1XO8A

Solution structure of at1g01470 from arabidopsis thaliana
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
151
structure length
151
Chain Sequence
MASLLDKAKDFVADKLTAIPKPEGSVTDVDLKDVNRDSVEYLAKVSVTNPYSHSIPICEISFTFHSAGREIGKGKIPDPGSLKAKDMTALDIPVVVPYSILFNLARDVGVDWDIDYELQIGLTIDLPVVGEFTIPISSKGEIKLPTFKDFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords At1g01470
publication title Solution structure of a late embryogenesis abundant protein (LEA14) from Arabidopsis thaliana, a cellular stress-related protein
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 16
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2004-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03168 LEA_2 Late embryogenesis abundant protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1820 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1xo8A00
1XO8A 1YYCA
chains in the Genus database with same CATH superfamily
2K4WA 3DXAE 1KTJA 4KKLD 4H1LA 3BJLA 3HE7B 4XVSL 2F7PA 3VFSA 5CN1A 5D1QA 4WF7A 1JXFA 2IH1A 1U33A 1JRHH 3P3RA 3UJIH 1N3NA 2ZWKA 5DGRA 1OAZH 3GI8L 2HTLD 4LCUA 3JT0A 4LPUA 5CLXA 1SRDA 2ZX6A 1AD0B 1EDYA 1QNZH 5EZIL 5JDSB 4MJID 1QTPA 4GKSA 4WDIB 5IHHA 4IM8A 5DQDH 1A21A 2A74A 1M05A 3CX5J 3GSOB 3IDJB 1MHHB 3WL9B 3W9DB 1HSBB 3OC5A 4KKCD 4RFEB 3FH5A 4LOUD 1IM3A 4KVNL 3H2PA 1AZNA 4GRWB 3SB3A 5E03A 4H8WC 3CZJA 4OBSA 5ADPL 3KJ4C 1IE4A 1DJHA 4JKKA 2RD0A 3MOAL 4NO5A 3NPSC 4KK9C 3N2JA 2H32B 4XX1E 1AI1L 1VEPA 5DDHA 3MRGA 4Q9RH 4JRXE 4KKPA 1WDAA 1VZIA 1MJ7L 3IJSA 4K9EL 1AKJA 3LS4H 2YA0A 5D1ZD 4OZGF 5FXCH 3LH8A 2CKBB 4I3GA 4DP7X 2P42B 2Q0ZX 3C5JB 4LHUG 1B0GA 1XD0A 2IADA 2HT4D 5E6IB 1EO8L 5AVQB 3V52H 1NUDA 1CICD 3GBMH 4A38A 3MRFA 5EBMA 4DOHE 4YHKL 4WGKA 2CO7B 4UBDC 1W16A 2DY2A 5ICYB 5T3ZD 3SE8L 3P4NA 1W0WB 4MNQB 3VWJD 1WICA 1H19A 4I5BB 2FGWL 4JFHE 2D31A 3QPKA 4W4OC 2BC4B 3BAYA 4WO4A 5EWIL 2EKSB 3RE0A 1UXSB 2CUHA 5AB0A 1A0QL 1D6VH 4ONHB 3WJJA 4XPHL 1R0AH 2CGZA 3FZUC 3HG1E 1GH7A 3MKKA 3EGXA 2A3TA 3WKYA 2XZAL 1MCNA 2D4DA 3FOMB 2BRRL 1OAYL 5TQ2H 2CDFA 1QW9A 1E90A 2O6CA 3DXAD 4GAFB 1U3YA 3TZVA 4GMTH 1SBSL 4NQDE 2K6ZA 5T5FA 1O5DT 1RHHB 4KROD 4X5WA 1KJMB 3UCQA 3D7PA 1P7KA 4FNQA 4F8PA 3WAKA 2XTJB 3G6AB 2GJ6E 5IW6B 4EI5A 1OGAB 3HE6A 3Q3GB 3LD8C 4I4WB 5AOKA 1KEGH 2PR4H 4GXVH 2EDQA 1U95A 5I6XC 1I9JH 1CO1A 4IKNA 5I5JA 4DH2A 1IEAB 4OIAA 1MI5D 3TWCL 2DB8A 3E80A 1RMFH 4XVOA 1NAKL 2B59B 1MVUB 2BSCA 4LVEA 5DRXB 2UV3A 3CH1B 5L0QC 4HKXB 3AABA 3O81A 1JD9A 2ESVB 3GPEA 4I3SH 5AAWC 4YJZL 3JBG7 1MCSA 4EIGB 4Y2DB 5J89A 2A6KB 3DDGA 3O8XA 1H6EA 4B97A 4RH4A 2W0FA 1A3LL 4Z7VE 5C07E 2FATH 2UVEA 2PETA 2FDBP 3MLSH 5SWZD 5CBAA 1OCWL 3S3JA 2Y7OA 4L9DA 1RLBA 2Z93A 4XB8A 1KCKA 3VXTA 1CIDA 2BSSB 3NJNA 3MYZA 5IJBC 1M2OA 3FOLA 5E99H 2R0KL 3CZSA 5BCAA 2NNXA 5FEBA 4FQXB 1ZSHA 5MI0B 3WLBB 1YEJH 3QDMB 4Y1AE 3EO9H 3GFUA 4B9IA 3WKQA 4HCRL 3ARSA 1KTRL 4ZS6C 1TIUA 2VMFA 4P07A 2DWEB 3S2AA 4PJAA 1DQLL 4Z7UE 1A6UL 3KGUA 3AB0B 4PJAF 3EO1B 2H26A 4DN3L 3PGCB 4EZJA 1G1YA 4IKLA 1T7VA 2Z91B 3D52A 3MREA 3K6DA 1YJDL 4OH2A 1BJ1H 3I6KB 3KMDA 2EDRA 3I6GA 1VPOL 1XH3B 3DETC 2HN7A 4FFZL 3QUYD 4OT1L 2UY7B 2VMJA 2WJ7A 3CZUB 4OZFH 4YUEL 4ZMOA 4NRXB 4ESKA 1EJ6A 3LEXB 3NACL 2HTLC 3W5MA 4HZLA 1F1DA 2F08A 2X4QA 4MLSA 1CR9H 4J8RA 4PJXA 2AEQL 3ZHDA 4QT5A 4ACPA 1KPUA 4PJXF 3TPUA 3WD5L 1WHOA 1CDJA 3P9LA 4P9HL 1S2EA 3EO0B 1OEZW 5CJOH 3LQZB 2DWDB 3MGTB 3FQXA 3QH3B 4KKCC 4ZYKB 4LOUC 2NUPA 4U31A 1R5WB 1ZXKA 4M48H 4QXTA 3D6GA 3VYOA 2E27H 1I3UA 5I0WA 4ZTOH 1I7RA 3GBNH 3Q2LA 4Y4KD 3ZTNH 4D9RE 2Q2LA 1SYSA 1CF8L 2VLKD 4IW4C 5LAXB 3MACL 3S6CA 2WGNB 1U6AH 4L3EB 2OMXA 1OTSC 2JKWA 5EBWA 4ZFFB 4H44C 4IIQA 3DGDA 1X5FA 4ZFQA 4AIEA 3DVGA 1N8OE 1NMAL 1U93A 1QBML 2ZOLB 1WZ1H 2F7RA 1ZHLB 4ODUB 4WHYG 5FUCE 1OB0A 2Q7AA 5D1ZC 5EA0H 1UACL 1HFUA 4YLQT 2DJSA 2H5UA 1F4WH 4KVPA 2E8YA 4J1UA 5DUBA 5C07D 5C0GA 4ERSH 4HZAA 4L9LA 4FTVE 5C0BD 3KLHC 2XWXA 3MLUH 3SE3A 1MNNA 2Q87A 2P8LA 4PRIA 1I8LA 4QRQA 3RPBA 1EEQA 1MNUH 5AAWA 1AXTH 3OAYH 3CZGA 2DI7A 5EC1B 1JYWA 3VRJB 2ZKHH 2IGTA 3BPOB 5CD5C 5KG9B 3V0FA 2QV4A 5BOJA 1WD9A 5LGJB 1BFVL 3VFPB 1A1OA 4CKQA 1IKNC 2V5SA 5HDWA 4DO4A 1SY6H 1D5IL 1Q94A 1LMIA 3DX1A 4FNLL 4FYQA 1Z2KA 3O6LL 4UU9B 5D7KE 1QG3A 1EXGA 3L3JA 3NRFA 3VYPA 3NZHH 4G5ZH 4GP5B 1KC5L 5E6SB 1IKOP 2JB5H 4J23A 1MRFH 2OW6A 4LLQA 4M7LL 5T3XL 5JW4M 1MJJB 4HIEB 5I1CL 4NZFA 2R0LL 4KU1A 3DECA 2AEIT 4YSCA 1GS6X 4RCAA 3FB7B 2I9TB 4MA1B 5GGSB 4QRTA 4N4YB 2P80A 2YPVA 2B0SL 4TVPH 4NBXB 5D9SA 3WIHH 4E9YA 2DLHA 2Z0BA 4TN9A 1I1AD 2HLAB 4NUGL 1BD2D 3FFDA 3OR7B 1L7IL 4JG9A 2ZCHL 1DVSA 2ADFH 4H7VA 5FA3A 1I9EA 2GTWA 5HGBA 1FUNA 1R3KA 3RI5K 3SE6A 2NW3B 4D3CL 2QKIA 1X4YA 1P84K 2FR4A 5TDOA 4AYEC 4LGPB 1CD0A 1NH6A 4F7EB 3ISRA 1A6AA 3LRHA 3PQYD 5KBDA 1BPVA 1EMTH 3VXQA 2NY4C 3LTVA 4HC1H 1FL6A 3GMRB 4JANA 3X1NA 1RP8A 1WBXA 4P46D 1UJ3B 2DQFB 3WSQL 3L2LA 2J5LB 1HIML 1VSCA 3OXSB 4LRNL 4YE4H 3RFZC 3GXTA 3BKJL 1SMAA 3TBTA 3VXOA 3V4PB 1PG7H 3GRGA 3SGDI 4OD1L 1XSKA 5C97A 5D7SL 4MDRA 4NLHA 1MCLA 2OXGB 5C3IA 1E9PB 3OZ9L 1N2RB 4EUPB 4LDEB 4LKCA 3VDBA 4LVHC 1A4BA 4KRMB 1BFOB 1C7TA 4RESB 4FXGC 5ADOL 3DBXB 4FI8A 4H5SA 2H1LM 