVPA 2CO4A 3IMTA 4JG0L 5EA0L 2NDFA 2R7EA 3OGOE 2X4TA 1BPVA 5PAZA 2DTSA 5E2VL 3G5ZA 5GJTH 1KPRB 1UA6L 3R4DA 5F7NC 1KYOJ 2X44D 2BOBA 4ZUUB 5KVDH 1IM9D 2NY6D 2AK4E 35C8L 1BOGA 3DVFA 5GS1C 1ES0A 5I76B 3U7WH 1FG2B 2JKWA 3D39A 1CFQB 2W8CA 3MDJA 3MU3A 5IB2A 2CO7A 5FHBL 2P8LB 4HK3N 4ZMWA 1I75A 3C09C 3MLSH 1T5WB 1HQ4A 4IYKA 2BSRA 5AB9A 1JD7A 4O2FA 3MBWB 2FBOJ 1PD1A 2DQFA 2RJMA 3DMMC 3Q9PA 4P2YA 1T0MB 3RRQA 4UQ9A 1WAAF 4IK7A 2YPKB 3UL4A 1CF8H 1BD2B 1BM7A 4JM2F 3OGCB 4YZFE 1GOFA 1V7NH 4P2RA 4NGHL 5MEOA 2ZZUT 2FJGA 3EYOB 5ALCH 2EADA 3LN5B 4ELKA 1ZS2A 4G2AA 1NLDL 2BP8B 5E5MA 5I18H 4CC1A 3JQOB 4G7YH 4TL4A 1J1XL 1JHKL 1IILE 5HDBF 3MZGB 4X2UA 2EAEA 3LKOA 1Q1JL 5I1IH 1XH2A 2EIEA 4PJIA 4TUOB 4JDVB 1RUAL 4RNRA 3KLHD 1IQDB 3B7TA 2D4FA 3WNJA 4WUKL 5GS0D 3BQUD 1QR1A 1RZPA 1VGEL 3ZZQA 4RAHA 5IHLB 1LDPL 1W8EA 2RR3A 5DEGA 5BVJA 4IJTA 3FU7B 1BQLH 5LGHH 2X9YA 2F74B 2J71A 2V5MA 2H6PB 4LO9A 5IJKC 1ZOXA 2ZWLT 4HS3B 5MP6L 5ABZA 1FDLH 2FWLB 2E7CA 1PBYA 1CFVL 3IXTB 3HG4A 4YE0A 3CH8A 5HYQA 5EFIA 2N1TE 3TVMA 3FT2A 5JHDE 3HUJE 2Q76B 1A7OH 3CXHJ 1JUFB 1OGPA 4P5MA 5AW9B 1TDQA 1BJ8A 3LV3B 3DUUA 4JX0A 1JNHA 2XIDA 5MEPB 1XV8A 2R69A 3SE9L 5KTEL 5E03A 1YN6A 3QQXA 5BRZD 3TWCH 3NH7H 3O2DA 2Q9OA 4XB8A 3WLWD 2Q7YA 5AAPA 1J05B 4AK2A 1HNGA 2X05A 4M00A 1Y1UA 5F6IB 5AYUH 1NBZA 4J1UB 3VXUE 1CG9A 5I2IA 2P8PB 2K78A 5E2WH 4LOVA 3TBSA 3CFBB 4HH8A 4NWTL 2QBWA 2VRQA 3WN6A 4ZBJA 5DJYB 2R29H 4JG1L 3PWNB 5IT2H 1MHHA 5B7FA 3NP3A 4BA8A 1IBHA 2BFVH 1TENA 3EYSL 4Y1AB 4AG4H 3VG9B 2YBRA 4R4FH 2Y07H 4XMPL 2EE6A 2FGWH 4K8RC 5B1KA 1MFNA 1J0JA 3FQWB 1P4LA 1ETZB 3QPQD 2CNZA 3H2QA 4NBXB 2P24A 1OTUC 3WI9A 4PJXB 1DBKL 4OQTL