5EORL

Structure of the murine antibody fab 8e3 bound to the vaccinia virus a27 peptide 101-110
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
217
structure length
217
Chain Sequence
QLVLTQSSSASFSLGASAKLTCTLSSQHSTYTIDWYQQQPLKPPKYVMELRRDGSHNTGDGIPDRFSGSSSGADRYLSISNIQPEDEAIYICGVGDTIKEQFVYVFGGGTKVTVLGQPKSTPTLTVFPPSSEELKENKATLVCLISNFSPSGVTVAWKANGTPITQGVDTSNPTKEGNKFMASSFLHLTSDQWRSHNSFTCQVTHEGDTVEKSLSPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords anti vaccinia virus A27 antibody 8E3 heavy chain
publication title Linear Epitopes in Vaccinia Virus A27 Are Targets of Protective Antibodies Induced by Vaccination against Smallpox.
pubmed doi rcsb
total genus 52
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2015-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eorL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eorL01
4WI8A 3JWOH 3NMEA 4JFQA 1OSPH 35C8L 4N9GB 5T1DH 4EDWH 1R5VA 4TSAH 4RFOL 5FM4A 3V2AR 3GHBL 3ILQD 3MJ8B 2NXYB 2DLEA 5C7XH 1FJ1B 4FFYH 3DXAD 1JTOA 5E8PB 2BP3A 2CDEA 3G9VA 5A3IC 2DDQH 4HJJL 4XVUD 4JN2B 5C9KA 4KKLC 3LS5L 3BHBB 2NW2B 1MJ8H 2RIKA 3W0WA 3SDAA 1O5DT 1Z6JT 4FQ2H 4G9DB 4PJAF 3LB6D 1DBAL 3TPUB 5HHMD 5B22A 5J57B 4HZLA 1B3JA 3MXVL 1C1EH 4NUGL 1JNLL 4JHWL 3DVIA 2ARJQ 1PX3A 5BZWA 5E56A 4X80H 1U8KA 4ISVB 1HXYB 1EFQA 1G7IA 1MPAH 2XACC 4LLYB 3D69A 1UCBL 5DJ6A 1XCQB 4LDOB 5IGXH 4K7PX 1BFSA 2HVKA 3TO2B 1A21A 2ARJA 3SOBL 4HS6B 5HHNB 2K1MA 2AXJA 5EU3B 5IIEA 5T33H 4GKSB 4X9HA 4G6ML 2IGFH 2PYEA 2R1WA 1ZEAL 5K9JH 4UDUA 3Q6GH 4LNVA 2OL3A 3VXRA 4GMTL 2VQUA 4P4KD 4OAWA 5IW1B 1P69B 5E5MB 4NP4H 2IMNA 4I3GA 1CU4H 1NMCC 4MA8H 3T2NH 4ELME 5DVNA 1GC1C 1Q9LA 3U7YL 1UA6H 1QO3A 3FRPG 4KJQC 4DQOH 5I8CA 2AGJL 2LU4A 1HE7A 5D2NA 3VRLE 5IVXB 4I3RH 4GAYB 1AXTL 1I7RB 1EEZA 3DRTA 4ZD3L 1ODAA 2N7AA 5KSVA 2FJGA 1U58B 4PJIF 3C2SA 3KPRE 4MD5A 4H88H 1OD7A 12E8H 4Y5VC 5DXWA 1MQKH 3OKLA 5EU6B 4YHIB 4Z7UA 4JM4L 1MJUH 3GBMH 5EUOE 5GS1A 1CE6B 2CO7B 5JHDE 4XNMA 2FBJL 2IBZY 3TN0B 4PB0H 3BP6B 4DVRL 3CK0L 1Q8MA 1H3PH 3MV7B 3UBXG 3P2TA 5CEZL 1I8MA 4WDIA 3NFSL 4DGVL 2Z8WC 4IIQB 4YGAB 5LBSH 4V1DA 1M7XA 1Q1JH 3PWPB 4HCRA 2GK2A 2VO5A 1JGUL 4MS8C 5T1KA 1SJHB 1JF1A 1ACYH 1A1NA 5HI3D 3IFOA 1NUGA 3BO8A 1IEBB 3T2PA 3UMTA 4H0IA 1BVKA 1U3HA 2JF1A 5GS2D 1QHPA 4GRLB 3DHMA 4PJEF 4Y1AA 1S7VB 2JIXB 1KCLA 3BN9D 2R0KH 4H1LH 2P24A 2PW2A 3L3IB 4NWUH 3DROA 2VLKB 3QG7H 3JV4B 4KPHL 2Y23A 3O6FD 4KTDH 4PJ7A 4XPAH 2EYTA 5FCSH 3TIEB 4XCFL 4K23L 4WFHD 4HK0A 4HC1L 1BQUA 4MNQA 1Q0YL 1ZLVH 1LGVA 1T0MA 5GJTH 5GS0L 1MCKA 1GAFL 4HKXA 1OSZB 1U6AL 1QSFB 3E0GA 3GM8A 3BP5B 4TUJB 5A1AA 1UM5H 1ZSDB 2FJFA 4P46D 5FCUL 2YZ8A 3WFBH 1S7UA 4GRMA 3HRPA 2WLYA 3PIQA 3LOWA 2BHYA 1BJ1H 2N4IA 4ZUWA 5DURD 5FDWB 3TBTB 3RAJL 3ARVA 4PG9A 1GJIA 2P46B 4NRYA 2YSSA 1XGUB 2XKNB 5BO1H 2FGWL 1N2RA 3IFLL 5JLZB 3Q5OA 5F6HJ 5T3ZE 3AFLA 4PJGA 4GKOA 1AGEA 1WFNA 3RBGA 3MRIB 1JFQH 3V52L 5IHLB 3HI5H 4NNYA 4X6DE 2IMMA 4OSUH 2W9EL 2WQ8A 3L7FB 3LZFL 4PV8A 1GPOL 3OV6A 1IAOA 2EKJA 2NXYC 4G8GD 1AGDA 4HXBH 3WXVL 2EIEA 2UWEA 3KYKH 4UDTA 3GMQA 2HTKC 2BNRE 3GSRB 3OB0H 4H1LG 2NW3A 1TMCB 5E8NB 4XBPB 1JHLL 2AABL 3IGAB 1LDPH 1ZMYA 1KBGL 3KPNB 4L29A 4OLUH 4YWGH 1FNSL 5IB2A 3ZE2F 3AVEA 5BMFH 3QUKA 1LE9B 1MCWW 4C56A 4NQCD 4XP6L 1OHQA 3V6FA 1AR1D 5AWNL 4TOYL 5B38A 1TVDA 4WFED 1YJDC 2P5EE 3SGEI 5KVFH 4PJ8B 1T03H 1JGEA 4UAOC 2NY7L 5J9PA 1MRCL 4XP4L 4E42B 1QPXA 4PREA 5IK3B 2B1HH 4YBHA 2YRPA 3QUYB 2VZSA 3CFKA 3MBXH 2MHAA 2XZAL 4WO4A 3A67H 4QYOA 3D39B 3RTQD 1RHHA 4H8WC 2O5XL 5DJXA 3U0WH 3KPMA 4KY1L 4L9LC 3BEWB 5D96B 5ACMA 5CJXC 2VLRB 4J3UA 1DFBL 1EGJH 5KAQG 4XCNA 2H6PA 1KJVB 4MX7B 3T4AB 2QHLA 1UB5A 3OBAA 2B1AH 1V7ML 3DX8B 2VZOA 4GXUM 3ARBD 2V2XB 2OL3L 3W9DB 3UCRA 2EO9A 4QF1B 3OL2A 1MCPH 1D3CA 1TQCC 2GAZB 4KFZC 1HYSD 2HRPH 4UINH 1OPGL 2ESVE 3X17A 2CLRB 2YPLD 1MUJB 5SWSE 3VWJB 4OQTA 2ZUQB 1LK3L 1MHEB 5FYJL 1RMFL 1PQZA 2WAHA 3CH8A 1QRKA 1QLEL 2VABB 5E6ID 3BX7C 5CLWA 3BGFB 3V0VB 3QXWA 3IJSA 4M8QA 5FA4B 2DQCL 3PQYB 5C0CA 1K4DA 2QV2A 3EJYD 3LHPL 1I8LC 1IC7L 4R4FL 3TVMC 4YLQT 3NFNB 3MJ7A 3UC0L 4Y4KA 3M8OH 4ZMAT 5JR1H 5E8OA 2WV3A 1IGTB 2BVYA 1P7QB 2XA8H 4ODSH 2XZZA 1FO0H 1A5FH 4IIQC 3QNYB 3VD9A 3HE6C 4XCEB 5D7LE 4TVSa 4GQPH 2X1PA 3PNWA 3FT4A 4WU7A 4HPYH 1ZS8A 2APVA 3S35H 2OR9L 3V95A 1BOGA 3IDMA 4HCRL 3F7QA 1WC7B 3HZMA 4B53A 4N0YL 2L7UA 3DVGA 3L3OB 4GRLC 1WEJL 4HAGA 5K9OB 1KJ2B 4D9QE 5K59F 1VSCA 3FKUS 1C5BL 1JYVA 4HZAA 3VMPA 5HI4C 5IB3A 3O8XA 1HH6B 1D9KB 4X8XA 4IHOA 1PG7L 3MLRH 5DDHB 4ONFL 3T4YB 4XNXL 4L8CA 2P45B 1OP5H 1RIVH 1XGQB 3O11A 4GW4A 5DJCB 4L4TA 3IF1A 4BSWA 2DQTH 5KJRL 4FFWD 1EBAA 3HUJA 1UXWA 5DC0A 1WWBX 3F7RA 5C09E 1CICD 5A2FA 4EOWH 5JTWA 4BH8A 4N8CL 5J1AA 3W39A 5ABDE 2ADJB 1BECA 2BSTB 3IU3A 1WBYB 3HR5A 2YD7A 3NVQA 3REWB 2VLJB 5CEXB 3MCLL 5EBWB 4NKOB 5EZIL 2F5AL 3V8OA 3HNVH 2X4TA 4KZEH 5BS0A 4AM0B 1KPRB 5EUKB 3ULSB 1FIEA 4X5WA 5HHQB 4R4BB 1XGPB 4BSVA 3IDXL 4WNQB 1HHGB 1MJJA 2QJDA 4DUWA 4LPYA 4Z7UF 2R8SL 1B88A 4WI4A 3OX8A 4RZCA 2E7LC 4NQVB 1H0DB 1T22B 5DEFA 3X3FL 3HMWH 2FX7L 4FN0A 4K8RL 2OSLA 2IALA 2XQYK 1KCUH 4PJBB 1ADQH 3TH3T 1S9YB 4MXQD 5ID1A 4N90D 4RGNE 3AAZA 