4RFNC

Crystal structure of adcc-potent rhesus macaque antibody jr4 in complex with hiv-1 clade a/e gp120 and m48
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
210
structure length
210
Chain Sequence
b'VLTQPPSVSAAPGQKVTISCSGSSSNIGRSYVSWYQQVPGAAPKLLIYDTNKRPSGVSDRFSGSKSGSSASLAITGLQTGDEADYYCGAWDGSLNVHIFGSGTKLTVLGQPKASPLVTLFPPSSEELQANKATLVCLISDFYPGVVKVAWKADGNSVNTGVETTTPSKQSNNKYAASSYLSLTSDQWKSHKSYSCQVTHEGSTVEKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 CLADE A/E 93TH057 (H375S) GP120
molecule tags Viral protein/immune system
source organism Human immunodeficiency virus 1
publication title Cocrystal Structures of Antibody N60-i3 and Antibody JR4 in Complex with gp120 Define More Cluster A Epitopes Involved in Effective Antibody-Dependent Effector Function against HIV-1.
pubmed doi rcsb
total genus 38
structure length 210
sequence length 210
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rfnC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rfnC01
2FJFA 4LEXL 5M94B 3VCLB 2DD8L 3H9HB 3IXAA 3GSRA 3OB8A 3BSZH 4GBXD 4NQVB 3RA7L 2IH1A 3GSUB 4FQXD 4JM2A 5TH2B 4XCYB 4ZUVA 3D5OF 3UJJL 1KCVL 3T65A 5F8RC 2XQYK 3G04A 4DN4H 1XF2A 5D72L 3WS3A 1X7QB 1TETL 5DJDA 2JJTA 4OB5H 4C4KT 3GHEL 1NCWL 1T0MA 4NKOB 3DMMB 3BIKA 4M48H 3MACH 4PG2C 1OTSC 4XXCA 4HBCH 5EBWB 1Y0LB 1RZ7H 2GAZA 2VZ1A 1A7BA 2O26U 4JFDA 1HYRC 4BA8A 5BQ7B 4PJ7A 1PG7H 4HMCA 4P57A 3SDXB 1XEDA 4O5LH 2E6JA 5C0ND 4O2FA 2EKJA 3S88L 2CLVB 5DUMH 2HJKA 1FVEB 4EUPA 4S11A 4WU7A 3IDYB 5E6IA 1L9NA 3QHTC 2M26A 1Q94B 5F3BA 4PRBA 1FL6A 1T22B 1FNGA 3CUPB 4U1SA 1L9MA 3U2SA 3K4AA 3ROLA 3LEXB 1R5WB 5T3ZE 5A3IC 1IEBB 5C0CB 1NAMA 4G3YH 2HRLA 3RIFF 3C6LD 2D03L 5EUOA 4NCDA 3DPBA 4HH9B 3VXSE 2IADA 2YKLL 3QEUA 3FT3B 4WW2A 1DLHA 4IMKA 3PHOA 3MV7E 1MLCA 1JNNH 4AT6A 4Y5XA 4ZNEE 2IH1B 4NSKB 4YGVB 3LQMA 1C7TA 4OTXL 1DFBL 3V6BR 1KN4H 3A0OA 3V5DA 1BD2A 5LBSH 4MLIA 2Q8AL 1X7QA 3R8QA 1EEZA 1NDGB 2D7TH 4J4PA 2IJ0C 3TESA 5TE4H 1I85C 2EDHA 5F44A 4QT5B 3EFDH 4KKBC 4P3DA 4F7PA 4QXWA 4NJAH 3D2UA 1X6NA 4AL8L 1RJYA 4ZPVA 2DM7A 4UQ2B 1KXTB 5JOFB 4UIMB 2A9MH 2F9BT 4TOYL 4QRUA 3BXNB 3IDUA 1QSEE 5GGSB 2LU7A 3BP7A 4ODBD 4G80B 3R06A 5HYJE 2FHCA 3QXVA 4V1DD 5LXGL 3B2VL 4U1HB 1IMHC 1FYTD 3U36A 4R2GD 1F4HA 3ZE1F 1CLZL 3SQOL 1UC6A 1HNFA 1CDHA 4L5FH 3SOBL 5GRZA 4ELMB 4B41A 1S7UB 2E6PA 4CU7A 5IWLA 3FN9A 1A7OH 1DL7L 3QO0A 2ZSVB 1FC1A 4LPXA 1NLDH 3QUZC 4LSVH 4TUKL 4UB0L 4B7LA 2RB8A 2LABA 4JPWH 3UPRB 3RDTA 4RBPH 5E4EB 3IB4A 3FFCE 5EZJB 3V7AG 5K9QG 1K4DB 4R7DA 4K3EL 1ES0B 3AROA 2ATKA 4NQEB 4EUPG 5HSFA 5KSVA 5GGUB 4M8VA 4ODHH 5E8PB 3CFBB 3OAYK 1AE6H 4OV5A 3BZ4B 4G7VH 3ARFB 4NM8H 1UA6H 1WBYA 2NY5L 1RIHL 4JO2H 3QIUB 4WU5A 1OY3B 1YJDL 5KVEH 1QSFA 1MFBH 4CMMA 4MX7B 5I66A 3W81A 1KV3A 4QTHB 1CT8A 3UBXA 3WMSA 3B9DA 4NNXA 4R7NB 5EZOH 3BGFC 1KIQA 3D3VD 5T1LB 3TO4D 1JGLH 1LMKA 2FECI 3SCMC 2H26A 1XZ0A 5D1QB 4L8BA 5IVXE 1AR1D 3KYNB 1CFVH 4QRPB 3NIGE 1FFNA 1KLFA 1DUZB 4H20L 4N1HB 3OR7B 1U8MB 1RUAL 2DQGH 4ZXBA 1C7SA 3GHBH 4OFPA 4FFWD 3EJZC 3OGCA 2C3XA 4MNGE 3SDYL 4CBPA 4LLMB 3CFCH 1AQDA 2WP3T 2W1NA 5ITFA 4FQLH 3QEGH 1S7XB 1TJIH 4N0YL 2ZUVA 4PJAF 3F7YA 5HDLA 5KZCB 5D1XD 3HUJB 1RZFH 5GRUH 5TDPB 4EUPH 1XMWA 4NQCD 4ISVA 4K2UH 3ARXA 2QQLH 4OQTL 3EKCA 1P7QD 4HG4J 5ALBL 1WWCA 2YWZA 1INQB 3IU4H 4MJ5B 4R6UA 1JK8A 5DI8A 4XPHL 1J0ZA 2XY1A 4P4KC 3MLTB 2B4CC 4G7VL 5I9QB 2NY2D 1MWAH 3MROB 4PJ5A 2EDYA 4NQEA 3TVMB 1HHIB 1FFOA 3SE8H 5KVDH 4F33A 4WNQA 4WUUA 3RWCA 2KZWA 3QCTH 4FN0A 5HI5C 3NACL 5DUBB 3IAGC 4AEFA 5IV2A 1WBYB 1HYSC 4EEEA 3I6LD 1QYGL 3MBXH 4CJ0A 4OGYL 3MA9L 2OR9L 3MV01 2R2EA 3U46A 4LPCA 1ED3A 1ADQH 2C3WA 3CXDH 4KK6D 5KW9H 3RTQD 3WLWC 1DLFH 4HGWB 1BZ9A 4I0PB 4DWHA 4P23B 3VFPB 3U1SH 5FUOL 3TBSB 4JQVC 3NFNA 2OJZH 3LY6A 2FWOA 5BJTA 2NY6C 2QQKH 1S7WB 5D1QA 3H6JA 1MY5A 5K9OA 4PB9H 3VXUB 4FXLA 4NKQB 5D7IF 1JZ3A 1ROWA 5C0JB 5GISL 4NOFA 2OI9B 2H2PC 2DWEA 5MHSE 4XPGH 4S1RH 2HTKD 3IGAA 4I3GA 4V1DE 3RIAF 1MNUH 4I3RL 4PJ5D 1E28B 4DUXA 4PJ9B 3V5KB 3MRQB 4M4PA 3ALPA 1L0XA 4UDTA 2W91A 3IDXH 4YZFE 4ELKA 5FYJL 3V4UL 1HOCB 4YXKL 4I4WB 1WICA 2LU3A 4HIEA 4QHKI 2A74B 1ZVSA 5ESVA 5BCAA 4JG1L 5DQ9A 3G9AB 1NL0L 3Q5TA 2WIMA 5ISZE 1J1OL 4G8FB 3CPLB 2IH3B 5GS0C 3WO3B 3V4PH 4OSUH 4ZFOB 1Q0XL 3MLYH 4M1GL 2PCPA 1XF2B 2P44B 3DX9B 3Q6GH 4GAYA 1T1YB 1EUTA 4JM4L 4H0HB 2FHFA 4HKBA 3L1OL 3MRCB 1S8DA 3FAWA 5D8JH 3RIAK 1YN7B 5F9OH 3U4BH 4NWTH 4UV4H 1KJ2H 1BM3H 3ZTNH 4UDUB 4WDIA 4RGND 3UPAA 4Y16C 5CGYC 5ICXA 3VRLF 5GJTL 3BESR 2FJGB 3P9MB 5AD0B 3O2DL 4JPKL 4NO2B 4S1SH 2ZCLH 5IB4B 2EH7H 3TYGH 4I1NB 2HJKB 4U1GB 4OF5A 3DETC 2O61B 5DJYA 3PDOA 3MLSL 2FL5B 1QRNA 1RUQH 3KXFE 5EUKB 3UTTA 1MRCL 3UDWA 4YE4L 4HSQA 4S10A 3X12B 3ULVF 4GAJH 1FL6B 1N0LA 3MV9E 5FDWA 5I74C 4LKCB 3QFJD 2AV1B 1IVLA 1JWSA 2YPKB 4PJXA 4PJEA 4G8IA 4HUWB 1HHHB 5H35A 1IGIH 5J11B 1G9ML 3BGFB 4C4KO 5DJ6A 5ICZB 4K8RD 1LILA 1TNNA 1KG0B 2PYED 3BN3B 4AY0A 4N8PA 4OCSH 3PHOB 2NY3B 5TH2A 4O2CB 5C1MB 5IT2L 1MLCB 3TWCL 5J57B 1RZIA 5DGRA 5HVHB 3WS3B 4XXDB 5GS1B 3LEYH 3JTTA 1GZQA 2APVA 2Y36H 3H9HA 3IXAB 3JWOH 1MFAL 3QXDB 2W9DH 4Z0BH 3GSUA 1C5DA 3RVTD 1A6WL 1DBMH 3TO2B 3N1FC 4ODUA 4KK6C 