4DZ8A 1GGIH 1E4KA 3OKMB 2EEAA 3INUH 3OAWA 3DRQA 3CC5B 3RPIB 5KZCD 3D39D 4F1ZA 3VE0A 3NJFA 4Z5RB 3QR2A 3HI6L 2AQRA 4DQOL 1IAKB 4L29B 1WFIA 1SLUA 3X12A 1G7JA 2J4WH 2AMUA 1Y0LA 1FL3B 1S7UA 1ZTXL 2B1OA 3TT3L 4YX2L 2J5WA 3VXRB 2ZQKA 1JZHA 4FI6A 4ALAC 5FHBH 4EI6A 4FLSA 3QDAA 5AOJA 4EXKA 3BMVA 2XPZA 3X11A 3TIDA 5KSVA 1QLFB 2HUHA 3AU1A 3JWNH 3KPLB 5KJRL 5JUEH 1JNHA 3QG6B 4F80A 4Y4HC 4KNTA 1GGBL 2P8MA 3LNIA 3G5VB 4M6OL 4PG9B 1JS4A 1LEGA 4KDTC 5DVMA 3ZKND 2ICEB 3QFDB 3BAEL 4L4TD 4OTXH 5CJQL 1CFMA 1OZUA 2BY2A 1P5UB 3CFCH 1QRKA 3FTXA 5DVPA 4GUOA 3TVMC 4R8WL 3M8OH 3DARA 3M1BB 1DLHB 3F7PC 3QIBC 3BX7C 4XPTL 5F71A 3O3BB 2PNDA 2F68X 3CMGA 3ARBA 3X17A 1F90H 2LLGA 4X4KA 5ESAB 1OTTC 1PX4A 1AMYA 4XE0A 4DP2X 3FYEB 3SDAB 2EECA 1F4YH 1QLRA 1MHCB 1HEZA 2AK4B 4PJ9B 2QZQA 3SYCA 4Z7OE 1Q9OB 2XETA 3RWJA 2WQWA 4FFYL 1PJWA 5F7AA 2X2UA 4R97B 2R1XA 3SOBH 2YAOA 2VISA 1RULL 3LIZH 5HI5D 1JHTA 2LU3A 2G3XA 3HMWH 4S1SH 5DTFB 4KMTL 5I1HL 3PABA 3RFZA 1S3RA 2W8CA 2ZKYA 4LARL 1BG9A 4EZKA 2AQ2A 3E0GA 3SY6A 5BMFL 4U6XB 2PWDA 3F01A 3GO1H 3GSXA 4OV5A 3FRPG 1LWHA 1S7VB 2VLRD 4I0PB 4Z95L 5CJXA 1TJMA 4N5UA 2BS71 1M6OA 3RGVD 3NCJL 1EDHA 2Q3AA 2EIJB 3MCLL 4FXGA 4K5NA 4FQCL 5DRWB 3QUXD 5D2NE 5D4JA 4D8OA 2BNUB 4GKLA 5F8RC 3Q5TA 2GI0A 1SDDA 4U1NA 5C0CB 2R27A 2YUXA 3HG1A 4LOVA 2E9BA 3PFQA 1IKFH 4O5LH 4JNXA 3LX9A 1QP1A 2AXFB 2X2YA 1MPAL 1A6VL 1PIGA 2ZOTA 1J05B 2LABA 3TBYA 3RUGA 3VWJB 3VWKD 3VFMB 1E50A 2D3JA 4I2XA 4UQ2A 2OSLA 3US1A 5I1GL 2EXYD 4X5XA 3FT4B 5J5EA 2BK8A 1IAOB 4P46C 4JPIA 1N8ZB 4NKMA 1L0PA 1RZKL 4MZRA 1OT4A 4XO9A 2JELL 4Y4HA 1YPZB 1UA7A 2C1OA 5HHOB 5FUCC 5IHBA 1ICTA 1OL0A 1BDYA 1IAII 1Q0XL 1SBBA 1ND0A 3KWWA 4LEOA 3VJ6A 3TVMA 4BDVA 3ABZA 1CJYA 1BEYL 4WKZA 2AXJA 4JM4H 4BH8A 3QIBA 4CVXA 3WFDL 1V10A 4DF9A 4KROB 3WNIA 2JIXB 4GT0A 1GPOH 2QGBA 2PKDA 2Z31B 3KYKH 1CF1A 4MTMA 1VEOA 4MJ6B 1TCRA 5I30L 2BY1A 2ZJSL 4N6QA 2WBWB 2ED9A 4OGYL 4Z7VA 1MCCA 3BUPA 3RL1A 5ACZA 1RQ5A 5AYTA 4Z7VF 3CVIL 1S5HA 4JMNA 4K5LA 5I76A 4GKOA 1BYPA 2X6AA 1XQ4A 4P4KB 5JHMA 4XN8A 5K39B 4QXVA 4JO4L 4K8RC 4NJAH 3SBPA 4FA8A 4Y1AA 2OZ4L 3LDBB 3LPPA 1H8SA 1V3JA 2CA3A 2CUMA 2LW3A 2WYZA 3H8NA 1HL5A 3AITA 3LXUX 2B15A 2P24A 1ZE3C 4G8IA 3TA3C 5DC0A 2DQUH 3VTTA 4HS6B 3O3AA 1GAFH 4Z7UA 4JQVC 4XN4A 1DBMH 3P02A 2ICWA 3Q8BA 4Z7UF 2CRYA 1SHMA 4MFHA 2PUQT 3D0LB 4CC0A 4XMVA 4F7TB 4RAVB 1FH2A 3DJ9A 3PS6A 4M5YH 1TQSA 3Q8EA 2QHLA 3I50L 3GNML 4HUVB 3ESVF 4B9KC 1HHJA 3VDAA 3FRUA 2WINB 2A6IA 1HS6A 4MD5B 2CBQA 4Y9BA 4Z0BH 3FUFA 1ROCA 4A7SA 3QHZL 5FV1L 5DC4B 2FZ3B 3CPLA 1SN0A 2DJUA 5HDBB 1F2XK 1AJ7L 3CV5A 2GSIB 3TO4C 3BPLB 2Y06L 3SDDB 3ZE1E 4QLRA 2V17L 1FFQA 5ANHA 5F21B 5HGGS 1QFWM 2RAMA 1OB1B 4C83A 3FW6A 3NCEB 3FB5A 1QZ1A 1ZS8A 4K5OA 4NUJA 5HI5C 4B53A 4PY8J 3RJQB 5AZEH 3U2SA 2BP5M 4PJ6A 4ZOBA 2GITA 3T3PB 1IC7L 2AXHA 3WTYA 1DQTA 4XHJD 4C4UA 4JREB 4OJFH 1G7IB 3QNXB 4Z9KB 2GBTA 4JDVA 3P73A 3U1PA 1E5CA 4RIRA 1KFAL 5AKRA 4Q6YA 3FT0A 4HFUH 4GSQA 3OL2A 4WUUE 2B2XL 2K78A 3APNA 5F1NA 1IIKA 2VN3A 2PCFA 4PRDA 1A14H 3IETA 4PJDB 4WQOA 1JG9A 1QTYT 3Q0HA 3FB8B 5FF6B 4APXA 1SXZA 3O4LA 4OIIH 4WENB 3X13A 1MFNA 3WHXB 1WUNT 1I85A 4PTTB 5C0BB 4L1BA 1NBCA 5GS1C 5SWQA 1C7SA 3TNNB 2R2BA 3G6JE 4H13C 1IFGA 5CSZB 1XIWC 4YFDB 4WW1B 1RLWA 5C6TL 3BEWB 1MLBB 1L6XA 5JOPE 3WKNA 3EFOB 2B4CL 4FCAA 3FJTA 2HRLA 3O6FD 1DSWA 2X0WA 4M29A 5G4NA 3EYOA 5L4FA 2IH8A 1E5UI 4PJIE 4AM0B 4MAZA 5C0FA 1F58L 2YGPA 2OR7A 1FO0A 3P30H 3PIQA 4Y88A 5F96H 4ODVL 1WF5A 4WWKD 4YSDA 1RZ8A 3RYMA 4DEPC 4JQIL 4NDMA 2I5YH 4LHUA 3BD5A 4PH8A 3B2UC 1QQDB 4OLEA 3WIIH 4I1PA 1N6UA 1FIGH 4WFHD 1XGPB 2EDTA 3A5VA 1XF3B 4I8DA 2PW2B 4ZUTB 3SPJA 2NTFA 4DP9X 2EO9A 4I18A 2VDOH 5GQBA 1G9MC 2HA1A 2ZWSA 3BD3A 5FO2A 4CW1B 1AOHA 1QSFD 5IOPB 5J0BA 2A6JA 3FB6A 3TH4T 2FEJA 1BZDA 2GW5A 2VKXA 1IGML 4UTBH 3QRGH 5M7QA 1HXYB 4OD3L 1K4DB 4UT7H 2WZPA 3OKOA 5KBNC 1I1AB 1NKOA 2OSXA 2RQEA 1JZGA 2J2ZB 3BZFB 5ISZA 4Y16A 2WQSA 4PMFA 1MCPL 3PPSA 2MNUA 4TNWF 2WCPA 5TE7L 3QXTA 1SVBA 2AJZA 2YMXH 2HWZL 3HZYB 2ZYIA 5IEKB 2DQIL 4WEMB 1MW3A 2WANA 2WWKT 1Y6MR 1PS3A 3ULVL 1B2WL 4OF5A 2WP3T 5AZUA 3U30C 5AB9A 2E6PA 3FCUB 3HN3A 3QZPA 2W5PA 5DFVC 4X2UA 3HHMA 3FQ1A 1E4XI 5L2JB 2V7HA 4NN5B 1IGCL 4GQPH 5D2NC 3IJ8A 2AW2A 5E9DB 3F7KA 2C26A 3HNTH 1UM5H 1KCSL 5IT2H 3ZTJG 4HISA 3IDNB 4FQHB 4LQFH 8PAZA 3B2XA 4LO9A 3FU6A 4Z0XA 5JTWA 3GSQB 3EOBB 5DUPL 4UDTB 1JI2A 1PKQA 3ZE0E 5DHYB 3V0WH 5F6IB 1OD9A 4RBPH 2NZIA 2XV6B 1F11B 1OPGL 3HI1B 1BBDH 5G4OA 3ZZSA 3VW3L 1KENH 1E2WA 3F6JA 3KXFB 4PM1A 1E8YA 3DJZA 1YG9A 1XIWA 3NN8A 2Q8AH 2FWSA 2H41A 2DM3A 3HPLB 4LNRB 4X5PA 4XBEH 43CAB 4DP5X 1AP2B 2AEOA 3PWNB 3BD4A 4R0LB 2MOGA 1NC2D 4F57H 5CEZD 2OS7A 3BP4B 5D7LD 2AC0A 4OLYH 3B2VL 5CEXB 2YGOA 3ARTA 1QRNB 2OJEA 4YN3A 4JJHA 4J8QA 5LBSH 3W3BA 2DI8A 1NOAA 5JMRA 2XHNA 1LO2L 4XN2A 5IB5A 2NPLX 1SNRA 3C5ZC 3C6LC 3O9WC 3UZEC 5DK2B 4YHML 1DQML 1NDMA 1WK0A 3J07A 4P57A 1LK2B 4OJAA 3U82B 3BO8B 4N0YH 5I1IL 4A67A 1MFUA 5D71H 1MCJA 2N56A 4W9LC 5AOMA 1ILUA 2X3AA 4GRWE 4Z7OF 4CJ0A 1MJUH 5KOMC 1S7QA 5T1KA 5A6LA 3Q5YA 4JO2L 4GG8A 4S1DD 1OK8A 1V27A 1VADA 2JKRM 2XZCL 3D50A 2BIMA 5HHMD 2R29L 1ZLVK 4Q9CA 2MKLC 4L3FA 5DHMC 3SGEI 2FNWA 4KRPD 