5BO0D

Crystal structure of human mcm2 hbd and asf1b chaperoning a histone h3.2-h4 dimer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
154
structure length
154
Chain Sequence
MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A unique binding mode enables MCM2 to chaperone histones H3-H4 at replication forks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone/dna binding protein
molecule keywords Histone H3.2
total genus 26
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2015-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF04729 ASF1_hist_chap ASF1 like histone chaperone
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1490 Mainly Beta Sandwich Immunoglobulin-like Histone chaperone ASF1-like 5bo0D00
2Z3FA 2IIJA 3AADB 1ROCA 2CU9A 2IDCA 5BO0D 2Z34A 2I32A 4ZBJA 2HUEA 2YGVA 2IO5A 5EIIG 4RRPM 1TEYA 2DZEA 5BNXD 4EO5A 5C3IA 1WG3A
chains in the Genus database with same CATH superfamily
5E1GA 3HAEH 2XZQL 1I9RL 3QJQB 3EGSB 2OA9A 3AWFA 1HX0A 4OIFA 1HVXA 1QSVA 2D9CA 3CZEA 1FCCA 4XO5A 3UXFA 1E3ZA 5HYJA 2B9AA 1ZANH 4KZEL 4KGJA 4A7VA 4FZEL 1KMGA 2ZXEB 4JBSA 3EUDA 3QNYA 2VDNH 2ZOKA 3UO8B 1AXSA 2B4CH 2EDKA 1XGTA 3QIUC 2QQQA 3HLKA 2B14A 5EN2B 3V6FA 3L3IA 4A2HA 1M2VA 5J56B 3ZTDC 2FK9A 3Q01A 1SMDA 4F15B 1M56B 1HL9A 1NAMH 4IRZA 2L7EA 1Z9NA 1KYOJ 4HUWB 4OZIA 4LGPB 3EH2A 4PRDB 3VFPB 4K7PX 1U8HA 4XI5C 3K2IA 1JGDB 4LSVH 4URKA 1ZJAA 4I7ZC 4G8EB 2AI0L 2YXFA 4UUJB 4JQVC 5ESAA 1VACB 5A2KH 2JIXB 3KGSA 1UVQA 1Q90A 4P2OD 4NNPL 3GNMH 3LNEA 4ZOCA 3CLEH 1IBBA 1RZ8B 4DEUA 1AGFA 3L2NA 2O93L 3QBTB 5DD6B 3ES6B 4OIAA 4Y2LA 4XVJL 1GY1A 2FYVA 1A66A 1PG7H 3MR9B 3EYOA 4NNXA 4PTTB 1N6VA 3B9KC 1YYML 2WBKA 3H9SE 2D31B 2CHXA 5D2NA 2MHAB 2GBTA 3HBQA 2W91A 5F0LB 4DPCX 1A6WL 1I1AB 1E67A 5EIIG 3RTQB 4HFUL 3ZE2B 2O6PA 3UTZB 4P2QD 2BIQA 3IAGC 1MNUL 1E9OB 2ZWSA 1Z2KA 3S88H 5GGTA 1DBJL 3LH2L 3LD8B 2OFQA 3POCA 3WIIH 3GHBL 2Y5EA 1T0MA 1J8KA 4FQIH 1LK3L 4O5LH 3RB7A 4ELMB 4AEIL 1YJDL 2YMXH 1JNJA 2DJ4A 3RVVD 4O2FB 3S3BB 1PY0A 1IU1A 5KVEH 3CV5A 2GJPA 4JLRA 1TTFA 4LF3B 3T2PA 3WG7B 2V9QA 4B9PA 2YUWA 2X4RB 2ZUVA 4PJHF 3N0AA 4S2SB 5EZOH 1B4RA 4POUB 4UOQA 4PHZA 2CRZA 1ERNA 2FEEL 3BIAX 4LXFA 5F9JB 4GRLB 4Y7MA 4KUZH 3GUTB 2QTEA 2JCCA 4X6EA 4IS6A 4X2UA 1C5DB 3GYRA 3UCRA 3NA9L 5EC1B 2YWYA 1EDYA 4AY0A 4CBZA 3CDZA 5AOIA 4JFVA 4Y5YA 5I6XB 3DUSA 4NLAA 1U4FA 4JDVB 3IU4H 3SD5A 1BYPA 2JI3A 2XWJB 3OAUH 3X1GA 3LN4A 5IGXH 4APQD 3EJJX 2X4UA 4ONHA 3QIBD 4QT5B 4RDQF 5CO1A 5EFIA 4KVNH 3GWJA 1LO5A 3WJLC 3CSYA 2VB5A 5SWZE 4D9LH 3FT1A 4XOAA 3MV9D 5AOJA 2XSKA 4BFGA 4HEME 1U3NA 3PF2A 2WINB 2EEFA 3R4RA 1P5UA 4P2RB 2A73B 3VGAC 3ZHFA 4RMQA 5I0ZA 1TG8A 3ATBA 4KQ4L 4NKOA 5BPPA 1KELH 4GP8B 1UWGH 4QRUA 1RZKC 5E9NA 2D7TH 3GI8L 1M05B 1R3HA 3PV6A 1NCTA 3B3BA 4OLVH 1YYLL 3VFWA 1OALA 2FJFA 4M5ZH 3V52H 3BIKA 1GW6A 2BHUA 5CLYA 4H1LG 4DKDC 4JMNA 4X7EC 2VERN 5C1MB 4X4MA 4XP4L 3ZBMA 2ATKB 3LQAC 5JW4M 3AFLA 2BH0A 4HSCX 1XGQA 3P3UA 3NJNA 1NJ9A 2HRLA 2JB6B 1HH6B 3MBWA 2H5UA 3Q3GA 3OZLA 4HU2A 5E4AA 4ZJ9A 1DJZA 4P23D 1WA1X 4G9DB 3RWDB 2HLAB 3MV8A 1RIUH 3S3SA 2F2HA 4M8QB 3CH1A 1SPDA 5SWZA 1NCNA 1CQYA 3VUAA 1I1FB 4IRSC 2X3BA 5FFLA 4LCCB 1CXHA 4N1HB 1A7QH 2AJVL 2NDGA 3QH3A 3K3QA 3V7AG 1KGXA 2VDQB 4P49A 3L4WA 3B56A 5IUCA 2A77L 3D48R 4WFED 1U0QA 3Q13A 4U6VL 2XWDA 5IBTH 1MCEA 2O6CA 4D9QD 1IE5A 4GG6E 4QY8A 3VD4A 2F1EA 4XPHL 4NJ9L 4U7KA 4JM4H 3VFRB 1HNFA 3ZL1A 2C9SA 2ZKWA 5GISH 5CEZE 3IK2A 5IMLA 2I9TA 2PXYD 4QHKJ 1A1OB 4YSDA 4W6WB 5I1IL 4OV5A 2Y36H 4BD4A 3QYNA 1NMCC 3ZL4L 3X11A 1PCSA 2O61A 1J5HA 2MTAA 1BQ5A 1L6PA 3NABL 2KZBA 3GXMA 1K4DA 1YEKH 3BUYB 1ZLEA 4NNYB 1IGJB 4P4RA 1NDMA 3IGAA 3APCA 1TTAA 2WSDA 2FR4A 5DTFA 4JREC 3CXDL 3IPFA 2FSEA 1MNNA 5AAWA 3I50L 1QG3A 3QW9A 2B2XH 4FTVD 1BZEA 2ZXGA 4HJTA 2WKLA 4HW6A 4DW2H 3IPEA 3MRFA 3MFFA 1MOEA 3IJHB 2WLIA 3GSQA 4OLYL 5I1AB 4LCIH 4UT9H 1DBKH 2BNRA 2NY1D 1A47A 3BZ5A 2ESVB 1QFUL 1AVAA 2LU4A 4M4RB 2X88A 4WGKA 2VDNB 4DP5X 5H37A 1BOYA 2PR9A 3L4XA 3S37L 4KPHL 4U3XA 1IC4L 2NY6C 4LEXH 5AVZB 3ARDA 2R1YB 1YN6B 2F1AA 2ITFA 3B6SA 3BGMA 3PUCA 2VIRA 4NGHH 1FNEB 2ZOOA 2MQ3A 1LEKB 2X40A 4PRAA 1R17A 2X5PA 3X2QB 4K3JH 4QPEA 2WQAA 3CC5A 4FRWA 3U1PA 5DHYA 1AQDB 3H3PH 1DEEA 2ORBL 3Q44A 4TM9A 4WHYG 5IB4A 4BQBA 2V5YA 1CDYA 4ZAKD 1EFXB 4HFWA 5LN4A 4WHTA 5DS8A 3VMPA 5A2JH 1N5YL 4IHBA 2H26B 5EMYA 2NY0C 4M7ZC 3FQTB 4JB9L 4PGEB 1WWBX 2WKOA 5HD8C 3SDXF 4NZRH 4P48A 3TO4B 5DJ6A 4ALAC 2X4QB 3L5XL 4OF7A 1RZJH 3ZTNH 4ZAKB 2ESVE 5FEBA 3HE7B 2A9MH 4J3OG 4LPWA 2QMJA 3C2AL 4U6VH 1TZIA 2PP7A 4MJ4A 1JV5B 2NNAB 1BPLB 2OYPA 3SOBL 3E8UL 2CG9X 2XCMC 3D34A 3K6IA 3ML9A 1MCDA 3VDBA 2YPLB 1RZFL 3GK8L 2NY0B 4M7ZB 4QXGL 3LDBB 3QZMA 1YMHA 3ULVD 1WHPA 3CIQA 3MOBL 3MGTA 1JJUA 4YBQD 1ZSDA 3L16A 3C9NA 1KTBA 1YPZF 4M8UA 1WWWX 2VLRD 3L1GA 4HLZG 5K9JL 2E75C 4Q58C 2G0KA 4KK6D 5I30L 1AQMA 5FA3B 1A6TA 1P0SE 1D9KA 1TNNA 2VT0A 5D7JB 5EZLA 5CEXA 1XH3A 1IM3D 1PPIA 4HGWB 3ISYA 4QWWC 5KBMA 5BCAA 2CGZA 3HZYB 5TE4L 1XF2B 3IM1A 4FAAB 1OQXA 2ZXWB 5D1XD 3T65B 5AZEL 4IK6A 4LU5H 3D4YA 5AW7B 1KIRA 4Z7NE 5I1EH 1MJ7L 4LRIC 2JH2A 4KQ4H 1QYGL 2VR4A 3MOAL 1PL3A 4P3DB 3NEXA 2WQXA 