2NNAA 1HHJB 5DHYB 5T3XH 5GJSH 4DVBA 3LKPA 3PWVB 4XVJH 4NO3A 3TZVD 1JPGB 3TEUA 3CFIC 5F1OB 3DVNB 2RQ8A 1QLFA 3IVKA 4LRNL 1I1CA 2B20A 1ACZA 2P24A 3O6MH 4Z7UB 3QJHA 1ITBB 2Z93B 4HT1H 1IC5H 3P9MA 1T7YA 3MC0A 5IB4A 4PD4K 3DOSA 3U36B 1JN6A 4YPGA 3BIBX 4YIQB 2YUVA 3SDXA 1JNLL 3ZE0F 4U0RB 1NGQH 5INDB 4G7YL 5BV7H 2VUYA 3U2SB 1CQYA 1FVEA 3QDMA 5DEGB 4JKPL 4WU7B 1KEGL 1ZTXL 5A2IH 5BV7C 1A21A 1N0XH 2VB5A 3TA3B 1Z5LA 4AEHH 4GW5A 3S5LA 4WUUD 3RWGA 5HYSA 1KCRH 1ADQA 3GDBA 4Z7UE 1X5GA 1LNUA 4PJ5E 1OPGH 1WLHA 1A7RL 1II4E 1UM4H 1ZANL 4LEOA 4F2MB 2ARJQ 4OZFG 5ANME 1OLZA 2Y06L 1H8SA 1NEZA 1X5ZA 4QRRE 5FYLH 3GI9H 1IM3B 4M6AA 4QHNA 3W0WE 5EZLB 2IADB 1RZ7L 5CEXB 5FCSH 3QG6A 5DMIL 3NFSH 5SV3A 3X11B 4TUOB 3FFDB 2GJZA 3KS0H 4FQJL 3QDAA 1B88A 5AWNH 1HQ4B 4XXDA 5T3XL 4TN9A 5E4EC 3BMWA 3QQ4B 5SWSA 2VLJB 5JA9A 2VXUL 2Y5TB 3QEQD 1S7RA 2H3NA 3UZEA 1G6VK 3ARPA 3S88H 3QBTB 4J8RA 5AUMB 2ZCKH 4GAFB 3OJVC 2V17L 1FL3B 1CICC 1GAFL 4GW4A 5IEHB 4CN1A 5JXAH 5HPMA 4F58H 2HMIC 1MHCA 2D7OA 4F37F 1T1XB 3ZDXF 3VXMD 3Q3GA 3VXTB 4U6XB 3X13A 3DURA 5ACMA 1AQKL 1MRFL 5SWQA 3FB8B 3Q48A 2HFEB 4KQ4H 3TNMA 1G7IA 2BVUA 3VFMA 3WFDH 1LD9A 4L3CB 2BHYA 1GGYA 4ZAKA 3TCXA 4MQXC 1F58H 4Q2ZA 1NCBH 5MENB 3MRLA 1T0NB 1OPGL 1G9NH 4NN7B 1RVFH 4HBQA 4P9HC 4I5BA 1B4JL 1WAAF 2R4SL 4XCCH 4TNWF 2NY0B 1SJHB 4OB5L 1HE7A 3S5LB 3VI4F 4M1CC 2MCPH 4HXAL 1RULH 3ZE1E 5E2VH 3BMVA 3AUVA 3C5JA 2R0KH 5DLMH 3MROA 4RGNC 1KIRA 1EAPA 4NRZA 4WFED 1KPUA 4RAUA 4MAYC 1AXIB 1VFMA 4HF5L 3G5VA 1NEZB 5IJKC 4KTDL 4TQEH 1A3QA 1BWWA 2BDNL 3MUY1 5MERB 3ZSSA 5T5FH 5J6GA 1HH9B 4OQ1A 5BS0E 4KK9D 3ILPB 1H5BB 3FO2A 5GGUA 5CP7A 4OZHF 5C70A 1GC1L 4L4VB 4WI7A 5LXGH 1I1AB 2E8ZA 3FB6B 1NC4D 5FIEA 4O51B 3I02A 3RZCB 4GXUN 5IMLA 1QBLL 3DV4B 4MD0A 4NO5B 2YHGA 5LJYH 1VENA 4L8SC 5DA0B 4EJ1C 3VFUA 3GMLB 3DETD 1CFSA 5KVFH 3OR7A 2DQIH 5HPMB 1KCLA 4C56E 5F7FA 3ULUH 4B7IA 3M1BA 1HXMB 5C0JA 5EWIH 4JR9L 5HHVH 1AQDB 4I18A 1SY6L 1X5KA 4OLYH 3BH8B 2VTFA 1S7XA 3MGOA 2WWKT 3BO8B 1A4JA 3DGGA 1OF2A 3VFOB 3IFOA 3L9RA 4FQXB 3QUYD 5M7QA 4NC0B 5JOEA 3P0VH 2A83B 1HKFA 4ZS7H 5H8DA 3T77A 4FZ8L 3HZMA 5SX5H 1T89C 4RRPA 1YZZA 5DLML 1YEDB 1KELL 1K3IA 3VJ6B 1CD1A 1WAAA 4I4WA 1MY7A 2NZ9D 3TZVB 2D31A 5GRWA 5EBMA 3VFNA 4BSWA 1WK0A 2IPKA 5HYIA 4P23D 3CPLA 1FO0B 2QJDA 2FYYB 1HHIA 3C87A 4JFHE 4PRIA 4XCNB 4X7FC 3LZFL 5KS9E 4MHHG 1JK8B 5DI8B 2DOCA 2WBJC 3NCCB 4M5YH 4HS8L 3G5VB 3MLTA 1A1NA 4ZSOE 4IIQC 3T2NL 1CXIA 4DKFH 4OI7A 4GKZB 5BMFL 3W5MA 3MUJA 3PL6A 4JGMA 5ITBL 3DTXB 3QI9A 1U8NB 2QV2A 2VL5A 3TH4T 2NY3D 5MEPA 1NSNL 3CX2A 4X5LA 4DZBA 3VGDA 4A2LA 1CLZH 1BOGB 3SQOH 1OW0A 5E6ID 4P23A 4XP1L 3BEWB 3VFPA 2VL4A 4U1NB 2EIZA 1RZGB 5BJTB 1HI6A 1S7WA 3OKKA 3TFKD 1NCCL 1E4JA 2QBWA 5K9OB 3CDCA 3HPJB 5D70L 3CFDB 3MFGB 2VLJE 1CFQB 1X4XA 3WKNA 5DR5L 1MQKL 4OQTH 1CFTB 1KYOJ 3Q1SH 4YXLH 5IFHH 5FCUL 4U1IA 5TJWK 3VXUA 5C09B 2H6PA 3C8KB 5TQ0L 4TSCH 4UT9L 4OCYH 2W65B 4NHCL 2J7LA 5KSAA 3LV3B 1KCVH 1IM9A 3ULVC 1KEMH 4NUJA 4KJPC 3JWNC 2V6HA 4LNRB 5IP4A 1OW0C 3ZO0A 3V5HB 1LO2L 3FQRB 3TBWB 5B4MD 1AGFB 4C83A 1V3MA 1XGYH 1SMOA 7CGTA 5DJXA 5DQ9B 3NOIA 1JWMA 1U42A 5EBLB 1FL5B 4PPTA 3TA3C 1M7DA 2W92A 2X6MA 1RUMH 3P9LB 3VA2C 3DXAE 1U93B 1E4KA 3HB3D 2GTZA 5E8NB 1G7MA 1NC4A 3LEVH 3RY5A 2X4UB 3OX8A 4UIKL 1CGTA 1G9NC 1UJ3A 5INCA 5F6HJ 1DQQB 4RQQB 4WHYH 5LGJB 4OM1H 4Q9CA 4PJBA 4RMTA 3CVIL 4BK5A 3MV11 1J5OL 1RHFA 5CP3A 1DTUA 3O2VH 5JNYA 4U1NA 5AD0A 4G6FB 2I9TA 5KVMC 4YQXH 3WCYA 5IB2A 5JR1H 1CBVH 5BO1H 5ICXB 3OXSA 2X40A 1CFQA 4P49A 1HINL 3D0LB 1BAFL 1ORSA 1K3ZA 5GZNC 1A6VL 1CE6B 5F6IC 5EO0A 1A3RL 2C26A 5L6YH 5DHXB 3GUTA 2ENYA 1FE8L 2GJ6A 2JJUA 2ESVE 5DVOA 5ID0A 3HRZA 1J05B 1ZOXA 2H8PB 1Q9LB 3SE8L 3T09A 4XNZB 5KSAB 4ZDHB 2X89A 1V5JA 3LQAL 4OLUL 4D0DB 2AQ1A 4X80H 1S9VB 5F96L 2C4XA 4LNRA 1R3HB 2OTUB 3CDGA 1EEYB 4FFWC 4G9FE 1U91A 1SBSH 5IMOA 4HWBH 2Z8SA 5IVXA 4DKEL 4XC1L 5AZEH 1JV5B 1CXKA 4WY7L 43CAB 3SE4A 1YEJL 4EOWH 3JTTB 1DQLL 2A9ML 2XKSA 1QLEL 1KG0A 2YD5A 1KJVA 2VERN 3QDHA 3SDCB 1BIIA 4KZDH 3KPTA 3B2VH 3B9VA 4QXTA 3LD8C 5HD8D 2F54A 4HS3A 4R4BB 2X4QA 4I0KA 5D7LD 3CLEL 4ZUVB 3VMPA 1W0WA 4HJ0D 1ZT4B 3QDGB 1I3GH 4MAYB 5INCB 4KVCH 4LDLB 2C9AA 4K71B 4MJIB 1H3GA 4OQTA 2X05A 3QJHB 1FJ1A 2EKSA 4YR6B 2FO4B 2DF3A 3VE0B 1PEZA 2EO1A 1J8HB 1CU4H 5E08L 4M93C 5C0CD 3MX0A 4U1LB 4D8PA 4WGWB 2NY2B 3VGEA 3V2AR 3KJ4B 3AREA 5A2LH 3L5XH 5TDNA 1YNKH 4KKLC 4ODSL 1HSBB 3PP4L 4CMHB 3LKRB 2WLZA 2OBGA 3RWGB 5BS0D 3KYOB 1NJ9A 8FABB 2EDBA 4WO4B 4F15B 4U2ZA 4LEOB 5KVEL 4J4PC 2KUTA 1NMAH 1PSKH 2XACC 2CKBB 5D96C 4F15C 5I75B 5CD5D 3U9PL 5D5ME 3E8UL 4LASH 2Q87A 4Z7QF 1T04B 3QEUB 4D9QE 4FFYH 1EGJA 4FTVB 3IFNL 3LB6C 4IMKC 5KZCD 1DLHB 2YUZA 2DQGL 3TYGL 5C8JA 5TF0A 3LKNA 5I19L 5IQ9B 4L4VA 4Y4FC 1I1AA 1M71B 5ICYB 4O51A 1FNEA 1U3HA 2DKMA 4GW4B 3OB0K 4YE4H 1C12B 4R2GB 4RDQG 5B8CB 2E9IA 1VFAB 2X09A 3UYOD 2ZNWA 4F7PB 2GYSA 4B53A 5AUMA 5D5MB 1FG2A 4K2UL 3BWAA 4ALAL 1KIPB 4MXVF 1UXWA 3U0TA 4PJ7B 1FAIL 1B6UA 3NIFE 3GNML 2SEBA 4N8CH 2VQTA 1LP9A 3MRLB 4JQIL 4MNQA 5CWSA 4Y1AE 4EUPB 2NY6D 5FO8A 1FC2D 4OLVH 4PJ7F 5I1CL 3ME0A 3GSNL 1PG7X 4CNIB 1D5IL 2VISB 1YNTB 1PSKL 1UEMA 4OBSA 1PY9A 1QR1A 5AWNL 4Q2ZB 1CD1B 1YEKL 