3IU4L 3RY4A 5I19L 4LRIA 4NBYB 4DZ8A 3OHXB 5DHVA 3D9AH 3RGVA 4YZFF 4PRAA 3B5TA 3P4OA 3R0MA 4GRWH 1MOEA 2V5RA 3QIBD 1C08B 1KENH 1QRNB 1G7MA 4NOFA 5EOCH 1WBXA 4OZIA 2NY5L 2BVUA 3ESUF 1I1AD 1A7RL 3ETBF 1PD6A 1ZHNA 2Q8BL 2PXYB 3SY0A 2BX5A 4NO2A 4RIRA 5KG9B 5DRWB 3AS1A 4LLWA 4FQJL 4WU5A 4Z78B 1CWVA 3JBG7 1NMBL 2XTJE 4JKPL 4NO0A 4RAVA 3IS1X 1I9JH 3GEWB 4CMHC 1RUML 1NUDA 5SWZA 2C1PA 4PJ8C 1C12A 4DVBB 3OZ9L 2DMBA 3ARUA 3KYMB 3IFPB 3IJYB 4QRTB 5I1IH 4YDKL 1KIPB 5ICXA 1IM9D 4U1LA 1SBSL 3QUYC 1LK2B 2BSRA 4KROB 3OGCB 1I9IL 2W60A 4PJ7F 4XP1L 2V7HA 1H3XA 4PGCA 3I50L 5I8EA 3HB3D 1H5BA 4K7PL 25C8L 2I07A 1GGIH 5D96C 3VWKB 1OGAA 1CF8H 1WF5A 1JPFB 1LEKA 5LXGL 4DGIL 4JDTL 1B6DA 4U31A 4LASH 2AK4E 1X5AA 1TQBC 1KELL 4G7VH 4QHKI 4M6MH 4JY5H 5C8JA 3WV0A 1SYVB 3ARFC 2X2YA 4NNPH 4HQQH 2HLFD 2X1QA 3E3QE 2QR0A 3LKPB 1YEJH 4NZRL 3LKSA 3T0EB 5E08H 3VXSE 1CFTB 3EYUH 4ZPVA 1MHPL 1VGKB 4MSWB 3O6LL 4PRNB 3TA3A 2HJFA 3QDGE 4UT6H 2HTLC 4BFGA 2A9NL 4JFOB 1MEXL 1ZXQA 4UQ2A 4PJGF 5LGJB 4JGMA 4GLRH 5B3JE 3CDCA 3BGFC 2VE6B 3GK8H 1TVBA 2IEPA 3BPNB 4ZPTA 2HJKB 2HWZL 1E4XH 4OQTL 1QBBA 2VITA 1NAMA 1WVZA 3JUZA 1X9QA 2DKMA 3KPRD 4X99B 5HHOA 1H3WM 4ODBD 5MHSE 1ZHBA 2UWEF 3O2WL 4X6CB 3GMMA 2AJUH 1NDGA 5GGTA 1P2CB 2QSTA 1D6EB 4LF3A 4ODHL 5FO8A 3ORJA 5C0ND 3UEZA 2XYCA 3IFNH 5DJ0A 1QA9B 2BZDA 3L5XH 4E41B 5JHDD 1BF8A 3TJHC 1UEMA 4JFFE 4AIZB 1I3UA 1UYWL 3MRJB 5GGVH 5DSCA 2CD0A 1JNNH 2ADFH 4EVNB 3OKKB 4JG0L 3WDHA 4M5YL 3UTTE 2HJLA 3NIGE 2XNAB 3C8HA 1P4LA 4NPYB 3X14A 1OLZA 4XVTH 1NFDF 2R39A 3P4LA 1TJIH 3MPCA 2VDQH 4N5ED 1A6WL 2V9RA 4I9WD 1JK8B 4Y0GA 4KHXH 4QTIH 1D9KC 2X4NB 2DI7A 3ZKQD 5IB5A 2G5BB 4PGDA 4MLSA 1TIUA 4U0RB 3MGOB 1UM4H 1DVFA 3UYPA 4P57A 2X05A 5EBLB 4IMKA 4W6YB 3ME0A 2ZG1A 2QKIB 4K3DL 1QACA 1Q9WA 2CK0L 1HWHB 1QNZH 3QQ3A 4H0HB 3MLSL 3ABZA 2R2BA 1HCVA 1U95A 3BP4A 4IOIA 4HKZB 4EUPG 4PRIA 4HEPG 1YEHH 5TE7H 3RU8L 5MENB 3TZVA 5BOPA 2V9TA 3BGAA 5EIQA 4PJXB 5KANG 3UJTL 4WRLA 1FG2B 4GW5A 5JXEA 1A6ZA 4HIEA 2ZKHH 3ZO0A 1QR1B 1KLUB 3UROR 3V4VH 5L2JA 4KK6C 4JAMB 4XP5L 4H26B 4L1HA 3V0WL 4CMMA 4F7EB 5AEAA 2J1KA 1BQHA 1EIBA 2AVGA 3HRZB 4S0TD 3ULUH 1I9EA 1JPGB 4AIOA 4LLDB 1MCBA 1R5IB 1XGTA 3KYAA 1XR8A 2K9UA 1SJVA 3DURA 4OZFG 3GSNB 15C8L 2FR4B 1PLGL 1QFWL 3VW3H 5L8KB 4RSVA 5DJDA 2F54B 4WY7L 3OR7B 1T2JA 1DBMH 4OQ1A 2Y1VA 4OCWL 2BCKB 5F44A 1JN6B 5CZXC 4OIAA 5T3ZD 1MLCB 1QSEB 1EHNA 2R29H 4TUOA 1S5IL 3O3BB 3BIAX 1CFBA 4NQEE 1HQRA 3P9LA 5LAXA 1QYGL 4LPWA 2EDKA 4M62L 1J8HA 2NY2C 4XHJC 3TO4C 1UZ6E 4X6EB 5E00B 4APQC 2DYPD 3L5HA 4A2MA 2Z93A 2VDRH 3QCVH 3QCUH 4K7PY 4ZTPL 3GSQB 5H8DA 3MMEB 3MV8A 3CFJB 5M94B 4YHKH 3X11A 2PXYC 1CR9L 5DRNA 3OJVC 1E6JL 1RZFL 4QRSA 1J05A 4ZAKA 5JHLH 4UNTA 5C2UB 3NAAL 3K0WA 5DS8A 4M3JA 5LWYH 2I60L 4D0DB 1AE6H 3DMMB 3DRQA 3HZKB 2AXFA 1DANU 5JQ6L 5L88H 3O6KL 5ANMA 5KVEH 1F6LL 3RVVD 4I0KA 1M7DA 1IGCH 1UACH 4DOHB 3VXQA 2IG2L 4KROC 3G5XA 3S35X 3Q48A 1ES0B 4WUUA 3BE1H 4PTTB 4L3CA 4M7LL 4NDMA 3SKMA 1NAKL 2HKFL 4ONGH 4OCXH 3DTXB 3TCXA 2FGZA 5FYJD 3L5JA 2BVOB 1KJMB 1ZLWH 4HIHB 3EOYG 1AIFA 3CXHJ 4LVEA 5K9KA 4BZ2H 1AJ7L 1UWGL 3HTLX 2DWDB 3T0EC 2P4AB 1T83C 3UTQB 3QIWB 1FGVL 1KIUA 4NKMB 3QRGH 1E27A 1X5HA 2J8UE 3RWHA 3WJJC 4PR5A 4ODUB 5L8LB 3ISWA 1KN4H 5FGCE 4YXHL 4TQEH 3PGCB 2DM3A 3RWFB 3BPNC 3VFRA 2X6MA 2ESVD 4X4YB 4ODWA 5SWSD 2FSEA 3BKJL 2X1WL 5T5FH 1T5WA 3QYCA 1N64L 5HDLA 4V1DD 3ZT5A 4P23D 4LSTL 2D03L 2E7MA 1U91B 3QPQD 2K3TA 5FB8A 5I1EL 3FRUA 1NAML 5F89A 2XN9A 3WXWH 1CT8B 2R9HC 4OZIF 1WGOA 3O41B 1U3HD 3IXTA 5E03A 4OT1H 5GGTL 3GBNH 4I0CC 3RBSA 4I48B 4JRXA 3HLAA 4Y1AD 3L9RB 1XH3A 3HS0A 1YY8B 5GRJH 3ECBA 5D7LD 4LCYB 4HIXH 1YZZA 1FLRL 1GZPA 1F6AB 3GMLB 3B9KB 3WLBB 3KPOB 4BQ9A 1H8NA 1QOKA 3JWOL 1OSPL 3WO3B 4WEMB 1T0PB 1CGYA 4UT7H 5TGBB 5T1DL 3HMXA 4EDWL 4TSAL 1S9KC 2YUZA 1N5AB 5GHWH 5JUEH 5GGRA 5C7XL 4FFYL 4JKKA 4D9QD 1DEEB 8CGTA 2VKXA 4H5SA 4MNQD 2FJHB 5D1ZB 2DDQL 1HK6A 4YHPA 1QFHA 4Q9CA 3NIFF 1FRGH 2HVJB 1MJ8L 3WHE0 2YKLH 4FQ2L 1A6TB 4X7TA 4U1IA 4M6OH 3RX8A 1C1EL 4F9LA 1BEYH 5E2VH 4X80L 5GS3A 4QGTA 1ZA3A 2OLDA 5DUBA 2OK0H 1MPAL 1G84A 1EVTC 3MRGB 1A64A 4MLIA 4K8RD 3ZE1F 5AD0B 5HPOA 4DTGH 3L95A 3VGEA 5IGXL 4M5ZH 4XTRD 5I30H 2XOTA 1C5CH 1IEAA 4OKVA 3RZWA 1ERNA 1EGJA 3S98A 1RU9H 5T33L 4KKCC 3FB6A 2IGFL 1JZ8A 4N68A 3BISA 5K9JL 3Q6GL 3BVNB 2BMKB 3F5WA 4Y5XB 4QXTA 4G6FD 4NP4L 5I15H 1MI5B 1CU4L 4MA8L 5I71B 4EQ3A 3T2NL 3ARSA 5C0FB 3W11C 2A83A 4Y8AA 1UA6L 4PRHA 5SV4A 2EXWD 2Q76A 4YGVB 3SKOA 4DQOL 5BV7H 5C92A 4LLQA 3S4SB 3DYOA 5EO9A 4I3RL 4XZUA 4Q7DA 3B5GA 4Q9RH 4QT5B 4RGND 3HG1A 3MV01 4OIBA 1ZHLA 3B2VH 4YPGB 3WIFB 4H88L 4ZS6D 5CWSB 4WV1A 3VH8G 12E8L 1AGCB 2ICEB 2AXGB 4NYLA 1N5YH 5E5RB 2HA1A 1MWAH 1RPQA 1MQKL 3RKDD 3IDUA 1JL8A 3H2WA 1Z9MA 2BVQB 1HOCB 2C1OA 1FO0A 1MJUL 3GBML 4U1MB 3RUGB 3DMMC 4JFPA 4MNGA 3E6FB 4WO4D 2DLIA 3WN5A 4OZ4B 1XMWA 4PB0L 3BI9X 3MYZA 1H3PL 4PGBA 4KAQH 3ELAT 1MLBB 1MCQA 2XTJD 4OD2A 4CDHA 5HTSA 1R3KB 2W0LA 3WHE1 3B8SA 4MA1B 5LBSL 4QLRA 1Q1JL 5C08E 5A2IH 5D6CA 3I6GA 4ZG1A 1NANH 3CFDA 2DBLH 1YEDB 32C2A 1ACYL 2QSQA 4AEFA 1X7QB 4IOFC 2GYSA 1NCAH 5IMKB 1I8KA 3BW9B 5HGBA 3UZVB 2BVPB 1PKQB 2OTWB 3I3DA 4LLVA 1B0GB 1X6NA 