2EYTB 3KGTA 1DEEB 2P47B 4G6MH 4GIPD 2W38A 1JNNL 2WYIA 3RP1A 3L5WB 15C8L 2VRQA 2VR6A 1OP5K 1EFXB 1TJGL 1O7VA 4HMCA 5CIPH 4ZG1A 5FYJE 4RSYA 1B4JL 2DQCH 1NC4B 5E1IA 1FYTB 2N59A 4GRLB 3N40F 5C2BL 4MA3B 2O5XH 5DJZB 3QQ4B 1WS8A 4R26L 3DI2B 5D7HA 3C5SB 2X4OA 3GSWA 1RK7A 4Y7MA 2VDRL 3SJVA 5C0AD 2ZAIA 4PV1C 2AQ3A 4MNQE 3IMWA 2QZ5A 2XX1A 3V4VB 3RLSA 4GO6B 1T7ZA 2DQDH 3U4EA 4V1DD 2P1YA 4PGDA 4YIQB 1XGYL 2IQAB 3STBA 3POHA 4KQ4H 4HWNA 1S7RB 3VI3A 2NXYC 3MROB 4AEHH 1JXJA 1MZZA 4N0CD 4XP6L 4X0NA 1M6UA 4O58H 4N6RA 5T1LD 3VI3F 4L4JA 1OAJA 1WZMA 3B1TA 5T5FL 2ZUXA 2X4TB 3B8YA 3W0WB 4A7TA 3UBHA 1YLBB 5EEXA 1RU9L 3EDJA 3FC8A 3UBXI 4XB7A 2VXQL 1BEXA 2HAZA 5GS3A 1KSRA 4TL4A 2J7LA 3NFSH 4CSSA 4EUPG 4KY1H 3WS6C 1GZPB 1PX3A 2K9UA 3TH2T 5PAZA 4C56B 5GHWH 2DH2A 2P43B 4LEXL 3MGAA 3OKLA 3GSVB 3OD3A 2XTJE 1UC6A 3MRMB 1KGWA 4ABUA 3AS2A 1OGAE 2OMZB 1OLLA 1AE6H 1MAML 4XPFL 2ATAA 4I9WE 4R83A 4LPXA 3GMLB 3M6DA 3L3KB 3L17A 3PL6D 4G9DB 2O61A 5FHAL 3QEQB 2DMBA 3DX4A 4LRIA 1M4KA 4U33A 1TYEB 3PV7A 3C6LA 3DVNB 2RBLA 3QZBA 3EBAA 3O9WA 1UA6H 3UZEA 4PLOB 5FW8A 3VMPA 5DLML 5JNYB 4U3CA 1FP5A 3O2VH 3F64A 3L2MA 1HQ4B 4NNYA 1AS8A 4NQUA 2WLLA 3B7RL 5D7IB 1BVKB 4RFNB 2Z92A 1YEIH 3C75A 3VD0A 1NCGA 4F3FB 2A9NH 4C4KT 1E2ZA 4UDUB 5FYJD 5A2CA 1G9HA 3QT2A 5AKSA 3LEVL 1DBJH 5HDOA 2X28A 4YR6A 5A7EA 1U36A 2O5ZH 4U6HB 3F12A 2JCCB 5FCUL 3CHRA 3QDME 5DZ9A 5K5YA 5KYUB 1UWGH 1CU4H 3RY4A 4X7TA 4TUOB 2MQ3A 2P26A 1Q38A 3LQAL 5FWQA 3ARVA 2DYSB 4UZGA 4JR9L 4K4KA 2OTPA 4HJ0D 5I6KA 1T80A 4JFDB 3CX5K 2QVIA 1FGNH 4JM0A 3P4MA 4KKAC 4EAEA 3ARGB 1R9FA 1MHPL 1YEHL 4UAOB 3SKNA 2CAKA 2IFGA 3NZSA 1RL1A 3W56A 3CFUA 3EYQC 4OFKA 1IFHL 3QCUH 2X6VA 4LSTL 1P5VA 2WXHA 4X4XB 1ETJA 1TU2A 1KIRA 3OTTA 4JE4B 1ZANL 4YHPA 1TFPA 1JHLL 5D4IA 1SVCP 1PCXA 1C12B 3GEWB 4J3TA 2NX5A 1CFVL 4XODA 3CIQA 4F2EA 5HHVL 1YDPA 4ZAKC 1K9TA 4MXVE 1NSNH 4W9GC 3UYPA 3S7GA 3D18A 3WLWD 4PY7A 3GZOA 3ZE1F 1KXVA 3VFTB 3SY0A 1J12A 3OV6A 1T2QH 3D87B 1KJ2A 4YSSA 1HK6A 3WS6A 4B96A 3OKEA 4TVSa 5GGVL 4KFZC 4W6XB 3NMEA 3OF6D 4HDIB 3SKUD 2IALA 2D7TH 3KNBB 1U2HA 5C08D 1ZT7A 4KRPC 1S78C 3LH2L 4EDWH 3MO1A 1U8PA 2BP8B 4TMPA 4CU6A 1E30A 3TT1H 3RTQB 4ZS7L 2NSXA 1YEGL 1Z5LA 4HUMB 4OCXH 4P06A 5ACLA 2Q7YB 4GQ9H 4TQHA 2BCMA 3LYRA 1DJZA 4GQRA 2IANA 4WUUA 4ZQKB 1FNEA 3BZEA 1ECYA 4G43A 1VFBA 3FT3B 2Y7NA 3W81A 1KLUA 1NMCC 1KLFA 2XN1A 1S8DA 1ETA1 4KBPA 1EJOH 1XT5A 2YPKB 4LCIL 4NO3B 1T0NB 3B1UA 3NTCL 5CEYA 1LNUA 1RD6A 4QYOB 4G1EA 3P9WB 4LP8A 2I26N 2I9LA 5IFJB 4N0CC 2EH7L 2NY0C 5B1JA 3G6JF 3FQRA 1IL1B 1L3NA 4PGCB 1KWGA 1KPRA 4OF8A 2ID5A 3L3GA 5DD3H 5I5RA 3KCWA 1H3GA 1ZHKB 3EZJB 3MJ9H 3PP3H 1I1RA 1NCCH 3AS1A 2X4PB 1KXTA 5DZLA 1IC4H 2YPVL 3HE7C 7FABH 2YAFA 4D0BA 1EEZB 3BKMH 1KDIA 3NFPB 4PJIF 4UQDA 2OI9B 3QFJD 3LXCA 3JWDC 2AABL 2NY3B 4QRUB 4UQEA 4EKXA 5KBKA 2AAAA 9CGTA 5JQ6H 1BGXH 2Q76A 2R15A 3H9SE 4HUWA 5I17A 3BLBA 3L3HB 3VSQA 3P0YH 4WV1B 1YYLH 4ZTPL 3QK0A 4I77H 1J1PL 3NJLA 3NUKA 3FO1A 4HCIA 3HOGA 4K71B 1CYGA 5GJTH 1MWOA 3P77B 1N0XL 2YD8A 5TQ0H 1XCTB 4F9LC 5TH2A 4IOFD 2ADIB 4XXCC 2Y23A 2ZT9C 3PNRB 4N0RA 4X7FC 3E2HC 4FQ2L 1U91B 3WJLA 1P7QD 3J27A 3D2TA 4UV4L 1W8NA 2CLVA 2VXTH 3AACA 5J3HC 5TE4H 4CU8A 4WWOA 5L4JA 3V52L 3D0AA 2V3DA 1MFBL 2VDQB 5EU4A 3MRIA 2DMHA 5C0DB 1E9OA 5I1LB 3L48A 4HLZH 3BGMB 5MENE 4F2FA 5F6HJ 4Z76A 4GQQA 1GJWA 2AMGA 2HRGA 4S0HA 4NKIL 3IXTA 3KLLA 2R1YB 1T20B 2Y36L 1FAIH 1FPTH 2WP3O 4JGUA 2BVOB 4DGYL 3S34L 1Z0NA 2F54E 4R4BA 1KULA 1UOVA 5E9NA 2QQKH 3CTTA 1DFBL 2YEVB 1R0AL 1P4BL 2FCBA 3R0MA 4HJGA 3MRJB 3X1EA 2IF7A 3BRFA 5FYKL 2AZAA 4NZTH 1KYFA 3KLKA 1ECZA 4ONGH 1GS7A 4MAYA 2Y0SA 5TQ2L 2GQHA 2PW1B 1BZ9A 4UIMA 5GRXG 4MA7L 4Q2ZB 4AVJA 1OSPH 3L4YA 2XTLA 5F7EL 1HOCA 3ZE0F 3I9GH 1T1WB 3VD2A 5ECGA 3VXRE 1X5HA 2G5BA 2VLJD 4BBWA 2WYHA 1DQQB 2QGDA 3B56A 2OL3A 3FS9A 3QO0A 4M8QA 5D4HA 1ASPA 2LAGB 5HGHB 4XZUA 1BYNA 3CFEA 4HJJH 1RIVL 3A23A 4H8WH 1W91A 5BNXD 1AFVL 4HOWA 2R2HB 5I6NA 2FEEL 3MLYL 1QLEB 1GIGL 1IM9B 1R6VA 1BM3H 3GHBL 1BQ5A 3WLWC 4F7MB 5I1EH 3IJEA 4XN5A 4X42A 4K23H 3H9SD 1QSZA 1KYDA 2W0LA 3CSYB 3IFPB 5CM1A 1YMHB 3HE7A 4YXKL 2BW4A 2EC9U 2ICCA 4CDGC 1CC3A 5IBLD 3HC4L 5C09A 1X5KA 3HJEA 3K8LA 5EOTB 1OANA 3RAJH 1B90A 1AD0A 5JDSA 1DFXA 3MLSL 1MCOH 3NFNB 3UJTH 3GS4A 4WDIA 4Y2DC 3KS0H 3GSOA 1E7UA 3IDJA 1MHHA 4M6AA 2QPEB 3W9DA 1HSBA 1VZGA 5EF3A 5AYUH 4BINA 1CZ8H 2O5YL 4XP5L 1PIFA 2AK4E 2FJGA 3K80A 4MB5A 3CDZB 4GRWF 4F9LA 2LU5A 3RB7A 4N2EA 5SWSB 5MEND 1Q72L 5J9PB 3R06B 5MI0C 1S5IL 2QADD 3TURA 2XN9A 4G1MA 4KOBA 3GS7A 4AUYA 2AJXL 3UCRA 2ETWA 4L1TA 1VLXA 1CE6B 4GG6E 2CKBA 1P6WA 3FN9A 3U6RB 1LDSA 1N6QH 5F9DC 3T4YB 3T0WA 5E6IA 3QIWB 4HEMA 4M4PA 4XCFL 3WCYA 3QDJA 4OM0H 3JTBA 1S9YB 4JM2B 4NN6C 3MX0B 2D03H 2FD6L 1K5WA 4CN4A 3QUGA 2CO7A 1UXMA 4N3UA 1JL8A 1R17A 3PWUB 5IMLB 3B83A 1AHKA 2EXWC 3LVTA 1W0WA 1WBZB 4MNQA 3BZEB 3U36B 5E0QA 4U1GB 5FGBC 4I5BA 2BC4A 3AG3B 2AGJL 2EKSA 1UXSA 4LVOB 3HS0A 3CFKB 4ONHA 2WXKA 2IWGA 4ZMNA 5C0CE 3SYAA 1SEQH 5EZJB 3GTNA 1G7PA 1QSED 1IARB 3ZTNL 4JVWA 3KH3A 2IWEA 3FOMA 3OXRB 1JGUH 1FLTX 2FJHB 5LG6A 1SUHA 4POYA 3STZB 1X9QA 3QEGH 3ARFD 3ETBF 1RHHA 4Z3EA 1KJMA 5I0DA 3KYMB 4GFXA 4UT9A 1ZT1B 1ZLUK 3G6AA 