3FT4A 5A16A 4I5BB 5BXFA 1RHHB 3CXDL 4QCIA 4QRSA 5GZOD 4NRYA 5FKPA 4D9LH 1Y6NR 2CKBA 5EUOB 2X70A 1G7JA 5IW6B 2VDRH 4R90H 5E99H 4M7JH 5DD6A 1WAAE 1T3FB 3O6ML 4NC1C 2WZPD 1A47A 2IPTH 3KPRB 3X3GH 3TYFB 3EYUL 5C2BL 3ECBB 1QBMH 4GRLD 1IFHH 5IMLB 1CGSL 2BNQA 4MNQE 4X7TA 5JHDD 2K7QA 5ICYA 4HWBA 3ARYA 5IJKA 4XCFL 1NCAL 1OGAD 5L7XL 3QHFH 3RPIB 2JIXD 2GFBA 2UY7A 3BDXA 3MRDB 1UZ6E 3ILQD 5FYJH 4J23A 5CZVH 3G6DH 1AJ7H 1JPSH 1UJ3C 4XCCL 1RJLB 4UIMA 5FYKD 4U6HB 5CD3B 4JRXA 3I2CH 1MHPL 3EBAA 1VFOA 1OT1A 3WJLC 1UB5A 1Q9WA 2ADGB 4IM8A 1T21A 4Z7WE 1CXLA 4MNQB 2VLLA 1P6FA 4V1DA 3RGVA 4NUJB 4APQA 4CNIA 1HHKB 4ZUWB 5D1QD 3BRGC 2VXUH 2P5EE 3FJTA 2BFVH 3FQUA 4KPHH 4XMLH 3QDGD 2BMKB 2HN7B 4XPFH 4P9HL 4L29A 4BH7A 7FABH 2CXKA 1HIML 2DQHH 3B6SA 3PP3K 3GK8H 3BPOB 1B0RB 1FIGH 2XN9B 2D7QA 1NGXB 3TZVA 4JJ5A 2ID5A 2A73A 1UFUA 2DYPD 3HI6L 1WF5A 1GH7A 2BVTA 2NQCA 1YECH 3T4AA 1D5XA 4KTYA 2YZ1A 1OARH 3HAEG 3L3IB 4X9FA 4DZBB 4X4ZA 4R3SA 3DROA 3S7GA 3H7BB 4NN5B 4P3CH 3QHFL 4PP1C 4DOHE 2P8LA 4LSTL 4W68A 4JN2B 1QEWA 5MP6L 5E8DL 3UYPA 3HZKA 4LCUA 1SY6H 4RQQA 2WBJA 5B39G 4PLKD 1EPFA 5MEPB 3BRFA 1JF5A 1GC1C 3HE6A 5KANI 1Z0NA 2FHBA 3AS1A 4LSSH 1YY9C 4Y88A 4IRSB 1A3LL 5HGAA 2ZG1A 5IB3B 4U6VL 4XNXL 4WRLA 1Z6JT 4MDIA 1BZ9B 1KB5H 2O5YH 4YC2C 4QYOB 3MLVL 1J0IA 2R9HD 4U6YB 4CL7A 3EYOB 2J12B 3K7UA 5F9WB 4JN1H 5E03A 1NUGA 1UACL 1F3JA 4HFUL 4LHUB 4K7PL 2DBJA 3GMPA 2VO5A 3F7PC 1X5AA 3CMOL 4XPFL 4X8XA 4W6YB 5D7LA 4Q58C 4JFOB 1ZGLM 3QA3B 4G6MH 4X4YB 3FQRA 1A5FH 1OP3K 1DZBA 4D0CB 5GJSL 4PJ9A 3AS2A 4AQOA 1IGYA 3C60B 5JQHC 5DRZA 3TIEB 3MODH 3O3BA 3WEXB 2KQMA 5I1KL 3WJLA 3FB5B 2G5BB 4PJ5B 5I8CB 2YSSA 2ICWB 3UJTH 5C0DB 1YDPA 2F54B 2VN7A 5EWIL 4WI2A 2IF7A 2NY1C 2CUMA 3RY6A 5FHAH 4NZTH 3WNOA 3QEQA 2X4UA 3OX8B 5HDBE 3CMGA 3MJ9H 5TQ0H 3P0VL 3ARDB 5MI0B 1TQBB 2D9CA 1QTYT 5E9DE 1X5HA 1TCMA 3T8XB 4JY5H 2YEZB 1YEIL 5EO0B 5JTWA 1OCWH 5D6CB 4JCLA 3RU8L 4N0CD 2CLVA 4FMKA 1LO2H 3PQYE 4W6XB 1U3JA 5FYLL 1S7QB 2WMPA 3GMNB 3O0RL 3PNWB 3MBXL 2DM3A 5BRZD 4N5EC 3BDYH 3KHQA 1A6ZB 1AD9B 4HXBH 2GJ6B 5ID0B 5D7JA 3LRSB 2OSLB 2Y72A 3EYFB 2H8PA 1K5NA 3NFPB 3VWJD 5FDWB 3QA3A 1JGUH 35C8H 1K85A 4JFEB 2FATL 1YQ2A 3CX5J 2NLJB 1NUDA 1YMME 4ZUSA 4HH9A 5GHWL 3ULVE 4KI5E 4HIEB 5ESVB 3VG0H 2Z4QB 4IRZL 3RVWC 2W0PA 2P5ED 3QI9C 1KJVB 2AXGA 3UTZB 4JVUA 1OP3H 4E41A 4EI5C 4AIXA 1V05A 1EDQA 4J2XA 1O5DT 3TCLB 2GW5A 2VSDA 2PW1A 3ILQC 1QLRB 5F89A 1JL8A 4XMPL 5F72S 4ERSH 2CLRA 5GGRA 1HILA 1AXTL 1ZT4A 3QDGA 4GQ9L 3PWPD 3H9SD 5FOBB 1BIIB 3JV4A 1ZT7B 3ROOA 4H88L 3BT2H 1UJTA 4PJGB 3H9YA 3DX8A 3V4UH 5GSVA 2HYMA 4HKBB 3G6AA 4LCCC 2NTSP 1G9NL 4KHXH 32C2A 3VFSB 5FYKL 4WW1A 1T0PB 4G6KH 4M9OA 4KJYB 1NFDF 1C5CL 3VXRD 2EO9A 1M7IB 2EECA 4MS8C 3SGDH 1SBSL 2BXZA 4IMLA 2Q8AH 2GEEA 3RFZC 3GM8A 4P9MH 1VKXA 1WEJH 4QGYA 1UM5L 2O5XH 1NGZA 1DQLH 4M6NH 1KB5A 5IBTL 4Y16A 4ESKA 2PYFB 4X6DA 3OTTA 3QXUA 4WHCA 4NBXB 1V7ML 5E1HB 1N59A 4PJHE 4HW6A 3MLUH 2FX9H 3RDTB 5JHDE 2EXYD 5DK0A 1RK0A 4GKNB 4ONHA 1EIBA 1MWAB 4AMKH 1MREL 2WBJD 3FAXA 2VITA 2AXGB 4L5FL 4M7LH 5CCKL 1DQMH 4XWGH 5JR1L 1W72B 4KRLB 4P2QD 4Y7MA 1F8TH 2R2HA 2NY4B 2HTLD 1UADC 4NKIH 1AI1H 4NGHH 1BVKB 4CU8A 2IQ9H 4TTDC 1F3DJ 3W9DB 5IMMA 5AEAA 4K07A 1INDL 2AEPL 2DQFB 4XZUB 5EORL 1N6VA 5F88A 1OGTA 4LOUC 1VHPA 2YK1H 1YEEL 4FQIL 1ZSDB 4D2NA 1IGIL 4OZIB 3BQUD 3MRHB 1S7RB 4Y2DA 1QFOA 1ZV5A 3LKPB 4HWZB 4LIQH 2CRZA 3RZWA 1TNMA 5GGQH 1XCTB 5D7IE 1KOAA 1GPOL 2DTSA 2VDLH 4ZQKB 1AC0A 1JUFB 1P2CA 3GSWA 4YLQT 2D2OA 1YPZF 4K3GA 5DHVB 1S3KH 2C1PB 5JZ7D 1T21B 3LZFH 1A7QH 3DO7A 1RUPL 5A3ID 2EDNA 3ZT6A 1YNTA 1TTGA 1I7RB 3WUWG 3STBA 1E4KC 2RFXB 5D6DA 5FO8B 3PQYA 1G7LA 3QDJD 3THML 4LARH 4ODTH 4YBHA 5GS0D 3NIFF 3AM8C 1AGCA 5FFLA 3HMXA 2CDEA 3MCLL 4MYWB 3BKCL 2VIRB 4WW2C 1QR1B 1PX3A 2B1AH 4GXVL 3IKCA 4KVCL 2CUIA 2X1OA 2JIXA 5IR1A 5D93B 1KTKE 1TJGL 4LAQH 3O8XC 2I07A 2X70B 5F7UA 3WL9A 4R3SB 4X7TB 1GYAA 5F7EL 1T2JA 3AY4A 3FFDA 4JFEE 1KEGH 2PN5A 5DMKA 3KAAA 4UU9B 3B8SA 5IFHL 4LIQL 2VLJA 1K4CB 3EOBB 1N0XL 4GKOA 1L0YA 2XKUA 3KG5A 1YC8A 1YA5A 4KUZL 4PJDE 4TSBH 4JKLA 3BPLB 4UILL 1ZHBA 5CBEB 1IAOB 2OTPA 4LP4A 3BWUC 4OZIA 1UM4L 1JTPA 5AYQA 1BQHB 2FIRT 2XQBH 2DB8A 3I3DA 5HGAB 1G6RB 5E2WH 2FWOB 3GI9L 3WDIA 3LIZH 1RUPH 1UB5B 1A7NH 4HULB 2ZUUA 1ZE3C 2X7LB 4DZ8A 5DQDH 3VXTA 3CCHA 3O2DA 5EN2A 4UBDC 5JORA 1FQ9C 4NP4H 1EHLL 3UTQB 3G5ZA 4PS4L 3BH8A 5MENA 2ED9A 3FQWB 2X4SA 3VXOA 3GM0A 3ARGC 4F7EB 1AGBB 3TPKA 1XGTA 3NABH 4F3FB 2FR4A 3FRUB 1KTDB 5F97E 4KTEL 5IHZA 5C9KA 4LAQL 1ODAA 1G9EA 3TNNA 3LQZB 3C6SB 1ZHKA 2WWKO 1QA9A 3T4AB 4GLRI 5EU6E 1BWMA 3L3IA 1EAPB 4NRZB 4M43L 4XCNA 3VDAA 1QNZL 1KENL 1U6AL 5EO1B 4IHOA 5J6GB 3ZDXE 3ILPA 1XF3B 4YJZL 4EI5A 3SDXE 5CP7B 4YDVA 1MI5B 3HA0A 4BH8B 3EJZD 5CJQL 4LSQH 1P6AB 1FYHB 1BJMA 5C09D 3MLPA 4XC3H 3TN0A 5DDHA 4KC3B 3J8F7 5ETUB 1OM3L 1MFEL 1I8KA 1D5MB 5HDQH 1EJOH 1VEPA 2FZ3B 4U6YA 2J8UA 5F7DA 4JHZA 4IRSA 3TVMD 2CMRL 3QIUD 4ZD3L 4LVOB 3RUGF 3VG9C 2HA1A 1ERNA 3WD5H 1BHGA 4WY7H 4D9LL 3GMOA 1PD6A 3GJEB 5HI4D 3IFPB 4O2EB 3LKQA 1JRHL 2P8MA 5DEFB 4M7JL 3NABL 1AO7B 2CD0A 3S37H 1EZVX 5JUEH 5AZ2H 5D2NB 3IDJB 3VXOB 3VH8A 4F7TA 5DVMA 4NN5C 4OLZL 5C7XL 3T3PE 3WN5A 3MV7A 2BERA 