5BO0D

Crystal structure of human mcm2 hbd and asf1b chaperoning a histone h3.2-h4 dimer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
154
structure length
154
Chain Sequence
MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/dna binding protein
molecule keywords Histone H3.2
total genus 26
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 5bo0D00
2IO5A 2Z34A 2Z3FA 2IIJA 5EIIG 2CU9A 1WG3A 1TEYA 2HUEA 2DZEA 4EO5A 5BO0D 5BNXD 1ROCA 5C3IA 4RRPM 2IDCA 2I32A 3AADB 2YGVA 4ZBJA
chains in the Genus database with same CATH superfamily
3VWJD 2I85A 4YSDA 2XQBH 4JG1H 5DEFB 1MW2A 1AHWA 4ZZKA 1QFHA 4HALA 4OGAC 4LLQB 25C8L 1JWUA 3O6LL 5H4YA 4NXKA 4YPGB 1MI5D 5JHDE 3VXSB 4C4BA 4ALAC 2OYMA 2P47B 4Z7WB 2A38A 2X9ZA 4FLRA 3KL3A 2K6ZA 1XGQB 4JQIA 4U31A 1CWVA 2ATPB 4U1MA 1B0GB 4UT7H 1HN1A 1WEJH 1WSST 2X7LA 3O8XB 4Z78A 1MHEA 2OJ1A 5IW1A 3GRWH 1SJEB 4MMZA 3HC4H 4RIRB 1A65A 3MOQA 2EDKA 1T3FA 1OT1A 3VXSA 2DWEA 1U8PB 1YYLL 4BFOA 1S7XA 3QNYA 4NKMA 1N4XH 1HE7A 5TDNA 1ZS8B 5GZOD 4LEXH 5E2JA 4HOWA 1NMAL 1IGML 3EGSB 5IJBC 1HFUA 1KFGA 1NEZG 4YZWA 3L17A 5JOPE 2DQDL 4N2GA 4IS6B 4AM0B 1LQBC 5IWLA 1VKXB 4XI5C 1U8KB 2YBRB 4ZYKA 5JIQA 2F1AA 4X80H 3HG0A 2YJLA 3NEOA 3WEBA 1F3DJ 1SDYA 3B4NA 1T1XB 3TCLA 1AMYA 4FZEL 3DJTA 1HXYB 2DH3A 1PZ5B 5EU6D 2BSRA 4MX7A 4KUCF 4I87A 4MXWL 5E8PB 1I1AD 3IMWA 4NQXB 1OCOB 2E9BA 2VDRH 1E4WH 1HKLH 4GP5B 3WDHA 2DQFA 2OYPA 5SWSE 1JFQH 4KKAD 2AXHA 3AROA 5CMAA 3WIIL 1BD2E 3QCVH 5L2KA 3V0EA 1AYRA 4HISA 3G04B 4TNWF 2ZG3A 3BDYH 4NB7A 5CLZA 3V52H 4OZIB 3BKYH 4OLVH 4IKLA 3UFIA 3BVTA 5EOCL 2K3TA 3QNXA 1OAUL 4G6JL 5CINH 1RIUH 1VCAA 5J56B 3VXSE 5EBLA 4ABWA 2D7OA 2XIIA 2Y7QA 3TP4A 3VDAA 1A21A 1VDGA 4Q9QH 4WTQA 1YY8B 4GO6B 2Y5QA 2QKIA 3RGHA 3B9KA 3QIBC 4IRJC 4F5CE 1GGCL 2ZAGA 4XPHL 3KPMA 5D2LB 1K3IA 3OKOA 5T1MA 4HXBH 3IXTA 3OAZH 4GUPA 1MCKA 3CBKB 1UEMA 3O2VH 1YMMB 2Z7ZA 2Q7YB 4KJYA 1FNAA 1L5GB 2PNDA 3GSRB 4KJWD 3ILQD 1NAKH 3BPCB 1C5BH 4LPWA 4ORGB 5T1KB 2R56L 4OZFG 3Q2WA 1A8JH 4UAOC 2F15A 1OP9A 5IMMB 4LAQL 1LE5A 2BY1A 2Q3AA 4FAAB 1FVDB 3L3HA 4AYSA 5M94B 1INDH 3MLUH 1DFXA 4JFFB 4P4KB 2OTUB 1ZK5A 3QUGA 5FO8B 4EO5A 4LNRB 3WFDH 4MWFB 1MKFA 5I1EH 3KBPA 3GSVA 4MKTA 4Z3GA 3NFPB 4ODTL 5B22A 3LQZA 4PJ7F 4XCEB 2V0AA 1P5UC 2KKQA 3WIHL 1CR9H 4X0KA 1H8LA 2Z4QA 4XPBH 3MPCA 2BC4B 2E7MA 1TLKA 5DYOA 2MOQA 3QUXD 4JKMA 1BIHA 5CGTA 4X5WB 4OQ1A 5JIIA 3SPGA 3HZYB 4QWWD 5D6DA 3ZRFC 2ORBL 3ORJA 4G6FB 4WCYH 1ZT7B 2DF3A 5C0BD 5HJ3A 3R0NA 3SKMB 1IE5A 2HTLD 5JORA 4NN6B 2EIZB 2G2NA 3NK4A 3MV8B 4LLVA 3VD4A 2A6DA 4I3SL 3RDTD 4E2OA 1ML0A 4GUCA 3OKMA 3VD2A 1CLCA 1ZV2A 1YDPA 1BVNT 4HGWB 1S7TA 4JLRB 4KH9A 1H6EA 1T83A 2WUBL 2UZXA 1MAKA 1UJ3C 5L8LB 4RDQF 3QAQA 3QI9D 4UQCA 4ZNEA 3LV3A 5C0EA 5AAWC 4N9OB 3GPSA 1J5OL 4YZFF 1DO6A 2VB5A 1XIWB 5TE7L 2JTYA 3KPSD 1XZ0B 5CS7A 2YXVA 1I9IL 1RZJC 3HCVA 4GAYA 4X5LA 5IF0B 1Q0EA 4UQIM 4WY7H 1PYWB 4DETA 5JR1L 4JVUA 3EFFA 3MFFA 5GHWL 1B6UA 1C8PA 4HLEA 1UZGA 1R3JA 2L7QA 2BFVH 4EDWH 5I71C 4LCCB 3GLDA 5EO0A 4YBLB 4YHNB 3QH3A 4UAOB 1Y6MR 4WWKD 3K6NA 5HJGA 2R2BA 2YQ3A 1P53A 2ROYA 3FYIB 2BSTA 4JM4L 4BFNA 5DJAA 3O0RH 2VZSA 5KVDE 3GHBH 4W6WB 3B9AA 1DJGA 3RBGA 1XL4A 4H44C 3HNTH 3QW9A 3EH2A 1NGPH 2XN9A 3JTTB 2QVMA 3RA7H 4R7VA 5D7LD 4MB1A 5F6IB 4HKZA 3OJMB 3TA3B 4F7MB 3ARYA 3H0TB 1DUZB 4PJIE 5DJ2A 4AH2B 1AO7D 5GS0L 3EIFA 5GGRY 3PU7A 5IFAH 1NKRA 1F45A 1OSPL 4HS3A 2R2HA 1NFKA 5IHZB 1UM5H 4ELMF 5E95B 2BRRH 3L5WB 1JWMB 1OAJA 4HZLA 4N5ED 3V4PB 3Q6FA 1O7VA 4XCNA 3ATDA 3BRFA 1HESA 1EX0A 1X4ZA 2GJ6D 1CVSC 2ADIA 4CBZA 3T4AA 5DJ0A 1U91B 4U7SA 2FEEI 2A83B 4PRPE 4QEGA 4WK4B 1J5CA 4AMXA 3DI2B 4DN3H 4WO4A 5FO9B 5HDBE 4I48A 1UCTA 4FQLH 5C0AA 2NTSP 1N12A 4FABL 4C56E 2IIJA 4OY9A 3REWB 2CDFA 1CLOL 1RJZA 4MDIA 4ZUUB 5SWQB 5DFVD 1CFVL 5GSVB 2X6AA 4DSYA 4JO2L 1Z9PA 3DJ9A 4IEFB 3T09A 4MJ6B 3QIUD 3TYGL 3L5XH 4RESB 4XPTL 4N2HA 3TZVD 4MSWA 1CDCA 4G8GD 4OFKA 1FC1A 4K3HA 1L3NA 3LZOA 1DSWA 4Q9RL 2DLFH 3NZ8A 3PL6D 4NC0B 4D9LH 2WBJA 4B95C 4GQZA 4EE2A 2FUQA 1RZPA 1HHHA 1MLCA 3R1GH 3S35L 4Y5VA 1S7UA 3HCVB 3W11D 4BM7A 4Y5XC 3EGXB 3Q8CA 1N5YH 3MRKB 2WZAA 4HGKC 2EXSA 1A6VH 4B0MM 2BVUA 3HAEA 4HIXL 4WI0B 1FZOB 1FFOB 3TL5A 1TETL 3KE0A 4QOKD 1WGVA 4MA7L 2VXSL 3V0WL 2OXGA 2JJSC 1YDPB 3S3PA 3ATAA 2VDOB 1TZOA 3CDCA 3GMPB 3NSJA 5CJQH 4A7QA 3UTPD 1TQWA 3V7MA 5C0ND 1H3GA 4MJHA 4LLVB 3ZSTA 2H6UA 3ECBB 3NQKA 1A7NH 5CUSH 3TWYA 1AMXA 4TOYL 1J1OH 4OCXL 2CJUL 4ES9A 4FFWD 5AOMA 2AVFA 3AU1B 4DIXA 2WN3A 1KCUL 3MRPB 5ID0A 3UZVB 1A6AA 5DURB 1YEEH 2GAZB 2VR7A 5EORH 1AD9A 5B3SB 43CAA 2C9SA 1HQRA 5ACLA 3OR7A 2JI3A 3B8SA 4KX9A 1JVOA 4PD4K 3MUJA 1QR1B 4LCVA 1D5XA 1X5YA 2UZYA 3KLSA 3OKNB 5DHDA 2AK4A 3MHZA 3C60C 4S11A 4TUKH 3AQXA 4R4FL 4FQ2H 4NUPA 3F58L 4XH2A 1OO2A 2Y7SA 1P5VA 1QSVA 5F1IB 3D2UD 5ISZE 1J1PH 3SGJA 5IJVA 3MA7B 1S7RB 1J5OH 2ZUUA 1DJHA 3HC0A 4BCYA 1MCFA 3IT8D 2QVIA 3T1FA 1NPNA 1T2XA 2EDHA 2VLLB 4APQD 4KUZL 3G08A 1MWOA 5IK3A 5JW5A 1KY6A 2CR0A 4G8AC 2QSQA 1ORQA 3FT2B 4YSOA 4Z18A 4RGNE 4UM8A 4EN3D 4KTEH 3GXTA 5DD6B 1BQHA 1A8ZA 1G1YA 2H4EA 1RXLA 5J11B 1AR1C 4XCNB 3SBRA 4K3DH 4Y16C 1XL6A 1IIIA 