3RKPA 2CKBH 2VN5A 4YL9A 1CTMA 1P1ZA 1F86A 3OGCB 1ROCA 1HWGB 3BQUC 1E9PA 3LQAH 4ODSH 3QAZC 5HHXH 1A6UL 4UOZA 2LLNA 5ITFA 2DQGL 1UB5B 1Y1UA 4WJKB 5D5MB 1UATA 2NY2B 3ZR6A 2UWEA 3D09A 3BVDB 1KXHA 5HI3C 4FKEA 5DJ2B 3ZHLA 4XN2A 3BWSA 1KG0B 2BZDA 4G11A 4UTBA 1QQDB 2A74B 1CFTB 3II3A 3PPSA 3TS8A 4N68A 2OSXA 5K5YA 1OHQA 3K74B 4GRWH 3GMRA 2OMTB 3BQUA 3MRIA 1RJYA 4ZMAT 5I2IB 3E0GA 3ZE0E 1O5PA 3GBNH 4ADJA 4XBEH 3SPVB 4GW5B 4JMXA 4BHUA 4MDJA 1V27A 2IGLA 3RVWC 1NLBL 2PN5A 4HUNB 4AQ8C 3WU1A 1Z1WA 1N2RB 4RQQA 1J9RA 4K23L 5TFSH 4P57B 3N1QC 2H7WA 4W9JC 3U79A 1WV7T 3KCPA 3C6EA 1U93B 4WENB 3WEOA 4JO2H 4E41E 3QWQB 5I16A 4JN2B 3S48A 5A3ID 2WXKA 3BAYA 3UYPB 1QNZL 1WE5A 4E41B 2AQ1A 2BVQA 2XXGA 4Y5XA 5GRWA 3LKPB 2GEQA 5BO1L 4NQDB 1FC1A 4AQ8A 4S1RL 5JW3L 2HUHA 2YBRA 5IG7B 2HG5A 3BCDA 1E5ZA 3VXUE 3RILA 3U7YL 3GKZA 4AYDC 1PU0A 4ZS6C 4KRLB 4ES9A 3TEYA 4H4NA 4PGDA 1D5XA 5JQ6H 3ARBC 1SF3A 3CMOL 2WQVA 3HS0C 3UZVB 3L95B 4Z3JA 2VZTA 4IIQA 1TENA 2L04A 3JUYA 3VNYA 5TH2A 4Y4FC 5IQOA 5DZVA 3VACA 3MLZH 2WTRA 3OHXC 5IHBA 1OO2A 4R97B 4OCMC 4J4PD 4RESB 3ZKXC 2Z4QA 4YBLB 4ZX6A 4PJBB 3EO1B 3O6KH 5DYFA 1L6XA 3V95A 1CGUA 4S0TD 5TDOB 3U30C 1OAJA 4JVPA 4NKIL 5D7SL 2B7DT 2L4OA 3EYVA 4HBCL 4TUJA 4W9EC 1OM3H 1E5UI 3K72A 3HHSB 3O3EA 2V2TA 1IIIA 4P9MH 1QWNA 4Y5XC 5AKRA 1E3FA 4C4BA 1WBXB 3FT3A 4WUUA 1C8PA 4F8TA 4N25A 2XXCB 1MF2L 2MNUA 2J44A 1I31A 1IAIL 4HX1A 3KWVA 1OTTC 2JELH 1DSFL 5KVDE 3NJHA 5FUZL 3BFWA 3P0YL 2UVFA 3ZZ1A 2R29H 5ITBL 4Z3GA 4PJFE 1Z0MA 1KF9B 3MX0A 4GAJL 3QDJA 2C34A 1FO0B 1JNLL 4GW1A 4HIXH 4UTAH 3FU7B 5CN1A 1D6EA 4TVPL 3CFQA 5AUMA 3L3OB 3GS0A 1F6FB 2PUQT 3QEGH 1P69B 2Z31A 2NNCA 1BPVA 2EC9U 3H42L 2Q2LA 1P6AB 2PPEA 5I6KA 3BMWA 2F8IA 1PKQE 4PJDA 4JO3H 3SGEH 2F18A 2VR8A 4YHKL 1PKQB 5B3JE 2CDFA 5DEGB 5T5FA 2BNQE 2JJVA 4AGNA 3H7LA 5CJXC 3BC9A 4ZT1A 2VW6A 4J3OC 3VD7A 4KKBC 1OB1A 3HIZA 5EC2A 2XZQH 1E6OL 1YPZB 4AH2B 1I7RA 2BC4B 4M7LL 3MUHL 3UTPD 4CVZB 1N6UA 1OGTB 1W72B 2CHNA 4AQ1C 3G9AB 3QUKB 4EXPX 4NQEE 2VLJA 5DT1H 4HJEA 5AW0B 2BXZA 4AV4A 5EBGA 3KPQB 1VESA 1QVOA 2K9FB 1SJEA 2VAAA 3JYBA 7PAZA 3DYPA 3GM8A 5T33H 4F7PB 4N3UA 1LP9A 1QFWI 4XZUB 4HPHA 2EVFA 2EO7A 1DLFL 5GS0C 3BKYL 2FEEI 5DZJA 4ADGA 3U1SL 3WE6B 1OGSA 3TP4A 1I1YB 1AGBB 1I9IL 3QYCA 2YAOA 4HKBB 5BRZD 1XF5B 2DQIH 3L45A 5CJQL 3WV0A 3RDJA 4FP8H 1FA4A 3ZKSD 1CWVA 4U1JB 4WTZG 2OMXA 1N59A 4PJGA 3HR5B 4HT1L 3RIAK 3V0DA 5LNDA 2NNXA 3EOTH 2DLGA 3N41F 4LCWA 3IDUA 3STBA 3LRSB 1WTLA 2Y6SD 3S3JA 4YHIA 3N43B 3LZFH 2OMZA 2VDMB 5T3XH 3VFSA 4MQ7A 4HIEB 3X13B 1MW2A 2UZXB 4KDVA 4KXAA 2YUXA 3EOBB 1MVFA 5ESVB 3FO1A 1TVHB 3WEXB 5JIQA 4R7NA 4MJ5A 5CU5A 4WI3A 1YZZA 4FLHA 4M6NL 4A37A 5DR5L 3A23A 5L88L 3SDYL 2K8QA 1U41A 3OX8A 4J3XA 5C07D 2OI9C 1TTRA 3OKOA 3KW7A 3VWKD 2LQRA 1BBDH 5KSBA 5C08D 5DRNB 3RJQB 4FL4B 1WUZA 1QLFB 1ZA6A 3DMMA 3H6AA 3UC0H 5JW4N 3RIAF 3TTYA 3CFBA 1MFAL 25C8L 1RUKL 3UTSE 3EDEA 4HK3J 1MFBH 1Q72H 4JFPA 3N1FC 2QPEB 2X4TB 3MBEC 2WY3B 4DN4L 4XT1C 3WTVA 1LGVA 1A9BB 1EJFA 2UWEE 4JY5L 4DKEH 3VWJB 2EXYD 1IEAA 2P45B 2XN9B 4HAKA 3RUGE 4JNXA 3HC2A 3S35H 3VTMA 4MMYA 3MNZB 5J0BA 5ALCH 3NRPA 3T5WA 5K9QI 4N9OB 5I1KL 1I1AC 1EV2E 4R2GC 2BIMA 1H15A 3LV3B 4YQXL 3H9HA 2PR4L 1Z32X 1E3XA 1N7ML 4NSKB 3U83A 3ARDC 2JTYA 3V0HA 2AVFA 4HKZB 3ARFD 3P40A 1XAKA 4MCMA 4K2UL 3V0EA 1FZJB 2BZ7A 1FPTL 5F3BB 5H35B 3QUXB 1P4BL 1TVDA 2PYEB 1J18A 3STLB 3FL7A 1JWMB 5TE7L 4WEUD 2VWEE 3A67L 5KANG 3DVFA 4HKJB 3VXSD 4EIBA 3G3LA 2WVVA 4BA0A 1PFCA 5D1ZA 1PSKL 1Q1PA 1T5WA 3GPEA 5FYJH 4EN3D 1T1WA 3PP3K 3L54A 1T0NB 3MRRB 4KO5A 3VI4E 4Z8FL 1NFDF 2K45A 2IH9A 1A4JA 2A0LD 3VRIA 1LD9B 1HI6B 2ARJA 3HBZA 3T77B 3P4MA 1ZIBA 4Z0BL 5H37G 1NMAL 3OV6A 1E5CA 1B0WA 3P02A 4G43A 2P24A 4CADA 4DKFH 2DQHH 3HNTL 3MUZ1 3NT0A 4F2ME 1OWWA 5IEKA 1A7NH 1DDHA 4X0NA 5LAXA 2IFFH 1LDPH 3C60A 3OSVA 4R4FH 4F2MB 3GJEA 5I1LB 2B16A 2BIHA 1X5XA 3BRGC 3D0LA 3LIZL 3WKMH 5T3ZL 5H2BB 2R39A 1G7IB 4NZUH 4WIQA 3AS1A 3FXIC 3C5SB 2B1AH 4OD1L 3KLHC 2AEQH 1UA7A 3MJ9L 3PWVA 4ZI8A 4KKQA 5BZDA 4NPJA 1BIHA 4M6AA 3O41A 4N22A 1ZV2A 2ZJSL 1GR7A 3CXFA 4QO1A 1QSEB 4AYID 3OXRA 2XIDA 2YOCA 3SJVE 4W68A 1H3TA 3DMMD 3E9UA 2ZD0A 3KLSA 2CNZA 2NTFA 3DVNA 1TZOA 2D4DA 2XXMB 3IDJB 1JK9B 3DRQA 4AITA 1UD3A 5ETUB 3UADA 1JYXA 1FYTA 4N2LA 3RWIB 1HHGA 4Q52A 3NCFB 4PV8A 4HJUA 3IDMB 5CU9A 4ORGA 2YN3A 1K8IA 3S6CA 1DN0B 4YBHA 1CIDA 3PE9A 1DLFH 5ERWA 3EZ8A 1A7QL 2ZKHL 3LXAA 4FNLL 4JDTH 4RA3A 1R0AH 1NUDA 3VXMD 4K71B 4PN6A 4E2OA 2C7UB 2BVUA 3W56A 3L13A 4D3CL 2MOQA 2Q5BA 1R5IA 3FH7A 4N26A 3WIFA 4N2GA 3I02B 3LOWA 2AK1H 4PSRA 4AMXA 4JM2D 1Y18A 1IAOA 2BHFA 3VFUA 4TSCH 1HOEA 1QI4A 4P9HH 1XH1A 1WAAA 5DQDL 3S0PA 4R2GD 1EAOA 3SDXE 1IGMH 4PAZA 2ED6A 3AS3A 5FK9B 2Z92B 1KCUL 3CTTA 2VLJD 4XNQB 4R96A 5C07A 3RI5K 4P2AA 1L7IL 3KGTA 5HHNA 3WHE0 4O02L 5DQ9B 4QRRD 5T5FH 5J6SA 5DD1L 3EUUA 5GGSA 1SOXA 3DX8B 4NUGL 4FLSA 2XQBL 3ZDYF 3OF6A 3QULA 1PD6A 4XGZA 3QEHA 1S5IL 2ICCA 2ZOTA 1PDKA 3HMXL 3NFSH 3U0TA 4AYSA 3WLWD 1U8JB 1JZIA 5I8OL 2ICEB 3QUYB 1RLBA 2VXQL 5CJ8A 5G5DA 3FCTB 2E56A 3DJZA 3OAUL 5JHDB 2DQ6A 3G6JE 4OF3A 2O4EA 3GBLA 1NCCH 2FL5B 1FVEA 1Z5HA 4X9HA 4AK1A 5E2UH 1WZ1H 2Y6SC 2MCAA 4GI9A 3WS3B 4OUUB 