5KVFL 4HCRL 5B22A 1YYLH 2HKHH 1B2WL 4DQOL 1R3KA 1AGDB 4AENB 4WFFD 1TZHB 3U6RB 1ZLUK 4HV8B 5ERWB 3QH3A 1MLBA 2ZUYA 2ICWA 5C0DA 4F7MA 5I1AA 3DIFB 1LWRA 2G2RB 3KNBB 1XGRA 4JPIB 1MFCL 1PY4A 1FLRL 3ARBD 3DVFA 3FT2A 1J1PL 4LSPL 2JCCB 5CMAB 4GKZA 3MLVH 3OSKA 3MV9A 1U8NA 4F37K 3RL1A 4TRPH 2XWTB 4EI5B 5HI3C 4JANB 4H1LB 2X9YA 1FZOB 4NO3B 5IQ7H 4X99B 3QUMH 1JPTL 2XKNB 1FLTX 3ZYOA 2N7AA 1FGNH 1VCAA 1MF2L 3I6GA 4FMFA 1JNHA 4HK0A 5IG7B 4ELME 1UCBH 5EIQA 1Q9OB 3NPZB 5CJBA 5SV4A 2VDKL 3VMOA 3LPFA 1ZA3B 3SEPA 3JTSB 3MNVA 4B50A 1NGWB 5HDBF 5DC0A 4XNMA 5JUEL 5IB2B 4YIQA 1CFTA 3ULVL 6FABL 4WV1B 1XIWD 1YEGH 4CW1B 5B3JF 4HX1A 2ATPA 4ZOCA 4FQ2L 4X6DE 4Q9BA 1UYWL 2NXYC 1CE6A 3HAEH 4R4ND 5F1IB 1A9EA 4GQPH 4XP1H 3VI4E 4BQCA 2Y25A 4P2RE 1TMCB 2HKHL 4DAGH 4K7PY 4KY1H 3O81A 1A6PA 5EIIB 3D1MC 1RK1B 4QRTB 2EEAA 4YHPA 2HMID 5DJ2A 2PR4H 1NCNA 2RIKA 2MQ3A 2PW1B 4BSJA 5L2KE 5HVHC 5F89B 1H3TA 4J3WA 4EBQL 4UTBH 4XNYL 1BVLB 2Z4QA 3LAFA 2EDWA 1IARB 4XNXH 1ZTXH 2QADB 2Q76A 3HMWL 1A9BA 2GJJA 4NM4L 4BELD 5E8NA 2VZTA 3L7FB 4M6OH 1JGVL 3MFFB 4HIIB 5F9AC 1BBJB 3WIFA 4PGEA 3FFCA 2XWTA 1P7KB 3MRHA 3SE9L 3QDMD 1Q9KA 4YHML 2VDKH 5A1AA 4D9RE 4HZLB 4R26L 3HC3H 3N1GC 5GSVB 4G6JL 2E7LA 2G75B 3G6AB 4G5ZH 3T0ED 4XP5L 1ULVA 4LF3B 3KYAA 3VD7A 3QRFM 1NDMB 1IGJA 2XXCB 5CEZD 3SJVD 5C09E 2AJZB 4XHJD 4PJBF 2EKSB 4JGUA 4P4KA 2VLRB 3DX7A 4P5TB 2Y7QB 5E94B 4IOSD 1BPVA 3ZSTA 1IL1A 4JZNA 1T66C 3V6FA 1EFXA 3GUTB 4F9PA 1O7SA 4DGIH 2UY6A 3PGFH 3IYLW 3P2TA 3H3PL 4LLQA 1P53A 1R5WA 3OKLA 2R8SL 1T03L 1A4KA 1JVKA 1RK0B 2PYFA 2VIRA 4XVSL 4JO4H 3VRJA 1U3HC 4C54A 3H0TA 3PE9A 3S3SA 2IANB 4JREC 1HINH 2VLRE 5LCVH 4OM0L 4MJ2A 3DVGA 3LCYA 1JPSL 4ONHB 5L6YL 4NZJA 5DURD 3VG9B 1FE8H 2EXWC 1CL7H 2OP4H 2VDNH 1MHPH 1LO4L 2IGFH 3RVXC 3IXTB 2I60L 2ZSWA 3WO4C 4HKZB 3VFRA 4DGVH 3NIDF 3QIBB 5HI3D 1MCQA 1OAKL 3FB6A 5I1HL 4LVNB 1M7XA 1I4FB 1NAML 2AK4A 5LVEA 1D9KB 3GMMB 4G42A 3W9DA 4RFNB 4Y8AA 3X17A 4YHNB 1YPZB 3W11C 4QTIL 4TUKH 5I76B 3F7VB 3K8KA 3LKOB 2ZUQC 4P3DB 1WCBB 1WFOA 2QHRH 4FQQA 4I3SH 1V7MH 4GKSB 5ENWB 1CLYH 4HC1H 4HK3N 3C09B 3WJJA 4EN3C 4NHUB 2BZDA 5DRXA 3REWA 4UTAL 4Y4FD 1J9CT 2Y07L 3H2WA 1DDHA 3AMKA 2AK4D 3H9ZA 4K94H 3L3GA 1RZKH 3BP4A 3CLEH 3CIQA 4FQXA 4JM2D 4XAKD 4U1HA 3LSOB 2DTML 4M9PA 4FFVC 5C9JB 2VZVA 1YPZE 4LVOC 5JW5A 4KZEH 4U7KA 3IFLH 1R24B 1LEKB 3UXFA 5IJVA 3PDGA 1EERB 1CG9A 2YD3A 3FTGA 3O9WC 2VH5H 3VH8G 1WIOA 2ITCA 4OTXH 3VDBA 1FFPB 3GSQB 1NAMH 1IZKA 2BSTB 4KJQC 1VFUA 4RNRA 2ZOLB 3GMRA 5JDSA 3HE6D 3IXTA 1QSFB 3KPRA 1NFKA 3T0BA 3OAUH 4CMMB 4F80A 5JOPD 4XNZC 1RJZA 1CT8B 4X6EB 3U83A 3A6OA 2FD6H 4G8GA 2XPGB 3O3AB 1DP0A 3O8XD 3QIUA 4TOYH 2GITA 1RZGA 5FKAA 4LRIA 3T0EC 2ARWA 3O41A 2ICES 2B39A 1NQBA 2HVKB 5E8EA 5E70A 3HTLX 4XVUC 1D5MA 2NPLX 4RWYL 1X4ZA 3RWIB 3ZDYE 4HUUA 4AJ0A 4ZNCD 4TVPD 1MOEA 4CADA 1VFBA 2P8PB 3B9KA 1B90A 5ITBH 4FFYL 1EK3A 4QXUL 4G9FB 2D3VA 1U8IB 2XT1B 3LOWA 3D39B 5ELIA 2YD4A 1MRDL 3AB0B 4QRPA 5EO9B 3VXQB 1A6AA 3F7YB 3BP5A 3NGBB 3NH7H 4ZSOB 4ZXBB 1UCTA 4I77L 5F93C 1N6QL 4NNYB 2VOTA 3L3OA 4OF6A 3RAJH 5ACZB 1HHGA 4M48L 1T5WA 3WBDA 3ZYZA 2J2ZA 3I3EA 3VXMB 3QIUC 2VDOH 4PJFA 2ENSA 4LCYA 3VXSA 3MJ9L 5T1LD 2DQEL 5BW7C 1F42A 4JCMA 3NMEA 3R0MA 1FFOB 3JV0A 5CSZA 3D39E 4P46D 4F33B 4H0IA 1RIHH 2IFFH 4Q0XL 3QAZB 3LS5L 4Q6IB 1SEQL 5CJXC 2F58H 5EU4A 1FV1A 2AXHA 2HFGL 3QNXB 5D1QC 3S35X 1KEML 2AXFB 5C08B 3VWKD 4B5EA 4FZEH 2ED7A 2VLRD 4GRWB 2W9LA 4JFFA 3P30L 1IQDB 1DN2A 5T3ZD 3QUZB 2J5LB 2VQ1A 3O0RH 4JANA 1F4XL 3OB0H 4GAGH 2A6KA 4IOFC 4Y8DC 4NZRL 5FYJD 1XF3A 5KN5B 4WO4C 1QBAA 1H15B 3D18B 2L7JA 4HMEA 4YHOL 4NQSA 3CDYA 3MRFA 1CWVA 1G7PB 4PJ7E 2DM2A 2GFBB 3SHSA 4P2RD 4PJGE 5DZLA 3THMH 3EZ8A 1FVCA 2E27L 1YN6B 4NKMB 5I17A 4Y4FA 5GGVL 1JGDB 2C1OA 4RGMC 3WIHA 3QUYC 3BPCA 4IRZH 4PP1D 3C8HA 4XAWH 1E6JH 1GHFL 2ZUWA 2R1XA 2E7LC 4M3JA 1N8ZB 5FYLD 5I1DA 4PV8B 1LHZA 5HHQA 3CVIH 3V6OE 3SGEI 4TSAL 1JTTA 1HCFX 1OAQH 4EDXA 1A6TA 3DI2B 4EI6B 1J7VR 3EO1A 5F9OL 1HYSD 1LP9E 4RMSA 4Y4HA 4O00A 4Y1AA 5GRJH 3ET9F 3U4EB 4WI9A 2W59A 4OAWA 5LGHH 2FH8A 4U33A 1BAFH 1F5WA 4N1CA 1L0QA 4UILH 5CJQH 3U7AA 4X0KB 3KWWB 1OP9A 3BZDA 3QUXC 4L9DA 1V3KA 4GMTH 1B0RA 2Q7NA 5DEZA 5ISZA 1DVFD 4Y5XC 1JPFB 4EN3B 2VZOA 3T3PF 1QD0A 3EDJA 3AAZA 2Z35A 3EOTH 3PP3H 1HEZA 5CS7A 5GGTA 3QIWA 1OL0A 3SOBH 1GOHA 1XGRB 1EX0A 4K3DH 1FZOA 2JK5B 1D6VH 1BBJA 4ONGL 4FXKB 5JW3L 1IAII 4C57C 2E27H 4GAYB 4XP9H 2BNRB 1E0OB 4POUB 3QFJA 4MXVE 5FECA 3WE6B 3QEQB 2CO6B 2N56A 2D7NA 1EMTH 1I8LC 1ZLWH 3HN3A 3V4VL 1UG9A 2F53B 3QT2A 1A64A 2NY5C 3MRNA 4HX1B 4IRJB 1QHPA 5EUKA 3UTTB 1OAQL 1GGIH 4L4TD 4OCMC 4KJQD 4M61B 5DMJB 4OD1H 3KPLB 4X6FB 3REVA 3GSXA 4M43H 4ZTPH 1F8TL 5HGBB 3GSNB 3JWOL 12E8H 4CVZB 3LPWA 1MFCH 4PJFF 4XBGA 1U58A 4U1JA 1U8OA 4EDXB 4PJXE 4PJEE 4N0UB 4HPOL 2HT4D 1A6ZA 3O6FD 3OPZH 1DEDA 1S9XB 2YK1L 4FQIH 3LRSA 1NBVH 1LEGA 1HH6B 2XRAH 3QXTA 1AO7D 4ENEC 2V7NA 2HJFB 1CTNA 2KQNA 1BQSA 3QUML 4OUUB 4Z0XB 3MJ7A 3N06B 1JJUA 5H35B 2BXYA 4HIXH 4RGNB 1E4XH 1CDJA 1GPOH 4Q97A 4DOHB 2APFA 4NN7C 1KJ2A 1DQJB 4GMSH 4OCRL 5L8KB 2VKWA 2P42B 1JPFA 2Y23A 5C3LD 5HHMD 1RSFA 4OFKA 2PXYC 4LDOB 2VR9A 5E0QA 3KLHD 3S36X 3PWLA 5E5UB 1HWGB 3DBXA 2J88L 3D39D 