4RFNC

Crystal structure of adcc-potent rhesus macaque antibody jr4 in complex with hiv-1 clade a/e gp120 and m48
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
210
structure length
210
Chain Sequence
VLTQPPSVSAAPGQKVTISCSGSSSNIGRSYVSWYQQVPGAAPKLLIYDTNKRPSGVSDRFSGSKSGSSASLAITGLQTGDEADYYCGAWDGSLNVHIFGSGTKLTVLGQPKASPLVTLFPPSSEELQANKATLVCLISDFYPGVVKVAWKADGNSVNTGVETTTPSKQSNNKYAASSYLSLTSDQWKSHKSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords HIV-1 CLADE A/E 93TH057 (H375S) GP120
publication title Cocrystal Structures of Antibody N60-i3 and Antibody JR4 in Complex with gp120 Define More Cluster A Epitopes Involved in Effective Antibody-Dependent Effector Function against HIV-1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 38
structure length 210
sequence length 210
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rfnC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rfnC01
1IFHL 5B3NA 4LNRB 4OZFH 4JQXC 2C3WA 3K3QA 3ZL4L 2DQDH 4PBXA 3RWFB 2MCPL 4XCEB 4JFDA 4WUKH 1YECL 4S2SA 1AXSA 2DLEA 3FO0H 4U49A 5HYJE 5HYEA 5TE6L 2QQNH 3MOBL 4F58H 3CXHJ 1LO0H 3O45A 1OTUC 3SY0A 3ZMRA 5F1SA 5CJBA 4TOYL 3UDWC 4HJJL 4C56E 1LQSR 2HYMA 4ODHH 1UACH 2HT4D 3I85A 1IM3A 3JWOL 4LQFH 3KJ4B 1MY5A 4J3TA 3SKMB 3IXAB 5H2BB 2CMRH 1J0ZA 5JLZB 5C86A 3VXOB 1FYTE 4XNZC 5IG7B 1DJSA 1S5HA 3ULUE 1AXTL 2VABB 3MV7A 5AD0B 3QHFL 4BQ6A 4WO4B 5JR1L 1HXYA 4R3SA 2Z93A 2NXZB 1UVQB 4JG1H 2XXCB 2JCCB 4EQ3A 4IOIA 5CIPB 4YXKH 5EDXA 3VXNA 4JJ5A 1ZLWH 5C92A 4Q0XL 5EU4A 5E03A 1FG2B 3GJFB 3MCLL 4HF5L 3UZVB 5A1AA 1QLRA 4IBLT 4XNYH 3ROOA 1ZTXL 2NYYC 4R90L 3SPVB 3T4YB 2OR7A 3MV8B 4CMHB 4RDQF 1A6UL 3ZE1F 2NY3C 1XCTA 5F9JA 1SJHB 3RA7L 3HKFA 3QEUA 5HHMD 1JPTL 4N90D 3REVA 4GW1B 1MPAL 4MD4B 3VXTA 4E0RA 3IFOB 4HX1A 3PQYE 3VDBA 1JRHH 3FB5A 4XVJL 4P49A 3CFDA 3WS3A 3LV3B 4U6XA 3Q1SL 4M43L 4J4PA 4N8CH 1FVDB 5L9DH 5JPNB 3PNWA 4TNWK 3KPSE 4H8WL 2VXVH 2HMID 1I85C 2E9WA 3QO1A 2ZSVB 4QHKI 1FNLA 4OUUA 4Y4HC 1URLA 5IK3A 4KTEL 3VFNA 4HKBB 4WWKA 1XR9A 5MHSE 5IWLA 1A7QL 5DJ0A 4OD3H 3B9KC 1J1XH 4TPRH 3MLYL 4EN3B 3DUSA 2F54B 3LZFH 4G6JH 3OHXB 4IRZH 2DLFH 5I19L 4K7PH 3BYTA 2VXTL 4NBZB 4XC3L 2FWOB 1D9KC 4ODVL 1OP3K 1UJ3B 2P44B 4HLZG 1TZHA 4JPVH 3T0BA 2YPLE 4OZHA 4PRHA 3FAXA 1P6FA 3S96B 5ERWA 2VDLH 2Z91A 3WFBH 3C60C 5DRWA 1XT5A 4PV9A 3DRTB 4NQDD 3TJHC 3EAKA 3DVGB 4DGYH 4CRPA 1KCUH 5DWUL 1VCAA 4RGND 4QRTB 4MXVE 3AMLA 4KDWA 2X05A 5DLMH 2YUWA 3FRPA 2Q8AH 3T0EA 2CD0A 3AC0A 3C5ZC 1J1PH 3JSSA 3ZTNL 1MSPA 3SE8L 1ULVA 1F4XH 4OUOA 3LMJH 4L4VB 1BJMA 4QHNB 3BX7C 4I0PC 1UJTA 4JDTH 2HJFA 5ALBH 1I7TB 5M94B 4LMQE 5E5RB 2J6EA 2DD8H 4UILH 5D7KD 5ID1A 3B6SB 4PGDA 5DDHB 5IMOA 1C5CL 1P4IH 4P2OB 1QACA 1DFBL 1NMBL 4RWYL 5D7LA 3UJTL 1KCRL 4FZ8L 1RU9H 4LLWA 3WJJC 1I1YA 1GL4B 5DRZB 1F4AA 2BNUA 4UT9H 1S3KH 3BZEA 1NSNH 3HZVA 1T20A 3FFDB 4OLWL 5A2KH 5J56B 1UXWB 4JFYB 1FLRL 7FABH 3QEQA 4UBDD 4NHUB 5DMIL 3FRPG 3N85H 3WSQL 5D70L 5IIEA 1FN4A 3IB4A 3WIFB 4CBPA 3MRGB 2GY7B 3RA7H 3ZDXE 4HWZA 4A2MA 5B4MC 5HHQA 5I1HH 3H3PH 3RWGA 4LKCA 2NY4C 4QHUA 5EBWB 5D2LE 1H5BC 5FYJU 4NZRH 1HHHB 3O81A 3GBLA 4P5TC 4M43H 5DMKB 4Q9QH 4PJAB 1X5ZA 1CGYA 1SJVA 1XZ0B 4FQJL 1YEGH 3HUJA 3EYFA 3HAEG 3P4MB 1KNOA 2HFFA 5FF6A 4XPGH 3MBED 2IG2H 3TYFB 3HS0A 3H0TA 4HMDA 3VMPA 1ZVSA 5F7DA 2GK2A 5CP7A 1MFBL 1Q0XL 4MLIA 4XPFL 2BJMH 4A6YB 2EDFA 3I75A 2RIKA 3X11B 1INQB 4K94L 4NN5C 1CR9H 3U9PL 1BIHA 2AEPH 1U8JB 3BN3B 5HYJB 4ODVH 5J12B 5GISL 3H6JA 1U8HA 4JKPH 4GLRI 4ZAKA 1F6LL 3D3VA 4OV5B 5GSVB 4Z8FL 2H26A 3WFCH 3P9WB 4YFLI 4UDTB 5FCSH 1OAQH 2D7NA 5C7XL 2D7OA 2IMNA 1RJYB 4ZFOL 1OARL 2P8LA 4P57B 3SJVD 4CVXA 1AO7D 5IQ9A 2E6PA 4C56B 3QUYB 4ZFGL 3V4VH 4PTTA 3QYCA 3RBGA 4Y89A 4ZFZB 3MRRB 1X4XA 4MA1B 3SQBA 5HD8C 4QT5B 5BRZA 5IB1B 5C0RL 5F9DC 1ZOXA 1IQDB 1GGUA 1ZA6A 3AY4A 2Z31C 1WTGT 2P8PA 3EHBD 1JF5A 1FYTB 2YOCA 3ILPB 3VGAC 4K23L 5SWQA 3RL1B 5FUOH 5FA3A 1Q1JH 5JOPD 2XTJD 3CD4A 3IRZA 5I1DB 5E9DE 5FUCE 3R1GL 4KQ4H 3ZT7A 2ZSWA 4FNLL 1N0XH 1EO5A 3FQRA 3L5XH 3HC0A 1TZIA 3MR9B 4YHPB 1N7ML 4NZUL 1B0GA 1RULH 3I9GL 1DFBH 5KZCD 4HC1L 3SGJA 4L9LA 5DD3H 3GSQA 4DGVL 3VFMA 1OAUH 4DW2L 32C2B 2EZ0C 1N8ZB 1TJHL 3HG1E 3B9DA 4D3CL 4TRPL 4YHKH 1EO8L 2G9HB 5F9AC 5ACZB 3ARVA 4I5BB 3TIEB 2AJVL 4M03A 5MEQA 5DA0B 1TZGL 4HS6A 4JLRA 5E2UH 5IMMA 2X4TA 3DSFH 3KPSB 2B5IB 4AYFA 4OZ4A 2HKFH 3OPZH 2OI9C 4HMCA 3HC3H 4BA8A 4OCRL 1CFNA 4OIAA 1MAKA 4HUXB 3GEWB 5ACLA 1QVOA 5DZLA 5E8PA 3FONA 4XPAL 2YZ8A 1AR1C 1LE5B 5E99H 1CT8A 1JHTB 1Y6NR 2B7DT 1I1FB 1KC5H 4LCYA 5JDJA 1T0MA 3MRDA 4YHMH 4Q74A 1KPVB 3CDGA 3OJVC 1YY9D 4LLVA 1MWAA 4IRJA 1OOAA 1LK3H 4WUUA 4X4YA 4BELD 4TQEL 2YPLB 2ZG2A 4PJHA 5MEOB 4XH2A 3SDAC 3SDDA 1KIPB 2C5DC 3I02B 15C8L 3VA2C 2MHAB 3WUZA 3PL6D 4YHIB 3DXAE 4NRYB 2H9GA 3ARXA 1EAPA 3CIQA 2R1YA 1UZ6F 1YUHA 3ARGA 3LEVH 2GJZA 5I30H 4K3DL 1QBLL 4HDIA 4LSUH 5E6IA 2JKXA 2XKNA 5F72S 3C2AL 3NGBC 5AYUL 1K3ZA 4NQEA 4UNTA 4PJIF 4HPOL 4DZ8A 4GG8B 2XG4A 2APTA 5L8LB 2VXUL 1PEZA 4G5ZH 2KL6A 4M7ZB 5C9JB 1YEJH 2DLHA 4KK9D 1KJ2B 1ES0B 4HT1H 5JNYB 4HJ0D 3FO9B 2P46B 5D8JH 1KXVC 4M3JA 5D1XC 4XVSH 5HVFB 4YIQB 2GSIA 2AKRA 3U1SH 4EQ2A 5BJTB 3SGEH 2OSLA 2VDQL 