3FFDA 5D93B 1GOFA 5DZNA 4HDIB 3RVWC 3K2UH 1INQB 2VKWA 1ITBB 3U36B 4KK8D 4PLKD 4N0CD 5B4MD 4IBLT 5C0JA 2R0KL 2NY3B 5MEPB 1MY5A 2H45A 1QLRB 2E7HA 4NKDA 4PJCF 4ELKB 1K6QH 4CNIB 3R8QA 4NWUL 4X5XA 5JNYB 1R3HA 3KHQA 5EU6E 4YHNA 4QHMB 3QG7L 2A77H 1NJ9B 1JGDB 3OAZH 4DKEH 3LMJH 3BIKB 4KTDL 4XPAL 2X9YA 4YDLB 3OJDA 3QDGD 1WCBA 2PYFA 3CSYB 3MV7E 5GJTL 3C8KB 3D5OF 1N6VA 1IAMA 3STBA 4JQIH 1YC8A 2IFGA 1R5WA 1UB6A 1JZ4A 1UM5L 1IEHA 4HUXA 2JJSA 3WFBL 3O3EA 4RMQA 4YDVB 1XCTA 4TUKH 5F7DA 1T2XA 2E9JA 1MIMH 3KPTA 5IWLC 4U7MA 3MROB 3ROOA 5HVFB 5DJ2B 5EBGA 5BO1L 5F1OB 3WLWD 2DF3A 3QDJB 4M02A 4NO3B 4JFFD 3O8XD 3LY6A 3DV6A 1JFQL 1A1MA 4NQSB 1ED3A 3HI5L 4G5ZH 3NA9H 3UO1H 4K9EH 4OSUL 5F6IB 1MAMH 1JI2A 4FTVB 4PJDA 1AC0A 3UTTD 4HXBL 2VLKE 3QFDA 3KYKL 4CVZA 3VE0B 5JZ7D 4WFGD 3HCVA 5D1ZC 2OMBA 4KJPC 4WHTA 5IMOA 2XT1B 1NGPH 2DQHH 3S7GA 4ZO8A 2P8LB 5IP4A 4U0QB 1MF2L 1LDPL 1NFKA 2F58H 3FQUA 1UWXH 4CUCA 4YWGL 4OLUL 5ICZA 4PJFA 2WMPA 5KSBA 1NLBH 1S5HB 1A1OA 5BMFL 5FKAB 2W9LA 4S0SD 1T21B 5IB1A 4LLMB 1NCTA 2DQGH 5KVFL 1T03L 3ET9F 5MERB 1KPVB 4MD0B 4UBDD 2AERT 2KPNA 2B1HL 3FB7A 4KKBC 4WFFE 3MRQA 3MBXL 1EUUA 3HE7B 3I6KA 3A67L 4JQXA 3T1FA 1QFWI 5KVDH 3WL9A 3U0WL 3MFFA 5IF0A 3BMWA 2ZSVA 2VSCA 5FK9A 1LE5B 5JW4N 1AGFA 4XXCC 4JFYA 1EGJL 1JPST 1NEZG 1ULVA 1W72H 3GSXB 4MQSB 5DJZA 4LIQE 4NN5C 5CBAB 1RSFA 3MLYH 4JN1H 3QI9C 1XR9B 2B1AL 2NX5B 4P2OB 4XRCB 1JZ2A 1JMZA 3NH7H 1B4JH 2WWMD 4EI5C 2R2EB 4J7RA 4QY8A 5E6ZA 1MCPL 3N1MC 2HRPL 4UINL 3ULVH 3KJ6H 1IL1A 1RZ8A 5FYKH 1HDMA 5E1AB 2Y5TA 3B9EA 5F9DC 4L4JA 4NO0D 5A3ID 3IDJB 1MFEH 4Y4HA 4NQED 4AH2B 1UQSA 2VZTA 4KKLD 3SBWC 4LCUA 3CMGA 4OLVH 4XCYB 4JCMA 1WAAA 5EO0A 3VXPA 1I8IA 5B21A 1Q94A 4KUZH 3KPSA 1CGUA 1K5NB 3LV3A 4ZFFA 1NCDH 3FTGB 3M8OL 5JR1L 1YQVH 5H94B 2IADB 4H25B 4UTBH 5C3LD 3RWJB 2XA8L 4ODSL 4F3FA 3D39E 1FO0L 2DWEB 4HUWA 1A5FL 4MA1C 2WM0A 1CG9B 2AJZA 2DTSA 5HHXH 4LCCB 3LRSA 4F2MA 2VLRE 5INDB 2AV1A 3CC5A 3MLVH 3SQBA 3MRCA 4OBRA 1G0XA 1TJGH 4HPYL 3EYFB 4X7FC 3S35L 4BFIA 4YFEA 1DBJH 3QXDA 3G5ZB 2BOBA 3FO9A 2Y7QB 4U2YA 4LDEB 5FGRA 2V17H 3DVNB 2PF6A 2H32B 1U93A 3PJSA 1X5YA 5GXBB 2NY3C 3G5VB 3TIDB 4LK4A 2X9WA 5D70H 5BOZG 3MLRL 3JWNC 2MWCA 2WK2A 5CJ8A 1F3JB 5TQ2H 4UIMA 4FQ1H 5F7YC 1RIVL 1AKJB 4WWKB 2V2TA 4OZHA 4G7YH 3CFBB 4R2GD 1K85A 5J13B 3PQYE 1UEYA 2DQTL 4Y19A 5IEKB 1T83A 4PJ9A 3H9SB 4YDLC 3IDNB 4UNUA 4ESKA 3MGTA 5FGBC 5DRZB 5DYOB 4EOWL 3FOLB 5FV2A 3RWCB 3GMNA 5DD6A 2YZ1A 4LSVH 5E8DH 5ID0A 2C4XA 1OVZA 2DQFB 5D7JA 2CKBB 1MH5A 5FECA 5IR1A 1VKXB 3HNVL 4KZEL 3FQXB 2YWZA 1KTKE 4GFTB 1INEH 1M05A 3VGAB 3PWUA 4P9HC 1U8IB 1VEOA 5A40E 3HC4H 5GGRY 4KH2A 2VDPH 4MS8D 4P5MB 3IAQA 3JSSA 1RJYA 4NZUH 2A73B 1PFCA 1MREH 3Q6FA 3ZDXF 1KIRB 4P2RA 3TJEH 1K8DA 3HMWL 5JOFB 1T1ZB 1DVFD 1KCUL 3OJ2C 5KS9B 1ADQL 2V2WA 1O7VA 1M7IB 4R90H 3S3PA 3ZTNH 1S9XB 1HH9A 1KF9B 1QEWA 5SX5H 4NQDB 3MBEA 1CGXA 1NC4B 3D9AL 5DF0A 5DMKB 3WJLA 5MEQA 1KENL 5EOCL 1WICA 3CFCH 3BXNA 3EYOA 4K71B 1LILA 4QHLA 1OP3H 1WT5C 1CTNA 4G6KH 43CAB 4WI3A 1OAYH 2IANA 3EZ8A 5EZJA 3C60A 3T3PE 2VLJE 5IKCB 5EH1A 1WIPA 2RJMA 1D5ZB 5D1QB 1CK0H 1MCSA 2NY1B 2GT9B 5I1HH 1EEYB 3ARDB 1I9JL 2DMKA 4YHLH 4OJFH 5IQ7H 2BNQB 4XHQA 3QQNA 3VGBA 1JWMA 5E2JA 5HGGS 3ARGB 1QBAA 4NHCH 1A9EA 4LPXA 5I1IL 3RJDA 1MQ8A 1NCBH 3FOMB 1YN7A 3GMRB 2ENYA 4H20H 3IJHA 4LMQE 1ACZA 2EYSA 5E95B 1Z9OA 5L9DH 1B0RA 4CDGC 1GGIL 2DD8H 4U1NB 5EN2A 5JIKA 3L5WB 1CF8L 1PYWA 3T65A 3HPJA 4LASL 5CS7A 4XPHH 4G7VL 4M6ML 4JY5L 4OCSH 5B39B 2JJTA 3NCEB 2VQ1B 4U1SA 3WUWB 2EDYA 3VI3E 4NNPL 4HQQL 3CZFA 1S7QB 5DJAA 4P2OC 4F58H 1FVCA 1YEJL 5IHZB 4LHUA 5E08L 4YHZH 5IEHB 3VA6A 1QRNE 3EYUL 3V5KA 4MQ7A 1A6AB 3MJ9H 1LP9B 2HFTA 4UT6L 3GSOA 2HTKD 3T3MF 2AQ1A 4L3EE 1DUYA 2HH0H 4DAGH 2PW1B 2ZSWA 3DSFH 3UJJH 4MCZA 1RZJH 2N1KA 3GK8L 1AY1H 5DD5H 3SPVB 1KB5B 1E4XL 1E4KA 1WWAX 4LSDA 3QWQB 1EUTA 3VRIB 1YEFH 3GUTB 1BBJB 4PJHA 3VFPA 3EO9H 4EN3A 4O00A 2X4OA 2AJUL 4LP4A 1FN4B 3PL6A 5CILH 1JZ5A 4HULB 1LNUA 4LPUA 3V7AG 4LVHC 3IFNL 4LCCC 1GOHA 1P6FA 3L5XL 2C3VB 3KLAB 3P9MA 5EFIB 3LSOB 4QRPB 3V7MA 3FFCA 5T1MA 5GGVL 1RZ7H 4PJFF 5KSBF 1CD0A 1JNNL 1K4CB 2ADFL 3UAJC 4M8VA 1TZIA 3DO7A 5C08D 3T0EE 5E9DB 2MCPH 3U7WH 1FL6B 5EWIH 2Q8AH 4XVTL 1BD2A 4C57C 1MHHB 1TJIL 4Y2OA 2LV4A 2VDQL 5FEBA 1DDHB 1JPTH 1HWGB 1NQBA 3KLDA 4WTXA 5IM7B 1FZMA 1VADB 1EJ6A 4KHXL 6FABH 4PRPA 1JPSH 5D9SB 3EZJB 3X13B 3VXOB 2VAJA 5HJ3B 1UM4L 3DXAB 4WWKC 2V7NB 3TLRA 5HPMA 2VL4A 3Q0HA 3MNWB 3UPCA 4JM2A 5HYSB 1LHZA 1QNZL 4BFBD 5DRXA 4X6DF 2D0HA 3PXJA 4X6CE 5C1MB 1YEHL 5EU6D 5TE7L 3MUHL 1NCCH 3AMKA 3WDIA 2VAAA 2A6KA 4I18B 3TVMD 1S7TB 3GO1H 4R3SA 5TDPB 4WUKH 1CFNA 4DUXA 2ZKHL 4QHKJ 3V4VL 4JY4A 1RAMA 3G6JA 3OGOE 1QP1A 1ONQA 4TTGA 3HE6D 2DN7A 1AXIB 4MDIB 5CFHA 3ULUL 1P4BH 5FM5M 4FQQB 3O3UN 1FNFA 3LEXA 5ESQB 3IKKA 3VW3L 2Q3AA 4XC1H 3DBXA 5I1DA 4GRLD 4P4KB 1DBML 1IQWH 1DLHB 3D18B 3SE3A 2DJ4A 3RZCA 4AQOA 3PDGA 2I5YH 2IPUG 2VISB 3BQUA 2R29L 5LGKA 4WIQA 5HI4D 3J7HA 1HNGA 3BEVA 2FO4B 2GJ6A 5GGSA 4X9IA 2AEPH 2J4WH 3B3IB 4K71C 2VDRL 3QCUL 4YHKL 2BNUB 1I7UA 4MXWH 2FIKA 3STZA 3SGJC 3PHQA 3ZSSA 5JHLL 2BDNH 5D5MB 2FBOJ 5D1QC 5D72H 4PG2A 2HYMA 3ARDC 5LWYL 5B8CB 1IJ9A 1YMHB 4ORZC 