4RFNC

Crystal structure of adcc-potent rhesus macaque antibody jr4 in complex with hiv-1 clade a/e gp120 and m48
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
210
structure length
210
Chain Sequence
VLTQPPSVSAAPGQKVTISCSGSSSNIGRSYVSWYQQVPGAAPKLLIYDTNKRPSGVSDRFSGSKSGSSASLAITGLQTGDEADYYCGAWDGSLNVHIFGSGTKLTVLGQPKASPLVTLFPPSSEELQANKATLVCLISDFYPGVVKVAWKADGNSVNTGVETTTPSKQSNNKYAASSYLSLTSDQWKSHKSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cocrystal Structures of Antibody N60-i3 and Antibody JR4 in Complex with gp120 Define More Cluster A Epitopes Involved in Effective Antibody-Dependent Effector Function against HIV-1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords HIV-1 CLADE A/E 93TH057 (H375S) GP120
total genus 38
structure length 210
sequence length 210
chains with identical sequence L
ec nomenclature
pdb deposition date 2014-09-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rfnC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4rfnC01
1AR1C 5AZEH 4J3XA 3PIQA 1I1AB 5GGRY 3SDAA 3VXRB 2DQGL 4M7KL 3HC3L 3EFDL 3LKQB 3DO7B 1IM9D 1RZGB 3U7WL 3ELAT 3VMOA 3I9GL 1PX4A 1JNNL 2AV7A 3BN9C 3I9GH 5EZIH 5AWNL 5TE7H 2DM4A 1KCVL 3TBTB 1FZMB 1DQJA 2MWCA 2XQYK 4YK4C 2PXYC 1S5HB 3HE7C 5EU6D 1RJYB 3QEQE 1R5IB 2FH6A 4H8WH 4NKMA 3P0YL 3D85D 4OF7A 3OB0H 1QOKA 2V7NA 4OQ1A 4TSCH 4LCCB 1DN0A 1X5YA 4PJDB 1Z5LB 4PJDE 4NJAL 5DO2C 5HJ3B 3B43A 1EJOH 2NY1D 3UTSE 3T2QA 1MHPL 2YSSA 4KQ4L 4BH8B 2J88L 3LMJL 5TGBA 4TSBH 3KLDA 5I6XC 2HMIC 2XZZA 3SKNA 5E00B 3QWQB 3HZVB 3GI8H 3OXSB 1BECA 5E8DL 3NPSC 2OX5A 4MAUL 2YKLL 1D7FA 2K7QA 4ZUWB 5EC1A 3GMMA 1KF9B 4ELKA 4ERSH 1JF6A 2X9XA 5CEXB 2OJEA 4U1MA 3LQAH 5IW1B 3R8QA 1CGUA 1JFQL 3BQUD 4HKZA 4I2XA 2LABA 3QUMH 1KULA 3SCMD 2NYYD 5IBTL 1YC7A 1RZKL 3WS3B 5BMFH 1IEAA 3IXTA 3SKOA 2OS7A 4NUGL 3NABH 4WHCA 4OFYA 3VU2A 5SX4I 5INCA 3C08L 1J7VR 4CL7A 2Q7YA 5GGVY 4PJBB 1IGTB 4FQ1L 1NFDB 4R9HA 3PQYE 1NGPL 4K2UH 4Z77B 4H8WL 2OSLB 1WC7A 3L5HA 5EA0L 4NZRL 3OGCB 5IEHA 3U6RB 4YXLL 3BQUC 4ZO7A 1PKQA 3CFBA 5JDSB 2MHAA 2EDFA 4PS4H 1EIBA 5GIRA 1S7VA 1ZTXL 3GHEL 3RKDD 3ZE1E 4OIIH 4ZFOB 3RA7L 3D1MC 4Q9RL 1P1ZB 1J1PL 1RFDH 2HYMA 1TVBA 4OZGE 3WUWA 3VA2C 4Q6IC 4OZGB 3DURA 3R8BB 4HWBL 5HYEA 1CGYA 2DQUL 4QXUL 4F7TB 3GMPB 5DS8B 3QRGL 4FFZH 1LK2A 4L9LB 2B0SH 1ZA3B 1LO4L 1TVHA 4IJ3B 2IQ9L 4LHJB 3LEXB 4HIHB 3PHQB 3VXNA 4G8GB 1MHHA 3GMRB 3KPLB 3A6OA 1G9EA 5F1IA 4BKLA 5DJCA 4EZMA 3U7YH 4L4VD 2EH7H 4CVWA 2VXVH 5A40E 4P4KD 1JN6B 3RWIB 2IF7A 2JCCA 3QO0A 5AG8A 3NZ8A 2PO6B 3STZA 5D2NA 4JM4L 3E8UL 2YZ1A 5F97E 5TE4L 5MEQA 2YRLA 3STLB 2FL5B 3RWFA 3BD5A 4C56D 2F54A 2LQRA 4NO3B 4YZFE 3D9AL 1BFVH 2VL5A 3G5XB 3O45B 4GXVL 3ALPA 3CVIL 4IRZH 1QLRB 4YBHA 5F7EL 4MVBC 1SJHB 3QI9B 4K7PX 1BFOA 3D6GA 4DKDC 4Y16D 3ME0A 3IFNL 1NCWL 4KY1H 2OR9H 2VH5L 2VN7A 3GMNB 1U8LB 3O8XD 2WSKA 5C09E 3UPAA 1QSFA 1SJXA 2VXSH 3WHE1 2HFGH 2KPNA 5BV7H 1DEDA 4EVNA 1CGVA 2BVPA 3V0VA 3EDKA 4PB0L 4X4MA 3FFDA 4UU9A 2V2XA 1H5BA 5DQJB 3W2DH 2G75B 5E8EA 2D7TL 4UT6L 5E8NB 4P9HL 2QL1A 4QT5A 3HN3A 1U2HA 2ZUUA 3BWUC 3AREA 2FR4B 1UWXH 4OLWL 3WS6A 5D5MF 5HYJD 4GAYA 4Z18A 4P46D 3QIWB 4OLEA 2D03H 1LE5B 1MCIA 1AI1L 3WN5B 4O58H 2FEDD 3QPXH 3CDGB 3FB7B 4PRBB 1OSPH 1YPZA 1UXSA 35C8H 1C1EL 5E5MB 4PJXA 2VDOL 1A7OL 1RHHB 3VXQB 3MPCA 1UB6A 4HJJL 1AFVH 1X5LA 2BNRB 3UJJL 4N0UE 5DI8B 1MWAH 4EI5D 2VERN 2NZ9C 2A77H 4N0UB 5GGQL 1KLUA 3QQ4B 3GSRB 3S7GA 4DKFL 5HYSG 4L4TE 4LFHD 2X4NA 1EK3A 1M4KA 1V7MH 5M7QA 3D3VA 4HIXL 3KLHC 1UB5B 4HIIA 5HVFB 5B38B 2JELH 5CZVL 2H1PL 3NPSB 4JEGB 1R0AH 3WJLC 2IAMA 4GKNA 4JFFB 1FFRA 4PGJA 5IEKB 4R90H 2D9CA 4ZS7L 4XRCA 1UJ3A 4R90L 2CDFA 3LSOA 5CZKA 2P5WE 3ARXA 3LB6D 4GLRH 4FFZL 3SOBL 1T6VN 2DTMH 5CUSH 5F7MC 4YJZL 1V7ML 1CGSH 2R29H 2MQ3A 2NQCA 1CFBA 5FYJH 5DTFB 4Y5VC 2VXQL 3CH8A 4CVXB 1Z9LA 2EIZB 1WAAA 2F53E 1KN2H 3SKJH 5JTWA 1EZVY 1CIDA 2R0LL 3WE6B 2A83B 2XXCB 5J11C 4OIBA 1MEXH 4MJ6B 3X12B 2CPCA 1TCRB 1I3RB 3TM6A 5DHVA 1VESA 5E2TH 4J4PD 5DJZA 4LRIA 1P4BL 5IGXH 3M17A 4WIQA 1BGXH 3DI2B 3U36B 3U83A 3AREC 1MCFA 3MLWH 3QWOA 2VZTA 5CP7A 1JPFB 4OD3H 3IRZA 5JA9A 4E0RB 4Y16B 5J4MA 4Q9BA 1B0RA 3Q3GB 2ID5A 1KXTB 3K1KC 1RU9L 2Z31A 4XWGL 5EIIB 3WLBB 4P5TA 1OAYH 5AUMA 5ANME 5TF1L 2RB8A 4DZBB 1T7ZA 3LIZH 3CSPA 3NN8B 1FGVH 5E4IA 1ZHKA 3ZTJH 5I16B 1EPFA 4R4FH 4UAOB 3EGSA 4GFTB 1ZANH 1B6DA 2VXQH 2WWKT 1JMZA 2XN9D 1CLZL 3DBXA 5DA0B 4F37F 1MY5A 4L4VB 1I7TA 1D5XB 2NY0D 5IB4A 4P4KA 5TQ2L 1HYRC 1P9MA 3NZHL 4ODXA 1DVFB 1A9EA 1NGXA 1HYSC 5GZOD 1MI5D 2LTQB 1QLEH 4HC1A 3EYVA 3ARVA 2EDWA 3S34L 4A6YH 3MGAA 1FAIL 1UEMA 4JN1H 5EBWA 4M7LT 2ORBL 2JB6A 2V6HA 3FHQA 5D9SB 3MRHA 1EVUA 1KT2B 1KIQA 5FHAL 1F4WL 2JTDA 3BUYB 3JWOC 3QBTB 1XF3A 4YUEL 2C4FU 4HF5L 5ESVB 3UTTD 4BK5A 3D25B 1AGEA 1RZ8A 2VNCA 4AEHH 1QQDA 5IJKA 3KPQB 5FDWA 5J8OA 2VDKL 3O2VL 4Z5RB 5HHXL 1QSFE 4YZFF 5HHPB 2W59A 4JVWA 4LVNC 3NH7L 4F33A 3ARWA 4F7EA 1NAMH 5I1CH 1L4IA 2VZOA 2YD7A 3P73B 2MJWA 1Z0MA 4MA1B 3D2UA 5I17B 3FO2B 1NL0L 4OLXL 1XIWD 4XX1G 5C0EB 4Z78B 4PJHB 1S9WA 4NKDA 2BFVH 2EDJA 1FG2A 3QDME 2R56L 4J4PC 5HGAB 1JZ4A 2UWEF 2QBWA 5C9JB 1GZPA 2CK0L 1QKZL 2OTUB 1CR9L 1VA9A 4PGZA 3FB8A 3F12B 4NCC1 