1RZIB 3IDNB 3WDJA 4NOFA 5EZLA 3W11D 4L8CB 3VRIB 1DBKL 4NDMA 5BV7B 1KBGL 5CSBA 4D0BB 3EYUH 4X4ME 1BJ1H 1GGBL 4HIHB 1ZLVK 2JB6A 1HXMB 1Y6KR 3D25A 2XWTB 3RZCA 3R8BB 1FAKT 5IGXH 1HH9A 1KLFA 4LLUA 4QF1A 4M8VA 1C1EH 2X10A 1IEAB 2XV6B 1OGTA 3TLRA 3X3FH 1C5BL 3WHE1 1Q9LB 3QXAA 4LCIH 2DI7A 4MVBC 4FQ2L 1MHCB 4H8WC 4IEFB 5JHDE 1PY4A 1WISA 3VFOB 2ZUXA 3FMGH 5IVZA 1JYVA 3GKWL 1I7ZB 2Y72A 1K6QL 1MJ8H 4NKMA 1YC7A 5D2LB 2WINB 4L8DA 2E27H 4MAYB 5I1IH 2OX5A 2K1MA 3CFKA 4XPHH 1PFCA 1MRDL 2JB5H 4I3SL 4X5XB 2CKNA 1XIWC 3HHRB 2HAZA 2A6KA 5C8JA 5LGHL 2J4WH 1S7QA 3QIUC 4OCRH 4XVUD 5E94B 3STLA 4LHUA 2WUCL 1UWXH 1G7MA 2DKSA 2PR4H 4OSUH 1VKXB 1E6JL 1FBIL 2LTQC 2AP2A 4N0FA 4F7CA 1T89A 3S5LG 4IMKC 5TDOA 2DM3A 1S5IL 4PRIA 1IGFL 1U8NB 2Z8WC 4OIIH 3V5DB 4HUVB 3KLHD 3WMSA 1XMWA 3NFSH 5SWSD 4JGUA 2LVCA 3RIFK 4HIJB 5C0NC 2CLZA 1ZLUH 4P2RE 3HE6A 1A6TA 4ONFH 2Q8BH 1CZ8L 1LO3H 4HUNB 2HH0L 3BO8B 4MX7A 1TDQA 4KJPD 5E1AA 1S7SA 4PJDF 4G8IB 4G7YL 5JPNA 4UMGA 1MQKH 1QBLH 4JPKL 4H1LG 5ALCH 1LDPH 2LABA 2ZNXA 4LHUG 5FV1L 4CADA 5E8DH 3M1BA 5D4QA 4KRPC 1R3JB 4Y19E 1WBYA 4HPOH 5TQ2H 4TNVK 5E9DB 2FSEA 4EN3A 3ARFC 4ZD3L 1QNZH 3VXMD 4LP4A 4XI5C 5I9QB 4LF3B 2F8XC 3P11H 4X5WB 4XP9L 4LCWB 5JORB 2PYED 3IU3B 3MQIA 4Y5VB 4G80A 3GHEL 2GFBB 4PJ5E 1BGXL 1MF2H 5E5UB 1WBZA 3TM6A 3ULVL 5DUPH 1JGLL 3BWAB 1RZGA 4IDLA 1PKQA 4OJFH 5HHXL 4HIEA 3SGDH 3O3AB 5C0IA 5C0BA 1CICD 3LS4L 1NCDH 3HMXA 3BGAA 4QY8B 2DQGL 3HG1B 3FQUB 1T03L 5D6DA 3NIDE 1H3VA 1TLKA 3K7UA 1WZKA 1HOCB 3LDBB 5E70A 1B2WL 5GGTH 3OZ9L 2CDEA 1RQ5A 4NNPL 1YEDA 2R2EA 3P30H 4LSVH 3D5OF 5IB3A 4RIRB 2LU7A 1P1ZA 4Q7DA 4QRQA 5KVDL 1OAZL 1C12B 5IEHB 1ZT7A 3W0WD 3WKMH 3C6LB 1NJ9A 4WEBH 1A7RL 1R3LB 3W5NA 3B3IB 4FTVB 3G6JF 3ME0A 4K9EL 3VWKC 3SEPA 1TTUA 4RRPA 3S4SA 4X6DE 4PG9B 5JUEL 2AJSL 5F8QC 4EVNB 4P23B 4K94C 3P9MB 3RVVD 4Y5XC 3DV4B 5IMLA 3U7YL 4CMMB 5D5MA 1QSFA 3ILQD 5AZ2H 4Z7WA 4RMQA 4PFEA 4WY7L 3E6HB 3G5VA 3MLXL 5SX4I 3MUGA 2ZOKA 5I1GH 4KUCD 4YHLH 2J88L 3SDCD 1CWVA 3DXAB 2F5AH 4EJ1C 1FHGA 2QJDA 4RSVA 2CDGB 3L3OB 4PJXF 1A2YA 4PRNB 3UTSA 5LGKA 1A9EB 1QLEL 2OBGA 3FB6B 3O2DA 1HNGA 2V2TB 1T3FA 3G6DL 2Y7QB 4Y4KA 3QDGD 2YKLH 2NY1C 4HSQA 4X7SL 5EPMB 3MZTA 3CVHH 1NDGB 3S4SG 5F1OB 3QUML 4LKXA 3T2NH 3A6CL 1L6XA 3X13A 3IFNH 3BIKA 3EJZC 3O11B 3MXWL 1ETZA 3G6AA 1QPXA 3EO9H 1XGTB 3TESA 1FVEB 2Q87A 2BHYA 1DBMH 2APFA 5JXEC 1OB1A 3LKRA 1Z0NA 1BZQK 4XTRC 4WFED 1BD2A 2RCSH 1SEQL 3EJYC 3RGVA 3RUGE 1R24B 4PPTA 4NKQB 4GO6B 2X89A 3HE7A 4OZGB 5ID0A 3WN5A 3MOAH 5C0JB 3LKOA 5CJ8A 3GSOA 3QPQD 2DQJL 1I1AB 5CEZD 3EZJB 5JO5B 1T7VA 5B22A 1T5WA 4F7PB 4NM8L 5H94A 4JO4H 3EO1A 5E8NB 1KELH 2DLTA 5JHDB 1H8OA 4XAWH 5EH1A 5BS0A 4AM0B 3V5HA 4M61B 1LMKA 2A74A 1KEMH 5KSAC 1WBXB 1LGVA 3LKQB 2C1PB 4WFFD 2WMPA 5MI0C 5IV2A 4PD4J 3V6ZB 1R5IB 4QGYA 5IB4B 2ZUTA 3VXSA 5KVDH 1W8OA 4I48A 1EXUB 3PGFL 3AUVA 5GRVK 5BVPL 4QCIA 1CK0H 4DK3A 4XBGB 1F11A 5I1DA 2WUBH 5C0AE 3CFIC 3VI4F 4OKVB 3VXPB 5B38G 4OQTH 4U7SA 4ZMAT 2HTLC 3BPNC 2I24N 3IF1B 3AAZA 4UV4L 2QQLL 4BFBD 5F6HJ 2IAND 3RI5F 1R6VA 2B4CH 2AJSH 3PXHA 3QI9D 1F5WA 1TNMA 4XVTL 5IVXE 1IC7H 4JDZB 3RNQB 4P4KC 1YEEL 4KKAC 3OKDB 4LU5H 1AHWA 4NZTL 1GH7A 4ZDHA 3G9VA 4O5LH 1N8ZA 4YDVB 2C3VA 5J1TC 3H9SD 1LNUA 1IKNC 2X1OA 4P2RB 4YPJA 3RHWK 3VD9A 3MTRA 1PW3A 3FB7A 4ZXBA 4CU7A 3PQYA 43C9B 3UTTB 1S7UA 1QFUH 1C8PA 3NCJL 1AKJD 2PO6D 4YFDB 2HKHH 3QWOB 4POYA 2ED7A 5I1KH 1YPZE 1JPFA 1YNKL 1KJVB 3UTPE 5ISZA 2D9QB 1MVUB 1B0RA 1CGXA 2JELH 3WJLA 3UC0L 3RVUD 2FH8A 5HGHB 1JZ4A 5HHOE 2ADIB 2XZQH 5C08A 4LFHG 3BPOC 2Z35A 4Y19B 1BBDL 1DL7H 4R96A 5DJ8A 2GIYA 1KPUA 4BK4A 2RBLA 4GRWH 1NKOA 3L5IA 3MUY1 4APQB 3EYQD 3OR6B 4JZNB 4F7EB 2CIKB 1T5XA 2KDGA 1CF8H 2XPGA 4L3AA 4M48H 4PJFF 4RMSA 3VXRA 3PHSA 2R9HD 4JHWH 5DYOB 4PJ5B 3ET9F 2VLJD 5LXGH 3KPPA 1S9WA 5IJKA 4YAQB 3V7AE 4RGMB 2CK0H 5T5NG 1PD6A 2YD4A 4YC2C 2H1PL 4P99A 4HKJB 1SEQH 4KY1H 4GG6F 4I9WD 3TT3L 3MODH 5DEFA 4IMLB 2EH8L 1JYWA 5BVJB 3HAEB 3MRFB 5FOJA 3N06B 4U1NB 2P5ED 5C07A 3LN4B 4RX4A 4IJ3B 4ACPA 4QRPB 5EU3B 2KQMA 3FQTB 3X14B 4V2BA 4NQUA 2BCKB 1OF2A 2CXKA 3JV6A 5J11B 3BD5A 4AEEA 1XGQA 1HDMA 4J3UA 3U2SB 9CGTA 2VOTA 1DTUA 4D9LL 3TZVD 2VE6A 2FJHA 4LLYB 5D9SB 4ALAH 1SEBB 4OM0L 3NCFB 4X6DB 5GSRA 2I9TA 1KJ3H 1KCLA 3DWTA 3QO0B 4KI5E 3QXDA 5T1KA 2A77L 4JFHE 3RL2B 5GZOD 3OX8B 3MRNA 1XH3B 1DVFC 5J4MA 4P46C 4FQCH 2BK8A 2ZZUT 4KI1A 3P9LA 2AV1B 2R56H 3C8KA 2X4RA 4IS6A 4Y4FA 5CJ5A 2YRZA 4L8BB 3SCMA 4UI2A 3ZDZE 3MLRH 2BVOA 1EVUA 4OI9A 1TPXB 4KMTH 1U8MA 3LKNB 3DNKA 3D2UA 1A6PA 3V6OC 3L1OL 5C09E 4Z7UE 1NMAL 2VAAB 1NLBL 3FT3B 4MXWL 3KYOA 5EUKA 2OLDA 1SMOA 1JHLH 2VIRB 4E42A 2XN9E 43CAA 2X7LA 1WC7B 4YGVB 4Z9KB 3QA3A 1CVRA 3OB0H 1KYOJ 1XF2A 5EZIH 4HMEA 4I0KA 4J2XA 5GRYA 2R1XA 2NY2C 5D7JA 4AL8H 3ULVC 2OTWA 1G7LA 3RUGB 4YQXH 1MI5E 3HZMA 1CXFA 4P5KB 4MQXD 1AQKL 4RNRA 4HWBH 4B5EA 4WI3A 1ZS8A 4FZEL 5TH2A 4OB5L 1XR8B 4FQXB 4X6FB 1MFDH 5E2JA 5IFJB 2ORBH 4MCYA 2SEBB 4F33A 3FOLA 3JTSA 4GAGL 1X5IA 1YYLL 3NFNA 1G7QB 1NQBA 4MGXA 1G6RA 5TPWL 1AGDA 1F8TH 3ROLA 1UM5H 3VFGL 1TNNA 1JF1A 3GJFH 1R3IH 5TDPA 4Z0XB 5DS8A 3UPAA 1AP2A 3MFFA 4F9LA 1V7NH 2IH1B 4XP6L 3ZHLA 3BT2H 4K9EC 2Q76A 3T65B 1P4BL 4LARL 3MRMA 