1AE6L 1IT9H 4W4OC 5E0QA 4ZSOE 3EYQC 4BQBA 3ARGC 3UTSA 5L88L 4BQ8A 5KSAC 3O9WC 4FZEH 5KVEL 5GIRA 4OZHF 3AS3A 5EZLA 2GSIA 1IGCL 1UACL 1HHHA 4JJHA 1JGLH 3RVXD 5I17B 3BE1L 1YQ2A 4Z7VB 3T8XA 1XF2B 2AEQH 4EQ2A 5FV1L 2RAMA 4ONGL 4OCXL 5D7IB 3SDXE 4CKVX 3PWNB 5BZDA 2KH2B 4BZ2L 5CGYD 1OT1A 3WE6B 2PKDA 1PW3A 2PCPA 3MO1A 4G9FE 2X7LB 4FXGA 4NQUA 3QRGL 5DZLA 3CUPB 2YWYA 4I0PC 3SCMA 1QBMH 4LGSB 3LKRA 4NFCA 4OF7A 2DM4A 3PP4H 2ZCHH 3PABB 1KN4L 2H3NB 5HGAB 4J6RH 4TQEL 3MRMB 5E1HB 1HKFA 4EI5A 1S7RB 3QJFB 5JO5B 5T5FL 1NBQA 5EU4A 2EICA 1TZHA 2Q7NA 3S8WA 2X4SA 2BHUA 2WINA 3ES6B 4KI1A 3IDGB 1BAFH 3KXFE 3O45A 3WFZA 3SBWA 4CN1A 3LPFA 4PJ8D 2AEIT 1NEZA 1UENA 3WXWL 1ZV5A 3WD5H 5I1LA 1B2WH 4DW2H 1V5JA 4S1SH 4OT1L 4NM4H 3GBNL 4JGUA 3L5IA 3B6SA 4PY7B 3D39D 2GTWB 3BWAB 4JQVC 2ITCA 4ZDHA 3TBWA 2E6PA 5GRJL 2VLRD 4G6JH 3VCLA 4ORGA 1I4FB 4HIXL 3VXUA 4N0UA 1F90H 2O26U 5FOBB 2G9HB 5DR5H 2EDQA 5F7EH 1CN4A 2D0GA 3ARFD 4KGLA 4UT7L 1A22B 4IDLA 4RAUA 5C0DA 5KTEH 5GHWL 5JUEL 3AMLA 1UKTA 5JIHA 2NLJB 4G8GB 2YOCA 5C0BE 1JWSA 5LGHH 1CDUA 3B9AA 3SE4C 4C4KO 5DVKA 1NGWB 3OPZH 3QH3A 1FRGL 4XVUC 2YA2A 1Q9KA 3VG9B 2YKLL 3G6JE 2DIBA 2BY1A 2GCYB 2IQAB 4M6OL 1CL7H 1DR9A 2WBJC 3B9DA 1G7JA 1RZKH 1BEYL 4I13B 5E2VL 2CH8A 4AG4H 4ZOAA 4I18C 5JW3H 3DGCR 3F7VA 2EYRB 4LFHG 1UWEH 1D6VH 4NQCB 2OK0L 2NPLX 2RQ8A 2H8PB 5CSZA 3LQZB 1P7QD 2EDTA 4DTGL 1JNHA 4MCYA 4M5ZL 5I30L 1C5CL 2C4FT 1BZ7B 4MXVE 4YDJB 1W72A 4E0RA 3TYFB 3TJHD 1RU9L 3O3DA 3EDDA 3GSUB 4L8SB 3RTQB 4YIQB 1FFPA 3HC0A 3JZ7A 2XA3A 5JPMB 2E8YA 1N6UA 1KIQA 4BKLA 5I15L 3BIBX 3G5YB 5D6DA 5GGUB 3QEQA 4WI6A 3FAWA 1FZJB 3BP7A 4PJ5B 4N9OB 3ARBB 4MA7H 5BV7L 1CQKA 2JB6A 1OGTA 1WTGT 4FQXA 3N1GC 2GFBB 3GSWB 3WNKA 4AZ8A 1KXVC 2NR6C 4RISH 4GS7C 1ZOXA 2XWTB 3OB0K 4Q9RL 4WTWA 1FL5A 2VTFA 4ZNCD 2YPLB 3B2VL 2UZIH 4WEUD 4J3XA 5DQ9B 1N5YL 4QHNA 1OAUH 1MWAL 4X9FA 1TJHH 1V3JA 1DLFH 4MD4B 3MRFB 5J12C 5B8CC 3DUHA 1T1WB 4Y4FB 1S7SB 4O2EB 1LD9A 3QZWA 1HQ4B 3JV0A 1WWCA 2Z91A 1KYOK 4TVPH 2ADGA 3L6FB 3QEHA 4KAQL 4FMFA 3QG6A 2AS5M 1S8DB 2D7TH 5HI5D 5TE4H 1ZGLA 4JM2F 3I02B 1G7PB 4KK6D 4XNZB 3OXRA 1UZ8B 2DBLL 1XIWC 4Y5YB 3DVFA 1MI5E 2X4QB 3FN0H 2X4RA 1NCAL 2UYLB 2FWOB 2WSKA 3AROA 3H42H 5E99H 5C9JA 4KQ4H 3DUSB 3DIFA 3MJ8A 3Q3GB 4XCCL 3SDDA 3L7EA 3K2UL 2ATKB 2NTSP 1YA5A 1J1XH 1KNOB 1KPUB 5CJQH 3RY6A 4ZQKA 4Y4HD 2FDBP 5CZXD 4LMQI 5IOPB 4QHUA 3TPUA 3VFGH 1K6QL 1E28A 2HFFA 3LDBB 1Z0MA 2ICWI 2BXZA 4R4NC 1T89A 1QRND 2NY2D 4XHJD 2A77L 4JPKH 3TO4D 3UJIH 3WEXA 4APQD 4DKEL 2Z8SA 1HXYA 1FFNB 4MWFB 3O6MH 1S7WB 2PXYD 4L3ED 1IAIM 3GJFA 1I3RA 5DJYB 4OGZA 4HHAA 4HIJB 4JQIL 5TDOA 3DETC 3RDTB 5CJOH 1Z3GH 1ORQA 5HHPB 1FNGB 4TUKL 3GGWA 5C0IB 4PJIB 1MIML 4JEGB 3UZQA 1PKQE 4KROD 3MRRA 4OM1H 1NGXB 5IW1A 4RMUA 5C0EB 1JE6A 3RI5F 1DQJA 1DE4B 3GB7B 5JDSA 3QWOA 4M4PA 4U1HB 2XXMB 2VJXA 4AMKH 4HX1A 3H7BA 4XPFH 3GIVB 3SKUD 4G5ZL 3SDCC 1IC4L 3NA9L 4GAYA 4Z0BH 4K9EL 3UO1L 3M17A 4CJ0A 1MAML 3IRPX 1EAPB 3T0ED 3TNNA 4XX1G 1F45A 4E9LA 4BSJA 1DBBH 5H37H 4IRJC 3MJ6A 1H3TA 3MV9A 3QDME 2R1YB 4KRLB 3P30H 3JUYA 5ETUB 1D5BB 4YHIA 1NGPL 2DQHL 5HYFA 4U3XA 3QIBB 3RRQA 4Q0XH 1NSNH 2F58L 4JHZA 2XIDA 4P3DA 1X4ZA 5IFHH 4OLYH 3WNPA 2Y72A 3TN0A 2QADB 1NLBL 4PJEB 1MCWM 4YJZL 3DGGA 3CJJA 4HV8B 3LKQB 3QEGH 1NUNB 5I6XC 5FUCC 1LQSR 2LE9A 4MB3A 2EC9T 3PWPA 2DQGL 4HUNB 4TSCL 2GK0A 3HPLA 4FQHB 1JYXA 2P7TB 5CEYA 3NFPA 4QRQB 2R9HD 1IM9B 1ZKAA 1E0OB 3QDJE 4XAKE 5KVDL 4DFHA 4DCQA 5I76B 3V5HA 2ENSA 1KCVH 4OFIA 2MPAH 2VL5A 3D3VE 3MACH 4IDJH 3VXNB 4FTVE 3P4MA 1W72L 4HGKC 3MRNA 2X70B 3REVA 3BYTA 4NCC1 4FNLH 3T2OA 4FFVD 1NGZA 3MLYL 3FQWB 4JN1L 3MJ9A 3H0TB 3L3IA 3CFIC 3IT8D 2GSGB 1B4JL 2CJUH 3NH7L 4TULH 5HDBF 3ARBC 4MDJB 1IBGH 1A3QA 1OQOA 2D31A 3JV4A 3QUMH 3P3YA 4IMLB 1AD9B 4RWHA 3TIEA 3ULVL 3KJ6L 1KCKA 5FYKL 4GG6A 3D6GA 5KVMC 4HWNA 1AQKH 2RBLA 4ELMB 5DD3H 5JDJA 1MFEL 2F19H 1LEGB 3VI4E 1OSZA 1QSFA 2GJZA 4OLVL 5CAYB 5DVMA 1BBDH 4EI6A 3NOIA 2BFVH 1OTUC 4Y4FC 4KUZL 5IV2B 2A38A 5DUMH 5J0BA 5IW3A 3M1BA 3TBYA 2HG5B 3KPRB 1NCDL 3SKJH 1GGUA 2X1OA 1DN0B 3AM8C 2J8UF 1IM3B 1YQVL 2RFXB 4K7FB 5C86A 5FDWA 4UTBL 2VQTA 1RJLA 4HKJA 2I9LB 5AUMA 2GJJA 5ESAA 1WSST 1G7LA 5IMMA 3WDJA 2KBGA 1NKRA 5HHXL 5EUOB 3LAFA 5JLZA 3MLVL 1HHIB 2YUXA 4XNYH 3MREB 4B7LA 2HFEA 3RFZC 4JKMA 1TJGL 5FA3A 4RX4A 4LHUD 1DBJL 5KSAA 3O9WA 4I4WA 4KKCD 5IFJB 4OF0A 3WHXB 4LSRH 2NX5E 1BWMA 3QHZH 1B9ZA 1DJSA 2V17L 3T0DA 2VZUA 4OLWH 4YQXH 3NN8B 3CDFA 5JORB 1KGCE 3SKNA 3EO1A 1I1YB 4U6TA 5D70L 3W11D 1OWWA 3D2UB 5CZVH 5HY9B 5AYQA 4E5XA 5TQ2L 3DI3B 4LSPH 3LDBC 2GITA 4FQ1L 3KPNA 5EIVA 3O4LA 2CUIA 4G7YL 4G9FD 2DJUA 4FFWC 4K55A 4NC2B 4I0PA 3CX2A 3ULVF 3ILPB 5C0GB 3IETA 2FX9H 4G8FB 4O51A 3FJTA 3C5ZC 4E42A 5IK3A 1CDBA 1EEQA 1MCLA 2FX8H 4PV9A 3DMMD 3RDTC 4F7MB 4LSVL 4JFXB 3BZEA 5E8DL 3PF2A 5C0AE 3B8YA 3OXSA 4FRWA 1INEL 2W59A 1AHWB 2XZQH 3KXFD 2OQJB 1S9VB 3QULA 3HC4L 1AR2A 3E8UH 2VDPL 4F7CA 1CIDA 2FCBA 4JFQB 4NZUL 1CZ8H 4IOFD 5ISZA 1R5VB 3QXVA 4PRPD 3QRFM 1MREL 3KDMA 3TJEL 4JVPA 2XTLA 2GAZA 1CDCA 2P8PB 3ZTJH 1IGFH 3EOAA 4KK9D 2CDEB 3H9HA 4R90L 3ZTNL 2KKQA 3QO0A 3RVWD 2P42B 1MVUA 1MUJA 3VWJA 2NXZB 3ZE0E 3SDAB 5D1XA 3H9SE 2NY0D 2VABA 1FFQA 