5EORL

Structure of the murine antibody fab 8e3 bound to the vaccinia virus a27 peptide 101-110
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
217
structure length
217
Chain Sequence
QLVLTQSSSASFSLGASAKLTCTLSSQHSTYTIDWYQQQPLKPPKYVMELRRDGSHNTGDGIPDRFSGSSSGADRYLSISNIQPEDEAIYICGVGDTIKEQFVYVFGGGTKVTVLGQPKSTPTLTVFPPSSEELKENKATLVCLISNFSPSGVTVAWKANGTPITQGVDTSNPTKEGNKFMASSFLHLTSDQWRSHNSFTCQVTHEGDTVEKSLSPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti vaccinia virus A27 antibody 8E3 heavy chain
publication title Linear Epitopes in Vaccinia Virus A27 Are Targets of Protective Antibodies Induced by Vaccination against Smallpox.
pubmed doi rcsb
molecule tags Viral protein/immune system
total genus 52
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2015-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eorL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5eorL01
2DBJA 3ABZA 1OLZA 1F02I 5B3NA 3KNBB 5ENWA 4XNMA 4QCIB 1C5BH 5D8JH 4N5UA 2YD5A 2XWTA 5BQ7A 1NAKL 5LCVL 1TZIB 2UZYB 5J3HC 3KHQA 5D2LA 4UNUA 3N06B 1KF9B 3WUWG 4P23B 3TV3L 5JORB 3C8HA 1RZJH 4PJ8B 4APQD 4OGXL 3UDWC 4X80L 2O5ZL 1W72A 2WV3A 4TVPD 3CJJA 4OUUA 3BQUB 3MRDB 4I77H 4QO1A 5FA3B 1CF8H 4KZEL 2VITA 3TBWA 3DX7B 3BPNB 3RX7A 3E6FA 3MV9D 4DGYH 1KTLB 4S11A 5T3ZD 1ZA6B 3PL6A 4R4NC 3OKOA 1P84J 4PRAB 5INCB 5DGQA 1R5VB 1UZ6E 1MIEH 3A0OA 5ILTL 2ADJB 1MCDA 5HHOE 5JOEA 4ORGB 4X99B 1ZMYA 2IJ0C 4CAGA 2EIZB 2H3NA 3OKKA 3OG4B 3B5TA 2F8VA 4WUUD 1F00I 2EECA 4LARL 2BNRD 4NHUB 3QCTL 2J8UF 2CXGA 3ILPB 4XCYA 2BFVL 3MRIA 2CDFA 1S7RA 4DAGL 3MO1B 3IDNB 4MX7A 2ED7A 3DYOA 5GGSB 4EIGB 1WUNT 2NR6D 5E00B 5T3XL 3P4MB 4CUCA 4M3JA 3ARBD 2G9HA 2X9XA 4R4FL 5GHWL 4ZUSB 3BDXA 3GGWA 1ZSDA 4I3SL 4U1NB 3WUWA 3CNKA 3GHBH 2IG2L 4OD1L 3IXAB 5IMLB 3RBGA 4KJWD 2VSCA 1KLUB 1LVEA 3LS4H 1CFSA 3CDGB 2HMIC 4X7DC 4R26H 4U0QB 1ED3A 2W0LA 1FO0L 5H35B 5T3ZL 1EHXA 4YUEH 2B0SL 3ZDZE 5I1GL 4DKEH 4PJAE 25C8L 2VWEC 5M7QA 4CVWA 3K4ZA 1D9KC 3GSQA 3MACH 4KK5D 1MSPA 2XTJD 4N9GA 4EDWL 2O5XH 3GKWL 1S7XA 5MI0C 5MENA 2NY6D 4GKZB 5TDOA 1GHFH 5C08A 4H1LH 4PB0H 4X6FB 2VAAB 4XB7A 3VXME 3UP1A 1TJIL 1KJ3L 3UTOA 1QTYT 5I16A 1OTUC 1IM9A 3HNVH 1JF1A 3LQAC 1FPTH 4L4TE 1JHKH 5FF6B 3PWVB 1BVZA 1U8JA 5DD1L 5IWLC 5T5NG 1XF5B 1GGTA 4ZUWA 3UBXG 2Y25A 4DZBB 4U2ZA 4PJIB 3ZTJH 1IL1A 1NGWB 4Y19A 1I9EA 1S9WA 4XP4L 5HI3D 3DWTA 4TPRL 1CQKA 4GRLC 4ETQB 3ULVD 1KCRH 3SGEH 3WFBH 1BFOA 1GAFH 5D2LE 3RUGF 4MXVF 3IS0X 5EUOB 4DKFH 1U58A 4Y1AA 3LQAH 1ZT7B 4POZC 1GOFA 4IRJB 5C9JB 5FXCH 3BEVB 2HAZA 2ZUXA 3CFKB 2VAJA 3UTTA 3DUUB 3AS1A 4LPUA 2WQ8A 2GJ6B 5F6IB 2YXMA 1E28A 2DOCA 4HKBB 4OLZL 2F53A 3PABA 3QWRA 3V6ZB 1MI5A 1QRKA 3QNYB 4QRTB 4WVRA 2V7HA 5T1MA 3GSWB 4BKLA 2AEPH 5TJWK 1UZ6F 4JFEB 3WHE0 4YE4H 5IMMB 2GSIB 2NX5B 3BFOA 1K8DA 5I1EL 2RGSA 4MAUL 1ES0A 1RZ8B 3TZVB 3U4BH 4XP6L 1DQQA 3RGHA 1I7UA 4ZNCD 3V6FB 5DJYB 4AEFA 3I6KB 4OTXL 3BGFC 1OARL 1JN6A 1FSKB 4U6YB 3MUJA 4HXAH 4LU5H 3RDTC 1GGYA 3ULVL 3AY4C 4NQEB 3GO1H 5TE6H 2IMNA 1EBAA 1J0JA 3HNSH 4M7LL 1JRHL 3UBXA 4UB0H 5E7FA 1UJ3C 5C0FB 4JRWA 1KG0A 3VFUB 1OT1A 4UV7L 3KPSE 2A9NL 4N1HB 3KR3H 4UTBH 5TE7L 4Q2ZB 3R0NA 2B1HH 4P3WA 1G7JB 1TQCB 1IGMH 1E4KC 4IIQA 4Y4KD 2FHCA 1DQJB 3ARGD 3ULSB 4PRHD 3FAWA 5KS9B 3E8UH 3ZDZF 2GUOA 2GT9B 5DMGD 4XBPB 1CD0A 4WFHD 1IZKA 2IPTH 4NZRL 5HBBA 4RFNC 1LEKA 3GSOB 3BW9B 4HKJB 4MQ7A 4Z9KB 1Q9WB 1HK6A 3P73B 1G9ML 5GGQL 3HI1B 4LSTL 1YYML 3U9PL 2P44B 2IAMD 3QQ9C 5EBLA 2NXYB 4LCWB 5MENE 1SJHB 4YIQA 3RZWA 1YEJH 1HCFX 1N59A 2A73B 1JZ3A 1FHGA 5C08E 3CGTA 4XBEH 1PZ5A 3D3VD 1WZ1L 4WFED 1QACA 5J1TC 5CWSB 3O6KL 1AD9B 5E5MA 1DUZA 1EZVX 5T5FH 4P2YA 1WAAA 2DDQH 4Z5RA 2E7MA 4ZODA 2NXZC 5BS0D 2Z92B 3EJYC 2A0LD 1CD9B 3BUTA 1V3KA 1X3DA 2YPKB 4JR9L 5D2LF 1VGKB 2HG5B 1HI6A 1MCPH 1KLGA 3V0WL 4GT7A 4S1SH 3L1OH 3VWKD 1KYOK 1Y18A 2OJEA 4JPWH 5K93A 4Y1AE 3W9DB 3MLRL 5D1QA 4JZJA 3I75B 4Z0XA 4NO2A 2BSSB 4LNVA 3MRKB 3UTTE 3ALWA 1BBDH 5IM7A 1B4RA 3L9RA 1D5MB 4LVHC 1KSRA 3EYVB 1PJ9A 1OD9A 2F53E 2UVFA 3CH1A 5DSCB 5DLML 2QLVB 5GGTL 1FN4B 3KXFD 4U31A 3HUJB 2DYPB 7FABH 3GEWB 6FABL 2KZWA 3V6BR 3DVGA 3HPLB 1OGAA 5KANG 2PW1A 2PN5A 3FN0H 3LSOB 3NPSB 4WO4B 3PWUB 5IJVA 5KSUA 3AREB 5IOPA 1IEAB 2B20A 1X5AA 2DBLH 2YS4A 1IFHH 2R2EA 2B5IB 1QA9A 1T5WA 4GRWB 3GMLB 5IF0A 3VD9A 1RIVL 5J8OA 4FQ2L 4NYLB 4XBGA 1LE5B 3RFZC 4UUJB 2F9BT 3VW3H 3ZT6A 2WBJC 3UJJH 3ARWA 2FZ3A 1HH6A 3EO9L 1PDKA 4CJ1A 3ROOB 4MNQE 4CDHA 4LLAA 3QFJE 4FMFA 4MJIA 3SKJH 1I3VA 4FG6D 4RGMC 1EMTL 3U82B 1JZ7A 1NMCC 3HZMB 3TBSA 5TQ2H 1BBJB 3WIHL 1YEDA 5L6YH 2HRPL 1CK0H 1I8MA 1D6VH 3SQOL 2Q3AA 2L0DA 3LKNA 2BSTB 4C54A 4P2RB 1FZJA 1F5WA 2J6EA 4NRYB 5L2JB 3AU1B 3CPLB 3IDJA 3OHXB 4DUVA 4LCUA 5F72S 3SDAD 3B2VH 4ETYA 3P30H 3CVHH 3ZDYE 1G7MA 5EU5B 1P2CA 5FAAA 4XCCH 4KRPB 4L4VB 3VXTB 1JGUL 1KBGL 3BP6B 2DM2A 5GGRY 2OTUA 2R4SH 4G6KH 5C09D 4WDIB 5D96C 1RFDL 4HAGA 1FZMB 1YY8A 4V1DB 1I8KB 3KNBA 1EUUA 4QCIA 3PGFL 4MJ5B 3HE6D 3PL6C 5J12C 2QTEA 3B4NA 1W72H 1TZIA 5SX4I 5JW3H 5L8LB 4AIZB 4P23A 1EEZB 5JORA 4X98B 1A6WL 1WAAE 5J13C 1AFVL 2XZAL 3D25A 4MNGB 4X4XB 4NM4L 3BO8B 2HJFA 5DA0B 3BQUA 3MRDA 4JRXD 4YFLF 4ONGL 5FA3A 2EIEA 4LSSH 4S1DC 