3P0YL 2F5AL 3ZTNL 1ZXQA 3BZFA 4OT1L 2PXYB 1I75A 5DFTA 2GK2A 1IT9L 3D0VA 4LVHB 4MGXA 1FVDA 1S9WB 2YMXL 1GCFA 2BNUA 3FONA 2X4OB 2APBA 2VDQH 3UZVB 1XR8A 3N85H 1GGIL 5FA3A 2AEQL 3SKMB 3MUZ1 2ITDA 1XIWC 5J1AA 3G6JF 4ZFZA 3AXLB 3GHEH 5J11C 4X7EC 5TF1H 4Z7UA 4YAQA 5DJ8B 5HHXL 1KPRB 4XRCA 1NMCB 3BP4B 3CH8A 4PJDA 3PWPA 5H37G 3UAJD 1A7PL 1NFDA 5K9KA 1BEYH 4Z5RB 4OGYH 3O6LL 2HWZL 2OZ4H 1J87A 4M8QA 1GZPA 3O2WH 3NCJH 2FNBA 3QHZL 4HUVA 5DJCB 4LVEA 5DC4B 1PG7L 3FT4B 1TVDA 1DVFB 5JOPE 1UKTA 3LRHA 4F2MA 3V0VA 1SVCP 4B0MM 5C0EB 4YEEA 4FNLL 3TWCH 3VFVB 3CC5B 3O11A 4WGVB 3PV6B 4MZ3A 4YHMH 5EZLA 1G0XA 5CEXA 2EIBA 2JCCE 3I75A 4OZ4A 4Z0XA 3QNZB 4U3HA 3VGFA 4XVTH 4PJHF 5EOTB 5J89A 5E5RB 3QWOA 1VESA 3HG1A 4Z0BL 1CK0H 1N4XH 5C6PB 3GMRB 3AY4C 1I4FA 1EBPA 2AK4B 1A1MB 3HNVL 3IJSA 5FUCE 5IGXH 1NCBL 4TULL 2AEWA 1JFQL 5CIPH 3QEHA 1EHLH 2HVJB 4HKZA 4FRWA 3O9WD 4MA8H 1NANH 4CVWA 1AR2A 5ISZD 4OCLC 4A6YL 2WLYA 2X9WA 2GTWA 1T20A 2PO6A 1G0YR 1ZLSL 5TF1L 2BNUB 3FONB 3S98A 4P5MB 4JFPA 1X4YA 3W0WB 2QL1A 3ABZA 3UEZA 1DDHB 4PRHB 2PF6A 3RL2A 5HI4C 3T0XA 4GKSA 2JB6A 1IFHL 2G60H 2IBBA 5E56A 3OJDA 5C0BA 1YEHL 4EZMA 3FRPG 4NHUA 1FSKB 5F70A 5HI5D 3OAYH 3E2HB 3P77B 4KAQH 1NGZB 4LCIH 4HKJA 2DMKA 2P43B 5F9WC 3WV0A 4L3AA 1S7TA 2OP4L 2VDNL 1I7RA 3UJJH 1ZANH 3OAZH 4XWOD 5I8OH 5E2TL 1PEWA 3E2HC 1TCRB 1QRKA 1ZVYA 2UVFA 5DMIH 2VE6A 4R26H 2J1KA 1KT2A 4L8SA 5HY9B 5DZOA 1V3LA 5C0FA 4G5ZL 4OZ4B 2ZOLA 3GGWB 4QRQB 2OCFD 1JF1B 3BVNA 4PJHA 3FO2B 5F9JB 4ZD3H 1AFVH 4K7FB 1YNLL 2VLMD 3ARZA 3MGTB 2FBJH 4GAJL 1KXQE 3VW3L 2I5YL 5E2UL 2EDLA 4Z7WB 2C4FT 1ZGLB 3G5XB 1MEXH 2AJVL 3D25B 2UZYB 1G9MC 1IC7H 2AJXH 1NBYA 1RZKC 4E5XA 5FO7B 5HGGS 3RWIA 4P2OA 2R15A 1B0GB 2P5EB 5C7XH 2A6DB 3BOVA 1VFBB 2G60L 4P2OC 2QQNL 1DQML 4PJDF 4DK6A 2WWMC 3H8NA 3WNPA 3SKOB 4NZDA 1BFSA 2CR6A 1YJDH 1E27A 1EH9A 4PJAB 4Y89A 3CSYA 5GXBB 3M1BB 4OM0H 5GQBA 1JGEB 4L4VE 1U8IA 2HT4C 3DO7B 4GRLB 3UMTA 3GMPB 1UB6B 3HHRB 1YEEH 4ODVL 5JHDB 5I2IB 4XHJC 5EOQL 4JFOA 4UOJA 1Z0MA 2BY0A 4N1EA 4LCYB 2DQJH 3VXSB 3MLRH 4D0CA 2VDLL 3MGAA 3EDDA 2P47B 3UO1H 2D7TL 4HF5H 4OFYD 1FO0L 4KJPD 2R0ZL 5KG9A 4L3EA 1AFVL 2YBRB 3RTQA 1U8PB 3IU3A 4YH6A 5ADPL 2D31B 2FX8H 4LGSB 4FQHB 1TJIL 2IPKB 1IKFL 3ZKMD 3OKNA 3CU1A 1AY1L 2YSSB 1MEXL 3VD3A 5BV7L 3KLDA 4LLVB 4WJ5A 3ISWA 4I8DA 3ARFA 4L4TE 3V7MA 4H8WH 3W39A 1MFNA 5HYJD 2MJWA 3IJYA 2BSRA 3MMEA 4OUOA 4YK4B 1JZ4A 4HJGA 2JE8A 5L88H 1YUHB 3HPJA 4E5XB 1MI5A 4BH8A 3OJMB 2VABA 1O0VA 4DAGL 5KN5A 4OZHA 2EDJA 4OZGF 1AR1C 3MRFB 3C9NB 2FEEL 1KBGH 4OJFH 3GRWH 3OG4B 4RGMB 1TIUA 1LGVA 1RD6A 5M95B 2XIDA 3ARFD 4HBCL 4XNYH 1QUNA 1IKNC 1F4YL 2DQDL 5KSUA 5GGSY 3GJEA 5CSBA 4W4OC 3HNTH 4UNVA 4NC2B 2IWGA 5JHDA 4PG9A 3L5WB 4FXGA 5FUZH 1I1YA 3RUGA 2A0LD 2F74A 4FTVE 2DQUL 2DAVA 3LV3A 3DGCR 3IJHA 3CU7A 1YEIH 4ZG1A 4KK8C 5ABDE 2EYSA 1YY8A 5LAXA 5ISZB 4NZRH 1KLGB 4MJ5A 3RDTC 4ZTOH 4OZIE 3CGTA 1MCPH 1LO3L 3KWWA 1JHKH 3U6RA 3IDXL 1QHOA 3SDDB 4JY4B 1EEQA 2H2PD 2YKLH 1P9MC 1ZHLB 3DX8B 4ODXB 1H3VA 3BD4A 4NO0D 4MLSA 4DCQA 2R4SH 3W39B 5CMAA 1NCCH 1MCBA 3PGFL 1ONQB 3NH7L 5HHNA 5DFWH 4LMQI 4XH2B 1MCOH 3U48A 2NY1D 5FM5O 4RMQA 5FGRA 4KI1A 5LGJA 2IAMB 5FA3B 4HLJA 4QGTA 2AI0H 2RHEA 5CINH 1MVUA 3PV7A 4P57B 4P4RB 3TLRA 2QQLL 4P59L 3QDJA 4BKLA 5ALBH 4O2FB 5CLWA 1NLBL 5T5FL 1KULA 3GMOB 4BFBD 4KKBD 1A0QH 4NQUA 3MV8B 2HLFC 2HH0L 1EV2E 4KZDL 1NGWA 5IBUG 4LOUD 4OIBA 3CD4A 2IGFL 3NA4A 4PJ8B 1NGPH 2YS4A 3DUSA 1PVHA 4AG4L 2FJHB 1DVFA 2C7UA 3TJHD 1U58B 1QG3A 3JVGC 2HJFA 4YNYA 4X6DF 2OL3H 1DBBL 4N0UA 3I6LE 4FQ1L 1DQJA 1QOKA 3MRMB 3GRWA 1FORL 3QCUL 5AG9A 3GBML 1WEJL 4JFZH 1LEGB 5DYOB 4AENA 4JM2B 3L3KB 1OWWA 5GGVY 1NLDL 4LSVL 3MV8E 2OJZL 4OF8A 2G2RA 3MBED 4JFYB 3KLAB 5E7BA 1G7HA 3QNYB 5I8EB 2BVYA 1A1MA 4S2SA 4U7MA 4ZFFB 3BISA 2JCCA 4ENED 4Z7VB 4M7ZC 5JPMB 4N0UE 2VC2L 4YDKH 5I74B 4XPBL 2LV4A 4S1RL 3AREC 5JIHA 5DRWB 2X4OA 1EEUA 3E1F1 1XR8B 4WCYH 2PO6B 2XA8L 4I3RH 12E8L 2PKDA 4N5UA 3VE0A 4MAYA 3D0VB 4MXQC 1CZ8L 4OFDA 1TJHL 3IFLL 4MJIA 2IEPA 1TLKA 1JNHB 5I18H 1HXYB 4NQCA 2AKRB 2OXHA 3CZFA 3B5HA 2YD9A 4JG1H 3ZKMC 3HE7C 1Z3GL 3U0WL 4GMTL 4GG6E 4WV1A 4XP6H 4K8RC 2B2XH 2DBLL 1H3PH 4XTRC 5D9SA 2BCKA 3PGDA 5GGQL 2AJUH 3W82A 1XIWA 4LSDA 4DKEH 2OM5A 4J1UA 4K7PX 3UCRA 5ALCL 1IC5L 4E42B 3FB7B 3JWOC 2Z8WC 4ONGH 2UYLB 2VLKE 1MHEA 1A4KB 4FG6D 1HHHA 1P4BL 1QLEH 4OF3A 3RWDB 1EO5A 4ALAH 4XBEL 2AK1L 3EGSA 2UWEB 3Q1SL 3UROR 3I3BA 4I9WD 3FN0L 2ZCHL 2OQJB 2BK8A 4IOIA 5TFSL 1V7NH 4P5TD 1VEOA 5IMKB 2Z31B 3IU4L 1OTTC 2VMFA 5MEQB 2YPLA 5B8CA 3OGOE 4GBXA 4JFFE 4KRPC 4QO1A 1T20B 5I71B 4ZTPL 1IZJA 4MVBC 4Y19A 4QTHA 3UBXB 3BZEA 2RJMA 2Q86A 3P11L 4O02L 1LE9B 2XY2A 5E08H 1TTFA 1QSVA 2EXWD 3RUGE 1F2QA 1TFHA 3RWEB 2P1YA 1C08B 4TYUA 4MB3A 4LBEB 4PGBB 5T3ZL 1A22B 1KF9B 1OVZA 1UM6L 3QUKA 1J10A 1MCRA 5J12C 2OX5A 2RCSH 2YD8A 1KCKA 3PDDA 5DK2B 5DRXB 3REWB 5FYKU 5C2BH 3ARVA 1M6OB 1NEZG 2HFGH 1BGXL 4KK8D 3C5ZB 2CKBL 1P4BH 4W81A 3RVUD 4DVRH 4NBZB 5JPNA 1J5OH 4J1UB 1XF4A 5IHZB 2VE6B 4C55A 2HAZA 4GW5B 1JWUB 3BGMA 5KG9B 2V9QA 3L6FB 2ATKB 1OAXL 3C6SA 3L5IA 2ZCHH 3MJGX 4YHIA 2EEBA 1WFNA 4ZODA 4FFZH 3ZMRA 3F8UB 3FTGB 4IRSD 4QRSB 3TVMA 3ZKNC 2CR3A 5D7KE 1I3RA 5ADOL 4CMHC 