4HZLB 3CFCL 5BZWB 5DK0A 4CADA 4N0RA 1PEZA 1U8KB 4FS0A 1B6UA 4W68A 1ZTXH 5C0BD 3U83A 1G7IB 4G6KL 2XG4A 2IAMA 4QNPF 5BW7A 1JBJA 1OAYL 2QADC 2DQJH 3D69B 5I1HL 1CK0L 1TETH 4NC0B 4YHLL 5IQ7L 5T3XH 3IYLW 4PBXA 1NFIA 3KAAA 1AD0A 3VXMA 2HVKB 3PHOB 2ARJB 1HEZB 1YYMH 4GQ9H 4NHCL 5IIEB 2E7BA 4LLUA 3QBTB 3ALWA 3SE8H 4XMLH 4WW1B 1NCBL 2PYEB 5TQ0H 2R1WB 4JY6A 3BFOA 4UDUB 3U6RA 1SMAA 4H20L 4XMPH 1BM3H 3L3OA 2VUOA 2X4PB 1DP0A 2XG5A 4OAWB 5L9DL 3STLA 2DD8L 1EEUA 3RZCD 5IROA 5KS9E 1I1CA 1Q9LB 4XPHL 1QO3B 3D85A 4OCSL 4WHCA 1YY9D 1FBIH 1HH6A 3U4BL 3KPLA 5F3HA 5I8CB 5DDHA 4F58L 3NCJH 1XGQA 1HSAA 1EEZB 5JOEA 3DRTB 4YHZL 1EO5A 5D2LA 5KSVB 2FJGB 3KYNA 4P4RA 1HXMA 5ITFA 1AGBB 4MD5B 4IRSA 3MJ9L 3MLZH 4MYWB 2LU3A 3OKLB 5BVJA 1A3RH 4FABH 5D1ZD 3S4SG 3IXAA 4X8JB 4KJPD 2HH0L 4DAGL 2YC1A 3DSFL 2ADJA 3UJJL 5LVEA 1RZJL 2VDMH 1AY1L 5DD5L 2BNQE 5IVXF 2B20A 3REWA 4R7NA 2W92A 1WLHA 4M1DH 5SWSB 4M1CC 1YEFL 1BQLH 1WZ1H 2IBBA 4V1DB 3EFFA 2C9AA 3EO9L 4P23B 4R4BA 3NPSC 4PY8I 2DL2A 5T1KB 5I8OH 3K81A 5CILL 1HHGA 1JF1B 3IFOB 2CPCA 3NTCH 4JHAH 2APTA 4R97B 4GOSA 4KKBD 1U3HB 4NQVA 1VENA 1RZ7L 4HEME 3PDDA 4Y1AB 5KOMC 1Y6KR 3LN4A 1TTUA 5FHAH 3PUCA 3T0BA 3K80A 1JV5B 2MCPL 1MFDH 3ZL4H 3U7WL 2P24B 2YRZA 5EWIL 4U6XA 2Q8AL 5JMOC 4RNRA 2PW2B 1MRDH 1MI5D 3B5HA 1JPTL 5C71A 3QI9D 4OFKA 1C08A 4YAQB 3EYSH 1SHMA 6FABL 2RB8A 5GS0C 2ZOLB 1JPSL 3VFTA 1V3MA 4EI5D 4PJ7B 2EYTB 5ACLA 4F37K 4HK0B 1T7XA 4MNQB 4Z78A 1GZQA 1T0MB 2A6JA 2UY6A 3EHBC 4HKXB 2I24N 3VFNA 1W0VA 2FJFB 3KLSA 4DVBA 1NCCL 3IFPA 3IJYA 4QRTA 3PIQB 1UH4A 1R3LA 2J8OA 1RULH 1LK2A 3TC9A 3VDAA 5FO7A 4ZUWB 1A0QH 2K7PA 1YPZA 3GO1L 4HUMB 4PG9B 4QRPE 4WUKL 4NRYB 2YSSB 2KDGA 1UJ3C 3O3AA 1BLNA 1YC7A 3FT2A 1SYSA 2CLVB 5CBEB 1N2RB 4XC3H 1GHFH 5BRZA 1EH9A 1IILE 4PJGB 1AGEB 3ROLA 1ZA6B 1F2XK 1G9MH 1X5LA 1SYVA 1OOAA 2WANA 3CFEA 4NNYB 4ZXBC 1Y0LA 1P4BL 3FQNA 4XT1C 3AXLA 4PV8B 1SVZA 3DPBA 3AU1A 1VGKA 1AGDB 4XC1L 4UDTB 3GMQB 1IQWL 4PRNA 2NXZC 2DKUA 2I5YL 2NMSA 3KR3H 3SDAC 3CPLB 4GW1A 1T1YB 4L29B 1TITA 5IB2B 4NJ9H 2HJKA 4S2SA 1IFHH 2AEPL 2J4WL 3EOTH 3QUKB 4RGNB 4C56B 1DBKH 3IDIA 1QD0A 3C5JA 3V6FB 1T20B 4MXWL 1U8PB 5B38B 1L0YA 3PG2A 3QDMD 3RWDA 3VFVA 4KI5D 2BDNL 1JGEB 1P2CA 2A0LD 5D72L 5DHYA 3P0GB 4D0CA 5J9PB 4TNWK 3U4EA 5ACZA 2QEJA 3JXAA 1A3LH 4PREB 1T4KA 2L4OA 1IT9L 3EO0A 5CJ5A 3MV11 4E41A 3CFKB 1FSKC 1YDPA 4BZYA 4WO4B 4QYOB 3MRJA 4FZEL 5DJXB 3T77A 1Q72H 5HYIA 3KPMB 4YBLB 2FATH 2D4DA 5CCKH 2X4UA 4JB9H 2QHRH 3OKKA 1JGLL 3WIHH 1UGNA 1DUZB 3ARQA 4ZO6A 2QQQA 2AEQL 4XCNB 2H6PB 4NPYA 3OMZA 3O2VH 1UB5B 4EEEA 3QR2A 1I1FA 4JDVA 1JK8A 3QDJD 2NZ9C 5D2NC 1FE8H 4XBEH 3V9FA 1CXKA 1U8OB 5DC4B 5DQDH 3WS6A 3ZHKA 3D3VD 3QFJE 4L4VA 4FTVD 3GSVB 1NLDH 2QKIA 5EOQH 1PQZB 2Z4QA 3WKMH 1B0WA 1QBML 5HVGB 3BOVA 2EE2A 1G0DA 2JCCA 3IJSB 3PP4L 2ZCHL 1X4YA 4M8QB 5D5ME 2HN7A 3RPKA 5C0CB 4QRRA 5GS1C 4J6RL 5MENA 1YNLH 4RWYL 4MJ6A 5SV3A 3MJ7B 4PJXA 5I8KH 4POZC 3QDGB 3B83A 2ILLA 1KLUA 3WFEH 4OCRH 1JHTB 4Y16A 3HNSH 3L3JA 4H26A 1BAFL 5FYLH 4F7EA 3B43A 1VA9A 3QPQC 2YPVH 3RI5K 3ZLQC 4Z7VE 3PNWB 4WU7B 1ZS8B 2YN5A 3WD5L 1GGYA 4LLDA 4R97C 1B2WL 2DIAA 4DW2L 4S1SL 5D7IE 2ZUSA 1U3HC 3HZMB 4NM4L 3KNBB 3DVGB 4G3YH 5ENWB 1YMMA 3U0PA 2F54A 1DQLH 3OR7A 3V8CA 5F71A 1ZT1A 4G6JL 1QSEA 4S10A 5B3NA 4JFFB 1F90L 3O8XB 2G2RA 3FO2B 4PGJA 5DR5L 5F7EL 2CGRH 3O11B 4GW4B 3H7LA 2EDHA 1DCLA 3W82A 4X6EA 2NX5D 4P2OD 5KTEL 4L4TB 3IF1B 1CI5A 4BSWB 4OCLC 2HAZA 3UYOD 2FD6H 2AJYH 3HUJB 5LGHL 1UXWB 1KGCD 1K8IB 3OPZL 5IJKA 4HS8H 4BH8B 1T66C 3OAZK 4KTEH 4D0DA 3IU3B 2CIIA 1KTDA 1HILA 1CL7L 1RZKL 2FL5A 3SQOH 4AG4L 2X4TB 1GSMA 5JW3L 2M1KA 1EHAA 1UWEL 1D6VL 4X5WB 1L7IH 5ECJE 3BUYA 1OM3H 4BSVB 1S3KH 4K8RC 2PO6A 1MJJB 2ICES 5MEOA 1CFSA 4HIIA 4F15B 4RZCB 3E2HB 1YEIH 4RGOH 1KJMA 4Q6YA 2FRGP 2NYYD 5DEFB 5C0AD 4UNVA 3ARWA 2IALB 5J56B 3FO1A 2KZWA 3UP1A 1LO4H 2W9DH 1IQDA 5ID1B 4OZGA 3DX7A 3UTQA 3QIWA 3AAZB 2NY5C 3UAJD 3RGHA 2R2HB 3LKNB 1NC2A 4NZDA 4NKMA 3QUMA 4DZ8B 5DHVB 1A7OH 4G8GE 1OD9A 1JUFB 3MFGB 4NN7C 3P4OB 3W9EB 5TE6H 1G7MB 5C3TA 1WBXB 4MA7L 2EXWC 2DTMH 4D0BA 4JG1H 3G08B 1LWRA 3NA4A 4PUBH 4RISL 1S7XA 3SY0B 4PJBF 4NO2B 1L9NA 1PSKH 2F15A 4WWKD 4LLWB 4WU5B 4ZUVB 2UZIL 2AJXH 4NO0B 4RAVB 1UKQA 2YHGA 4NQEB 3VI3F 1LO5A 1OAUL 5FUCE 4NQCE 5C2BL 5SWZB 1TJHL 1DLFL 2F9BT 4R96A 1C12B 5E4EC 4M93B 2X10A 1GRWA 4YFLI 3VRJB 5ICXB 3U0TA 5E24E 3O41A 2BSRB 4WO4C 2W60B 3BYYA 1DL7H 4PGCB 4TVPL 3TFKC 5I8EB 4YBLC 1H5BB 2D7TL 2FO1A 2I07B 1OGAB 5TE4L 1LEKB 5EOTA 2X9XA 1DQDH 2WQRA 3ARRA 3CAFA 5DFWH 5C8JB 2CRMA 5GZNC 3BZFB 4A6YH 1H8OA 3FN0L 2QR0B 2JCCE 1G7QA 1F4AA 2F53A 2MJWA 3H42L 3LKSB 5E99L 4MJIE 4RMRA 4KQ4L 4PJ5E 4ZPVB 4PBWD 2QTEA 1OQXA 1WQVT 1M71B 4HMEA 2DI9A 2HJFB 3TA3B 5B39G 1J1XL 5CJQL 4M6AA 5JIPA 3WUWG 3SJVE 3K7UA 4UQ2B 2R1XB 2A1WL 3NPZB 1N0LA 3DJ9A 3VFGL 1TVBB 2H26B 3BZ4A 2VITB 1XF3A 1NAMB 4WEBH 4JPKL 1WBZA 3UJIL 4R2GB 5GRUH 3HZVB 4Y4KC 5HHOB 2IH1A 3BUTA 1ZHBB 2H1PH 2IH3A 2YMXH 1JHKH 1TPXB 3GMMB 3MRGA 1NDGB 1ZANH 4XWGH 4Y5VB 4LF3B 1WZLA 5FO8B 4PLOB 3PGDA 3OF6A 3ARDD 4P59H 4OFVA 2F8XC 2BNQD 3CVHH 5CJOL 1CDJA 4KV5F 4PS4H 4XP9H 1LDSA 5E6YA 3EYQD 4WTZA 1Z3GL 3ARGD 2ADIA 4RX4D 4PJAE 2EZ0C 