3C08H 3DX7A 4HAFA 2GHWB 4QHKI 4L4JA 4Y4HD 1KTLA 1ZA6A 2VKWA 1F4YH 3MA9H 3V5DA 3LZFH 1A5FL 4EXPX 2R9HC 2ADJA 5KVMC 4JQIH 4ORGA 4X99A 2NY5L 3AC0A 1T22B 2JIXD 2J2ZA 1TETL 1F11B 4FQXD 3HRPA 1TTFA 5DQJB 3ILPA 1OGAE 1NUNB 1ZA3B 1G1CA 1RU9L 3MO1A 4JO2H 1PG7L 3F7PC 4Z7VB 1A7RL 5GGSA 2D0GA 1L9MA 1MCBA 3IDMB 5C07B 4HPYL 1I7RB 2L7UA 1YN6A 1OQXA 3CLFH 1NLBL 2ZUVA 4U1NA 2YOCA 4IEFB 1KLUA 5T5NF 2OK0L 5CS7A 3CDGA 3LS5L 4NO0A 3NA4A 5FGCE 5H35A 1TNNA 4Y8AA 2A6KA 4Z6AT 3DV4A 5GQBA 3IFNH 1X5IA 3GJEA 3MGTB 3WFCH 3GBMH 4FFZH 1UCBL 1DEDA 5I18H 3FB7B 2D7NA 4P9MH 1FIEA 4PP1C 1G9NL 2AXFB 2AEQH 4CKVX 4NC1E 4GKZA 3ZDYF 1KCUH 3ARDB 1DQDL 2VZ3A 5C2UB 4GAGH 2BP3A 3TFKC 1I1RA 1WC7A 2VAAA 2VZVA 5DJAA 3MRFA 1JHTB 1F8TL 4PLJD 3S34L 1SHMA 3BT2L 1TJHL 2CUHA 2ZJSL 2ZUQC 2NLJB 1QSEA 3RP1A 1RUKH 5FF6A 3O3AA 2VXVL 4Y2DB 1CGVA 4UOJA 5E9DA 3G6JA 1XF5A 2ESVE 4U0RC 4DZBA 4V2BA 5F3BB 3N1QC 2VJXA 5EG6C 1NGWA 2ARJQ 4YHNA 5B22A 4ETQA 2DQIL 1WAAF 3K1KC 5EUOA 3TWCL 4KKNA 5E2WL 1RK1A 3WV0A 1D5ZA 4IRJA 1WLHA 2DJSA 3M45A 3QDJB 4TN9A 3CFKA 3MA7B 4JHWH 1IGJB 4GUPB 4J3SA 1JV5A 1FZOB 4PV8B 4HKBA 1CBVL 3KYMB 2I5YL 3FT2B 1S78D 4XPTL 3QNYA 4QTIH 4BQCA 3OXSB 4QRTA 4KMQA 3F5WA 5BRZD 4M48L 2P5EE 3RVWD 3GSWA 2V9QA 3QIBB 3ARVA 4TUJB 1DTUA 4ZFZB 4TTGA 3QR2A 4JDVA 2GQHA 2NX5A 3BKYL 1J0YA 1HHJA 3SY0B 1JNNH 4YBLC 2VSDA 4YHOL 4KKAC 1FC1A 3CSGA 3LIZL 4LVNC 5GGUA 2CUIA 4IIQC 3NACL 2WQRA 3M17B 3V6FA 5DJYA 4R7NB 3BX7C 3I6KA 3PWPE 5CZXC 3PHQA 4UNTA 4XNYL 1RUMH 2QL1A 1JZ6A 4U6YA 2VLMD 1BZ9B 2BXYA 1T6VN 3BYYA 3BHBB 3T3PE 4NQEA 3AS3A 2XZCH 4E5XA 5BZDB 2MQ0A 4XWGH 1RIHH 2ZNWA 5C0FA 3S88H 4U1MB 1TQBB 3VFUA 5DMKB 4P2CG 2HFGL 3OR7B 4HJ0D 2K7PA 1ZHKB 3ECBB 2JKXA 4Q2ZA 1I4FB 4HK0A 4NRXB 1TVBB 1QNZH 1QBMH 2YK1H 2IFGA 3ULSA 3B6SB 4JDTH 1JPST 2EDQA 1MH5A 2GT9A 3LKOB 1I75A 4R2GD 1UACH 4XBPA 3WEXA 3RVVD 3GSOA 4HKJA 2E27H 4G5ZH 4JPVH 4JRYB 1NANI 5HDBE 1S5IL 3HI1A 2WBKA 3T1FB 4X6DA 5I0DA 4JREB 3T0BA 4LCWA 4OLVH 4RDQG 4DVBB 1LEGA 5I9QC 1MIML 2QQNH 5KVFH 1JNJA 2FEDD 3AFLA 4CU6A 5BOZG 5CSGA 3MV11 4KJQD 3TN0A 2CMRL 3FOLB 5D1QC 4JZJC 3NBNA 4RMQA 3KLAB 5CWSA 3IDXH 2VZSA 4PRPB 2EE6A 4Y5YB 4RGOL 4LPYA 4E41D 3EDKA 4F9LA 2BHYA 1QSEE 3SDDB 4NZTH 3D2UB 5D7JB 2Z92A 4HBCH 5E9DE 3ARFB 3RTQA 3G6JE 3G5YB 2XN9B 1VGKA 5T1KD 1FFOB 4OGAC 3QJFB 3IFPB 4M6OL 5HYJB 3DO7B 3W9DA 4QXUL 2ZUTA 3I75A 1AR1D 3OAZK 5L0QB 1RULL 2BSSA 1CDCA 3MRKA 5CGYC 4HH8A 3UJIL 3EYVA 5A2JH 2DQTH 4OQ1A 3REVA 2A2QT 2UZIL 3OXRB 5D2NB 1WSST 5E2TL 4APQB 3S3JA 1A6AA 4GG8B 4WO4A 3PWUA 2ED9A 4M6AA 2M2DA 3AREA 1FNSH 3FO0H 4P9HL 4OQTL 5C3TA 5HD8C 2AKRB 1LO0H 3GMLA 1QFWM 3O3BB 3EZJB 2K9UA 4OUOA 3MV9B 2EIDA 1FO0B 2HVKB 4NYLA 1LE5A 1A6VL 4O2CB 3O41A 3NCBB 3V7AG 3CFBB 1G7LA 4K3EH 1XCTA 2EZ0D 4U49A 4NQEE 5F88A 3ROOA 1B0RB 1RZGB 4KMTL 2VUOA 1TDQA 3OJDB 4WUUB 3OAZH 2OJZH 1R24A 3HZMA 4JFPB 1A3QA 2BNRB 1BBJA 1YMHB 2HWZH 5JW4R 4LSUL 2AQ3A 2WINB 4QHMB 2AI0H 4YEEA 4NRYA 3ZSTA 2HJLA 5L2JA 3AU1A 3CPLA 5JR1L 1TVHB 3OHXA 4EJ1C 2C3GA 3H3KA 5DRXB 1MJ8L 2IMMA 1OGTA 3RWIB 4JZNB 4P23C 4PJ8C 4HDIA 1FYHB 2X4OB 4L4VA 3VXTA 1WIUA 4DUXA 5CEZE 3BP6A 2YA2A 1WCBA 1H0DB 4M1DL 1HHIB 2OMNA 2CRIA 1XGTB 4WDIA 4X6DE 2NTSP 4I13B 3BQUC 1K5NB 1FZMA 1T5XB 4NO3B 5F93C 5I1IL 2IBBA 4V1DA 4MYWB 4ZTOL 3SKUD 1DBJH 1S5HB 3BPNC 3QQ4B 5CSZB 1P4BL 3O2VH 4MXWH 1UT9A 2XTJB 3OBAA 3QDMD 4RBPK 4G8FB 5IHZB 5IJKA 4AIZA 4X98A 2FH8A 4W4OA 2DD8H 3UMTA 3DMMD 2EDKA 4ZG1A 3G6JF 3X14B 4AM0A 4QY8B 3BJ91 4MNGA 3MQIA 4X4XA 5IB5B 1WWWX 3BO8A 3MRCB 4EBQL 1FVDB 4BSJA 4J6RL 4NKDB 1MCWW 2EYSB 5CIPB 1DL7H 2FD6L 5EUOF 2XQBH 2VMFA 1FIGL 5H94B 1QEWB 3DVIA 3F65A 1J9CT 4LIQL 4K9EH 1ERNA 3X3GH 1JWMA 4TYUA 5CD3B 1AP2B 1G6RB 2Q7NA 2DIAA 3LN9A 4JG1H 4YJZL 3TNMB 1T22A 5C0JA 1F97A 1UKTA 3MNVB 4NQTA 3MZGB 3V9FA 4AG4H 2XNAB 1A14L 2BRRH 5DQJA 1UYWL 1ZVSB 1L7IH 4HFUH 4LGSB 1AI1L 1ZA3A 1EFXD 3QUZD 4RBPH 1OAUH 2ZUYA 4Z7VA 2EDFA 1AGDB 2YA0A 1EHAA 3UJTL 4KPHL 4URTB 1H3VA 3DX6B 1ORSA 2OR9H 5C07A 3RQ3A 1C1EL 4KHTH 3FB5B 4R97B 2DF3A 2DWEB 3FB8B 2BVOB 4FMKA 1ZS8B 4KFZC 1P4LB 2V5TA 5JW4M 1LO2L 1BQUA 3BZDA 3O3EB 5FO9B 5AZEL 3TT1L 1UM5H 2RCSH 5K9JH 3SGDH 1ZVHA 5GRJH 1F2XK 4OD2B 4YH6A 1OM3L 3MGTA 3ARPA 1OCWL 1OTTD 3QDGD 2AXFA 4MJ4A 4PJ7B 1I3RB 5GRUL 3ARDA 4LCCB 3OSKA 5AWNL 1B88A 1G7PB 4Z95H 5DD6B 3LKPB 2XZQL 1Z5LB 2FX7H 3EHBD 4P4RA 4MA8H 2WW8A 3UPCA 3BAEL 3WSQL 5LVEA 1O0VA 4IRJC 1JHTA 5DO2D 4X6DF 1BZ7A 4ZPVB 4Y4KB 1PD6A 3ARGB 4PRHB 3ZL4L 2AJSL 5F6IC 4KZDH 3H0TB 2R69H 3Q48A 4N1EA 4Q0XH 4Y2DA 4V1DE 1E6JH 1CT8A 5DUPL 3VMPA 3VDAA 3V6OA 4ZFFB 1NMBH 1Z9MA 5F3BA 3DECA 5ETUA 4GMTL 1MJUL 5C86A 1TPXC 5FGSA 1GVIA 2GAZB 3QHFL 5DT1H 2V9RA 2IAMB 5F7HA 3F58H 2YN3A 3QDJA 4N8VB 3G5VB 1NMAH 4MA7L 3OB8A 1BOGB 3LMJL 1G6VK 1IGJA 1W0YT 3OKNB 4WCYL 3T65B 1FZOA 5GRYA 1FSKC 4PJCE 4HW6A 5E8PA 4XH2B 4UV4H 5FM5O 3WFZA 1OLLA 1S9VB 3QIBA 2X41A 3QSKB 3D39D 5BS0B 4QRRD 2J8HA 4JFDD 4KK9C 3E3QE 4WHDA 3MXVH 4PJDB 5K9QG 2MCPL 4PV9B 3OWEA 5I1CL 4MWFA 1YQVL 3HKFA 1TQCC 3EDFA 5C1MB 2GKIA 1ZT1A 5LJYH 2DLTA 3M17A 4AENA 2HT2D 5AAMA 1MFDH 1YEHH 4R7NA 4H88L 2FJHB 4KJYB 1J11A 3OAUH 5D7KD 4GBXA 4RDQF 3FT4B 1K85A 4Z7OF 4ZFGL 5C92A 3R06B 2Y36H 2G5BB 1KEML 1ROWA 