1H3WM 2DS4A 1BZEA 4LLAA 5IW6A 2H45A 3CC1A 4LFHG 1YPZE 3Q3GA 5HHOE 1DVYA 4I4WA 3V0VB 1BA9A 3TC9A 4FA6A 2AFNA 1U8MB 2J21A 1IEAA 4NNPH 2VLMD 5AAMC 5KTEH 5E2WH 2B59A 3GXUB 4Q4IA 2WTOA 4ANKA 3A22A 3CH1A 4XRCB 5D8JL 5JW3H 1QI5A 4NQCD 4HKXA 4N9GB 3L9YA 1SXCA 2ESVA 3KR3L 5JMOC 1AC6A 1OAKL 2IWFA 4Y2DA 2A6KA 3OLIA 1CYXA 1PZ3A 2FJUB 2BINA 1UYWH 2YQ3A 1MH5B 4KHTL 4ENZA 1NCNA 4FQ1H 3K6SB 1A9EB 4UB0H 1I3GL 4FL4C 1XF4B 2WCSA 4I13B 2JB5L 3IE9A 2BSSA 2A83B 3HRZB 3IFOB 3WFBH 4FQXA 2ORBH 1FIEA 3T0BA 3WLBA 4FF9A 5DEFB 1T83C 1U92B 4GW4B 4U2ZA 1TEGA 3T0XA 5ALBL 4NWUH 4OM1L 5A2AA 5C9JB 5JOFB 1T04B 2DIJA 2DWEA 4Z7AA 4NP4H 1NICA 1Y7VA 1A4JB 4QGTA 4KZDL 4TUKH 5BZWB 3EO1A 3V10A 1L6ZA 3PGCA 4J6IA 4KXZH 4MA1C 4TPRH 3ROLB 4HPHA 1RP9A 3ATDA 3GDCA 3EJQA 4AYBA 3I6KA 2IDCA 3K72B 2CO3A 1AGFB 2NY2B 2UY7A 5AW0B 3DSFH 1UKQA 2A73B 3IU3B 1MFDH 2KMWA 5FGBA 3LEXA 4UUJB 2AXWA 8FABB 3A4DA 1XBRA 3QG7L 4PVMA 2AQSA 4LCCB 5A2JH 1EGJH 3B9KB 3EO0A 4G8GB 4HWUA 3ZGIA 3LQZA 2DWDA 3QH3A 3MRRA 3IB4A 3KGRA 1UJ3C 1RJCA 5FDWB 5HDBE 5G4MA 1E67A 5T3ZH 1R5WA 4FFVD 4XMKH 4BFGA 4LPWA 1BYOA 1YEKL 2BXZA 3CVCA 4KO6A 2WV3A 3DRTA 5TF1L 1DQJB 4JW3A 4AV0A 2XCMC 4L3EA 3JV5A 2FB4H 1A7PL 4ZFFA 3QA3B 3B7UX 3ZKMD 2EACA 3SGKA 4I1RA 3ASWA 2D0HA 1RH8A 3HC2A 3RVWC 3SPGA 4J2XA 1ZHLA 4ISVA 4ODUA 1RZJL 4ZUSB 4W9CC 1UCBL 3T3PE 4PJFB 1EFQA 6FABL 3BAIA 4YVUA 1F18A 4ATWA 1AXSB 4M5SA 3CFMA 5K1JA 5F3HB 5C2UB 4K7PL 1CXKA 1LK3H 4D7BA 3GJFH 3IDUA 3EJUA 3RWDB 5E6ZA 3VM7A 5EC1A 4PD4J 2COVD 3EFDL 4LSPL 2A99A 5KG9A 4PJDE 5IHUH 4TSBH 3T3MB 3KYOB 3VI4B 5LGJA 3BW9B 1DL7L 1MY5A 4I85A 4NQXB 1T7XA 3KG5A 3PP4H 4YSEA 2H47C 1I82A 5KVDE 1UQSB 1NCUA 4GBXD 3QZOA 1NWPA 1T1ZA 2DQTL 4UU9A 4OQTH 1U8JA 1DEDA 3H53A 3RWFB 2NOYA 4P5MB 3TBSB 4O4YH 3DURA 1T83A 4K2UL 4X6DB 1FO0L 1Q90A 1E7VA 4PY8I 4XP9H 3UABA 1LEKB 2F1AA 2KBGA 3BN3B 5CJ8A 4HIEA 3ARFC 5JHDA 4YLBA 1P5UC 4NWTH 3TASA 2K3HA 2WUBH 5AW7B 3UAFA 2JLPA 3QQ3B 4L1LA 3FB7A 5JORB 2I9TA 2IAMA 5GGSA 1CI5A 1ZEAH 3O2DH 1GMIA 2P5WB 2FX7H 1UUNA 4YHIB 1RPUA 3T4AC 1JHKH 2HLAA 4IDJL 2BHUA 3SKOA 3UO1H 3SDAC 2WXQA 2XYBA 2GBUA 2O26U 5JIHA 4PJ9C 4I3RH 5IWLC 4OY9A 4JB9H 1FC1A 1DDHB 4FP8L 2NW3A 2P5PA 4UYPA 3JTSB 4M43L 2P49B 3ARDA 3LIZL 4F7EA 4FEMA 2C3WA 4GAAA 4X9BA 4JFSA 4OFVA 5E8DH 3U1SL 4R97C 3MRHB 4PG2C 2DQFA 4ICXA 3GZPA 3X2QB 1G4RA 3OMZA 2VJ0A 3OXSA 3CE1A 4QHLB 3FNKA 3V4PA 4OZ4A 4O9HH 1BQKA 4ALAH 4JRYB 4LPVA 1B3JA 3I02B 5I1JL 1KCUH 1N2RA 2WO4A 4EUPA 2NTSP 4Q58C 1NCBL 5DMGC 2FO1A 4JDZB 3IXAA 1XD1A 4OGXL 1BFOA 2PP9A 5D7JA 3DBXA 2MPAL 2E7BA 4S1RL 4JFFD 2BCKB 4OCMC 3OKMA 3L4XA 3QQ9D 3Q7JA 3BHBB 4OLVH 5HTSA 1WFJA 3CC5A 4BQCA 3RPIA 3EGSA 5LN8A 1W80A 1RUAL 5E9DE 3BT2H 1G9EA 4Z5RA 4NFCA 4JAMA 4K94L 1IAKA 4HS8H 4L29A 4MXQD 3DHJA 1YQ2A 1TLMA 1FHGA 4E41D 1DANU 1TJHL 4AG4L 5EO0B 3VXRA 2DBJA 4N26A 3UO8B 4NHCL 3WN5C 4HMDA 3OAZH 1GY1A 2CE6A 2QVMA 3KXFE 4NAQA 2K4AA 1QLFA 5E9AA 3VXNB 2PTTB 3KPLA 2KZWA 5JXEA 3QG6A 2AQTA 3VXSD 1I1FB 3WFHB 4APQB 2ENPA 3G5VA 4PG9A 3UPAA 5C6PB 4F33B 4IRZA 4Z7NB 2ICEA 4QWWD 3FDWA 3QFDA 4F37K 3GSNH 4LLYA 1QRNE 2GAZB 3M1BA 2ZP8A 3O3BA 1KCBA 2Z31C 1YRKA 3DHMA 3FTZA 5FGCB 5E51A 1WWWX 4WJG3 2HG0A 3W39A 1JYNA 4HJEA 3VXUD 4Q14A 3O3DB 1G9ML 2VL4A 2WC7A 2CO1A 4IHOB 3F7YB 4UINH 4J39A 2AI0H 5I74B 1K85A 2ZUUA 1RIUL 2AK4A 4FJ6A 4PJ9A 3ECUA 2KQMA 4NO2B 1Q9OA 4K7FB 3D48R 4YLCA 1I3RB 3PWLB 4P4KC 3GQFA 2ZX8A 4KQ0A 3BGAA 1D7DA 3K81A 4O2EB 5D1XD 4Z7IA 4HHGA 4OCYH 1RIHH 5IVNA 1F4XH 2JB6B 4FKEA 4PG2A 7CGTA 3V0GA 4AJ0A 3SDXA 2UUDK 5DTFA 3PHAA 3LSOB 4GBXC 4GUQA 2E75C 2A9CA 2DQHL 3GB7B 3IMUA 5MERB 1IAIM 4NZUL 4U6XA 1X5JA 1FYTE 1S7VA 4I0PA 4JFPB 2W59A 3MUY1 1WTLA 4KNQA 1JJUA 3HPJB 2FIKB 4Z0BL 4A6YH 1FNGB 3A67L 1WUZA 4GXFA 3GSRB 2WMPA 5L2KB 3I84A 1RSFA 1H8LA 4DO6A 3D3VB 1GCYA 5LB1A 5C0CA 2ZXQA 3KVPA 4HAGA 5DUMH 2CGRL 5DJXB 5GRUL 1CICA 4BFKA 1RZFL 4YDIH 5AZ2L 1F56A 3W1ZA 5JPNB 2R8SL 1WFUA 2WVTA 1EBPA 3LNGA 4QYAA 3BPLC 2AJSH 3SDDC 4OKDA 1J05A 3MNWB 1K5NB 2LGNA 3W0WE 1CXLA 3VWJA 1U8OB 2NY5C 3B37A 3VFMA 3RY5A 4LSRL 1ZKAA 4JRLA 3FT4A 3M17B 1IAOA 4C56E 3VB8A 4UYQA 5F7YC 2QHRL 1Q1JL 2IPTL 2NW2B 3O0LA 3PWJB 3QUZD 5AVTB 2OLDA 4K8RH 4AIOA 1QSEB 4Z8FL 2JKLA 4YEFA 1YPZF 4XPAH 2IPUK 1JXDA 5GGVY 5EMYA 5K1VA 5CP3H 3VD9A 4LCVA 1ZE3H 5AL8A 4BELD 3CZLA 3UC0L 2CALA 2WQAA 1I75A 3QEQE 5DJAB 4JHVA 2JIXA 1GOHA 4AH2B 2Z31A 5D7EA 2J1YA 1KLGB 2C9AA 4MJ6A 1Y1DA 1XH0A 3RVTD 3AXLB 3LMJL 1AYRA 2BFVH 2VMDA 4HWBA 2WXPA 1INEH 2F19L 4AT6B 3EDEA 5DJDB 3ZTCC 4PN6A 5D7IE 4PJHB 2C4FU 3QWRA 4WFED 2E9JA 4YMPA 1QFUL 4B5ZA 5K39A 3T0VA 5F9WC 1M53A 1JPSL 2CR6A 2DD8H 2FLMA 2HT3C 3AQXA 4JG0L 3PJLA 5A43C 4CUCA 4TUUA 2DWSA 2JCCE 5D5MA 3FONB 3P30L 3NIDB 5F96L 2LTQC 1WZKA 1A7OH 4E9RA 4PJCB 2F53D 2DTSA 4AY0A 3HVDA 4P59H 1B9ZA 3FTSA 2VQ4A 5AB2A 2WTRA 5AVVB 3D0LA 3B7YA 4JFDE 4YQXH 2IGFH 3MRKB 4RAVA 4JFTA 2J8UB 4ZXBD 3HNVH 3QJHB 3N41B 4J6RH 1HQRB 4QWWC 1YEFL 1ILSA 1MQKL 4FE9A 4MA8H 3MNVB 1M3IA 1FC2D 3I3EA 5J13C 1PLBA 1G9NL 2WINA 4OKVB 2B9AA 4DUXA 4MD5A 4UTBL 3WNMA 1NM9A 3QRGL 3LS5L 2VIRB 5BO1L 1VA9A 3RZCD 3MV9D 3HVNA 4XPGL 1RZIB 4J5VA 1CMOA 2NY6B 2NT0A 4JDTL 2DIAA 1KJ2L 3MUGB 3RVXC 5FOBB 4K07A 2FZ3A 2YMXL 