1MEXL 4K2UL 2BWQA 3B2XA 4PJXE 4OKDA 3D51A 3EJQA 4J8QA 1QRNA 3OLIA 1ONQB 3MGTA 3RVVC 1KB9K 3K2MC 2NW2A 3SDYH 1X5XA 1AD0B 2ED7A 3MRQA 3UBGA 3O3BB 2GJ6A 4U7MA 3S3DB 2VH5L 3T1WA 3G5XA 4CVXA 4IDLA 2TRHA 4QHKJ 2IH9A 2LLGA 2H8PA 4Z8FL 3POHA 5KYXB 1VEMA 3PWLB 3FO0H 2JNZA 2GTQA 3K72B 4YHLH 3CH8A 1NOAA 1J8HD 1P4LB 1F8TL 3DOSB 2I27N 4JHVA 4A38A 2OCJA 2AEIT 3IAPA 3MRBB 4X8GA 3PP3K 2HB0A 3H56A 4JFZL 1H8OA 1TSHA 2VXSH 3N1PC 4AW4A 4HWBL 5D8JH 5KYYA 1IBZA 3M8OH 4UOW0 3EHBD 4RFNB 3CFEA 5ALCL 3U82B 1G84A 5C0DA 1HINL 4RFEB 2UVFA 4EI6B 1QI4A 3HG2A 4P23A 3OG4B 3TGXA 1RY7B 4CC1A 4KMTL 3MUUA 2GPZA 2FTAA 1RZQA 3GPEA 4ZDHB 3TA4D 4PWFA 5DJXB 3D3VD 1M2VA 4M61A 3RVXD 2BP8A 3BZDA 4Q9RH 2IH1B 3CE1A 3RWCA 3WMQA 3DOSA 4G8IB 4L8BB 4LGRB 4I5BB 5HPOA 1F90H 3IM1A 3ISWA 4NENB 4NO0A 4H8QA 4PG9A 4Z76B 5D70L 3SBQA 4OKVB 4M62L 3VXTA 2V5TA 1E50A 1HEZA 1M6UA 1XGUB 3CZKA 1G6RH 4LNRA 4GIAA 1FQ9C 2UZXB 1F58L 1YC8A 3BC9A 2CRZA 4XP4L 1C5DA 1KJ2L 1UQSA 2D9QB 4ZUVB 2AP2A 4B9KC 1HIML 2VIRB 1JF1B 3WELA 4B96A 4OU3A 2X1XR 1KWKA 3HG5A 4KNQA 5AL8A 4JS7A 5MEPB 2XJLA 2E5EA 3V6FB 4BFBD 4L1DA 1GOGA 5D4JA 3NJVA 5F7YC 4L8SC 3EO0B 3G08B 5IK3B 4BUGA 4MA7H 3UTZB 3BPOC 3AREC 1T7VA 5DLMH 1CFTB 1ET8A 1FV1B 1A4KA 1EXUA 1XCTA 1Y6NR 3EDDA 4HIXH 4R5XA 5BZXA 3SCMA 5ICXA 1NMBH 5CP3A 5E4IA 2QMJA 3U6XS 2ESVE 1DN0B 2V7HB 1H19A 1ZWIB 5FEBA 3N9GH 3HI5H 3IDYC 3JWNH 5L6YL 1Y07A 2PR4H 6PAZA 4TMPA 3L4UA 4A6YB 4KZCA 4MWFA 1HZHH 3MACL 4M93C 2X6UA 2DQJL 5TF0A 2KL6A 1Z5HA 1OAKH 1OQOA 1CS6A 1NM4A 3FBKA 4QCIB 3ASNB 1XH3A 3NN8B 1KENL 4Q6KA 5DQ9A 4P46A 1R33A 3TVMA 3BLBA 5DD5H 3UH8A 2MOGA 5I76A 4FQJH 3WKPA 1BYPA 2H5UA 3GSRA 4AQZA 2APBA 4W9KC 1O9VA 2VC2L 4Z7QB 1XIWD 1FVCB 1CDYA 2Y07H 5CHNA 1DQDH 5AQ0A 3KPLA 4JN1L 2EZ0C 4OLXH 5AG9A 3B1TA 4HMCA 3TOPA 2EH7L 2I24N 3V8OA 1KCLA 1V7MH 4Y19A 1FNGA 4W6YB 5AOLA 1A7OH 2WQRA 4WFGE 3QCUH 3P77A 4MQXD 2OK0L 5BVJB 1J1PL 3ZIMA 1DQVA 2QJDA 4LGPB 5DVKA 3PJNA 1S9KC 4NO3B 4OFDA 2CHDA 5FKPB 3W38A 5KS9E 3OD3A 2WB7A 3VXQB 3ULVD 5C0IA 2I5YL 6FABL 5CIPB 4YHIB 5CEXA 1VZIA 5FDWA 4O51A 1E3ZA 4KI1A 5C0BE 4FCAA 1XMEB 4J6RL 4UT9H 3OPZL 4DW2L 4P5TD 3QEUB 2C34A 3Q9QA 3PYCA 4QRPB 2OAAA 2AK4D 2CALA 4A39A 2NX5A 4KKLC 1ZY9A 4LGSB 5KW9L 1IZKA 3GHBL 4Y4HC 1XGPB 1NA8A 5EA0H 1S7VA 1D5RA 5GGRB 2NYZA 4F37F 4A2MA 2WLLB 1CF8L 4LO9A 1T0MB 3TBVA 3CVHL 3NCCB 3H42H 4ONGL 4TV3A 1Z9LA 5CP3H 2C4FT 3HI5L 1WPCA 5DQJA 5DHMC 3IFLH 1DLHA 1RJZB 4MDIB 4ZUUA 1ZS8A 2BHFA 2OX5A 4XPGH 2CDFB 1M7UA 3FN0H 2X4PB 1Q1PA 3MJ8B 2FNWA 3L3IA 1KV3A 4FQIL 2IXQA 5T1LA 5C0RL 1M4KA 5MI0C 1L4IA 3HVNA 4B9JA 2WM0A 4U1IB 2G5BB 1GTFA 4LMQE 4J3OD 5IFJA 2BNRA 5HYQA 4ZXBC 2EH8H 1R46A 5FK9A 2YGQA 4GEIA 1A9VA 1WBZB 4MS8D 3SGEI 4M1CD 2ZWLT 1ZT4A 3RHWF 4NBXB 2R51A 3D4YA 3ZGHA 5JIKA 1SJHB 2QVTA 3ESMA 4WW2F 3PAVA 4AQ8C 1OCCB 4ADGA 1UWXH 4TLUA 1CB4A 1DDHB 1MLBA 2LAAA 1IGIL 4DGWC 4U1LA 5D70H 1FVDA 2B2XL 4M62H 2ZONA 1MI5E 2JQAA 3I6GB 1G5GA 3EZ8A 5JHDD 2CPCA 1HCFX 1QR1A 1EUUA 2FWOB 2FL5A 2LFEA 1GIGH 1X9UA 3DUSA 4L4VB 2K0RA 4S1SL 3FU7A 1QA9B 3EDFA 3G6DL 1JNLH 3MODH 3P77B 5AL0A 4ZUSA 1I8UA 3ULVF 3EJZD 4H1LH 1QI5A 2BY3A 4OM0L 5GRZA 4XXCC 3RFRA 2ERJC 4BZ1L 5IUSA 3D0AA 4C56A 4YBQC 4K8RL 1EMTH 1JGVH 1QFPA 3HC0B 3D4CA 3IXAA 4R96A 4P2OC 3AZUA 4ECNA 1QLFA 5DJCB 1A9EA 3TNMA 1EFQA 1SEBA 4U6YA 1L9SA 1S7WA 5I76B 2FWOA 3K46A 4XMWA 3WTYA 3TVMB 3ZK0A 2A7BA 2RQ8A 1SPDA 1X5ZA 3O2WH 3MQIA 3P4LA 1OTSD 4IKIA 2FEDD 1L0YA 3RWHB 1M57B 1DQMH 2ZF9A 2UWEA 2F6AA 5FYKD 3U46B 4ZNCD 1T2QL 3IGLA 1MWAL 4DP4X 5E24E 3S35X 3AU0A 2H2PD 1NUNB 1IAMA 4OIFA 1N64H 4A6YA 4G1EA 5C0CB 1YNLL 2Y06L 4ZXBB 4J4PA 3WIFA 2O61A 2FEJA 2CM5A 2X2JA 6CGTA 1PZ2A 5KTEL 3JV4B 3L1FA 4NN5C 4YLCA 4ZW3A 3DYMA 2YSTA 1E3FA 1ZVNA 4XNMA 1N10A 4DNLA 4UT6A 4ETYA 4GKZB 2APWA 5JIDA 5IT2H 1GGIL 1EANA 3FQUB 3T0EC 1BG1A 1OGTB 4L4VD 4WU5A 3N0AA 3FU0A 4D0CA 3S37H 2XT1B 4E9SA 1T7WA 3B83A 5LCVL 2I5YH 4OZGF 1BM3L 1XX9C 5L2KB 2JJSA 4RETB 1FL3B 2ZPKL 4WY7L 3W39A 2VSKB 3HI1B 3X13B 4NSKA 4OUOA 1NOLA 2A6KA 2HLFC 3QHTC 1OW0C 3IFPB 4FQHA 1T0MA 1ZLSH 3TBVB 1MDTA 5BUPA 4KRLB 4FQ2L 4GW1B 3RTQB 4ZX4A 1CICD 1FLRL 1JNNH 3OMAB 4F57H 1E8YA 1TTAA 4FGMA 2EYSA 5F7EL 4NENA 1QBBA 2FDBP 4PG9B 3Q1EA 4ODHH 4QKXB 2PO6B 5FCUL 2BNRE 5MERA 1IX2A 3CVHH 5AB1A 3WJMA 1FE8H 4HZLB 1ZJAA 4TVPD 2EUWA 3JWNE 4KJYB 2NY3D 1SBSH 3CD4A 1VLXA 5C0CD 2W0FA 3J07A 1E6JL 5EDSA 1A3LH 3VX1A 5C0DB 1F18A 1YECH 1BAFL 3KVQA 1MQKL 1P1ZA 4K3DL 5EF1A 3E9TA 4FNLH 4KK9D 5D7JB 3CC1A 5KANI 3FB7B 4WJ5B 4F7EA 4U6HB 1A4BA 1U93A 4WHYH 3ZRSA 4ICWA 5AEAA 5D2NC 4MNGE 1OM3H 3B2PA 5C0AB 3QDGA 5J1AB 4MAUH 4MNGB 3C09C 2E47A 5ESVA 4P3DA 1E9OA 3FFCD 1KTLB 1UYWL 1T5WA 2YIHA 3GSNH 3ULUF 2W9EH 5IBTL 1FBIL 1S7SA 2QPEB 3G5XB 4N22A 4ZTEA 4CVXB 3P4NA 2XZAL 3F84A 2Y36H 2HTKC 2D0FA 4AMKL 2W91A 4LCCA 1NUDA 4GBXA 4PJ9A 4G83A 3OB0H 3T0EE 3Q5OA 2WTOA 3LH8A 4CU7A 2DQMA 2J8UF 5I1JH 1MI5A 3FMGL 4LL1A 1TJGL 4M7LL 1N7MH 3ELQA 2AXWA 4JFED 3WGVB 1IGJB 2EKSB 2NX5D 3DX3A 4XGZA 5FK9B 4NAQA 4L3CA 5JNYA 3BRDA 1T5WB 3QRGH 4GSXA 2W5PA 2AC0A 1ZS2A 1RU9H 4GKNA 3I50H 5L4JA 1OP5K 4BQ6A 1VB9A 3BFQG 3AY4A 4Q9QL 2YAHA 1K85A 