3BP5B 4RAHA 4TUKL 3BHBA 2NZ9C 2JE8A 4GRWF 5H37G 3DVFA 5CAYB 5IMOB 1FG9C 1JGLL 4U1MA 3JVGA 5DMKA 2X05A 1V05A 3KXFB 2AAVA 4M6NL 1A6UL 3ECBA 1A3RH 1PKQA 3TH2T 1I4FA 1UXWA 5EB9A 4U7SA 2Q1EA 1TVBA 2IALB 3ESVF 4HWUA 3Q3GB 3QXDB 3I6GB 4RMTA 2NY0C 5AG8A 3WHXB 2CLZB 3B6SA 3GI8L 4O4YL 5CEZH 3LKOA 1HXMA 2AXGA 4BQ8A 2AK4D 2Q86B 4G6ML 4WENB 4F9LC 2I60L 3WKMH 2L7JA 4JRYA 3IGAB 2XXMB 4J4PA 3RTQC 3T1FA 4QTHB 5HI5C 4MXQD 4BYHA 3T0ED 5DUBB 2ADGB 3QPQC 4DVBA 4WEUD 1JF5A 3K7UA 1OWWA 1WBYA 2R0WL 1NEZB 4DK3A 2VRAA 2JELH 3FOLA 2EYTA 3GIZL 4D9RE 3KLAA 4XPHH 4P59H 4C56E 1IGIL 4PRPA 4Y5YA 3WO3B 5FCUL 4ZMAT 1A6PA 3MRPB 4CW1A 1T7WA 5SWZD 2IQAA 1RZIB 4ZTPL 2Q76B 3IJSB 1YEIL 3T0DA 3D2UA 3SDAB 4LAQH 2CKBL 2GY7B 3ARFA 1E4XH 3C5JB 5IBLC 2HTKD 2D7OA 2XN9A 5FHAL 1CXKA 4R96B 1NBZB 2DKMA 3NPSC 4RMUA 2ZG1A 4WO4C 5C09B 2D31B 3AREC 4S1QL 2PKDA 1V8HA 2ZG2A 5E56A 1INEL 3H6JA 1CDIA 4Q6IB 1I1CA 4XAWL 4N9OB 2B5IC 3IDGB 4H25A 4YC2B 1ACYH 3NFPB 2BX5A 3FO2B 1A7QL 3HE6B 2BJMH 3EO1B 1N0LA 1U8HA 4HJGB 1AH1A 2APVA 5HPOA 4OF8A 3OXRA 5D2NA 5DFWH 4N0UA 2VXSH 1IC7L 4APQA 4XRCA 5CJ8A 5I0ZA 2DL2A 2E7HA 3H9ZA 4PGDB 5EOCH 4GRWH 1KELH 4UT9L 4MD5A 3K81A 3IU4H 1CDGA 2JJVA 4JRXB 5HGHB 3QCUL 1AY1H 2AW2A 2R0KH 5IBTL 5DC9B 3O3BA 2EKJA 3MV9A 4Y4HB 1FO0A 2HVKA 2JB5L 4HV8B 4JKWA 3U4EA 3S9DB 3QB7C 4GLRI 4YHIB 4Z7VF 3IS1X 4O2CA 3CFBA 4NCC1 2YWYA 5DDHB 4KRPC 4LHUG 1RZGA 1IC4H 2BK8A 2ICES 2JIXB 4HGWB 3OJDA 4WUUA 1SBSL 3X13B 4JFPA 3PDOB 4KDWA 1YMHA 4PGCA 1GGBH 1PKQE 5D7LE 2WINA 4QHMA 5TE4H 3GNML 1MLCA 2D4FA 5ICXA 4DGIL 2J1KA 1TVHA 5C71A 2D7QA 4EEEA 4R8WH 3BZEB 3P9LB 5E6ZA 4ODSL 5IJKC 4X8JB 4XWOC 4JZNA 3ARBA 3QUXD 4YHYB 4W4OC 3MRMB 1KIPB 5FCSH 5FYLD 2X4OA 3UO1H 1MEXH 4EVNA 1A4JA 2XFXA 4NBZB 5IR1B 1WVZA 1XGTA 3LHPH 1OP3K 3MBXL 4DQOH 1K5NA 4P49A 3JWOC 1S5HA 3FHAA 2Y9RT 3QQ4A 5CSZA 3UYPA 1CXFA 1R6VA 1WWAX 2NY3D 4PJ5E 4UIMA 3WD5L 3H7LA 4G8FA 5IHZA 4HG4J 2BVUA 1DDHB 2VQTA 1N3NB 4D9QE 2JCCB 3Q5TA 5C0GB 3JWOH 4QY8A 3X12B 1QVOB 2DLFH 5IP4A 2YR3A 5DYOA 4EOWL 4LHUA 1INDH 4PJFB 3ES6B 2MHAB 3MRCA 1FVDA 4HZLB 4NKDA 4XP5H 2EYSA 4YBHA 2VO5A 3MROA 5JIPA 1A6ZA 4E9LA 4QRQA 5J1SC 1CICD 1ZOXA 3FQXB 4NKMB 1NUDA 3EFDL 5FYJE 5CD3A 1AP2A 1G6RA 3QCVH 1OAKH 5GJSL 4PJXE 1OP3H 1CL7I 2N56A 5C0RH 1I7ZB 1OAQH 2DQGL 4WJ5B 3MNVA 5D2NE 2I9LB 4N0UE 1NGZB 4NQDD 3BDYL 2XNAA 4UOW0 3TBYB 3TCLA 5AAWA 2DQJH 1S7QA 1ZVSA 3RVTD 1R5WA 5C0ND 2LU4A 4TVPE 1BQLL 4YXKL 1AGDA 2B4CL 5DFTA 3THMH 3WS3A 4LSRH 4OFYD 4S0TD 3FB5A 1MAJA 1BMGA 5BRZB 2DWEA 2FBJL 2BVOA 3MV9E 3LEYH 5ADPL 3ARDC 3TM6A 3T2NL 1P4LA 3CLEL 3O3EA 1EV2E 1CGXA 4N8VG 5C0IB 4ODWA 1I9RL 3WXWL 3HI5H 4OD2A 2H26B 4MLIA 2BNQE 3U30B 2ZCKH 2VDPH 2AV7B 4Y2DC 1LD9A 2PTTA 3V6OC 5D6CB 5IG7B 4KTYA 5LQBH 1RHFA 2G2RB 2D0FA 4LCCA 5DD6A 5DS8B 3DV6B 3LKPA 1KIUA 5JZ7D 1Z5LA 4UILL 5K9KB 4U3HA 3MLVH 5FM5M 3V8OA 5LGKA 2ERJB 3EO0B 4K7FA 3ARGA 4M62L 5L2KE 1IQDA 1O5DT 2WWKO 1QP1A 2X4UB 4KGLA 4OZFB 3H0TA 1KC5L 5C0CD 2B7DT 4R2GB 5FGBA 4OZHE 5DJ2B 3GMNB 3FQNA 5E8OB 1FNEB 3QIBC 5E8DH 4IMLA 5DEFB 2VLJD 1EHNA 3PP4H 3V4VL 3VH8B 4O5LL 2DKUA 5CEYA 2GAZA 3MCKB 3J7HA 1SEQH 2GTWB 2IAMA 3OKLB 3ET9F 4IJ3C 2KZ1B 4YXHH 5J89A 3VRLE 1HOCB 4N8VA 3D48R 3G5VA 4LSPL 3KDMA 2BDNH 3D3VA 3OKNA 1X4ZA 4GBXC 1VENA 4PYHA 4XH2A 2B2XH 1FYTD 4E41B 1B6UA 3NGBB 1QFWI 1HKFA 1S9VA 3O4OB 3W11C 3EBAA 5ITFB 3ALPA 3VXQB 5HGGS 5BS0A 4KHXL 4KK8D 1TQBC 4OV6F 3JVGC 5ANMB 4PJDA 3BIAX 2Z9TA 4X7EC 5DHVB 1Q72H 1PG7W 4M93B 5T1KB 5CINH 5IQ7L 1J1OH 4FABL 1U6AH 2KPNA 1J8KA 5CSBA 3VWKA 4BELD 3MOQA 1I1YB 4LSDA 5B38B 2OMBA 2NCMA 2JJWA 3SJVD 3FT4A 3GSUB 1UXSA 1KXVC 3R06A 3ZKND 4YDLB 2G5BA 4NCC2 3NABL 5GPRA 1LMKA 3G9VA 3DRTB 1BVKA 3TJEH 1LGVA 2Y1VA 4J4PC 4K8RC 5IMOA 5ESAA 3U48A 5HSFA 4GKSA 5T1DL 2PO6D 4OJFH 4XP9H 3ZKMD 2IALA 4KQ3H 3Q3GA 1ZGLB 3I6GA 3QQ3B 3WHXA 2CLZA 3K2MC 4IS6A 3A6BH 4YHPB 2PYFB 2FGWH 4F80A 1JNLL 4MQSB 4K8RH 1U36A 4Y5YC 1E27B 3GDBA 4W6WB 3MSPA 1CYGA 1NCBL 2Q86A 2SEBB 4U1GB 5KSAA 2VL5B 2HFEA 4IMKA 4U2YA 3O6MH 4ODHH 3ZKSD 3RGVD 4X6EB 2DKSA 3T4AB 3TV3H 3ARFC 4QTHA 4OGXH 5IBUB 1L6XA 5IB1A 43CAB 4PJBB 3FB6B 1B0WA 3RY4A 5BW7A 4GQ9L 2B1AH 4AEHL 4IRZL 3KPOA 3QXUA 4FFVD 5L0QC 5C9KA 5FYKU 2W92A 3MRPA 5H37H 1RZIA 2O5YH 1Q0YL 5D72H 5FKPB 3SOBL 3SDAA 3VA2C 1DR9A 3RWGB 1M71B 2ZCLH 1J7VR 5ILTH 5D2NC 4K23L 3VGGA 3C5JA 2VDLL 4APQC 2DLIA 5JOPE 4LARH 5IEKB 1E6OL 4GKNB 5FYJH 1ONQB 1K6QH 1U95B 3WNOA 2D31A 1XR8B 3AXLB 2VISB 2VDML 4YHZH 5HJ3A 1A6TA 2CRMA 4G8EB 3IDGA 3D3VE 3HE6A 3EO1A 4AIOA 2RR3A 4HJGA 5HGDB 3QDMB 3SPVB 5JO5B 3OKDB 4M7KL 5GHWH 4TVPH 1NL0L 4QHKJ 3DMMB 1BJ1H 4G7YH 2IBGA 1MCIA 2V2XB 4PGDA 3VD4A 4OT1H 4DTGL 5A2IH 4NUGL 1FO0H 1CLOL 4I2XE 4HG4K 3ULVF 1WIPA 3DTXB 4MCYA 1A7PL 4Y4HA 1ZEAH 1IAIM 1R3IL 4PLKD 3JV5A 5HHXH 1Q8MA 3HS0B 3ARBC 2R1YA 5DDHA 3KLHD 4S2SB 2A1WL 1H3GA 4NOFA 4Q6YA 4HGWA 4S10A 4KJWC 3X13A 4FQXA 5I76A 4I0PD 5HVHC 2HP4A 4QXTB 4LPCA 1DE4B 3DO3A 3SKMA 1R0AL 3S4SB 4N0RA 1EFXB 4PD4J 1I7TB 3QUZB 5C7XL 1MHHB 4TSBH 4UDUA 4KK5C 2ZNXA 1DLHB 2XTJC 3BZEA 3P9LA 5DRNB 1UB5A 1VGEL 3LRGA 1RZKL 4YHLL 1DSFL 2BXZA 2NY6C 1JPGB 4CBPA 2CK2A 3L3JA 4MQTB 1U8OA 3H3BC 3L3IB 4M43L 3Q5YA 3B8SA 4PRDB 5IR1A 3IAPA 2CIIB 1J8HD 