4QTHA 2GSIA 3K0WA 4F2MB 1WRFA 3QUYA 3GPSA 1ORQB 3IWUA 3SDDA 5AW8B 2XA3A 5HDBF 2K7PA 2BIQA 4LIQE 4JRWA 4UT6A 1RK1B 4CADB 4H0HB 1QYGL 2JJTC 2VQTA 3QS3A 1CL7I 1OB1A 1UEMA 5G5DB 2FBJH 5ES4B 3H42L 5CCKH 4ATTA 4XCCL 1T7WA 3VXME 1OAQL 5HYQB 5LBGA 4LESA 3NZ8A 2ZPKL 4XO8A 5SV4A 4LF3B 4AZUA 1OSEA 2JWYA 2CIKB 5B7FA 3NGBC 4WUKH 2VR7A 4QF1B 5IT2L 3T3PF 5D72H 1G7IA 3QNXA 4NN5C 3VYNA 2WB7A 4LQFL 3KGSA 4Y4KA 5B3JE 3MXWH 4YBHA 2Q86B 4MSWB 2VLKA 4TV3A 5TJWK 2DYPD 1LO0H 5DQ9B 5IB1B 5IQ7L 1DO6A 2K9FB 1WAEA 3V8CA 5GRZA 3WEXB 4PJDA 1WITA 2IGLA 1PY4A 4PAZA 4PJDF 3OVUB 3MCG1 3FB8A 5F6IC 5CINH 2G2RB 4L0ZA 4CDHA 4QJ5B 5FF6A 2X9XA 1S9KC 5AQ0A 4PTTA 2AJVL 2BWQA 4XBEL 5C0BA 1HAUA 1QBBA 2XVBA 4F57L 4ZMPA 2MSPA 2W94A 4WI0B 4NRYA 3EHBD 3EJCA 3NIGE 5CSZA 4YGVB 4UQ3B 4WW1A 3BEWA 9PCYA 3B34A 3EFOA 4R0LC 5F9OL 3TV3L 3VFWB 1AANA 1I9IH 4L3AA 1U8CB 5CZXC 2GTZB 2BSED 4FRWA 1XF2B 2N1KA 3QXDA 5GZOD 4RNRB 2X2IA 2ROYA 3ALPA 3CFDB 3QUZC 5DMJB 2AAVA 4N0YL 4ZNCD 4Y8DC 3VGHA 1U3NA 3HMXA 3QSKB 4RGNB 2N3JA 2X1OA 4XP4H 1QQDA 2WXOA 2XQYK 2Y07H 2C7UB 3MAWA 1RZQA 3RWGB 2ZD0A 4LOFA 1IC5H 1LTXA 2G9HB 3BKCL 1X3DA 1XGPA 2OR9H 4W9FC 4JO1L 5CU9A 1XF3A 3D34A 2DICA 1S9WA 2PW2A 4ZUTA 2JV6A 5CGMA 5LJYH 5E08L 2VL5A 4HIJB 5I2IB 5KSBE 4NLAA 5ABZA 4P3CH 4WHYH 4X6FA 2A2QT 2F7QA 2C3GA 4MCZB 3V0JA 5IOPA 1U3HD 2FLBT 4TLKA 3T8XB 2FK9A 4ZZFA 1N4XH 3RVTC 1HXYA 3ZIYA 1K4DA 3VXMD 4ZMZA 5IB3B 1PEZA 3CMOH 1I1AA 3BZFA 2J2ZA 3MV7D 3B2PA 1AQMA 5ANMA 5J1AB 1HZHH 5E8EB 4P23D 5DQJB 2NXZB 3L9BA 3LKQB 3QDGB 5CWSB 4JPKH 3HZYA 4I48B 2JJTA 2Y1VA 3ZVVA 5LQBH 5EULV 3V6OA 3ULUL 4KTDH 4G9FD 4P04A 1BQLL 4GRLC 2LV4A 4N0UE 1Z5YD 4BZYA 4HJTA 4J3OC 1BIIB 4XBMA 1F8TH 1JPFA 3MU3A 1L5GB 2ZCZA 2X44D 3T2NL 1WPCA 3OZKA 4W6WB 4OLZL 4PGZA 4KQ4L 4LSUL 3G5ZB 3QO1B 5L2JA 4LSVL 1AO7B 1N5YH 4BZ1H 2KQNA 1IGYB 3PLYA 4HJ1A 1JFQL 1AGBB 1U9KA 3MNZB 4F7KA 1T03H 1UB5B 3IDXH 1MDTA 4FQHA 3N6YA 1WAAE 1FQ9C 3W37A 1I8IA 3ZDYB 1LEIA 2OL3L 1JRHI 2EINB 2CUAA 3LKPB 3GSQA 2ZE0A 1JZEA 3EOBA 3WIAA 4AL8C 1QASA 3HNSH 4KY1L 1Y18B 1A2YB 3TYFA 3CN4A 4PB9H 5GHWL 4JFFB 4K3EH 4TNGA 3V95A 1ACYH 2W9DL 3U9UB 4Y5VB 2QL1A 4Y7OC 3QJQB 3KXFA 4EMZA 1A8JH 3RX5A 1MW1A 2M26A 4KHXH 3B2MA 4LNRA 1WT5A 3HPLA 3RHWF 43CAA 2XV0A 4CBZA 3PWNA 4PJ7A 1ZDSA 2B20A 5F6HI 3ES6B 4CJ1A 4KGJA 1ODAA 1CYWA 3TYGL 4F7PB 5FKAB 1DVFD 3BP4A 3JXAA 4XVJH 4Q52A 4FQIH 5CEXA 2HJFB 3OLGA 2PPAA 3OJDB 3ZL4H 1J1XL 3IU4H 3TN0D 1WEJH 4KK5C 1IT9L 1BW8A 1JAEA 4U49A 3O2VL 1HHHA 3VFUB 5DK2A 1XTLA 3EXJA 2AXGB 4ZW8A 4IKIA 1KTDB 4CGTA 5JIIA 3JT2A 2H2SD 1BQUA 4XC1H 4LHJB 1OK0A 4QXGL 4L4TA 4RFNC 1TVHA 4OF7A 1IV8A 4AEFA 2ZX5A 3SO5A 2CKBL 4WSJA 5DZVA 1MAKA 2NCMA 5TK4A 3WS3B 1TTFA 2EYTA 1EJ8A 1FNSH 1DEEA 5EDXA 2YQ2A 3L5WA 5CCGE 3NBNA 2AVFA 1EFXA 1GYUA 5JYLA 4BCZA 3UG4A 3EHBC 3ZGHA 3EDKA 1JF1B 4HPYH 5TD4A 3SYOA 1FYTA 1OF0A 4GRLA 2UWEA 1J48A 4JS7A 4N2NA 1JBJA 3HI5H 4MA3A 5DJZA 1T22B 1OV8A 3HB3D 3S37L 3ARGC 4CL7A 3P69A 3VVWA 2TAAA 1Z3RA 1WH0A 4J3OF 2OMTB 4QHMA 3KPPB 1W72B 5GZOC 2X4SB 2WBJB 3SIKA 4N8UA 3FQNB 3PDOB 4JHAH 4K3DL 1DBAH 3GKZA 3PF2A 2HCZX 3DUSA 4M3HA 5F0LB 4Z3GA 4YIQA 2IQAA 3EJJX 4Z78B 1LO4L 4WFFD 1PZUB 2DQJH 2EVFA 4X9GA 3MROA 4GLRI 3ETSA 4OCSH 5CSGA 1O9WA 1T66C 1IFRA 1NLBH 4XO3A 3C12A 2X4TA 1ZSDB 3O11B 3W0WA 4DGVH 4N0FB 5IVZB 4TRPH 1H3XA 1C1EL 3BVDB 5DZAA 5DEGB 2B5IB 4KKNA 4AIXA 2ENQA 4UV7L 3S36L 3GMMA 1IGTB 1GZPA 3BWAB 4C56A 2IOMA 3TT1L 4RGOH 2CNZA 1MCWW 3FN0L 3HZKB 5C0ND 4OCXL 3GSVA 5KVGE 3CLEH 4LDCA 3MRMA 4KFMA 3T6WA 1GZHC 2VITB 4HIHA 1A64A 1OQXA 1QPXA 2OMZA 4R4FH 3RTQC 1DLFH 3FU9A 3G3LA 2IAAC 1TKWB 2YD3A 3V9FA 4MWFA 3GMLA 3RWEB 3L3KA 3KLDA 4G9DA 4LCWB 1JYVA 5EDSA 3CZFB 4S0SD 4YL4A 3DO7B 1AZBA 1E3FA 3DVNA 1FN4B 4YNYB 4S1QL 2FYVA 3TCLB 4Y89A 3T0EB 5JW5B 3FPXA 4MB3A 1YMMB 5H2BB 4J7RA 1KJ3L 4ODWB 5JNYA 2FL5B 5EU5A 2Y2YA 2TRHA 1HQ4A 1R3IL 4G82A 1G6RB 2WZ0A 3CCHA 1BVKA 2AERT 4K7PY 5D7IA 5T1DL 3ZE2B 4F3FA 1OW0C 5D7IF 3KCPB 4QOKD 2DLGA 4RMQA 4UDUA 3OWRA 4NCDA 1AD9B 3SE9H 4G71B 4X7CC 3ZN6A 2ZSWB 3MBXH 4NAJA 3JZ7A 3OWEA 4G6AD 2JCCA 1KYOJ 3M7OA 5KYUA 1FFNB 5EEVA 3WMPA 5EORH 4TUOA 2JCCF 2FO8A 2B1AL 1CFTB 5KBLA 1PZ5A 1YQVL 2KL6A 3DX7B 3FT2B 3FU3A 4EN3D 1RZ7H 1S7XB 2YQBA 3U7AA 4JFDA 4HAKA 2OI9C 1XCQB 1GA2A 4LCUB 3EBGA 2NY3C 3UTSD 3ARGA 4M00A 4GKNA 4P2YA 4LGSB 4GKSB 1K2DA 4TTDC 4WV1C 4KUZL 3P2TA 1M05B 5ICXB 2PR9A 3AZUA 5KJ7E 2XTSA 2VUOA 4OV6F 4X4XA 1CLOL 4JUSA 2PP8A 3EYSL 1MIML 4K71C 4Z3HA 1OHZA 2J43A 5A3ID 2IG2H 3UTQB 4MKTA 2EE0A 1C12A 5HJBA 1ZVNA 4G8GE 4ZXBB 2N7BA 4N2HA 5DDHB 5E6UB 4PREB 5EIIB 3AG4B 3MRGB 4OB5H 1D9KD 4RWHA 4NPYB 3IJSB 3VFTA 3KL0A 4LSSH 2DWTA 3NJXA 4P2QB 5D55A 2V5YA 1CXIA 1GMEA 4FKHA 2KPWA 2IQ9L 4LAQH 2OMUA 4HDIA 3TJEH 5IJDC 3KNBA 3MUZ1 5JOEA 2ZF9A 3VQLA 5JO5B 1ZCRA 1C8PA 1JXKA 1RJZB 3RWHB 4J28A 1VEMA 5BJTB 2Z8VC 4NQSB 3RTQA 1A65A 3KWTA 2WXRA 3J7HA 4UIKH 1R33A 4PJFE 1V7NH 5F1KC 3DOSA 3EJZD 4D0DA 2Q7YA 1NUGA 4R90H 1DJYA 2D31B 5EN2B 4WO4B 2MCAA 5B3JF 4G7VL 4G7SB 4ZQKA 5F1OB 1MFAH 3HB3C 3VFRB 2P52A 3FT3A 4WSGA 1O6TA 3L1GA 3JWDH 4RISL 2Z7WA 3I74A 4G7RB 3EGXB 3SKJL 1EPFA 2GK2A 5CR8A 2YPKA 4MS8D 1TITA 3T3ME 1FVEA 4NO3A 3VI4E 1HINL 3GLAA 2DDQH 4QYOA 5GS0D 