3SE9L 1J5OH 1A4KA 4JHAH 4JQXA 5KN5B 1JIBA 1JRHI 2QHRL 1N6QH 4F7MB 1RJZA 4RGNC 4NPYB 1ZT1B 5JW4Q 4JZJB 4FQLL 2XQBH 4D9LH 5CGTA 4KKCD 5K59F 4JREB 2GITB 4DN4H 2ADJA 3BPLC 2WLYA 1BQLH 1W72H 3C5JB 3INUL 4U3CA 1NC2B 3VMOA 3WNLA 3BDYH 4ETQA 3ARED 3UDWA 3QXWA 4XWOD 3EYVA 4O4YH 3UBXA 2Y6SC 1FV1A 2IH3B 1JUFB 4KFZC 5F88A 5IVXB 1NCCH 4DUXA 1YN7A 4C58B 2HT3C 3K4DA 1W2KT 1P7QD 4U1MB 2O61B 4PJ8B 4U0RB 3KPRE 5H35B 5F7KC 3ZYOA 2BNRE 4HUMB 5F89A 1R5WA 4DJMA 4S1DD 1VSCA 1HOCA 4LDEB 5GJTL 5ADPL 1FJ1B 2KZWA 4NQSB 1YYML 1DANU 1YEHH 3FTGB 3GJEB 3VXQB 4BQ8A 5AG8A 4MZ2A 1I7RA 3GSNB 2UYLA 4HV8B 4MJ5A 3C6LA 1KLUA 5ITFA 1XGUA 4L5FL 1EBPA 4L9DA 5CBAA 4WTWA 2DM2A 4U0QB 1O7VA 3UBXG 5B8CC 2XRAL 3VW3H 3BPCB 6FABH 5KVGL 4HWNA 3BXNB 2A9NH 3GM8A 4UTAL 1PY9A 4L3ED 3HZYB 5J3HD 1J05B 1IVLA 5HGBB 4IRSB 4OCXL 2GUOB 5DF0A 3D39D 2CUIA 3MGTB 4U1LA 4UQ2B 5K33A 4GQ9L 2XZAH 3BGFC 4X6EA 3HN3A 5I8EA 1GGCH 1NDMB 4NO0A 1G9MC 3MBEC 4X9FA 5C0FB 1I85A 4KK6C 1B4JL 4DOHB 4FXGA 1HKLL 1LEIB 4Y4HA 1IGTB 5DK0B 3MLWH 4WENB 3TBSA 1A6VH 1A6WL 3S37H 3B9KA 1NEZA 3FOMB 1ZAGA 2XWJB 5DFTA 3S5LB 2BFVL 2VSCA 4UUJA 3TPUB 2X1WL 4NT6B 2FEEI 3KDMA 1YNTB 4HZLB 1D9KA 5FK9B 2ICWI 3RDTC 3PIQB 2HFGH 4JCMA 4J23A 2ZUSA 1LDSA 2F74A 2MWCA 4M7LH 2RFXB 2C3XA 3OXRA 2GT9B 4HH9A 3VWJC 1DBBH 1S7TB 3AM8C 2EECA 4PRPE 3SO3B 4KUZH 1DBJL 1P4BH 3C60A 2V5YA 4EBQL 4KKBD 4K71C 5GS2H 2AJZA 3KPOA 3SDXF 3MFGB 3EOBB 4M7JL 3MROB 3GMOB 2ATPB 2Z9TA 1HIML 3RPIB 2ZCLH 5FO9B 3PV7A 4H1LB 2V7HA 1NL0H 3LQAC 3LSOB 3WLWC 3C5ZA 5HJ3A 4H0HB 4O2CB 1CN4A 3GIVA 2O5XL 4R9HA 5BZDA 4OAWB 2HJLA 1JPGB 3KNBA 2FGZA 4F37F 5CS7A 4I0PA 1TJIL 2OCFD 1BFOB 1N2RB 3OAZH 2FDBP 1UWGH 2Z8SA 1YQVL 3K74B 1RURL 4MMXC 4P2YA 3S98A 3QH3A 5C09B 4Z7UB 4X0KA 5LBSL 1ORSB 5T33L 3BP4B 5TF1H 2VR4A 3KG5A 3U7WL 3QEGH 4TSBL 3WJJA 4ZFFB 5I66A 1YYMH 1R5IA 5CEZL 1NGZB 35C8L 3GB7B 1QSEB 2XN9B 4DGIL 5I1LB 4GMSL 3O9WB 2XQYG 1OLZA 3MJ6A 4KJYA 3RWCA 5F3BA 1MI5B 3IF1A 4ODXB 4C83A 2BY1A 5E8EA 4YDJA 4P9HC 5JQ6L 1X5JA 5GRJH 4YNYB 5JDSB 3JV0A 3CSYB 1D5XA 4JM2D 2CLVA 4WU7B 3RWDA 2UZIL 1GSMA 1H5BA 2X4PA 3NPZB 1ERNA 5DXWA 1HZHL 3BKML 5C0DB 4UB0H 1IQWH 4OGAD 2V2WA 5HHME 4N90E 4P5TA 4WHYH 5C6TH 4QYOB 3RIAK 4P2RA 3D1MC 1KB9J 3TNMA 5DJXB 3ARPA 4D0CA 3NA4A 1WCBB 3OGCA 2E5EA 4HIXH 5AUMB 4BSVB 1JWUB 1NCWL 4JY6B 3ZE1E 3WDIA 3CZFA 2OTPA 3T09A 1AD9B 4AIOA 5HGHA 4MAUL 1ZHBB 4XCCL 3MO1A 4R4BA 4XHQA 2YHGA 3NH7L 1BZ7A 2B2XH 1DANT 5GIRA 1GZQB 1IT9H 4X8JA 2BERA 2FX8H 4APQA 2AK4A 1FGNH 1GOHA 3P0VH 4ZTPL 2FJFB 1CBVL 1RFDL 4GRWF 2OZ4H 3CLEH 1XCQA 1MCLA 1KN4L 2OR9L 3C09C 5INDB 4KMQA 3KXFE 3TVMB 3QIBB 4HUWA 2P8MA 3M17B 4HJ0C 1VFBA 5HHVH 3BE1L 3ZDYF 1JGUL 4LOUD 4PP1D 3IS1X 4NQDE 2V5TA 2BRRL 2IWGA 1YMME 3KPRB 2G5RA 1XF3B 4Y16B 2Z31A 4G8GA 4PJGE 1EJOH 3U46A 4K3JH 3W11C 4F57H 2BNRB 1PEWA 4KDVA 3FCTA 3GRWH 1DQLL 1RUAH 6CGTA 1RV6X 2EC9U 1T7ZA 4LSSH 3QG7H 4NIKB 4ZPVA 4YX2H 1A3LH 1D5MB 3JWDH 4NO2B 4HWEH 1A64A 1Q72L 3S3PA 3NA9H 5L2JA 4K3EL 5CZXC 3ARBB 1YMHA 1ZT4A 4JN1L 4WI6A 2AI0H 4O2EA 3WFDL 2W91A 4PJDA 5IP4A 2V2XB 5LBSH 1T21B 4YE4L 4X99B 4U1KA 3WO4B 3UROR 1OGAD 1KN2H 4FN0A 1EK3A 2B39A 2CKBA 5CZVL 4G42A 1G7JB 2YEZB 1IEHA 4BSWB 5HY9B 2IPTL 3A0OA 5J57B 1KCVL 2NTSP 2W0LA 3VU2A 4X7DC 4XVUC 3SGEI 3K8KA 3HNTL 4Y1AD 3TEUA 4ZUTA 1OPGH 4LRNL 4J1UB 1TQBC 4OGYH 5EO9A 4OV6F 5B38B 4IIQC 5AEAA 1EGJL 3LKNA 4S10A 5DQDH 5KSBF 2H45A 1HZHH 1HHIA 4O9HH 4RQQB 3DV6B 2DQUL 3EBAA 1J11A 5B3JE 1KT2B 3TN0D 5K9KB 3MRPA 3BSZH 3IGAA 4MQ7B 3V8OA 3NACL 2IPKA 4LCUB 1NCWH 1WUNT 2EIBA 3SDAA 1I9IL 4PRPB 5I0DA 1QP1A 4JKWA 1INDH 1LWRA 4KDTC 2R23B 4YUEH 2W0PA 2PETA 1NBZB 4P59H 4DAGL 1FG9C 5I76B 1DN0B 1QO3B 5HYSB 2GY5A 4C57C 4M00A 3D18A 5L2KD 5JMOC 5T3ZH 1Q0YL 1S9YB 5IBTH 3VFVA 1H9VA 3OTTA 1FYHB 2EE2A 2YA1A 3EFDH 3KLDA 4JPIA 1I8MA 4ISVA 4UTBL 1DE4B 4PB0H 2P24A 3TJEL 1HEZA 4G9DB 1I3GH 2P1YA 3HA0A 1AO7E 1BMGA 1RI8A 3BP6A 1P4LA 1SM3H 1U3HB 3G5XA 2KZ1B 5D1XA 5LAXA 5CINH 5IF0A 4WHTB 1CICC 3CH1A 5MERA 4Q6IB 3KPMB 2CRYA 1HQ4B 2YPKB 3MRIB 4X6CF 2DF3A 2FHBA 5IM7B 5IB2B 1MFEL 5KVFH 1M6OB 4H26A 4ZUVB 2H2SC 2D31B 5KVEL 4AIZB 5JOPE 2XTJE 1AI1H 1WIOA 4OTXH 5DRXA 3UZEA 5HPOA 2C3GA 1ZEAH 4P48A 1TJGH 5C0AA 3ARDD 3VFTA 4XNQB 3Q6FB 4JFZH 1FPTH 4E9LA 2BP3A 1Z3GH 2OJZH 1HHJB 2AJUH 5HI3D 1VGKB 3O3EA 5E7FA 3EOAB 3QPXL 1KB5B 4S11A 2FL5B 1IM9A 1LK2A 1F3DJ 1MCBA 2GJ6E 3BZFB 3EGSB 1EA9C 2EXWD 5HHMB 4TTDD 5EU5B 5IHZB 1NAMB 5F9WB 3RVVC 5K9OB 1XIWA 3DVNB 2OL3H 3O6LH 3EO0A 4MB5A 3AS2A 3SGDI 1FJ1A 3QIUA 5GZNC 4L4JA 1INEL 1YJDH 1RUQL 4QXGL 3DX9A 2HRLA 5LG1A 5FOBA 1CDJA 1YPZA 4N68A 3VH8A 3VXUE 1ODAA 4H88H 5C70A 5DUML 3QIWC 5T3XH 2AGJH 4XGZA 3GSNA 1T1YB 5HHOA 4IMKA 3GMLB 1ZLSL 2R2BB 1YEKL 2EC9T 4Y2DC 2ZOLA 2CJUH 1F4WH 3O3BA 3FQNB 3KLAB 1PSKL 3MJ7B 1WIUA 2JTDA 3O6ML 4N9GA 5DVKA 4GRMB 3ZKMD 2EE3A 3L3GA 4CNIB 5CSZA 2KPNA 1I3RA 2IEPA 3DVFA 4D94A 5HGBA 2FZ3A 3L9RA 3U82B 3KXFB 5JIIA 1WVZA 4JQIL 3T77B 1H3TA 2FHCA 2Q3ZA 1NDMA 1FGVH 4NQDB 2NY5L 1YMMB 3LHPL 4X80H 1S8DA 4PJGB 4PREA 2HTKD 2R0KH 5C2BL 4DWHA 2BC4B 3OXSA 3WEXB 1EPFA 2G75A 4M6NH 3V95A 3BKJH 4ZSOA 5TGBB 3HZKA 4L4VD 4G6AD 3ARFA 3WIHH 2XWJA 3TO4D 5FYKL 4NGHL 3E6FB 5C3TA 1YNTA 2AJ3A 