2X9YA 3NCFB 4Z77A 1WISA 2YPVL 2N7BA 3MLSH 5HHNB 3EYQD 2KQMA 5EORL 2KH2B 3OQ3B 3HTLX 1NDGB 1M7DA 3L6FB 5C0AD 2BVPA 2DTMH 3QDGB 5EULV 1GGCL 2P43B 1N3NA 2OYPA 4U1LB 1IC5H 2JCCA 4LDLB 5HI3C 5C0GA 3K3QA 3QIWD 3ULVC 1BD2A 5DK3A 5I71B 3EYUL 4XP6H 5DQDH 5IHUL 2PXYA 1QKZL 3ES6A 4PJFA 4HZLA 4I4WB 1A7NL 4WEMB 2ZKHL 1V3MA 4EI6A 3QEQB 5DK2B 1G6RH 5EBWB 3T1WA 3FQXA 4R97C 3ULVH 1VKXB 4NKMA 4RX4A 4B0MM 2R8SL 2MKLC 3CFDB 4I3RH 1KV3A 1EX0A 5I1DB 1ULVA 1I7ZA 2X1XR 2BVYA 5FYKD 2ILLA 1HYSD 5F7FA 3S35X 5LKNA 1NGZA 3JTSB 3TBYA 1HWHB 4ZXBD 3MJ9L 5EUKB 3ZTNL 4OZFG 4PJDF 4JFOB 4N90D 1KFAL 4OM0H 4CU8A 4XGZB 1MCOL 4JHBA 1N7MH 1INQB 1T03L 3PQYD 1DQML 1JK8B 1DJSA 4DN3L 3VWJD 5GGQH 4QRSB 3U0TB 4R3SB 3D39B 4LSTH 5EWIL 1UWGL 4ODVL 4LCCC 4QRRB 4JFDB 3NCYS 3IXTA 2E9IA 2RFXB 5C0IA 1JWSB 3V95A 1KENL 3KLSA 2GK2A 3IRZA 3MLTA 1VFAB 5GS0D 3VXOB 1WZ1H 3ARGC 4ELKB 2H26A 3O4LD 4LMQE 4GQPH 4OIIL 4KDTA 5DMGC 2AV7A 4HPOL 5FGBC 3P0YL 1KCSL 4XVSL 1YC8A 5E8NA 3GIVA 5IG7A 5FYKL 3MCLL 1I8IB 4DK6A 5DQ9A 2CDGB 3GI9H 4XXCA 1CDBA 4PJGA 2QJDA 3DV6A 3PWJB 1QQDB 5K9KA 2IAMC 35C8L 1VHPA 1WFOA 2CKBB 2YUWA 3KWWB 4Q9QH 5E94B 4P3CL 1G7IA 1TCRB 3AS2A 2X4UA 4OZFA 1T4KB 3JV0A 3QG6A 3NPZB 5ADOL 2NW3B 5DJ2A 3GMNA 2AK4B 5FK9B 5E8OA 4HWNA 1FNEA 4KJPD 3A6CL 3IB4A 5CZVH 4KKLD 2G60L 4PS4L 4HIHB 1DN0B 1L9NA 4JG0H 3OTTA 2GTWA 4JO1L 1HH9B 3T0EB 3VCLA 1FBIL 3OKLA 5E5RB 2JCCE 2APBA 1BD2E 3VWKC 5EA0L 3RI5K 4B41A 3OZ9L 5D71L 2Q7YB 3X11B 3U7AA 5E7BA 4M8QB 5L8JB 3BESR 4KAQH 2PUQT 5TPWL 5SWZB 5DJXB 4Z7WE 5IBUG 3GUTB 5JOFB 3Q1SL 2NW2B 4TVSa 1S7UB 4GG6B 5BVPL 1G7QA 1WEJL 2YD8A 5DHYB 1FP5A 5FDWA 2CKNA 5DHVA 5EOTB 1MCEA 4U6VL 3EFFB 1EAPA 1JPTL 4KI5D 4ACPA 1DN2A 2HRPH 3BKJL 3CFCL 1JUFA 4Z0BL 5AZ2L 4D94A 3GSUA 4O58L 5KSAC 1MFBH 4D0CB 4IMKC 2AJ3B 5DD0L 1H3TA 3ZLQC 2IBZY 5IVXA 4UT6L 4XTRC 1MFEL 1JGUH 1MHCB 1HHKB 4NQUA 3SE4A 1FLRH 2K3TA 3C60B 5DZNA 4FG6C 5BW7C 2PCPB 2Y5TB 1RFDH 1ZGLA 3QQ3A 2EEBA 4FP8L 2ARJB 4GMSH 1CFQA 4YHPA 4KY1H 2P8LB 3QA3B 3H42L 1E0OB 1E27A 4L1HA 5MEOB 3PGFH 2O26U 2VDQH 2SEBA 3BP4A 4OZGB 3SDXE 4LNRB 3FAXA 4B7LA 2VL5A 2AK1H 3CZFA 3SDAC 3T4AA 2HTLC 4FQLL 2QSTA 4NHCL 1KN4L 3RWJB 5BMFL 4MA1B 3FFDB 4EQ3A 2X7LB 4PJGE 3EYSL 1V7ML 2OTWB 1MRCL 4LHJB 5J6GA 4EDXB 3CK0L 1NAML 2V5SA 4BA8A 3NTCL 1EFQA 5L8KB 2UUDH 3B9KD 1CXIA 3HE6C 1QG3A 4QYOA 5FKPA 4HIEB 2A38A 2AS5M 5FO7B 5A2KH 1TMCB 1M71A 2Q3ZA 4D3CL 1QR4A 3QUXB 3NN8B 1F4HA 1NGQL 3N1PC 4PD4K 4G7VL 2PYED 5MEPB 3RWDB 4HF5L 1DBML 1ONQA 1RMFH 1ZHBA 4QXGL 1U95A 5I74C 2JCCF 3S4SG 1J1XH 4FFWD 4NJAH 1CZ8L 3AXLA 2VISA 4QNPE 1JI2A 1H3PL 4FQIL 2EXYD 4MA3A 3MV7E 5I1KH 1AXTL 4PJFF 5MERA 3CDYA 5E6YA 1IGCL 3JV6B 2RQ8A 4XCFL 4Y4HC 3B43A 3HG1D 3OKEA 3P11L 4KMLB 4HPYH 4NNPL 3VI3E 2NY3B 2ZCHH 3QDMA 5CJQL 5JO5A 5JHLL 1DFBH 1SJEB 3DMMA 3LEVL 1P7KB 3WE6A 1C5CL 3LS5H 2OQJB 1XEDA 4FQXC 4JKMA 4JKKA 3DBXB 3K2UH 1ZV5A 1FE8L 4Y4FD 1JTOA 3DTXA 4YFLI 1UCBH 4CRPA 1I9IH 3KG5A 4P2OD 1CICB 1KJ2L 3QNZB 2H32B 5C0EA 2ICWB 1RUPH 1N64H 3HS0A 1KIRB 3KHOA 2AXJA 3LV3B 4YHYC 5L7XH 1NH6A 4S2SA 1KPVB 1DQDH 2XPGB 2H9GA 4Q9RL 3H7BB 2ADIB 4O02H 5KVDH 1PYWB 5E4IA 5IVXE 1BEYL 3UTQB 4NQDB 4JO3L 4LGRB 5EIIB 1F8TH 1DE4A 1SY6A 1KJVA 2VLKE 3VGDA 3BT2H 1TJHH 2X1OA 3S4SA 1EFXA 3CFEA 1I7TA 3VG0L 4XC3L 3MRNB 3QUKB 4A6YB 1DLHA 4HUMB 1OT2A 5DRNA 4OLYH 4QHLA 5CUSH 4OCSH 3IAGC 4QT5B 1HXYB 2VDOH 1YEEL 3NFSL 3K80A 1MUJB 1UVQB 4Y16D 3SKOA 3V4PL 2CPCA 4PRDA 1XH3B 2PXYC 1WBXB 4XNZB 4C58B 3DOSA 4PJGF 3C2AL 4HFWB 1R3JB 4G9FD 2LAAA 2YC1B 4LCYB 1RUQH 3FMGL 5HHNA 4PLJC 4BH7A 4HXBH 1Z6JT 1R5IA 4JGMA 3SE8L 1PFCA 4ODTL 1K2DB 2EO1A 2WANA 4XPTH 5F9DC 1I9JH 1NDGA 3GMRA 4YLQT 5CFHA 5CD5C 3RVXD 2W07A 1T3FB 3QDGA 4PLNC 3FCTB 5MEQB 4HUWB 2F15A 5HDOA 1OP5K 4LHQB 4YHOH 3LIZH 2P42B 3MJGX 4K2UL 5FFLA 5GS2H 3CMOH 4UQ3B 4PJHE 1Y0LB 4X6BB 2AJVL 3EZ8A 4QNPF 4KU1A 5DK2A 4N0YL 5C0CB 4I18A 5EBWA 4XXDB 1JZ2A 4GXVL 1T89A 5F1NB 3VI3F 1S78C 2MMXA 4MCZB 3CFDA 3O6FD 5CJOL 2ADFL 2H1PH 1LO5A 2FHBA 2VLJB 3NFNB 3HCVB 4X5XB 5I1DA 1OSZB 3AROA 3QDME 1F4WL 2A77H 1ZGLP 2MPAL 1GSMA 1DUYB 1HINL 3RU8L 5HDQL 3NMEA 1YMMA 3UZQA 5EUKA 2FDBP 4XVUD 2DLGA 3KYNB 3F7VB 5TQ0H 4NRZB 1C7TA 4HQQL 4WGVB 3U30C 2OSLB 5KSBE 4GSDL 4KDTC 4TQEH 2WWMD 1QPXA 4LEOA 1MFCL 1OP5H 1JK8A 1FYTB 3GJFB 2DLEA 4OGYL 5B39G 4FQCL 4QRSA 1CR9L 4X7CC 3D39A 4XXCC 4LGPB 2QQQA 4QRRA 4JFDA 1KTRL 2XKUA 2HKFH 1SJXA 3ARUA 5IVXF 2C26A 3D18B 3LQMA 1MIMH 5I1HL 3S37L 3RIAF 1NC2A 2X4RA 5HGAB 1VFAA 3BIBX 3VXOA 3P0VL 1NANH 3KPMB 5DR5L 1YNKL 3C6LA 3QHZL 1V3LA 2AABL 3CSYB 1F6AB 4F15B 3GK8H 4RGOH 4XPGL 1Q94A 3SJVB 5F9OL 1U8IB 2RB8A 5DVOA 3RVVC 5HHMD 4HUVB 1I8IA 2CDGA 3VE0B 3RPIB 4BJLA 3NA9H 3PWJA 3MRQA 2Q6WB 2PO6B 1QQDA 2BC4B 2XKSA 4LSVL 4B53A 4OZFH 4ORZC 4K71B 5IUSA 3KAAA 5AD0A 1Z2KA 1M05B 4QXUH 3KWWA 4PREB 3HMXA 4DGVL 1RK0B 4HWEL 5E94A 3TC9A 1TCRA 1HIMH 2EH7H 3MCG1 1SEBB 2AK4A 5FK9A 4WV1B 4P9HC 4LCIH 1NSNH 4PJEB 3RGVB 2UZIH 1VERA 3ARSA 1Q38A 1FNFA 3KLDA 4HIHA 1DN0A 5I17B 4LASH 5B39A 2IBZX 3JV4A 3QDGE 3OX8B 4OM1L 3VFGL 2AJYH 4WEBL 3K4DA 4JPKH 4M93C 1J12A 1UM6L 2NY2D 4HS3B 2AEWA 4JN1H 3W5NA 4G8GE 1BAFH 2Q7YA 4PUBH 1A9BB 5TDPB 1A7BA 1AR1C 4M8QA 3MLZL 4YDLC 2VZUA 3H9HB 