4XOEA 1CGWA 5FO8A 1N18A 5IFJA 3GMQB 4X5WB 4DN4H 3WEMA 2YKLL 5JLZA 1OM3H 1IL1A 3QAQA 4PGCA 4NC2B 1T7YA 2OJZL 1L0XA 4KY2A 2H32H 1ZHKA 2FEDC 4X6DE 4FNRA 4H20L 1PPIA 4L4VD 4XZ4A 1YVLA 3VNYA 1XL6A 4WNSA 1T5KA 1YEEL 3WELA 3DK2A 3ILDA 4LLDB 1EEZA 3N06B 3BVUA 3NFPA 5C0NC 3MV01 4NZRH 2VMEA 1NIDA 5FYJH 4NERA 2F58H 5KAQG 4QRUA 1YC7A 2P5WE 4NO0B 4XVTL 1DSFH 5IBUB 2I7OA 3L3HA 3JTTA 3RKPA 3MRBB 2CKNA 3APDA 1HYRC 4HT1H 2HVKA 5IIEB 3LHPL 3NABL 2D7NA 1K4CB 5IGXH 5BRZD 2Z93B 5IVOA 2ERJB 3P77A 2PXYB 1ZD6A 1XCTA 3VXTB 4P2RD 3QQDA 3FOLB 2ED6A 4WWKA 1L9OA 2ADIA 2EH8H 1UH2A 4PRPD 5AD0B 4P2CG 3V4PL 1U91A 2CCVA 2MOQA 3AJ7A 2JJSC 2OSWA 5L4MA 1JOIA 1GW6A 2NUTA 2VZUA 1KXHA 1KELL 4OJYA 3WU1A 5I1KH 3CD4A 3KS0J 3V0DA 4YHYC 1EHNA 4ELME 1LM8V 1IBGH 2HVBA 1JN6B 2XOTA 5C0EB 5DEJA 2ZXAA 4X8JB 5C0DA 4XN1A 4PB0L 3GKWL 5I1LA 4YFEA 3BGMA 3EYFA 2BSTB 4BJLA 4JRYE 2CCLA 2ICES 3G5WA 2X4NB 3QIWC 4KTEH 5DGQA 3HA0A 1D5XB 1MEXH 1T20A 2R1YA 2VAJA 3IDMB 1GTNA 3BXNA 2BVOA 1WGOA 5IQNA 4KMQA 1MCEA 4PLJD 1G1CA 4F91B 1IO4C 3BIBX 1UM4L 4QPEA 4DKAA 4PRNB 3S3PA 4U1GC 4P23B 4U1MA 4HZLB 5HGAB 3ZDXB 3IGLA 3MRJA 2OK0H 3UZVB 3PHQB 1P9MA 1BFTA 4LVOC 1KPUB 1WAAA 2MOVA 1UEYA 2IDQA 3FH7A 3O3UN 5L8JB 2PW1A 3I75B 3MJ8B 4OJEH 2P5ED 1WAAF 2X89D 3AREB 3F58H 4JN1H 5DZNA 4QXWA 5HYJD 2Q6WB 2LQRA 2V0AA 4Q2ZA 2YARA 4IRSB 1JDAA 1T1WA 4QXTB 1FA4A 4Y9FA 1J8HB 1MCRA 1RZPA 1FRGH 5HGHA 5FYLL 4GY4A 1J8SA 2NLJA 1UWEH 3I2CL 3MV8D 5TPWH 4U3SB 1MCIA 2G2PA 5I73B 2R2HA 3MLXH 1B0IA 2A5UA 3DKHA 4F7MA 3DVGB 1U93B 2OCCB 1BXVA 1NBZB 1A4KB 1BAGA 4I9XA 3U48A 3QWNA 3RRQA 3CSYA 4Z7NE 3A6BH 2J88H 4W1TA 2X2JA 5LWYL 3VD1A 2WXFA 3VU2A 1ACCA 3JWOC 1T5WB 3APFA 4IJTA 4PD4K 3Q01A 2J1XA 4M5ZL 3P4OB 3KBHE 2L3BA 4O02B 3HR5B 4XXWC 3SQBB 4KO7A 4QRQB 2O6FA 4LLWA 1O5PA 3NFNA 4JFEB 3ZR5A 2C9QA 2HRHA 4TSCH 3L5JA 4FHKA 3RA7L 3EJZC 1YNLL 1CTMA 5D7LA 5C7ZA 3NSJA 1KCVH 1F6AB 5K9KB 3K3QA 4AXWB 3CZNA 1RURH 2E5EA 3CDZA 1ONQB 3BH8B 5E00B 5MEPB 3OGCB 4QHKJ 3A4EA 3PUCA 2YGQA 2XG5B 5SWSA 1YY8B 4ODTL 3B7TA 3R06A 5J9PA 4HK0B 2IBBA 25C8H 2JJSA 4TQEL 4XB3A 3LZOA 4KK6C 3GMNB 3ZTJH 2CDGB 4IJ3C 5GS0C 4PWJA 3SSGA 4G42B 3P0GB 3U6RA 1H8NA 3T4YA 3LZFL 2KLSA 3K6NA 5ID0B 3WDJA 4JKMA 1M3JA 5T3XE 5D6DC 5J1TC 1S9YA 4JM2A 4ELKB 2QVTA 1LL1A 4ODSH 4U1SB 5D93B 4MCNA 2YSTA 2ZCKH 4JM2F 4A7GF 3AM8A 4DEWA 3DSNB 3PWUA 2NY2C 4AVHA 3ZZLA 3KPNB 5IMLA 1KN4L 1A8ZA 2QQQA 4KRLB 3U36A 2ZUQC 5L2KE 4HPOH 3NIFE 4HWZB 1R3KB 2XXGA 3FQTB 4PYGA 1RI8A 2AEPH 4Y4FD 3D3VE 4N2LA 5DURB 1G1KA 4LCCC 5DD1H 5EZJA 5HP5A 3WEBA 4JANB 3S96A 4NJ9H 1NBVL 1L9NA 3OXRA 2EDHA 4KJPD 2FJHA 4MAUH 4D9QE 2YPLD 2FB4L 2XFGB 2VOTA 5G2NA 3STZA 2NZ1A 3IFNL 5AW4B 5JXAH 2GCYA 2E7DA 3GM0A 4Y5YB 4PBXA 2FSDA 4V1DA 4WNJA 4ZQTA 4CSTA 2XRAL 3KYMA 4LLUA 3S9DB 1SDAB 4K9EC 3FUKA 1ZT1A 4TNEA 4XCNB 4PJBE 3RDTB 2QR0B 2F61A 5HI3C 3KWXA 3V0VA 3O2WH 1JGEB 1U8MA 4N2CA 2WTPA 4ETYA 1BLNB 2ZOKB 4P8QA 4DZ8B 4GI8A 5HDRA 1BAWA 3NJVA 4P48A 2EDFA 3ZUNC 3MJ7B 4F93B 2D2CC 3DRQB 1WA0X 2ZXEB 2WUCH 4HWBL 4LNVA 2O72A 1GJIA 2HLFC 4N9GA 2UZYA 1SFHA 5T1MB 4PLJC 4B60A 4IBQA 1G7JB 2A9ML 4MNGE 4QAWA 4WW2A 2FJFB 2F5BH 4XI5C 2K0RA 1Z9OA 3W9EA 5GISL 4M8RA 4NZ8A 2V37A 5E2TH 4UMGA 1MN4A 4XOBA 3K6SA 1A9EA 2IDUA 2MEJB 1XF4A 3T6ZA 2XA8L 1CDUA 4BFFA 1GHFL 1SQ2N 2A83A 4XMWA 3HRZA 2UXTA 5KANI 1MREH 1E4HA 1FNHA 2E76C 2VW7A 3LB6D 4HUXB 4MRBA 2MKWA 4C57C 5T3XD 1U92A 4NWTL 4GW4A 1UB6B 5HDLA 4L8BB 1R5VB 2ZXCA 4MJ2A 5JOFA 3NIDE 2OYKA 1T04A 1ZEAL 4GAJH 2DLFH 4PJCE 1E6JH 3GXDA 2EP6A 1A1NB 4U6VH 4MBRA 4O2FB 4Q9QL 5BZWA 2EIMB 4P5TD 3HRPA 1W8OA 4GP8B 2HLEB 2XXFA 4JB9L 3UBXA 4EUPH 3PUUA 1AGFA 2WIMA 4UAHA 4WWPA 3BPNB 4MMXA 2G4EA 4MCYA 2A73A 2IH9A 3B7SA 3IU3A 4D9QD 4ILDA 3QIUD 5E8DL 2Z1PA 3LN5A 1HHGB 2QDVA 3VG0L 4MMZB 8FABA 5CLWA 4KX7A 2FT7A 3RWJB 3SCMD 1C5BL 3W11D 3PDDA 4LCCA 3B9KA 4G8GA 4UT6L 2VUYA 2W95A 3VRIB 3X3FH 4HGWA 2X9ZA 2MCMA 3VD3A 5IF0B 4F2ME 5BPPA 3NCYP 1XGZA 3MRLA 1A7QH 3PABB 1OAUL 3FSVA 2L7JA 1DJGA 1NWOA 1Q9KA 1RVFL 2CRZA 3NSYA 3OMNB 1CTOA 1EV2E 1DQJA 4XNYH 4OF6A 1WGVA 2APVA 1EEYB 2YUVA 1NMBH 3QA3A 3GSXB 3ESNA 3IDYB 3ATBA 1F5WA 4XMXA 1M6OB 1NKGA 3GMOB 1DYZA 4ZSOE 1U8QB 2W65A 4ZUSA 1KB9J 1UWYA 4PJFA 2QPFA 4HKJB 1CS6A 3KAAA 4PJFF 4IRZH 2ADGB 1AXSA 4HS8L 3HZVB 1YJDC 3CQFA 2BNRB 1EXUB 3TBVA 4OLUH 4XNMB 5F3HA 1BMZA 2YRBA 1Q8MA 4X6EB 3RWDA 1KG0B 5DJ0B 3UZQB 1ZLEA 2VYRE 3KEDA 1SOSA 1O6SB 3AROA 3ZL1A 2VZTA 4WZ9A 1B4TA 3BH4A 3KYOA 2GC4C 4JKWA 3BW9A 3ILQC 1KT2B 2OQJB 4NQXA 3VI4F 2ENJA 3T3MF 4Y1SA 3RUGB 4PS3A 3BSZH 3M86A 2CM5A 1UQSA 2DWYA 5I26A 1UZ8B 4I2XB 2NDGA 4WI8A 2H0JA 1NCHA 3RWFA 1LWJA 3BIKB 4NKMB 1MWAH 2OYMA 1GJUA 4PBDA 3TBSA 2OP4H 1N59A 2PYFA 4APQC 4GINA 4LPYA 5ETUA 4OCWH 4QRPB 3VX0A 4X6DF 1BVOA 3MI6A 2VXUH 3MOBH 4H0IA 1LEKA 1EAOA 3VJ6B 3HMXL 1MSPA 2YD1A 4Y19B 3I9IA 4WKZB 3C2SA 3QQ3A 5JORA 5ACMA 2P5WA 2YFNA 2NR6C 4YHIA 3L7EB 5C0IA 3CDGB 4RGNE 5MP6H 4PV9B 2DJ4A 3SHSA 4E9XA 4LLMB 3HIZA 4F27A 1NJ9B 1H3UA 3OLDA 4OCYL 1DDHA 2CJUL 1LP9B 3JTSA 3TA4D 4Z77B 3G6DH 1ID2A 5JIMA 3WY3A 2BOCA 4QTFA 4N2DA 3MRHA 4PGJA 1P84J 1OAXH 3OQRA 2AK1H 3S8WA 1V7MH 4G2AA 2GIXA 1B0WA 5DO8A 2P24B 1G0XA 1YY9C 1DQVA 3HFMH 4PJ8D 4FZEH 4WI9A 4EJ1C 