2OS7A 5KSAD 3O9WD 1OAXH 4NSKA 4OLZH 1RUKH 3FB8A 2FYYA 3QUZA 2Z0BA 1Z0NA 3EJZC 3D0VA 1JRHI 3BVNA 2OX5A 4OM1L 4MAYA 5E7BA 4X6CF 3X14B 1FYTA 3D1MC 5DA0B 5CLTA 3TBSA 2B4CH 5C0FA 3G6DH 4KMQA 2NY4C 3BSZH 4U05A 4AMKL 3O8XC 5IB5B 4XPFL 1PGRB 2J8HA 5JA8B 4HG4J 1J7VR 4HBCH 4Z0BL 2FIRT 1DVFB 4WHYG 1MIEH 3KJ4B 2R23A 4ONHA 5L7XH 4RRPG 1Q9WB 1DBBL 2G75A 3QQ3B 1AGCA 4I0PD 2R2BB 1U95B 1IGMH 1JP5A 3BP4B 3P30L 4IOIB 4PRIB 3KS0J 2Z35B 4DGYH 4JO4H 4Q0XL 1KOAA 3RUGA 2AJ3B 4AT6A 1NSNL 1D5XA 5HSFA 4M61A 5IFHL 4OLYL 1GGCH 4GW5B 1A6ZB 4HIEB 5HYSG 1CFQA 4PGEA 3QEGL 1WUNT 2K7QA 1CGTA 2DM7A 5L2JB 3KPQA 5I1CH 4NCC2 3H8NA 3QJHA 4N5UA 2X42A 4PJIE 4CMMB 5IVNA 1BQHB 5T1LA 3S5LA 4HXAH 1YEDA 3AC0A 3AGVA 1X7QA 1X5JA 3I84A 3T2QA 3WFHA 5ISZD 1MCNA 5IMKA 3BAEH 3E2HC 1FVEB 1XGTB 1XR8B 3DURB 4LARH 2HFGH 1CDHA 4PJXF 5E5UB 5SX4I 4L3AA 3ZHDA 1KCVL 4HDIA 2MPAL 1INQA 3MACL 3U9UA 4IDJL 1OF2B 4N1HB 1FC2D 3BWUC 4LRIC 1QLFB 4TUOB 2ICWJ 4N90E 5D1XD 3RGVC 5GS2H 3ZT7A 2I9TA 3P9LB 4Z7OF 3KHOA 5LAXB 1WZMA 1J0YA 3LD8C 4TYUA 4TULL 2CJUL 5IB4B 1VACA 2WWMC 4ZXBA 1IBGL 3MSPA 3QUML 5SX5K 1NJ9A 2Z93B 1HZHH 1JJUA 3S9DB 4P5TA 3OG4B 3X11B 5DRNB 5BXFA 3DV4B 4QRSB 1AQKL 1J05B 4UOW0 4PJEE 4ZAKB 4LVOB 5DD3L 1HHJA 2VR9A 5ICYB 5DS8B 5AZEH 3C8KA 2ED8A 2ZZUT 4I2XA 3VXMD 2FEEI 1OP3K 4HGWA 3DRQB 2AXFB 5DLMH 1BBDL 2VZ1A 5GZOC 4M93C 4Z7NF 1BMGA 2BFVL 3AS0A 3BKYH 2WBJD 4YDVA 5ANMB 3VFWB 4EZMA 3GNMH 3PWLA 5DUML 2GY7B 3JV6A 1DQTA 3MROA 4JZOB 3A6OA 4WUUB 1IMHC 2A6IA 1H5BC 4L3CB 4NDMB 5DJ2A 3SKMB 4ZS7H 5F1IA 1A47A 3MR9B 4UAOB 3D85D 1VCAA 1XGYH 4K3EH 4YK4B 4XNYL 5HYQB 3CH1A 5JXAH 1AIFB 3WYRA 5A16A 3AREA 5JW4Q 1OB1A 4LSRL 1NGQH 3QHZL 4L9LB 4QWWC 5C08B 4IRSD 2BRRH 1E27B 4OLWL 4YQXL 3TA3C 4Q74A 4Z6AT 4OUOA 3RWHB 5I1GH 3AY4A 3VFOA 1C8PA 3QNZA 4PR5B 1IZKA 5I74B 2P8LA 5J6HA 1KTLB 5CEZE 5CZVL 1TDQA 5F7FA 3TV3H 1QBLH 4LSPL 5DK3A 2UZYB 3VFRB 3QFJD 2D4FA 4ZFZA 4ODWB 2NR6D 4POUB 1TQCB 2O5YH 1F4HA 2B2XH 4OZGF 4R2GC 3EDEA 5J89A 3BH8B 5JPNB 2DIJA 3OKDA 4P49A 2EDNA 1TPXC 2J2ZA 2ZPKH 3BH9A 3SGEH 4KUCD 3U2SA 3W81A 1P6AB 2FX9L 2X09A 5F89B 2XN9B 5DQJB 1KPVA 2COQA 4P2YA 2O61A 2UV3A 4XPTH 1QG3A 2FX8L 4UZGA 3IXTB 1ETZB 3HE7A 1J88A 4JPWH 3TVMB 3AUVA 4JRXB 1MAKA 1LMKA 3HLAB 2DI8A 4UOW1 1T2QH 3JWOC 4OUUB 3U7AA 3IVKA 4I77H 1BIIB 3ZE2E 2XZQL 3ECBB 5C07A 5EO1A 2R0ZH 4NRZB 3E8UL 5CBAA 1GZPB 2QSVA 4LOUC 3HE6B 2YD8A 4CN6A 4LL9A 1RZGA 1XIWD 1CTOA 1CZ8L 5FYJU 4NNXA 1B4RA 4YUEH 3OAYK 2R56H 4ZODA 5GGRB 1JZ6A 3SGDI 4I9WE 2IPUK 1VFAB 1IGFL 1DVFC 4OF5A 3LQAH 4IMKC 3FO0H 5CSGA 3KJ4C 4H5SB 4RGMB 2A9MH 4KU1A 4YHPB 2DICA 2MTPA 3LEVH 3QO1A 4MXVF 3MNZA 4WI5A 4X7TB 4DN4H 1X44A 3TYGH 4K94H 5BVPH 4WENB 3TZVC 4R4ND 5JW5A 2Y36H 1B90A 5CUSH 1J10A 1ZTXL 1K5NA 4K3JH 5DUBB 2DQJL 5H94A 2AK1H 5JXEC 4H25A 1CGVA 5EA0H 1D5IH 3RWJA 1KT2A 1FNEB 3BZDA 4OCYH 4EDXA 1TETL 3L95B 5CP3H 1UC6A 5T3XL 1IEAB 5E7FA 4OKVB 1OP9A 1T7WA 2R0LH 3WIHA 1E4WH 2D9QB 1VDGA 2XICA 1HHKA 4NO5A 5E2WH 1YYML 2VXUH 4GQ9L 3D0LA 7FABH 2VR5A 1U2CA 3DETD 4Z7WA 3SE8L 4XMLL 1NEUA 3FB6B 5TQ0L 3G5ZA 2AAVA 3VJ6A 4F7PA 1WFOA 4L8DA 5K93A 3EOBA 1BM3L 4XMPL 3F5WB 3CLFH 4QXTB 3UTPD 3DVNA 1R6VA 2XFXA 2H41A 3N0PB 2CSPA 3HN3A 2A83B 3QISA 4PRHB 2NNAB 3G6AA 1J18A 3QQ4A 1FBIL 4LLQB 1TENA 3W0WE 2E7CA 4HJGA 5EO9B 1U8QA 1OAKH 4XZUB 3NCJL 2C3WA 1FNHA 3SDCD 3HG1B 2Q1EA 4GSDH 1ZHLB 1FV1A 1ZWIA 2CLZA 2C5DC 1RUQH 3MLZL 1W0YT 1WFTA 4S1RH 4NYLB 1FZKA 2E9WA 4IRJD 4ZAKC 1A3RL 4LVOC 3P73B 4FABL 5DYOA 1FVDA 1MSPA 4JFPB 3RWCA 5DTFA 2CMRH 2XRAH 2FECI 2DQFA 4J12A 4M1DL 5D71H 4PGBB 1VKXA 4TPRH 1PZ5A 4OD2B 4QOKA 1JZ7A 1BQLL 2YUWA 1WZ1L 5L2KA 2PYEE 5I2IA 5D6CB 5I8OL 3I6GB 4BM7A 3VXRE 3CFDB 1U8HB 4CMHB 5EPMB 1Q38A 1W0WA 1G1CA 1NFDA 3QUXC 1FHGA 3NTCL 4JHAL 1I8KB 4FQPA 4ZNEA 3RUGF 2ORBH 4YK4C 2A73A 1Y18A 4NJAH 2XKSA 4CVXB 3QIUA 5F7UA 1KCRH 5FYJE 5HGDB 2ZUVA 1EO7A 3FFDB 2V6HA 5D2NE 1M7IA 2DQDH 5FHAL 1JI1A 1N59A 5C0JB 1MFDL 8FABA 3ZL4L 2MOVA 4NQDA 4NKDB 5TDNA 1CLYH 1TQBB 1MRDL 1M1SA 3BT2H 5CIPB 3GI9H 4YH6A 3ARFB 1R3HB 4QRRD 1N3NA 3EYSL 5I74C 1F5WA 3SDYH 4MJID 4Z7UE 4YHNB 2A2QT 4PJ5D 3TT1H 4FFZH 3MRBA 1A4KB 1J0KA 43CAA 2LFGA 2VERN 1SJEA 3OKYA 3SJVD 1PEWA 1TCRA 4Y16D 5EC1A 5C6TH 2GT9A 4X98A 4V1DE 1QVOA 2ZP0T 4HUXB 3OKNA 4YZFE 4JFEA 4NQXB 1XCTB 1OTUD 1RULL 5F7DB 4Y4FD 3I2CH 1I3VA 3QXAA 1UVQA 4M00A 1A0QL 3TGXA 2W0FB 4LCIH 1U8NA 3ROOB 3MRKB 4QTHB 3VDBA 4Y1AE 1QTYT 4XC3L 1GHFL 4ZFOA 1WIUA 1IKFH 5B39A 3OKEA 1M6OA 1A1MB 1G9ML 5FAAA 4HMDA 4WJ5A 3WUWA 1ED3B 2HLAB 2ED9A 1S7QA 4HLZG 4GRWB 5L6YH 1C16B 4O9HH 1RK1A 4XBGA 4PJDB 2JE8A 4OKDA 3TWCH 1I75A 3ZKXB 2WIIA 3QFDB 1A6AA 2KZ1B 1LP9A 3HCVB 3NCYS 4PJ7E 4RGMC 1JTPA 3VFUA 3L3GB 3KR3L 1U36A 1FNLA 3BPLB 4MNQE 4ZUSA 4LCWA 3SHSA 3FQUB 4V2CB 2NCMA 4UIKH 4AY0A 3PV6A 4F9LC 1AXSA 5ICZB 4PJFB 5KSBB 4NJ9L 3EOTL 1IFHL 1A1OB 3MLTA 4PY8J 1W8NA 1DBKL 3P77A 3FHQA 5IB1B 1FFRA 5FFLA 1CYGA 5L8JB 4Z5RA 1A3LL 3EDKA 4LAQH 1X5ZA 3C5ZD 3KLAA 4NT6B 3RJQB 3I6KB 4PJGE 1HKLH 3RDTD 5FHBH 3QDHA 3L3HA 3T1FB 3ZSTA 3RIFF 3GMPA 3WL9B 1Q72L 5IF0B 4A6YA 4LGRB 2ZSVB 5CCKL 5FK9B 4JB9L 2QHRL 3WIHL 4X9BA 2X41A 5E9DA 1HCFX 2LVCA 4JFYB 3RVXC 2D9CA 2IF7A 5DJZB 1YN6A 2OTUA 3QHFH 5CD3B 