3N1GC 1QSZA 3CCHA 1HQ4B 5TH2B 5DJXA 1F3JA 1RZFL 5DHVH 1IAII 5JOFA 5IW6B 5MP6H 1GRWA 2LTQB 2NW2A 1BWWA 4JM4L 1NCDL 3SE4C 2QKIB 5EOTA 5H2BA 1J1PL 1CFVL 4HS6A 3M07A 3ISWA 2FL5B 4HIXL 3C6SB 4LSUH 4OCYL 1ADQL 2HT3C 2R4RH 5HHQA 5E99L 1YMME 3CC5A 1N8ZA 3QISA 4X0KB 2VLRD 5JR1H 1K9TA 4D0CA 4L3CB 2EDYA 1YPZB 2CLVB 2AJ3A 1WK0A 2F8OA 2V5MA 4FZEL 3IDYB 1ZK9A 3CFIC 1IGFH 3UTSE 1E4WL 2DJUA 4DUWA 2EZ0C 1OQOA 3FOMB 3BKCL 5E1AB 5IB4B 3PHSA 1CVRA 3TIEB 4M1DH 1DBBL 2Y5TA 4JFDE 4XC1H 4U3XA 3QNXB 2P8LA 3S5LB 4XAKD 4WUKH 4GH7B 5GRVK 5EIQA 1FNGB 1X5ZA 43C9B 1T7VA 3QO0B 3BOVA 1SYSB 1P4BH 4Z76B 3ZDXF 3QRGH 2W59A 5JNYB 1N4XH 3IT8D 5E0QA 1V7NL 4E42A 4ZO6A 4AY0A 4NNXB 4XPBH 4EQ2A 3MMEA 4GS7C 1U3HD 2RBLA 3FFDA 2X7LA 5ESQB 4JY5L 4O51B 4ALAH 2NQCA 3FQWB 4EBQH 1U3YA 3U7WL 4I0PB 3FQRA 1U92B 2RHEA 2X4TB 1H8SA 2F74B 4WI3A 2CJUL 3I3BA 4UT7L 1XGUB 4LIQH 3K1DA 3JTTB 5TGBA 4Z78A 4HIEA 1U8KB 5FO7A 1FDLL 4LDEB 2IPUG 4ZFOA 2MJWA 2AK4E 3NN8A 3DMMC 1AGBB 4KK6D 3QULA 4LLDB 3SGDI 3S35H 5CLWA 2FYYB 1J8HB 2D0HA 3BZFB 3MV8E 1KIQB 2EDNA 2R56L 4KKCD 3RAJL 2F5BH 4HWBA 4KPHH 4DN4H 4HS8L 5BO1H 5J6HA 4KTDH 3FO1B 3SGKA 3NAAL 3CU1A 4F33A 5C0AB 3EDEA 3DXAE 4IOIA 4LBEA 4ZPTA 4XVTL 2P5WD 1S7WB 5EC1A 1ITCA 1NUFA 1LO2H 4LLYB 3QIWB 4RCAA 5JPMB 3SDYL 4BH8B 1RURL 3DBXA 4OAWA 2R0ZH 2AERT 2CLRB 4N1CA 4TULL 5CBAB 4OI7A 1BF2A 2C1PB 3QG7L 4TNWF 4ZOBA 1CICA 2UWEA 4NWTH 5ISZD 3QNZA 2Z4QB 4D0DB 3C5ZA 2H32A 4OLXL 3WUZA 2ICWA 1B4JL 5KVEH 4NPYB 5E6ID 1KIRA 3LV3A 5GRUH 4NN7B 3DVNB 3TO4D 1KPVA 5SWQB 3DGGB 4AMKH 1SY6H 4TNVF 3H7BA 4AEIL 5I1JL 1EAJA 1QYGH 2ADIA 2IPKA 1G0YR 1HHHB 1JPSH 3TT3L 3BAEH 4FZ8L 3UTQA 4NQDA 5EIIA 4ZXBB 3QHTC 1A8JH 4R0LA 5GISL 5IB2B 5EO9B 5C0BD 4XPFL 2X09A 4QWWD 2IANE 3MRNA 3QUKA 3U2SB 4OFYA 5KTEL 1H8OA 4A6YA 3PQYB 15C8L 5IVZB 1TNMA 1IT9H 2A6DB 2BCKB 1OTTC 5F7EH 3VWJB 1HXYA 1MJUH 2GJJA 4KC3B 1MUJA 1UVQA 3IETB 3U1SL 2ARWA 5I19L 2J7LA 5JUEL 3T08A 1XH3A 3I84A 4TRPL 1MNUL 3EHBC 1WBXA 4TNWK 2PW2A 4K94L 3ZKXC 1IBGH 1XF1A 3MLXH 2YC1A 4LCYA 1MHEB 3S6CA 2EKSB 1DVFD 3O4LB 1GC1L 4LOUD 3ZHKA 1K2DA 4PTTB 4WI6A 3NZHH 3OKMB 4I18C 5D7SH 4EUPB 4TNVK 2VC2H 1T89C 1JGVH 2CGRL 1YECL 3I6LD 3FCTA 4LK4A 4HUWA 3L7FB 1AO7A 2EH8L 1F3DH 1CCZA 1OPGH 5SX5K 4XPAH 4OD3L 5DD3L 4NJ9L 3OL2A 4MLSA 3KPLA 5FYLE 2OZ4L 3T77B 3WNNA 5DF0A 1U8PB 2F5AL 3VU2A 5AEAA 3BSZH 4QOKE 4OB5H 3ULUD 1IGYB 1KEMH 4TSCH 4TUKH 5F1NA 2XWJA 1EUTA 5LXGL 4MCZA 4J8RA 4L3EE 3O8XD 1JZ8A 2VLJA 3MODL 3HCVA 4X5XA 1NGYB 2XA8H 1KPRB 5GS3A 3LPFA 1A6UH 4Y5XB 2BVTA 4H0IA 3PXHA 3BIKA 2EDHA 2HLAA 2VDKH 2HT2C 4PBWD 4NRZA 4O4YH 2GI7A 2FX9L 4FQHB 3C6LC 2OSLA 3RL2B 2A83B 4PRID 1X4YA 1DLFL 1ZE3C 1T0NA 3OF6D 4R7DB 5C0DA 4WFGD 3GJFA 4G6MH 5TF0A 3RNQA 4EZMA 1E4XI 5BJTB 3H9SD 1PEZA 2UWEE 1RUAL 5I8EB 1QZ1A 1MVUB 5IV2A 1ZLWK 4IHOA 1KJMA 4BZ1L 3FFCB 4HC1L 2R0WH 4LDOB 4RAUA 2X6MA 5HGAA 5CP7B 2J8OA 3KPMA 4HHAB 4JY6B 4L9LB 5FUOL 2VOTA 5DVNA 1IGIH 3TCXA 1F6AA 3CSYA 1HCVA 3SJVA 3L7EB 4P2QD 3SKNB 3STZB 1U8IA 2CUMA 2LQRA 4UTAL 3GMPB 2C3WA 2YMXH 3AM8A 4ZUUA 5LAXB 1NAMB 1FL6A 3OGCA 4F7MA 3VE0A 2LVEA 2M8XA 3VI4E 2YEZA 1NQBA 3HMXH 5FHAH 5HHVH 4F58H 3KJ4C 2Q6WA 2BC4A 4I0KA 5LGHL 3EOTL 3ZKQD 1Y6NR 3JWDL 2AJXL 4NQCE 1M6OA 3BGAA 1M05A 3VFTB 4PREA 4DW2L 3GM8A 1Q0XL 2Q8AH 1QRNE 1ND0B 5EZJA 4D8PB 1U8LB 3H3PH 3IKCB 3PWNA 5C6TL 3WNMA 1A7QH 5BVJB 4WV1A 1TTGA 5D8JL 2E8YA 2UY6A 3VXRD 1EVTC 3T2QA 3ARZA 5SWSE 3HLAB 2FJGB 1IC7H 4X6CA 4GXUM 4L5FH 3G04B 2HTKC 2Z8VC 5ICZA 3OX8A 1BFVH 1MREH 1Z9OA 4F2MB 5MHSD 2D7TH 2Y06H 4UT9H 1AO7E 2W91A 3VG9B 3O0RH 5TDPA 2V2TB 4X4MA 3QXAA 1JWUB 1CF8L 4LEXH 3HI6L 3U7YH 4EKXA 1YJDC 4L3AA 5L88H 3LN4B 4DGYL 5TH2A 2VQ1B 2KUTA 1IGTB 2DQDH 4N8PA 5IW6A 2P49B 1B0GB 1MIEL 3FJTA 3HZVB 4XMKH 1KJ2B 2PYEB 2QKIA 2D03H 2VLJE 3VFWB 3GSXA 1YJDH 2HMID 3BJLA 5B4MD 4K7PY 5FM8A 4PRBB 4GLRH 3C6SA 5CKGA 4Z7UB 3GSRB 3W9EA 5EN2B 2F54D 4JFFE 1FQ9C 3LY6A 4IDJH 3ZYZA 3GNMH 4OZIB 4R90H 5HGBB 3VFSB 4L3CA 3HG1B 1YPZA 2CLVA 2R15A 4NT6B 3A6OA 5IIEB 2UWEF 1NFDE 4KUZH 1QR1A 3FOMA 4MA1C 4KQ4H 4Q9CA 5E2VL 4HCRA 2XG5A 1L0XA 3GHBL 1CGSH 3EAKA 3MBXH 3LS4L 2C3VB 1TZHA 3QNXA 1FNGA 4RMVA 4Y4FB 43C9A 2I25N 1R3HA 3BWAB 4DKEL 1SYSA 5DJDB 1YN7B 4XP1H 2DM4A 3IDIA 4P2OB 3F6IA 5JNYA 4GKOA 4NKOB 3LQZB 3S8WA 1A1OB 2O5XL 3IU3B 4DEPB 1FORH 3W81A 4NNXA 5IKCB 1UEYA 3C09C 1BX2B 1AXSB 1QOKA 2X5PA 2D7PA 5EU7E 4LVOC 5ESQA 4O51A 4POZD 4PB0L 4I0PA 5HYQB 2YUVA 2VLLB 2X4TA 5GGVY 1VB9A 1D5BA 1QSFA 2GCYB 5ACZB 5FYLH 1FPTL 3JTTA 1X7QB 2E7BA 1NFKA 2NY3C 3SGKC 1U8KA 3EFDH 1Q9KA 2FSEA 3EUUA 4KRMB 3LKQB 1CE6B 2B4CC 1JPFA 3L3OB 1CGWA 1AGBA 2DQGH 4Y16B 1Z0NA 3MXWH 3WFBL 3VGEA 1M7IA 4HWBH 4X6CE 3KGRA 5AG9A 2FYYA 4DKFL 1J8HA 1AE6L 4PRNB 1AIFB 4G9FB 6CGTA 3QI9D 2R1XA 1HQRA 2ZSVB 2B4CH 1CL7H 4W68A 3MJ9A 1CICC 2FB4H 1T20B 3FO1A 5HPMB 4WWKD 3C5ZC 1RV6X 2FBJH 5C0AA 3MRJB 5EFIB 5E2UH 2AEPL 3T2NH 4P0DA 1RZ7L 4YE4L 4LLYA 1EXUA 1NC4A 1N0XH 2WUCH 1I9RH 3U4BL 4M5YL 5I75C 4BH8A 5JPMA 4GO6B 3FTGB 2FWOB 3CX5J 3MLUH 2H32H 3K8MA 4R0LC 4X9BA 4EUPG 5C0NC 1ETZA 3O9WD 5GGSY 3HR5B 5F7DB 2Z4QA 4J3TA 4HXAL 3HC0B 4MB5A 2GY5A 4NPYA 3WL9B 3BKMH 3O6FB 3MUGB 1FFNB 3DVNA 3DPBA 5SWQA 3HNSL 2RIKA 2VE6A 3DGGA 4LP5A 