4DT2A 4OV6F 3HLAA 1KYOK 2BIIA 5DK3A 4PVNA 3RVTD 4XMVA 2PYED 2VDMB 3MDJA 4PCTA 5BNXD 5DC0A 1LLAA 3VI3B 1IL1B 2A73B 3AACA 4HPHA 3QUML 4O5LH 4FI6A 5GS1A 2X38A 3T6ZA 5F70A 3F7VA 3L4XA 1TEGA 4FXGB 3OF6A 3AAZA 3HAEH 3OLDA 5AUMA 4F20A 5F6HI 5D7LB 2F8OA 1KCBA 1INDL 3MLUL 3HBPA 2W07B 5KBMA 2EYSB 4OZHF 3CHQA 5EOCJ 4NZFA 3Q2LA 2HUEA 2ZXEB 4QMEA 3UDWC 1FGVL 1XIWA 2AV7B 1EMTL 3CGTA 4W9IC 4WFEE 1MCIA 1JN6A 4YXKL 4LLDA 4GRLA 4Z7WA 2BVPA 2VLME 1OTTC 3ARSA 3LOWA 3S36L 2V2WA 2DMGA 3GXNA 1V5JA 3CMOL 1A9BB 3WIAA 2VSDA 2Y1ZA 1NGPL 2N01B 2OJZH 2DLIA 3Q48A 4HW6A 1L6ZA 5AB2A 3V0VA 3AAZB 4PRPD 1GYUA 1FAIH 1CXHA 2NXYB 5CLTA 4YHYC 1FL5A 5HHNA 2EADA 5AENA 3O0LA 5KSBA 3HZMB 4M48L 2GJRA 5DQDL 1OZTG 2O5YL 2CO4A 4IKJA 3FUHA 4NQCD 3U0PA 3BQUC 3PWPE 4PI2A 3FUIA 1MFCL 3O6KL 4AT6A 4MS8C 1F90L 3NRPA 4B9CA 4DFHA 1V54B 2V9RA 1AR1D 3QHFL 2G3NA 4L9LA 2WUCH 5GGVL 3NJKA 4NQDD 1GHFH 4L2LA 5EH1A 5LG6A 2VAJA 1MQ8A 5TDOA 3RZWA 2YD4A 3FUFA 2XPYA 3BJLA 2QGCA 4X6DA 4KZEL 2IDSA 3QNXB 4X5RA 3FDWA 4LCIH 2XU9A 3GK8L 2Y1YA 2NUPA 3DXAA 4YH6A 3S98A 4LCYA 1AKJD 3G04A 3VXNA 1MI5B 5E6YA 1LK2B 4PRDB 1I3UA 2HWZL 4FNRA 4X99B 1U8IB 5CU5A 3L5WA 1PCSA 1O9ZA 2EE3A 2NYKA 1A7OL 1P2CB 2C9PA 2KDYA 3EJTA 1ADQH 4HUWB 4E9LA 2NY5C 2V9QA 4NUGH 2QQKH 4KROB 1ZDSA 1QW9A 3TN0C 1IM9D 1QLEH 5I19H 4WV1C 4BZ2L 5DJ6A 2OBGA 1YEJH 5MP6H 3WLBA 1QHOA 1DVFD 1JD7A 5HHXL 3DX8B 4PJEF 1AGDA 1SLVA 1X5LA 4ELKA 3HE6C 4XHJD 2R7EB 1SDDA 4JM2D 5ESVB 5J6HB 2N0MA 2HX8A 4P5TC 1ZV5A 2OSLA 2DQGH 5IG7B 2IXQB 3QS3A 5T1LB 5CJXA 1X4YA 1KLFA 3LSOA 1URLA 1ES0B 2IG2H 1PVHA 4R0LA 4C58B 1E6OL 5EWIH 4L4TE 5F2FA 5TPWL 3KPPA 1RIHL 3V0IA 3FOMA 3V9EA 2AJYL 4AGOA 5C6TL 3WAJA 2NW2B 1E5BA 2CHZA 1JRHH 2X10A 3TLRA 1YNKH 4KKBC 2CMRL 4TNWK 2ENJA 1F6AA 1K8IB 4BEIA 4IHOB 4KHXL 1A4JB 4X4KA 4HUNB 5H37H 2YHGA 2WYHA 5KBPA 1EDHA 1R5WB 5IB3B 4PS4L 3QBTB 2V5MA 1XEUA 3D3VE 4UM8B 3ABGA 2H7WA 1FZKA 1DVUA 2QGEA 2RIKA 3MLYH 4NZDA 5BV7H 4UZGA 2HRHA 1C5CH 5IESH 3MKKA 3QSKB 4JLRA 4Y5YB 2FT8A 4NRXA 4H8PA 4OIIL 3OKMB 2O5ZH 4LMQI 3VFGL 5F97E 3SKUD 5F0PB 4JGNA 1NAML 3OAZK 2IQAB 3ZQXA 3C08H 3G6JE 4P5SA 3GHEL 5IJVB 5AOZA 1FAKT 2CK0H 3UDWA 2NT0A 2JKNA 1SXCA 1NCCH 2X3AA 2CO2A 2ICEB 4FNUA 5IY5B 1JDAA 2XX0A 1A7QH 4X8CA 1SOKA 3H2WA 3I50L 3W57A 3TO4D 1RPUA 4JE4B 5F1NB 2ZP9A 4FQLL 3WJLA 3QCVL 3GJFB 3HBZA 4C55A 1SXAA 3DIFA 3P2BA 4NPYA 1QQDA 3S6CA 2FEEL 4WUKH 2P8PA 2WINA 5C0FA 4YFDB 2KDGA 3NEEA 3U36B 3VFWB 4GG6F 1HOCA 3WIFB 3DHPA 2O61B 4Q4IA 3EH1A 1NGYA 3RY6C 4TNVF 3VWKC 4HGWA 2NZ1A 5CGMA 3CVHB 1DJXA 4P46B 5F71A 4UAHA 3RTLA 3NA9H 1I9JH 2F8VA 3F64A 3RWFA 2EVFA 5ESQA 4FCHA 3NH7L 3VNYA 4P2RA 1SYSB 2MTAA 5BUGA 4PJGA 5KSBE 1NCHA 3AM8A 1ESOA 3D4GA 3S5LG 3SDAA 4IOSD 1WISA 4M6MH 2JKWA 3HZYA 4TVPL 1DE4B 4X98A 5AKTA 1W2KT 4KY1H 2EACA 4AYGA 3DYOA 3RNKA 4ZD3H 3LVTA 1X9LA 2VJ0A 4LF3B 5SX5K 3RVWD 2CAKA 1DCLA 3CXFA 4Y16D 1YYLH 5D7IE 4LEOA 4NQTA 2Y6TE 3CSYA 2E59A 2N59A 4L4VA 5AVSB 3INUL 3GJFH 4N2OA 3IS1X 1R5IB 4JW3A 3S4SB 3DIDA 3NJXA 4EN3C 4PP2A 2OTUA 4OCXH 3NZUA 3QDJE 1SYSA 3MBXL 2VABA 3OQRA 2HG0A 3Q7JA 4TKWA 5A16A 2B08A 2NY6C 2XVBA 3BWAB 1TQVA 5IB1A 4GH7B 2AJXH 2VUKA 3CLFH 1G7JA 4I7ZC 3KCPA 4J4PD 1H3XA 2CCLA 2XN9E 4LCWD 4NERA 4Q9CA 2AJZB 2VUOA 5IEKB 2FNBA 1Z3RA 2G0LA 2UY7A 3DUUA 2MCAA 3ZE1F 2PO6C 1HINH 5F6IC 5D6CB 4FLHA 2YPLA 5JA8B 1UD3A 3H0TA 3L8QA 4KDWA 2P8PB 1RUQL 1FLTX 2B9AA 3IDMB 3JZ7A 4GRWB 4UV4L 5DRNB 3WCYA 2PO6D 3IAQA 3CSFA 4ZS6D 2GJ6E 4HX1B 5FWRA 1S78C 1U3HA 1ZMYA 4HCFA 3QO0A 3R1GL 1EQWA 5JPMB 4HXBL 3IGKA 4O2CB 4B3VA 4OD3H 3OKDB 3O4LE 4PJDA 3CDGB 3MCLL 3NYKA 2PCFA 3P3RA 2DQDH 4NZ8A 1F42A 4EI6A 5T1KD 4QLWA 1AQ8A 2MNWA 1CFNA 5BV7C 4AWJC 5F1KC 3EOYG 4PS3A 2ZOLA 2F74A 5C0AD 3ARDA 1JVKA 2P42B 2EXWC 2D2CC 3HAEB 3V4VA 4UDTB 3K6SA 2I9TB 5K9JL 1SOQA 1J5IA 4JPVH 3J8F7 1IUZA 4XWOC 3VW3L 1N64L 1XR9B 3OX8A 3PGFH 2X7LB 4G59C 4PSRA 4K8RD 3S97C 3TCLB 5C8JA 5AYUH 2YAPA 3NIFF 3H7LA 3WEXB 2B3IA 2QT6A 4PLJC 2WBJB 2VDMH 3MLRL 3ZKNC 5CR8A 1H8NA 3O2WL 4X7DC 3SJVB 1QEWA 5E70A 3MXVL 3UYPB 4MXQD 5FDWB 3V4VL 4Z7NB 5CEXB 2ZWSA 4TLKA 3VXQA 1SOSA 3FT9A 1WRFA 2BNRD 2GHZA 1R5VA 1P7QB 2E75C 5IW6B 2IPTL 3NFSH 2DYPA 1FORH 3QNYB 1LJMA 3NBNA 5K1NA 5L88H 5I30L 3EW3B 3HKFA 4FQXA 1X5KA 2VQTA 2FK9A 3E6HA 2WLKA 3IEAA 1C12A 1UXSB 2YD2A 4HCIA 1MWAB 4QT5B 3BGMB 1U3HB 3BGAA 2IAAC 4QHUB 4UQDA 2HLEB 4WEBH 4UANA 3VXOA 3H3BC 4P4KC 3B56A 3P73A 1OAUH 1HHIB 5KWYC 3EF4A 5T3XD 5T3ZE 2KS0A 4XN8A 1DUYB 1RUMH 3QWRA 5IEKA 4M3HA 4GKOA 4G7YH 3SDDD 5ANMB 1YA5A 5BQ7A 2VISA 1NCBL 3MREB 4PG2A 3MV8A 3C9NB 3LRSB 2V37A 3P11H 4LSRH 1P4IH 5HPMA 3MJWA 1U95B 4LVNC 4QRSB 4MBRA 4OAWB 1NFDF 2HKHH 1NFAA 4KHTH 5SWSB 2ZKXA 2GTZA 3CSGA 4ODWA 4JM0A 2H3XC 3KS0H 1AANA 1JZGA 2MQ3A 1ZEAL 1CZ8H 4LDEB 4UMSA 4WI5A 3DX6A 1QTYT 3G9AB 2SODB 3WXWL 1FFTB 2AJ3A 4JQIH 2JCCF 3EOAA 3FO0L 5ETUB 3ZDXF 2HRLA 4X6DE 5FYLD 3J27A 1JYVA 3D07A 4UYPA 3E1ZA 1HHJB 1SF3A 3W9DB 5C6WH 5AKSA 4P07A 4YX2L 4YFLI 4P2QE 1T1YB 2Z7WA 3NIFB 5HHVL 1URZA 3II2A 1LE5B 2V2WB 2V9TA 4LCYB 1EAOA 3MRNA 5PCYA 3OHXA 3LV3B 5C0EB 5T33L 1BBJB 5EUOF 3D8MA 1CQYA 1YAZA 2GHWB 5F7MC 1NJ9B 1DQJB 2W07A 3SPHA 