3TEUA 2UWEE 4OLEA 3UX9B 3O2VL 4NWTH 2VXVH 1JWUA 1VADA 3LCYA 1CXIA 3MRPB 1FE8L 4QY8B 1RJZA 4R26H 4XBEL 2F74A 5DQDL 3X13A 4OF6A 2N56A 2DBJA 2ICWB 5CGYC 3DXAA 1IL1B 2V7NA 3H3PH 1HDMB 2CKNA 2Y5TB 3PDOA 4XH2B 2EE3A 1NLDL 3NCCB 3T0VA 5EOQL 3HR6A 4WV1C 4Y4HB 2FH8A 3WKML 1UQSB 2APBA 4AEIH 4C56E 3CD4A 4LCUB 4KHTH 3QA3A 1KC5H 5F7NC 3OG6B 5EC2A 5EO0B 1P9MA 3VXPB 1NFDE 4B41A 1EMTH 2YD3A 3O4OB 1Q94B 1YNLL 3UPRB 2NY2B 4EJ1C 3KPSB 3TO4B 4APQB 3WN5C 3LV3B 4ZFFB 4GKZA 5I8KL 1P5UA 3UTZA 3CVHA 1EV2E 2QADD 2FZ3A 4F3FB 1VGEH 2P5WA 4HUUA 5ITBH 1ZGLP 3WFEL 4JVUA 4L3EB 4OCRL 1A7QH 5J7CC 3HNSL 2AJZB 1IZJA 4F2MB 5FYLL 4XI5C 1U8LA 1U41A 2AV1B 3CC5B 3MRCB 1IAIH 2YPVL 1NBZA 2BSSA 4MHHI 3JWDH 1PDKA 5CHNA 3QXDB 4FQQA 2CK2A 2P48B 2BOBB 1UT9A 3FO9B 4UUJA 4G3YL 3TBVA 4G8EA 4U1KA 4G42A 1DQLL 2FHCA 5J6GA 1C5DA 1U93B 4ZUTB 1XGRA 3PJSB 4AENA 4KDVA 3QDAA 1J0ZA 2AABH 1Q9OA 4GH7B 4KKAC 5HYEA 5FUOH 4LQFH 4UIMB 4Z7WF 2CGRL 2B0SH 4NKIH 4ZYKB 5AG8A 4JLRA 2V2TB 1YNKH 2ZUTA 5T3ZH 4DFIA 5C0CE 2AV7A 4Y19B 4PJ9B 2FD6L 2AJYL 3QPXH 3MGTB 2R4RL 2FH6A 4HS8L 3MOAH 2JJWA 3W2DH 3OF6D 5DJ8A 2YK1L 3DSNA 5CEZD 1AO7A 1UCTA 4KTEL 4EUPH 2PTVA 2LAAA 3B2UD 3GMNB 4ETQA 5DD6B 2JJSC 2WP3O 4Y2DA 2Q3ZA 5ID0B 5D7JB 5IR1B 1MH5B 3NCFB 3SQOL 3ZE0F 5HDQH 2GKIA 4N1CA 4CVUA 4M1CD 1L7IL 4W70A 1M05B 1OM3L 5IJVA 1S3KL 1G9NH 3P11H 5DVOA 1XF2A 1FYTD 2PN5A 1EHLH 4LSQH 2EIZB 4HWEH 1YEIL 4RGOL 4D3CH 1LEIA 3Q6FB 1D5MB 4P2RB 1FORH 1K8DB 1LO3H 4Z76B 1ZT7A 4RMWA 3GKZA 1LO4L 2V2WB 4OZFH 4PRDA 2W9DL 3FRPA 4ZFOL 1HH9B 1QEWB 3RA7H 3ZKXC 4L4TE 2OXHA 2RGSA 3MOBH 3CUPA 4L8BB 4OFPA 3BDYH 1A7OL 5DEGA 3KLHC 2PUQT 3HUJE 3WCYA 4Z77A 5MEQB 5TE6L 4WFGE 3BRFA 2UUDH 3BPLC 3M45A 2DTML 3EYOB 2VC2H 3MRMA 2YR3A 5T3XD 4JG1L 3D2UD 5GS0D 4PUBL 3PWVA 3GIZH 3QJFA 3O6FA 3BGMA 1A6UH 5EZJB 1PSKL 4Q2ZA 1ZE3C 3C60B 2AJXL 1M4KA 3GDBA 5BS0E 5DGQA 1JWMB 3EHBD 3UBXA 4MAUH 2OI9B 4P2QA 4RCAA 4U1JA 4MGXA 1YUHA 4AEEA 4P46A 3MYJA 2EIDA 4MMXC 3R06B 2E6JA 1JYNA 3BKCH 4QCIA 5J1TC 4MNHA 4JQXC 1DL7L 2EKSA 2EYSB 5INCA 2ID5A 1B0RB 2EDXA 4O2CB 1PYWB 2JB5H 3T65B 5HI5C 2W65A 1NH6A 3HPJB 1DQDL 3RWGA 4ZSOB 4F9PA 1I4FA 1I7ZA 4U1SB 3OAUH 4PRBB 4A6YL 4PJCA 3CZFB 5F3BA 2BJMH 1FVCB 4LHUB 4ZXBD 4JKWA 2YPKA 2Y07H 4O2FA 4MQ7B 4R0LA 4OZIE 4AEHH 4HF5H 2A6DA 3K4AA 2CDGA 2HT4C 1QFUH 3GSOB 4GKNA 3SDXB 4Y4HC 1IAKB 1ZVSB 4CAGA 5I66A 2NXZD 1U8JA 1A6PA 4O02H 2ZSWB 3W0WD 3SDAD 1ZHKA 2GCYA 4MCZB 5SWZE 3O4OC 4WEBL 3TNMA 3IS0X 3HAEB 2XWJA 4G9FB 5GRUL 3VD4A 1OTTC 1A14H 4RFNB 1EBPA 3BESR 2H1PL 4PJHB 2YMXL 3VFPB 1JHKL 2X4OB 3UPAA 1EO8H 1LP9F 2H8PA 1CGWA 1ZANL 4C4KT 5TFSH 4XWGL 3LQZA 3QSKB 1LNUB 1OGAE 3P9MB 4P59L 3T0AA 4R6UA 3NIFE 4FXKA 2BRQA 3CVHL 2ZCLH 4XP9L 4PS4L 3V5DA 3FFCB 4YDJA 3S36H 2XI9A 2YEZB 5F9JA 1OAXL 3ARED 4OLZL 1RUKL 3VMOA 1UXSA 3LKOA 5JPMA 1TZIB 2PYED 2AJSH 1KJ3H 1VPOH 4DUVA 1I85C 4FXLA 4Y89A 2FLRT 3KXFB 4P3WA 1BX2B 3VXRD 5EULV 2GQHA 1QFPA 2B4CL 3MA7A 4YE4H 1FZJA 3G6DL 1FZMB 1VFOA 3BSZL 3QUXA 1DQMH 1AO7E 4PRPB 3VGDA 2NZ9D 1KFAH 4XGZB 4H1LA 3RWIA 1A7RH 4HBCL 3OKMB 1EAJA 1MIEL 3FQTA 4BQCA 5L7XL 2YPLA 4MJ2A 4JM2B 4PJ9C 3TF7C 5DQ9A 5HHOE 4GXVH 5DRXB 1IGML 2NY0B 5E6IA 3OR6B 3MRFA 4DGYL 4JO4L 4NUJA 4PPTA 1F13A 3N85H 5CP3A 3P0YH 5IVZA 1P7HL 3IAGC 1PKOA 1GGCL 3P4NA 5C0BB 1HN1A 5D7JC 4R3SB 3L6FA 3U46B 4POZD 1CFNB 4X9GA 3ULUC 1JMXA 4JY4B 4MVBC 5I1CL 1G7PA 3G6JB 4ETYA 2LQRA 1ONQB 4XWOC 5T1KD 4HXAL 2VXQH 3BAEL 3RL1A 2VNCA 4JFDA 4UMGA 2PTUA 3LEXB 2PNDA 4LARL 2HFGL 1P7KB 4YDIH 2OTPA 2CRIA 2NTFB 3DUSA 1YEGH 4J1UA 5I1DB 1FCCA 4R7DB 1W2KT 1FDLH 4EKXA 2ATKA 4MJ5B 2WWKO 3RZCB 5D7SH 2DM2A 3BQUB 3P40A 1BZ9A 3ALPA 3MBEC 1MY7A 1CLOH 5HVWA 4FFVC 5IOPA 4PP1D 3WJLC 4UQ3A 3BEVB 2GJ6B 5GGSB 4M4RA 2VXSH 4PRIE 1MNUH 3WO4C 1HZHL 2VIRA 4X4MA 2VN4A 5HD8D 3D25B 1I7UB 3STZB 3PHQB 3C60C 5FM8A 5JW4M 3EGSA 4LPVA 2EEDA 1T1XB 5AZEL 5GSVB 4O58H 1CICA 4ZOCA 4OV6F 3DNKA 5DLML 1T66D 2OI9C 1CD1A 1NCUA 2JJUA 4PFEA 3BKYL 5HHPA 5GIRB 3GNML 5CD5C 5EZLB 5B38G 2GSIB 1HHHB 1EXUA 5D4QA 1G6RB 1U8MA 5FO9A 5F1NB 3T8XB 3C5SA 2CR6A 4LKXA 3JVGA 4YFDB 4ZS7L 5D5MF 1CGSH 1DE4A 1XAUA 2XWBA 1R3JB 1U3ZA 5E4IA 1XGYL 4K3EL 2JJTC 3JTTA 5BZDB 4U1HA 5F7HA 4KWUA 5HYJA 4PTUB 5JXAL 1MCEA 1VFMA 2QQNH 2UY7A 4CN4A 3GKWH 1J8HE 3I75A 1NGQL 1TVHA 2PCPB 3MO1B 1C7SA 1RIHH 2PTTA 4FXGB 3EDFA 2BRRL 3SCMB 1MCJA 1F4YH 2WNGA 3FQRB 3MV8E 5K33A 4P5KA 3MRHB 4NN5B 5ETUA 5I1GL 3G04A 2IQ9H 1YYLH 5D7IF 3QI9B 3ZYJA 1IGYA 5LCVH 5DUPH 3ZDZF 4CU6A 1V3KA 3TV3L 2AKRB 1QBLL 3UTOA 5FYLD 5DI8B 4EI5B 4NHUB 1I1AA 2EH7H 4JO3H 1E4KC 3O81A 4RFEA 2DLHA 2O5YL 4JREB 4HV8A 2B2XL 2P1YA 4Q6IA 5ANME 4RFNC 1TZHB 1L4IA 5ADPH 4C56D 2WINB 3L3KA 1FYHB 3MCKA 4EN3C 3MUJA 2ZPKL 3MA9H 4JDZA 4EBQH 2HT2D 4B0MM 1GL4B 3O45B 4Y8DC 4BH7B 5A2KH 3PL6C 1T3FA 1Y6NR 5I1AA 4WUUE 4FQHA 1A7PH 3QNXA 4OD1H 4RQQA 4HWZB 4XPTL 2EDRA 5I1LB 3U30B 4TRPH 2X89A 1IKNA 3FB5A 1X3DA 4JPWL 2BVTA 3F7PC 3OKOB 3B6SB 4FG6C 5I76A 1T2QL 4LSUH 4LSSH 3TFKD 2ITCB 4J3SA 4ZDHB 1A9BA 3TBWB 5EIIA 1FLTX 1EK3A 3KYOA 2R0ZL 3K8LA 4RAHA 3NCYP 1WZKA 4ORGB 3VCLB 3VXUB 3R1GH 4N0UB 4W4NA 3MRLA 3NIDF 3FQWA 5GZND 5FOJA 4YUEL 4DN3H 2R56L 2GSGA 4RAUB 5C0DB 3S6CA 43C9B 1AC6A 2F8VA 1JWSB 3LQAL 