2ITCB 2YN3A 3RNKA 3CVHB 4YUEL 1FFPA 3TT1L 3QPQC 3WXWH 4HJGB 5IK3B 3U79A 3RWFA 2VABB 2BFVL 4HGWA 1CD0A 3I9GL 2QHLA 1CDYA 2XI9A 2XPGA 3O3AA 4NNPL 5I76A 1N3NB 1NGYA 3GNMH 4OD3H 2ADJA 5F7NC 4C56B 1YEJH 1DUZA 5IW1A 1FH5H 3U4BL 3CSPA 4WWID 1EZVY 4XBPB 5F71A 1KFAL 4MB4A 3PABB 4WTXA 4CADB 5D93C 3QIWD 3CH1A 3MRIB 3K2UH 3TGXA 3WFEL 2I24N 1OSZB 4WENB 1SYVB 2ADGA 5K59E 1HDMB 4IJ3C 3W0WD 3SKJL 4JZJB 2UZIL 3GEWB 3ZE0E 5E2UH 4R97B 1YY8B 2A74A 4XI5C 1LEKA 5F6HI 1T5WB 2A73B 1PW3A 3VU2A 2MWCA 1QP1A 1NUFA 4LGRB 1K8IA 1ZLSH 1QBML 3TT1H 4ZS7L 1EMTL 4AIZB 4W6WB 1AHWB 3S37L 1WV7T 3GJFA 4OD2B 4Z78A 1OSPH 1S9YA 3VXRA 5L9DL 1QRND 4J6RH 4PY7B 2QQNH 1V8HA 3UTOA 3L5XL 3HZYB 4WHYG 2MFNA 2ZKHH 4AL8H 1MPAH 2IBZX 3WUZA 1BJ1J 4ODXA 2HLAA 3CVHA 3SDCC 4YX2L 1YN7A 2B8OT 4OD3L 4LCIL 4LCCB 1VADA 4WDIB 4KQ3L 2BSRB 4M5YL 1NMAL 4AQ1B 3O4LA 1JZ2A 1F90L 4RFEA 3PUCA 4X98B 1YUHA 5AYUL 1RV6X 5J13B 3ES6A 3VMNA 4GBXC 4JHBA 4RIRB 2H32H 1IJ9A 3P40A 4LAJH 3MV8A 4LHUA 3Q0HA 4JO3L 2PTTB 5JW4Q 3U0PB 4PJ8A 3RUGB 4UDTB 5ESQB 3C5SA 4LLAA 4P46A 2J88H 3QUZD 1CXEA 1F3JB 3O3DB 3T3ME 3CK0L 3T77B 3SDDD 4PGZA 2R29H 3P9WB 1CGWA 1YEDA 2DQTL 5DJ2B 4CN4A 1ACYH 3SPVA 2WINB 5FCUH 3QIBD 1M05B 2ZPKL 1UA6L 2NY5H 3HR6A 1C16A 2QEJA 1E6OH 1WFTA 2VDQL 4JY5L 3LN4A 4UT7H 1D9KD 1KCRL 5I75C 5DRZB 4X5XA 4ZS6C 1A9BB 1S9YB 3D9AL 5KSAD 1DR9A 5HHXH 4X9HA 4KQ3H 1C5DB 4G43B 1FNAA 2VL5B 4UZGA 1AKJB 4PREB 4Y4KA 1J8KA 1U2HA 2A6KB 2MKWA 3DVNA 3RGHA 3KHOA 1JHTA 4ZAKD 5C3TA 1KPVB 3QEQE 3EOYG 5EU3B 3CJJA 4NYLB 1CCZA 2GT9A 3SDYH 2C3VB 5FGBA 4M1DH 4YWGH 3G5YA 3RHWF 3RJQB 4N9GA 2DL2A 4J3TA 2W07A 2YEZA 3HFML 3ULSA 3PWNB 2BRQA 1MCWW 5KOMC 2VXSL 4U1IB 1MCIA 3VXME 2YD1A 1U95A 2PTTA 1EO7A 1LO3H 1S7QA 2K1MA 3KYKL 4KDVA 1KN2L 3OKLB 4YHOH 2YPLE 5HYQB 4E42A 3FMGL 1GVIA 4ZUSB 2CXGA 1AIFA 1N5AB 1NSNH 2CK0H 4FABH 5LQBH 3WS6A 2ADIA 5GS0L 4OAWB 4UINH 1FBIL 2CJUH 4JFEA 4MAYD 1CICD 3KPPB 2EE3A 2I9LA 4M5ZL 4DGIL 2ZUSA 3QQ3A 5DJXB 2JJWA 4UT6L 2G9HB 5C0IA 1JWMB 5EBLA 2VLKA 3MRPA 1RU9L 2RGSA 3MUHL 4NZTL 3TCLA 1RULL 3QZWB 3TH2T 3VFRB 1IGFH 4NKDA 1QLRA 5BRZB 1SJEA 2YPLB 4HWBL 1ZWIB 2GCYB 5DRWA 3B2UC 5CKAA 3QDGE 4XC1H 2XZZA 3KPQB 3GMMA 4H26B 4Z7VA 4TSCL 2NXYB 3PHQB 1ITCA 1CR9L 3BZFB 4MQXD 3ZDYF 3EHBC 2W0LA 1NMBL 1MELA 2BNRA 1T0MB 1K8DB 4HKXA 1KCUL 1R5VB 3I84A 3QUMB 4O58L 2XFXA 2GT9B 3N1QC 4O9HH 3PWUA 2P5WA 1DBBH 1YECL 5L0QB 4FHBD 3S3JA 4M7LL 2Q6WB 5KSBF 5CGTA 3S96B 5I1HH 4XXCC 3TNMB 5BRZE 4ZTOL 1KB9J 4ZAKB 3OL2A 3GKWL 2OXGA 4U1SB 3KPLA 3B9AA 3REVB 3TA3A 2Z31D 3DSFH 2ZUXA 1YNLH 4XP9L 3EZJB 1M1SA 4KRNA 4LPUA 1ZGLP 4UINL 2ERJB 2WNGA 1BFOB 3QG7L 4JHWL 1V3JA 2E3VA 1R24A 3C08L 2DLFL 4XVUD 4RAVB 4YBQD 3Q5YA 5C08D 1A3LH 3N9GH 3BKMH 3R0NA 4YHIB 5DQJB 3L3JA 1HH6A 5EU5A 5ANMB 3CFEA 3U7WH 3NAAL 4PP2A 4PJCE 3O2VL 5ACLA 4JM4H 2KKQA 4UV7H 1OQOA 5HGHB 5IMKA 4KH2A 4U1KA 4GG6B 5A2FA 4BYHA 2Z31A 2CIKB 2FJFB 3I75B 1HH9A 2XA3A 4BQ9A 2VAAB 2P5WE 2Q7YA 3QWOB 5K33A 4MA3B 4NKDB 4Z7OF 1FNHA 5HGDA 2Q1EA 4ORZC 3HR5B 2XZQL 3O2DH 1FZMB 4JPKH 2B2XL 3V5DB 2EDFA 4NKOA 2IALA 3MXVL 1K2DA 1FVDB 4GO6B 1ZK9A 5HBBA 2ADJB 1WIPA 1X5LA 3NZ8A 1RUQL 1WZLA 4QHLB 1DCLA 1MIMH 1MRCH 1FO0H 3FFCD 4JFDB 3H9SB 4HUNB 4M6NL 2DJUA 2P5WB 2ITDB 4W4NA 1LD9B 1M6OA 4YAQB 4JFZL 3SE4C 3ULUD 1REIA 3WFCH 2FLBT 4JAMB 1RZ8A 2ZJSL 4LLDB 1LP9F 1Y6MR 5I15H 3NA9H 2KBGA 4RA3A 1G9MH 1CS6A 4OCWL 2A83A 2ZOKB 1ZLUH 4P0DA 1Q94A 1WBZA 4LHUG 3TBVB 5F1SA 1T22A 3K8MA 3QP3A 3O9WB 2VDPL 4PJFB 1IGTA 1OD7A 5IR1B 3WLBA 1YQVH 3KGRA 4QXUH 1D9KC 3ARWA 2XQBL 3BD5A 5DQJA 2I07B 1J8HD 5ANMA 2BHUA 1MFBL 4TNWK 1N6QH 3RNKB 3GSOB 2H41A 5IB5B 4U1KB 4GG6A 4UU9A 1O7VA 2DM4A 3HB3C 4LP5A 2NY7H 2AXJA 1D5ZA 1SJVA 2DDQL 2MQCA 3O6LH 4JFQA 4FTVA 1TENA 2FEDD 2IFGA 3NCJL 5I0DA 4NSKA 4YGVA 3MXVH 2F53E 3G6JE 3AFLA 5J12B 2DI8A 3T0EB 5ID1A 3BPNC 1LDPH 4PRID 1OAYH 1BQHA 1EGJH 1QQDB 2R23B 1N3NA 3NTCL 1FZMA 1BBDL 4Q74A 4R0LB 4C59B 5I1JH 2VXVL 1JTOA 4K3HA 1LO0H 2CKBH 4DTGL 1ZHBB 4N0YH 4Y2DD 3CCHB 1VA9A 1TQCC 3H9SA 3RX7A 1I9EA 3MRRA 3WFHA 2QKIB 4WEUD 5E2JA 1F4XH 4GAGL 1BJ8A 4LEXH 3U4AA 3KPSD 2X42A 2BSSA 4PJXF 4MDJB 4PJEF 2YWYA 5L2KB 1KENH 1U6AH 3U0PA 3IF1A 1E4WL 3HS0A 2AW2A 1A6TB 3BAEH 3H3KA 4FP8L 4U05A 3S4SA 4Z76A 5BOPA 2V9TA 1VGEH 4DW2H 2OTWB 4G6AD 1UB6A 4KHXL 3CAFA 1A6VH 2VSCA 3VXNB 1KTLA 3L7EB 3U4EA 5J3HD 2ESVD 3FQWA 5IROA 1DUYA 1TJGH 4JHAL 3HUJA 4OV6F 1FNLA 4RMUA 4LCWB 3TN0C 1KXVC 4PFEA 1KTDA 1EJOL 4M00A 4Z78B 3MA9H 3I9GH 2VAJA 3TNNB 4MSWA 4X80L 4KKCD 4TSAH 4X5XB 5IEKA 4V2CB 2Y5EA 1T3FA 1HEZB 4OZFB 1UM5H 5T3ZH 4WEBL 4KVNH 1J1XH 2FX7H 3OKNB 4KFZC 1NC4B 5DVKA 5MHSD 3BE1L 1HIMH 2DQHL 1CN4A 3SO3B 4CGTA 2WIIA 4WI8A 5EC1A 4HMDA 5IV2B 4MJ6A 4HJ0C 2EC8A 4QY8A 4AYFA 2BX5A 4NYLA 3RKPA 4DVRL 4NNXB 2H45A 1H5BC 4Y4HD 3IETA 2G5RA 1KIQB 2HT2D 3GB7A 4X8JB 2MMXA 4LSTH 1F58L 3OXSB 1B2WH 4DQOH 2H1PL 2A1WH 4IIQA 4XWGL 3HPLA 5C07A 1F4WL 4YZFF 5D1XC 5JW3H 4NGHL 1T7ZA 4JVWA 4PJAA 2IANE 3IRZA 3HRZB 2I26N 4LSSL 1JGEA 1IGCL 1N7MH 5CZXC 5E2VL 3WN5B 2YR3A 1OSPL 3LRGA 1QFUH 1HOCA 2F5BH 5EH1A 4CDHA 1JF6A 1M05A 2R2BA 1MHHB 5D2NA 5SWSD 2BDNH 5DSCB 1S5IL 5EPMA 4MNQD 2R1YB 4PYGA 4YO0B 4JN1L 4BUGA 1FL5A 5A2KH 5B39A 2LQRA 4JRWA 3KJ6H 5I8KL 