1U0QA 1TETL 1WGOA 4NN7B 4TUKL 3BGFC 3L3GA 1ZLUH 5L2KE 5I8CA 3RPIB 1UVQA 2NXYB 5F1KC 4R8WL 3KG5A 1VKXA 2YRPA 4R3SB 4X6DA 1RK1A 4YHIB 4M1DL 1XZ0B 1R5VA 1EO8H 4U3CA 3U82B 3JUYA 2O26U 3C08H 4YHYB 3HPLA 3O4LD 1TENA 3KAAA 4XP1H 1CLCA 4JB9H 3MLRL 3FOMB 1FYTE 1CXIA 4S2SA 1WTLA 5DUBB 8FABB 3BRGC 5J6HA 3S98A 3PWPB 3AS2A 4DAGL 5E2TL 1FPTL 4RX4D 5L2JA 5H35A 3TN0A 3LVEA 3CVHB 4KH2A 3V6OA 4GXUN 4APQD 3L95B 4YHZH 4KK8D 4J1UB 5AYUL 1NCBH 2BVOA 1S7SB 4WENB 2YKLH 5BOPA 3JWNC 3AROA 2YPLD 1G9ML 3D69A 1TTUA 3QNXA 5IBUG 4GG8B 5C0AA 1QFWM 4XVJH 2Q8AL 4RAHA 3LMJH 5ADOH 5EOCJ 3Q5TA 3RVTC 4PJIF 1NGYB 2E6PA 3H7BB 1YNKL 5ETUA 4HUXB 4R0LC 3DSFL 2XWTA 4RFNC 3CX5K 5FXCH 1L9MA 3RUGE 1KCRH 4PR5A 1CFNA 4GW4B 1QEWA 3EJZC 3MLSL 5C07E 3MGOB 5DR5H 4A6YA 5IB1B 1IQDB 5JLZB 3FT3A 1WTGT 4MD0A 1NL0H 1DUZB 1IGML 1FZJB 2X1WL 1MCEA 1G7PA 1F4AA 5F3HA 4ODVH 1J8HE 2J2ZA 4ZFFA 3CD4A 1I4FA 4LSSH 1MWAL 4KHTH 4GJTB 3DV4B 5DQ9A 3LKQA 1T7XA 4ZXBC 1RZGA 4PYGA 1YNTB 3Q0HA 1T1XA 5FECA 3DTXA 2IPKB 4NZTL 2AV7B 2VDQH 4MXQC 3TBTA 4WWKB 4DAGH 3FAWA 1DQJB 5DHYA 3FQXA 3RZCC 1MHCA 5IBLD 1OAQL 4HX1A 4NKMB 4U1NA 1CDIA 2B5IC 4MXVE 3CVIH 4IRZL 4Y4FC 3D18A 3C2AH 5E1AA 1T22B 3QUYA 5DZOA 2DL9A 4OB5L 1DN0B 3LDBB 1K8DA 2IANB 1Z5LA 3JTSB 4U0RB 4JZNA 4TPRH 2X1OA 2YSSB 3ARBD 3FT2B 3O41A 2ARWA 1K85A 3L3OB 5L88L 4TUOA 4WFED 7FABL 5E00A 2VAAA 1KN2L 5I1HH 2VUOA 4ELMF 1X5KA 4QNPE 4ELKB 5EU7E 1U3JA 4DJMA 3ROOA 1HINH 3TGXA 4YIQA 5IW1A 2Q6WA 5FGSA 4JHZA 2EE9A 5H94A 1W8OA 2CLRA 3BP5A 2VLLB 4H1LA 4RGNE 4HKZB 1JYVA 3L3KA 4N1CA 5E24E 1XGYH 1RAMA 3ZYIA 3BO8A 2RHEA 1IEAB 4JFPB 4I4WB 5DEZA 4LIQE 4TSCL 1I1YA 5GZND 3T0AA 3BDBA 4LPVA 1KPVA 2FATH 5FCSH 3G6DL 4P5KB 1GSMA 1IC4L 1HKFA 3BUTA 4HIXH 4PJBA 3OWEA 3E6HB 2MPAH 3NCYP 4Z77A 5IFAH 1RZJL 2AEWA 2FIRT 3B3IA 2YXMA 1WZ1H 2Z8VC 3SKJL 3OGCA 3HMWH 4L3EA 1BLNB 1TFHA 3QEQB 4AZ8A 4MYWB 4PJ5E 1PKQB 3CFBB 5JDSA 5IHUH 4MXQD 3UYOD 4N0RA 3QI9C 1ZLVK 3NTCH 3QNYB 2ZUXA 2AK1H 2FEEL 1NBQA 3P4NA 1DQLL 2AI0H 2ZUSA 4ZXBD 2AJSL 4FHBD 5KS9A 3RY4A 3GSWA 3F5WB 2P5ED 1E4JA 1XGUB 3SDXA 5ALBL 4GRWF 1CICB 4M00A 3DHJA 5IHUL 4CADB 2PYEB 4PLKD 1DLFH 5KSUA 1AGDB 1N4XH 3MYZA 3V7MA 4YE4L 1F2QA 1DE4B 5MI0C 4PB0H 5I1JH 3PHQA 5L88H 3R4DA 1MHHB 4G8GA 1DVFC 5DJCB 1FGNH 1BOGA 3CMGA 2NNAB 3MRGA 1R3LB 1F00I 1JVKA 3QO0B 3MR9A 4K7PH 5BS0E 5D2NB 4Z8FH 2J8UA 5DD1H 3W0WD 2FL5A 1FL6A 3ORJA 1CU4H 1NC2B 3VD4A 4NO3A 4PJCF 3V0AC 1H3GA 3ARFD 3G5XA 3O45A 3DVGB 3K1DA 1J88A 1KG0B 5HGGS 3V6OC 3WL9A 4MLIA 5K9JH 3CFCH 3GRWH 1E4XI 4K7PL 2GCYB 1YECL 4L3CA 1DQQB 2VMFA 4XPAL 2NY1B 1U8LA 2LE9A 4Z7VE 2FNBA 3HPJA 3B2UC 4WGVB 1D5BB 4D9LL 1R24A 5T1KA 3TO2B 3LKNA 2DLFL 3C5ZB 1KYOK 4UZGA 4P59H 3D39E 5DURB 4EXKA 1PLGL 3L3JA 5EG6C 2GITB 1SY6H 4UU9B 2JF1A 3B9VA 4OGZA 1S9YA 5F9OH 5L0QC 1F4HA 1G0DA 4HS6B 1K4CA 2R2BB 4NO5B 1A6AB 4UAOC 4L1HA 3AREB 2VKWA 5CZVH 5TQ0L 3IDIB 1ZT7A 3BZ4B 4D9QE 5D8JH 3FQWA 4X9GA 4X9FA 3T04D 5J9PA 4I13B 1GHFH 2BK8A 2WP3O 2OMNA 4QO1A 5DEFB 4JCLA 3SGEI 1YPZB 3MOAL 1T0PB 2CUMA 3VXQA 5MEPA 4GBXA 5EOQH 4FQJL 2R0WL 1RIHH 1S78C 4OSUL 4M6NL 3H2WA 4PJAE 1MCOH 4M7JH 3IFOA 1LE9A 1TQBB 1S7QA 4HZLB 2X4NB 3Q48A 1N64H 2CKBH 3O6FB 1UB5A 1T66C 2EDQA 1VEPA 3MJ6A 1CXEA 3C60A 1YYMH 4NUGH 5KSBB 2IAMB 4GKNB 3WFDH 4V1DA 4XRCB 1LDPL 1XGPB 4L8SB 3ARED 4WI9A 1ZEAH 4Z7UA 5DJ8B 3ZO0A 1X6LA 1D5ZB 3WFZA 4YNYB 1T7WA 2DIAA 4MAYD 2YK1L 2WWMC 1Z0NA 4PJFE 3L9RB 1AE6L 2CRIA 3DJ9A 2BMKA 3ZLQC 1Y6MR 4F3FA 5FB8B 1DBJL 5INDB 1TTGA 2DIBA 2CDEA 1RZ7L 1X5ZA 5HI3C 3CSYA 4ISVB 4MHHI 5C2UB 2AJVL 2DM3A 4LRNH 2R56H 4XNXL 2XOTA 1LO2L 4OJFL 2CUIA 1C8PA 4OT1L 2C9AA 2HFFA 4N1HB 4K8RC 4U6TA 3X12A 1IAIL 4MA8H 3T0BA 3LV3A 1KCUL 5FF6B 2VKXA 4Y2OA 4YX2L 3T09A 1G6VK 1OB1A 1WWAX 3P9WB 4GG6A 1ND0B 4HUWB 5DJYA 1G7LB 3BH8A 1EO8L 1QYGH 4GQPH 3OJVC 1B0RB 1BX2B 3Q3GA 4CU7A 4G5ZH 2Q76A 5EOTA 5F7NC 4GAGL 3OAZH 1ZLUK 2QJDA 3ARUA 1CXFA 1GL4B 4PGEA 4EIZC 4FQLH 4EI6B 5ITFB 4LMQE 4WFFE 5I16A 1QPXA 1A4KB 1YNLH 2EDNA 3BQUA 3BMWA 1J8KA 2JJVA 2AABH 5BVJA 3EGSB 2NR6D 3EDEA 2R4RL 5DMGD 3QG6B 5IW3A 3BI9X 4QRSB 3DBXB 5CGYD 1I7TB 4PY8I 1D5XA 3HAEB 1L7TH 1K3ZA 3S37X 1HCVA 4Y8AA 1E4KA 4X7TB 5I9QB 5C0BD 1A9EB 1NGXB 2AJZA 4ENED 3PWVA 1NJ9B 4OCNC 4HC1L 1MFEH 1BD2D 5EBWB 2KUTA 1F3JA 1Z3GL 3ARGD 2NXYC 4O2FA 2JB6B 2DQTL 4WU5B 1XR9B 3MRHB 2QQLL 3F7PC 4ONGH 4KVCH 4ZXBA 2CXGA 3KJ4C 5HVGB 4OCYH 3TO4B 5K59E 1WF5A 4FXKA 4JZJB 4ONOA 4EDXA 3KPQA 5FDWB 1R6VA 2YD9A 4NCC2 4G8IA 5HYJE 3G5ZB 4Z5RA 3TN0C 1BREA 5IP4A 4PLNC 3CXDH 4G8FB 3OKEB 1H3PL 4DN4L 4F33B 5C1MB 2HTLC 5IV2A 1KPUB 5CEZL 1VGKB 1MHEA 3UZQA 1UENA 2R69L 4ZD3L 5I17A 4PJ7E 4XXDB 4JPKH 5C0EA 4PJHA 3VWKC 3QDGE 1FG2B 1YZZA 4KK9C 4G7YH 3M07A 2ZSWA 3C6LC 2AK4A 1A1OA 4LAJH 5I1LB 2LVCA 3QFJE 4UIMB 4YFDB 4R97C 5C9JA 5JPMA 1GGBH 4Y1AD 3FB8B 2H8PA 2EZ0C 1DANU 1A6UL 3OKLA 2A1WH 3OMZA 3N0PB 3MNVB 3RPIA 4WTZA 5T3XE 3UTPE 2J8OA 1YEJL 4QTIL 5EFIB 1BM3H 4NNYB 2NR6C 3O0RH 1OCWL 1YYML 3WDHA 4Z7QF 4EOWH 4MA7L 5DMKB 5I1DA 4ZNEE 3HPLB 2CXKA 1KELH 3ABZA 5I1GL 5MERA 4QLRA 3AM8C 1BP3B 3GO1L 1NKRA 1WIUA 2ESVE 5DUBA 8FABA 3CIQA 1A6TB 1L7IL 3PWPA 3QCTH 4Q9QH 5DUPL 1A21A 3CVHA 3UX9B 5D7SH 2PTTA 4X80L 2BVOB 2E5EA 1SBSH 1S78D 1CG9B 5SWSD 