3DGCR 1I8IB 3BAJA 4TRPL 4NQUA 1QI3A 4ZX5A 5JHDB 2IH1A 5DD0H 2C7UA 4WI6A 5JTWA 2DQTL 4ZO7A 4AT6B 1YNTB 4OV5B 4Z76A 2E46A 4HIIA 1J8HE 2NY0B 3CFTA 2VXQA 1XDTT 3VFUB 1KJVA 3OKYA 3FB5B 3RWCB 1M53A 1IC0A 4NIYE 4NNXB 4Z0BH 3TZVB 2DQEL 1RUQH 1XSKA 2FL5B 3PDGA 1FRGL 4KK5D 1JZHA 1ZRUA 3SCMD 1P9MC 4GPVA 4PGEB 1BLNA 1G9NC 2ICWB 4BH8B 1KIPA 3LDBB 1OCZB 5DC4B 2WXHA 4K15A 4PUBH 3W0WA 4WI7A 1F5WA 3PNWA 4N0FA 3L48A 1KLUA 3FO1A 1MNUL 2J20A 1WVZA 2O30A 2W9DH 4JFWA 3CDZA 2LW3A 3MI6A 5JOPD 3H9ZA 1MIML 4EUPA 4UNIA 4GT0A 1G5AA 4PJHE 1GZQB 2A74A 3BAKA 2XN9D 3MBEB 15C8H 3ARDB 3H3KA 5KG9B 4KVNL 4HS3B 4D0BA 2LR4A 5I8EA 5HGAB 1NLBH 4JPIB 3MZTA 5DMKB 3HG1A 5A2AA 1U2YA 2YR3A 4GUQA 3NFSL 4BUQA 1MOEA 4LSPH 1DCEA 1H3TA 1J0YA 3LXAA 4X8JA 2VLRD 2Y3NA 1GAFH 1S7XB 1HILA 2R29A 1T3FB 3F7QA 3P1VA 3RJDA 4WSGA 2CMRH 3TXAA 4AQ1B 1A4CA 1ET5A 4MJ2A 3L4VA 3MROB 1VGKA 4QDGA 2XV3A 2NSXA 1JRHL 1S9XB 4MZ3A 1AS8A 4MDJA 1MF2L 2M83A 4NNYA 1PIFA 2O6EA 3BP6A 3BW9A 4JE0A 2NZ9D 1KZQA 4BK5A 4D9LL 4DUWA 1DN2A 4X7FC 4QTIL 5D5MB 5DJZA 1RUPL 1JCVA 4QWWC 1RUML 4PJ5A 1GMIA 3BEVA 1X7QB 4M3JA 4Y2NA 1E4KA 1YQVL 3AB0B 1IM9B 1U8OA 5INCA 2DB8A 1TVBA 4NI3A 5A16B 3RKDD 2BS71 3ZN6A 4WNQB 5IV2A 4ERSH 3QJZA 4BFKA 3GLAA 5EOCH 1Q9LA 1OTTD 2ZUWA 3DETC 5LKNA 3TV8A 2C3HA 2DS4A 4MNQA 4OQTA 1G43A 1G87A 3MBED 1YO4A 1XCQA 3EO9H 3Q8EA 2PWEA 4DVRH 1DQIA 1CLVA 5EEUA 5IMKB 2R9HC 3LD8B 4HUCA 4HXAH 3CXHK 5AAMC 2OXHB 1PNDA 4IK6A 2EDNA 3K2UL 3CJJA 4LAJH 4BZYA 5AW7B 3G7TA 1UADC 4PW9A 3VB9A 3ZUCA 2QZQA 3WS6C 4I77H 3W2DL 4M6OL 3GD1C 4RMVA 4LAQH 5B7FA 3HFMH 1E43A 4FF9A 4ZSOB 5A3IC 3WU1A 4JAMB 5EU3B 1QEXA 3FU9A 3PHOB 3US9A 2HN7B 4DP5X 4LL4A 3IFLL 2ZCLL 3FQRB 5GRWA 3F7YA 1F11B 2ZUVA 5EG6C 1F4WH 1NMAH 1KCSH 3BKCH 1S7UB 4WI0A 3KLHD 3T65B 3MRKA 4H2AA 5KVFL 1LP9F 2P5WD 4GP8B 1ORSB 1RK0A 4O2EB 2BK8A 3DV6B 1E9PA 1H5BC 2DWXA 5EZJB 2VITB 3DBSA 5JQ6L 2OZ4A 3LQAC 4WW1B 4ZSOA 1DBMH 5DLLA 5B1JC 2CDGB 2P24A 3CG8A 3QZLA 2ADGA 1JPEA 3TBTA 1H3VA 3BDYL 3RWGB 2VXQH 3EO1B 4M7KL 4XMLH 4XCCH 3WFCH 4LIQL 4TULL 5FGCB 4IBWA 1QPPA 3EDEA 3K8MA 3TCTA 1UWGL 4TTDD 4X5WA 5F72S 1T1WA 4HWNA 3O9WD 4XC1H 3TO4B 2NSQA 2WXNA 2C3VB 5I1HL 3WY2A 4IRZH 2FYYA 4MZ2A 2Z4QB 2X1OA 3WOVA 3NP4A 3NACH 4PJBE 5IMKA 3RY4A 4QRRD 4XI5D 2DQEH 4MD4B 3FQNB 4YNYB 5HI5D 5A2KH 2NYYD 3Q6GH 5FFGA 4FFVC 4PVMA 4C4KO 4PGZA 1N6QH 2W9LA 5I1GH 3GLEA 4PCKA 3L7FA 4PTTA 2AJSH 2OR8A 4OQTH 4X9HA 1MRDL 4EXKA 1KBBA 1OGAD 2GJJA 4GW4B 4P9HL 4DOHB 5FF6A 1YVLA 2QBWA 1M56B 5LBSA 5LGHH 4X6FB 3GBLA 4PJAB 3HB3B 1BVLA 1UWEL 3BD4A 3DOIA 4M7ZC 4JRWA 3GMQB 4ZMXA 4P23B 4Y1SA 2Y9RT 4X7EC 2C7FA 2WJ5A 5CCKH 1OHZA 5ADPH 1KXHA 1IB5A 1YEHL 4PRAB 1U2CA 2IGLA 4UWQB 3F04A 1CR9L 3EYQC 4WWNA 3N40F 4V1DB 5DA0B 5BO1H 1CLYL 4GMSH 4P59H 1TIUA 3EFDH 2FGWL 5TH2A 1GGBL 1Q0YL 1Q38A 1MWAH 3MRBA 3UJTH 1JGDA 4POYA 3V2AR 2R2BB 5CJBA 3PWJA 4KNSA 1KTCA 1WDAA 4NZTH 2WWMD 1D9KA 3HR5B 2GITA 3K2IA 2WAQA 2O6FA 1EFXA 4IMKC 3SKJH 2VM3A 2WGXA 4FULA 4HV8B 5C2UB 3ARGC 4NZRL 1XB6A 3SODB 5E1HB 3N85H 3SY6A 4RGND 4DKEH 1ONQA 3T0ED 3VCLA 2XNAA 4JFSA 2NY5L 2H45A 3B7YA 2R69L 3ZE0E 5I5RA 3A22A 5JZ7D 5MERB 1NC4D 5LNDA 1PYWA 1PJ9A 1M3IA 1OB0A 1QPXA 5T5FH 2YGVA 4TM9A 1LM8V 5D55A 1BXAA 1NBZB 2WIIA 4G43A 2DEXX 3NCJL 1A1NB 3QZMA 1MHHA 1MFEL 3PQYD 5EU5B 1ASOA 4KU1A 3UROR 3BUQA 3RZCA 3TO2A 1DVFB 1MCNA 5IB4B 2YFNA 4P2RD 3MLVL 3LXUX 4DP0X 2VW7A 2D0GA 1OCWH 3JTSB 2EC9T 4Y9EA 4K94C 2E9WA 2AJSL 2FBOJ 3TJHC 3OM3B 3OKDA 3T04D 1KIRA 1X7TA 2X4QB 3U0WH 2Q0ZX 1N70A 3P4MA 5E8EA 4X4XA 4B60A 3VFUA 1S3RA 2H3NA 3GMRA 3QDHA 4MAYD 5E6RB 1U2HA 3NJIA 1J12A 3I84A 4MS6A 2KERA 1R3HA 4UTBH 1ZIBA 3U79A 2Y1VA 1I1FA 2VOTA 5CCHE 3PWNB 1FJ1B 1H9VA 5CN1A 4YHZH 3MRHA 3VXRE 2PXYB 4JFHD 1TNMA 3KZ8A 1LP9E 1X9QA 3BISA 2OULB 3TIEA 2Y23A 4F15C 5IFAL 4GAFB 4R7XA 3BFOA 1DBJL 5K5YA 1WK0A 4ZFQA 5DO2D 4N2KA 4O4YH 3RVUD 2QLVB 2CD0A 1NC4B 2VC2H 4P99A 1PSKL 3SDDC 4LEXL 1DBML 4R4NC 3IDXH 4HBQA 4ZMNA 3FCSA 5I18L 1WAAF 3TN0B 3UAJD 5ICYB 1W0VB 4M48H 5DQDH 5D2NE 1ZTMA 3CFCH 3FTWA 3V4PL 4I8DA 5IM7A 2ZTBA 3EJPA 3FNKA 5D7LE 3GMPA 3QJFA 3R0MA 1EWHA 3QZOA 4HJIA 1E4HA 3IDNA 2F7IA 5EBGA 3VD0A 4YHPB 1VA9A 3BE1L 4YAQA 3DSFH 5J3HC 2RH0A 4Y19B 4ZFOA 4YXLH 2BO0A 3RPIA 2X4TA 4MA1B 3MRJB 5A6LA 1O7SA 2Z31D 4M93B 4K0OA 1RZKH 2EIEA 3QUXA 1BGXL 1FYTB 2JJTA 2WTRB 3KPQB 2XXCB 5B1KA 2R59A 4WV1B 1HHHB 3US0A 2X44D 4E9VA 1JYNA 2ZOKB 2HJKB 2B39A 1HWHB 1XH3B 1PCXA 4Z77A 5J9PB 4X6BA 5E6IC 4Z0BL 5IVZB 3HC2A 1BWWA 1W0WA 4XO9A 3P11L 4PJEB 3MV9E 4IBZA 4CVZA 1L0XA 3WEOA 2YPKB 5TGBA 2XA8H 3WTXA 2EDEA 4LVHC 4YC2B 1EBPA 3MV7A 4ZFFA 1QQDB 1HI6A 1FSKC 4FYRA 3IDIA 1K2DA 1EZVY 1DN0A 1XH0A 2V7HA 3EJJX 3V5DB 3GM8A 3H8NA 2DM4A 4JY6B 2J55A 1VKXA 4L1BA 4EVNA 2IH3B 2JJVA 1MFEH 2AANA 1PIGA 4HHAA 1LEGB 3O4OB 3MV7D 2B7DT 5EU4B 2ARJB 3DHMA 3QDJB 5F89B 4ZPTA 2EXYD 3TURA 3CX5K 4NFCA 2XV0A 5AWNH 4BYHA 3S34H 5I1LB 2WBWB 1T5KA 2Q8AL 5D7IB 1SYVA 1TTGA 1Q94B 1IM3B 3REVA 3QYCA 2MKLC 4D7BA 1MZZA 2NY5H 1AKJA 5CJ8A 3WV0A 5F7FA 5B7MA 3W0WE 4JFPB 4JZJB 3TBWB 2VLJB 2Z93A 2DWDA 3M1BB 3KPTA 5C09B 1JS4A 2XVGA 1R47A 4IRJA 3OGOE 4HSAC 2YOAA 4MCYA 2J1YA 3SKJL 