4NQTA 2KZ1B 4UV4L 3OXRA 1MCLA 2VLKB 1HQRB 1LK2A 3DXAB 5FK9B 4Y5YC 5I18L 5LKNA 1U3YA 1G7MB 1YY9D 1HK6A 3DX9A 3RJDA 4HWEL 2CDFA 3STLB 1QACA 3BQUB 1F6FB 1KJ3H 4JKMA 4HHAA 1IKNA 2V5YA 3KXFD 1S9KC 2CPCA 3PIQB 3SDDA 3MLRL 2Y1VA 1N2RB 3PHQA 3MQIA 5EU3A 5TE7L 2AJUL 2L0DA 3U46B 3ZT7A 5F7KC 5EZIL 1AKJA 4PREA 4HJJL 5EULV 4U0RC 3BW9A 5D2NC 4N9GB 1W8NA 5JHLH 1OTSD 2R29L 2O93L 5IB3A 2B0SH 1WQVT 3GIZH 4A2MA 4YHZL 3GK8L 4OT1H 2FJGA 2EYTA 4YPJA 2Z0BA 1KELH 5HJ3A 3O6KH 1WC7A 2ESVB 2V2WA 4O4YL 1WWBX 1NKOA 2AV1A 1PYWA 4KMTH 1SMAA 4N8VG 2OI9C 1WZKA 3MBEC 1P9MA 1FRGL 2ICWI 3SJVA 1RK1A 1JCKA 2QSVA 4YHPB 5C0CA 4EVNB 1VACB 2V7HA 1FZKA 1SEBA 2FEEI 1ETZA 3B5TA 1T2XA 4OJFL 2R2BB 3T2NH 4DKFL 1OOAA 2C7UB 1FN4B 4O02H 2I9LB 2EYSB 2P4AB 1BD2E 3O8XA 4YNYB 1T2QH 4POZD 1J1PH 4NIKB 2OLDA 4GUPA 3C6LC 5J1SC 3TIEA 2LTQC 3HC4H 4DUVA 2HWZH 2OZ4L 5SX4I 3QXDA 2XZAH 3GHBL 4WFHD 3RX5A 4Q9QL 2VYRE 2MTPA 4LHUD 1T4KB 3JV6B 5DJAA 4HDIB 4HHAB 1NDGA 1CXHA 3OKMB 4JQVA 4JO3H 2MQ0A 4QT5A 3UPCA 5DD0H 2VXSH 2G75A 1FNSH 4OIIL 3RX8A 4PGEB 3EYUH 2FECL 4G3YL 2CQVA 4X9GA 3ARDA 1PZUB 1OGAA 4Y1AD 1UT9A 3UC0H 3RBSA 1A5FL 4JKPH 4MXWL 1OGAE 5K9JH 3GZKA 1MAKA 3ZL4H 2AJYH 4RX4A 1NCAH 5L7XH 5DO2C 1B4RA 2O61A 2EYTB 3LN5B 4QHMA 3P77A 1X5YA 2F19L 2NTFB 3VD5A 1I9IL 2LAGB 4ELMA 2V2WB 4I48A 4A6YH 1DE4B 1DFBH 4JZNB 1FCGA 4QHKJ 1EFXB 1RU9H 5HYSB 4I2XE 4W70A 3SGKA 4QWWC 2ARJA 2F53D 4HUXB 2W0FA 3EYFA 2DYPB 1L7IH 1VACA 1PQZB 5FB8B 3F7RA 2J3SA 3X14A 5D2LB 2V9RA 4W4OA 5DJ6B 3SGJC 5ICZA 3P4OA 1JF1A 3BVNB 4KROC 5DYOA 1F11B 4X9IA 5E1AA 4PV9B 5E5MA 2Y07H 4P9HH 5DS8B 2Y5TA 1FDLH 3BZ4A 5E9DD 1IM3A 4JDTL 2XZCH 4QHNB 5JXAL 1JYVA 2FLRT 4YHYC 2ICEA 5I1EH 1SM3L 5HD8C 4WU5B 2CO7B 4G42B 4TUOA 3OF6A 3G04B 3VI3E 4JLRB 2R23A 3TO2A 5IF0A 3H3BC 1NEUA 3KYKH 4FQ1H 1CGVA 2X4NB 1PJ9A 2XWBA 3ZL4L 4QXGL 32C2B 4PTTA 4MCYB 3EUUA 4CU6A 4RISH 4OFIA 3QG7H 4JHWH 3QXAA 3SKOA 3K8LA 3FB8A 1B4JH 1KSRA 3VW3H 5F3HA 1G7IB 1Q9WB 1MHCB 1A2YA 4KI5D 3NAAH 4NC1E 1JYWA 5JW4R 3HC0A 4M5ZH 1JN6B 4YPGB 2VC2H 4YDKL 1KGCE 1EHXA 3MLWH 2R2CA 4BZ2H 2XTJC 5SWQB 1EXUA 2EC9T 5C92A 1VPOL 2AABL 4BQBA 2YN5A 1DANU 2J8UE 1MPAL 1WZ1L 3CLFH 1T1ZB 3ROLB 1N59B 1RMFH 4MAUH 1PLGH 1CVRA 1CXFA 5IVOA 3KPOB 1LDSA 4YBLC 1CL7L 2KH2B 4OLWH 5GPRA 4G8GE 1NMBH 2WW8A 3X14B 1FDLL 3JWDH 4XNUL 3TC9A 3MCKA 4WVRA 3EYSH 3HKFA 3L6FA 3M45A 1BFTA 3C5JB 2DBLH 3VXRE 4LARL 4FQ2H 4ODTL 2HKFL 3FHAA 2OQJA 4IOIB 3MCLH 5DXWA 5HTSA 5BS0B 4P2CG 3QQ4A 2OL3B 1WFUA 1BD2B 4HZAA 2IAND 4KY1L 4Y5YA 4XT1C 4GXUM 2J4WL 3GBNL 3MNWA 5JIIA 5MEND 4FFVD 4UB0H 4OLYL 5L2KD 3FO9A 5ADPH 3DYOA 2VZSA 4G8GB 4U6HA 3PL6D 1BLNB 3CK0H 3RWFB 3TV3H 3ARTA 3VWKA 1QO3B 4MDIB 1ACYL 4ZQKA 3ZLQC 3MOQA 2VDPH 1C08A 2D0GA 4LU5L 2ORBL 3VFUB 1P2CB 3D87B 5FAAA 5BW7A 5GS2H 3BJ91 3HMWH 5J56B 2DTMH 3DURB 2QQQA 2WWMD 1IEAA 1M4KA 3G6JB 2EE2A 1A2YB 2IQAB 1OAUH 5L88L 3ARQA 3WHE0 3EJJX 3CNKA 4EDWH 1KTLB 3L7EA 3SE9H 3VXMA 3V5KA 3P11H 2B5IC 3BP5B 4HS8H 4OLWL 4L29B 4BH7B 4ELKB 5HHPA 4Z76B 1Q0YH 1XF4B 4YFEA 2ADFL 5T3XD 3PF2A 1MJUL 4JJ5B 4FQCH 2BVEA 4LLYA 4RWHA 1D5BB 4P5TC 2HKFH 1UXSA 2R69H 4GRWF 3T0AA 3QNXA 1P4LB 5FV2A 1HQRA 1LK2B 3DXAA 3D3VB 4MJIE 5EBMB 5FK9A 5H94B 2UUDH 5CJOL 3T4YA 3VFNB 2FYYA 2FSEA 3WNMA 5GISH 1P84J 3WIIL 1IQDA 5I6XB 5CSZB 5MERA 5D70H 5EC1B 1ZHLA 4PLJD 5EU4B 5FV1L 3MRCA 2QADC 3D18A 3MNZA 2Y6SC 4MJ6B 2OL3A 1K4CA 3WFCL 4NDMB 5I15L 4U0QB 3OKKB 1R0AH 3QUZA 3T2PA 3VFWB 4G8EB 3DHJA 3H9SE 3RWHB 1TVHB 2OS7A 1IAOA 1MCPL 1U2CA 4ZYKA 3WS6C 1DQDH 1QPXA 3HI1B 1XCQA 4J7RA 5FGBC 5LQBL 1DBAL 5E9DA 3S97C 1NL0H 3BH9B 4GS7C 3ARGD 4KUCD 4NO2A 2R1XB 3FL7A 3K1KC 2R0WH 3BPOC 3PDOB 3UJIH 3GMNA 1MH5A 4LVNC 5FHBH 3UYRL 5EN2B 3C2SA 1IEAB 3G6JA 4MA1C 4HCRA 4RFNC 4ETYA 1CGYA 5JORB 3HG1D 4GT7A 1IEHA 5I1DB 2HT3D 4ZOEA 5D2NE 5C09A 1NFDE 4UQ3A 1MJUH 5IFJB 3L1OH 4WFHE 1RUML 4EVNA 2VDRL 3WUWB 5D7IA 4H25A 4NNPH 4DFHA 1CE1H 3BE1H 4JDVA 2FR4B 3O3DA 4E9LA 2ZCKL 5D1ZD 3MRMA 4UIKH 2LAAA 4S1DC 4EN3A 2Y9RT 1T89A 5EB9A 1JYNA 4KKCC 25C8H 5EPMB 2HH0H 5GGRY 4DEPB 4UTAH 2NW3B 1LO0L 3F12B 5EC2B 3TBWA 3QPQD 3P30H 4RX4D 2GTZB 5GS1A 3TT3H 3WFEH 2DLHA 4XI5D 3ARBC 4BK4A 3V52L 2YXFA 1F4WH 4LIQE 4UNUA 3MA7A 1NUNB 3QWQB 3WFDL 1CBVL 3DTXA 2OL3L 3DHMA 5L2JA 2VN4A 2WANA 3QISA 5I9QC 4YXHH 1TZGH 3SCMD 2DI9A 3BX7C 4M6MH 1CF8H 4PJ9C 3SBWC 4NP4L 4HFWA 3VFSA 4JPWL 3PL6C 3BAEL 4FP8H 5D1ZC 4JJHA 4QRRA 5E4IA 4ZO6A 2IQ9L 1H8OA 3CFJA 1JHTB 4PBXA 3MRNB 3D0LA 1ORSB 1G6RL 5F1NA 2FDBP 4NQDD 4TRPL 4CUCA 5BV7B 3HLAB 3W2DL 3QZWG 4ZFOL 2V2TB 3BPNB 5GS1C 4KPHL 1PZ5B 1T5XB 4M1GH 4XMLL 5E6IB 2NTFA 3IFPA 5IKCA 4X7CC 3EOAA 2OMBA 4WCYL 5E24E 4K9EH 5CFHA 3MXWH 5DD3H 4WI5A 4WUKH 2ZG3A 1A8JH 1UZ8A 1FZKB 1SEBB 2HTLC 1VSCA 1A6WH 1L6ZA 3FB7A 1ETZB 2NLJA 1U95B 4P4KD 1IT9H 5HYJA 1J88A 2UYLA 3SJVB 5HYQA 4OUUA 5DK0B 3MJ6A 1CIUA 4BUHA 4MB5A 2WINA 1H0DA 5I1LA 1OARL 1R3LB 3E3QE 4XC3L 5CGYD 1P5UA 1U91B 4PJCA 5MP6H 2ADIB 5KJRL 4G6AC 2I25N 2FRGP 2UZXB 4J3SA 5B8CC 5DS8A 3W5NA 1MI5E 5JHLL 4KWUA 2Z91A 4M6ML 4PRPA 2WSKA 2ICEB 3MYZA 3S34L 4KMQA 2PCPB 4JM2F 4HAFA 5F88B 4JLRA 4ZOAA 2GK0B 2ZJSH 3MZGB 3T65B 1SJEB 4L9LA 1KGCD 3JV6A 1FJ1B 3T0VA 3NPSC 4YR6A 1W0WB 4PJBB 3CSBA 5AZ2L 2ZPKH 1KPVA 4P2YA 