4JDTH 3TZVD 5F8QC 3AXLB 4I77H 4TQEL 5CIPB 3F65A 1AH1A 3UYPA 3V9FA 1YJDC 4GW5A 1NFIB 1CDYA 4QF1B 3V4VL 5HYIA 4HWZA 1JV5B 2F15A 2CIIA 1CFNB 2VAJA 4GW4A 1F90H 2H45A 4XVTH 2BDNH 1XGTB 4N8VB 4P23C 1G7PB 5F3HB 3WXVL 3OPZH 3S96B 1LO2H 2CR3A 3RDTD 3H8NA 2VDOH 5EUOF 2P5EE 2PYFA 3DV4A 5DQ9B 2KZ1B 1YNTA 4KI5C 1F3DJ 4BFGA 3DTXB 4LAQH 4UTBH 3PXJA 2ITDA 4J3TA 5I30L 4XBGA 4WWKA 2HKFH 5IMMB 1WCBB 1KTLB 4O2EB 3VFGL 3ULUE 4I0PA 2XTJB 4P46C 3VFUA 1V7NH 1J5OL 4P2QE 1CU4L 5GJSL 1KB9K 1CVSC 4QXGL 5DD0L 2GY7B 3RWDA 5FCUH 2CKBA 1CQKA 2OXHA 3QIBA 1W8NA 3ULUL 3L5XH 5EO9A 3RTQB 1JHTB 3K8MA 3GSNL 4PJIE 2J12B 2VLJD 1KJMA 2ZOLA 2IANA 4HZAA 4DWHA 2GFBB 1NDMB 3MYJB 4LBEA 2IFGA 1DBBL 4ZUUB 1ZT1B 2Q7NA 1U8JB 2AP2A 4JFHE 2PW1A 1QNZH 1YMME 3O41B 2XWJA 4M93B 2BCKA 1PG7W 1T1ZA 3GFUA 4XI5C 5F7UA 3Q1SH 4WEBH 4ODHL 1EEZA 2N7AA 3MCG1 2EH8L 4Y4FD 2D9QB 2EE6A 5DK2B 3TNNA 1NKOA 4DUXA 3T4YA 2NY1C 2ZUVA 2WBJC 1CFQA 4TOYL 1NMBL 1CCZA 4KQ3L 1P2CB 2D0HA 3QEGL 1LO3L 2YZ8A 5DJ2A 1JK8B 2Q6WB 5CILL 2M1KA 2CLRB 5D5MB 3HB3D 1SEQH 3FOLA 4XC3H 1N26A 4KVNL 1JNJA 1CFSB 1U8OA 4GUPB 5EOCL 1I1YB 1HHIA 2IFFH 4QRPD 3N9GL 1ZVSA 3BESR 3RHWK 5I2IA 3IXAA 4WO4A 3RUGB 2RFXB 3RY6A 5I1AA 1MREL 1MLBA 4WTWA 4A2MA 3DUUB 5JW4N 3ESUF 5C86A 2ZUQB 4UMGA 5DJXA 4ZS6D 4G5ZL 3TBSB 4G3YL 1S8DA 4DGIH 3QEQA 1IFHL 2XIDA 1T0MA 1YEHH 1IKFH 3QI9D 3OXRA 3QNYA 3BFOA 3P4NB 4E42A 1JHLH 1A64A 5KS9B 3K4AA 4RAVA 4NQEB 5LBSL 3T1WA 1LP9E 1U36A 1XGUA 2ZCKL 3RNQB 3ZKMD 2FJFA 1QFWI 2MMXA 1S7UA 4Q6IA 5FYJU 5T3XL 5I1HL 1A4JA 3RKDC 1CICA 4XP1L 4HK0A 2DWDA 2PYEA 5KSUB 1T0NA 5GZNC 4FNLH 2H26B 5MEOB 3H9HB 2BNUB 1DE4A 2I9TA 4UILH 4C59B 4EDWH 3BGMA 1X9QA 4LPCA 1M7IA 4L9LC 1CVRA 4MQTB 4FP8H 4P4RB 1MQ8A 5DRXB 1OTSC 3P0VL 2NTFB 4NM4L 4KJQC 4O2CA 5B39A 3SCMC 3WIIH 1FL6B 1L6XA 1UJTA 4NIKB 4UV7H 5D1ZB 1YEIH 5IIEA 4P3CL 5EU5B 1NC2A 4ZUSA 2R0KH 1I1CA 1B6UA 4WFGD 3UDWC 1GAFL 5D2LE 2YD8A 1NH6A 5FGBC 3DVNA 4R6UA 5GS2D 5HDLA 2V7HA 1KG0A 3BIKB 4LSQL 2UZIH 4MX7A 4PUBL 3S3PA 4JKPL 4W6WB 4NNXA 3ETBF 4C55A 3T8XB 3V6FA 5K9QG 1FC2D 4L5FL 3A67H 3WFHB 3QDJD 3HPJB 4XAWL 2ARJA 5KJRH 3PWNA 4Z7VA 1D5BA 3MLXH 1A2YA 3LKNB 5D2NC 1I1FA 3IDJA 1KB9J 4I3RL 1PZ5A 2Q86A 1FHGA 1C08A 2IQ9H 4LGPB 3BP7B 5GGUB 5EOCH 1OTUD 3VXME 1OD9A 4XBEH 2PCPA 4HQQL 4JPWL 3S3SA 4L8CA 1C7TA 3MODH 3UTQB 3BPCB 5HHVH 1P7QB 4KTYA 2R2BA 3D0LB 3HNTL 4NRXA 3V5HB 4HPYL 1V7NL 3ARBC 1FAKT 1DLHB 1I3GL 3LS5L 1C5DA 1LO5A 1ZS8A 2P1YA 5AWNH 5TE7L 3FMGL 5GS2H 5A2LH 3PP3H 2P24A 4X9HA 1FNEB 1S3KL 4LPTA 5KN5A 5GGSY 4HFWA 5CINL 2B7DT 3TCLB 1IGCL 4M62H 4Y5VB 4G6JH 1DTUA 1E27B 3WUWG 5F1OB 4XXCA 1HHKB 2X4PA 5FUOH 3RNKA 4IOSD 1LE9B 4LCCC 2ADGB 1UADC 4HZLA 1S7QB 3QUXA 2OJZL 1ZGLM 1CBVH 2EIDA 3O6FA 4XNYH 4P2RD 5JZ7C 3KNBA 2VQ1A 2GK2A 1KCSL 1JPSH 3TIEB 1RZKC 3C60B 4JO1L 4HUUB 2VABB 1KCKA 1FO0B 1FVDA 4OB5H 4DGVH 3RX8A 3D0VB 1ZSDA 3WJLA 4Z7UB 3SDDD 1D5ZA 2DRUA 4Y2DC 4Z7VF 3CLFH 4F3FB 3KYKH 4M93C 1CR9H 5FB8A 4AENB 4M3KB 4L29B 4GQ9H 4MJ5A 2H6PB 4HS3B 5EIVA 1A0QH 1BVKA 5KVDH 2WNGA 3LN4B 1MLCA 4Y4HD 1RMFL 4PJ9C 3ZDXF 3EFFB 4FFWC 2Z8RA 4JFEA 2XQYG 4Z7WA 1DBML 5DLML 4EI5C 4X6EA 4Y19E 4OBSA 4HQQH 3LV3B 4YDVA 5SWSB 4KK8C 3OG4B 2DQDL 1NBVH 4N8CL 1OB1B 4X6CF 1ND0A 3SHSA 4X4ME 5SWQA 1T1WA 1MREH 3TWCH 1BX2A 5EOTB 3TH4T 3QXWA 3CLEH 4JVUA 1J10A 1NANI 4U6YA 4L5FH 5D7JB 3L7FA 4XMPH 3OF6D 3V6ZB 5J06A 2ESVD 4JO2H 2F74B 4JAMB 5J1TC 1QFPA 1NBVL 1J1OL 1GOFA 3IGAA 4J23A 4N8CH 4YPJA 1FZOB 3MBEB 4FZEL 5E5UB 1MIML 4FQCL 1QLEL 1MVFA 3C6LA 3GKZA 3PF2A 3P9MA 4QXGH 5DD0H 4CW1B 5DRZA 3G04B 4KKBD 4I0KA 3EUUA 4GRLB 3HAEA 4FFYH 1S9XB 4RFOL 4N5UA 4EBQL 3ZYJA 2AJZB 1ZANL 1J87A 5JXAH 1JGEA 4M1GH 1NJ9A 1FZKA 1YEEL 4WW1A 5DD1L 4PJCA 3VFSB 1Q8MA 2QKIA 4RNRA 4W6YB 3D3VE 4O2FB 3WXVH 1XR9A 1R3KB 2NY0C 5CHNA 3B8YA 4WDIA 3CDCA 1JGLL 2FX8H 1DVFD 3N85H 2BOCB 4XNUH 5GZOC 3TO4A 2O5YH 3HCVA 4XVTL 4HCRL 5E56A 4FXKB 4NSKA 1AKJD 5T1DH 1I8LA 2V2WB 5B22A 1I9RL 3VXUB 5DEGB 3IFLH 1N3NA 3V4VH 3I6KA 1M7DA 4AQ1B 2UWEA 3SDDC 2OJZH 3HUJA 3B2VL 3CX5J 1KPUA 1VGKA 4LSVL 3BJ91 3QAZB 1I1AA 3SDAB 5HHQA 1UFUA 4LLAA 2BRQA 1GGIL 3MLZH 1B4JL 4U1GC 4GW1A 4PTUB 3GHBH 3H9SB 2ZSWB 3S4SB 2DWEB 5I1LA 1FZMA 2EDXA 3ROLB 1ULVA 4JFYA 4D0BB 1WUNT 3ARSA 4K23H 1SEBA 3ZL4H 3CLEL 5D71H 5BS0D 4BFBD 4FG6C 3K2UL 1JWMB 4N9GA 3FZUD 3MNVA 4NC2B 3REWA 5EUOE 1RZFH 3LN5B 4LNVA 3CH1A 5DDHA 3T3PF 4DK6A 4NNYA 1MCWW 3QHFL 5DUML 4KC3B 5KZCB 1R0AL 5HJ3A 5DMKA 5I1DB 4JO3L 1OCWH 3O0RL 1A9BB 3BPOC 5TGBB 1JNHB 3IU3A 3OAYK 4O4YH 4LVHC 5MERB 3V0WH 5DLMH 4MDJA 5LGKA 3SE3A 1NLBL 1L7TL 4F37K 4MMXC 5CJQH 4DFIA 1JF1B 1F13A 3T2NL 5EC1B 1EEYB 1G0YR 3A67L 3GMMB 2X7LB 1EGJL 2XYCA 4FQXD 3GM0A 4MLSA 3O4LA 3ZDZF 4WV1C 2ED8A 1KIUA 4OFDA 3WNLA 3DYMA 1EO7A 1HE7A 3K8KA 4F57H 1O7SA 4LLVA 1XCTA 4I2XB 5B38G 2JJSC 1L0YA 3BJLA 1QR1B 2FZ3A 4HWUA 3VXRD 5CIPA 2XY1A 3SKOB 1NFIA 2GSGB 5C0GA 2VE6A 5INCB 4QF1A 2K3TA 2BC4A 2DYPD 4CN4A 1U92A 4YPGB 1J5OH 2CJUL 4OV5B 2OSLA 3CVHH 3K2UH 3WO4C 1D6VH 1QSVA 5IEHB 1FVCA 2JJTC 1P7QD 1E6JH 1MPAH 3NIFF 3SDYL 2B2XH 1S7VB 4OCLC 2MSPA 5MI0B 4JM2C 1ACYL 3OL2A 5DFWH 4LRNL 4ZFOA 5H8DA 5C7XL 2HFTA 3O9WD 3JSSA 1RZ7H 4LSSL 2ADFL 1GIGH 3WUWB 3H9ZA 4OZGA 3DURB 1JYWA 3QDGB 