4UB0L 3DSNA 4UILH 4HD9A 2BSED 1A0QL 3KR3L 4TOYH 2B1HL 5EO0B 4A6YH 1JTTA 2FGZA 4M62H 4NZJA 3R8QA 3LRSB 4L8DB 5IB2A 4M7LT 4YNYB 3E8UL 4KV5F 3F6LA 3PQYA 4U1HA 5IVZA 2IPTL 2BCKA 1A4KA 5D9SB 5HHOD 4C4KT 5IESH 3EJZD 3K8LA 1ZLSH 3I9GH 3EYFB 1GZPB 5F9WB 2EDOA 4X5WB 2AEIT 4NO5B 1IAMA 3GZKA 5JZ7C 4XT1C 2IQ9H 5F7YC 3W39A 4PY8I 1LQSR 4DOHB 3FO9A 1FGVH 4WFFE 5J57B 1YEJL 5FDYA 3V0AC 2ITDA 5K9OB 1MCCA 3HZKB 1NGXB 1MHEA 2EKSA 3O4LA 3CX2A 1I1FA 2DIJA 4PTTA 4EUPA 2E5EA 3BH9A 3P4NB 4OCXH 5I66A 3N9GL 5KJRH 3TO2B 2WK2A 4RA3A 5DJCB 4ZQKB 1QSFE 5HHMB 4PR5B 2DDQL 2F19H 5ACMA 3BEWB 4KHXH 3GHEH 3CFJA 3KJ6H 5FGRA 1DQTA 4OLWL 4XZUB 4YXLL 1FAIH 5IQ7H 1KYOJ 2Y6SD 5D7JD 4X6CF 1MCPL 3T77A 2XG4A 5JPNB 5A2FA 5IFAH 3L1OL 1U8PA 5D5MB 4UI2A 3VFRB 4OKVB 4JPWL 4N0CC 5DC4B 1VFUA 3PHOB 1J8HE 3HC4H 1IGYA 4WNQB 1CE1H 1BBDL 5TDNB 5JXED 3BE1H 2BSRA 4DJMA 2WBJD 3M1BB 1GGIH 3V52L 5T1DH 1C08B 4RMSA 3VXMD 1KPRA 3J8F7 5CZKA 5E4EB 5DRZA 3O2WL 5F7LB 3MTRA 7FABL 2CD0A 2NY2B 5EZIH 4M4RA 2YXFA 2OL3A 3GJFH 3FN0L 4L4TD 2ZSWB 4XX1E 5T3XD 4MXVE 1JNLH 3RUGE 4M6MH 2A83A 2VN7A 5GSVB 1T2QH 3PGDB 4R7DA 3ZKNC 3AM8C 4EI5D 1S3KH 4HK3N 4JB9H 1DBAL 3MUY1 4G8IB 4H5SB 4Y89A 4HIJB 4OFIA 5EU7C 4MS8C 4MHHI 5I8EA 1YPZF 3DARA 2PO6C 3WLWD 4K71C 5DEGB 3SKJL 1X5XA 1HSBB 4GQ9H 4GW4B 2VKXA 4F7EA 3O45B 2IFFL 3VA6A 5TQ2L 4CVZA 2LVCA 1R3KB 4JY6A 4L9LA 2GK0B 5L6YL 1CK0L 3Q6FA 5DD5H 4WW2B 1WZKA 1A7OH 3ZYOA 1W2KT 3SKNA 3STZA 3QAZB 3IJYB 2VLRB 1MWAH 3Q6GH 4HUUB 4WY7L 3RNKB 4WV1C 2P48B 3VFPB 3SOBH 2GITB 5LAXA 4LQ1A 3U4AA 1KPUB 2VTFA 3L5XH 4K23H 3B2VL 3PQYE 1GYAA 1SBBA 2VDLH 3CVHL 3PNWB 2OR7A 1K3ZA 1KXTB 2KQNA 5ID1B 1Z9LA 5I6XB 2R4SL 4G6KL 4K7PX 4BSVB 2HRLA 2VDMH 1D5IH 5IMKA 4FFVC 3TH3T 2E9WA 1U8LA 4HT1L 4QRPE 3GB7B 4NIKB 3L3KB 3BRDA 4XMLH 5L9DH 4LPTA 3L3GB 3I2CH 5A16A 2ZUUA 4M7KH 3RBSA 2R2BB 4POUB 2DIBA 2LTQC 3KPSD 4F7TB 1A21A 3REWB 5JW3L 1HDMB 1URLA 2YZ8A 1U3HB 4DTGH 4NUGH 1JE6A 3BD3A 4KRNA 1ZLVK 1FH5H 2FCBA 1LK3L 2X70B 2VXTH 1MY7A 4LSSL 5EO1B 1UWEH 1ZGLM 3B9KA 1XCQB 1S8DB 3LN4A 1A1MB 1CLZH 1JHLH 5F3HA 1KACB 1F4YL 5D1XD 3MA9L 1IGTA 5EU4A 3UZVB 4ELMB 3F12B 3LZFL 3CXDH 4JANA 1ZVYA 3HZVA 4WHTA 3U79A 4JQIL 2PYEA 3VFWA 1IMHC 4M8VA 4WI4A 4PRBA 4GRMB 4JVPA 4BFIB 4Z7UA 3V0VB 4L9DA 5EN2A 5D93B 3SDCD 1R0AH 1Q1JL 4FOMA 4JO2L 4KGJA 1VFMA 4OZIA 5HGBA 5FOBB 3VFSA 3OG6B 3T0WA 3HG1A 4XI5D 4HCRH 4PLKC 3W0WB 3L5WA 1DEEB 4PP1D 3DUSA 1DSFH 1B3JA 1DZBA 3NCMA 3MRHA 4JO4H 2P5WB 2WM0A 3CLFL 1UA6H 2HN7B 5ID0B 1QD0A 1WQVT 2DM7A 1WBZB 2UZXB 4UQ2B 1ZLVH 1D7FA 3MRBB 5IT2H 1EERB 4Y1AD 1NEUA 4KTEH 4X9FA 4I0PC 1AR2A 1J0IA 3BPOB 4JY4B 1NCWH 1H8NA 1CFNA 3UTTD 3D69A 4Y4FA 1XGYL 3BWAA 3GSNA 3IFNL 1NJ9A 3WFCL 5DJDA 4JHZA 1N2RA 3OB0K 3GBML 1JYNA 4PP2B 2F53D 3P40A 1JRHI 4D0BB 5ISZB 1QBBA 4YO0B 4HKXA 1GGCH 3UXFA 3CX5K 5E6IB 1OAYL 2Q87A 3IU3A 3VXUA 5IHBA 2OCFD 3TO4B 5IKCA 1NFIA 3HHRB 4YDKL 5FO8A 3N0PB 4NGHL 2X2YA 3BUYB 1EIBA 2HH0H 4OV5B 1D6EA 4GOSA 3WFHB 4YHKH 5KG9B 2VLLA 1NUGA 4GAJH 1REIA 3EYQC 2G75B 3ESUF 3PJSA 3KYOB 5C0BB 2GCYA 2XYCA 5ACZA 3R8BB 2P24B 4NSKB 2NY1C 1F90H 2Y7QB 2QHRH 3LKQA 3D0VB 1CE6A 1Q9LB 3K0WA 4MNQD 3MRRB 3QFJD 5EPMB 3OV6A 3BPCB 3L3OA 3ZZ1A 2FX8H 2Y07H 4Y16A 2YPLA 3V5HA 4DCQB 1MF2H 3D85D 3MJ9H 1XF3A 5EZOH 1L7TH 1MRDL 1ZHNA 3OB0H 4R4BB 2ZUSA 1LNUA 1EEQA 1U3ZA 1ZANH 2VXQL 1LK2B 2NYYD 2VIRA 1MCOH 3EOAB 1DVFB 3UAJC 3MNWB 1T03H 2Y23A 4AK1A 1T20A 5KVGH 5HPMA 4YDJB 5DJ0B 1CU4H 5DEZA 4QTIL 4ZD3L 2DI9A 4JM2D 5EWIH 4NN7C 5EFIA 1BQHB 1MCFA 2FLRT 3LPGA 2EDXA 4YK4B 1T0MB 1KENH 4X9HA 1JNNL 1HYSC 3CIQA 3RZCD 3FTGA 4GW1B 1HZHH 4DVRL 3DROB 3NIFE 2FIRT 2C5DC 2CIKA 2J88H 2DJ4A 2P8MB 4Y19E 4U1JA 4Z7UE 4RGNE 4U7KA 2XRAL 2DWDB 1RUML 4C57C 4XVSH 3LKRB 4CJ0A 1JZ4A 4PIRF 1QLRA 1F3RB 2R0LH 5I30H 3HC0A 5FYKH 1PLGH 1KGCE 3D9AH 3O6FA 1FFNA 1PQZB 2XZCL 2HJKA 3O8XB 3DX9B 1BIIB 1RIHL 1N6UA 3S88L 7CGTA 5EO0A 5I1LB 1MI5E 1ZHLA 1QNZL 5GS0C 5J9PA 4YNYA 5ADOH 3LDBB 3BH8A 2N1KA 4OLEA 4PRIB 1OAXL 3JXAA 4H20H 3C2SA 1WTLA 1UACL 4MDIA 2OP4H 3L5JA 1OWRM 5DVKA 1AJ7H 1MFAH 3H9SB 1RJYA 4JPVL 4G5ZL 5BV7L 1GZPA 5GS0H 4JO1H 4X5WA 4NDMB 4NO5A 1FBIH 3VXUE 3AAZB 3DHJA 4EUPH 4BFBD 5HYIA 3UEZA 2QQNL 4XCNB 3LCYA 4O9HH 1NGXA 3HZKA 4LLWB 1P7QA 2FEEL 3INUL 3KPPB 4N0FB 2VL4A 3P4NA 4P2QB 5TPWH 3IDXL 3TPUA 1CXEA 5DJCA 4ZQKA 1RVFL 1K4DA 4PR5A 4CN6A 3O11B 1LDPH 3BEWA 3Q1SH 4KKLC 4NZTL 4OKDA 1LE9B 3D87B 5BVPH 2P8PB 4WWID 1EH9A 1NCAH 2YSSA 2PR4H 4U6VH 4WU5B 4XZUA 3ZO0A 1JPTH 3KPRA 2NTFB 1U42A 4HGKC 5JPNA 4JCMA 4JDZB 5D5MA 2YPLE 1CD8A 5IW3A 4OKVA 2W65B 3L3DB 3PHOA 2YWZA 1UC6A 5HD8D 1ZTXH 2FJFB 4O58H 3ZE1F 5INDB 1DCLA 4WNQA 4C83B 4PJ9D 5ELIA 5TDNA 4OF3A 2IADB 4XNUH 3VXRB 3BYTA 2HLFD 1I85A 4UT6H 2DQTL 2OL3H 3M1BA 2YBRB 1C08A 4CVUA 2NZIA 2OS7A 2P7TB 2YUZA 2CXKA 1YNTB 1CDJA 2WUBH 4FP8H 4PJ8A 4PY7B 4L9LC 3GM0A 1JGDB 3FO0L 2CO6B 2KBGA 3NIFF 1EHLL 3JZ7A 2ESVD 5GSVA 3PGDA 4Z7UF 1LO0L 2Z0BA 1NCTA 1K3IA 4Y88A 4K3DH 5DUML 1ODAA 3P77B 2JF1A 3RVUD 4FQLH 4OZIF 4G8IA 4ODBD 1EEUA 4NHCH 4QXWA 5TF1H 1MPAH 5F1IB 1U8MB 1WWBX 4K3EL 5IK3B 1PBYA 3HRZB 4PRAA 5INCA 1R5VA 3EYSH 2H41A 1T7YA 4O00A 1HSBA 4GW4A 4UAOC 2MQ3A 3PV7A 3O45A 2OJZL 3CK0H 1G1YA 2GK0A 2F54B 2EIZA 