1GSMA 3QDGE 3ESOA 4JRYA 5HDQH 3MXVL 3I02A 1IU1A 4P2RB 5GRJH 1II4E 1PLGH 2W91A 2QSTA 2ILLA 3H7LA 1NCDH 2GI7A 4KI5E 4JDZA 1AHMA 3ZZQA 1QUNB 1LO3H 5B8CB 1P7QA 3FUHA 1A7BA 5GJSL 2BCKA 4QXUH 3FRUB 1WD8A 1AO7E 3NEOA 4JFUA 4P5TC 3PGFH 3BHBA 4DK5A 2M83A 3D5OF 3HEIB 4R9HA 4YDIL 1K6QL 2QSCL 1HWWA 5EIIG 1E65A 4PRHD 1ZPLA 2YWZA 4QTIL 4TULH 3ZDYE 4ZMWA 5JPNC 1FDLL 4JPWH 2MFNA 4XTRC 3QIUC 4AJWA 2OA9A 5EO0A 4CVZB 4KVCL 3GMPB 4XAWH 3F85A 2BM3A 2HPOA 1FE8H 2EIKB 3BQUD 3W11C 3KHQA 3U0WH 2AF2A 5F7MC 4C83B 2R0ZH 1RUPH 2YLKA 3KPMB 3V5HB 3AS0A 4NIKB 3C08H 3VXNA 2PTTA 5E2VH 1EIBA 1I1FA 2PO6B 2NY1B 3EYUH 3WFHA 4APQA 2Y3NA 3BE1H 5BUGA 2WNGA 4ZMLA 5KW9L 3SGJC 4JL1A 2X1WL 3F3HA 1TF4A 1YYML 1IZKA 1E9QB 1M7IB 1E5AA 5AYQA 5IW1B 4Z7NF 2FQGA 4NI6A 3DX6B 2GAZA 2XIBA 2G0LA 1URIA 3ZKQD 4D2NA 5F3BB 3MCYA 2PCFB 2M8XA 5BS0D 5B4MD 1PVHA 4GMSH 3O3DA 3ABLB 2CHWA 3IETB 4IHOA 4G59C 4NSKB 1L9MA 5CLYA 5C0JB 1SLVA 5EF0A 1SDYA 3GI9H 3H9YA 1MFMA 5HGDA 3N0AA 2XWJB 4NO2A 4PRAB 3X13B 1RXLA 4K7FA 3EFFB 2CIIA 4TM9A 1I3RA 3L4UA 3PWLA 3EBIA 4TQ8A 3G9VA 1B0RB 2XWTA 3CK0H 1IIIA 1A7OL 2JB6A 2F5AH 4BH7B 4NQED 3SN6N 2KC0A 4RBPK 5L88L 4DWHA 2HX9A 1SXNA 3UAEA 3LSOA 2VJXA 1I1YB 2OM5A 2IGFL 3HNVL 4ZPVB 3H1ZA 1J1OH 1DUYB 3GB7A 2NY5H 4HKZA 5MERA 1R3LB 1TQBB 3PIQB 2A77H 2VDKL 4NYLA 3AWEA 3QJRB 4U0RB 5IBUG 2VXVL 3UP6A 3ZKXB 1JF6A 4JFPA 4MA8L 3TEWA 2F0CA 1YECL 2WOBA 3INOA 1K3ZA 4Z7WA 3S3DB 1TNNA 4YDVB 5I23A 1IC0A 4L8CA 3W2DH 4LSQH 3PWPD 1JZ8A 5H35B 3GSRA 2JCWA 1BZQK 1D3CA 3TX4A 2PP7A 3I6LD 1RFDH 2YUZA 3D3VA 2NTFB 2CH8A 3TFKD 4P9ML 1DQKA 2EQDA 3H3KA 2EDDA 3NDZE 4ZUWA 1NFKA 5DJXA 5HHNB 2NY6C 3QPXH 3IN0A 2FECI 4DGUA 1CE1L 5IFHH 1QWHA 4EOWL 5JPNA 4NC1C 4U7SA 3UTTD 3FTYA 3JVGC 3OKOB 4Q7DA 3MODH 5ISZB 3MNWA 4NQQA 1K5NA 1ITCA 2HKHL 2PCYA 4K73A 5CCKL 1U8OA 5IOKA 2BVYA 1BVNT 4G6JH 3C60B 2PCPB 35C8H 4AJYV 5KVDH 3FSZA 3MBED 1Y6KR 2PTVA 3M17A 2EICA 2Z65C 1KPVB 3M7FB 2YK1L 4OFQA 4WUKL 2R4RH 1R47A 5LHDA 1DP0A 2NW2A 3CBKB 1JGVL 1XV8A 3PWJA 1QSEA 3E1ZA 4FLOA 3LKOB 2NY7H 2R9HD 3Q1SL 2BIIA 4TOYH 5I1DA 3ECBA 1DCLA 5H37H 1F3JA 3SGJA 2CJTA 1HWHB 3DV4B 5IQ9B 2V7HB 1YUHA 2CXGA 3ULVE 2VAAB 1NOLA 4LCWE 5CO1A 3EJYC 5C0RL 3CX2A 4KAQH 5DJAA 4AH2A 4KRNA 3US0A 2ODHA 1KLGA 4ZUUA 2P8PB 3T0EE 4AWJC 2EO1A 5ILTL 5F7DB 5EH1A 4Z0XB 1YMME 1ANUA 4FYRA 4KOCA 3SD5A 3AXLA 1PKQB 5I19H 1R1CA 4HALA 5TFSH 4YHOH 5IV2B 5IROD 4RQQB 5DS8B 5KAQF 3RBSA 5CD3B 2K7QA 2CO2A 4GIOA 5DJDA 2JKNA 3RWIB 3QUMH 4PJHA 4YHZH 3ZE2E 5GGRY 1CCZA 3CVHA 1E6OH 3WE6A 3KLQA 1VGEH 3MYJB 5HSFA 5HYEA 5C70A 3NN8B 4HLJA 3ZW3A 5K93A 3SKMB 2WZ6A 3IGFA 2BNQD 5J12B 3FONA 1D6EB 5C6WH 2WO3B 4K3JH 1LE9B 4XPBL 1ES0B 1KV7A 4GW1A 3Q48A 4A2MA 3NIDF 1RZKC 1PTZA 2OJEB 5E5MB 3TGXA 5L7XL 4PJCF 3VNZA 1NFDA 1TZGL 2R39A 3OG6B 5E2JA 4FQJL 4KDWA 4IBVA 4FG4A 3F83A 3MRKA 1KBKA 1SLWA 2J8UA 4M93C 3K5SA 2HKAA 4RGNC 5LNDA 3QJHA 3C9NA 1HQRA 3FO0H 2J8UF 5DHXB 4P57B 3N41F 4B41A 4P3CL 3SDCD 5HJ3A 1IAIL 3CLFH 4ZT1A 1THAA 1N4XL 3NRQA 3O45B 3MA9H 2VIRA 3WGVB 3MR9B 3HC3L 3RIAF 1LDPL 1ASQA 1IQWH 3ZL2A 3MLTA 5T1KB 4XWGL 4LU5H 2BOBB 3ILPB 3ENEA 3MUGA 5FOBA 3GXPA 3EH5B 4MQSB 2Y22A 4F2MA 1ZY9A 1KY6A 4FFYA 3TH3T 1MJ8L 5FFLA 5KSAD 1DZ0A 1FSKB 3QJZA 4LVNC 1RK1A 4U1HA 4P2QE 3IRPX 2NXZC 5DI8B 1QVOB 4AVKA 2Z8SA 5F7LB 1QBLH 5G5DA 2D3LA 4HUKB 2QQNL 4HIPA 2G30A 2H8PB 4I0KA 1TTUA 4UNVA 4KI5C 5HYQA 1TOXA 4LF3A 2CIKA 5CILL 2VB5A 3WMSA 4UOW1 1T03L 3SJVB 4OCRL 4BZ2A 4WEUD 1YYCA 3FT1A 4EVNB 3N9GL 5AAPA 1PMYA 1TQTA 1BMWA 4UF7C 4UI2A 1NGPL 1CVSC 5DJYB 5EHFA 3DTUB 2VQ1B 5DQ9A 4WEEA 1DBKL 3WEXA 1XAKA 1NPNA 4AKOA 2G2RA 7PAZA 1MOEA 5FV2A 4MQXD 4QRRB 3BN9D 1XB8A 4Y5VC 4HJUA 1CD8A 5JIPA 2E7MA 5E2UL 1J9RA 3QQXA 5D1QD 1NFIB 1EHAA 4J2QA 4NM4H 4YGVA 4FFWC 3S35X 5BW7C 4BGDA 4XP1L 2F8OA 4J4PD 1SMOA 5I0YA 2B9BA 3FK3A 4OCLC 5I24A 3P1VA 1U8CA 1TPXC 1XTMA 2DEWX 2HH0H 1F3DH 2GTZA 4DIXA 5F7UA 1XF2A 1XGTB 3MBEC 4JCLA 2W81C 3QI9B 4WY7H 3BAWA 4X99A 1FWXA 2OJ1A 1NAMH 3AUVA 3CFDA 1IM3D 1DJIA 2FLRT 1D5MA 2QGCA 2R0WH 5E4AA 4XNAA 1UGKA 3D4ZA 4N25A 3PRZA 2YN3A 4ZK8A 1S9VB 1F42A 2C7UA 4J3OH 3RWGA 5JPMA 2G9HA 4L2YA 5ABDE 3VGDA 2J6EA 1RAMA 4DUVA 4JKLA 3KPQA 3NAAH 2Z92B 4HIJA 5I2IA 2YAMA 1AKJD 2X1XR 1FNFA 3V4VH 4CBPA 3RL2A 2IFFL 2C3VB 5CU5A 1KYOK 1PEWA 1BV8A 1NIAA 2VDQL 3O3EB 3PYCA 3CJJA 3T8XA 1IEBB 5IROC 2WXIA 5IB3A 3DJTA 4X8CA 4IKJA 4AL8H 5LCVA 4X7TB 5J1AA 1NL0L 2DM7A 4FQLL 5E8EA 5I8KL 5E6YA 1AR1B 2BP0A 3APMA 3HTLX 3LKQA 3QDGA 4YK4C 4I48A 5CWSA 2OZ4A 4QEGA 2MCPH 2JJUA 2B4CC 2VSMB 2B7DT 4PJ5B 2N0MA 2R69H 5CS7A 4JPVL 1CFNA 3PP3K 1KZQA 3P4MB 5HJDA 1VZHA 2OR8A 1BIIA 4KI5F 3KPRD 2J6WA 1L5GA 2AANA 1ZLSL 4G7QB 3A4AA 2WBJC 3G5ZA 1AO7A 1NOFA 5DA4A 3U2IA 2W07A 3B9AA 4PJ8B 1ZXQA 1KIRB 2LFEA 1TETL 3ZDXE 1AGBA 3MNZA 3TLRA 1UB5A 3N44B 2VDOB 3D05A 4YHPB 3TZVD 5IHLB 5AKVA 4Z7QB 2RR3A 5FW6A 4FABL 2NX5B 3LKPA 3SDCC 1ROWA 2G60H 4R2GB 3ZDYF 5JR1H 3UYPB 1A2YA 2EDOA 2WZAA 4RGOL 3RKDD 4JFFA 3ZYZA 4AQ8A 3OKKB 4HFWA 4PW3A 4EI5D 1QLEL 1UD8A 3HE6D 2RHEA 4Q6IC 2B5IC 3U9UA 1K72A 4Y5VA 4G83A 1J8HE 5CFAA 3ARYA 4ODHL 3RILA 2JQAA 4M7LT 3CN0A 1DLFL 1KCRL 2IALB 5BW7A 1T2XA 2IDFA 3K2UH 3MGOB 5FCSH 3ES6A 3ML9A 4OZFG 4TNVF 4F7PA 4KQ3L 