3U79A 5JHLH 4XWOC 4X5XA 1SMOA 4JHWH 1Z6JT 4F7TA 3KLAA 3HUJF 4XBGB 1ZWIB 4OCRH 5IVXF 2ZPKL 1KTLA 4O2EA 4I0PB 2HVJB 1ZA3A 5JIKA 3TVMA 1J1OH 2APBA 3I6LE 5GJTH 5JORA 4OQTH 4JFDD 4HIHA 2WINA 3PABB 4YH6A 4LLMB 4BSWA 4KRPD 3QIBB 5L7XH 5GS0H 4JY5L 3KPLA 5EIIA 3OJDB 5C08A 2R8SL 3NBNA 1EHXA 2X1XR 4QOKD 3RTQA 4HJ0C 1REIA 3THMH 1LWRA 1Z9MA 2FIKA 2F5BH 3MA9H 4RGND 2ZOLB 4D0CA 1JN6A 3RWIA 4LBEB 2PO6A 3STZB 1TPXB 5MEQB 2BNRE 2ZZUT 1U8JA 1FH5L 3STLA 2PW1B 1PY4A 5CS7A 2QR0A 3TZVA 5D7KE 1MF2L 2BCKB 1T1ZB 1ZKAA 3SQOH 2VL5B 4H20L 3HAEG 2WLZA 3T0EC 3BOVA 2X4UA 3IDXL 1QLRA 2ENYA 5DK2A 4WEMB 4ODVL 4P23B 4K7FA 1FAIH 4JN1L 1X5AA 4P49A 3T4YB 1IGIH 5DZLA 4HG4K 5IUSA 5L9DL 4P3CH 5ACZA 3L1OH 1X7QB 4JG0L 1P2CA 5DJ2B 1JK8A 3ALXA 1IVLA 1OW0A 4CN1A 1IAOB 5I8EB 3JBG7 2P48B 4NM8H 1CFSA 1QSFB 2ED9A 1CK0H 1I8IA 1OAZL 4GUPA 4LHUD 1OGAE 2HTLD 3SDYH 4JKWA 3FJTA 2YOCA 4UOW0 3FFDB 1IEHA 4U6XB 4GAGH 2O93L 1H5BB 5DQJA 2G75A 5I2IB 3IXAB 3MOBL 4WO4B 3RUGA 4PJHE 5E8NA 2DI9A 1MRCH 4P2CG 1MLBB 3FFCA 4QT5B 3ZSTA 5JW3L 3PP3K 4JKPH 4NKQB 1D5IL 5D1QD 1HZHH 4MB4A 4P9MH 1J0JA 3IFPA 4MNGA 4NHCH 3NFSH 3WN5A 3CFJA 4P3DA 2BFVL 3OKKB 5AAWA 4E42B 1ZGLP 1HEZB 2Z31C 1OD7A 5E5MA 1ZE3C 5EZJA 1RHHA 1A0QL 1UB6B 1KLGA 2VLRD 4WW2B 3S35L 3SO3C 1ZLVH 4OQTA 2PTUA 3CPLA 3QUMA 5L6YH 1S7UB 4Q6IB 2OTWB 5KSAC 4N0UA 2QQKH 4Y88A 1N6VA 4PGCA 1I7ZA 4YDLC 1T0NB 1XF4A 4HT1L 2Z4QA 5IVZB 3S8WA 4KZEL 2A2QT 1VACA 1D6VL 5B38A 2BNUA 2I9TB 2FJHB 4FNLL 2R29L 4NQDA 4P9HC 5IEKA 2WUCH 5FM4A 3RRQA 3KPRD 4NWUH 2XZCH 2CDFB 1WEJL 3LSOB 3QUKA 5TFSH 4UBDC 4JY6B 4U1IB 4ODSL 1CBVL 2OK0H 1HDMB 2NTFA 4U3HA 4UOJA 3DRQB 4BM7A 3C09B 4H0GA 5F9WB 1IGIL 4OF6A 3ULUF 5IIEB 5EU5A 2WUBL 5DTFA 4WI2A 3K80A 3FB5A 4QRPA 1IKNC 1UWGH 1QBBA 2V7HB 3BPLC 3RDTB 5D96C 4MX7B 4M9PA 5CAYB 1T2QH 5E9DB 1SHMA 4MJ6A 2P4AB 4YFLF 5DHVB 3DXAE 1LQSR 2AS5M 4ZPTA 2FB4H 1A2YB 3DRTA 2B1AL 1I1FB 4BSJA 5CP7B 1U8MA 5EN2B 1C08B 4HAGA 4PY7A 4Y16A 4XAKE 1AQKL 4MNQA 1S7XB 4P5TB 1KENH 3H9SD 3UTQA 1P7QA 3QXVA 4AL8L 4LLYB 3NN8A 4NRXB 5ERWB 4EN3D 3V5HA 3NZHH 3DXAD 4YQXL 2IALB 3FO1A 5JW4Q 5IB5B 1W0WA 1ZS8B 3TYGH 1KBGL 2P24B 3ZE2F 2GTWA 5IB4B 4P4KB 1A47A 3DX6B 2BJML 5CJBA 4KUCF 1GGCH 4LQ1A 5JMOC 3EYVB 1MFNA 1OAYL 2PXYD 5JHDE 1HHKA 1IGMH 1LDPH 3GMOB 4ZPVB 2NY5H 2AI0L 2B4CH 2ADGA 3F7YB 4DN3H 1T89C 4KRPB 3KNBB 1KIQB 3GIVA 3EDJA 4JO2L 3UTTB 3BUYA 3TIEA 4Z7QE 2A9NL 5HD8C 2OI9B 1XF3B 1U3HD 3QYCA 2GY5A 4I48A 5FHBL 3BAEH 2P49B 2DD8L 4E5XA 4JGMA 3S6CA 2W9EH 1EHNA 3D25A 1F6AB 1RZ8B 3N9GH 3JVGA 3MV7A 4QXWA 3SO3B 4OI7A 5SX5H 1ODAA 1RZJC 4ZG1A 2I26N 1G9MH 2QSCL 4QHMA 3D3VD 3O8XA 4JRWA 1FYTD 3VWJA 5HPMA 5HHPA 4OF0A 3TT3H 4AENA 2UZXB 3UJTL 3ARFA 4MJ5B 1OGAA 1U9KA 1BVKB 1IC1A 3V52L 5KG9A 5DQDL 3PQYA 3RVWC 1MLCB 4X7FC 4GMTH 3FO2A 4JFEB 1S9WB 2VTFA 3V79C 4UT9H 5D93B 4U3XA 1RUML 4LCIL 5AD0B 5HGAA 3DX9B 4LOUC 3GKWH 1GZPB 2OTUA 4OLWH 4RSVA 5C71A 1NFKA 1IFHH 2GT9A 1Z9OA 2YPLE 2C1OB 1HOCA 3HZYA 3JWOL 1U8IB 2E8YA 3L3GB 4X7SH 3D39D 3FRPG 3HG1A 3A6CH 4Y89A 3S5LB 4FOMA 4Y5YB 1VKXB 4OUOA 4KZDH 4X6DB 4Q0XH 1XZ0A 4ZAKD 5DSCA 3WEXA 5EUKB 3S3JA 4U6YB 2C4FT 2IPUG 1FO0L 4OZ4A 2WP3T 2HN7B 4ZSOA 3VJ6A 1FZOA 3MBEA 2IH1A 5EU3B 4Q9QL 4NFCA 4UI2A 4Z7WF 1L7IH 5FYKH 3C5ZC 2EYTB 5E2UH 1S7WA 4APQB 3G04A 5H35B 4MVBD 3SBWA 1S9XA 3B2UD 2HRPL 4KJYB 1X5IA 3L95A 1FNFA 2X4RB 1A7RL 3WJJA 4J1UA 5FEBA 2Z8WC 1S7SA 2F54E 2Y7QB 1NMCC 2YXFA 1FZKB 2XG4A 4WW1B 2NY7L 1HI6B 4XPGL 1E4XH 1IJ9A 5C0AB 1IAKB 4H5SA 3QEQD 2QKIB 4H26A 4YDJB 4P0DA 5E99H 3EYQC 4XPBH 5D2LA 4PJBE 2EDBA 3H7BA 3T4AB 4EQ2A 4L9DA 1PD6A 1BQLH 3HCVB 3KPRB 5JMRA 4PR5B 3E3QC 1QEWB 2DKMA 2VLRA 4XVUC 5CD3B 5JLZA 3FT3B 5ADPH 3QB7C 2YD4A 4HPOL 3I6KB 5E95B 2VN4A 3D39B 2ICWJ 4DZ8B 2YA0A 4M5YH 4HIJA 3HUJB 4X98A 2XKNA 4YDKL 1WAAF 1CF8H 1I4FB 4JVPA 2Y36H 1OY3B 4JRYE 3LHPH 5KVEH 5FKAB 1FNSH 1QA9B 1T1XB 4H20H 4PTUA 3H9SA 2IPKA 1U91B 4PUBH 4J6RL 4G6FB 2DWEA 2FEDC 2DI7A 4KKLC 4C4KO 4DUVA 3QHTC 1MFCH 4PP1D 3ROLA 4MAYB 4JFYB 4D0BA 2DQGH 1MHCB 2QSQA 1L9NA 1KJ2H 2O5XH 3H42L 1FE8L 3MV8B 4PIRF 4HX1B 2UVFA 4M7ZC 1VCAA 2R9HD 4U1NB 1YPZE 4Z9KB 1JWMA 4I8DA 3D18B 3FN0L 4N9GB 3WFBL 3SJVE 2EE2A 2R2CA 3QUYB 4KGJA 3RU8H 3THML 2V5SA 2E7HA 4R26L 3CH1B 5DDHB 2APWA 4OD3L 4PRPE 2NY0B 4LSTH 3OKOB 1CICC 3UO1H 3JV5A 1PYWA 3JTSA 3UJIL 2CK2A 4PJAB 2XI9A 3K46A 3I3BA 5C0FB 3MLUL 2I07B 3SBWC 3L3OA 1JNHA 3IU3B 3H6JA 4TUOB 4F7PB 4MA3A 4C58B 1F5WA 2VAAB 4YHYC 1N0XH 4MDJB 5EO0B 3N06B 3BKJL 1J0KA 1J1PH 1RFDL 3MRIA 2EO1A 1IARB 4UV4L 4D2NA 2ADFH 3CU1A 3T1FA 4CJ0A 1IAII 4IRJA 3I75A 3TJEL 1EEYA 4IRSA 2A0LC 2A0LD 4NRYA 2VWEE 3BPLB 4XZUB 5D7JD 2X70B 2BSSB 2Y6SD 5ICYA 5DC4B 4OKDA 3ZKXC 3BP5B 2VLLA 4LLVB 4GMSH 3L3KB 4HWEH 4P9ML 3CDYA 2VSCA 1QR1A 2FZ3B 4LCWB 4F9PC 4JFPA 1U8NA 3O6KH 2GSGA 5J1AB 1WFOA 3O6KL 1KPVB 2I5YL 2V9RA 2VE6B 1OVZA 1U6AL 4XC1H 4P5KA 3KVQA 4WNQB 1N7ML 2EKJA 4FQXC 3D87B 2NMSA 4YPGA 1RIUL 2IWGA 4UILL 1FE8H 4OV5A 4XT1C 1AHWA 2FHCA 4ZO8A 4HWBA 3GSXB 1P7HL 1FVCB 5JW4R 1Q0XL 4QHKI 3EIFA 5FGCB 4TUKH 1MFBL 3OBAA 3FMGH 4RCAA 5M94B 3ARFC 1PW3A 1MIEL 3QUXD 4UINL 1P9MC 3PWJA 4KU1A 3T65A 4L8SC 3EFDH 2VITB 4HMEA 3GSWB 3F5WA 1LK3L 2R2HB 3W11D 3Q6GH 4X6FB 4KQ3H 1T6WA 3DNKA 