2ZAGA 1CQKA 2DW5A 3BH9A 5T1KA 2H3NB 3WIAA 4KJYA 1B0RA 1A2YA 1GZPB 2DPKA 3CDCA 4XE0A 5I5RA 3GZQA 3AGVA 2EO9A 5J6HB 3QJHB 4RGNE 5F1IB 5CCHE 4EI0A 4X6BB 4YDIL 1KCUH 5ELIA 1C9SA 3V4LA 4JO5A 5GS0D 1KULA 3IMRA 3PCYA 4L1BA 3BJLA 4G1MA 2K6ZA 2K9UA 3GLDA 5E6ZA 1M4KA 1HEZB 3QZWB 3H9ZA 2P5WA 1H3GA 5B39G 2ZXBA 1U3HC 4FFWC 5CBAA 4U1HB 4BSVB 4JRXA 3F5WA 3PYCA 1Z3RA 4XVOA 2OPCA 4FG6D 4HEPG 3SBPA 2V17L 3JXAA 5I0VA 4Z7WA 1X7QB 3FOMB 2EICA 4ZRGA 3DOSA 5CEYA 5EOTA 4D3CH 4Q7DA 1TJGH 3ULSA 4WW2C 3OKLA 4YDIH 5SWQB 1S7VB 2JF1A 2QHRH 1G4MA 4X6CF 4A7UA 3L1OH 4LKCA 4I3GA 4N0RA 3HW7A 3QEUA 4WK2B 2C8NA 4WVRA 5E08L 2KERA 2WLKA 1ZT7B 4XPAL 5IF0A 5HDOA 2HB0A 1KIPB 4JFQA 3SE3C 4AUUA 4L5FE 3MRNB 4DP2X 5F6HI 3IETB 2PWEA 4Y2DD 5IVXE 2ADJA 5EIIA 3EW3B 3UPRB 3Q1SH 5E9DE 3HEIB 3O2DA 3BMVA 1PQZA 1VLXA 4W9GC 3U9PL 4L3FA 5INDA 4Y1AD 2Q7YA 3ZRSA 3NCJH 3NUKA 1RP9A 3OJ2C 4A7QA 3F6IA 1PNDA 1M3JA 3GT6A 3VI4A 1INQA 3DSFH 1MG3C 2J8OA 4EQ3A 4U4IA 1YNTB 4LVOB 4AUJA 1Q1JH 4PJ7E 1A6UH 2G2RB 2RQ8A 4ZMZA 3NYKA 1M9SA 1GYAA 1N3NA 4HPOH 1ZT1B 3FBKA 1P7QA 2CPCA 3VG9B 1Q0YL 2DMBA 2CKBL 3OR6B 1A4BA 1SBSH 3MRHB 4IU2A 4WFFE 4NRYA 2NXYB 1YA5A 1HH9A 5KOVC 1WQVT 4YWGH 1BM7A 4ODVH 4ZX4A 4R83A 3D69B 1KPUA 5IW1B 3RWHB 2D3LA 2F7QA 3RY6A 5E1AA 3UJTH 4PRHE 4J4PC 5FYLD 3ESUF 3ZYIA 1FVCB 4QRTA 4UQ9A 1H3WM 5DYOA 4JPWH 4PJ7F 4DN3L 1W8NA 2JTDA 2YPVL 3C8KB 4KZEH 1DDTA 4ILDA 1PBYA 4Q6IB 2AV1B 1JHKH 1K2DA 2DM4A 1O6SA 3NZHH 3GSVA 2XA8L 2O6DA 5KEZA 1NFDA 2NT1A 3D0VA 3DOIA 1MW1A 3NZ8A 4X5WA 3RE0A 3TV8A 4M6ML 3WAJA 1CXFA 1S7UA 2JXMB 3EF7A 4K15A 4XN4A 3LNDA 4F8NA 1FYTE 1OZUA 5I74B 4BKSC 3NIFB 4R90L 3QEQA 4L4VD 2EE3A 3ZE1E 4MAYB 1DVZA 1JRHH 4YK4C 4OGQC 1YY9C 4M5YL 1I4FB 1SEBA 4O51B 1S2EA 2DEYX 2Q3AA 4KXBA 4AW4A 2CBMA 2W59A 4QRPD 4B6ZA 1QSFD 1HKFA 4Y0GA 1XCQB 1ORQA 1OEZW 4ZNEA 3BDBA 1VERA 3SDDC 5CR1A 1AKJA 4IIQC 4I1RA 3MPCA 1KXTB 5LCVH 3ZSSA 1UOLA 5HGBB 1IFGA 2PPAA 4DKEL 1DFBH 3F58L 2ZUUA 4MJ2A 3U0PA 2RGSA 1A65A 5C09A 5CFHA 2ZICA 4OH2A 2ZP9A 4RNRA 5FWRA 5C7XH 3UGEA 3E9TA 4N1CA 4CVXB 4NWUH 2A0LC 4HCGA 2JMRA 3TYGL 2IAMD 4XB8A 1IIKA 3QUMA 1BBDL 5GJTL 4CGUB 4G5AA 1JZ6A 2WMPA 5C70A 3QUZB 2BP0B 4UV7H 3CLFH 2ZUXA 4N5EC 1V7MH 5D72H 3BGFB 4PB9H 1AGDA 1W6LA 5F3HB 2Y7QA 1CFSA 4NZTL 1IBYA 4JJHA 4UT9L 3NFNB 2QZQA 2YPKB 4XCCH 4H8WH 1ETZB 4XXWA 5LKNA 3DURA 4HHGA 1J9QA 3S5LB 3VW3L 3ARDD 4Z8FH 1MFMA 3K46A 5LB1A 1NIBA 4Z7UE 3GO1L 4ZOAA 3L2MA 1KENL 3EJZD 4FHJA 3F64A 2C3XA 3CXDH 2XV3A 3MLXH 4U6TA 5J6GB 4GT7A 4Z7WE 5CJBA 2EXYC 4HUVA 1RULL 5C2BL 5L9DH 1PZ5A 3KH4A 4KBPA 3K2MC 3UP6A 4DP6X 2HLFD 1DEDA 1FFOB 3MBED 1HESA 3S4SA 5GGRB 2PLTA 3W81A 1UM6L 5GISL 1Z9SB 3R0NA 4RMTA 3ABKB 4WW2B 2J88L 2N01B 4NJ9H 3HHMA 3NQKA 4YX2H 2Y07H 1ILUA 1AS7A 1BLIA 4KI5F 1GGIH 1VZGA 4FLOA 5DJAB 3QI9C 3UERA 4ELME 1EIBA 3OZ9H 2Z8VC 4QCIA 4CC1A 4MASA 4Y8DC 35C8L 3X3FL 1QUPA 4AM0Q 5DJ8B 4A7TA 2WZAA 3DVGB 2R2EA 2BNQD 2YK1H 3U0WH 2IH1B 2K4WA 4X9IA 3UC0L 5T1LD 1OP9A 3K8LA 2R69A 3V6OE 1NBYB 1DVXA 2ADYA 4NN5C 5BOZG 3D30A 3QQ4B 2Z0BA 1N8ZB 1T3FB 1BVLA 1PZAA 4KROD 2Y25A 4Z77A 3P0YH 4GLRH 4BFRA 3HFMH 1EXHA 1MCOL 1T21A 4IOFD 5F1KC 4JPSA 4QKXB 3N44F 1HN1A 3MJWA 1HOCB 3VXNB 4WQOA 1Z5LA 4EF3A 4Z7VA 3QWOB 3EH4B 3FT4A 4XTRD 4EZKA 5L8LB 3WTWA 3KJ4C 2E6QA 4M1GH 2OM5A 5EO1A 1TNMA 4MA7L 3KLLA 2N7SA 5GS3A 4E0RA 2JKJA 5FYKE 4J3OD 3O0RL 3CX5J 1ZE3H 2I60H 3BKMH 4TLTA 2DIAA 3U1QA 2B1HL 1GVIA 5GS1A 3HC3H 3V0AC 5JPNB 3NIGE 2OMYA 4P59H 5F7YC 1AZVA 1TQBC 4GMTH 4PJ5B 1UACL 2F53E 3MACH 4PD4K 2R69L 3CDGA 4LVNC 5IHZB 2FWSA 1J86A 5SX4H 3CVDA 3L4YA 4Q2ZA 1R3IH 5G2NA 4NDMB 3MLYL 1FNGB 5JOFB 1XMEB 1TCRB 1PF3A 5IWLC 1NEPA 3SO3B 5HDQL 5FV2A 4U3CA 4MMXA 1ML0A 2RA1A 3L3HB 1Q9LA 4R0LA 4Z76B 1H8NA 4NX0A 1D5RA 2DWYA 3MRQB 3LKNA 1FFPA 1JXKA 4JO2L 2BVTA 3KBFA 2J21A 3R4DA 4NPYA 4PP2B 1S7SA 5C0CE 3V9EA 1TKWA 2IF7A 2C9AA 2BPBA 4YHMH 2E47A 3EBHA 2K0RA 3T6ZA 4G2AA 2OJEB 1UZ8B 2F54D 4ETYA 5CLWA 5J57B 1RUAL 2SEBB 4KRPC 2PETA 4PJCA 4YNYA 3WBDA 2BVOB 4DVBB 2JB5L 1SN5A 2DLFL 1FNFA 4BWUA 3W2DH 1J8RA 2P7TA 5AOMA 5KJRH 4GQZA 1EZVX 2YA2A 2VQUA 4LO9A 2O72A 3E6HA 1RFDH 4GKZB 1PZ2A 3B7UX 5GJSL 3QZBA 2UYLB 4DGUA 3ZYJA 5FYJD 1EJ8A 2X7LB 1UCBL 4TL4A 2AEPH 2IV8A 4P59L 5F7HA 4OCSL 2HJLA 5MEQB 3INUL 1TMQA 1UWEH 4OJEH 2X4PA 1KB9K 3BKCH 4F8PA 2ZWYA 4IQHA 4YGVA 3V0GA 4HBCH 1WCBB 2PTUA 3ELQA 5B38G 1SY6L 4MNQB 1VCBC 4KRMB 1ES0B 4JO1L 3TOPA 1S8DB 2Z35A 3E6FB 3LKOB 4QGTA 4MD4A 4AI7A 5CMAA 4EUPB 4XNYL 1EEZA 2A83A 2CA3A 4A2FA 3BAJA 5C0FA 4S0HA 3GIZH 1M57B 1MJ7H 3BXNB 3NFPB 1IV8A 3BN9D 4MMZA 1U42A 4RFEB 5D2LA 3SJVA 4F9PC 3EYQD 3NH7H 5FCUL 4CILA 2AEPL 2GUYA 3ESVF 2XQYG 1MHHA 3KHOA 5KS9B 1HILB 4H88L 4APXB 4YSCA 3WN5B 4OB5L 3RL1B 4NKMA 1A9EB 4KUCD 1I8KA 4P9HL 2VZ3A 1J9CT 3WLBA 1I3RA 3U7YH 1ET8A 4WKZB 5EA0L 3ILQD 3RWFB 3U9UA 5J11B 1U95B 3JV4A 2MEJB 2FBJL 5E8OA 1BG1A 4AENB 3NRQA 1J0HA 1HZHL 2JIXD 2RH0A 3MOBH 4L1HA 3DHJA 4PM1A 1K72A 2VJXA 2YEZB 4JFEA 3V4VH 1MAJA 4ZTOL 1E5YA 4ZYKB 3HZVB 2OQJB 3IJSA 2A99A 1SQ2N 4FNLH 4JM2F 3M8OL 2NZIA 2XQ0A 4L9LC 4QRPE 2FJGA 4RGOL 4HG4J 3SE4A 1P5UC 4FZEH 3RX9A 1ODUA 1PEZA 1ZY9A 4PV1C 4YIQA 4UQCA 1A3RL 2NXZD 3MRDB 5BXFB 1RXLA 3C2AH 4XPGH 