3DX8B 3L95A 4Z95L 4EDXB 1CU4L 3WUWB 4OF5A 4K2UH 1P84J 1MH5A 4WV1B 1FZMB 2H32A 3OR7A 4E41A 1LEGA 1HHKB 1UZ6E 5DO2D 5BQ7A 4OCMC 1VFMA 1RJLB 4JY5L 1EFXA 4RFNC 3DIFA 5MENB 1I1CA 3LCYA 1X4YA 4XMPH 1VFAB 5FA4B 4PJIE 4XCFH 1CFTA 4PJFA 2R1WB 4LDOB 1EEYA 3PHOB 2J6EL 2DWEA 5FDWB 1T1XB 4N0YL 1DSFL 2XZCL 3VFSB 4GG6A 3BP7A 3IYLW 4RFOL 3QQ9D 1PG7X 3VWKA 1T1ZA 4HAGA 3TA3C 3QI9C 1U58B 5GS2D 1OAXL 4ZUWB 5CUSH 2CO6B 3HPJA 3K2UL 3QAZC 1IGCH 5INCB 1KPRA 2Y36H 4Y5XA 5F6IB 1KTRL 4JB9H 5I1CL 3G5YB 3MLVH 4XMLL 5CWSB 3CFJB 3CMOL 3RQ3A 4KK8D 4NJAL 1M7XA 3GKZA 4HLZH 2PO6C 1NGYA 1ADQH 2BXZA 4CDHA 3PF2A 3DURB 2YSSB 4GXVL 3X12A 1CLZL 1BM3H 1R3HA 5DTFB 1MCEA 1JNHA 1QSVA 3DGGB 5DJCA 5ESQB 3HC4H 3LD8B 2AEQH 3U9UB 2EKSB 5E56A 2ZKHL 5DVLA 2KH2B 2VDNH 2DQHH 2B0SH 5D71L 5SWSE 1TCMA 1JNLH 2AEWA 4XNUH 5IEKA 4LEOA 1YN6B 3PABA 1LO4H 1AO7B 2OXHA 4KJQC 4R0LB 3SBWC 2QR0A 5T5FH 5JXEA 2VLKA 4XP1H 3KPLB 1NCNA 3D0VA 1P7HL 5FHAH 4GXUN 4TYUA 3QJHA 4CN1A 3O8XC 1A9BA 1R5VB 2A83B 5C0EA 2D0HA 5FM4A 1Z5LB 1GGIL 4MSWA 1FSKB 3MNVA 2J8UF 3WFEL 3EUUA 4OQ1A 2XTJB 3MJ8A 1QFOA 5CJOL 4UU9A 1CU4H 2RR3A 4OM1H 4K8RH 3VXME 1AGFB 4EI5D 1F02I 1LEKB 4X6BB 2PYEE 4PJ9C 1M1SA 1E4XH 3WE6B 2BSSA 1N0LA 3REWA 3TZVC 5KZCB 2L0DA 3LS5H 3WS6C 3NAAH 1T7WA 3T2PA 2R0ZH 3RWHA 1K8IA 3MRLA 1TETH 5DRNA 4N8PA 5D1ZB 4S1RL 2GJ6B 4YHOH 5KSAA 4I77L 1Z9OA 4P3DB 5GZOC 4HS8H 4MXQC 3OAYK 1QKZH 2B20A 4X8XA 4G6ML 4KXZH 5BO1H 1UWEH 5FUZL 2I07A 5IW6A 4UAOC 4GSDH 1EHLH 1BOGA 3MV9A 1KV3A 4OI7A 1OLLA 3H7BB 4F15B 5IKCB 4PJ7E 3VXUB 2NY7L 3DX6B 5FYLH 4QTIL 3HAEH 4XBEL 1YQ2A 3S34L 3O3DB 2EH7H 5MHSD 4X99A 5D2NC 3K2UH 1UKTA 4LASL 1T04B 4P4KA 1JGVL 3ARYA 5TF0A 5I75C 3QNXA 3DPBA 1CFBA 2FECL 4JG0L 2YUZA 3BEVB 1AY1H 1RZJL 3DYOA 3ZHKA 1NBYB 5SWZA 4M7KH 4OCWH 2YPLD 2HN7A 4TVPH 1E28B 1CXLA 1IKNA 4I0CC 4DFIA 1FIGH 2XA3A 1I1RA 5D93B 5ANMA 3QNZB 5DJZA 4M5YL 1U0QA 1P7KA 3PL6B 2XNAB 3G6JE 2A73A 5EZOH 1K4CA 3FFCA 3L5WA 2DS4A 1KIQB 1L0YA 5JXAL 3AB0B 1IE5A 4QWWD 4KPHH 2R0WL 4HUUB 4XCNA 5F96L 4QRUA 4PS4L 4Q9RL 4Z5RB 1B88A 4WEMB 3RJQB 4GKZA 1FO0B 1DEDA 3MNWB 3OAUL 5D71H 4CN6A 3ORJA 4WDIA 2ICES 1T4KA 1T0NA 2P45B 1EERB 3QDGE 3STZB 3JTTA 3CDCA 1NCBH 2VC2H 4G3YH 4R97B 3C5SB 3EDKA 1XGRB 3WFHA 1U92A 4QKXB 3S35X 4MQ7A 5DI8A 3QBTB 4ZS6C 4GKOA 5FFLA 3L3IA 1A7NL 1YY8B 4PRPA 4JR9L 2ARJB 5F1NA 1ZANH 1MCOH 4BSJA 3PWLB 2I25N 4WFEE 1CS6A 4M1GH 3GMPA 4Z7VF 1X7QA 5ESAB 4PJIB 4U1GC 5CKAA 1C5DB 2VITB 3OJDA 4PJCF 2PF6A 5CHNA 4KHTL 3CFCL 4YDIH 4GRLD 2FJGA 1ZHNA 3ESUF 3KYAA 4U6VL 1JVKA 1F3JA 2BVPA 5DD6B 4KQ3H 4NO3A 3RTQB 5FKPB 2BY0A 1T7YA 3K1DA 3OB8A 4LVOB 1CL7H 3GMQB 4UDUB 2HG5B 4OLYL 3AREC 4G9DA 4XWOC 1CQKA 5E2WH 1SYVB 1JK8A 1CD1A 2DQIL 1T0PB 2VR9A 5FECA 1GYAA 5FKAB 1KCSL 1MAMH 1HINH 4QHLB 4KZEH 2ERJB 4WFFE 4OZFB 1GOFA 4G8EA 4R4FL 2BVQA 5FO7B 2VDML 2YMXL 3U0WH 1U91A 2DBLH 1DVFA 1KFAH 1ORQB 1QRNA 5T3ZD 4P46A 2NY7H 4GMTL 4OGXH 2D4DA 4S1DC 4ZS7H 2FGWH 5T1LD 1EMTL 4DKAA 1E6OL 2BSRA 5ADOH 2J8HA 4NQXB 4F8TA 3KWWA 3N0PB 2DN7A 1JGEB 2ESVD 1ZSDA 3AU1A 3E8UL 3P4OA 2QSCH 2IANE 4LASH 2D2OA 5FB8B 5KANI 1JGVH 2DDQH 4F3FA 1NUFA 3SDXA 3WD5L 1MFAH 3UJIH 1NLDH 1GJIA 1GGYA 3V6OA 5D1QD 2PYFB 3EOTH 5DSCA 1FFQA 2QL1A 1SHMA 1KLGA 4EUPA 3S36X 4HEPG 2XFXB 3WNKA 2V17L 5EWIL 5SWSB 2ZCHL 5J6HB 1OM3L 1K2DA 4BFIB 1K5NB 2VQ1B 3V6BR 5KS9E 3H9SE 5J3HC 1MREH 4POZD 3ZTJG 3FRUA 25C8H 1KEGL 4WW2F 2R0WH 3CXDL 1S9VA 4LEXH 2H8PA 1OQOA 1MWAH 4EIZC 4DCQB 3IAQA 1VACA 3X17A 1VFOA 2H6PA 3CDFA 1A6ZB 1KJMB 3MLSH 3NFPA 2A9MH 1QD0A 3PWUB 2R0LH 5GXBB 4NUGH 3S8WA 1BIIB 3DUUA 1XFPA 2EDQA 1M7DA 1TVHB 2BRQA 1KTLB 3NPSC 4UINL 3VXMB 4IOFC 2D0GA 3ARUA 1F4HA 4LCWD 3BHBA 1U8KB 4MNQD 3OKMB 1II4E 3MJ7A 1CXEA 1A7NH 2PYEB 4PJEF 5GJSL 4EUPG 5J1AB 4GFTB 4ORGB 2DYPA 5DJ6B 1F2QA 2VLJE 5IUSA 3RBSA 3TCLB 2DM7A 5ICYB 2CLRB 2W0FB 2Q86A 2BY3A 1U8QA 4DKEL 1UA6H 2GTWB 1HI6A 4M02A 4I9WE 3HG1D 3Q5TA 1BVLB 1LP9F 2BXYA 1ITCA 2NX5D 3FB8A 5T3XD 5TQ0L 1NC4D 1RIHL 1F00I 4XZUB 2YD6A 5EU6A 3QRGH 2PTTB 3IS0X 2X6MA 2AXGA 2P5EE 3KPNA 3S88H 5CBEB 3WEXA 4LAQH 4PY8J 3SDYH 3TV3H 1D5IL 3MLUL 4L29A 4ZQKA 1UB5A 4I4WB 1U6AL 3MLPA 2N1KA 3RFZC 5ILTL 5KTEL 3C9NA 2IQAB 4OZIF 1HILB 2FYYA 3GIZL 5DK2A 4MWFB 4GAJL 4K7PY 4KKLC 4XBPA 1CG9A 1GGTA 2GCYB 1EAJA 1D6EA 4FTVD 3WUWA 1F3DH 2UY7A 4J8RB 5J7CC 2A2QT 4KK5C 3RY6C 4GW5A 4XX1E 1JGDA 4F7TB 1QQDB 5K9QI 5KSVA 5C0CD 3HLAA 3O4LD 3BP5B 3QDJB 5EC2A 1JJUA 4JFXB 5F7EH 4R4NC 4L1DA 1BX2B 2P5WD 1LD9B 3SHSA 4YHYB 5DJAA 2XG5A 3G6JB 1PLGL 1JTOA 4Q97A 3SDCB 2JJWA 2XA8L 1IAKB 3RWEA 4JFDD 5EUOE 3EFFA 1SBSH 1S9XA 2AXJA 1WAAE 4HD9A 2X2YA 4H1LH 4ODTL 3L7EB 2Z8RA 4LIQH 1NBVH 3RRQA 1OM3H 3QDGB 4JM2C 5B8CA 1U58A 4Q58C 4NC1E 4ELME 2BSTA 3KR3L 2EO1A 3CC5B 1OTTD 2A6DB 3QUXC 1AD0B 1IGJA 5A2FA 4TUOA 4I2XE 2MQ3A 5LGJA 3ISWA 1U93B 1EDQA 1RZ7H 3HI6L 4Y5YB 4RAVA 5DD1L 1AFVH 3MV01 4O02H 5GS0D 3MBEA 5IJVA 1TVBA 2DIBA 4PBVC 1QFWL 3AY4C 4RMUA 3LH2L 3BYYA 1DQQB 2ICWB 3V52H 4PR5B 3GGWB 1WF5A 1J87A 4LVHC 4PRBA 4KHXH 1SY6L 2A1WH 3WO3B 4J3OC 5F1IA 5BOZG 4HK0A 1DQDL 1RD6A 3IAGC 5EOQH 4NJ9H 1HH6A 2FBJL 1HSAB 1QPPA 3JXAA 5TDNA 1H8SA 3RDTA 3HCVA 4JGJA 2FIRT 5J0BA 4NUJB 3SJVA 3VWJA 5AWNH 1X3DA 3AM8A 3ARRA 2GK0B 