2LTQB 3T6QC 1UD6A 3O3BA 2DQTH 4H8WH 1XWVA 1I82A 3ULSA 2VO8A 3Q44A 4M61B 1BXUA 3CVBA 1FNEA 5C6TH 2QQLL 3ZMNA 1Q94A 3REVB 3RL1B 2GIXA 4ZMLA 3K71A 1M9SA 4FLSA 3VFVA 3ZSSA 2ZXAA 1GL4B 5I6XB 1KV7A 3H1ZA 3SKMA 2B9BA 3ZTNL 4KKCC 5KYYB 1EXGA 1MAMH 2B1AL 4K5PA 3VX0A 3WEMA 3G5ZA 1EHXA 5DZJA 3ZXAC 1EDYA 2YZ1A 5E6SB 4N0UE 1BECA 4CNIB 5IJKA 4OGZA 4LESA 4HX1A 3C08L 5F7DB 2BNUB 2EKJA 3P9LB 1UCBL 3FYEB 4FP8H 1HNYA 3LTVA 1TO5A 4XXWC 2C9RA 1AD0A 5IJDC 3AY2A 1QFOA 2FO1A 1W0WB 2EP6A 1M1XB 43C9A 3LKOB 3JYCA 4W6XB 3C5SA 4Q0XL 4FQQB 4UQAA 4UYQA 4NQDE 3TJEH 4WDIA 5JORB 4K71C 2GEEA 1UWFA 2M1KA 1IKFH 2OMUA 2H2SD 3PWPD 1ACYH 4HLJA 1DQJA 4MVBC 5FCSH 2YUXA 4R26L 1SRDA 1VACA 3LH2H 3PQYA 2NY4B 1SM3L 3CDYA 4ZFOB 3S2CA 5M7QA 1BP3B 1A14L 1SMAA 5KEZA 4OF3A 1YEEL 1N0XH 3ET9F 3MOAL 5HGDB 4TQEH 3LQZB 4XCEA 4L29B 5B39A 1OHQA 4HSQA 3LEYL 5BZDB 2HT4C 4Z7VF 3ZKMC 3OLGA 2WMPB 1MQKH 1NWOA 2UVEA 2F53E 2NY2C 3D1MC 3P4OA 4JFEA 2D73A 1OAKL 1F4HA 3ZUNC 1U42A 2E6PA 2MQGA 3UBHA 4OZIE 4LL9A 5GGUB 3F8UB 3NRQA 3LKPB 4HUXB 4J39A 1G9NL 3MJ9A 2BVTA 2GUYA 1O0VA 5KVGL 4HIJB 2H0PA 5D1XE 1KGUA 3QCTH 4AQ1C 4W4OC 3N1GC 5I82A 2FQGA 3MRRA 5IJKC 4ENEC 4NPKA 4M29A 1CBVL 2QKSA 4LHQB 2ZYHA 1F1GA 2FBJL 3N91A 4W9CC 5JR1H 2GFBA 4PWEA 1C9SA 5ID0B 3L3JB 1QRNE 2GJPA 3VI4E 1U3JA 4HC1L 1EAJA 1ZLWH 4UTBL 2Q7NA 1OALA 3ARDC 4M43L 3UGUA 5JHLA 4FFZL 5EEZA 3QDGE 2MPVA 3MN8A 1DFBL 1TZHA 1R24A 1JAEA 2IPKB 3S88L 1ZGLP 2Y07L 4KDVA 5L2JA 5EBMA 3KNBA 4PRIE 4XVSH 1UWYA 4H8WC 5JIPA 1SEQL 1E4XH 5IQ9B 3RURA 7FABL 1WG3A 3CQQA 3O3EA 4HKJB 4NQXA 4MMZB 3HN8A 4MQSB 4P2QB 4X9IA 3HA0A 3HE6D 4LOUD 4KMQA 5FKAA 4Y2LA 2ADIB 3WKYA 2XCMC 1DJIA 2CR3A 3L95A 1D5IH 4ZD3L 2VDKL 1BZDA 1TJMA 2AZAA 4F58L 1P4UA 5K93A 2HLAB 5HYJA 3ZE2F 5HYSG 4FFYA 5LBGA 3A3YB 4GG6B 4AYMC 2F08A 5I71B 1K8DB 3DPBA 3WD5L 2XQ0A 2EE9A 3FFOA 4Y2OB 2WB1A 5SWQA 1E2ZA 3RWJA 3T0BA 4HULB 1ETZB 5D93B 3TT3L 2VKWA 4E9XA 3BUYB 4H1LG 4HWUA 3D85D 5DD1H 5JHLH 2ETWA 2HP4A 3LEXA 2VDML 5FGCE 3OAUL 2XKUA 1CYWA 3BLPX 4RRPA 1E7UA 4OFVA 4XBPB 2B4CH 3MYJB 1WFMA 1U93B 2W0PA 2RACA 1JNHB 2R23A 2WLIB 4OCYL 1BPLB 1KB3A 2G75B 4EBQL 4XODA 3V4VB 2A9AA 2UWEE 3CH1A 5L9DH 2AKRA 3HNVH 3LXCA 5CJXC 3TBBA 5ERWB 4AXWA 1DQLH 4OGYL 2AMGA 1AGEB 5IROD 2IADA 1DHKA 2H2SC 4MVBD 5JOFB 2FRGP 1ZANL 1MUJB 5IVXB 3ARGA 2PXYD 2O5ZL 2Z0BA 2WKGA 4JCMA 4EIZC 5JPMA 2R0LH 4KVPA 5HJBA 2GSIB 5DJYB 1I31A 4FXKB 4E41E 4JM2B 1N19A 3FF7A 3SYAA 1WH0A 5HVHB 3AQYA 3UYRH 5B3JF 2XTJC 5TDOB 3A67H 4S0SD 1RP9A 1ZA3A 3QUZA 4XMUA 4RGNC 3TWCL 1I1AC 3VRLF 4Z3IA 3BXNA 4LSRL 1KN2H 5DK2A 3TV3H 4GRMA 3PS6A 5TK2A 2P5PA 4QHLB 1FFRA 3QT2A 4O9HL 2YZ8A 3BCDA 1WAPA 3LRGA 3SPCA 1FL5B 5LNGA 4AVHA 3WYRA 2WWMC 4OLZL 4N0CC 4ONGH 1FYTA 3MV11 4W9JC 5IEHA 4GMSL 4P59L 4EZLA 4Y16B 4ACPA 5E7BA 4Y19D 4TUJB 4ZMTA 2FSEA 1N4XL 4OD2A 5K39B 1FHGA 2KZWA 5C97A 4AQAA 3S8WA 4A68A 1FAIL 4F7KA 3BPNC 2IBZY 3MOAH 1WYJA 2W59A 4LLDB 3BP7B 1P5UB 2Y06H 3DVNB 4HWZA 5HHOB 1VEPA 3G5VA 1FWXA 4TPRL 5IM7B 4LCWE 3OJ2C 1FC2D 3UX9B 4B9ZA 4BCXA 2JTDA 2AEWA 2P5EB 2Q3ZA 4AM0Q 2H32A 4MASA 4G8FA 2ZX6A 1LVEA 3MBWB 4PWIA 3UOAB 4KO5A 1ND0A 5LBVA 3QIWC 5BS0B 4XZ4A 4XX5A 3O6LH 3QEQB 1CU4L 2IBZX 1SN0A 2MPAL 3HUJB 3N44F 2YKKA 2ZPKH 3TCXA 1KNOB 2BLFA 1IAOB 4JBSA 1QKZH 3BAEL 5DYOB 1UT2A 5DT1H 4U7KA 4OM1L 3NCYP 2FBRA 2BIMA 2K70A 4FHKA 4KOBA 3FCGA 1N8ZA 3VXMB 1KXQE 3QQDA 1BAGA 5CEYA 2IWKA 4KGJA 3OBAA 1YEDB 5FYKU 4Z7OE 5KAQG 2BXZA 2JELH 3DRTB 3BSZH 3KPRD 1OCWL 3QR2A 3ULVL 2BNQD 1CE6B 1HOEA 1I1RA 4H20L 1WE5A 4PWJA 1UB5A 2WZPA 3FF8A 3RZCC 1DVFC 2G2PA 2CKBH 1Y0LB 2GT9B 2WVTA 1E4XL 3B9VA 4AGNA 3AQZA 2IQAA 1FVEA 3M1OA 4E41B 5B8CA 2O5XL 1O7DE 4HPYH 1NDMB 3AWEA 1ULVA 1JSYA 5IB2B 3JWNG 1BIIA 1A7NL 1XR8A 3T4YA 2H2PC 1S7SB 2CRYA 3WO4B 3FCUB 4G43B 1RZ7L 2QR0A 4HWBH 4NZRH 4UINL 4RCAA 5IB3A 1WA1X 4TNGA 4D9RD 1TJHH 3GMMA 4PRNB 3VFTA 4IS6A 4LU5L 4AM0A 1LEIA 2EEDA 2J73A 3GSNL 3NCXA 2A6IA 2UWEF 4U6HA 4V33A 3QO1A 3D0VB 1FBIH 3ARGB 3DHJA 1IBYA 3HLKA 1GAFL 1NLDL 3DIVA 2YC1B 4LKCB 4Y19E 1FG2A 3E6FB 3OZLA 4FA6A 4N2NA 4DFIA 1KB5A 5FM5O 1W9XA 2DWEB 1KT2A 3K6DA 4HJ0D 4LOVA 1MCOL 2X0WA 1NFIB 3PDOB 5DGQA 1P6WA 2EDJA 4A2EA 3O6ML 2YLKA 1YPZA 5I1CH 1OY3B 4L8SA 1S7QA 2GK0A 5C07B 1I3VA 4ZO8A 4HZAA 3QJHB 2BH0A 2JI2A 4BWWA 2I9LA 2K9UA 1RIUL 3U30C 1PKOA 3UTQA 1B0GA 3GS0A 4GFTB 3PIQA 1CBJA 1ITCA 2APVA 5JDJA 1XGQA 5FS5A 3VRLE 3I3DA 1KJ2B 4K7FB 1S8DB 5DJ8B 5LGJB 1A25A 4HS6B 2BS8A 2X0UA 3AADB 3MV7B 4YVUA 4ZFFB 1JNNL 2ICWA 4F57L 4Z23A 5JQIB 3BHBA 3FMGH 2FEDC 3Q6GL 1IQWL 2AABH 3BVVA 5FAAA 4TNEA 5FA3B 3N1MC 3THML 3V5HB 3C12A 3OMIB 4QIRA 4GW5B 1PJWA 4FFYL 4DK6A 3CAFA 5E6IA 3DX9A 4KJWC 4P5RA 1U8MB 1OCRB 1BMGA 1DANU 3IN0A 1BEXA 3ULUE 3MLSH 2AQTA 4XNMB 3OXSA 4Q9BA 1YEDA 1KYAA 1GZHC 4PRIB 2WO3B 2EJ1A 3FQNA 4L5FE 3KWTA 3TA3C 4IRJD 1FZOA 1GYCA 3VFRB 4DPCX 4HIEA 5DO8A 4D8OA 1XGRA 2ZCKL 3KPLB 2C3GA 1MFDL 3CLWA 4BZ1A 2ATPA 4U1MB 3VD5A 5E8NB 3NSXA 4HKXA 4N2FA 4DZ8A 3ARFD 4G7VH 3CFBA 3SY0A 4R90H 3HNTL 1U8MA 4ANXA 5FUCC 3QZNA 3FFDB 3V6OC 4QCIA 3V4UH 2GTWA 1VRSA 3CQPA 4MXVE 2GBUA 2QPUA 1HZLA 2VDQB 1L5GA 4OZGE 5E5RB 1XGZA 4O02L 3MRDA 