4LZKA 1UT2A 3NJLA 43CAA 4U0QB 5TQ2L 3SE3A 3QZNA 1IFRA 5MEOA 4F37K 2XVKA 4JQXC 3GRWL 1UEMA 1IGFH 4LLYA 5AW8B 1CGYA 5EORH 2UX7A 5ICZA 4F1ZA 1KBWA 3SE8H 2GEEA 2LLGA 3P2DA 4L1TA 2ZCLH 2VQ1A 1RZGB 3ZXAC 4N8VA 4FNUA 2DQTH 4OJDH 4ENEC 4LQFH 4R2GB 4HH9A 1E9QB 5T5NG 4BQ6A 1EEYB 2C3WA 4OM0L 3TCLB 5FOBA 5DJCB 1RULH 1P9MC 3FN3A 3HMXA 4G71B 1AC6A 3EO9H 4LEOB 1LO0H 1QX1A 2ADIB 3BWAB 5GQBA 2FLBT 4N2HA 4RWYH 2ZYHA 3BT0A 1KCLA 4KK6C 1T1ZA 3MBEB 4GO6B 1QEWB 1QYGH 3LCYA 3MOAH 3QDGE 4UQ2A 2P47B 3RVUD 2PF6A 2UY6A 1CXLA 1IGYA 4YBQC 2CPUA 3VFMA 1CG9A 1N0LB 3WUWA 4XP1H 4CU8A 1P2CA 1PIGA 3OJMB 1HHKB 1YC8A 1RZ7H 4M62L 1EHLH 3C6SA 2WXHA 5KAQF 2EKSB 2VOTA 2Y2TA 4XMKL 4GG8B 3B2VL 1B2WH 1AJ7L 3KYOB 4QAWA 4YL4A 1GOHA 2C26A 3D6GA 2QVFB 1RK1A 2KQNA 4JANB 2CMRH 4PJBF 3V4PL 2X1WL 2CGRH 4FEMA 4LPTA 4U1GB 2V2WB 3MXWH 4FQCH 3CFCH 1W0VB 2VMCA 1E8WA 5F6HJ 3THML 3JWDL 1BZ8A 2FTAA 5IB5B 4YX2L 2JJTC 3DGDA 3T8XA 4MJID 4PGJA 5IEHB 2DL2A 3MRBA 2FO4A 1SYVB 3CU1A 3EJCA 3UTSA 1U8QB 4JG0H 3OZ9L 5TJWK 3DXAA 4L1LA 2CE6A 5DFWH 1NSNL 2PR4H 2ZPKH 2C9XA 3ZE2F 4AVIA 3WTXA 3RB5A 5ICXB 1KXVC 2X6CA 3CZUB 4WK4B 4OZFB 1HINL 2C5DC 5B1JC 2H2PC 5JIHA 5ALCL 1C5BH 2NY6D 4QLRA 4HD5A 4NWTH 5EO0B 5A6LA 2NW2A 1C08B 4NHCL 1CGSL 4AIEA 4N20A 2CDEB 1WUNT 4OFIA 2LTQC 4NBXB 1MREH 2Q3XA 1FZOB 2HYMA 3TO2A 1X5MA 1RUKH 2BSRB 3LN9A 4IHOB 1P7BA 2C1PB 3MREB 2A1WL 5IJDC 3I6LD 2MCPH 4XMUA 1X7SA 2DQFA 2IPUK 4ODUB 5L4IA 2BM3A 4FQ1H 1EHKB 1NH6A 4Z6AT 5BRQA 3VXSA 3QIUA 4GMSH 3W38A 1QAWA 2AJUH 3FQ2A 1YY8A 2XA8H 5D8JH 1CZ8H 4PJGF 4YXHL 5MENE 5DR5H 1R3KB 3ZQ9A 2OL3L 2WP3O 3MNMA 3E80A 2FX7H 4UV7L 2X05A 1SQMA 1EEUA 3FCGA 3CC1A 5JXEC 5F7EH 2OTUA 1OP4A 3W3BA 4HGMA 4AE0A 1U92A 5C9JA 3RIFF 4PTUA 5KTEL 4TNVF 4X7FC 2DBJA 4FJYA 4LSRL 4FGMA 1AHWA 1EHAA 3MJ9A 2BDNL 4QIRA 4XP1L 3MHZA 4G80B 2DZEA 4YWGL 1QTPA 5JZ7C 2JJTA 2HMIC 1KBBA 1CE1L 2EECA 4UQAA 1JBJA 4FHBD 4K5PA 1HSBA 1RMFH 2QGDA 4HDIB 4MNQE 1JHTA 1M1XB 2F8XC 2NX5A 3BWZA 2OXHA 2IWKA 2DBLH 2FO8A 4QDGA 2NX5E 3U30B 2GFBB 5ANMB 1CK0H 1VIWA 2PCPA 4LLDB 3N50A 3TVMA 3LKQA 4N2CA 1AZZC 2X09A 4UTCA 4G82A 1Z66A 2KMWA 2ZCLL 1ADQL 1VGEL 1SFHA 4HBQA 3TCTA 1EZVY 1F4AA 1WDAA 1B4TA 3Q8FA 3U9PH 2R23A 5F7DB 4LLWB 3T2QA 1J87A 3H0TA 2I9LB 1T04A 5DD5L 1KIUB 5CZRA 1G9NH 3O4LE 4PRIE 1OCWL 2X2JA 3AW5A 4XP5H 3E2HC 3EO0B 3DYOA 2V0AA 4Y8AA 4OLWL 4GAYB 4J23A 3CK0L 5BMFH 5JO5A 2VN7A 1RPKA 5IQMA 5IY5B 3QDMD 4B5EA 1BVNT 5C6PB 1FL5B 1TJGL 2BK8A 2HFEB 4B7IA 3WS6A 1QR1B 4JG9A 1NGPL 3KPPB 4YZFE 3OXSA 1CYGA 1ZWIB 2G60L 4JPIA 3IBOA 1TQBB 4LCVA 5I75B 4R7LA 2YJQA 2FNWA 2RJMA 4IW4C 1G5AA 1MLBA 4H25A 2VABA 3I6KB 4OBRA 1DBAL 3UGXA 4D7BA 1CD8A 1FLRH 1QSEE 1TR7A 3C75A 1JPEA 3IJEA 4PRHB 4QXVA 5J13C 2WLLA 3BVTA 1I75A 2V5SA 3EOAA 3MOQA 3VD5A 3HNVL 4OI9A 1BVKA 2NY4D 5E6UB 3FJTA 4M5ZL 3V4VB 3ZIYA 4C83A 4YVUA 3P2TA 1D6VL 1FBIL 5KYUA 3UH8A 2VDLH 3SKJL 5FECA 4GRLC 4W9IC 4AM0A 3RGBA 4CNIA 1U8CB 1HAWA 1QW9A 3OF6D 3ZVVA 3O8XA 1UA3A 3U36A 2D4FA 4BSWA 4GG6A 1RQ5A 1SBSL 3EFDL 3WE1A 4JO1H 4X4YA 4TQEL 4X6DF 5F89B 2APXA 3WFCH 4YFLF 3QJXA 3MLUH 4B3VA 5JOEA 2RBLA 1M6OA 3TBCA 3QDGB 1KPRB 3IF1A 4D9LL 3RBGA 1II4E 4EMZA 4QHLA 1ZHKB 2B59A 3UGUA 2PW1B 4R5TA 3LD8C 4AIOA 1GGBL 1UQSB 5HYSB 1DZBA 3QNXA 1OAYL 1OOWA 2DDQH 1OTUC 4R4BA 2KC0A 2CK2A 2VXQH 5EU7C 4C4KT 3D9AH 4LSPL 3QAZB 2X1PA 8FABB 2XWZA 1MHCB 2QJDA 3G6JB 1E4KC 3RTQC 3RVVC 4YK4B 1QLRA 3RU8H 1KYUA 2LV4A 4XXCA 5FGRA 1GKEA 3TA4D 5E00B 43C9A 4ZMWA 1QSFE 5HJ3B 5E5MB 3HI1B 4AJWA 2OMWB 5HHQA 5JA9A 1HU8A 4OV6F 4UIMA 1IM9B 5CUSH 1GC1L 5T5FL 4DETA 5ICYA 1Z3GH 4NQED 2WZPA 1XGRA 4IYKA 2QQKH 3FTXA 2R56L 4O9HL 1VA9A 2BHZA 1EZSA 4NAQA 4GIAA 4TQ8A 1CD1B 2O6EA 5FGBA 1UYWL 4GBXB 4N6RA 4Y16A 5E95B 1WIPA 4GSRA 4FYSA 3VXQB 3SPHA 3G6DL 3B9KD 1B0GA 3TWYA 1G94A 4X5RA 1PY4A 3OR7B 5KYWB 3TBVB 2JKTM 1YDPB 4LSQH 2ATAA 1KGCD 2KZ1B 4ANKA 3ALWA 4CSZA 3KPMA 5H8DA 4JZJC 3RZCB 1B3IA 5GGVL 3T0EE 3S88L 4JFSA 3ZDYB 1QSED 1UZ6F 5KN5A 3GBMH 4K7FB 4ZUUB 3NSYA 1T7VA 3SGJC 4GKLA 4MKMA 2AXGA 2J72A 5ISZD 4Z7QE 2RACA 2I60L 3BKML 1BFOB 1HHJB 3JZYA 4DUXA 1Q0EA 1MWOA 1QFWL 4W4NA 4JPQA 2ENQA 1RIHH 3UROR 5IOPA 1A4CA 5KW9L 1OSPH 1YLBB 2HCZX 1JPST 1I7UB 3V0WL 1YMMA 4YSAA 3CN2A 1K4CA 1CLYL 4X4XA 1S5IH 2A9DA 3HZ3A 1UD8A 1ADQH 1VGEH 2XJLA 3D05A 5FAAA 1AG6A 3B34A 1CVRA 2GJ6D 3EFDH 1HJCA 1JZ7A 4G6AD 1ET5A 3QFJB 1MCLA 2BIIA 1CK0L 2R7EA 3BSZL 1FF5A 3AY4A 3P0VL 5TDPB 5AB1A 4FZ8H 5D1ZD 1A6ZA 4ZFGL 2FAUA 4OFYA 3KXFE 2DI7A 5JIPA 1D6VH 1CYXA 1FBIH 1WFTA 4L29A 5DVPA 3WY3A 2EVJA 3VO0A 3HG4A 1ZOXA 3M7FB 4Q74A 1LEIA 3OWRA 3DTXA 4P2RE 5DC0A 3IE4A 2W95A 2XYBA 4B60A 1FLRL 3RZWA 1HCZA 2MNJB 4ZPTA 4HS8L 4ZFFB 3IB4A 1U3HB 3MGOB 3O6FA 2AK4E 3DJRA 5EU6A 5J12C 5F9OH 4PJ9A 2YUZA 2ENPA 3ULVE 4MVBC 5DFVD 1NFIA 2V7HB 3J07A 2B39A 4UDUA 2AK1L 5FYJL 1BSIA 1YNKL 4JB9H 3DO3A 4KK9D 4X6CA 4X9BA 3WL9A 3ZDXB 3IVKB 2YAMA 2VO5A 1GJWA 2FECL 4LRIA 2BMKA 2EIKB 4L1DA 2VLKB 1EXGA 4PJHB 3CN3A 4NRXB 1NIDA 1J8HB 1KGWA 4ZOBA 4D0CA 4PJEE 4EN3A 4U49A 3TEWA 2AEIT 1UG9A 5C6WH 4ZSOB 1T2QH 2HJKB 4HPYL 2QTVA 5EUKA 5GSVB 5C0AA 2QMKA 2OTWA 4DIXA 1NEZB 4L4VA 5JXAL 2FIKB 1A8ZA 3ZKMD 2JKNA 3QRGH 3TJEL 1MFVA 3GQFA 2F5BH 3TWCL 1OSYA 