2HWZL 1PW3A 3CDFA 4WW2A 3NVQA 4H1LB 4AH2B 3KPQB 2P5ED 3IJYA 3ALXA 1SMOA 2AI0L 2VLRA 5GJTH 4NHUA 3RNKA 1VCAA 4H8WC 3WN5B 5KZCD 3I85A 4ZUVB 5K59E 5EBMB 4L8BB 5MI0B 3IDNA 4PTUB 3U9UB 1NGQH 4G7VH 3PNWA 5J7CC 3G08B 5E00A 2VDRL 4HF5H 3S36X 3P4MA 4YDVB 1DBMH 5ID1A 3PWPD 3VG9C 1LP9B 4H8WH 4ZUSA 4BSVA 1H3PH 4I48B 1AXTH 1S9XB 1DBKL 5IMLA 3IXAA 4OCRH 2WP3O 4CADB 3B9KC 2VN4A 2W0FB 4NNPH 3GB7A 3RHWF 4ISVB 3L3KA 1FFQA 3NIDE 2EYRB 3L3GA 4LF3B 4LMQI 4MJIE 3O2VL 2KKQA 3MPCA 5CJQH 4JHAH 4MXWL 2IF7A 4A2LA 5JW4N 2R2BA 1H3XA 3TYGH 2GYSA 1HDMA 2DD8L 1C5CH 1U3HA 5IFJB 5IW1B 1MCQA 4WI9A 5AYUL 1W8NA 3GBNL 4KVCH 4RGNC 3QEUB 4FFWC 3H9YA 3KPRE 1DL7L 2XQBL 4G42B 2EXYC 2YD7A 3FN3A 3IYLW 3P2TA 3VFVB 1FV1B 4X6FA 2LE9A 5FUCC 3I50H 5IB3B 2YKLH 4K9EL 4ZS7H 5B8CB 4ELMA 1FL5B 3E2HC 5DA4A 3FQTB 3X3GL 5ERWB 1T1WB 5M94B 3ZT7A 1QLFB 2Q8BL 3PWVA 5FHBL 3N85H 4Q58C 5F70A 1BEYH 12E8L 1MCHA 3DNKA 4JO3H 4BFIA 4PJIA 3RHWK 4K3JH 3V0VA 1FG2B 3QI9B 4HFUL 4Y4FC 3VG0H 4XC3H 5M95B 3TESA 1ZT7A 1T2JA 1OAUL 1PVHA 5FOBA 1I1AD 4BFGA 5E9DD 3NH7H 2XACC 5C9JA 2OR9L 3BEVA 4WWKB 4KHTL 1DEEA 1XZ0B 3DUUA 2GJ6A 2G5RA 3V79C 1YEEH 5LWYH 4KRLB 1TZGL 2VZOA 5ID0A 1HKLH 3QWQB 4UQ2A 1UJ3B 3V4PH 3V6ZA 5EOQH 3MRBA 3GSNH 4PG2A 3ILQD 2ZWLT 1P6FA 3C2AH 2VDNH 4IOSD 3HZYB 4JFEA 1UM5L 2RCSL 4JY4A 5IMMA 2GSIA 2QV2A 5CCKH 1N5YH 5GRJL 3SE8H 5AUMB 1RZ8A 3O9WB 3TZVA 3TA3D 2UY7A 3CVIL 4PP2A 4M4PA 5EIVA 4D0BA 5ISZA 4YO0A 1BQHG 1L4IA 1PSKH 4CNIB 1T1ZB 5K59F 4HUKB 2W9EL 3VXPB 5LG1A 3TO4A 2I9TB 4NNYB 3ETBF 4Y16C 1LO3H 2VB5A 3QYCA 4U7MA 3WBDA 4N5ED 3WFHA 1FZKB 4MA8L 5KG9A 4YPGB 2AJVH 3FQUB 5HYFA 2G75A 3KYOA 5C0BA 2F58H 2H8PB 3O3DB 4HIIB 4NSKA 2MQCA 1NLDH 2R69L 4U05A 1G7JA 4ERSL 4Q0XL 3TP4A 2Y7QA 3NIDF 2H2PD 1DQJA 1E6JL 1MRFH 2KDGA 3MOBL 3D0VA 1RPQA 4UINH 5HHOB 1Q9LA 1N6QH 2ADFH 1NMBL 5JA9A 3MRRA 5KS9A 4GAYB 1WFNA 5EPMA 3BPCA 5ECJE 4KK9D 3QEGL 3HPJB 3RU8H 5HDQH 3BW9A 1Q9WA 4HJJL 3P73A 1VADB 3TJHD 3IKKA 5JXAH 3F58L 3IF1B 4NWUH 1RQ5A 4R4BA 4HQQH 3EOAA 4JFXB 4GSDH 1SJHA 3IFLH 1T21B 2A73A 5D5MF 4YDJA 4UV4L 1U93B 4OGYH 4U6HB 5KSVB 1CR9H 3O6FC 1A1NB 2XQYG 1QFPA 4RWYL 5CEZD 2X4SB 1BQHA 5BXFB 1AD9A 1VFBB 4ZO7A 4M9PA 4RISH 4G3YL 1FFPB 3MXVL 4M61B 3AS0A 1W0VB 2W9DH 3EOBB 3BISA 4FXGB 4GW1A 4N8CH 2NY0D 4PJAB 4XVUC 5DR5H 4W70A 2UYLB 3DROA 2YPKA 2XY2A 2GSGB 2AABH 3TN0D 1TJGH 4PJIE 4XPGH 2P8MA 4Q7DA 2HG5A 4Z18A 3OAUL 5F9OH 2EDEA 4HUNB 3VGBA 2DWDA 2WWMC 5HHPB 3C9NB 1MHPH 2XT1B 3P9MB 2Y36L 5EUOE 4HBQA 1PQZA 2CK0L 1MCKA 3O8XA 3PIQB 3DX9A 2WBJB 1A2YB 3RTQD 1LEIB 3V4UH 3EKCA 1BIIA 3VXMB 2GJ6E 3V5KB 1D5MA 5F9JB 1A3RL 2Z93B 4M7JL 3JSSA 4LRNH 3CVHB 4K7PH 5DSCA 4L4TB 1F58H 3HR6A 1FN4A 1KEGH 3HUJA 2DYPA 3HPLA 4JFEE 5CEZL 1SM3L 4GAFB 4YHMH 2A9ML 3OF6A 3LSOA 2NX5E 4EI5B 1WIOA 4WW2F 2ZOLB 4S1RH 4P4KD 5BQ7B 1IEAA 4NFCA 5D2LB 5IBLD 2A6IB 5KOVC 3U46B 5FM4A 4OM1H 3VFGH 2C4FT 4WEBH 1GXEA 2VZTA 4UUJA 4CL7A 2DQUH 3VFMB 5D96B 5EOCJ 4LLWA 5JLZB 3BN9D 2JELL 4N0FA 1UWXH 2VITB 1KULA 3TBWB 2FECL 4P2QA 4P59L 4XPHL 2J6EH 3E6FB 3EIFA 1RZFH 3OAYH 5J12B 5C0BE 1AGEB 1HE7A 3O11A 1I85C 3ZE0E 2BSTA 3VGHA 3HMWH 4P2RA 4LAQL 2QQKH 4JM4H 1NCDH 1UGNA 5KS9E 2H3NB 4WU5A 1CFVH 4ZS6C 4RFEB 2NY2C 3RWCB 3KYKH 3QXTA 5EU5A 4JDZA 1KLFA 5HVGB 5IGXH 4AQ1B 1IAIH 4XCYB 5I15H 5GGVH 1FVCB 3AUVA 4MX7B 2C4FU 5INDA 3W2DL 1P1ZB 4LCWE 2LFGA 5DWUL 3VXRA 2C7UB 1I8KA 2G9HB 3M8OL 3KPSB 3BKCH 3MRGB 1QBLH 4MJ5A 3UYRL 4ELMF 2VXSL 3WUWB 2EC8A 2P7TA 2WSKA 1GOHA 4YAQB 5LBSL 4WHYG 1CFSB 1EEZA 5A3IC 4RA0C 5CILH 2I07B 3IU4L 3UX9B 3U0WH 1JGDA 2AJZB 4WW2C 3K4AA 4PJIF 2DI8A 1AY1L 2R0KL 1CLYH 4TSAH 4P5KB 3P77A 4N9GB 5D1XB 3ULUE 5E08L 1BJMA 2VUYA 3PF2A 5IK3A 3MOAH 3O2DL 3DRQB 1IC4L 1MJ7H 1UADC 4JY5H 3GSVB 5FOJA 4I9WE 1X9QA 1UH2A 3DIFB 5I16B 2F54A 1GGBL 4OIAA 3SDCB 1GH7A 1GPOL 4UZGA 4AH2A 3KPQA 1F11A 5IFHL 5TE4L 2H2SC 3WN5A 3HUJE 1U8JB 1FDLH 3TBVB 4DZ8B 5DI8B 3QPXH 5EBMA 2QQLH 4Z7OE 3QFDB 1S9WB 4RMWA 1X5LA 4BSWB 3G08A 3IDMA 1WJ3A 5BCAA 1U3HC 3CSPA 1I7RA 3FT3B 4Y1AB 4GRWE 4JVWA 3L3HB 3DETD 1LP9A 3LHPL 4I48A 1S9XA 2MWCA 2R56H 4WI2A 1KUMA 3UTTB 1YYLH 5C8JB 3MGAA 1E28B 1KCVH 1HNGA 1JVKA 4ISVA 3QRFM 3P4OB 1JI1A 3NAAH 2EYRA 1B9ZA 2F53B 3PABB 3G5XB 4G6AD 3WFDH 2QSCH 4U0RB 5JHDD 2V7HB 4KVNH 3WXVH 4BKLB 2OXGA 4H0HB 3ZE0F 2BRQA 5IFJA 4KROD 3SO5A 3FB7A 4OI8A 1K8DB 4KK6C 1ES0B 5KS9F 4P2RE 1INDL 1OTSD 1I7UB 5JIIA 4FQ1H 4XP5L 5D93C 4MQXD 4G42A 2DQCH 3T0VA 2BY3A 32C2B 4BZ2H 1FV1A 4KKCC 2AV1B 1JN6B 4L4VE 4L8CB 4OLXH 5B8CA 1FL5A 2IEPA 3FQTA 3QEQD 4MNQB 2NLJA 3QFJB 1T1WA 4FQJH 4MJ6B 5ERWA 5I1JH 4AEIH 3UBXB 1QLFA 3UC0H 4RNRB 5SV4A 1KG0B 1XF4B 2ZP0T 5C0RL 1OAQL 4PG2C 4YBLB 4M1CC 4JPIB 3D85B 4D9RD 4L1DA 2FATH 4C56D 3BPOC 5GIRB 1CI5A 1L0YA 3BP7B 3QI9A 3MLWL 3TZVC 1I3GH 1KTDB 4PPTA 4LSRL 3T3MF 15C8H 3V7AE 4WWKA 4MNGE 4JCLA 1XZ0A 3MA7A 4MQ7B 1OOAA 4JKPH 4GUPA 4JM2B 3ULUF 4YZFE 3TO4C 3U1SH 2AJUH 3LEYL 4PV8A 5E70A 5CJBA 3KYMA 4UIKL 3FT2A 2E7LA 4M7ZB 4TRPH 3OXSA 1RIUH 4X7TB 4TUJA 2LU7A 4ZFZA 1N59B 3HZYA 5BV7B 3RZCB 1HYRC 2WIMA 4HLZG 2VH5L 4NN6B 4DFHA 3SY0A 3AMLA 5AUMA 1RAMA 3O9WA 4YX2H 3VFOB 5LGJB 3SCMD 2VDPL 1RJZB 3LB6C 1DUZB 3HUJF 4Z5RB 1T1ZA 1B2WH 4W6YB 4P3DB 5LQBL 3R4DA 1IEBB 