1SZNA 5D96B 1RFDL 2F8IA 2BFVL 4GRLB 1BSIA 2VE6A 1MH5A 1YUHB 2G3MA 3IAGC 5K33A 1OPGL 1G94A 4XVTL 5HHPA 1A2YA 3C60A 4AQEA 3GJEB 4OGAD 1YY8A 4FKHA 4ZW6A 1FGNL 2P7TA 3A4FA 3A6CL 5F7LB 1MJJB 4UU9A 3F7VB 2JB6B 3MUGB 3SDXF 2Y3AA 2XOTA 4F2EA 1JGIA 2KPNA 4PRID 1VJSA 3DMMC 5HYJE 1BF5A 2WO2B 1HIMH 2XKNB 3PGFL 3OKEA 4NN6C 2AK1L 4N26A 3S7GA 1NDGB 3A24A 3HE6B 4WGWB 1UACH 4FMFA 1JOIA 3FTYA 4XPTH 4WFED 2F5AL 2GG1A 2A6IB 3ETTA 3KPOA 2VDLL 4LB8A 4HMEA 1BG9A 1X5MA 1MCEA 1UA6H 4PGCB 4PRNA 3VFTB 3ARFC 2VZ1A 2WXRA 1CG9B 1A1NA 2OL3B 4FG6C 1S5IL 4IJTA 3BGMA 1AS7A 1OAXL 3I75B 2PWGA 3WFBH 2WZ5A 1HEHC 3E7JA 3WIHA 2R1WA 3HS0B 1T03L 3TA3D 2J1ZA 4IIQB 4OZHA 1ZCRA 5I30H 3DTXB 2YRLA 1YPZB 5FYKH 3BAIA 5FUCE 4F8OA 3TPKA 1HX0A 1NFIA 1JJUA 4K7PH 2B59A 4GRWE 2DQUH 4Z7WF 2D8KA 2PF6A 2FB4H 1DR9A 1OAYH 5CCGE 4LRIC 4P05A 2PYFA 5ABZA 4LLWA 5CZXD 4IBVA 1T1ZA 3EDKA 2PTTA 1U8QA 5I6KA 3E2HB 3LVEA 3I74A 4KTDL 3TBYA 1YY9D 3B9KC 1IEBB 1L9MA 3H6JA 5IVXF 2RD0A 4U1JB 1E6OH 3HMXH 5EWIL 5FUOL 2JB5L 1AKPA 3IRZA 1KCKA 3EH3B 1NCIA 1XT5A 4MAYA 3U9PL 4F91B 4YDLC 1A7RL 3FT0A 3GKWL 1EGJL 4TSCH 3MCG1 1KIQA 4GKSB 4FE9A 1OGPA 1OVZA 5DMIL 2FX9L 4IMLB 4DGIL 3O2DL 1GZHA 5J7CC 4G6JH 4A04A 3X14A 2VLJE 8PAZA 5AW5B 1NM9A 1HWGB 5FYLL 5CR1A 5T3XL 4DPBX 3GS7A 3VU1A 2XYBA 2XWBA 2LV4A 3OKLA 4QTFA 3UTSD 4W1TA 3QDJD 4OFYA 2RALA 2P80A 4HIQA 3M7OA 3D05A 3NZHL 4RFOL 2F54E 3ILEA 7PAZA 4AQAB 1VFMA 4ZS7H 2XKNA 2FSEB 1DTUA 4ZPVB 2FYYB 1K5NA 4PJ7E 3U7WL 2KLTA 1SYVB 1CC3A 2PCYA 3T77A 3U0WL 3UBXG 4N8CL 1SXSA 3X12B 4Y7MA 4EIBA 2BW4A 4HQQL 2B4CC 3TZVA 3J7HA 1RH8A 1OGTA 5GJTH 3N3EA 2HYMA 2Q76A 3GSXA 2FECI 3NOIA 3FFCA 2E86A 1P0SE 3T9WA 1CL7H 1IGMH 3ARBD 5E5MB 5KTEH 1MCQA 4B9YA 3MCKA 1YUHA 1L3WA 3GYRA 4XN7A 4X6EA 4GG8A 1BFSA 3QYMA 1THCA 3MMEB 4L1LA 1IAIM 2W0LA 3GMNA 4ORZC 5F7AA 3VFGH 3EHBB 2FJHA 4ZUWA 4O02B 5D71L 1S2EA 4OCRL 2BVQB 4WW2B 4H8VA 1PDKA 4M7JH 3CLEH 3QNZB 3QEQD 5ILTL 3SCMC 4ZOEA 2G2RA 2HRPL 1PKQE 4JZOB 4KK5C 4H8WL 1NC2D 1J48A 3VTMA 5JXAL 5DUPL 1CTOA 2B77A 3QJQB 4NQEB 4EQ3A 4LDLB 4JMNA 1EAPB 1FNHA 2DQUL 5MEQA 3VXMD 1BF2A 4F2MA 4Z3TA 2BWDA 3D2UB 3C8HA 4Y7OC 2CO1A 2VR9A 1NGYB 3FTSA 4L3AA 5EZPA 3ILPB 5L2KE 3B34A 2BNQB 2BCKA 4JKNA 2BSRB 2OJEA 1NCAH 3DX2A 2EZ0D 4CSSA 2OM5A 4JFYA 4YDMA 5E9DE 2H1PL 1XIWC 4MMXC 2NNRA 1JNLL 4ZBJA 4ATTA 3S5YA 1A02N 4IYKA 1ZHLA 2Y72A 2GSIA 2HZHA 4MA8H 4TVPE 4OTXL 5BJTA 1BAFH 3VXUB 5ANHA 5KN5A 5IBUG 4LCUA 2PP9A 1G7HA 1G6RL 2G9HB 2VDLH 4H20H 2ESVA 4XTRC 2X9XA 1NCWL 5J89A 4JY4B 4PBDA 3GBML 2A2QT 3JT0A 4HS6A 3IFNL 2G5UA 2V3DA 3L4TA 4S1DD 3VFSB 5FDYA 3FQXB 5KVDH 4M5ZL 1XH2A 4U49A 3VGHA 2WVSA 1HCVA 2J8UE 3GSQB 4YQXH 4NLHA 2IQ9L 2ZXBA 3UADA 5E9DA 5F7DA 3GTTA 1U21A 4LRNH 4U3HA 5CJOH 1IILE 4MDJB 5I1EL 1HJBC 1N2RB 2F9BT 4ZTPH 3BSHA 4PJGF 2D7MA 5TFSH 3HBQA 4A55A 3QPQD 3TT3H 4KWUA 2AVGA 2CCVA 3D48R 1OAYL 4PR5B 4JDEA 1OPGH 4GB9A 2GJZB 3FPXA 3KXFE 1NBVH 4UINH 3BJ91 4LHUB 4IMLA 5AZEL 1A6TB 4LSTL 4DEWA 1UFUA 4MFHA 2HKAA 4NGHL 4JRYB 3X14B 1GKEA 1GGIH 3FH5A 3QO1B 1PEZA 3DK2A 3CLEL 2VRAA 2FJFB 3D34A 32C2A 1VGEH 4GOSA 4KZ0A 2WWNA 3KGRA 1CK0L 5DD5L 3BRGC 4CN1A 3V5KA 4G70B 3L3JA 3QXVA 5AW2B 5GIRB 1BZ7A 1BFVH 2R0WH 3T4YB 3DK0A 1BVZA 5JPNC 5EBWB 4EKJA 5GZOA 2LU3A 4AV5A 4KO9A 2C4XA 1K4DA 2G9KA 4P5KA 4WEEA 4U2ZA 5A2JH 2F74B 2EO7A 5IW3A 2O6CA 5EO1B 2GY5A 2VDRB 3L3KA 2BZDA 1MELA 5KBLA 4XPFL 3V9FA 2P26A 2QQKL 1WLHA 3IF1A 3KNBB 4FN0A 4DZBA 4KX8A 2IBBA 4HPOL 1R24B 2IPKA 1BZOA 3BWSA 2WYIA 5ENWA 4Q8BA 4KUCD 1DVYA 1QPKA 3DLQR 3VFNA 3T5WA 2F19L 4O02A 2NNAB 1O5PA 2HFFB 1XVSA 1RP8A 2J2ZA 3NZHH 2M2DA 5IMOB 3MUY1 2BRRL 4JKPL 4DGVL 3LS5H 4DUVA 1KPUB 3TH3T 3JSSA 5B38G 3H9SA 2ZJSL 5D7IF 1MAJA 2VMCA 4L37A 2EUVA 4L9LB 4I0PA 4N6RB 4M7KH 3D39D 1N59B 1JNJA 3VU2A 1U3ZA 1OE3A 2WCSA 1TYJA 3GSXB 4LLYA 3LZLA 5EA0L 3RIAK 1NIEA 5GRVL 4XCFH 1KENH 1EZSA 4YX2H 3ZDYF 4PJIA 5KVFH 5I1CL 3QUXB 3RIFK 1F0LA 3NQIA 2EVHA 3NFNB 4K55A 4QXWA 1QSEB 2OJZL 2X4RB 4WFGD 4HUVB 3DBXB 4LPCA 1QMUA 1PSKH 3QPXH 1OSEA 5C0BB 5CEYB 2D03H 5E8OA 3DX4A 4CW1A 4PAZA 1SMOA 2HSIA 3U30B 2I60L 1JV2A 4P5TA 3WKML 1CFBA 1SLUA 4UV7H 2FLBT 1MG2C 1BMWA 2CA3A 1AQDB 2RTTA 2OSWA 2AI0L 3W3BA 4AK2A 4CGUB 2YLHA 2V7NA 2YAMA 4GXFA 2OR9H 4X83A 2YO3A 3FU5A 3NZ8B 4KKBD 1W91A 4JVPA 3T6WA 3GS4A 3UIYA 1N5YL 2XQBL 1KG0A 1ZT1A 2FJSA 2VZVA 2FSDA 1IE4A 4NZJA 4Y4HB 1UQSB 3H42L 1NAMA 4NYLB 2DTMH 4N0RA 4WJG3 5HXMA 2EXWD 2UYLA 4AENB 1OP3H 2OTWB 4DK3A 3AM8C 1HSBA 2JXMA 2CKBL 1WFTA 2G5RA 5I24A 3QDMA 3FXIC 4TF4A 1GOHA 4S1RL 4ZW7A 3RNQA 3BQUD 3NCMA 3WS3B 4XP1L 3VAEA 1CICA 2F5AH 4U1HA 2CJUH 4F37K 4W68A 1ZAGA 3ARXA 5EN2A 4FQXB 2HJLB 2NUTB 3QORA 3O11B 4G82A 4GRMB 4KRPB 4JNXA 3DPDA 1G7IA 2H1XA 3DRQA 3WE1A 4GNKB 2AQPA 4ENED 4N2AA 4I3GA 1J8KA 1BW8A 4FQIH 4X9FA 5FB8B 3F6JA 1D5MA 1HAUA 1KPUA 2C1OB 4X6CA 1GJIA 4JQVC 1HXMB 1T20B 2AJYH 4XVTH 4POUB 4MAUL 4AK1A 2P49B 3L5IA 2HFGH 3NK3A 4MA3B 4N20A 1TSRA 2K6WA 4RSYA 4OUUA 1CE1H 1MFBH 5C9JB 2VXUH 4H0GA 4UMGA 5EU6B 1HTYA 4NDMA 4S1SH 3EH4B 1W72L 3QUYC 4U1NA 5GS0C 5IB5A 4RMTA 2BSCA 4ATWA 1B0RB 2NXZB 4G9FD 1XD0A 3IMUA 3IF1B 4DZBB 1OARH 4CU8A 2ZYSA 3CZEA 3TX4A 