4P0DA 5DHVB 5HPMA 1ZVSA 1BM3L 1ND0A 1IVTA 1RMFL 4P9HC 1ZS8A 4HWEL 5ABDE 5MERB 1TYEB 5I6MA 1EA9C 3IXTA 3SQBA 4WI0A 1GZQB 1OAZL 4K9EC 1W80A 4DKAA 1KTLA 2B0SL 3MTXA 1FG9C 1LDPL 5DQJA 2EIJB 3MJ9H 4TUOB 1MWAH 4G8FB 1YEHH 3FHEA 3T1FB 5J7CC 2WOBA 1O0VA 1AQ8A 3EFOA 4N0UA 1BF2A 3C6LA 3G5VB 2J8UF 1E5AA 1R4XA 2AXFA 3MXWL 5AW9B 1T1XB 2IAMA 1FORH 1NMAH 2X4OA 2MCG1 1ODAA 2F58L 5E23A 4OLZH 2XN2A 3SDYH 4PJ6A 2W0KA 4W9ZA 5JW4Q 4F3FA 4L3AA 2UXVA 5I24A 1HHIB 1ETA1 2ZCKL 3I9PA 4ZUVA 4ATWA 1FNSL 4X5XB 3Q2VA 2Z1PA 1KTJA 4V33A 5DRWA 3UBFA 2AS5M 3N85L 3WFZA 1GIGH 4TTDC 3RX8A 3MRGB 3GINA 3VWKB 3ZL4H 4DUVA 3LSOB 1W9XA 2FVNA 1HQ4A 2UXGA 2P4AB 3DO4A 1J10A 1TYJA 4F93B 4HT1H 2E3VA 2X3AA 3KNBB 4IOFC 4QF1A 3MQIA 4EDWL 1TT6A 2BOBA 4HLZH 3U48A 4HH8A 4Y16C 1XR9A 4GYBA 2IQAA 2WXNA 4JRYA 1VSCA 1JRHL 4I8DA 4KV5E 2VXSH 2CIIA 4JS7A 1MVUB 3RNKA 1FPTH 3N2JA 3PGDA 4LHUB 4U6YA 4P5TC 5I6LA 4Z78A 5C0IB 1CCZA 3PDOB 5JUEH 2BSED 3ULUD 5D6CB 4CJ1A 4ISVB 3FBQA 1NSNH 2G75A 4PWKA 5EU4B 4NO0A 5F88B 3ASNB 3U4KA 3CUPA 4LCYA 4I4WB 2UZIH 4F80A 1V55B 2YHGA 4JE0A 4GRMA 5ANHA 5DRZA 4A6YL 3F65A 4NJAL 5JW4R 2J4WH 1LWRA 2W81C 1DQJB 2HN7A 4LLUB 4OLZL 2KKQA 2B4CC 1IE4A 1JL8A 2R4RL 4OCYL 1J1PL 5LUMA 3D87B 3PHOA 5D1QB 3SJVD 3V4PH 5TF0A 1GJUA 1YEHL 3O6LL 1HXYB 1IFHL 4Z7UB 3UZEA 3PLYA 2HT3D 4M6NH 1E27A 5IZ7A 1G4RA 4OT1L 3TBTA 2HLFC 1W72H 4HULB 3MTRA 4XP9H 1WC7A 5EU3B 1T03L 4KKZA 3ETTA 3V0VA 4IBVA 2YD2A 4MQXC 5BQDA 1L7TH 2ADFH 4HLJA 1KN4H 1L0PA 2FD6L 3GRGA 4H8UA 3NIDF 3T2LA 3SY0B 4UV4L 3TLRA 5L88H 4AIZB 2Y5TB 2LVEA 1BECA 2B77A 4N0FB 3JWNE 5FW7A 5SX5H 4IGBC 2VSMB 3SN6N 4X0KB 1XV8A 3KYNA 3BSHA 4KVNL 5SWSA 3RWCB 4OB5H 2Z65C 3WJMB 2YGVA 4EOWL 3WUZA 1K3IA 4ODXB 1BD2A 1IGTA 2Q9OA 2W8CA 4IOSA 4ONFH 2DEXX 1NGQL 3DJ9A 2C3GA 5FCUH 4K07A 3O2WL 3QI9B 1NKGA 5JMOC 3KWWB 2GT9B 2FB4H 4X80H 4XRCA 3WEBA 1JE6A 2GG1A 5D7IA 2VL5B 3V0IA 1U21A 2HSIA 2LFGA 2WXGA 4QHNB 2FYYA 4LDOB 1IKOP 2W5PA 5E94A 3SE8L 1R5VA 2QR0A 5E08H 2TRHA 3FONA 3TESA 5AW3B 2AKRA 7FABL 1H9VA 4CMMB 3RFRA 1EGJA 2ZX6A 1HT6A 4C59B 5DMKB 2H3KA 3HKFA 4GEIA 1D7FA 1X5AA 3LZNA 3Q2NA 5GZOD 3S5YA 4LLQA 5A2AA 4OFPA 4IOIA 2CJ3A 1J0ZA 2V17H 3TZVB 4QOKD 3LHPL 5J12B 1WG3A 4JRXD 1XF4B 5F7NC 4LCWE 4G8GB 1A7PH 5C9KA 1DTUA 2YMTA 5G4MA 4PLKD 3QEGL 4TSBL 2YEVB 4PD4J 4GS7B 2APFA 5IB2B 4YHML 3HA0A 1PJ9A 3EGDB 4Q14A 1V3LA 3UEQA 4W70A 4OZGB 1XSKA 3MROB 3N42B 5HHOA 2EUXA 4OI7A 2D03H 1SXAA 4JPKH 5T3ZD 3RFZA 4KJQD 1G1CA 2JJSC 3WKPA 1ETJA 3AXLA 4X8JA 1F97A 4AZ8B 4HQQL 2EIBA 4LP4A 2XXFA 2E5EA 2R51A 4PJ5E 5GGUA 1U9KA 3M1BA 3CHQA 1BDYA 2BP8A 4UCFA 2E7LA 3CSPA 3E3QC 3MUGB 3MRJA 1OKEA 4NNPH 3TIEA 2PYFB 2H6OA 2I5YH 5CZVL 1FGNL 4O2CB 4JKKA 5I18H 1F2XK 3V10A 4KOCA 2HT3C 2ENJA 3FRPB 2FBOJ 5AG8A 1JZ5A 5I8OH 4PY7A 2BCMA 4OZHB 3QXDB 2AQSA 1G9MC 2KPWA 2VLRB 4LLAA 1GGCL 2Y2WA 2L8AA 3INUH 3VFNB 4I0PC 3S34H 4BFJA 2QVTA 2IANE 1PZUB 4YHNB 4TQEH 4YSUA 2PYED 3FSOA 1X4XA 4PJXA 4BINA 2HG0A 5DU7A 1L9SA 4LVOC 3ZDZE 2FLMA 5EWIL 4HHAB 1UASA 5DC4B 3QGVA 1KCRL 4MA8H 1BZ7B 3TO4C 2XC8A 4MJ6A 1M42A 5HGHB 1JN6B 1FN4B 1NIAA 1RUAH 3DUHA 4EVNA 5B1BB 2DYSB 4CVUA 5MENB 3T0WA 3HFML 5C0GB 3VXME 5CINL 1V7NH 3E3QE 3OB0K 4WUUE 3VXOB 1UM4H 3E1ZA 3O4LB 4PRIB 3WOVA 1THCA 4XWGL 4MCNA 4S1RH 3REVA 1KEMH 2CIKA 4Q89A 1I8MA 2N7BA 3DDGA 1JGIA 4JRWA 5CUSL 1XBDA 1OCRB 4HCFA 3W0WD 1N12A 1NPUA 4YDJB 3I6GB 3IDNA 4AV0A 5JOPE 2PTVA 3HHRB 4NO2B 1ZLWH 2GJ6E 3EGXA 4UIKL 5MHSD 1KGJA 2X6VA 4NFBA 1ONQA 3ECBA 3KPRA 1MRDL 3GIVB 2YAQA 3X14A 4BZ2A 1QASA 4P4KA 5DUML 3X1NA 1T22B 1UD6A 3ECUA 3GSOA 4I87A 1CF8L 1CL7I 4JFDD 3TXAA 3CBKB 4WFGE 5BS0B 4PU2A 4C57C 1S6NA 5EV7A 1G7LB 4WWKB 3TA3B 1E30A 1VAHA 2CO4A 3HMWL 4YE0A 12E8H 1TSRA 3HZKB 4FG6C 1TDQA 1ZT4A 1BFVL 2O26U 2Z9TA 4HWBL 1IAMA 2MQ0A 3AU0A 5FHAH 2R8SH 3IJYA 1KYDA 1RUQL 2EYSB 3WI9A 4JL1A 4HETA 1KGCE 1JGLH 3QDME 4HKXB 3BUBA 1U3YA 3K71A 2I25N 3P73A 4X80L 3VGBA 2FHBA 3IWUA 4M29A 4MAUL 5IIEB 2JK5A 4O2EA 2XKNA 4F7EA 1EMTL 3BEWA 5HI5C 4HJ0C 4V1DD 5DA0B 4ONFL 4NZUL 5D7IE 3OAZH 2LTQB 2OMUA 4L4VE 2HFGH 3QXAA 3BD3A 4MLIA 4NQSB 3CPUA 2IPKA 3CSGA 4XE5B 4ZUTB 1IC4H 1Y0LA 3SO5A 1F4YL 1OY3B 4KKCC 3F05A 4P5RA 3L48A 3FQXB 4PS8A 1JPSH 1R75A 2EXSA 1B4JL 1EH9A 2Z0UA 3G5YB 4HUXA 1S7RA 5CWSA 1ASQA 1KOAA 2EDFA 5SV3A 4LCIL 4R7XA 3ZU8A 2XKUA 3WHE1 2XKSA 4NM8H 1SJHB 4EE2A 4QXGH 1QSFB 1IFHH 2WXLA 3CD4A 4JO8A 3N3EA 1VKXB 5HDBF 2V5RA 3SDXB 4OD3L 2B2XL 1ULVA 5D7EA 3VDAA 4UQDA 3KYKL 1WBZA 3BO8B 4DERA 1TITA 1ZDQA 2ADGA 2P28B 3QHZH 4LARL 1BW8A 2ITCA 1IVLA 5TDNA 5FM8A 2J1WA 5HGAB 2ICWJ 3AGWA 1DVFC 1RI8A 2EC9T 3ARXA 3BCFA 4K2UH 4PWGA 4TVPD 3TTSA 4N2DA 2HVKA 3G5XB 5HYSG 1ZVYA 3DX6A 4UNVA 1QO3A 3L81A 3R18A 4XCYA 1EAJA 3L5XH 1C5BL 1UXSB 4L5FH 3SDCD 4JE4B 5DMIH 4FJZA 4BHUI 3PWUA 3OQRA 2B08A 3PXJA 4TVSa 4J1UB 4U1SA 4PRPE 2YS4A 3H4FA 1IKFH 5D1ZC 2Z7UA 2PXYB 3L8QA 3D33A 3CN4A 2VISA 2J7LA 1OM9A 4R7DA 4X9YA 5E99H 1TEFA 5GRYA 1NCUA 1JF1A 3COOA 1C5CH 1VFMA 1LNUA 3FO9B 5DHXB 4TLUA 4NT6B 2J8HA 3T4YA 3E38A 1ZA3A 5I17A 1ZHBB 4I2XE 5E9DD 1QFUH 4M6MH 1F41A 1JWUB 2WBJA 3RDTC 4LVEA 3WYRA 3ZE2E 1LMIA 3OLEA 3UCQA 1JPSL 1MZZA 3IKKA 1AOZA 1DHKA 4OGXL 1UFGA 3IDIA 1CI3M 2HPTA 3QHTC 