4MQXC 4KK9C 3FO0L 4U1GB 2A9ML 4WHDA 4ELMA 4JM2C 3LEVL 1Q9KB 1LEGA 2BY0A 3V79C 2RCSH 4DN4L 3TYGL 3GJEB 2GTZA 4K94L 2NY0C 5BVPL 4Y88A 1G7JB 3QXTA 3RX7A 2Y36L 3VFMA 5CUSL 2XN9E 5C0CD 5GQBA 2BHZA 4K3JL 3KPRA 3UYRH 5C6WH 2VWEC 4Y4KD 2AK1L 3EYVA 3RIFK 1D5IL 3KWWA 5CSZB 3QDMB 2YXFA 4JRXE 4OCYL 4MCYB 5GRZA 3KGRA 4JPVH 5EUOA 2R0LL 3KPPA 1E4WL 1KG0A 2C26A 1HHIA 5E2WL 2Q7YB 5JHDA 2VXUL 7FABL 2Q20A 3MREA 2ERJB 3O3DB 2CIKA 1Z5LA 5I75B 3WNLA 2EZ0D 1SEBB 5BV7C 2R2CA 3ZDYF 1INDH 3RVUD 4CL7A 3EJZD 3CLFL 1KIQB 4BKLB 3SE3C 3RZCC 4YC2B 1FPTH 3BQUC 3CMOH 1ADQA 3BP7B 1WCQA 2NY4D 4ENEC 1YY9C 2JB6B 1OGTB 5IFAH 4D8PA 5A2JH 1OAKL 5DZOA 1QQDB 1FL5B 3D3VB 4GSDL 4L4TD 5F96H 1GC1H 1RUQL 1VERA 2ZOKA 3JV5A 4S1RL 4QHNB 4C54A 4RA3A 3NZHH 3ILPA 4PG2C 2CUMA 4G8FA 4NC1C 4U49A 1T04A 1LD9B 3QZWB 2R69H 2CMRL 2XRAL 4JFXA 2Z91B 5D71L 2ADGB 3QEHB 5IG7B 4GO6B 4TPRL 1XZ0A 3QG6B 3T0XA 3S36X 5BJTB 4YPJA 2V9QA 1X5XA 1ZGLB 5BS0D 4Z0XA 5IQ9B 4NBXB 1QUNA 5ERWA 1S9VA 3OXRB 2BERA 2X4RB 1VFBA 3MZGB 2ORBL 4NJAL 5GRWA 5C9JB 4PRHE 3C08H 3DIFB 1KCRL 1EDQA 1AP2A 1I7TA 3NABH 2P8PA 3SDDB 1T5XA 3L7EB 1L0QA 2DQDL 4NKQB 1FIGH 4M1GH 4ZQKB 3HG1E 5F9OH 1HI6B 3SCMC 3V6ZA 1CLYL 3BT2L 4QHUB 2GI7A 3GI9L 3RGVD 1E28B 2HFFB 4GBXA 4HPOH 3MC0A 1ITCA 4X6DA 3CXHK 4GG8A 3KG5A 3SDYL 5F88A 5GSRA 2L7JA 2GIYA 5KAQF 3WEXB 2P44B 2VDKH 2DYPA 4FFZL 3TT1L 4EUPA 4MNGE 3ZDXE 5F7KC 1YEEH 4JREC 4Z7QF 2BNRA 2P5WD 4DWHA 3GJFB 1XF4A 4O4YH 1I3RB 2I26N 4HGMA 1NPUA 5BQ7A 5C6TL 4HHAB 4I3SH 4LLAA 5CKAA 5TDOB 1CVRA 3MNVB 1II4E 4IOSD 3PHOA 5SWZD 4DZBA 4YBQC 1Y6MR 1HEZA 3PP3H 3RIAK 3PWJA 1ORQB 5GZOD 4NQTA 1YNTA 4WW1A 2YBRB 3U30C 3GGWB 3I2CL 5FXCH 1KLFA 4NM8H 3BPCA 3MRRB 1CDYA 4LCIL 4X6BA 2X4PA 2P5EA 4HD9A 3CIQA 5F7LB 5MP6H 4K9EC 1DQJB 1KEGH 3I3BA 4OZFA 4F7TA 1OGAD 5KN5A 5JDSB 3QWOB 1IKFL 1U92A 2KUTA 3C6SA 5DFTA 1H3GA 4LVHB 4HX1B 1AQDB 3H7BB 2MQCA 5C0AB 4AIXA 3M17B 3ZZ1A 2AW2A 5L6YL 4O9HL 2DAVA 3TNNB 4U6HA 3TWCL 3GMOA 2EDLA 1AGBA 5IMLA 4QWWD 1MCIA 4XXDA 1I85A 4HLJA 4U1GC 3MV9B 1TZGH 3TA3D 2JK5A 4BUHA 5HHVH 4X8JA 4X7CC 1AO7D 3C6LA 4LKCA 4UB0H 3ZKSD 1TFHA 3GRWH 3GBLA 4P3DB 4NIKB 1MRFH 4UIKL 4X0KA 4Y2DD 4DKFH 3U79A 5DD0H 2ESVA 3DGGB 2NQCA 2W91A 4Q97A 2FLBT 5SWSA 5I73B 4X6FB 1ZLUH 4J4PA 3X12A 5HHOD 4P23A 4MQTB 1WIOA 2GK0B 3HPLB 4KI5C 2A0LC 1PBYA 3W5MA 4HFWA 4LAQL 5CEYB 4IS6A 1Q0XH 3NFPB 3T3ME 3HZYA 2Q6WB 3BD3A 2ZG2A 4F8QA 2ERJC 1HKLL 5FHBL 4DCQB 3V5HB 1P1ZA 5I75C 1YJDH 2P8MA 3V4UH 2VL5B 5C6PB 2IBGA 4PLNC 4GRWE 4BK5A 4C83A 1BQHG 4X4XA 3P4MB 1JV5A 1BIHA 4PJDE 3MRNB 5H35A 3REVB 5D7LA 5CGTA 1F4WH 3QHFL 5EORH 1NGZB 5D6DC 2Z31C 3K2MC 3ULVC 4NWTL 4YC2C 1CFVH 4LOUD 4AL8H 2VXVL 5I16A 4H8WH 4YAQA 4LEXH 2ZOLA 1MFNA 2D31B 4FQXC 4R26L 5AYUH 3X3GH 3DUUA 5TJWK 5FF6A 2UVFA 2V5SA 4GG6B 3H3PL 3QB7C 2H9GA 4PJFE 5KSBE 2A74A 5LQBH 1J5OH 4OGAC 1CE1H 4BYHA 4AEIL 4LAJH 4PP2B 4KHTL 1OTSC 1KC5L 2GJZB 4IJ3B 4P2QD 2OBGA 2EE6A 4EI6B 1RK0A 3R8BB 3E6HA 1EMTL 4PRID 1MFCH 3TZVD 3M1BB 3TBYB 4HS3A 4JZNA 2R4SH 2YRLA 5J06A 1X5KA 1RJLB 3VXTA 3UBXI 4HKJB 5AUMB 4PGZA 5ESAB 1VGEL 2C3GA 4QO1A 1G7LB 5IMMB 5ITBL 5JXED 1A7QL 5C09A 4ELMF 4YO0A 2CLVA 5CBEA 5KBNC 2AXHA 2BOCA 1IAIL 3VRLF 5EBMA 3BPOC 1ZA6A 3JWDL 2HFEB 5FA3B 5HDOA 5KSAB 3O9WB 1YEKH 4I4WB 4QRUA 1NUFA 1ND0A 2YD1A 1L6XA 1P53A 5I0ZA 4JANA 1OAQH 3SDDC 4R8WH 4NRXA 1MCFA 2BC4A 3V6OC 1CD8A 3RY6C 3HMXH 3SKNB 3EO1B 4M03A 4F33A 1RFDH 3FONA 1RHFA 5EUOF 3CPLA 1MF2H 5H2BA 5FUOL 4LQFL 4E5XB 2GITB 5A43C 1T1YA 2B0SL 2YN3A 4NKIL 5E8EA 3O4LB 1T89C 1J8HD 1WAAE 1YNKL 5T3ZL 5CINH 4K2UH 2B39A 3KPSE 1T20A 1U8PA 4G6AC 3MV8D 3QPXL 4JFHE 4QKXB 4I0PB 1BWWA 3MOAL 3IETB 4O51B 2GUOB 4ZAKD 3W2DL 1MFAH 5JQHC 2DRUA 4PV9B 3P9WB 4S1DC 3I6LE 1BFOA 4YXLH 3BZEB 3ARYA 2ZUUA 1TCMA 5HDQL 2DQUH 3L3DA 3OXSB 1L0XA 3ZKMC 1KLGA 1F6FB 4YEFA 3W5NA 4GUPB 1DUZA 1G9NL 3P11L 3K8KA 3QULB 4KDWA 3FN9A 4WUUD 4F7CB 1EHLL 4LSQL 5TH2A 3F7YB 2EEAA 4PYHA 4HWEL 1WV7T 3QUXD 5ISZB 4D3CL 5IHBA 3KDMB 1FORL 1LO3L 4PIRF 2NYYC 1U8OA 1IGJA 3EOAB 4KMTH 3RNQB 5FKPA 3H9HB 3QO0B 2GW5A 1DSFH 1MVUB 3GSVA 3RA7L 4OZHE 3F6IA 2AK4A 3OAYH 3MOBL 4W81A 1SY6H 3BDYL 2E27H 4Y19E 5D1XB 1EFXA 4CW1B 3QWRA 1KB9J 3LH2H 1A7BA 1CS6A 2CO6B 3VH8A 3VXSA 2IPKA 5DK0B 2VC2L 3FZUD 4CADB 2CRYA 3FT3A 5SWQB 4W6WB 4QTIL 5DFVC 3GIZL 4LIQH 3TN0C 2IAMB 1BOYA 1A6UL 2AP2A 3QDGA 5I73C 4HUVA 3DLQR 1QHOA 1JHTA 3ULUE 3MUGA 3VXMB 1NFIB 4OFYA 1AD0B 1DQQA 4MAUL 2H2SC 1G7HB 4LLUB 4FZ8H 2XN9D 1EX0A 4JFDD 4N8VB 2PETA 2WBJB 4U6YB 3BKCL 4JY6B 9CGTA 1DZBA 1R24B 3U6RB 3KNBA 1J1PH 4P2RE 3STLB 5ENWA 4JRXD 3WFDH 4BK4A 3NGBB 4W6XB 4BZ1H 2JB5L 5AAWA 2ED7A 1T7ZA 2QQLH 3D85B 4ODTH 1T80A 4JFFA 3KPLB 5F3HB 4F80A 3OAUL 3FO2A 3E1F1 5J4MA 2BJML 4HKBB 4X7DC 1HSAB 4IRZH 4WW2A 5D2LB 4X7EC 2Y07L 3KYNB 4P4RB 1HXMB 2JKXA 5ITFB 4AEHL 5LJYH 4HF5L 3UTTA 4IRSB 1RZJC 2EDWA 4RDQG 5CIPH 1QFUL 2JELH 4JKLA 1CBVH 1K8IA 5BVJB 1EA9C 2IANE 3OJMB 4MJ4A 3IXAB 2E9BA 4JRYA 4KVCH 5GISH 2YC1B 4O02L 3A6BH 4IJ3C 5DT1H 1T0NB 3FN3A 3QEUA 1ZLSH 3UDWA 4R7NB 4LP5A 3QFJB 4P2CG 1MWAA 3DWTA 4GS7B 5IBLD 4JZJA 1NGYB 1A14L 5LKNA 3EFFB 3QCVL 3NZ8B 1EO8L 3QCTH 3SGKA 5TFSL 4DJMA 2KQMA 3VFSA 4LBEB 4LEOB 5D8JH 4KJYA 5J12B 2ZCLL