2P47B 2I9TA 4NNYA 1BZ9A 1EO7A 3ARQA 3NIGE 3HB3D 4OD3H 5DD3H 4NJ9H 1J18A 5I8OH 4Z7VE 1FZKA 5I9QB 5C07E 5BZDA 4PLOB 2ORBL 4YPGA 1Y18B 2OJEB 4JAMB 3QP3A 4NZUH 4WW1B 1NBQA 3OR7A 2NXYC 1ZHKA 2H8PA 4LOUC 4GBXD 4NRXA 3RY5A 4KI1A 5CBEB 1NBVH 5IM7B 2W60B 4MHHG 4ZOAA 5KW9H 2FO1A 1MAMH 5HHOA 1WT5A 4GAYA 3MODH 5E8DL 2Z8WC 4YK4C 3PP4L 3HPJA 1YEGH 1SEQL 2R29L 3DVGB 1OGAB 5D7LD 1VADA 1TIUA 3RKPA 4AZ8A 1D5XB 2AGJH 2FX9H 4OCWH 3WNPA 2BDNL 1DLFH 1T21A 3ULUC 1KOAA 2B2XL 4YWGH 1U93A 4U6HA 5KSVA 5F9AC 4XBGB 1QLEH 2X89D 5JQ6H 1OY3B 2X4SA 2XQYK 4J4PD 4K8RD 3O8XC 5BXFA 4OBRA 4JN2B 1YEFH 2FZ3B 1HH6B 2WIIB 1EJOL 5FGCB 4OFKA 3SDDA 3EOBA 5C6WH 5D7JA 1T04B 3R1GL 3ULUH 4FNLH 5CINL 1J1OL 1U6AL 4PJAA 4NP4H 3G5YA 2UYLA 1YEDB 3V6OE 1YNLL 3D1MC 2GSGA 4PJ5D 3LDBC 3JWDC 4J3OC 4UTAH 1FFOA 1X5GA 5HHPA 1LWRA 3C9NA 1FZJB 2Y5EA 3QJFA 3QIUD 1YC7A 3IFPA 5HYJA 4PJ9B 3DO7A 4D9QD 5JXEA 4Z7NE 3PIQA 1XFPA 1A2YA 3QDJE 4KKBD 1CIUA 4YZFF 1P2CB 3VXMA 4YBQC 3S36H 1CGYA 5LGHH 3JWDH 4QLRA 3V5KA 4XP9L 2Z93A 4OLUH 2P1YA 4MVBD 3LH2L 4KQ3L 2EDRA 4L4TA 2E6PA 3CAFA 1AHWB 3A6BL 3C60D 2FGWL 3LPWA 5C2BL 2Q20A 5C6TH 2DAVA 2ESVB 5FYJD 4GG8A 4K8RL 4EI5A 2ZOLA 3QUYD 3O6ML 4ODHL 3IVKB 3KS0H 2DQHH 2A6IA 2AKRA 1VSCA 3U46A 3FKUS 3NIGF 3FZUD 4I8DA 2IGFH 4IRSD 3D25B 1BJ1J 4D9LH 3VFMA 2HJFB 1LILA 5ALBL 1MAKA 2B1AL 1B0RA 5JLZA 5J06A 3HI6H 3OPZH 1LP9F 2P5EB 4NQXB 1UM4H 2BNRA 2O5YL 2W0PA 4U4BA 5D72L 1AGEA 3WIFB 1OAZH 1V5JA 3V5DB 5KZCB 1IQWL 2ZCLL 4X7SL 4LQFH 4YQXH 5DRXA 1BGXH 4RFEA 3RWCA 2BNQD 3RWIA 5FYJL 4ZNEA 1K6QL 3PWPB 4Q97A 1F2QA 4JRYE 1FVCA 3MNZB 3RX5A 4YHZL 4TUOB 4OIBA 1H0DA 1HHIA 2WNGA 3PP3K 1P1ZA 1NDMB 2WLYA 1T5XA 4NO3A 2C7UA 1YN6B 1FRGL 1QFUH 3KPSA 4TVPL 2LABA 3MRGA 2GFBB 4X8XA 1M1SA 5E2VH 4LP4A 2ZG3A 4G7YL 1KCLA 4YAQA 5HYEA 4OCMC 4PRPE 5L2KD 4NN5B 3BGMB 5B4MC 4OT1L 1U2HA 4NO0B 4YDIH 2I07A 2A6KB 3DV4B 1SJVA 3X14A 1X6NA 2AJZA 4FA8A 3GJEB 4RFOH 5IB5A 2BZDA 2XN9E 3WN5C 3MLYH 1ZEAL 5CIPA 4P5KA 4F7CB 3MUZ1 1C5DB 3WHE1 1JZ5A 5D1XA 5H94A 1QEWA 3MBED 5HHXL 4BQ6A 5DGRA 4Z7NF 5HYJE 3RA7H 1P7HL 2D9QB 3DRQA 1CGTA 3HE7D 5DFVC 3GSVA 4LHUD 1WC7B 3DIFA 5DJAB 5E95B 3MRFB 1XF2B 3PP3H 4P5TD 3SDCA 3TNMA 3WNKA 1KN2L 2Z35B 1QSEB 3BXNB 3O3AB 1I1AB 5T3XE 1FNHA 3LKSB 5E9DB 4TSBL 3TBVA 4DZ8A 3G6JB 5DI8A 4X4YB 4HMEA 5KAQG 1PG7X 1EO8H 2WLZA 5EBGA 4AQOA 1J5OH 3QFDA 2DB8A 4BSWA 4YHNB 3GFUA 4WHYH 3DX6A 5KN5B 5KBNC 1HILB 2BHUA 3FT3A 5F96H 1PKOA 5E8EB 2ICWI 1RK1B 3FB8A 3L3HA 1AE6H 1CVSC 3EGSB 1D5ZB 5T3ZE 2P46B 1ZS8A 3MLSL 5C8JA 5FO9A 5B21A 1FNAA 3WFEH 1JV5B 4XCEB 3TA3B 3P4OA 2ZPKH 3G5XA 4UU9B 5B8CC 4WUUE 3F5WB 3DJ9A 3LOWA 2DTML 2BNRE 1RZ7H 1JNHB 1TPXB 4JDVB 1IC5L 3ZYJA 1HHJB 4N68A 1Z3GH 1WCQA 3DYPA 4M5YH 1OW0A 1AQKL 5CGMA 5DQDL 5GGUB 2V9TA 4PJ7A 1I3RA 4JFYB 1PAMA 3TVMD 1G7PA 3QI9C 32C2A 4ZNEE 4FRWA 2AV1A 1JYWA 3PHQB 1G6RL 1K8IB 4L8CA 3WYRA 4ZPVA 4WWKC 1WTGT 4Y4KA 4PRHA 4MNQA 2A6JB 4E5XB 2IC2A 3QFJA 1XAUA 2CDEB 4MJ6A 4E0RB 4I3RL 4RNRA 5DMIH 2WMPA 5FKAB 2RJMA 2E7LC 1XF4A 4ZFFA 1A0QH 4JJ5B 4JPIA 4HK0B 3VFNB 3D85A 4ENEC 1OHQA 5GIRA 1VPOH 5IVNA 2XTJE 2Z31D 1EPFA 3BP7A 5D6DA 3D6GA 4U1IB 3U6RB 2ENYA 1FCGA 1MH5B 3O9WC 4OM0L 1KTDA 4PJAF 3Q5OA 1N7ML 3WEXB 4NCDA 2FNBA 1AQDB 5GGTA 1BOGA 3T65A 4JM2A 5JOPD 3BVNB 1H5BB 4X6DB 1SQ2N 2JJUA 3LN5B 4X7TA 3PDDA 2RAMA 3T09A 1LEGB 3LAFA 3RZCA 3NCJH 4JFHD 2NY0B 1MCNA 1BM3L 1MQKH 2R23B 1O7VA 3TN0B 4AL8H 4PV9A 1ITBB 1YY9D 3VFOA 5LGJA 1NEZG 3N9GH 3QWOB 1RJZA 3ULVE 5FUZH 1H3UA 2FJHA 3EJZC 4KJYA 4P3DA 1WT5C 1IEBA 4PB9L 3GI9L 3RTQB 5I8KH 3BP5A 4WIQA 3WIHA 4OLWH 4YXLH 4POYA 2FBOJ 1JFQL 1J0KA 2CR6A 4JAMA 2OTPA 2AQ1A 3B2UD 4WW1A 2JTDA 4JREC 3KXFA 4FXKB 4Q9QL 3G6DH 3O81A 4UBDD 4F57H 1F4XH 3RKDD 5CBEA 3QXDA 5J11B 2W60A 5JMOC 4YFEA 4P4KB 2EEAA 3REVB 3V52H 5CZVL 3F8UB 3BN3B 4CDGC 3MLPA 1U41A 3O2WH 1NAKH 4JG0L 1LDSA 5LCVH 4G43B 4HLZH 3SDDC 5ITBL 2I24N 2Y6SC 1A6AB 3IGAA 5D7JC 1A9EB 1KNOB 2DMCA 1H15B 1DANT 1D5XA 1TFHA 4XNQB 4X80H 5D70L 2O5ZH 5DUBA 2ADGA 4PJ7E 3HAEB 2X4QB 4KAQL 5KSAD 4NM8L 1S9YB 1NEZA 5JXEC 1DBAH 4KZEH 4Q74A 4XVJL 3O41B 4G6JL 4JLRB 4JN2A 4XTRD 1G7LB 1XCTB 2O61B 2WIIA 5F88B 4PRHE 2Q76A 3IJSA 1T7ZA 4YGAB 1QO3B 1T04A 2APWA 2IFFH 4WFHE 1R24B 1P84K 3VD7A 3KVQA 4QGYA 3OR6B 3V2AR 4M9OA 4WHCA 4R96A 4P46D 2BOCB 1NBZA 2XV6B 4WY7H 5D4QA 2HJLB 3QCTH 5C09A 4EI5C 4PJ9A 1MFBL 2BFVH 5BZWB 1AC0A 4DAGH 2HTLD 4Q6IA 1DANU 1OGTB 3MGOB 5CP3A 3NFPA 4HDIB 2BMKB 3FO2A 5T3XH 4WFEE 3WLWC 1FLRL 5JTWA 1WCBB 4R4FH 2FIKB 1XR9B 4I3SH 4GMSL 1AHWA 2IG2H 4OD1H 4KY1L 4HT1H 4RZCB 5BS0E 2ESVA 2VDQL 2DS4A 2H45A 4PJDE 5T3ZH 1WFUA 1BIHA 4JRXA 2B0SH 2AK1L 5I1GH 3IVKA 4HWZB 5HGHA 3WCYA 5J1AB 3FHQA 3GMMB 25C8H 3RWFB 2NR6C 4HV8A 5HVFB 1FAKT 4AM0B 1SMAA 4EDWH 4YHIA 3GKWH 3Q2CA 1JGEB 4V2CB 2EC9T 4PJCB 1LK3H 2JIXA 1X4XA 2P5EA 3O6LL 2VR4A 4NQXA 1TJIH 3PDOA 4ZO9A 1KJ3H 1J0ZA 3KXFE 1CWVA 3IFOB 3WIFA 1IARB 1JWMB 2DMKA 3JUYA 3TH4T 5DD1H 2JB6B 5C0JB 4X8JA 3PWPA 1RMFL 1ZLUK 4XP4H 3MRMA 3O3UN 1KIPA 4TPRH 1J1XL 1Q1JH 4NJAL 3MNZA 4TUOA 4FN0A 5D1ZD 3VDBA 5I1KL 4PJ7F 2I26N 3ME0A 5HVWA 3DSFL 1QFHA 3JBG7 1ORSB 1NDMA 4BZYA 2ZCHL 5D1XC 5JHDB 2EC9U 2EXWD 1AKJD 5EU3B 1DFBL 2GFBA 4OLZH 4KROB 1A64A 3BGMA 1DDHA