3OLGA 1CZ8L 4WW1A 4XP4H 4YXHH 1EUTA 1XIWB 5LN8A 5AAPA 1CICC 4JPWL 3BP7B 4B97A 3TCXA 1I8LA 2BS71 3QIWB 5JHBA 1S9WA 3P4NB 3PG2A 4C55A 4L8BB 3QO1B 4Z7IA 2GITA 4G1EA 3EG9B 1A6PA 2X10A 2CXGA 4MSWA 1KDJA 4AOFA 5B7MA 1SF5A 4MCYA 3UAJC 2F7PA 2PCXA 4FFZA 2YQ3A 4FP8L 4XMZA 2VW7A 2VMFA 2X28A 2VC2H 5IW6A 3AROA 3AM8A 5I73C 3UBXB 2K3HA 4KY1H 1QMUA 3EDFA 2XDHA 4GKOA 3EO9L 5HHPB 4AXWB 4KX8A 4WNJA 1U8PB 1HINH 1XIWD 4Z7QB 2YC1A 2D2OA 4JFOB 3HMWH 3TBYA 4PREB 3B37A 4H5SB 4I18C 4XPHH 4BDVB 5IM7B 3S8GB 4NO3A 1KV3A 3REWA 4YE4L 1RUQH 5IVXB 4JDZA 2FT8A 1UJ3A 1JMZA 1MHPH 3R8QA 4WUKH 3MV9B 12E8L 3H3BC 1GS6X 4LK4A 3GEWB 4LEBA 3JWOH 4PW3A 3Q6GH 3T2NL 3DV4A 4ENZA 5A7EA 3DX0A 3WIHH 4FF9A 5BUGA 3WCYA 1RIUL 3QS3A 1A3RH 4Q6IC 5E8NA 3RTQD 4D0BB 3MV7D 3T0EC 5GS1C 5T3ZE 3WDJA 3BPOB 4YHZH 2VCOA 5FA4A 1NINA 4MLSA 2J6WA 5J3HD 1IJNA 2W1NA 3KXFA 4RIRB 1MRCH 3QRFM 5T1MB 3EH1A 3NTCL 4Y5VA 2WKOF 1OXYA 1LO2L 3JSSA 3L3DA 3SIKA 3DNKA 4L9LB 4U7MA 4TVPH 5A6IA 3SDDB 4ZD3L 3FN0H 1QI3A 4M6OH 4XN1A 3S9DB 3ARFC 2WQRA 2YA1A 1SDDA 5D1XB 3RY5A 3UO1H 4EN2A 5IJVA 2OL3B 5F7WC 3GB7B 3RNQA 2W0FB 2Y7MA 5EU5A 1HJBC 1NCOA 1T5KA 3OMIB 2UY7A 5DUBB 2MCMA 1S9YB 5CGYD 4OCWH 4JRYD 1CE6B 4LL9A 4WO4D 3Q6FB 1XCXA 3ZKNC 3V7MA 4P9ML 4PGBB 4PV9A 2PO6A 1CDHA 4URTB 2HRPH 4UANA 5C0DB 2NY4C 5T1LB 4NI6A 3RI5F 1NA8A 1JZ8A 4K3HA 3L1FA 2ODHA 2FE0A 4NKIH 4MJHA 5D7SH 5IV2B 4LQFL 2WXIA 5A2CA 2VLLB 2DD8H 1DANU 3SD2A 1AD9A 5CZVH 5ECJE 1E7VA 5E1HB 2CUHA 1MH5B 5FUCC 3WTYA 2ZE0A 1CFNB 4OZIE 1R3JA 3MLZL 4ZPVA 4BJLA 1UENA 3TNMA 3F6LA 3AY4C 1DUZA 1IC5H 1CI5A 3LXBA 3RDTB 1TZHB 2C4XA 1F8TH 3RVXD 4HA1A 5ISZA 3N40P 4DZ8B 1G6RH 1X7TA 5F21B 1KV7A 1JIBA 2FX9H 1LVEA 5L4MA 5AOKA 4TSBH 4BH7A 2XYCA 4V11A 3VB8A 2NR6D 3QCTH 3OMNB 5H4ZA 1AXSB 1XGTB 4FQXC 5CCKL 4LAQL 1ZKAA 1T4KB 4KC3B 5DJ0B 4GAAA 4EUPG 5EN2A 4MYPA 3V6FB 3IGLA 1M2VB 1BYNA 4JZOB 2ZT9C 5BS0D 5I26A 4J8RB 1ILSA 4HFUH 3UIYA 3DK0A 4Z7WF 4OZIB 4FXGB 1N26A 2JKWA 3NH7L 4PRDA 3H2PA 3ARBA 3VFPA 1U8HB 4S1DD 2EH7H 5CCGE 5KYNA 4L3CA 2WXQA 1G7HA 1VADA 3TH4T 3FRPG 1MJJA 5JORA 3NJVA 5JHMA 5DD3H 5LDSA 4U1KA 2XTJC 4G8EA 3M86A 3S7GA 1PG7L 4Z5RB 4UUJA 5ESAB 1X3DA 2JIXA 4NLHA 1I1CA 4OZGF 5FM5M 4HJGA 1BFTA 1FAIL 2J5LB 3FAWA 1U33A 5JXED 4ZTPL 1Y6MR 2ZOLB 3IFOB 1AGFB 1A4KB 5DD6A 4OCSH 5D1ZI 1JSYA 3W1ZA 3MR9A 3EYOB 1AFVL 4NNXB 4PTTA 5FO8A 3AREC 1HCYA 3ESOA 4LSVL 4BRJA 2Q10A 1DJYA 4ZFOA 2D31A 2E59A 2J8UE 1HAUA 4UI2A 1HQRA 2MHAA 1BLNB 3RY6C 4PMFA 2Y22A 3P9MA 3RTQA 1RPQA 4CN4A 1RUPL 1JTOA 1QUNB 2HZHA 3WS6C 2WN2A 1BVOA 2D7PA 3KHQA 3UACA 1E9OA 4YDKH 4AEHL 1UT9A 5F7AA 1FIGH 4QEGA 1IM3A 5B1CA 3MLTA 1T0MB 1UC6A 4M9PA 3RX7A 3OMAB 3DOHA 4OD1H 4M56A 4ELMA 4E9LA 1UEYA 1HYRC 1SHSA 1FZMB 3ASOB 4FLQA 4DGYL 3HB3D 2F15A 4FFYH 4JLRB 5L6YH 1ZSHA 4NAMA 3GSXB 2X4RA 4G6FB 1U8KB 4KJWC 4UAOB 2Y7SA 2UUDK 4OTXH 4CC4C 4S2SA 1U3JA 2XUWA 4BFFA 4UOW1 3O8XC 5DMGC 5C3TA 1UWXH 1E65A 2PTTB 2WXPA 5EF1A 1LTXA 3ZT5A 3MSPA 4GRLA 3HNSH 4X6CE 3HG1B 3TVMC 2JCCB 3AUWB 4IS6B 1M53A 5AW5B 4DO4A 1C5DA 3ULUE 3TL5A 5JUEL 5CSBA 5EC1A 4FABL 5IMKB 3UBXI 3CDZB 4Y5YB 3DUSB 1AO7A 3L3JB 1IX2A 3LN4B 4DPBX 5K1NA 3K6NA 3K7UA 4PVMA 3S96A 5JR1L 1AO7E 2CK0L 2B3IA 1R19A 5EFIB 2WZ6A 1LO5B 1R6VA 2GK0A 2Y1ZA 1B6DA 4NQCE 5DRXA 2IOMA 1Q94A 1WT5A 3BWUF 5FYJE 3MRKA 2H32A 5IQ9B 3H3PL 1Q9KA 2WINA 1MI5A 4KK8C 4MZ2A 5D5ME 3FO0L 2A73A 3LAFA 1AYOA 1BZDA 3OAWA 4XMPH 4AGQA 5J9PB 4QRUB 1XH0A 2OW6A 2ZCKH 3ET9F 4KPHH 3TJHC 4ZMVA 2VE6A 2ARJQ 4RDQG 3T3MB 1NBZA 5AAWC 5AYTA 4FYTA 1ACCA 4ZO8A 3BPNB 3VFWB 3ALXA 4GAGL 3WXVL 3MDJA 3F04A 2BNRD 3B2MA 4UZGA 1WWAX 3FO2B 5I5MA 3LXUX 2R29A 2IH3A 3KBPA 4ETQA 3DRTB 1NCGA 2NY3B 1JDDA 1XGQB 2JB6A 3MBWB 2F58H 2DQHL 3HNTH 2E9GA 1URLA 4WWID 4AV5A 1CICB 2VM4A 4OIIL 2GB2A 3CZSA 3MV8B 2G2NA 5IQ7H 1OWRM 4HXBH 4M8QA 1T0OA 3G08B 4HMCA 3AS0A 1GGIL 1GMIA 4TVUA 4V1DE 2ZNXA 1YG9A 3QXTA 5JHAA 1UXWA 3KPSD 4LCCA 1QPXA 2YFNA 5DVMA 3NIGB 3QH3B 3ULUH 3QRGL 4GINA 1QPKA 3BVUA 1RHHB 4HWZB 4KHTL 1TETH 3ESMA 4X7TB 3NCYS 1I7TB 3NJFA 4WUUD 3KCWA 5T8IA 5AVQB 3VE0A 2R1XA 5EBMB 3VFRA 1P4BH 1AIZA 3OKMA 5FFOA 1RV6X 1ZTXE 2FZ3A 1TIUA 3U6XA 3UYRH 3HVDA 2DWTA 3ILQC 2WYZA 1KBPA 1KGUA 4I9WE 3UG3A 4R3SA 2O61B 1M3IA 1IILE 1NC4D 5I73B 5AOZA 3PL6D 3FCSA 1IGJA 3LN5B 3GO1H 3RURA 5INCB 1NDMB 4FABH 3EJRA 3IGAB 3FU0A 5KJ4A 3KPSA 3FNKA 4AJ0A 5I0DA 4XCCL 3OPZL 2FR4B 2FSEB 4KXCA 1EXUB 1WPCA 3EBAA 3FUKA 4P2OB 3UJIL 1RH8A 4DESA 5HDWA 4NZFA 4JCMA 3MFFB 5EHFA 5C7ZA 3ARQA 1G6RB 3NGBC 3IJHA 1D2OA 1H3UA 2MOVA 3AB0C 2BLFA 5DZAA 3KLDA 3MC0A 2BNRB 4TTGA 4OQTL 2XQYA 3ZDXF 2HH0L 2ESVA 5K1VA 1MFCH 4RISL 4ODBD 4M5SA 2DMGA 5F9DC 4BRVA 3ARDB 2AMGA 2R1YA 3B6SB 1T89A 3BGMB 3IXAB 4FQJL 2OULB 2G4EA 2VIRB 4X5LA 1FNEA 1NCBL 5D4HA 4JL2A 3L6FA 1Q0YH 4PRAB 1A1MA 1C12A 4KJWD 4MDRA 3CHSA 3IDYC 4L8SA 3CC5B 2X42A 2HP4A 2VM3A 5DHYB 1DEEB 1F4YH 2ZX9A 1EFXA 4LKXB 1DSFH 1J8HD 2MKLC 3LKSA 2PPCA 2IDTA 2P80A 3X1EA 4XHJC 1AAJA 2OZ4L 3V2AR 1MLCA 4XNDA 4K8RC 5KW9H 4HFWB 4WHTB 3BUIA 3SE4C 3T08A 1YJDC 2P42B 1T4WA 2E7CA 1JGEA 5GZNA 4ODTH 2WQSA 5HDLA 2GBVA 1BD2E 4JFUA 3T0BA 2W9DH 4YJZL 4NENA 3QDJE 5EPMA 3TO4A 4A6YA 3UAEA 5DJ6B 3Q1SL 1FAIH 2R4SL 2EDLA 2X4QA 5F7FA 