4YGAB 4HLZH 5EU7C 3TM6A 3GMQB 2QSCL 4RSVA 4U1LA 4D8PB 3DWTA 4HFUH 3M8OH 3QUKB 2I9TB 5F3HB 5GRYA 5GIRA 1AD0B 4Z7NE 2GAZB 5F1NB 4KV5F 2HG5B 1KJMB 1X5XA 3QDJE 4I48B 1DE4A 3QCTL 5FUCC 1QFWM 1SY6A 4FQJH 5DJ8A 3HE7D 3JUYA 4XP5H 3RPKA 2ZG2A 3RVVD 2CRMA 1Q9LA 5J3HC 1OHQA 2EE6A 1NC2A 3MJ9A 4FQXC 1LDPL 4GKNA 2YRZA 2XNAB 1UM6H 1OD9A 3VA6A 1R3HA 2OTUA 3CDGB 4XMKL 4Z95L 4XCEB 3OR6A 5J06A 1MIEL 3MCKB 2RCSL 4RGOH 5TGBB 3KPSB 5F1KC 4PRNA 5CILL 4HS6B 43CAA 2B5IB 5ILTH 1E6JL 3PV6A 2EH8H 2Q3ZA 2X9XA 3ARED 2J6EH 1WWAX 4LPWA 4OV5B 5EOTA 3RVTC 3QEHB 1BFVH 1B0WA 1OGTB 3EJYC 4YBQC 1XH3A 1MAJA 2BC4A 4KHTL 2YD7A 3RY6C 1JPST 4MD4B 5CBAB 3WXVH 1NMCC 4PJIF 4R4BA 2A6JB 3MO1A 3AS3A 3AU1A 4L8DA 3KPQA 3BYTA 1M71A 4TUJA 4P48A 2VNCA 4BZ1H 3CDFA 2CJUL 1U3HB 1NGYB 4XX1E 3SQBA 1LO4H 3F5WB 5ADOH 1J1OH 3R06B 5JMOC 1D5IH 5FEBA 4WWKD 2VRAA 3B83A 1NDMA 5T3XE 1FFNB 3MV7D 1GL4B 1EHAA 4N0FB 5TE4L 3EOTL 2NXZC 5GGSA 2HG5A 5HVFB 3EFDL 4P4KB 4F7CA 3QUXD 2BOCB 5E6YA 2Y7QA 5E94A 1MCKA 3U82B 1I1AD 5DFVC 4MJID 4NJAL 5DVNA 4ZFGH 5I73B 2YC1B 4HGMA 2YA1A 4UUJA 2QHRL 4I3SL 1CR9H 2WUBL 4OLEA 4DN3H 4ZUTB 1UH4A 4X4XB 5B3JE 3QWRA 1BM3L 3FRUA 2XWJB 3RZCC 1I7UA 3SE3C 1SM3H 4WHDA 3SGJA 5J8OA 3C2AL 2CKNA 4L4JA 4LGPB 4L8SB 5HY9A 1CGUA 2YPVL 5CZXD 2XTJD 4O9HL 1CGSH 2E9BA 5A16B 5IVNA 1BF2A 3P3YA 4JDZB 1Z9LA 3QDME 2CDGA 5TGBA 3CFBA 2E7BA 3KVQA 2B1HL 1K4DA 9CGTA 1A7OL 1DL7H 2AERT 3DVGB 4TULH 5DMGD 2CSPA 5K9JL 3DVIA 4WNQB 4WUUB 5IVZB 4R8WL 5IHBA 3X11A 3SDAA 2UVEA 4OFYA 3PWJB 4UI2A 3PXHA 4YDVB 5E8PA 5D4QA 5KSBE 4LFHD 4ETQA 4ZUUB 4BSVA 2P5EA 1VADB 4HGKC 3MRDA 2EIZB 3HG1E 4R96A 4Z8FL 4Z7WF 5HPOA 4TUJB 4L8BB 2NY4C 5C0AD 4JRXB 1FL3A 5TE6L 4IDJL 4GH7B 1E4XL 5D5MA 4OGAD 2YZ8A 3B43A 3QWRD 4ZFGL 5IT2H 4NT6A 3MSPA 2P48B 3X13B 2WUBH 4DN3L 4IJ3B 2JB5H 4EIGB 1DBKH 3DARA 4RBPK 3C8KA 2HFEA 2W9DL 2QSTA 5BMFH 3EO9H 2QKIA 5ESQA 4JAMA 1AGBA 2XZQH 4HWEH 3O45B 4P46B 4U2YA 3LDBC 3QXWA 5L2KA 4DJMA 2VISA 4DGVL 1I7TB 1I9JH 2VLLB 3MJ8B 3LDBB 3N85L 4Z7VE 1IGTB 5F7WC 2AEQH 5JIPA 5BXFB 2K7PA 4QOKA 2FGWH 1H3WM 1TITA 1RY7B 1ZVHA 2FSEB 3E6HB 2BNQD 3FHQA 4PJAE 3WYRA 1INQA 4NZUH 4U1MA 2X10A 4IHOB 1KPUB 4RAUB 3DECA 1CD9B 3FT2B 3GSOA 2QTEA 4F8QA 4BM7A 3MNZB 3GIZL 4YHZH 5EA0H 4LHJB 3WJJC 3VD9A 4LKXA 3L95B 4UT9H 3EDFA 3O6KL 1AP2B 3FQTB 4WFGE 3SO3C 1RJZB 1VPOH 4HH8A 3HZKB 4LCUB 2IBZY 3CFJB 1WSST 2C3VA 3VFWA 3HE6B 1T1WA 1N64L 5E7FA 4F9LC 1QKZL 1CFSB 4D9RD 2HJLA 1Q0YL 3LKQB 5CIPB 1TVBA 2P8MB 2OK0L 2P8PA 3B9KB 4Y4KC 3T2QA 3MACL 2CGRH 4NT6B 1QRNB 1JHKL 4G9FA 1HKLL 4M03A 2ATPB 2A6IA 5IFAH 3HPLB 5C07B 5J7CC 5F1IA 2NX5A 4NQXA 3OAZK 2DL9A 2UWEE 1MI5D 4PGDA 2A2QT 2AJ3A 3E3QC 2HT3C 5I6XC 1OAZL 4LSUH 4Q9QH 1UQSA 3RGVB 1PKQA 5DUML 2V17H 1HHKA 4ZUWA 1HN1A 1U3ZA 3FN3A 5D7LB 4MNHA 3FQUB 2PUQT 8CGTA 1I1YB 1AGDA 2CIIB 1INEH 4JGJA 1YYMH 4XP4L 2NW3A 5I1GH 3HFMH 3DIFA 3NCBB 1U3HD 3A6CL 1ZLVH 1MQKH 4O2CA 4ZFOA 1CVSC 3FOLA 4X6CF 3QRGL 1RZIB 5EUOF 1H3XA 1FAIH 2X4RB 1EFXD 3TIDA 3RL1B 1FPTL 1UWEH 5HHNB 4L4TA 2PW2A 2P8LB 3CXHK 1KYOK 4XH2A 1D6EA 4YDJA 1G1YA 3IS1X 3MRBB 4LPVA 1N64H 3RP1A 3N1MC 4PG2A 1YEFH 4DCQB 4UOW1 1J18A 2MCPL 2I60H 1N2RA 1YEKH 1ONQA 2OK0H 4P4RA 4UT6H 5FA4B 2P24B 5DK3A 4XWOC 5D6CA 5JW4N 1QFWL 1YN6A 1R6VA 2DQDH 5H37H 1VERA 2VLME 2WAHA 4PLNC 2C1OB 4CDGC 4CW1A 4KVNL 3HNTL 3KPMB 1BMGA 3T8XA 1CICA 1CDIA 4PRPE 3T2OA 2NW2A 4Y19E 4LLWB 5H2BB 1N6UA 2DQUH 3W9EB 3LS5H 5DJYB 3LKRA 4JDTH 5GJTH 1S5HA 4PJEB 1NJ9B 4PJXB 1T80A 8FABA 3SGKC 2XQYG 1B9ZA 4FS0A 4OM1L 1UQSB 2KDGA 4M7LT 3EO1B 4Z77A 1N5YL 1LNUB 3QRGH 5JDJA 3LS4L 1TZGL 3ULUL 4QXGH 4G8IB 3A6BL 1AGFA 1XT5A 4MNGB 4C83B 3S6CA 2Z91B 4PRPB 1MFDH 4MD5B 5EBGA 3SCMA 1C5BL 3O8XB 4S2SB 4ZFFA 3I2CL 3RWJB 2ILLA 3U0WH 4G6KL 1IGCH 2WQRA 2CDFB 5IQ9A 3VCLA 2X1XR 3UJIL 3G9VA 4DVBB 4Q7DA 5C0GB 4FZ8H 3R1GH 1IAKB 3OMZA 3R8BB 1BP3B 3MRBA 4HDIA 3A67H 2VKXA 3MXWL 1AE6L 3MZTA 3F5WA 2O5XL 2GJ6D 4KDWA 3B8YA 2Z93A 1P1ZA 5C07D 3KR3L 3UTPE 5T1KD 1SBBA 3ARDC 3WKMH 4TPRH 1RZJC 1IL1B 1I3UA 3S5LG 1W0VA 2AJSL 3JWDL 3EYVA 1NKRA 5BQ7A 2WBKA 1KB5B 3L3GB 2NY1B 1JGLL 1TQCB 3QSKB 1J05A 4NQDB 1AD9A 4CKVX 2VZ3A 5I30H 1UWXH 2BCKB 3PGDB 3WHE1 1CG9B 5GRVL 5D2LE 2KPNA 4PRNB 5SX4H 2B0SL 2W0FB 3HCVB 4JRYE 2MOVA 1I3VA 4RFOH 4YFLI 1BEYL 1YMMA 1OQXA 3K4DA 3B9EA 4XCEA 1X5FA 1AH1A 1S7VA 5T1DL 4D0BA 1X5IA 3K1DA 1H3UA 5DD5H 4U31A 2XG5A 1G7QB 4WWKB 2CLRB 5E1AB 5E5MB 5GGRB 5HYEA 2BNQB 4FNLH 4L3EE 5KTEL 1UCBL 2DS4A 5I1CH 4ETQB 1I8IB 1MWAL 1DSFH 1ZT7A 3ROOB 2W60B 2GITB 3O6FB 4R0LA 2H3NB 3WIHL 3GO1L 3UAJC 1UKSA 3JZ7A 3DMMA 3AU1B 5EOCH 4F8TA 2FO1A 3O6FC 1YJDC 2Q86B 5DHVA 2ADFH 3DMMC 3DYPA 1S78C 3HNVH 1I1RA 1M7IA 1XGPB 3TBTA 1F3RB 4UQ2A 3SKMA 3BGAA 3VFMB 4MA8L 4ZFZB 4M7ZB 2DKUA 5ESAB 2R0LH 1OTTD 3IDIB 3BP7B 1JBJA 1TTUA 1P69B 4GMSL 3U1SL 3LEVL 1P4IL 2D9QB 4K3JH 5FGCB 1XGQA 2QQKL 5CZKA 3HZVA 2BOCA 4GSDL 5TDNB 3PJSB 5KVGL 5HHME 1QVOA 5FYLE 2IC2A 2XV6B 3G08A 1QR4A 1CL7I 2YC1A 4NQDA 4U6TA 5AG8A 4KHTH 1ORQA 4JDZA 3MLZL 5T1DH 2AI0L 5CINL 3V0VB 4YHKL 2FEDC 3KJ4C 4Y0GA 4Q6IC 5HDOA 5CZVL 1LE5A 3MRJA 2FGZA 3PGCA 1TETH 2BSTA 4FQPA 3SKNB 3T08A 2YRLA 1RVFL 4WW2F 3EJYD 4QHUA 1JZ7A 1CYGA 4XB8A 3RTQC 4XPAH 4OGZA 3K3QA 2R2HB 4P23C