4HJGB 2E7CA 1RIHH 1QR1B 2AQ3A 1REIA 4A6YL 2IFFH 3DI3B 4NKIL 3U4BH 2AXHA 5KSBA 2HWZL 4GBXB 3K0WA 4PP1C 3V6FB 3U83A 3LPWA 3UPRB 3ULSA 3QDMA 3FO2B 4MJ6B 4H0IA 5FYKU 3T8XA 1CFSB 4U05A 5DR5L 4PGEA 3WXWL 2HLAB 4UNUA 1QFHA 1Q9WA 5GGSA 4QOKA 1K3IA 5A2IH 2EDLA 3HMXH 4X4XA 2WP3T 4WU5B 1OSZB 4OZHF 3V0WL 2XY1A 4JKLA 1EV2E 2IANB 1LEKA 5MP6H 3L6FA 3ZSTA 5DJ2B 5GRWA 1UH3A 3P73B 4PLJD 1E4JA 3U4AA 3RWJB 2X1PA 1TVDA 2CRIA 2EYTB 1WFOA 2DQTH 3ULUL 1CLCA 1FZKA 3ES6A 1EEZB 5K59E 3NVQA 5KS9B 3H9SB 4JAMA 3UTTD 4OLZH 3IDGB 3VG0L 4GS7B 1NGQH 2XA8H 4UT7H 2V5SA 5DHVA 1AKJB 1ZWIB 4NQCE 5GHWH 2I26N 4LAJH 4GUPB 1UQSB 1JV5B 1U8OB 1WFTA 1L7IL 2YZ1A 3QISA 4QTHA 4ZPTA 1UZ8A 5CCKL 2EDBA 1MNUH 3TBTA 1BAFL 4IM8A 3EIFA 3IKCA 3EYOA 4UIKH 4YHZH 5F6HI 3QUZD 2F58L 4XPTL 3VDCA 4M93C 1G7HA 3UCRA 1L0QA 1HSBB 3T04D 3V5KB 4MA3A 4KVCH 4L3EE 3O2DH 4ODSL 2NLJB 2VLJB 3TH2T 3D39E 2VR5A 4HIIB 1FAIH 1C16B 5D7LD 2DTML 3PWVB 4G8FB 1I9RL 1YDPB 5FYLD 3CLFL 5E4EC 2NXYC 1SYSA 5HPMA 1DQDH 2FR4B 1NGXB 1MLBA 2P5EB 2IGFH 4QRPD 4ELKA 3AMKA 3PP3H 4NO5A 3TIDA 3TCXA 3H2WA 3MYJB 4P5MB 1RIVH 3I2CL 3NIGF 2V9RA 1JZ7A 4JFFA 4Z78B 3ZT6A 3OBAA 3BAEH 1AGBA 4HS3A 4TVPD 1A6AB 2BOBA 2HP4A 4NWUH 4Y88A 4YZFF 1RZFH 3OKNA 3U79A 3DO7B 4DQOL 3LN5B 2VDOH 2YRPA 3H9ZA 2B1AH 2FATL 1ONQA 3K8MA 2VZ3A 3KJ4C 5EORH 2HFEA 4DVRH 4JFQB 4R8WH 4YXHL 3QQ3A 5HVWA 3RI5K 1MRFL 3CFBA 4D8PB 4DVBA 1FH5H 1S7VB 2VLLB 2VXSH 2RQ8A 5DVNA 5D7IA 2APWA 2IADA 5ESAA 3QZWB 2AABH 1BBJB 4WCYH 1Q9OB 2WK2A 5HHNA 1N4XH 2M2DA 2Y25A 4ZFOB 1UH2A 4WO4C 5T1DL 1PJ9A 3B5TA 5IT2L 1KJ2L 2NXZC 1Y18A 3I3BA 1WFNA 3AXLB 1T1WA 1U8PA 5ESVA 5EUOB 5IQ7L 5KJRL 3FO1A 5IBUG 1QA9B 3GMQA 3IKKA 4ZAKD 1ZVYA 3D3VD 3B2VH 5JOFB 4CMHC 4MDJA 1PVHA 1RK0A 2WWMD 3TH4T 4OLVH 2O5ZL 5BV7L 2M26A 1CCZA 4XXDA 1DBAH 1FNGB 3PGCB 4N0CD 3RVTC 2VL5B 4JFOA 4TTDC 5C9KA 1LO2H 1UENA 4ZOBA 1FVCB 2DRUA 5KAQF 3OG4B 5BRZD 4BK5A 3C8HA 3VE0B 1RK1A 1F4YH 1PKOA 4Z76B 1RUPH 1LO5B 3QQ4A 2OP4L 4NQXA 1KG0A 3HMWH 2DAVA 1MEXH 2QKIA 3BZDA 4XPBL 5HGDA 3SOBH 1CLYL 1G0XA 4IIQA 4MJIB 3Q6GL 3F7QA 1IGMH 2HJKB 5DJYB 5L7XL 3E2HB 4U6HA 4EN3C 4BH8B 3BH8B 3Q3GB 4GXUM 4PRAB 4CJ0A 4LHJB 4KU1A 4YBHA 4V1DA 3RKDC 1BFSA 2J5LB 2ITDA 4HXAL 1UJ3C 5J6HA 3QCUL 3MRCB 2DTMH 3F7YA 4CVZB 3CUPA 2X4UA 3WL9B 4PLKD 4CAGA 2ITCA 3ECBB 5DT1L 3LPGA 2LAGB 4KDTA 1J0IA 3BUTA 4OFVA 2YA0A 5EB9A 2F5BL 3OKEA 3CPLA 4XC1L 4YR6A 5E2VL 3VI3E 1NCAL 3DHMA 4TSCL 2R29L 2CUHA 5ICXA 2CIIA 2HTKC 4PYGA 1G6RL 3LRSB 2IAMB 1NFIA 3PGDA 3PWUA 3PP4L 5IHUL 1UB6B 1YEIL 3FT2B 3LQZB 1DLFH 3WHXA 2ZCKL 3U7AA 3MMEB 3F7VB 3IJSA 1M05A 3UJJH 1QHOA 3EOYG 1F45A 1UM4H 2WWKT 3IFLL 3C2SA 1MCPH 5CD3B 4BH7A 4OT1L 2XKSA 3BQUB 1OAKL 4HKXA 5DD0L 2OMNA 1N3NA 5ICYA 1MUJA 4P2OC 2HT2D 1CICA 4IRJD 4RMWA 1IAIH 1KSRA 4MB3A 2NTFB 1P7QB 4PJ8D 3HNSH 1H0DB 4W6YB 1I8LC 2AXFA 4AH2A 1AQDA 4JRXB 4WW1B 3UTQA 5K93A 5FYJL 4GRWE 4ZYKA 2OJEA 5IOPB 5CBEA 1JWMA 3RU8H 4NQCB 5CMAB 3QEHB 5DGRA 1AJ7H 2MOVA 1RAMA 3GI8H 4PJ7A 4QRSB 4XHJD 2YD1A 3ARGD 2HLFD 1MCCA 3W0WA 5DD5L 2D7TH 2V6HA 3PWJB 5I8KH 1PYWB 5E6ID 1XF4B 2PNDA 3GZKA 5DUBB 1B6DA 1BVZA 3QWQB 3W5MA 3PDGA 1MIML 3QFJA 1OGAE 3BOVA 3IDYB 4TNWF 5EZJA 1TTFA 4L3EB 3GMNA 4TUJB 1UWXK 4DN3H 3UTZA 3MOQA 1QTYT 1TENA 1OSPL 3D39B 1A7OL 3QCTL 3AS3A 1MELA 4N0UE 3A67L 4KK8C 2EIZB 4HHAA 2FIKB 3QIWA 4K7FA 2NNAB 5I73B 2OK0L 3UTOA 2DQEL 5D72L 5ITBL 5FO8B 1A22B 2ADGA 3PXJA 4ONHA 3L3DB 5J12C 1S7WB 4NHCL 4WHYG 1QZ1A 1LILA 1PZ5B 3CMGA 1FZOA 3EDEA 3WKNA 5KW9H 3MRQB 3SKJL 3PV6B 3UO1L 3W39A 3U30B 3RNKA 2A6DA 2WBJB 4XNXH 1AD0A 1A0QL 3QUYC 3FN0H 2F5BH 5GRVL 3ARTA 1U93A 4X7TB 2JCCF 5EO1B 4MA1C 3RX5A 5HHPA 4IOSD 1QHPA 3O41A 2AQ2A 3CXHK 3DMMB 1G6RH 3MACL 4EOWH 5J13B 3DRQB 4XWGH 2G5BA 2E7LC 1BLNB 3GMRB 2AJXH 3PDOB 5A3ID 4U6TA 3KYNB 2FX9H 3MLTB 4CL7A 1K4DA 2IALB 4BQ9A 4PLOB 1E4WH 3ULUC 1I8IB 2P4AB 3QFDA 4YO0B 1G9NH 3TBYB 4LHUD 1S7XA 4AEIL 1QEWA 5IMKB 2IBGA 5L2KE 4RFEB 5GGRB 2Y5TB 3FQXB 1AE6L 2R4RL 3MXVL 2E8YA 1SVCP 2DQFA 3L3KB 5GGRY 2IC2A 3OKLA 4PRID 3GUTA 5GS0L 1HYSD 4WIQA 4NQVA 5C09D 4W6XB 1D6VL 2P48B 1FL6A 2YD5A 4JO3H 2UUDH 1U36A 3VD4A 2EXYD 1SJEB 5DFVD 4ERSH 3ALPA 3HB3C 5D6CB 2JIXA 5EBMB 5C0GA 1QSED 2ZPKL 3HI5H 3P77B 1F6AA 3IJHA 4PUBH 4G6KL 4FQ1L 3ALXA 1NGWB 2JLLA 4UOJA 4U1HA 4MNHB 4QRRB 4AENA 2B5IC 2BMKB 4RAUA 2G2RA 3WJLC 3DROB 3MRKB 4UOW0 5DMYA 4U1SA 2I60H 4LBEA 4MA8L 3DOSA 5E00B 4PTUB 1DZBA 3LB6C 1BZ9B 3KAAA 2WANA 2WAHA 3TA3A 4YGAB 3QI9A 2YN3A 2APVA 4PJCA 2LVEA 4NCC1 4LLQB 3SO5A 3GSVA 4JEGB 1CGSL 1CFQA 1E4XI 5EC1B 4KTYA 2EYRB 4JO2H 3MUHL 5CILL 3WYRA 2MTPA 1Q38A 2Q7YB 2CGRL 3MRBB 4H5SB 2R8SH 1JHKL 4CKVX 3BN9C 5K9JH 3AFLA 4U6YB 2PO6A 2R2HA 1Q9KB 5I8CA 5CGYC 1JWSB 4JO1L 3WLBA 3PWPA 1J1OL 3OG6B 2ZWLT 4L4TD 1J86A 4KXZI 1G7IA 4KV5E 1CFVL 4JRYA 3QUKB 4PGBB 2W9EL 3BDXA 4NP4L 2C4FT 3MCG1 1NFDE 4K7PX 4Z7WF 1O0VA 1ZHLB 3V5KA 3A6BL 5DHYB 2G60H 5KG9B 5JW3L 3SKNA 4M7ZC 4Z77B 3MGOB 4Z7QF 1HHGB 2ARJQ 3SBWA 1YNLH 3TBWA 4F37K 3CSPA 4QHMA 4H20H 5EOTB 3VRJB 1N64L 5DJDB 1ROWA 5F3HA 3O8XA 4MNGA 4OCSH 4DZBB 1NGXA 5BV7C 4GRWB 3D85B 1DEEA 3BKCL 3QUMB 2Y06H 5TE4L 4LGRB 5D7SL 1I7UA 8FABB 4G43A 4P2QA 2GQHA 5IFAL 4E5XB 3QNYB 1FNSL 3BW9A 4P2CG 5L88L 1X6NA 