4NO5A 2CSPA 3MKKA 2R27A 1HWHB 2H6UA 1TZIB 4H1LA 2FQDA 2NLJA 3O3DB 1BF5A 1G1YA 2FEDD 4Z23A 3NAAH 4WHCA 4WY7L 5E2TH 1DYZA 4AJVA 2YPLA 1UM5H 3HUJE 1YMHB 3ATEA 5EZPA 1ZVHA 4MFHA 4N90E 3Q5TA 3ZTEA 2KBGA 2ZQKA 3MGTB 2Y9RT 3UTOA 3VDCA 4KVCH 1ZSDB 2IXQA 5LNGA 5IVXF 5E8EB 1SUHA 3ZR5A 1YNLL 4XBGA 4DVRL 1CT8A 1A6TB 3GHBH 4ODVL 5D7JA 5EZLB 5CEXB 3MO1A 3SGKA 4OF8A 3QPXH 2AABH 3HZYA 7PCYA 1XF2A 3QFJD 1BP3B 3SPCA 4ZMPA 4UILH 3T65A 1KB3A 1OIOA 3GMQA 2LGNA 5DDHB 5FO2A 1S3RA 3BVNB 3T6QC 2CBOA 4LSDA 4KKPA 1GC1H 4AEHH 1JCVA 4Y4HB 4P3DA 1ZLUH 3ECVA 1HZKA 2JKXA 4KROC 5DI8B 1E9PB 5GGSY 1GOFA 4I89A 2FT7A 4CN6A 5LAPA 1JP5A 5I9QB 3ZKXB 4X4ZA 3W5MA 5D5MA 2UWEB 3T3ME 3WNNA 5DJ2A 3VXUD 1EJOL 4FQHA 2IH8A 5I1DA 2A74A 1CFTA 1FI8C 1BQHB 4D8PA 5L2KA 1DN2A 3IDXL 2OMTA 5E0QA 1INDL 1KCSH 3BQUB 3MRIB 2H32H 1RJYB 5FOJA 5I2IA 4PJAA 3MU3A 5C09E 4G3YH 2VSDA 3SPVA 2FJHB 3GC3A 4GW5A 5C0CA 4MDJB 1NAML 3B9KA 1FQ9C 4NRZA 4XN5A 5IT2H 1X9RA 3FB6B 1CF1A 1DANT 1ETB1 5GJSH 2PWGA 4N8CH 1NL0H 1LQBC 3DX1A 4P57A 5DLLA 3WENA 1XL4A 4M43H 1FSKB 1JXGA 3ZGIA 1S7TB 4JN2A 3ATAA 4H1LH 3HC0A 1FRGL 4NQDA 4YDZA 4Q4IA 2E86A 3QIBC 4TNVK 5F3FA 1MEXH 1UM5L 5CGYC 2EUZA 4IGBA 1XT5A 4TQIA 4PGDB 5K9JH 2UX6A 4IKKA 4P99A 3S4SG 1KLGB 5I5IA 3U9WA 2EDTA 3UZVA 2GBUA 1A22B 4OF6A 4ZMQA 5A43C 5IMMA 3MXVH 1G9NL 3GSRA 4KMQA 2WTRB 3IFNH 4CKQA 1MCNA 1JVOA 1VFUA 4IRJD 3QS2A 4POYA 3HE7C 1KCKA 4PJBA 5TGBB 3EO1A 2AQ3A 2ZG3A 3FUFA 3T0VA 1UTDA 5TDOA 1Y1DA 3BUQA 4TLSA 1QA9B 2Z3FA 4WI2A 1G7PB 2YAFA 3K72B 4K73A 4QLWA 3B7RL 3FZUD 3O3EB 5ACMA 2V2TB 1YEDA 2QVKA 1NWPA 4Y2OA 1EZUA 2CUIA 4FFTA 3LQAL 2X4SA 1WBXA 3FT3B 4WUUB 4ZDHA 1N5YH 2APWA 3AG4B 3CSFA 3QK0A 2DD8L 4S0SD 2YMOA 2VWEC 5DC9B 3SYPA 3VRJA 4XC3H 4FQJH 4DGIL 3P4LA 3POHA 2X9ZA 3JUZA 2E6PA 4YLBA 4TMPA 3NCEB 4HAGA 4BFEA 1DSYA 1MQKH 3WFHB 3O2WH 1KGIA 3MX0B 3ZZSA 5EF2A 1RJLB 1KYFA 1D6EB 3SDDD 1IGML 3QISA 1ACYH 4EOWH 5F7EL 1G5GA 1MCOH 1AYRA 5B22A 1U6AH 5IVOA 2GTZB 3DYMA 2FX7L 1EBPA 2IFFL 4JM0A 5JPMB 4F33B 1DQML 4HF5L 4KK8D 1G87A 1SYSB 4PJDB 1L7TL 4ZXBD 3HE6A 3MV7A 1PKQA 2CDFB 1WEJL 4O4YL 2QSCL 2OR8A 4RGND 1NGPH 2JWYA 4P2OC 4U1NB 5DEGA 5IB1A 1LDSA 4AQ1A 4HOXA 1LEGB 4ZO6A 5CD5C 2EKJA 2JQZA 2BC4A 3WO4C 3DBXB 3A4DA 4GMSL 4PIBA 2VLJB 3WD5H 2WXOA 5IROC 1QVOB 3RGVB 3DO7B 3BZ4A 4F7PA 4K94C 2Y69B 1LP9B 3TVMD 1MW0A 4FLRA 2OJZL 3PDDA 5DMGD 3NP3A 1AGBA 4HKBA 2OXGA 5GHWH 2H3XC 2EDJA 4MYWB 2WGNB 4LL1A 3NJMA 3FUIA 4U1JA 2FHCA 1N59B 1JI2A 1FL3B 2LE9A 3HR5A 4M8RA 3UMNA 4IBZA 4K7PL 1COBA 4LCWB 5DEFB 1LM8V 3S35L 4KY1L 4LVHC 3QP3A 3MLXL 1WD9A 4HXBL 5T3ZH 2CM5A 1O7DC 2DYPB 3CFCL 3QORB 3VFSB 1SOQA 1UADC 4HIEA 4MQ7B 3X13A 2X89A 5DMYA 5KBKA 1EHNA 5CGTA 1X5JA 3EOBA 3NCXA 4R4FL 5ESVA 1TVHA 3WEXA 4R7NB 4WU7A 4DAGH 1KLFB 4F2FA 4K3EL 5FF6A 4KO7A 4N2EA 3STZA 3BAEL 1S7XB 3B2VH 2EEBA 3OX8B 4YH6A 5AENA 4NBZB 1VZIA 2ICWA 3KGRA 4F9LA 5KSBB 2W92A 4B9CA 3ENEA 1DJWA 4GAGH 2ENYA 3FUEA 4PJIF 3ARGC 1QLFA 2CMRL 2PO6C 1W91A 3DMMB 3HRZC 1B4JH 3IGUA 2Y06H 2P9RA 4DP7X 4Y19B 4RMWA 3ULVL 4JFPB 3AU1A 4RFOH 2X4TA 4D94A 1QACA 1PSKH 3HS0A 3NJJA 1KACB 2HFGL 3VWJA 3HE6D 1IEAB 2GBAA 2YN5A 4PS3A 5FYKH 3PJLA 1I7ZB 4CN1A 4LPYA 3MNZA 1LE9A 1VHPA 1WIOA 2N4IA 1GHFH 5IHHA 4BK5A 2GSIA 1PD1A 1OAZH 3LV3A 2XTJD 3JTBA 4PJAF 4YSEA 1MPAH 3H9HB 4R84A 2RR3A 1G7QA 4XPTH 4NSKA 3N1GC 3O6FD 4LGRB 1U3HD 3TH2T 4HKZA 2B20A 3FQRA 3KLQA 4QXUL 2J8UA 3W57A 2Z8RA 3BKYH 3MCLL 2D3JA 4TNEA 1P1VA 3P3TA 1EGJH 1UZGA 4GSUA 1HL4A 3F7PC 1RU9H 4FQLL 1JWMA 2Y7OA 4H0IA 4HKJA 2GABA 3HLAB 2IMMA 2WVVB 5D1ZB 1QFOA 5BUPA 2J5LC 4OZHF 1CL7L 1T1WB 3MGAA 1T0NA 2B5IB 3MRRA 2E46A 3ZT7A 2OJZH 1E6OH 2Z93B 1BQKA 4B96A 1A4JB 3VRIB 4DEWA 1HI6A 3T77A 3DTUB 4UINL 4AQOA 3ZHKA 2AXHA 4ZZKA 4G43B 1AP2A 4ELKA 1A6AA 3MCYA 2P24B 4RGOH 4CADB 1A64A 4UQBA 4XWGH 3NZHL 4H8VA 2ZYRA 4G9FA 5IEKB 5LAXB 5EA0H 3C60B 5KYYB 4F2MA 4LL4A 1HC1A 4HUKB 5I1LA 1SN0A 4RFNC 3WNJA 1CFMA 4TULL 2QSCH 3NIDB 3D7PA 4DPAX 3V52L 5EU6D 1JF6A 1G7IA 4TSAL 1PYWB 5DSCB 1SHWA 4ODHL 1DQMH 4HF5H 5F0MB 4QJ4B 2WSKA 2D7TL 3GI8H 2HT2D 3PWPD 4WEBH 1T5XB 1U2YA 4ZUWB 2A9BA 4XMXA 5DFAA 1B90A 1QSEA 2CR0A 1BEXA 1EFXD 5IT2L 4GW4A 3VXRE 4G7QB 3KEDA 1XGPB 2NTFB 3DVNB 4NYLB 1A6WH 4HPOL 3K6SA 3IDJA 1JK9A 5D93C 3DRQB 2IGFL 5JIIA 2QPDB 4OQ1A 2NUTB 1INDH 1KCSL 1FYTB 4Z1PA 1XTMA 2CJUL 1HHGB 2EYRA 4PV8B 5LVEA 3AXIA 3V6BR 4OGZA 5TPWL 4XMTA 3EYFB 3JT0A 2VZSA 4PCTA 3FPYA 4JM2C 2FO1A 1UHVA 1IEBA 5DD3L 2W07B 5AEAA 1MXDA 3MYZA 3GRWH 3UG5A 1T83A 1UWEL 4I18A 3FUJA 2VO8A 1H8OA 5FWQA 1Q9WB 5F7BA 4AGOA 2WLNA 4IBYA 2C7UA 4L2YA 1UCBH 3U6RA 2YKLL 3Q2CA 2GCYB 2IOIA 5A16A 1R5IB 4XCFL 4JHBA 7TAAA 4QYAA 1DZ0A 4BFIB 3RGVC 5JQ6L 1KTDA 3D06A 2GC4C 3I02A 3VSUA 4BZ1A 3T0ED 3PAZA 5JHDE 3L1OL 4Y4FB 2XX0A 1Y18B 1IAOB 1XQ4A 1YECL 2Y1VA 2RCSL 1G43A 3VFUB 2IBZX 1NIFA 1R3LB 5DZOA 1MCCA 3HCVA 5AAMA 4I48A 5F6IB 4FKKA 4YDVA 3GPSA 4KNSA 1RY7B 1UH2A 2WWMD 5FK9A 3DKHA 1JD7A 2R0LL 4XNQA 2P26A 5KUMA 4N2FA 5CINH 4MDIA 1IAIM 4Z18A 3L1EA 4QXWA 5DQ9A 5EG6C 4B9IA 3D25B 5IJKA 1ADQA 5G55A 5I19L 1JZEA 1B88A 3DX8A 3QARA 5JIMA 2NXZB 2V7NA 3NZUA 1IMHC 3KH3A 3IPBA 1A25A 3QEHB 1UZ6E 1PDKB 2VTFA 5C0ND 1OW0C 1TVBB 3PWJA 1U8JA 