1QFUH 3MACL 1KFAH 3UTSA 5C0CD 2H2SC 4N0CC 3SDXB 4W68A 1ZWIA 4BQ6A 2ZUTA 1CDGA 4CADA 4LIQH 4U1HB 2HVJA 3UO1L 1AGDA 3TVMB 2J3SA 4RGOL 3NCCB 4YWGL 5K9OB 3CX2A 2WINB 3PABA 3MV8E 1VDGA 1TJGH 2RR3A 3BGAA 5C08B 1OTTD 3W2DL 5D7IF 3LIZL 4LCUA 2JE8A 1BOGB 4YHMH 3MRGB 3AMKA 2V5YA 3TIDA 5DMYA 1R3LA 2ZG1A 1CDHA 3MR9B 3ZL4L 1MJUH 1KC5L 2J8UB 3TZVB 1T20A 2NY7H 5BJTB 2QR0B 4Y4KB 3U9PL 2XFXA 2CO7B 4FXLA 5JNYB 2VOTA 2IGFL 2ZKHL 4LEXH 1F8TL 4Y4FB 1JZ6A 3FN3A 3MXWL 2VXTH 5C6TH 1BGXL 4IRSD 4WFGE 4BQ9A 3ARDB 1HIML 3BD4A 2LVEA 4K7FB 3WL9B 3SY0A 3BKCH 3LS4H 4LP5A 1GC1H 3NA4A 3CMOH 4WHYG 3RIFF 3DETD 1X7QA 4L3CB 3FQTB 1DQQA 3L5IA 4RA0C 2KQNA 3CFKA 3A0OA 3HMXH 4XNZB 3G6JE 3JWDL 3KPSB 3SPVB 5I8EA 3OR6B 5IFHL 4LHUB 1R24B 1AD0B 2D0FA 1TPXC 3U30B 5J11B 5IQ9A 3MBXL 3TH2T 1FL5A 4BZ2L 3WKML 3E1F1 3L3JB 4XVSL 5DD6B 4JDZB 1MNUL 4XP9L 4TVPH 2EYRA 3NIGF 1JGVH 2GITA 3QUZC 4U6XA 1S9YB 2BVYA 4AL8H 2FJGA 4JE4B 4QRTA 4RMRA 1DLFL 4X6CA 3FFCB 5JR1H 1K4CB 1Q1JH 4NO5A 1KEGL 3NFNA 5T33L 3IDIA 1YQVL 1IAMA 3IFNH 3FQWB 4MNGB 2IBBA 3CFJB 4P3DB 1JGUH 3QJFA 2YEZA 4HFUL 4HMCA 3OKKA 4M4RA 4UT7H 1HIMH 4DKFH 2EECA 3K74B 4LSRL 5AYQA 3S4SG 5IHBA 3VI4E 3O3BA 5EZJB 4PJEA 1KLGB 2K7PA 4WW2A 2NY4D 2Y06L 3CPLB 3QUMB 1ZTXH 1RUKH 3O2WL 3UAJC 2OTWA 3BDXA 3VRJA 3GMLA 4L4TB 2OZ4A 4FQHB 4JO4H 3RVTD 2AVGA 2XY2A 4PRIE 1PKOA 2C4XA 5DXWA 4U0QB 2Y07H 5I1JL 4FG6D 1F4WH 1VACB 4F15C 2FJHA 4NQDB 1YJDL 1QHOA 2ZSVA 2BOBB 4V1DB 4R97B 3OKMB 4RDQG 1JRHI 1XGPA 4L8SA 3QUKB 4JQIL 1MFDL 4BZYA 1CLOL 4KKAD 4JY6A 4U1IA 3HS0A 3OZ9L 1AGBA 4DGYH 3SGKC 1WEJH 4YNYA 1HDMA 1NGWA 4LSUH 5C09A 3H3PL 3U1SL 1MNUH 4XP9H 5T3ZE 4QRRD 3MACH 3CNKA 3QP3A 4NWTH 3PGFH 2OL3B 2X89A 2CDEB 3FB5B 4QRPB 5F7WC 3CSYB 4ISVA 4PJ7A 4M6MH 5EORH 5I1IH 1V05A 3QNZB 2P44B 4UINH 3QT2A 2HJFA 2OZ4H 1OTUC 3BWAB 4CU8A 3J8F7 35C8L 4GRLD 3QSKB 4JQVC 1X4ZA 1AQDA 1KXQE 2HFFB 2VDNL 4MXVF 4QY8B 4FQPA 4YAQA 3DMMC 5KVMC 1D6EB 1EZVX 5JXED 1MCHA 3W0WB 1B3JA 2OL3H 3SE8L 4LNRA 3NCYS 3KPSE 3GSVA 5DHVH 4DN4H 4PREB 2N4IA 2VIRA 3VRLF 3DRTB 5GSRA 4X4YB 1G7LA 1FFQA 4YHLH 4PY7B 4BK4A 3U9PH 5F6IC 2VDPH 4IRJD 2VXUH 2Q76B 2D7TH 3TA3A 2NY5L 5DFTA 4MNQB 1S7XA 1Q9KB 4JR9H 4P2QB 3FO0L 5CGMA 5C2BH 1V3JA 5F3BB 1B9ZA 2WAHA 3PUCA 5T1LD 5JOPE 5BO1L 3BQUB 1A4KA 1WT5A 2W60A 5TF0A 1W0WB 2WBJB 3U30C 3QG6A 5J7CC 5IVOA 5L2KA 4QRSA 4PJXF 1VEMA 4U31A 3OTTA 4Y5XB 3PV6A 1MRDH 3W81A 2GTWB 4PLJD 4PJXE 4RMSA 4G8EB 5HI3D 5C0CA 2X6MA 5DYOA 1OP3H 4TSBL 4YO0B 3PWVB 4KQ4H 2NX5D 4NRZA 5EU6E 1OQXA 3EYFA 3PHSA 4ZPVA 5JW4M 3OJMB 2IGFH 2ZKHH 4LEXL 3NCFB 3MODL 2CSPA 4WU5A 3VGDA 3ET9F 3GIVB 1BWMA 3E8UH 5TE4H 3UTTA 1XGQB 3HRPA 1OAQH 1G6RB 3DYPA 4Y19D 4ZXBB 3BP4A 5FA4B 4D8PA 4I48B 1J05A 3EBAA 1S5IL 2KH2B 3O9WA 4M9OA 3VMNA 1XCQA 1JZ3A 1B88A 1FIGL 4KJQD 4EDXB 1F97A 2W65A 2I9LA 2F5BL 1N7MH 2WANA 2YUVA 5FOJA 2C3XA 1X6NA 2P46B 2WZPD 4QHMB 3O8XB 3TV3L 2PW2A 3OKEA 1NC4D 4U0RC 4E41B 5IMLA 2H2PD 3OGOE 1MHEB 1V3LA 1OGAB 3KYAA 4RA3A 5KG9B 1QP1A 1RUQL 2F5AL 3IJYB 4LLWB 2KKQA 4OT1H 3VG0L 1KJVB 4F9LA 2AK4B 1RUPH 3DX9A 4UIMA 3JTTB 5H37H 1MOEA 1NDGA 2FO1A 3SDCB 2C1OA 2GJ6D 2H8PB 3WNOA 3AS1A 4WUUD 3RAJH 1U8IA 1MJJB 2IADB 2VWEC 3MJ9H 4ZTPH 3S35X 3V95A 3S5LA 3W82A 5ENWB 3TA3D 3UC0L 2XWBB 2IANE 2I60H 2HFGL 4GOSA 4ZTOL 5EFIA 4PJ8C 3VXPB 3HI5L 4GG6F 1BFTA 3SQBA 4OI9A 5HD8D 5E9DD 3WEXB 3BYYA 5DSCB 5EUKA 1YMMD 3QDGD 5D6DA 5JHDB 5D7LE 3KXFE 5FYKD 1FYTB 4YX2H 4OZ4B 3INUH 4G6KH 4ZSOB 3OHXB 4IOIB 3BKCL 1NLDH 1N64L 1XR8A 2IH1B 1OP5K 2EYTA 2VUYA 4F7CB 4APQA 5FYKL 5HHNB 4KRLB 5C0BA 3MV7D 3BE1H 1CFVL 4LHUG 1DBAL 4KJYA 2A6KA 2PTTB 2FX9L 3K0WA 5T3ZH 2IBZY 1WFNA 1QSZA 4EJ1C 2GJ6B 4RWYH 2Y7QA 3TPUB 3LS5H 2FGZA 2DJSA 4M1DH 4ESKA 2GTZB 4TVPL 1BIHA 1CG9A 1HI6A 3UPRA 2IBZX 3ZKQD 1H15A 1ZHLB 4Y2DB 1ZA6B 2GYSA 4H5SB 4OZFA 3AXLA 1F90L 4NWTL 4I0CC 2NXZC 4H26B 3MJ9L 4GW5B 3O6FD 5CJ8A 5D2LB 4AYFA 2N56A 4FQIH 3LEYL 3SOBH 1UH2A 4HWZB 5C3TA 3T4AA 1EH9A 4RGOH 4YWGH 1JV5A 3C60C 5GS3A 5ITBL 3KPRA 3KGRA 2NLJA 1HH6A 1BF2A 2VLRB 4UBDD 5CD3A 1YA5A 4AIOA 4IRSC 1A1MB 4PLKC 1XGTA 4N8VA 1W72B 4NO2B 2XKUA 2VR9A 5LGJA 3D39A 4WCYL 2XPGA 1QD0A 3STBA 4DZ8A 1IMHC 4HIJB 1LEKB 1B2WH 4X98B 2FECL 2J8HA 1LDSA 2NCMA 5FKAA 5IROA 1DBAH 1QA9A 4NQED 1ITCA 3Q1SL 1FGVL 5GS1A 2QSCH 1U91A 3GHBL 4MS8D 5IMMA 1WCBA 5F6HI 3VFUB 1S5IH 1YEIL 5D1XC 5E4EC 4QCIB 3RWDB 4C54A 1UM4L 2V17H 4W6XB 5KSVA 1AIFB 2EKSB 2CKBB 3WSQL 5HGDB 2XRAL 3I3EA 4OI8A 4TVSa 1PVHA 1CGWA 4MA1C 4NYLA 4KJPD 1LHZA 4JLRA 4S1RH 1JNLL 2CRZA 3IJHA 4GMSL 3OKOA 4HWEL 4NKIL 4OUUB 2IG2H 5ELIA 3LD8C 1KB5H 1ZT1A 1FGNL 3DHMA 3LQAL 1ROWA 1M1SA 2XWJB 2EDEA 2ZCHH 4OLUL 4MA3B 3MRNB 2AJVH 3TNNB 3T1FB 4IRJB 3I75B 5B3JE 4IRSB 2JB5L 4RWHA 4Z7UE 3O6ML 1RZIA 3HE6D 3U7AA 1AO7A 5TF1H 3QIWD 1QTYT 2YR3A 2W38A 1QFWL 1DUYB 5D5MA 4IMLB 3QUZD 3KJ6L 2EZ0D 2H3NB 1CXLA 4LDEB 2VDPL 3DGCR 4IM8A 4RISL 3ULUC 1DCLA 3ARTA 4GKSA 2F8OA 5F93C 4UOW1 1IAIM 2XZAH 3OAUL 1U8NB 1HHIB 2AJ3A 5MENB 3MRLA 1ZVSB 4OTXL 3BZEB 4WNQA 1EBPA 3OKDA 2NY6B 4LL9A 4YBLC 2AEPH 2SEBA 1HHHB 3O3UN 5GRJL 4KK6D 3L3HB 4JPVH 4QWWC 1AR1D 1AHWB 1DEEA 1TETH 2NY3D 3GSXA 4ZOAA 4S1QL 1S8DB 1I85A 2YD1A 2LAGB 2XZAL 4D9RE 2ICCA 3LHPL 4HUKB 5KVEL 5IHZB 1WZMA 