3TO2B 2F8VA 3ARBD 3IVKB 2PCPB 2W0KA 3UTSD 4AIXA 4HFUH 4HULB 1JI1A 4PJ9A 2HVJA 4AEHL 3LIZH 1BQHB 2Y5EA 2NZ9C 2E6QA 3TZVA 1FO0H 4Z0BH 1QBML 3PJSB 5B21A 1U8IA 4QEGA 2ATKB 3HI1B 3GHBL 3WS6A 4HCRH 3IETA 3C6SA 4KAQL 5AZEL 4BFEA 4FABH 1D7FA 1OGAB 3TYGH 1JBJA 4MAYC 1CD9B 1CLOH 4M9PA 1XGYL 3U6RA 1CQYA 1IGIH 4NRXB 2C1OA 2Q6WB 4OF7A 3JV4A 4YBQC 3QZWA 5I17B 4LSRL 4BYHA 5CJQH 1XF1A 4NKOB 1PBYA 4H25B 4N0UB 1BD2D 3HPLA 4NC0B 1A3RH 4J6RL 4N8VB 5T1MA 3RGVD 5CD5C 1J88A 1MJUL 1IC4L 2IMMA 3MA7B 5FGBC 1LP9A 1N26A 2E9BA 1TFHA 2CSPA 4RZCA 4EI6A 5D2NA 3H9HA 4OF0A 4M1CD 5JOFA 1N59B 1U8LA 3BZ4A 3MBXH 1S7RB 4I18B 4WNQB 2E7HA 4ELMA 1JTTA 1CE6B 4XP5H 3W2DL 4P4RA 3TN0B 4D0DA 1CL7I 4B53A 1DQJA 2ICEB 5HI4C 2BOCA 1FZJB 1V7MH 5GS1B 2UV3A 3MRHA 4YJZL 4NSKA 5LCVL 4I2XA 1C08A 2EDXA 4GKSB 1BHGA 4LK4A 1H3XA 3P2TA 4NKDA 3QHZH 1FL3B 4WI4A 4QLRA 2DJ4A 1VGEL 2V9QA 1MHPL 4FFYL 4JM4H 5DQJB 5F7NC 5JHLL 1NH6A 5EG6C 2X70B 1T22A 4JFPA 1UKSA 4OLUL 3RAJH 4PGCB 1FORH 4MD0A 3QG6A 2EYSB 3C08L 5L2KB 1F42A 4AT6B 2XYCA 1IL1A 5T5NF 4JDVA 5FUCC 4JGMA 4LFHD 4PBWD 2WW8A 3QULB 1GAFH 5I9QC 4YBLB 4MMZC 3LEYH 4Y5VC 3GI9L 2FECI 3HFML 1BVKA 1JZ6A 1AGEB 2X4NA 1U3HD 1PG7L 3GMMB 1IILE 2W9DH 4KVNL 4LHQB 2X4SA 3OKOB 1MCSA 4HKZA 3LAFA 4NRZA 4YWGL 1CGWA 1DLHB 1N5AB 4NYLA 5TE4H 5I15L 1FFNA 2A0LD 1A47A 2B1HH 4O58H 2LFGA 4S1QL 3LDBC 3KJ6L 5EBLA 1IBGL 4ZUUA 2HRPL 4CVUA 3MYZA 5ISZD 8CGTA 5MEPA 4JANB 4NN7B 4GAYA 2DMCA 4HGWA 3VA6A 3ARDB 2O5YH 5IHLB 4WTZA 1RHHA 4MDIB 2YPVL 5C08D 5IESH 3C6LC 2NY6B 1BF8A 3X3GL 3G04B 2VDKH 5E6YA 1OTSD 3L3JA 2YD8A 3AREA 3GSXB 2GSGA 3TWCL 1WLHA 4X6CB 4WJ5A 4NZDA 4HG4J 1TTGA 2J8UE 4PRDB 3V4UH 4MXVF 3VXRD 2AK1L 4M7LT 4P23C 1JNNL 3IDIB 5TE7H 1HCVA 3BGMB 3D69B 4BKLB 1RZKC 3OKKB 1KIRB 4J6RH 3UYPA 3V4PL 4ONGL 1MLCA 1MJUH 4L8SB 1I4FA 2X4OA 3M07A 1VADB 4CW1A 3O6FB 3WXVH 1FL5A 2CKBH 1W72B 2N4IA 4D2NA 5C07D 4XNMA 3TBVA 5HDBF 4JPWH 3KYMA 3RIFF 4LGSB 5DVMA 3U0PB 4WTZG 1KTKE 1FFOB 3W2DH 1EVTC 2IQ9L 2VDRL 4HPYL 4URTB 1BFVH 1AR2A 3LKSB 3O0RH 4CU6A 1ZHKB 1NFDB 3OB0K 5F7WC 1KXTB 4U1IB 1CGTA 4ODWB 3CK0H 2NY0D 4MLSA 3VFPA 3BVNB 2ILLA 2PW1A 5TJWK 3KXFD 3T1FA 4DTGL 1N5YH 3GSNL 4OD1H 1IFHH 4ZO6A 5T1KD 3RVWD 5F44A 1W0VA 4TNVF 2VDPL 3ZL4H 2LE9A 2MCPH 1YMMD 5GS0C 1YECH 4RA3A 1UCBL 5TE6H 3MOBH 1VPOL 3KVQA 5D2LF 1T2QL 4TOYH 3R06B 2MPAL 3GJFK 4Y4FD 3IRPX 4LPUA 1RZ8B 1OHQA 1I1AC 3GI9H 4HJJH 5ECJE 3SCMD 1V3JA 5I1EL 3W9EB 3TO4B 1L7TL 1QBBA 1A1MA 2P7TA 3FT4A 2MMXA 5L0QB 3JWOH 4FQQB 3DJ9A 3ARWA 3L7FB 4F2MA 2N56A 2F9BT 1CE1L 3QR2A 1NUGA 2O26U 4MS8C 3LQMA 4YPGA 5MEND 4X9IA 1AXTH 4LCCB 5GGUB 3QHFH 4M6ML 5JR1H 1UGNA 3VJ6B 1DUYB 3T4AB 2Z4QB 5A16A 3NCMA 3D9AL 4Q0XH 5BMFL 5D7JD 3X3GH 3GK8L 3MCLH 4HF5H 2JK5B 5GRUL 3CVHA 1ZTXH 4R90H 1YA5A 5BZWB 4R7NB 1A6UH 4MD5B 3F12A 3JZ7A 2UWEE 1D5BA 4Z7VE 1HQRA 3RY6A 1LE9A 1JPTH 5FHBL 3G08B 1MPAH 4R7DA 2C7UB 4IDJL 1KTDA 4XVJH 2F53D 4ONGH 3DTXA 4PP2B 2AV7A 4UV7L 3I6GB 1DDHA 5FGSA 3Q1SH 4JZOB 1UYWL 4RAHA 5JA9A 3GSUB 4H8WH 5J9PB 4BZ2L 3L3HB 1CIUA 2J8OA 3S35L 4RBPK 5T3ZE 2NW2A 3NZHL 3IDMB 1UXSB 2FD6L 1WWAX 4JY4A 3U0TB 4QXUL 1X5KA 4ZTOL 4KTEH 4LLDA 2DJSA 4NWTL 2ESVE 1A7QH 1D5ZA 2VYRE 3MLYH 1H15A 4N1HB 1G6VK 4LSTL 5I19H 5I18L 5ETUB 4RISL 5E00A 2VXTH 3BD4A 4PTUA 4XC3H 4YXLL 5J6GB 1P2CB 1ND0A 5C3LD 4JM2A 2BDNL 3P4NB 1OTUD 4APQC 5CKGA 2CDFA 3NABL 5ICZB 1IGYB 1MCRA 3QUXA 2A6JB 3F58L 4PJBA 4MHHG 1U9KA 1P9MC 4RGMC 3G5ZA 2R2CA 5IFHL 2R4SL 5I2IA 3DX7A 2GAZB 5DWUH 4XCYB 5LWYL 1MCIA 5I16A 2BNQA 1XEDA 1FRGL 5CEYA 4AEFA 4DEPB 4NNXA 3ZTNH 3SE8H 2MPAH 4O2FB 4IJ3C 12E8L 3F7RA 3DBXB 1AIFB 5JOEA 5IW1B 3PWNA 2OQJB 1KGCD 5HTSA 2H3NA 3VFWA 4X7EC 5J11C 4EI5B 4MNQE 4LCWE 1C5CH 1A4JB 1ED3B 3O3UN 1NMBH 5E8OB 4RWYH 2DWDA 4YDKL 3U36B 3UJTH 4JFEA 1KCRH 2NY3D 4FZ8H 4MYWB 4QXTA 5HGAB 3GSWA 5JZ7C 1F58L 2VLRA 2J8UB 4X98B 5D1ZD 5IR1A 1QUNA 2GJ6D 4CVWA 2NX5E 4OLWH 3S36L 5T3XE 1XF5B 4TUKL 2QQKL 1FLRH 4YDLB 2YBRB 3VMNA 2H32H 1AGCA 1GZPA 5DMIH 5E95B 3WSQH 4PJEE 3V0VA 3HRZB 5D70H 4GKNA 4NO0D 4J3WA 3QXTA 3OAZK 1R3KB 3O6KL 3VXUD 1FNEB 5E5MA 2WNGA 4Y4HD 3RWIB 2DTSA 5EO0A 4TULL 4YHNA 5KAQG 1RMFL 4IHOB 1TPXC 2NW3A 2WV3A 4FTVE 3B9KD 3IXTB 3RHWF 5FM5O 4LNVA 3PJSA 3PG2A 4OF6A 2ATKA 3MNZB 2FH6A 5IB5A 1NANH 4N5EC 4UIMB 1D9KD 2VZVA 3IU4L 1P69B 5C0CE 5I71B 3O4LE 3IFPA 4FQJH 3W9DB 4PY7A 3DYPA 2EDDA 4N0CC 1MRCL 4OZIE 2PXYB 2L7JA 4GW4B 3BEWA 2FHFA 3FQWB 3C60D 2F19L 2FB4L 2P5WE 2X4QA 2PW2B 3BH9B 4NWTH 1MFBH 1Q0XH 1GIGL 4XPFH 3TJHD 5FCUL 4K94H 3U9PH 5GISH 4Y1AA 3OJ2C 4O51A 3VCLB 3F8UB 4JN2A 4JFDE 5JPMB 1MHHA 4X9BA 4Z8FH 4ODUB 1FFPB 2WQRA 5JMRA 1JTPA 1RUML 3GO1L 4FQHA 4HGMA 5C7XH 3TP4A 1PQZA 4FQXC 1OARH 3LKPA 1Z6JT 3BJLA 4ZFGH 4ZG1A 2L7UA 3THML 4MCZB 2R4SH 3TN0A 1Y0LA 1QLFB 5C0RH 1ZGLB 3VFUA 3MA9L 4I1NB 5LWYH 2VISA 1I9JL 3TH3T 3ZE2F 4CN4A 4Y7MA 4I3RL 5B39B 1T80A 3HNVL 3NBNA 4K23H 3BKYL 4ZUSA 4R6UA 4LNRA 3R1GH 3W81A 4FNLH 3GBNL 4OZGE 1XGPB 2QBWA 4P3CL 3RWFA 2I9LB 4XCEA 5IBLD 3SKOB 1UEYA 4GRLB 1N7MH 4NZUH 5EIIB 1GPOL 4JZJC 1G9EA 1AXIB 3I9GH 5EFIB 4HC1H 3RTQD 4JREC 5E2TL 4XP4L 4S1SL 4PD4K 4FXKB 4DGVH 1J10A 4UQ3B 1IAOB 3D0LB 5DC4B 1M7IB 4DW2H 3QJFB 5DQ9B 2UWEB 4Z7VB 1TJHH 2NY4D 3UPCA 