1PLCA 3SDDA 5C0GB 4LLUB 2W1NA 4YOKA 1YEIL 3MV9B 1I1YA 2B2XH 5HBBA 4LBEB 4O00A 3FTXA 4NJ9L 2VWEC 1FO0A 5K9QG 4AIZB 5MEND 1MJJA 3KBEA 4U3SB 1NGQL 3QIWB 2NOYA 1WEJL 3LHPL 4IBSA 4K23L 4XXDB 4FQ1H 3S88H 2GSGB 4ZMQA 3P3SA 5JW5B 3GZOA 4PGBB 2ITDB 2V17L 5DR5L 5EU6A 3K91A 4U3CA 5JYLA 5F7EH 5DYFA 4KMTH 2VLLA 3D50A 4ETQA 3GMMB 1Q9KA 5KBKA 4Q56A 4J3OF 1EEZA 4E41D 3QJXA 1EDQA 2VJ8A 3FO2B 2RBLA 5EOQL 3ZDZE 2HT2D 4OF5A 4IDJH 3KJ4C 4KKAC 3U6XA 4GG8B 3P40A 4RFOH 5ECGA 2Z65C 4IOSA 5DMKA 4G3YH 4NYLA 5B8CB 4B9FA 4XH2B 1X5GA 5D1ZI 3QXDA 3U48A 3BUPA 3CSTA 1QACA 4NQSB 3ASWA 4KXAA 1Q0XL 1PZUB 1UCBH 4PV8A 1UEYA 2ZF8A 2HLAA 2R0LL 2MJWA 3NCFB 2HJKA 4JDVB 4WU5B 3SO3C 5CM1A 5HYJB 1CXIA 2DM3A 2X9YA 5E7FA 4ANVA 2NUPB 5E03A 2EE0A 2N7BA 5ITFA 4XP5L 1M7IA 3GUTB 4UBDD 3ENEA 1KPRA 3NABH 3QQDB 3GBNL 4I3SH 5IMLB 1Q8MA 4FNLL 3QQ9C 1TU2B 5A6MA 4PJXB 3RFZB 1CJYA 2X9WA 5DRZB 2AXFB 2JIXB 2DWSA 1TCRB 3Q2NA 2RGSA 3CFCL 1AAJA 2DIBA 3NIGE 3VACA 4HIHB 4PJAF 2V8MA 4BRJA 5DUBB 2V2TB 1UWXK 4NIKB 4NQED 2VDLB 4AX3A 4K3EL 1I3RB 3I2CL 4P4KA 3U0PB 1JWSA 1HNFA 4WSJA 5KOMC 5DS2A 5EMYA 3VH8B 1OE2A 1CE1L 4PRHD 5E6IB 8FABA 3ECBA 3RUGE 1KYOJ 2KBGA 4GW5A 3JTSA 5KBNC 3NAAL 3D39E 3W9EA 2FYVA 3FCSB 5MEOA 4ZUWB 1NLDH 2H0EA 5HGDA 3DMMD 1SEBB 4GAGH 2BHYA 1ZHLB 3CFJA 2DMHA 4MYWB 3DKHA 4U6YB 4ZFZB 3R7RA 5DHVA 3RX9A 2DJSA 2QFRA 4H1LB 1T6VN 2UUDH 4W9EC 5D7KE 3WLWC 3NJLA 4HHGA 4Z7QF 2X09A 5EU7C 3WKMH 3ZL4L 2R0KL 3BYTA 4ONFH 5EZLA 5E8NA 4F27A 5HI5C 2B3RA 3QK0A 4AYID 4FEIA 4MJ4A 1MFNA 3ABKB 4LVEA 4N1EA 2IH8A 4F2MB 1KCRH 4HIJA 2V17H 5DR5H 3S34L 4JAMA 5AZ2H 1ILSA 2XTJE 4LPVA 2EIMB 3SIKA 4OZHE 1SHSA 4CVUA 4MB4A 4WWPA 2NR6C 4JFDB 5A2IH 2AW2A 1YEIH 4IRSB 3FHAA 4IM8A 5F6HJ 2ZQKA 3HZ3A 2CJTA 1PF3A 3CMGA 3EBAA 4JRXD 4M02A 3BXNB 5SX5H 5FM5M 3C5ZD 4ZOAA 3TIEB 1OAQH 1YEJL 5MP6L 2EC9U 1LO0H 3ATEA 1CIDA 2HUHA 2GVYA 2JELL 4TLTA 1T4WA 2WLMA 4BGLA 2ZP8A 4MRBA 1VACB 3Q8AA 5I1JL 1WZ1L 3TT1H 1DLFL 3DA0A 2QTVA 1S6NA 1T1XA 2CK2A 2W65A 3L45A 2HFGL 4LHUD 5DJ0B 2HVBA 2WKOA 5J11C 32C2B 3V7AG 3PJSA 3VSTA 5BV7B 3A47A 1IM9A 1U8OB 4TVSa 4ZW8A 1PKQB 4U3SA 2Y36L 1AO7B 3GMQA 3ILQC 1VEOA 5J13C 1T7XA 5CD5D 3VNZA 1KDIA 4ZTPL 1UHVA 2OMNA 3MV9A 3AREB 2PYEE 5I0ZA 1RIHH 4RZCA 4LSSL 1NDGA 4YDKH 2HX9A 3O9WC 3CLFL 3OMNB 4H40A 4PLKC 4NQDB 4HKZB 4BBWA 4NAMA 5CLWA 3UG5A 1EFXB 1JD9A 5D71H 3C6EA 1CGVA 1WD8A 4U2YA 2FX9H 3SE6A 5F7UA 1XGPA 3TEYA 2E7HA 2Y5TA 3AWGA 2WXQA 3CHRA 4Y1AD 4CNIA 1C08A 1F3RB 1J0HA 4Z7UE 2ZAIA 5TTRA 5H94B 4F7EB 2EECA 3SE3A 4PJ8A 2BERA 3GMLA 4FFZA 3SGEH 1A0QL 1AZUA 3P0YL 4NRYB 1EEQA 1F1AA 2J21A 3VRJB 4ZTOL 1MREH 3JVFC 4HC1A 3VWJB 3CFJB 4F7TA 4WNSA 1E5UI 3MJGX 3COOA 4M6OH 4LHUA 5BJTB 2D3VA 5KN5B 2I07B 1KGWA 5J4MA 1YMHB 2OL3A 3H4FA 3E8VA 2ZD0A 3H54A 1ORSA 1RK0B 4LPYA 4CRPA 3HMWH 2DLGA 1NCOA 5ICZA 5JMRA 5GGSB 1IQWH 1PX8A 2AABL 2FWLB 1KC5H 2GB2A 3CN2A 4HIHA 5DRWB 2X2YA 2X4OA 1ETA1 3BP5B 4FI7A 4WHDA 5GRJL 3W0WB 4B97A 1AGFB 4JRXA 1UTDA 1BREA 2VDPB 4ACTA 2QDWA 1MG3C 3QHFH 5GGVH 2R9HD 3B3BA 4UT9A 1NICA 1GHFL 4G42B 3OF6D 4PY7A 5CJ5A 5GZOC 4FD0A 1IAOA 4WI3A 2QMKA 1SF5A 4TVUA 1MY7A 4F24A 3TPUB 4L18A 2OMZB 2P8MA 1EV2E 3V4UL 5IR1A 2WP3O 3EYOA 3K0WA 4AL8H 1TZHB 2BIOA 5JW3H 3DTUB 4XCFL 2MEJB 4OCNC 4WLCA 4K71B 1VGEL 2JQZA 4O2CA 5D7HA 5JZ7C 1HE8A 3AMLA 3F7LA 3VFOB 3CFIC 2QDVA 3BO8B 4ZODA 3MRFB 3MMEA 3H4HA 1BBJA 2BIPA 1XF3B 4OF7A 3HOGA 4XMTA 1IBFA 4GRWH 2GC7C 2NYYC 2CQVA 3G6JF 1OLLA 3GI9H 4DP7X 2VXVH 4W9LC 3IPBA 2VLKA 3BSGA 1TTFA 1SY6L 3IBOA 3WD5H 3DBXA 5CD5C 5FYJE 2A9NL 5K39A 2I9LB 1X5FA 2J57A 4HUXA 4QYAA 5I15L 1ICTA 3QR0A 5I8CA 5IMMA 3GGWB 5C1MB 4I1NB 2IAMD 5C08A 4KTGA 4HPOH 4NQEA 1FYTE 3NJGA 3GINA 5D5MA 1Q9OB 5DJZB 4HH9A 3QE5A 4O58H 5C3IA 2F54D 3WUZA 3RAJL 1IL1A 4FG6D 4GAJL 4KK6C 5EIQA 3E6FA 4XOAA 4FOMA 5A1AA 3PFQA 3IWVA 1KGCE 1YHPA 1GS8A 4PS8A 3ECVA 1A7QL 3GBMH 3FRPG 2J44A 1DQLL 4G71B 4AQOA 1RJCA 2ADFH 3OGCB 5FGSA 2IV8A 4OVUA 4JX0A 4JFHE 4KKLD 4JQXC 4D9RE 4G8IA 3BEWA 1DP0A 4L8BA 4NCC2 5ICYA 2CIIA 1PLBA 3F12A 4KJQC 3GWJA 3D9AH 4M8RA 1TZGL 2EDDA 1K8DA 2AITA 3QFGA 3FAXA 2OMXA 4EIGB 1RIVH 5KVEH 5KG9A 3CFBB 2XA8L 1I7UB 5DJ8A 2DMCA 4ZAKB 4DZ8B 1FNSH 4Y2DB 3NEXA 1NMBL 5ALCH 2VRKA 3A67L 1I8AA 4HWBA 1WJ3A 4NUMA 1CXKA 1LK3L 5EN2B 5D8JL 1ZT4B 3U6RA 5IBTH 4PI0A 4UDUB 2LVEA 1C08B 3QIWA 5CSGA 1ZA6B 2AERT 1JNHA 4HJTA 5IQMA 3VUAA 1F8TH 5TJWK 3KYMB 4AGQA 1UM5L 1RFDH 3CX5J 3MROA 3PWLA 4LASL 3MLRH 5ESAB 3GSOB 3JYBA 4MHHG 1KIRB 3N41F 4ZT1A 3G6AB 2DI7A 3DSFL 4RDQG 5B4MD 3DETD 4JUTA 4YXLL 2ZE0A 4FQJL 3WUWG 1KSRA 3ATFA 1WBYA 1AHKA 5FGBA 3DTDA 1BFVL 2R0WL 1AQKH 3UXFA 4AKPA 3RGVB 2VL4A 1EHNA 4QD2E 1O5DT 1YEKH 5JW3L 1KZYA 3S5LB 4G6MH 3DVIA 3TESA 2R1WB 3HS0A 3S96A 1RMFL 3LNFA 4RIRA 1JPFB 4HIPA 4BZ2A 1M71A 3VXUD 2NNFA 1A22B 4FLOA 2HX7A 5J1SC 5FB8A 3QI9B 3SPJA 2A1WL 5EUKA 1K8IA 2XX1A 1ZLWK 5I1GL 4JVWA 3JV6B 2CUMA 4CUCA 3S4SG 2R4SL 2R1YA 1T1ZB 1ZSDA 3H9YA 1BWMA 2JF1A 1CU4H 2LU5A 2ZNXA 2HG5B 1ZHKA 1HL4A 5K69A 2MHAA 2WV3A 1WGOA 3F2LA 1KEML 1N5AB 2F53A 4JFEE 4MXVF 3NIFE 2RB8A 4HCRH 4NWTH 1BJ1J 1TZGH 1UZ8B 3MRMA 3ULAB 1AFVH 1DSFL 5JUEH 1HKFA 4HIIB 4ZZFA 3DO4A 