3RL2A 2MPVA 3EYSL 2ICEA 5DWPA 3QUYA 4LNRA 3ROOA 1Y6KR 1TUPA 4I3SH 3OD3A 4PRHD 2QQLH 2MFNA 4G8IB 1FVEB 2Y7NA 5KSAD 3WDIA 3IDXH 1CICD 3IJ9A 3GMMA 5AFAA 1LK2A 3D9AL 4OUUA 2DF3A 4PJBE 4W4OA 5D2NE 4PI0A 1IBZA 5T1KB 4IU3B 2H3NA 2V6HA 2N1KA 1EJOH 4KJYB 3A22A 1GGBH 2CM6A 3UG4A 1A2YB 1NGXA 4RX4A 1T66C 2F74A 1TFPA 1XCTB 1IZKA 1GL4B 3ABZA 1YEIL 2CO1A 3US1A 4UT6A 3QCVH 4N6QA 4UV4H 4F7CA 5F0PB 4IMLB 4BK4A 4AQAB 2OI9B 3SYOA 3AABA 1JXJA 4M5TA 1QNZH 1TEGA 3PWLA 4O02H 4IBUA 4P46B 3DXAE 5B3NA 3MRCB 2YK1L 3JWNH 4WI7A 1A02N 2VZUA 1SUJA 5CBAB 4GSQA 4U1HA 4JRXB 2ED9A 3F5WB 4NUJA 5HYFA 4AYEC 1XCWA 3X3GH 3R19A 1QD0A 4K23H 4JRXE 3HG3A 3IMUA 4Z7WB 4OZIF 4DK5A 1X7QA 2H8PA 2YD9A 3P9WB 5EBLB 1X9UA 5EOTB 4JAMB 2C9UA 3OKLB 1A7PL 1XB8A 1S7VA 3Q8CA 1I9RH 2LT9A 1T89C 3RG1C 4GG6F 1O9ZA 4LKCB 3BISA 1I8UA 2VN6A 5D70L 3H9SB 3SQRA 4GP4B 2F68X 3H7BA 3SOBH 4B27A 1TZAA 1U8OB 1HYSD 5ANME 1ZT7A 5IF0B 4YXKH 1WK0A 1HIML 3WFBL 1KIPA 1UACH 3MRNA 1X5IA 3QUHA 3IETA 2KLTA 1RP8A 5HGDB 2XV6B 3SYCA 1AZCA 1NGWA 4E41D 3UPRA 4RA0C 4L2LA 5EF0A 5L9DL 5C0RL 3WY1A 1PQZB 5HHXL 2RQEA 4BZ1L 3MCLH 4J27A 2CUMA 5BRZA 5BUAA 4U0RC 4GUOA 5INDB 2LAGB 3O0RH 1YEEL 4HEMA 3KBHE 4FMKA 1HS6A 3TZVC 3GGWB 4KXZI 5DK0A 4KNTA 1INQB 4DTGH 1ADWA 3H53A 3BDYH 3ULAB 1HTYA 1YNTA 3GFUA 4UMGA 2JCWA 1MAML 2CO7A 2ORBH 1N3NB 3UTQA 1RURH 1HKLH 1T1YA 1ZT1A 4R8WL 4ANUA 4ZW5A 1GY2A 4EI6A 4F2EA 1BQSA 3QB7C 4IU2B 2BVPA 3D85B 4UM8B 1NCAH 1HH9B 3I3DA 4QHKI 1A3ZA 4X4KA 3QIBB 2JCCE 1XL6A 4MHHG 4PGZA 1KPUB 5IW1A 1YEFL 3MCKA 4POZD 5E1AB 4P5KB 5B8CA 1KB5B 3BAKA 5EH1A 5HI5D 1ZAGA 1XH2A 4BKLB 3V79C 1BAGA 1FVCA 4QRTB 5DYOB 3QQ9D 3SQOL 2NY6B 3C8KA 3LVEA 3O0LA 4TNFA 2CDGB 2E7LC 2AV1A 1K2DB 1X9LA 4A7GF 4DHLA 2HKHH 2XY1A 1A7NL 1NM9A 1GS7A 3AMKA 3GSVB 2VJ8A 4BGDA 1CVSC 4NQCB 5KTEH 1K3ZA 3D0VB 4IRSB 4IRZL 3NZ8B 4X5WB 3SZKC 2VAJA 3VAEA 1K9TA 2TAAA 2QKIC 2WWNA 3SQOH 1S7UB 3RHWK 1BHGA 4UT7H 2E8YA 3APMA 1PX3A 1NCHA 2B15A 3BAIA 4H20L 1RZJL 4UT6L 3ZTNL 4FS0A 2OL3H 2QPFA 3QEQB 4CBPA 1FG2B 1AS8A 1YEGL 3B43A 4KTDH 5AKSA 3CG8A 4J39A 4GP5B 3D2TA 4PBDA 5JYMA 2DIEA 3FF7A 3FU9A 4O51A 4ZMYA 2BY2A 3ABMB 3DBSA 3QJOA 1HKLL 4R8WH 3IGKA 3RP1A 4MCZA 4WI8A 1XCQA 2VXSL 5DEZA 1AKJB 5LBSA 1FYTD 5JR1H 4AIXA 3I2CL 1GA2A 5IFJB 1RVFH 4UTBH 4LDLB 1PZDA 1RL1A 5FYKU 2WXRA 1FZKA 3N42F 1WAAF 1J11A 4GNKB 5C09B 4B5ZA 5I0WA 3VXUA 3TO4D 3F7KA 5HHMB 4CVXA 3PWPB 1KC5L 1BJ1J 1FO0H 3SKOB 1NC2A 3FTSA 4U2ZA 4NZTH 1PNCA 1W6WA 3QUMB 4FD0A 2L7QA 4V1DB 5ESQA 2XV2A 4MD5A 4DN3H 4HZ1A 4X99A 5BNXD 3ZJAA 2D3VA 3BP4A 4UOJA 3NDYE 2WMPB 4A2GA 3UJTL 3QUZA 2BP0A 3FB7A 5D7HA 5J4MA 2WOYA 1PLBA 1MFAH 5E2WH 4X5PA 3UJJH 2QGEA 2DL9A 5D6DC 2H1XA 1CFSB 3CHPA 1NAKL 3WNLA 2CGRL 1F58L 3NFNA 2YPKA 5DZ9A 2K3TA 1ETZA 1GGTA 1KBVA 1U58B 1SMOA 2VMDA 2ODIA 3S5LA 1AKJD 5KANI 1MQKL 2EEAA 3ASWA 2Q20A 3NGBB 4CC4A 4FYQA 2CO6B 2WO4A 5BVPH 1E4HA 3F12B 3WXVH 1M9WA 2VL4A 5J6GA 1PZCA 1RZJC 4LIQE 1BM3H 3MN8A 4UB0H 4HWBH 5HYIA 2C7FA 4K55A 1TQTA 4XXDB 3P54A 3GHEL 4YZFF 5K1JA 5DGQA 2AQTA 2AJ3B 1UWXK 4JKMA 1FFOA 2BOCA 5GGRA 1DVYA 2ICES 1VPOL 3HRPA 5F7UA 5CKGA 2BVEA 4C54A 3W11C 2VRKA 2A77H 1G9EA 3NCWA 3AAZB 1Z9SA 2F7RA 4BCZA 3QFJE 4G6AC 2AJVH 5D1QE 3EHBC 4B0MM 4PLKC 1UOVA 4FFZH 4NKDB 4JRLA 2DEWX 4FJ6A 4NZ8A 2ZCHH 1INEL 1CFQB 2V8LA 4QXTA 2AQQA 4KUZL 2EADA 1AGEB 1JVKA 3TYFA 4XWOD 3DVGA 5FYKD 1U8IA 2XOTA 5C0BD 1UM4L 4U1IB 2XRAL 4RMRA 4G6ML 4OF5A 1OE1A 3FQNB 5E6RB 4BZYA 3GMOA 5HI3D 4DOHE 4IJTA 3HNSL 4ODWB 1XWVA 2AEOA 5DJZA 3OAYK 4WZ9A 4FULA 5ISZE 4PRBB 2DJUA 2DJSA 1UYWH 3QQ4A 2WXMA 1S4IA 1N8ZA 1BVLB 3L9YA 5MEPA 1QATA 2DWEB 2CZNA 2LR4A 3UTTA 1DJXA 3FYEB 2FX8L 2NQ3A 4JHAL 1T21B 1A5FL 3EJTA 4U33A 3FSZA 1E4XH 5SWZD 4KJPC 2MTPA 2FBJH 4HK0B 4FI7A 4KZ0A 1TZGH 1ANUA 2DYPD 5C07E 1Z5LB 4Z7VB 2CXKA 5D1XC 2X44D 1GGCH 3GZPA 5CBEB 3ZDWA 4DSYA 4CC0A 2GI7A 3LPOA 1OB0A 3PDGA 5DFTA 4YO0A 4NN7C 1JXDA 3GKWH 5FYLH 3O45B 1JAEA 4NC2B 4PJGE 2IGTA 4PBXA 2F53B 4QRQA 2NW3A 3UDWC 3TONA 5C92A 1C16B 2Y6TE 3BD5A 4FX5A 3SCMC 4EXKA 2YQBA 2OMYB 4J3OF 4YN3A 4YFDB 5EO9A 2NXYD 3GKWL 3U46A 2AI0H 3OPUA 5GXBB 1ACXA 4IDJL 4B9KC 5IHZA 1L9QA 3BAXA 3Q8BA 3RGVD 4G8GD 5DCCA 3ZX1A 5KSBF 1F4WH 1IC1A 1L7IH 1FNGA 4KDTC 4GI8A 4MQTB 1TJHH 4N86A 2QSTA 1TCRA 3B2DC 2FGWH 1DFXA 4S1SH 5BW7C 4ABVA 2DQUH 3L3HA 4MMXB 4R0LB 1Q9LB 4Z76A 4PYHA 2YD4A 2WIIB 3MRQA 5GIRB 4F27A 4JHAH 3LKNB 5D7LB 3CMGA 4APQB 4F20A 4Z3FA 4O5LL 4NUMA 5L2JA 3VI3F 1M71B 2J1YA 2ITDA 4M7KL 4NPYB 4LSQL 4PP2A 1WFOA 2Z6FA 2ITEA 3ULUC 3CVIH 1OCCB 1URZA 1JNNH 1UZ8A 4F7MB 1MNUH 2EE0A 5FDWA 4PJCB 4YNYB 4DVBA 2BVOA 2E7BA 3DIFB 3KM1A 4OM1H 4GRLD 1VFBA 2W0LA 1I82A 2P7TB 1BQLH 3B9AA 5HVHB 1IQDA 5CSZA 4MAYC 1NMCB 1F00I 5JHDD 3MRLA 4A39A 1U36A 4NHUB 4PG9B 2X7LA 4W9LC 2DIJA 1V3JA 4ANWA 1WTGT 2Z91A 4LDEB 4FFZL 3S5LG 4FEIA 2X4PB 4M48H 4TTDD 5E2UL 3GNML 5EU6E 3J7HA 3T71A 4NUPA 1D5ZB 3CHOA 4MNQA 1ES0A 3EIFA 3AREB 2ED8A 1N6QL 3IAQA 1NAMA 4KVPA 1S8DA 5J13B 3E6FA 3VFTA 4L0YA 3LKOA 2XWTA 3QCUL 5KSVB 3LRHA 4EUPA 3FFCB 2PKDA 3HC3L 3OJDA 4Y88A 5C0FB 1WZMA 4FXKC 1KPVB 3VYOA 3BXNA 3NFPA 4PJDF 5D2LB 3SJVB 2AC0A 3BIBX 5ALBH 1SRDA 4KK5D 4X6DA 2J71A 3WHXA 3H9YA 1S9VB 3FUDA 5KS9A 1NDT