4RGOL 4D3CH 3HR5B 4I3GA 4TRPH 3ZYJA 2ZUQB 1EO8H 2FO4B 3QB7C 2AJVH 1I8KB 3SKMA 3S9DB 3IXAA 5H2BA 1TZGH 4OLXL 4PJ8C 4U0RC 1MOEA 1RIUL 3KPQB 5JLZA 3VXOA 5IG7A 5A43C 5ENWB 2VABA 5AD0A 5HYQB 1YEFL 4WO4A 4NNYB 5T1LB 1WJ3A 3T3PE 3VGEA 1UVQA 4XPAH 2YC1B 3VG9B 1IKFL 2JCCA 5KSUB 2ESVB 2OTUB 4RMVA 5CIPA 4XHJC 4G7VL 2HLFC 5HI5C 1FG2A 3GJFA 5DEGB 3E3QE 1MFCL 3KYKL 2J2ZA 3IU4H 4LLMB 3SPVA 3T4YA 3RKPA 5D1QB 3O2WL 3MV8A 2VXQL 4EXKA 1MJJB 2AK4D 3MREB 1MRCH 4TQEH 3NIDF 1H3UA 2BVTA 2IPUK 1IJ9A 4XMKL 4L1HA 1SJHA 5JW5B 15C8H 1A5FL 4KH2A 4OZHE 3P0YL 4GW1A 4PRHE 2FBOJ 4MD4A 3NCYS 4IRSC 2AERT 3IFOA 2YUVA 1MY7A 3UTTE 1A7BA 5HD8D 5FIEA 5BXFB 3LOWA 3LV3A 1TCRB 1GHFL 4LPYA 4OIBA 1FVDA 1IAII 4K3DH 4A2LA 2Z31D 4G8GD 3GO1H 1KB5L 2ZSVA 4X5LA 3C2AH 5AYUH 5HDQL 4AK1A 3VD3A 4HQQL 3T0EE 2V7NB 4HKBA 1G7PB 5DA4A 4XRCB 2VXUH 1NAML 3GNML 2F54A 4EDWL 1M71B 4WW2B 3MA9H 3OHXA 4XAKE 4KTDL 4HFWB 4WGWB 4MNQB 4G9FB 4AMKL 2FWOA 1UJ3A 5SV3A 1MFNA 4RCAA 2OL3B 3SE3C 2J7LA 2VH5L 2VDQH 1NPUA 1H3GA 4K55A 3SO3C 3S96A 1ACZA 2EZ0D 2YA2A 5D7LE 1DBKH 4KI5C 2ZJSL 5EULV 1KBGH 3DRTA 3TC9A 2W65B 2NX5B 1WZ1L 2YK1L 5FYLE 1NC4B 1DUZB 3DVGA 1GGBH 4LRIC 2WIIB 4M6OL 5A3IC 3SE4C 4QRTA 4PJEB 4QRPE 1MJ7L 1WITA 2V9TA 3IDJB 1C5BH 4L4VA 3I6KB 4HW6A 2JJTC 4FQ2H 4QHNA 4FQIL 3VFRB 4RGOH 1GRWA 1JN6B 3GKWH 3TT1L 4TVPE 1AR1D 1K6QH 5DFWH 3R0MA 3V8CA 1I7TA 1Q94B 1NAKL 4HBCL 3ZKXB 1MRDH 3B6SA 2YD3A 5DDHA 4BM7A 4I3SH 3CX5J 3MX0A 2WZPD 4P2OA 2A6IB 5C71A 1RSFA 1DN2A 1A1OB 5C0CB 3O4LB 2Z92B 3SQOL 5LGHH 1CDUA 1IZKA 3NIGE 5DFVC 2MFNA 3QDJD 1I8LA 5DRZA 4OZIB 3HUJE 1L9MA 2WUCH 1BEYL 1GC1L 2P5WB 3FFDA 3TNNB 1E6JH 1FBIH 2E6JA 5CEXB 3O9WC 1UXWA 4JFYA 5JIKA 5EU7E 4NHUA 3ZTJH 5I8OL 1S5IH 1IGFH 1QFWM 4PY8I 2BHZA 4JFDB 3WIFA 4S2SB 1AXSB 3MRGA 2MNUA 5CJXA 2ADFL 3F5WB 3D3VE 4ZOCA 1KYOK 4EZMA 2EIDA 4FOMA 4W6WB 3O45B 5EBWA 3SY0B 4BZ1L 4RRPG 4M62L 1CZ8H 1HHHA 2HH0H 1SY6A 2I5YL 5DMKA 4JVPA 1EEQA 4G7YH 4PJAA 2CRMA 1MHEB 1IM3B 4OBSA 5D1XD 4JPKH 1XZ0A 5BRZE 1ZE3C 3P4MA 4R2GB 4EUPH 3I50L 3TYFA 1H3PL 3MJGX 2AJYL 1CGVA 5HVGB 3UBXI 1S5HB 4ZD3H 3MV7B 4HLJA 4A6YA 2MJWA 1HXYB 3X11A 1INQA 4R3SB 4XP9H 1U8JA 4J7RA 2FLRT 2Z93B 2X9WA 5FV2A 5HYJA 3UYRL 3GHEH 1BGXH 4IOIB 4OV5A 5GSVA 3ULVH 3VXNB 1JGLH 5HHXH 4UDTA 5EU4B 1RJYA 1QLRB 4MVBD 1G9ML 3LS4H 3Q48A 3ROOB 4P57A 1QSZA 4CGTA 3O2VL 4AG4L 4C56A 2DQGH 3QUYA 5E08L 1YPZF 3H42L 4NN6B 3TVMC 1T03H 1XCTB 3QIBC 1IM9D 4ZFZA 3MRRA 5F9JB 4QT5A 5IB1A 4QO1A 4GBXD 2VMFA 3REVB 1IQDA 1B2WH 1E0OB 2E7LA 1XIWD 3OZ9H 3VXTB 4E0RB 4HX1B 3MPCA 4Y16C 4NNPH 3FB5B 4W4NA 3CFDB 3WS3B 1FYTA 4B0MM 3ILPA 4U6XB 1G1CA 4M8QB 4FFWD 1OAZH 1UM6L 1X5AA 3RL1A 4O2FA 3PNWB 4OLEA 1A7RH 5LVEA 3QO1B 4LGPB 2OQJA 4K9EH 2X9XA 4HBCH 4KGJA 4M5ZL 4OUUB 3RX7A 3ARBC 4UNVA 3MR9A 5IK3B 4YHPA 3VFNB 4WWKB 1XR9B 4KJWC 5JUEH 1ACYL 2FX7L 5C2UB 3I84A 5DJ0B 4HEME 3WO4C 3DUSB 3SQOH 5E7BA 2VUYA 4ZNEE 3U7YH 2DQCL 4X98A 5F97E 3LQAL 1BEYH 2VZUA 1F13A 32C2A 2Q20A 5KOMC 3W82A 1TZHB 4WY7H 1T66C 1A8JH 3MLXH 4PJHE 4OZHB 2A38A 2G9HA 4PRHB 5ACZA 2J88H 4I5BA 3ELAT 3TIEA 1H3WM 4UZGA 5ERWB 2Z91B 5GPRA 5DRWB 4PB9L 4PV9B 4R26L 5KBNC 4LSQL 1QLEH 3KPSA 1UEMA 1G84A 2QSVA 3FJTA 4RA0C 3G6DH 1WSST 4HUXA 3HTLX 4X7SH 3T0EB 4KI5F 3RIAF 2FEDD 1LE5A 3QUMH 3ARFD 1JHTA 4XI5D 5GGQL 1I1FA 3A6CH 3QUZB 2W38A 1KPVA 1R0AL 2VKXA 4DKFL 3MXWH 4KZDL 2HJFB 1JMZA 3NCBB 4WI7A 4E41D 3AS1A 4PGDB 2YPLA 5IMOB 5MEOA 3GRWA 4HZAA 1KIPA 4P9HL 1EFXD 2PW2A 3I02A 4Q2ZB 2MHAA 5D7LB 1FDLL 2WBKA 3ZDZF 1I1YB 4YHIA 4DOHE 2BNUB 4NRYA 1RVFL 3I3DA 2DQJH 3BZEB 1BQUA 3HZVB 1T20B 2CRZA 2GEEA 4Z7UF 1IAIM 5JPMA 5L6YL 4U7MA 3QEQB 4YFEA 3QCVL 3FN3A 4ESKA 4NM8H 4X7CC 3S37X 5IIEB 3OAYH 1JPST 4GG8A 1F90L 3VWKD 4HXBL 4HWZB 5HHQB 5C9JA 3RWGB 1KJ2A 4LKCB 1QYGL 1ZV5A 1ES0A 4QHUB 5JNYA 1MIEL 2YUXA 2HT4C 3FO9A 3EYSL 1OL0A 1U3HC 1VERA 4MJ2A 3WBDA 3DGCR 3N1GC 4YIQA 2EDWA 3M8OL 5BJTA 2EEDA 4FP8L 1RZIA 3IDNA 3MJ9L 3PGFH 5BVPH 4Q6IC 2XACC 5I1JL 4L8CA 1T2JA 3VRIA 3MUZ1 3HUJB 2D03L 2DKMA 3EYFB 4HH8A 4LSPL 3ZE0E 1KNOB 2HFFB 4FS0A 4M5ZH 2QQLH 4LIQE 4UV4H 5FF6B 3RVXD 4D0BA 3HS0B 4HIHA 4FFZL 4J3VA 1HXMA 3H0TB 2XWTA 1ZVSB 2D4FA 5F7DB 2PKDA 5CP7B 4ENED 4XVTH 1WT5C 1IEAA 3I75B 1YEEH 4ORZC 4FMKA 4PRIE 4NZTH 1DQML 1OAYL 1Q9LA 1U8HB 2UVEA 1MHCA 4ZAKB 3D3VB 3VFOA 5FEBA 2H26B 5EOCL 1I7ZA 1JZ5A 5D2LA 1A7PL 2WINA 4MAYA 1NGPL 1P5UA 2X42A 4TSAL 3NCJH 5IQ9B 4X5XA 4W4OC 5F9WC 1QSEE 1YNKH 5BRZB 3UC0H 3T0VA 4C55A 5E94A 3U4EB 3ARQA 1BBDH 2K9UA 2HMIC 2P8PB 5H37G 1VKXA 5SWQB 4QGTA 1SQ2N 2EDYA 5FA3B 3GFUA 5FGBA 4MJID 1KB9K 5LQBL 5DHVH 2ZSWB 1U8NA 2IBZX 4B50A 3V5DA 1X44A 4HUVA 2DQDL 3FQRB 3HC0B 1TZIB 3CVIL 3FO0L 5KOVC 4XXCC 1B0GB 2H1PH 1A1NB 2QQNL 4F58L 3PDDA 4U2ZA 4HIJA 3ETBF 1PKQE 1LO0L 4L9LB 3TT3H 2EDNA 4CU8A 2EH8H 3GSQB 5C0BE 1X5GA 1FE8L 3VFMB 3BO8A 5KSAD 4ODHL 4G8IA 5GS3A 1UACL 1ZVHA 4LQFL 5MEQB 4HS6B 2IAMD 1R3JA 4JLRB 4N5UA 4KROB 5IMMB 2X4TB 4L4TE 4OZ4B 2BVUA 2HTLD 5E9DA 2EE9A 1CDGA 1CFNB 4LF3A 4NFCA 1GC1C 3DO3A 1QVOB 4X5WA 4HUKB 4LCWA 3IU3A 5E8PB 5JORA 4OM0H 4Y5VA 3FONB 3S97C 4JG1L 1AC0A 3EYSH 2GFBA 4Q9CA 3BQUD 1CT8B 2A77H 4WV1C 4LCYB 3BWAA 1J12A 1T0MB 3MRDB 4KKAD 3BI9X 3O3AA 5EBGA 3CDGB 4XNYL 4LLVB 