3HUJE 3DARA 3VWJD 3OXRB 4MHHG 2Z35B 3PWJB 3F58L 3T65B 2WQ8A 4PJHF 3VRIA 2VITA 3FONA 4RAVB 1RD6A 4NQEA 1HHJA 1B0GB 2R2HA 1NAML 5I1CL 4NN6B 3RNQA 4PJGF 3OZ9H 3UTSB 1MQKH 2Y1VA 4DGYL 1RIVL 1UKSA 2W92A 3BN9D 2GQHA 1A4JB 2WIIA 5I1GH 3SDCD 1QSEE 4HK0B 2OM5A 5HPOA 4U1HA 4R4BA 1F4YH 3MX0A 4ORGA 2FX7L 2H26A 4HCRH 4GQ9L 5B4MD 3N50A 4Z0BL 3V4UH 1FIGH 1CTNA 1CDCA 5BV7B 3C6LD 1G9NL 1M7IB 4LCUB 3SE4A 4HUMB 2X42A 4P4RA 5DRXA 5IFHH 1TZGH 3TIDB 4NN5B 5GS0C 2Z93B 3NMEA 4HJJH 1DQDL 1EXUA 3MUHL 2BSTB 5FCUL 5B39B 5BJTA 5ICXA 4Y4KA 3C2AL 3RWGB 2XFXB 2UUDH 4X6BA 3GJFA 2X4QA 3CDFA 3JZ7A 4ZUSB 1UM4H 2DTSA 2V17L 3C8DA 4Y4FA 4PJGB 4MS8C 1D9KD 1HSAA 2ICEB 4XNYL 1C5BH 2EDHA 2EICA 3DVNB 2PETA 3VDAA 3GJFH 3SGJA 2EE3A 3C8HA 3MRMB 4K07A 4OF3A 4UIKL 3ZTNL 5GGVL 4XPFH 4NHCL 1DQDH 3RWEA 4ERSL 3B5HA 3FQTA 3T8XA 4ETQB 4WTZG 3CFKB 3EYQD 4JHAL 3KPSA 3SPVA 1OARL 3ARGC 2ARJB 4UV4H 3PWNB 4Z7VB 4XNUL 3P30H 1PZ5B 3IDJB 5E2WL 4K8RD 5DMGC 4XPHL 1FL5B 4LDOB 3BP7A 3NIGE 5E7BA 5GGUA 4JDZA 3LY6A 2PCPB 3MRJB 3UYRL 4ODSH 4JRXA 2CKBL 2JK5B 1UM5L 3DSFH 1JIBA 4LSPL 3OAZK 2UV3A 3MUZ1 1MFEL 2DQUH 4QRQA 1DLHA 4QXUH 2APFA 4BFIB 1IILE 1YMHA 4FQJH 3PG2A 1HYSD 1C5DB 1LK3H 1LO5B 4LVEA 3QJFB 4LGRB 3O2WH 4TULL 1T7YA 4WTXA 4U1LA 1FO0H 1X5HA 3QDMD 1EEUA 4HFWB 3O3BB 2GAZB 3P0GB 1XAUA 1OP9A 3UTPD 2C3HA 4JPVL 1CICD 1Q0XH 4OM0H 4F80A 1Q9WA 2EXYC 4LPXA 1QBLL 1Y6NR 3BXNA 3WLWD 4XH2B 3VRJB 3NIDE 3WMSA 2X4PB 5D96B 1HKLL 1R5WA 5HI4C 1KCLA 1V3KA 2O5ZL 4X83A 1YN6B 1BBJB 5D7LD 5DVKA 5FYKE 3I02B 1F4XL 4HULB 4C4KT 4PJDF 3MGTB 1IC5H 4QOKE 1HZHL 3H3KA 4HUUA 3RIFK 2BOBA 4XBPA 1FBIH 1F58H 1ZSDB 2WWMD 4N8VG 1JI1A 3MTRA 2HLFD 4I2XE 3HS0B 3ARYA 1EMTL 2DM7A 1NGWB 1S7TA 5C09B 5JO5A 3KHQA 3RBSA 5GRUL 1DFBL 5D1QB 5DMIH 3RIAF 1DP0A 5DVOA 4LCWE 4L29A 1C7SA 3RBGA 1EBAA 5CJXC 4PJ7B 1GGYA 4PB9H 4N0FA 5E1HB 5E8DH 1VFMA 3VFTB 3BWAA 3M1BB 1EUUA 2QV2A 3GEWB 1TNMA 2W9EL 4QY8A 4YAQB 2R1XA 1DN2A 1X5GA 1D6EA 3N1GC 2BNQA 3W0WA 1JTPA 3SE9L 4LNRB 3NFSL 2NXYD 4YC2B 5JOPD 4X4ZA 3GSVB 4PREA 3HTLX 1BEYL 4X4YA 1UYWL 4QNPF 3S88H 3AU1A 1LGVA 5SWQB 1T1WB 4YR6A 4ODUB 3DVIA 1G9NH 3WBDA 2QHRH 5ISZE 4J2XA 3U9UA 1BPVA 3MQIA 3L7FB 5D7JA 2DIJA 4N90D 2F74A 2NZ9D 1H3VA 3BPNB 4JAMA 5FHAH 4OM1H 3TP4A 4WW2F 3VDCA 3IGAB 1Q0YL 3U4EA 4HWNA 4Q7DA 5IK3B 4OCXL 3C6LB 1U58A 1CQYA 1EGJH 3B9KA 2WBJA 4U6VH 3QRGH 1Y0LA 5DRZB 5B39G 4DW2H 4Y5XA 4F58H 1KFAL 3O4LE 2ZPKH 4GRLA 1H3XA 4KDVA 4TULH 2F53D 4KPHL 3WNPA 3WCYA 5CILH 4G8EA 1DQLH 1TJHH 4KKBC 4J8RA 1M05B 1TMCB 1RJLB 1SJVA 5DYOB 1JGEB 4KMTH 3DUHA 2YD3A 4PJCB 3VFSA 5DQDH 1Q0YH 4NRZB 2J4WH 1MFBH 4J3SA 4RNRB 3LEYH 4PG2C 4R4ND 3GZKA 2OYPA 2F8XC 1R3KA 3UDWA 3KYMB 5EA0H 4X7DC 4I3RH 1XGQA 1G6RA 3QFJD 3B8SA 3BP4B 5FA4A 2BOCA 3IVKA 1TJGL 3O9WB 2LV4A 5CJXA 1XCQB 1EEQA 2DD8H 3P9LA 3VRLE 2R8SH 4D9LH 1CD0A 2I9LB 5HHOB 3WFCH 3VXUA 1XGYL 1OM3L 3O6LL 1UXWA 3BE1L 1N3NB 4ZDHA 1F02I 1LD9B 2UWEB 4M7KH 1HXYA 1QFWH 2PW2B 5CJOL 1I9IL 2D7PA 1UKQA 5HHQB 2ITCA 4JJ5B 5DC9B 1K8IA 4JKMA 3ARDD 4AIZA 3IJYA 15C8L 4LLWA 4GW1B 2GKIA 3EDFA 1KJVA 4X6CE 2AAVA 4J3WA 3S4SA 2A6IB 5C0IA 5I1EL 5C0AD 5FV2A 2C26A 3QPQD 5LQBL 1HILB 1SEBB 3SDCA 1P4LA 1ADQL 4MQ7A 4R7DB 1MJJA 1I7RA 2ENSA 3F7QA 4L3AA 4XNMB 3PP4L 2IADA 2R1WB 1I7UA 4FS0A 5E2VL 1JGLH 3REWB 4S1RL 3DYOA 5ENWA 3LN5A 4XPTH 2CJUH 1BEYH 4POZC 3CFEA 3F62A 5D70H 2ICWI 2CK0H 1X4XA 3FQUA 3RZWA 4I9WE 1BD2A 1SYSA 2NX5B 2XV6B 3W9DA 2P7TB 1A9BA 5JHDA 3ILPA 4I18B 2W07A 3EYSL 1FYTA 1J18A 3D85A 1P4BH 3MSPA 4UT9L 4IOIA 4KTEL 5T3XD 3MRFA 3LRGA 1XR8B 4M6AA 5F7FA 3HZMB 5I75C 2OBGA 3NH7H 1NMAH 1JF1A 4YHKH 1CD1B 2VQTA 3BP6B 2OI9C 2X7LA 5C0BB 4KV5E 4XCCL 1MF2H 4HAFA 3GSNA 3O4LB 5C0BE 3BVNA 4B7IA 5J56B 4G80B 4GSDL 1MFAL 2CLVA 2GJ6A 4PJ8B 3TPUA 1DBKH 4HHAB 3TNMB 4AG4L 4S1QH 4Q0XL 1CL7L 3KPTA 2GTZA 1XCTB 3ECBA 1H15B 1ZHLA 1P69B 3DX8B 4FN0A 5FUZH 3VW3H 4OZFB 3V0WL 3NCMA 1P7KB 3WDIA 3LB6C 2IFFL 1JPGA 3L3DB 4OLZL 4OGAC 5C0GB 3VI3E 3GO1H 4JQXC 3ES6A 1WZLA 4Y4HA 2BC4B 4LKXA 1IM9A 1U2CA 1U92B 4LLDA 5I15L 4M03A 1E4WH 3BMVA 4W4OC 3Q6FA 3H7LA 3AY4A 4JG0H 2GI7A 2NLJB 1QVOA 2VLKB 3EJJX 2W0FB 4XPBL 5K33A 4XVSH 1W72A 3FT4B 4NO2A 3C09C 5F9WC 5LGJB 2XPGB 3MNWB 4ZOEA 5ESQA 3T0EE 2CMRH 1G7IA 32C2A 1WT5C 1FP5A 3UJJH 1RY7B 2CGRH 4OCSL 3KYOA 4RIRB 1UEYA 4Z7OE 1PAMA 5DJDB 3GRWL 5T5FL 1FH5H 3GIZL 5I19L 4JM2F 3QDGA 1IBGH 2E7BA 1KTKE 4X5XB 1P5UA 3L5WA 1NQBA 4JR9L 3KLAB 1NLDL 3EZJB 3CVHL 4RMWA 1AC0A 3FN9A 4XCEB 5FO7A 5D1XD 4YFLI 5JORB 5EZOL 3R06A 1KB5L 4QCIA 2C7UA 5KSVB 5JOFB 4LLMA 4BSWB 5HGDA 2BRRL 4NNPH 3HI6H 1C5CH 3OJDA 3EJYC 1CDBA 4JM4H 2HTKC 4JLRB 2FIKB 3C87A 5FKPA 3IJHB 1G1CA 3N85L 4D0CB 1YY9D 1OAXL 3O9WC 1G7MB 1SYVA 3VWKB 3EJZD 4Z7NF 3V4UL 1MVUB 5TDPB 2NY4B 3O4OB 4NBZB 4QHUA 1EX0A 1KTDA 1NCDH 4GS7B 3O3AA 3LCYA 5FGRA 3PGCB 5CINH 3C5SB 2DQDH 5IT2H 3LKOA 2H2SD 4N0CD 2X4UB 3N1QC 3JV6A 5HGBA 2NY3C 2D3VA 3RVXC 4PG9B 4P23A 3CZJA 4Z95H 3MLUH 4YHKL 3BISA 4Y0GA 5J6GA 1I3UA 3BSZH 5ACZB 1DDHA 3VXSE 2ZNXA 4K7PY 4GMTL 2AK4D 3RGVB 3VXOB 1DUYA 4XI5D 1IAOA 3UMTA 2EDDA 4J12A 5DURD 1AJ7L 1BBDH 3B5TA 4O02L 4G8GD 4GKSB 1BZ7A 1YDPA 1I8IB 1TQCC 4MA7H 2H1PH 5SWZE 4GBXC 1CXKA 5ITBH 1PG7X 2P5EA 3HC0A 4PV9B 5KOMC 1ZHNA 