5FKAA 3RU8L 2GFBB 4XCYA 2DBLL 3L4WA 1E40A 2HJFA 4BGLA 2MMXA 3H6JA 3ULVC 3OJDA 3BDYH 4EIZC 5CEZL 2AJYL 2VDNL 1FNEB 3QJUB 2BIHA 1GC1H 3VFUA 1J18A 3T0EC 3BAKA 3N1FC 5FYJU 2UXVA 4I89A 3ZBMA 4P2OC 2AXGA 3ALXA 4KK9D 4XNQB 5GGQL 2V2TB 4JFEE 1KTDA 3CLWA 3BI9X 3LKNB 2N4IA 4GPVA 3QISA 2BERA 1B4RA 2CO6B 3IN2A 1PZSA 3WTTA 1DVXA 1PSKL 5EBLB 5FGSA 3VA6A 2YRZA 1GOGA 3SE9L 2AKRB 3NZUA 1OARL 5CEYB 2KH2B 1KGCE 4E36A 3UTPE 3MA7A 5I15H 4XMLH 5D4QA 3DMMB 3CXDL 2VZSA 5EEYA 4G72B 4L18A 3FQRB 5DC2A 4K5PA 3Q13A 1T21A 1KPRB 3NRPA 4XAKE 3WS3A 3VCLB 1I8MB 1LGVA 5AVSB 1J9QA 4MQXC 3BN9C 3NA4A 3ZIMA 1KXTB 3WXVH 5FS5A 4JFZH 4UBDD 2XACC 2EDKA 2CZNA 2YBRA 4LIQH 3ZDZB 4D0BB 2Y5EA 1JF1A 3EUDA 3F04A 5I28A 3EZ8A 3QXUA 4UCFA 5E5UB 1CBVL 2C1PA 3LRGA 4AMWA 1T22A 2VDLL 2CUIA 3N85H 4AKPA 1Z6JT 5DRZB 1IQDB 2JKTM 2XZQL 2X6BA 2HZHA 2A74C 1W72A 2WLKA 3KPPA 5KS9B 2X4SA 3PU7A 3PDOA 5DD0H 1J88A 1G7LB 4HU2A 2OSYA 3B4NA 4DKEH 2EUZA 1U4EA 1TTBA 1OXYA 4Z78A 4L37B 2Q8BL 2BZ7A 3NA9H 5EF1A 1UM6L 4YBLB 2G9KA 3U9PH 3WTWA 3N55A 1GR7A 4OLXH 1N9PA 3DJSA 4QHKI 1HEHC 3IMVA 3PWPB 1ZSDA 2CJSA 1R75A 3O0RH 2CLVB 4N0FA 3ESPA 2GSGB 5DXWA 2XV3A 2QV2A 2O6PA 4JCWA 5DEGA 5AALA 1VFOA 4G80B 1P69B 1E9OB 3BWAA 4N8CH 4PCYA 1RUQH 5CIPB 2ZWNA 2RIKA 2WB1A 2J57A 1SLXA 1MF2L 3HZKA 4UIKL 4W9DC 5E4IA 1IVLA 3ZQ9A 4YDLB 3IXTB 1NGYB 4G6KL 4HZ1A 2YEQA 4PRID 5CZRA 2VITA 1PZBA 4R4BB 4PP1C 1HWGB 1TKWA 4QDGA 2WSDA 3OG4B 3RWEA 1U8IA 2QVFB 1C8QA 4WO4C 3QQNA 3ULVF 3BZDA 4LOEA 3DO7A 2KUTA 3V7AG 4YNYA 3TCLA 1V5JA 2VSDA 3LNHA 4JHBA 4MASA 3WJJC 1YMMA 1IBZA 5H2BA 2YZ1A 2BSRB 2NDFA 3D30A 2FL5A 3UTZB 4QRSB 1JXGA 1ADQL 4KXZI 3KPSD 3MUJA 4HH8A 1HILB 1FL5B 2WO2B 5FYKE 3LPOA 5E24E 1G6RA 2WJ5A 3P0VH 3VQ1C 2G5BB 4YPJA 2COQA 2OL3B 3MLWL 3KCPA 1HKFA 4PJEB 1AAJA 3CFEB 5IESL 3ZE2F 1WBYB 1WQVT 4BM7A 3MLVH 1J5OL 4OGAC 2WLHA 1GW0A 5D1ZI 4Y2OB 4DVRH 2SODB 4FDWA 2ZSWA 2W60B 4DKDC 2PYED 3LEYL 2D3VA 4LL1A 1FFNA 3HE6C 1PX8A 1HNFA 4YSOA 4PV8B 1CFTA 4WEBL 2E6JA 3QEUA 2F58L 3DETD 4LHQB 3DX7A 3FT2A 1MIEL 1VERA 2KERA 3NJJA 1S7XA 3O6MH 2MWCA 1AGEB 5C09B 2OTUA 4MXWL 1ZK5A 1XCQA 5AG9A 2VLLB 1UD4A 3IM1A 1E28B 2VZVA 1KGUA 4WI7A 3O8XC 2RCSH 2E7LA 5ICXA 5DS2A 3VSVA 4LQ1A 3WXWL 3UACA 2F53A 1KBBA 1H3TA 3K5RA 5DVLA 2N7AA 4MGXA 2FJGB 3SO3C 3JWNG 4UTAL 3UTQA 4JFYB 1HYSD 2CG9X 1FFTB 4HV8B 3UEQA 4MD0B 2BWDA 4ZXBA 1A7RH 1OTSD 5L8LB 4DVBB 1WLHA 5EIIA 4PREA 5TGBB 5ITBH 1KV3A 1IGFH 1Z0MA 2BMKB 4JY4B 1OWWA 4NPYA 1ZK9A 2XN9B 4G1MB 2VN7A 3NH7L 4L5FL 4P2QA 1R19A 1ZRUA 4A2DA 2R29A 1JK9A 3D69A 2VE6A 1AQDA 2UZIH 3BQVA 5B38B 5EU6D 3KLHD 1NIEA 4AQEB 1LQBC 5JO5A 3L54A 3QDJB 3LNDA 3LQAC 1E4WL 2XBZA 1RJZA 1U42A 2KDGA 3RWHA 3VM5A 4MB4A 5BJTA 4NQSA 3ZZ1A 1CDGA 4FMKA 4X7DC 4DHLA 1JWUA 2UZPA 2P7TB 3WYRA 4OFDA 1ZLWH 5CD5D 4NIYE 5T8IA 4GW5B 3DTXB 1JPTH 1NA8A 5EN2A 4B0MB 2JKXA 4ZD3L 3VFRA 2BNRE 4BQ8A 5E1QA 1P4IL 3FFCB 3ABMB 3QP3A 3HS0B 4J3BA 3K71B 1OHQA 3FTUA 3QULB 4EDXB 2ADYA 1G7PB 2BY3A 3L8QA 3MLZH 4HYTB 4M7JL 4LBEB 2Y6SC 1BG1A 1AG6A 2GBAA 4BV1A 4IRSC 5ID1B 3ROOA 5HHXH 2YD6A 2V4LA 2V5RA 3H3BC 4PMEA 2FWLB 4PLKC 3MLXL 3RUGE 2NQDA 4I2XE 3GMQA 1UZ6E 3JV6B 2ZCLH 1U0QA 5BZXA 4H8HA 5I73C 4IIQC 2DYPA 2IWKA 2D3NA 1I9RL 2VXQA 3GTVA 2GJZA 3ARBD 3BVVA 3DOHA 1IMHC 4CU7A 4PCTA 1Z7JA 2EAEA 1U41A 2YD5A 4LLDA 2R4SL 3WUWB 2H0FA 1MG2C 3O6KL 4L9LC 3K6IA 1NEPA 1G0DA 4TSCL 3SE3C 2DV6A 3CN1A 3IF1A 4R6UA 3ZRSA 2ZX7A 3NSXA 1I8LC 4NO0A 4JFWA 4GEIA 1A6WH 3MRBA 1TT6A 1ITBB 2NY4D 1RURL 3GDBA 5I18L 1FGVH 5IIEA 4M9OA 2XKUA 1OTUD 4JRXD 3ORJA 4NP9A 3HAEH 3RB5A 5KUKA 1K4CA 4ORGB 3GJFK 3NCXA 2PXYA 4BHUI 5TE6L 4WFGE 5JA8B 3DROB 1KBWA 5AD0A 2HKFH 2VW4A 4JG1H 4EBQL 1SJVA 5HPOA 1NCAH 4U1JB 1B9KA 1ET7A 2QMKA 1J86A 1OE2A 1PZAA 3LZPA 1FZJB 1AZZC 1KBGL 12E8L 2B16A 2LLNA 3AADB 2YC1A 3MLRL 1A9VA 1JN6A 5C0EA 3CNKA 4F5CA 4X8JA 3RWCB 2EIDA 4JFHD 2ZCKL 2BSTA 1OGTB 1FFOB 3QAZB 1S3KH 2X4NA 1MW2A 1D5XA 2BP3A 5KJ4A 3WNLA 3GGWB 2FJSA 3IDMA 3ULAB 5I16A 5KVGH 5D93C 2WOYA 4WIQA 5FGRA 2AEPL 3V6ZB 3HG1D 1VGKB 1JGLH 4BXSV 2DLTA 3MV7A 4FHBD 4PRNA 4OR1A 4P23A 5HGAA 2ZICA 5E4EB 5FA4A 2A6DA 4ES8A 4Y8AA 2QKIC 5JQHC 3UZVA 3PHQA 1Q0YL 2QKSA 3JWOH 3L95B 4G9FA 3ZDXF 5J11C 3Q2WA 4NQDD 2R1WB 3FQWB 3LRKA 3I75A 3MJ8A 3AREA 3B9EA 3NP4A 1EHXA 3MRRB 2Q6WA 3V55A 4YL9A 3VFGL 1Z3GL 3LIUA 3V7AE 4JPSA 4IRSA 2GJ6D 3E3QE 5T5NG 4Y4HD 3JUYA 2A1WL 5D70L 5K9JL 1UVQB 1J8HA 2GK0A 4FD0A 2V9TA 3DRTB 3DX8B 1KBVA 5EPMB 2H3NB 4JVUA 1HYSC 1E5BA 2HJKB 2P46B 3ECQA 3P3TA 4Y5YC 2PCXA 5E8NB 1OCCB 4U3SA 3VXPB 3OAUL 2DQEL 3TVMD 1KB9K 1M1SA 3L4ZA 3UEZA 1UD3A 3BP7B 5KVFH 3RDTC 3QIBD 4URTB 1WC7B 4QRAA 1NBZA 1A4KA 1F45A 3CN3A 4ISVB 2J56A 1AYOA 1EO7A 2A0LC 5DR5H 5KANG 4R4NC 2AITA 3V4LA 3ULSB 1OTTD 3CGTA 1F02I 3N42F 1E4KC 3NEEA 5GS0H 3LQMA 3IJYB 2UY6B 1T5WA 1RUML 1OSYA 3L1OH 5LXGL 3X3GL 3P4OA 4O02A 3HR5A 4AEIL 4IGBB 3SQBA 2CQVA 4JFEA 5LGHH 1CGSL 3Q2VA 4XVSH 4OI9A 4XN7A 3GIZL 3U0TB 2VM4A 2C3HA 4Y1AD 3I9PA 3LNEA 3T0AA 4R84A 4AYGA 3GI8H 1F6AA 1JV5B 5K9KA 4AXWA 4C55A 3O4LE 4YXLL 5GGRB 2FAUA 4CMHB 5EZIH 1ONQA 3T1WA 3BH8A 5E00A 1T1ZB 1A02N 3TF7C 4PS4L 5MEPA 3OGCA 1TZ8A 1FHNA 1U8JB 2XG5A 5CLZA 1YY8A 2VSKB 4HK0A 3DURB 3NPSB 3M88A 4HSQA 3GRWA