5SWZD 1MWAB 3NIFF 4IRJB 4QY8A 3HG1A 4X4YB 3FQUA 1CDYA 4PJHB 5D5ME 4XH2B 4DK6A 3SDDB 2VWEE 4GT7A 1O7SA 1WWBX 5CP3A 1EHAA 4JRXD 4Z7WE 4B41A 2P43B 2JE8A 3FFCD 4LVNB 2X44D 4NQCD 1JRHL 1RHFA 4RWHA 2H9GB 1EAPB 3K46A 4UBDC 4S0TD 4BUHA 4RIRA 2R1YB 1YUHB 1C12A 4N8CL 5IEHA 3ARGB 3L1OH 2JJUA 2GJZB 3UTSE 5L9DL 1NMAH 1NLBH 2VXVL 4MXWH 4HDIB 5E6IB 1R3LA 3KLSA 2CXGA 3B3IA 2XKNB 4FTVA 1AH1A 3T0WA 1T7XA 1K85A 3N1FC 4WHDA 1FFRA 1X5HA 4PG9A 4DZ8B 5EA0L 4OFKA 4OD3L 4EVNA 4P23A 3OV6A 1J1XL 4TPRL 4G6JL 5M95B 3P9MA 4IRZL 2DLFL 5F6IC 3DV4A 4K7PL 4CMMA 2KKQA 2GSIB 2AKRB 1MCKA 1TITA 4JPVL 3E6HA 3ZYIA 1AQKH 4LSDA 3RZWA 2OSLB 1BD2E 5EZLB 3DXAA 4FZEH 4WWID 2VDLL 3WFBL 2CDGA 4OB5H 4NDMB 3L3OA 4PRNA 1TQCB 4GAGH 1A9EA 1YYLH 3CVIH 2WQ8A 3FB6A 5CFHA 4DGYL 3LD8C 2JB6B 3D25B 2V2TA 1KCUL 2Y7QA 5TPWH 3RZCB 3VFGH 3F5WA 2EDRA 1HH9B 4LLUB 4QF1B 5DLML 5EPMA 2Q8AL 1NDGA 1OGTB 4YK4B 1J1PL 3JBG7 1FE8H 4OFIA 1F4XL 3LMJL 3QXAB 2WBJD 4WGVB 5IVZB 5BS0E 4XP6H 1MHEA 3O11A 4JDTL 5ALBL 4NKMB 4LARH 4L8DB 1XGTA 4R0LC 1FVEA 3SE9H 2DD8L 4UILL 3DMMD 1KOAA 3CFKB 2QHRH 3OMZA 1WTLA 1EX0A 1P4IL 4LPCA 4OGZA 1DVFD 3H3KA 1QRND 2DIAA 1R24A 4FQLH 5HGGS 2A6KB 4P46D 5C8JB 3EHBC 3VXSE 1RU9L 4P3WA 4AQOA 1S7QB 2Z0BA 4OZGA 4C4KT 1FSKC 4L3CB 3INUH 5C0JA 4U1JB 4X4MA 4LHUB 4UT9L 3STLB 2XTJC 1S3KL 2HA1A 1NSNL 4PG2C 4FA8A 1G7MB 1I1AA 5JO5A 3JUYA 4N0FB 4F7CB 1NEZG 7FABL 1ZK9A 4F7PA 2VZTA 5TDOB 3N85L 4PRIB 5E8NA 2FEEL 5JHDA 3ULVF 1KF9B 4AM0A 2QEJA 1HE7A 4M61A 1ADQA 5I1HL 5D1ZC 3VGHA 1WBXA 3H3PL 5GJTH 5ADPH 2CLZB 3LKQA 2C1PA 3HE6B 1A6TB 3V6ZA 1U42A 4NZRL 5IB4A 4MX7B 1I75A 2E3VA 5E1AB 4M8QA 1S7SB 1EXUA 2Z8VC 5J06A 4QRRD 4Q9QL 4F80A 2NY2D 3ULVD 5ISZE 4XBGA 4KC3B 1YEGL 4OKVA 2BX5A 4L5FH 3VXPA 4F15C 5E0QA 4CADB 3M1BB 4XPGL 2IG2L 5C08E 2XRAH 1OWWA 2GKIA 1WBYB 5AAWA 5KVGH 5EA0H 2FSEB 2YN5A 4UTAH 4JDZA 2BJML 3RNQA 4PJGF 3OKDA 1CR9L 2AEPL 4OCXH 4K07A 4G80B 3VXRE 2DYPD 1YY9C 4JKPL 4GQ9H 2EE6A 4YDVA 5HDOA 1WBZB 1RZGB 2IBBA 3OQ3B 3WFCL 1PKQB 4HIEB 1OAQL 2Y9RT 5C0IB 5C0BB 43C9A 5D93C 3UTTA 3STBA 1B4JH 1HKLH 4FMFA 4W70A 3PL6C 3V4VL 1W8NA 3QWOA 1KJVA 5EU6D 1Q8MA 1MVUA 3AB0C 5C07E 1A6WH 2ADIA 2BFVH 4Y19A 2CDEB 4L4TB 3ZKND 4JHZA 3NOIA 4P9ML 1YEDB 2R2EB 4B7IA 5IB3B 3O4OB 1P1ZB 4QRQB 5FUOL 1ZT7B 3QUZA 1NBQA 1Q1JL 3ZSSA 1NJ9B 4R97C 3OR6A 3QWRA 1JZ8A 1DBJH 4JZNA 4KQ4L 4F7EA 2CIKA 2Y6SD 1J7VR 1N0XL 4U2YA 4EBQH 3AS0A 5DYOA 2MQ0A 4PJ5A 3L5XL 1P9MA 3S4SB 2GW5A 4D9QE 4KK9C 4YAQA 1EHNA 5HDBE 1RULL 4M7JH 2HT3D 1NANI 1HIMH 4HKJA 4Q2ZA 1UKQA 5DD3L 4IMLA 2M1KA 5IMLB 5BVJA 3HAEA 3MRFA 5D5MB 1OAUL 1QSFB 2CPCA 4U1NA 4OCLC 1P84K 4Z7WB 3LN4A 2O5XH 3D85D 3G5VB 4QRPA 4YHKL 3MUGB 2ZOKB 5B3JF 1TJIH 5EU3A 5IBLC 3T1WA 3FQTA 3X14A 2BCKA 1A2YB 1YQVH 1RURH 5E2UL 3RTQC 3UTSB 3DSFL 3U2SA 4LVOC 1B4RA 4F9PC 2HKFL 1WZMA 3OPZL 1T3FB 5T33H 3HC3L 4Y4KB 4LLYA 3U7WH 4TSBH 5D9SA 1N6VA 3KS0J 1X6LA 4MB4A 1SEBA 4AJ0A 5FM5M 1JI2A 4X6DA 5CEZH 35C8H 3QO0A 4LKXB 5E99L 5MENE 1JP5A 1KC5L 3ESVF 4DGIH 1CXHA 2ERJC 3RL2A 4GMSH 3L5HA 2ENSA 3X13B 4YHML 1CDIA 3BIKB 1ETZB 2NMSA 3G6AB 3OX8A 1XH3A 1LK3L 1OB1B 3LKRB 2AV1A 5JQ6H 4KK6D 1BD2B 3RGVB 4L8BA 5I6XB 5IROC 3HE7B 5ID0B 3WN5B 2UZIH 3LKOB 3GSOB 4WHCA 3BKMH 2OR8A 3HRPA 3LEVL 5I30L 3KLHC 4Z18A 2VAAA 3FT3A 3RDTD 1T5WB 4LSUL 1T83C 5H94B 2F53E 3EO1B 3VWJD 2VIRA 3Q2CA 2BVYA 2N7BA 5BS0B 4YGVA 1WC7A 3V5HB 4G5ZL 5H8DA 2VQTA 2A74B 4KJPC 1YEJL 4WTXA 4MAUH 3FKUS 1KULA 4XCCH 4HT1L 3U4EA 3QDMD 5IV2B 5D8JL 5AAMA 3NH7H 4XVSL 4P9MH 3RUGA 2LV4A 3U1SL 4P5KA 3VXSB 4I48B 1WK0A 4QOKD 3WLWD 3ZZ1A 4QCIB 1Z2KA 2VZOA 4ZTPH 1F11B 1CBVH 1XR8A 4FQXA 4X6FA 5I74B 1RFDH 5IFJA 4Y8AA 1CTNA 1KN4H 1MAJA 3AAZB 2SEBA 3FHQA 3EYUL 2OR9H 1G7QA 5FYJE 1I9EA 4LPXA 1A1NA 5IGXL 3BE1H 1JGUH 1LVEA 4ZOEA 3V0AC 1EEUA 1C1EL 2BRRH 2V5MA 4Z0XA 2ZUYA 3X3FL 3QXVA 1AHWB 3MGAA 4LCIL 4ZDHB 3PP3K 4XB8A 1J0HA 2C3VB 2IH1A 1DQLH 3FMGL 1LNUB 2QADB 1MJ8L 3T65A 2JF1A 3FB7B 3QXUA 4ZXBB 2E27L 3PQYB 4Y2OA 5DURB 1S7UB 5I1IL 5KN5A 4XPHL 3B5GA 1Q72H 1WICA 4F7MA 4K3EH 1QFPA 2JB5L 1A3QA 4JN1H 4NPYA 3WFDH 1ZT1A 4UOW1 1JPFB 4JZJA 2C3HA 5ISZB 1B0RB 4YE4H 2VQUA 2J4WL 1KGCE 2GITA 2ZUVA 5TFSL 2NY6D 2QTEA 3C5JA 5C08B 1NC2A 2Z35B 4Y0GA 4R96B 5DJ8B 1KPUB 2PR4L 5LKNA 3B9VA 4OSUL 4I13B 2IH3A 3S6CA 5CZVH 2NQCA 1JUFA 2EKJA 3FHAA 5IVXA 2IPTH 4HK3J 4ZNEA 4NFBA 3SN6N 1KCVH 1T5XB 2M8XA 2XPGB 2ICCA 4OIIL 3VXRB 4U1MA 2O61A 3KPPB 4PJ8A 1O5DT 1S9WB 3NFSL 1NMCB 2K7PA 1EUTA 2QHLA 5H35A 3HNTH 3ILQC 4NQSA 4LRNH 4YHYC 2X5PA 5DEFB 2Q8BL 4ONFL 3MRJB 3O6FD 1LO3L 3FTGA 1J8HD 3GJEA 3VXQA 3SDCC 1EGJH 5DZNA 5C07B 4HV8A 4C59B 3ZO0A 3JWOC 1MQKL 2DQUH 1F3RB 3CGTA 4JVUA 5ALCL 1LDPL 1PGRB 4YEEA 1OF2B 5E8DL 4CUCA 1BPVA 1KENL 4JFFD 3JV6B 3NACH 5D7IF 3BPCA 1XGQB 1HDMB 1MCJA 5TQ2L 3BXNA 1I9IH 2VE6B 2FJHB 2DI8A 1QNZL 2NY0B 3HZYA 1J05A 3P11L 4IRSA 1VDGA 2GUOA 1X5FA 3MGTA 5GSRB 4UQ2A 4DAGH 2I9TB 3QXDB 4Y5YC 1MF2L 5T1KB 5DUPL 4D9RD 2EEAA 4OJFL 3JVGC 4LQ1A 4LLAA 1IC1A 1W0WB 5C0FA 3B5HA 2C4XA 3MRNB 1NCDL 2Q3AA 3F62A 4ZO8A 1LEIA 1Q0YH 3VH8G 4NZJA 3ZKSD 1IGTA 4OFYA 3P9LB 5DK0A 1YZZA 1MCNA 4UTBH 3QPQC 3WIIL 3C8KB 2X4RB 3TJEH 4IS6B 3FOMA 4Y4FB 5CZXD 5HVHB 3SCMB 3S5LA 5GGTL 5A2LH 3TPUA 3BRGC