4HUVB 2AJ3B 5MENA 4Y19A 4PRPD 4FQLL 1UCBH 3LH2H 3OKDB 3KPNA 2F53A 5IF0A 4Y1AE 1MFAH 4L3EE 2Z8SA 5D1XB 4MZ2A 4NBXB 4DQOL 5IFJA 1OT1A 3NABL 2FBJL 2VLKE 3IFPB 5KAQF 1CGXA 2B0SL 4MB5A 3WKNA 5IHZA 2ZUYA 4YC2C 1NGZA 4QYOA 4X6DE 2Z35A 3ZHLA 4LSQH 2Y5EA 3ZSSA 3B2VH 2WBJD 1F2XK 4NFBA 2RJMA 1OAKL 1OF2B 3VRIB 1HEZA 1LP9B 4B41A 4NO0B 1B0GA 4F9PA 3VGFA 4WFHD 3LPWA 2CD0A 5EBGA 3HHRB 4KHXH 3RVVD 4P2QD 1EGJA 4PGCB 1I7ZB 4MAUH 5C7XH 4R4BB 3GSOB 1BM3L 1XF4B 3BHBB 4ORGB 3KYKL 2Z4QB 5IVZA 4HLJA 3WKMH 4O9HL 1FC1A 5AZ2L 1NUFA 3ZDZE 1WBZB 2IPTL 1FSKB 1J11A 3T0VA 2J88H 4K94H 1NCAH 3HAEH 4M43L 1DJSA 2J7LA 3AB0B 3PXHA 1ORSA 2Z93A 3S35H 4P46A 3FHAA 3DRQA 2BSTA 2J5LB 2NPLX 5T1MB 5J3HC 1QKZH 5I8OL 1YN7A 3FN0H 4KI5F 3LRSB 1N5AA 3KPOA 3P0YH 3W5NA 1VENA 3CSBA 2RAMA 1D3CA 4JFQB 2G60H 3EJYD 2ICEA 2BY1A 2B39A 3B5GA 1H8OA 1KV3A 4AY0A 4ZFZA 3RDTA 4FZEH 1WWCA 4HMDA 1H3UA 4BQBA 4Z76B 4OCWL 4LCYB 5EOQL 3VG9B 3FCTA 2ZJSH 4W70A 2DQFB 1OSZA 4OLUH 5E9DA 4H88L 4WI4A 4HKJB 2X1QA 1F3DH 1BWWA 3KYNB 5JHDD 4OAWB 4ZPTB 3EYUH 4XX1E 1JE6A 4JRYB 3NGBC 1U8MB 1EFXD 1WICA 3U0PA 3MLSH 4NC0B 5EN2A 4PTTA 1NFDF 5EC2A 5C0DA 5DT1L 4YUEH 3ULVE 5DD5H 1L0XA 4RRPG 4JO3H 3MRPB 3MRJA 3EYOB 3FL7A 1IEBB 1X5XA 4FP8L 2PO6D 4LLYA 5GGRB 2PYEE 5ERWA 4I18C 1T3FA 2A77L 2JJTA 2HG5A 2IALA 3FO1B 5EIQA 3CSGA 3VH8A 4RQQB 1YMHB 4HBQA 5IB5A 4DW2L 1TQCB 25C8H 3MV9E 4OKVB 1N6QL 4LRIC 1JWSB 4MCZA 4HXBH 4PJ7F 3MXVH 4U1LB 1J86A 3PL6B 3HRZA 2DJUA 4LVOB 3ULVD 3DX6A 2GAZA 2G5RA 1T89A 1FLRL 2Y36L 3BDYL 2WK2A 1G9NC 3EO1B 5J0BA 1AI1H 4NQCB 4JJHA 3W39B 3GMOA 2VDMH 3MLRH 3F7YA 4G7VL 5E08H 4RMQA 1YN6A 1BBJA 2FD6L 5JR1L 3C5ZD 3S88L 3T3PE 3BZFB 1BJ1H 3VGHA 1KEML 4DGIL 2E7MA 1C12A 1Q9OB 5CCKH 1U8HA 3NOIA 4XBPB 4E5XB 3QDAA 5FUOL 1F6AA 3MV7B 1NCAL 4PJ9D 4JHWL 3KPSD 3FFCD 2NW3A 2FX8L 2BSRB 4PJFB 4LVHB 4ZUTB 5JO5B 1G84A 5D1QA 3SGKA 3VWJB 5HPMB 1TJIL 3QH3A 3T77B 2XN9A 1QZ1A 1NCWH 4QXTA 4FABH 3ARFB 15C8H 4KHXL 1G6RL 4K3HA 3PQYB 2DN7A 3EZ8A 3HR5B 4UDTB 3HFML 1SEQL 4X0KA 4WEUD 4M6ML 5CJQL 5JQ6H 5KW9H 1MI5A 1NFDE 5CD5C 3VFTA 3M1BA 5CJOH 5AD0A 4IMKA 2R1XB 5CBEA 2GT9B 5F44A 3DUSB 2BNQB 1HOCB 3EOAB 3HZYB 5B8CC 1VHPA 1RJZA 1N59B 2XA3A 2BNQE 4PRHE 4ZQKA 3RL1A 3HG1B 3IJSA 5IR1B 3G5YB 4U1SA 5IW6B 1XIWA 5J12C 4Y5YA 3MCLH 3AU1B 5MP6H 3UC0H 3JXAA 1TCMA 1PLGH 3SDXE 4A2LA 1YYLH 1DR9A 4XP5L 4P5TD 1NPUA 4U7SA 3IU4L 4EEEA 1AO7D 3LZFH 2X9YA 2HN7A 2O61A 1QSEA 3OKNA 5TDOA 3VJ6B 5DHXB 1CZ8L 3VGBA 3U4EB 1QG3A 1QRNA 5EU3A 5C08E 4G9FD 3P4OA 2AXJA 1QR4A 2WUBH 4CNIB 3B9KB 3GK8H 1S7WB 5CLWA 1RUQH 3WD5H 1GHFL 3PDOA 4P2OA 1KN4H 5TQ2H 1N5YL 1SBBA 2EXYD 5I30H 4NP4L 1OTTC 2X4RA 4PRPB 3WO3B 4J8RB 4EIGB 1RJLA 5LCVH 2Z91B 1KIPB 4HCRA 3UJTH 1UJ3C 1J1XH 2R4SL 3F6LA 4NQCE 5T1DL 4EN3C 1IAKA 2VSDA 3GBLA 4MDIA 4M5ZH 4YDJA 5C2BL 1D9KB 1NEZB 2BY3A 3EOYG 5E2WH 2DLTA 2PUQT 5I66A 1JZ7A 1SQ2N 4TPRL 2V5MA 5EBMA 1VADA 5GRVK 4JN2A 1A7RH 4L4TD 1UWEH 5HHOA 1J0HA 3DMMB 1UXWB 1KCSH 2VZSA 4RRPA 4ZDHB 2DLEA 1WBXA 1HXYB 1U3YA 1OPGL 2FD6H 2FECI 4GAJH 3ILQC 2VB5A 2XKNB 4I77L 1VPOH 4J3VA 3BT2L 4K3GA 3WD5L 2ITCB 4JJ5A 1GIGL 1K8IB 5LJYH 4AIZB 2ZUQC 2F58L 3V2AR 2AK1L 1RHFA 1X5JA 3RWHB 4X80H 4M1CC 5DJ0A 1DFBH 1FNGA 2L7JA 2A6IA 3LN9A 3IDYC 1WIOA 5C0IB 2FGWL 4YDIL 4JQXA 2E9WA 2AERT 4MAYA 4XMLL 4KHTL 1HILA 1OQOA 4JRYD 3MV8A 3DPBA 4XNMA 1P5VA 1WFUA 1PG7H 1I7UB 3K3QA 4NM8L 4H1LG 3NFPA 2VR4A 3HNTH 1MCDA 4F15B 3QIUC 2E9IA 3CFEB 1VSCA 3KPPB 1GGTA 1PYWB 4NGHL 1HWHB 1P84J 1W0VB 4PJAA 2CRMA 3F7RA 1FFNB 3W9DB 2NY2B 5C0FA 5HVHB 3ILPB 4I18A 1YEGL 2I07A 5E6ID 4K71C 1CTOA 2ESVB 4M61A 4MXWL 4X7EC 4F7PA 2FB4L 4WHDA 3HNVH 3O3DB 1H8SA 4KK5C 4X99A 3MLXL 4BUGA 5EO0A 2A9MH 4KPHH 1UZ6F 3MRIB 3HZMA 2Q8AH 3RVUC 1CD1A 2FBJH 1FNSL 4NRYB 4WEBL 4ELMB 5D7SL 4XZUA 1S9KC 1EAPA 5EWIL 2Z0BA 2X70A 3BVNB 3IU4H 4KMLB 4IHOB 2BSSA 5ICYB 3TVMC 1DBBH 3SCMA 4PJ8A 1TQBC 2ICWA 3TNMA 5KAQG 1OWRM 3Q5OA 3TWCL 1INDH 2AGJL 1FPTH 5ID1B 1GAFH 3DX8A 4DGVL 3KLHD 2CIKB 4LCWA 5JOEA 3T0ED 3ULUH 2R15A 2DYPB 4WHTA 5J1AA 1JPGB 1MCRA 3QHZL 4B53A 3L3DA 2EC8A 1IL1B 3ES6B 4OCRL 4Y4HB 3NAAL 1I9JH 1UACH 2AV1B 4LKXB 5DWUH 2WMPA 2QHLA 1WIPA 3DETC 1YEJH 3Q6FB 2YN3A 1KCUH 4TOYH 1GRWA 2YPKB 3MBXH 1NCCL 1J0IA 2VLKA 4K94L 4V2BA 4UTBL 4LARH 1K2DB 4OZHA 3DROB 5CP3A 4ZO9A 4EDWL 2E7LA 3IDMA 5JXEA 3QIBD 3MNWA 4NN6C 4OGYH 4F8TA 3T0WA 1G7HB 1GGBL 2WM0A 4OGYL 3MUGB 32C2B 5DK3A 3KYOB 4JG1L 4RIRA 3GI9H 4MNQE 1A1NA 1MRFL 3RWJB 4X6FA 1PDKA 1N5YH 2AJXL 1MWAA 2UVEA 3IDUA 3U2SA 4OLXH 3HE6C 1WV7T 1KJ2A 1I9IH 4NKIH 1QRND 4XCEA 4R96B 5K9OA 3R06B 3B9EA 1YEHL 1G7JB 4MJ2A 1BQSA 4KROB 3BD3A 4OLZH 4XGZB 5EZOH 1R3IH 4CMHC 4PJIB 3MRDB 4XP6H 1TZIB 3MV9D 4FQIL 1T83C 3DO3A 5E5RB 1KGCE 5FKPB 1VFAA 1EERB 5ACMA 1G7MA 1XF1A 3QIUD 1T03L 3RVXD 5FUCC 1T20B 3EW3B 4JY5H 4KFZC 2IC2A 1J1XL 1JZ2A 1KTDB 5JNYA 1XGRB 1XEDA 3PGCA 4YHZL 3C5SA 1FFPB 3DIFA 2YC1B 5MHSE 4PY8J 1I8KB 3ARDA 4M8VA 3Q6GL 2BNRD 2HWZH 1JYXA 3SY0B 4HPYH 5J6GB 2K9UA 4NGHH 1KGCD 4Q9RH 3HFMH 3HMXA 5HHOE 4JB9L 1NAMA 4Z6AT 4L3ED 4NQVA 1MCLA 1JHKL 4U6HB 3OR6A 4LHUA 3S5LG 3PGDA 1AD0A 1YNLL 1BZ7B 4K55A 1A3QA 5IQ9B 2J6EL 4OF8A 5DD6A 3HC0B 2P5EB 4PV9A 5IROC 1C16A 1ZHNB 2EYRB 4ODTH 4CGTA 2XA8L 2GK0B 1K5NB 