4FKKA 1ZGLM 4MZRA 5IHWA 2BSBA 3L3OA 1V7NL 4AC4A 4BQ9A 4U1KA 1A5FL 2QR0B 3V10A 3DX1A 1OOWA 2BNQE 2E4FA 4Z95L 5GGQH 2C3VA 4PQXA 4Y9GA 1IBGL 4K8RC 5JQ6H 1UURA 4HBCL 3DX8A 4JO5A 4E36A 5IROC 5HGHB 2X12A 4H1LA 2ATKB 4RH4A 4P4KD 1FVCA 2DAVA 5LDUA 2ZOTA 1ZGLB 2F7QA 4HK0A 2J6EA 4LVOC 2OMVB 5CILL 2E9GA 2YAQA 3SD5A 2BSDA 4XNDA 3GSWA 4X6FA 4GXUM 2JKRM 4EXPX 1FO0L 5LQBL 2J1KA 5INDB 1PZSA 3GT6A 5HDRA 2CGYA 4UOW1 1TOXA 4QAMB 5DEGB 4YXHH 3QAZB 1L7TL 5AZEH 3MXWL 4B9IA 3EOAB 4D3CH 1VZGA 5B39B 1WA2X 4AIXA 4KQ3L 4MZIA 4XHQA 2YWZA 5GGSY 3LMJL 1BZ9B 4LF3A 2XDHA 2P8LA 4YE0A 3CXDL 1QABA 2EO9A 5J1TC 3W1ZA 1IEAA 5C86A 1I3GL 2YN5A 2YRPA 4NBZB 4TUKL 5E1AB 3UTZA 1KN4H 2WSPA 2DMBA 1QA9A 2ENQA 1B0WA 2ILLA 4IBQA 3LS4L 2VLKD 4EUPG 4Z7AA 4EOWL 2H32B 5HHNB 1JGUL 3LRSA 2FLRT 3JWDC 5BPPA 5HY9A 3GXUB 2Y2YA 4RWYH 2WNWA 5EB9A 5EDXA 3KPSB 4L5FL 3S5LA 3NDYE 3V5HA 1PZDA 1HAWA 4GT7A 1G7MB 3QIUB 3RPKA 3UL4A 3FQ1A 2PTUA 4DGYH 5HYSA 4JCWA 3VRJA 2ADFL 1AE6H 2HPTA 3KCWA 3V0GA 1EERB 2BVPB 2WWKO 4P5TB 1UATA 3KPNA 3H2PA 5LGHL 3OB8A 1UVQA 4PUBL 3OKKB 5F1SA 3RTQC 4CW1B 2HFFA 4ZUTB 4NCDA 5IQNA 2AV7A 3BN9D 5JQHC 2A9CA 1NDTA 1X6LA 2JIXD 5CUSL 1R3HB 3I3BA 5FO9A 1HVXA 3GF8A 4H8HA 1XFPA 2VSMB 5I1DA 3NSYA 4MQXC 1CGWA 4NM4L 3MTXA 4P9MH 4WK0B 4HLZH 2R8SL 1KT2B 2IFGA 2QGDA 4LLYB 2B0SH 3ABLB 4WSKA 1FF5A 1KB5B 2V2XB 2DOCA 5FLVA 1CGXA 1KEGH 4CC0A 1LL1A 2PCFB 4ZSOE 4JUSA 1FFQA 4XCCL 3WFCL 1DUZA 1N0LA 3K80A 5I66A 4NCC1 2P5EE 5LG1A 4C59B 1MFCH 3DROA 3HMXA 3V0HA 2EYTB 5TDPB 2Q8BL 2BP3A 2N1KA 1D2OA 1ETZA 5C8JB 4OB5H 4LVOB 3IFOB 1A3RH 2VL5A 2OJEB 1TPXB 1MUJA 2N7AA 5HHOE 1IGFH 4XNZC 3E1F1 3BEVB 1GPOL 5FIEA 3FOMB 1BZQK 3KEHA 3M17B 3PQYE 1AS6A 3L4WA 4JDTL 1BQLH 5CBAA 4P9HH 3QIBA 4P0DA 2DIJA 5IB1B 4V2BA 4JHAH 4XN2A 4XN9A 1TTUA 5DC2A 2GI7A 4EN2A 1P1VA 5FKAB 4MAZA 4JFFE 3TNNA 4GI6A 3RB7A 1WAAE 2XG4A 2Y0SA 4CKVX 1I9IH 1PDKB 1LEKB 5SWSD 1F4AA 4G8GB 3TM6A 1JPGB 1RI8A 1CPUA 2EIBA 4EMZA 4DAGL 1AR2A 5IIEB 3IDUA 4PLJD 4EKXA 1QBMH 3BLKA 3EUDA 3HVDA 4WJ5A 4HXAL 2JH2A 4UNTA 3ARZA 2FJFA 2IEPA 3GXMA 4FZ8H 4OCSH 3T2NH 5J5EA 2CH8A 5I5IA 4XPFH 4N5EC 4XVUD 2P52A 3ZMEA 1WWCA 4JPIA 5KSUA 3K7UA 3T2QA 3ZKQD 3B5HA 5F3BA 2Z3FA 4XP1H 1INQA 3L2MA 1AGBA 1OAZH 4IIZA 1A4AA 2AQNA 1HHKA 4UTAH 3M07A 3WHXB 5EHFA 3N1FC 4UQBA 2JV6A 3WG7B 5KSVA 1B4RA 3W37A 2NXZD 2D7TH 2P8LB 4MD4A 4ODXB 1JDCA 1HHGB 4H0LC 1TU2A 1Z5LA 3DNKA 2ZUXA 1AC6A 5AVVB 2VW6A 3KGSA 1ZTXH 5HHPB 1FYHB 2CA4A 3BPLB 4FKEA 5DD1L 4HH9B 1RUAL 1E4WL 1HKLL 1ZWIA 4PMFA 4Q52A 3X13A 1QSFB 1MDAA 5GGSA 3L7EB 3IK2A 3EF7A 3BVNA 2ZNWA 1MCDA 4NO2B 4JFZH 6PCYA 3UZQB 1T1WB 1CXLA 2D3LA 3PWUB 1MSPA 5JXED 4YUEL 2R8SH 2WCGA 1L7TH 1PX4A 1E8ZA 4PMEA 4X6CE 2G4GA 1CN4A 4MNQD 4P48A 4GY4A 4C57C 5GS2H 1KPVA 4Z6AT 4X7TA 4Y4FA 1L9TA 5A43C 3ULVE 2WUBH 1V3MA 3BVDB 2A74C 1GGCH 2ICWJ 5E1AA 5FO7A 3G5VB 4DN4L 1ZANH 1DANT 3UAJA 5KJ7E 2XQYG 3KWUA 3RTQD 1U95A 4XNXL 3TIDA 2EDYA 3UBXA 4AV4A 4PJFA 5K9QI 1S5HA 3C9NA 4AL8C 2HAZA 4JO2H 3ZT6A 4LEBA 5E0QA 5D7JC 5F8QC 5MEQB 4WU7B 2R0ZL 3RDTC 2HFEB 1UOKA 4HH8A 2KT6A 3APCA 2I7SA 4ZFGL 3CNKA 1MJ8L 3LX9A 4MJIE 5D1ZB 1TYRA 2W81C 4OJEH 4QYOB 3FRPA 3ARDD 3WL9A 1HHJA 1WZLA 4O4YL 4DKFH 2BZ7A 1JGLH 3VGDA 3FK3A 4N0YL 2Q86B 1S46A 3KLAB 2B59B 4N87A 5CMAB 1ZSDB 2WXOA 1MRFL 4Y9CA 5HHQA 3JWOH 4AGLA 4QRTA 2A77H 1QSFD 4L05A 3C5JB 4MMYB 3FB6B 5EF3A 1M1SA 2XWTB 1FG9C 4I0PB 4N6RA 2IANE 3UIZA 2BINA 5EU5A 2BSSA 3F7RA 2YEQA 4X6EB 3SZ6A 1R3IL 2VMJA 1F4XL 3G5ZB 4NWUL 3D18A 3V4VH 3KH4A 4J4PC 4OAWA 4HP5A 3WNPA 1UYWH 4XGZB 5BRZD 4KC3B 4XPGL 3HZKA 4YL9A 3RGVD 2NXYD 2NNAA 4M7JL 3SGDI 2D9CA 4KK8C 2LABA 3EYUL 4XP6H 4OI7A 3BT2H 3NIDB 2X3BA 3OC8A 5ICUA 5AYUL 1QO3A 4JQXA 3ZOAA 1M1XA 2XNAB 3C8DA 4WVRA 5HGBA 3ZKMD 4QJ5B 5IBLC 1T0PB 3IJYA 3KDPB 2YQBA 4OGYH 3BH8A 1FZMA 2ZT9C 2XA3A 3OKEB 4OCWH 1M7XA 2WYZA 3I3EA 1ZHKB 4Z7OF 1Q9WB 3E0GA 5EO1A 4U6VL 1E4XI 4PRBB 1CE6A 3MNZB 2VO5A 4R0LC 5IQOA 3FQ2A 2GITB 1FFNA 1U8QB 4XOEA 3UAJC 3HKZA 4GSRA 3LN4A 3EYFA 5KSBF 2NCMA 1RHFA 4ODHL 4XBPA 3LEVH 5F7NC 4M4PA 2JXMB 1AYOA 4L3EB 1M71B 4XOCA 1E7VA 3RVUC 4W70A 1ECZA 1AGDB 1PG7X 1JPFA 3KH3A 4FZ8L 4BD4A 2Z6FA 1EO5A 4POZC 1V8HA 1TDQA 2Y7LA 8CGTA 1R5VB 1ZLVH 5IW6A 3DX7B 3OAYH 1ECYA 4P23D 1K5WA 4X8XA 5LWYL 3THMH 4X6DF 2BMKA 3PFUA 4PJDE 5HGGS 3U4BH 2XXGA 1Z3GL 3TONA 2J12B 2EDTA 3LIZL 4ZO9A 1KJ3H 2R4SH 3L9RB 1PG7W 1OWRM 2R4RH 1A9BA 2V33A 3FONB 5AVWB 4BDVA 5MENE 5BRZB 3ZGIA 4TL4A 3W81A 1SUHA 1TMCB 3PV6B 4WEUD 4NNPL 2YA1A 1H3PH 2UXFA 4R84A 5DRNA 2WZ6A 3QIUC 4EI5D 2WAHA 2G60H 5LB1A 3PABB 1UASA 5EEVA 5ADPL 3O6KH 3SJVE 5HVHC 2HH0H 1CDJA 4N0FB 2PPFA 4NP9A 4X6BB 2R0ZH 2P5WB 1LNUA 1Z6JT 5F7BA 2NW3A 3C2AH 4PRIA 4PB9H 3D6GA 4K7PX 3DJRA 3TTYA 3US1A 2YEZA 2XG5A 5G4OA 5EOTA 4E0RA 3PAZA 4UCFA 5GGTA 3D4ZA 3R8BB 1A14H 3SKNB 4PP1D 3EJUA 1W72H 4KI5F 3SPIA 2R69A 2YXWA 4YGAB 4R8WL 1NCGA 4WW1A 1W80A 4EN3A 2MPAH 3O9WB 4DUXA 4IQHA 4WNJA 2HKFH 1NBYB 2JJTC 3GMNB 4J8RB 4A2LA 3NFPA 3MRFA 2H1LM 3UTPE 35C8L 3T3PB 3DVNA 3O4LB 2Z91B 3ARWA 2ITCA 1Q9LB 1RV6X 3TEUA 5DJDA 5TE4L 2QFPA 4ZOBA 1EJOH 3ZTCC 2GSGA 3HG1E 4LOEA 3EFDL 4AVIA 2DMKA 3CZGA 3FTGB 4JFF