1ERNA 4YHNA 4F8QA 1CD8A 4F7MA 4XHJC 4ZTPL 2FJGB 4QRTB 3QJHA 3KPNB 2F53B 4GKZA 2VO5A 4LPUA 4X6CB 1QYGL 4RAUB 2VZVA 1EUTA 1OHQA 3NFNB 5D1XA 3RDTC 4O5LL 2HKHH 5F7DB 2F54D 1O0VA 2FO4A 2MTPA 3VXMD 3VG0H 2YEZB 4P23D 2DQJH 4QYOB 4ZFGH 2NXZD 4PPTA 5HDBE 5KS9E 4Q2ZA 2G5BB 2APVA 1KLFA 1HSBA 4NO0A 1Y18A 1H0DB 4PJEB 1FDLH 4ZSOE 4EN3B 4PYHA 3REVA 4PJEE 4M1CD 1RUAL 2QADD 1ACYH 3GMLB 4L4TA 2XTJE 4FQHA 4YXHH 4WU7A 3MJ7B 4ZO6A 5E2VH 3HI5H 4HGWA 5DJAB 5A2IH 4TVPE 4POZD 4JFDE 4N1EA 2B1HL 2YBRB 1WBZA 5IM7A 2ZSVB 4KKLD 1WK0A 3PHOB 4M4PA 1IQWL 2BHZA 3OKMA 2IH3A 2J4WL 4OZFG 1KPRA 2W9LA 4WY7L 3VE0A 5D6CB 4KI5D 1AGBB 5TE6L 2H9GA 2W0PA 2VZ3A 3PV7A 4BQCA 2PR4H 5IVXB 1YN7B 1INDL 2AGJH 1N5AB 3KPOB 4ACPA 4OLYH 1T2QL 2OL3A 5E0QA 3IDXH 1DL7H 1FN4B 3RJDA 1HNFA 4QKXB 3TCXA 2M8XA 2VDRL 3IKCA 3FKUS 5I73B 3QNZA 3O6LH 2HJFB 1XMWA 4XNQA 5E8OB 2Q20A 4XP5H 3QCUH 1AQDB 4BA8A 1PKQE 1OSZB 1T83A 4G43A 1WISA 1UQSA 1XFPA 4P2RA 4OAWA 3G5VA 1NC2D 4YXKL 3T0EA 2VIRB 4X9IA 4HDIB 4JRYA 4DVRH 1P6AB 5GSRB 2D03L 3HE7D 2GJZA 5C70A 5KSAB 2APXA 3SKMB 3MRKB 3MO1B 1EA9C 3TA3B 2XICA 3I6GB 4Y1AB 1Q9KA 5ISZD 1N2RA 2AJXH 1TJHL 2NY6C 2DOCA 4P2QA 5F3BA 3BKMH 5GGRA 4O9HH 4WUKL 4PV8A 4PJ8D 2UZYB 1T3FB 2KQMA 1E4XL 3JV4B 1GGCL 2W60B 3P4LA 4JG1H 3VH8B 1FG9C 4M5ZL 4RQQA 5GSVB 1O5DT 1A7PH 3GIZH 4TTDD 3C9NA 1JWSA 2VXSL 3MV01 5L2KB 4NO0D 3LQZB 3MV9A 5F9JA 3PV6B 1QO3A 4CVZB 3PL6A 5LCVL 4QRUB 2A6DA 3QQNA 2GSIA 5GRUH 4WV1A 5C0CB 1L0QA 4WO4C 1I3VA 4HKBA 4YO0A 3MFGB 5C0NC 4NQCA 1F6FB 3W39A 2P5WD 1FBIL 3GSNH 3EYFB 2PYED 4GLRI 4QGYA 1II4E 1T7VA 6CGTA 43C9B 1MRCL 1V5JA 2H2PC 4LSDA 4YHLL 4G7VH 3BZFA 5E08L 2H41A 3KPRE 4XXCC 1AHWC 1C12B 1Q9OA 4D8PB 2AJUL 1J05B 4LOUD 3IDYB 5IGXL 1U8HB 4LGSB 1HKLH 2V5TA 5IFAL 3QXUA 4OJFH 2KDGA 5FOBA 3VD9A 2W65B 1CK0L 2EH7L 2NW3B 3ARGA 2PXYB 4P2OC 4KVCL 4Z0BH 4S0SD 1YEKH 3P77A 4O02H 1MJ7H 3QG7H 5C0RH 3T2NH 2XN9B 25C8L 4NOFA 5DJ6B 4E41A 4JZOB 4HUNB 5IMLB 4QXTB 1UCTA 5EULV 1JGDB 4G9DA 4MWFA 4NCDA 4CMMB 3HR5A 4X0KB 5HDBF 5KS9F 2OP4H 3QZWB 4LSPH 3JTTA 4QHKJ 3VFMB 4NN7C 4FQCH 3DXAA 2QADB 5T33H 3ULVC 5CBEB 5T1LB 1NDGB 5KVDL 5DT1H 3ZHDA 5F9OL 2HRLA 1RJZB 1N59A 4HIEB 1FV1A 4P9HH 4RGMC 4C83B 2ATKB 2EC9T 1UCBL 3LH2L 3ZKXB 1XIWB 1PZUB 4OZIE 2XWBA 5FUZL 3QXAA 1TIUA 3DLQR 3VXPA 2EDRA 4ENEC 1JPTH 3O2DH 4JFED 1NUGA 1R3IL 2PO6C 2ADJB 1RUKL 1LEIB 2HVKB 3NCJL 3OHXA 2O61B 1QSEB 3OKNB 1OWWA 3G6JF 2FX9H 4UIKH 3QUYD 5T3ZL 5LGHL 1RUMH 5GJSH 5KSBE 4D3CL 2A38A 4BSVA 5JZ7D 4F7CA 1IGJB 4MD5A 4K3DH 4FQ2H 3PDOB 3QPXL 4MAYC 1NSNH 4P2OB 2HA1A 5HHNA 1ETZB 1MCJA 3V7AE 5CWSA 2A6KB 4PRPA 4LLUA 4Z8FL 1M71A 4POYA 1Q72L 5D2NE 3BRFA 1EV2E 3ULUD 3KXFD 3UPRB 1N6QH 4Y2DA 1ZA6A 2WBWB 3KHOA 12E8H 4MDIB 2LTQC 2HT3C 4RFEB 1JZ5A 1D9KA 4FMKA 4YLQT 2YK1H 5F71A 3AGVA 1YEEH 5I66B 3MV7E 2BRRH 4NNPL 3H3BC 4LQFH 1HH9B 5E7FA 4LF3B 1HH6B 2PTVA 1GPOL 1VADB 4NZUL 4OCMC 1RIVH 4DVBA 4JN2B 5L8JB 1A1MA 2AQ2A 4JFHD 3DMMA 4Z0XB 2K1MA 3LS4L 1WBXB 2N1KA 3BKYL 3VI4F 1LMKA 4HLZH 3HG1E 2BJMH 1LEKA 3M8OH 3EO9L 3W5MA 3LEVL 3HR6A 5A2FA 4U7KA 3VXMA 3OV6A 1T2JA 5I19H 5C3LD 3N1FC 3P2TA 4UUJA 3QQ9C 3RWHA 3P4MA 4MD4B 5GS1B 1FRGH 5CGTA 3TBWB 2UZIL 1FNGB 4JRXD 1P4IL 2QTEA 4PJFF 4Y4KC 5DD3H 1SVCP 3RJQB 2HJKB 5SWZD 3QQ3B 4WUUE 2DDQH 5IHLB 1VB9A 2LU4A 5IQ7H 1AIFA 1RSFA 1IRAY 2EKSA 2QQLH 5JIHA 4PBVC 4CKVX 1PEZA 3EYSH 2VLJB 4FQXA 1Y6KR 2OQJB 3NFPB 4BYHA 1CIUA 1ORQA 4NYLB 4X8JA 4UQ2A 2AEQH 1FVEA 5DRWA 1LO4H 4OUUA 4BUHA 2VYRE 1E0OB 5D93C 1UZ8A 3BSZL 1FFNA 5B3NA 3TH3T 2Q1EA 3HZKA 1TXKA 4HXAL 3WDJA 2ESVA 3ISWA 1SBSL 3EYUL 5BRZA 3JV0A 5FIEA 4XAWH 5F7LB 3MRNA 4DOHB 4X99B 3P30L 1YEKL 3KS0J 5AG9A 1UH3A 3QEHB 3SDAD 1J0YA 4OGXH 2AABL 1AGFA 5HDQL 2IPUK 1UM6L 1RZIB 3QIBC 4UT7L 1EAPB 4U1KB 4K9EL 1UZ6E 1AO7B 2B2XL 3DWTA 3MCKA 4IMLA 4OTXH 2AXHA 2ICWB 2H3NA 1FL3B 4DKEH 5I1KH 2FBOJ 3X11B 5ID1A 3MNZB 3RZCD 3MV11 3VCLA 2CIKA 1A6WH 3WFDL 3HG1D 2VC2L 4WHTB 4JFXA 2ZOKB 5ICZB 1IL1A 3MRLB 5D2LF 3QFJB 4X9BA 3BZEA 2AV1A 2Q3AA 5IB2B 1WAAE 1VFBA 2SEBB 4WGWB 1HHHA 1T80A 5K9QI 3L3HA 4EKXA 1CE1L 2HTKD 1DEEB 4HF5H 4C57C 5E94A 1OP5H 3TVMD 5EU7C 4NZTH 3DROA 3IDMB 4YEFA 3EDDA 5SV3A 2J6EA 1G7HA 5DRNB 3VGAC 5L0QB 4PRNA 4WUKH 2YPVL 3MA7A 3FONB 1A1NB 4PBWD 1HHJB 3BEWB 1BZQK 2Y6SC 2HH0L 4ODBD 3C8KB 5CMAB 1OAUL 3SEPA 3TFKD 3G9VA 2P8LA 5E6IC 5EPMA 3WYRA 2WIIB 2E3VA 3FRPA 1KJ2B 3ZZ1A 4M48L 2FH8A 2E6JA 4R96A 2DM2A 2FRGP 1CI5A 1T03H 4O00A 1G7JA 3RU8L 4UB0L 4JFFE 2AW2A 1YJDH 5DA4A 4JGJA 3WIFA 4PJIA 3MRDA 1XIWC 3QO1B 2VLJE 3DSNA 2B20A 5A2KH 4PJCE 1YEFH 1EHAA 1JPST 4OM0L 3G6AA 1EXUB 2ZJSL 3GRWA 1KIRB 1Z3GH 4AQOA 4QRRE 3HI6L 5ICXB 4NQXB 3RWGA 4X6BB 3GJFB 2X4QB 4XC3L 4PJGA 4KAQL 1HSAB 3O81A 1C1EH 3CJJA 3I85A 2YC1A 1I8KA 1LEGB 3O3EA 3MRMA 3JVGC 3QXTA 1UGNA 3RWEB 2NW2A 4ZODA 3QCVL 3UTOA 1UA6L 4ETQA 5F70A 1LO0H 5GISL 4B7LA 2G9HA 3SKUD 1A5FH 6FABH 4KXZH 2MKLC 5I74C 4DTGH 4UQ3B 3IB4A 7FABH 1NCNA 2CDGA 2GUOA 1RUAH 2WIMA 5GS0L 1K5NA 2X41A 2M26A 5ANMB 4GKZB 4JRXB 3WHXA 2JK5A 4UDUB 4RAUA 1UG9A 5CBAB 1RK0B 2DLHA 3QUZB 3OG6B 4QRQB 4BFIA 5GRVL 4FA8A 2FO4B 4R2GC 2A74A 2OL3L 2VDLH 3SE8H 4EBQH 2PN5A 3IYLW 2Y5TB 4KWUA 3V7AG 4Q2ZB 4XNXH 5BCAA 2G5BA 1BFSA 2JJUA 3DI3B 4TNVF 1Y18B