3C5SA

Crystal structure of monoclonal fab f22-4 specific for shigella flexneri 2a o-ag
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
218
structure length
218
Chain Sequence
b'DIVMTQAAFSNPVTLGTSASISCRSSKSLLHSDGITYLYWYLQKPGQSPHLLIYHLSNLASGVPDRFSSSGSGTDFTLRISRVEAEDVGIYYCAHNVELPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab F22-4 light chain
publication title Structures of synthetic O-antigen fragments from serotype 2a Shigella flexneri in complex with a protective monoclonal antibody
pubmed doi rcsb
molecule tags Immune system
total genus 51
structure length 218
sequence length 218
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5sA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5sA01
3CFCH 3MA9L 2Y72A 5ILTL 2AXFA 2XN9B 5IQ9A 1SEQL 4AIXA 1U8HA 1EXUB 4WI5A 2VLJB 1LK3L 4NKDA 1U8IB 3MJ7B 4QOKA 1UWXH 1YEJL 5AD0B 2GJZB 5J3HD 2AJYH 4I0PA 4XAWL 3DV6B 1NCBL 4RGOH 3MLYL 3RRQA 3VWKA 5CEZL 3MUY1 3KPNB 3HTLX 3KDMA 4PJIF 5F7DA 3F5WB 1IGYA 3KS0J 4YHYB 3MMEA 1TVDA 4GAGH 4UV7H 4KQ4L 1MFCL 1MCIA 4NO5A 2ORBH 2IQ9L 4BM7A 4ELMB 2DBLL 3ARFA 1TETH 3PP4L 2Q76B 3PWUA 1C08B 4Y19D 3WXWH 1T89C 4JE4B 3ZKXC 4ODVL 2EKJA 5E0QA 4PJ8B 5DRWA 2CO7B 4TVPH 2IAMA 1PG7L 4OZ4B 2C3GA 4GRLC 4LCCA 3FO2B 1P7HL 5ANMB 2I24N 3S34L 2CLVB 3KYMA 3B5HA 1K5NA 4LAQH 5IR1A 3UBXA 1LNUB 3MBED 4XB7A 3SDCC 4LQFL 3TZVB 1KN4L 1RZKL 2SEBB 2DYPD 3U2SB 1IGCL 1N0XL 3LAFA 1OSPL 2HRLA 2PTTA 3HRZB 4QF1A 4X4XB 4P2YA 4Y4HB 2R56L 2AQ3A 3PL6B 3T2QA 5DRNB 1TCMA 5D5ME 1FFNA 1KF9B 3MFGB 2BDNH 4NNYB 1IGJB 3T8XA 3TN0A 3LSOA 3RVUD 5EOCH 3IDUA 4L3CA 1BQHB 1K3IA 2PO6B 1F8TL 5IKCA 4KHXL 4QTIH 3TCLA 3LKPA 4LNRA 2AJXL 4C83A 1PKOA 5LXGL 4LRNH 4OJFL 3ARPA 4QEGA 1G7QA 4QOKD 5CEZD 3DUHA 3QDMA 4HBCL 3DYPA 5GGSA 4LEXH 4GRWH 4I0PD 1BJ1J 4UIMB 3UTSB 2JB6A 2EYSA 1GRWA 2VTFA 3VXQA 2YPVH 2F74B 4FQ1L 1FG2A 4LSVH 3KPSA 2NY4D 4ODSL 3EYSL 2HVJB 2C1PA 3C5JA 3VFTB 2VE6A 2NY6B 3KHQA 2EC8A 4POYA 5KAQG 5HYQA 2VQ1A 3WXVL 1EIBA 3LQZB 4GSDL 3H7BA 2XYCA 2NW2A 3KAAA 4S1QH 3ARFD 5AG9A 3O4OB 1P6FA 3R0MA 4KVNH 3I3EA 3N1MC 1I7UB 1OAUL 4FTVD 2X7LA 1UACH 1OPGH 5L8KB 2BOCA 4Z18A 2HT2D 2VDKL 2X40A 2IAMD 3DUSB 4R7NB 5HYJD 1KTRL 4UAOC 4N9GB 1CT8A 2BJMH 1UQSA 5FKAA 3SDXF 4B0MM 3BD4A 3NABL 4PRPA 2JJTA 3ECBA 5JDSB 1B0WA 1GOGA 3MZTA 4D8PB 3FN3A 2DQEL 5SWZB 3VGFA 5DJCA 1EEQA 5LAXB 4Y7MA 2DQJL 1WAAF 2W1NA 4XP1L 1ZHNB 3RWEA 4YDKH 5BVJA 2X4RA 3HCVB 2WP3O 4ZUVA 5B4MD 5IHZA 5D70H 3TN0D 1T0PB 4ODTL 1K9TA 2AJSH 3HZYA 15C8L 4LCWB 4HX1B 4Z7UE 4G42B 1UJ3C 5D6DA 5J13B 1U8JA 4HZLA 4PJXB 2VWEE 1Q9OB 2GFBA 4S0TD 3F65A 5I75C 4H1LB 3ULVC 4GRLB 3FT2B 4FABL 1JYWA 3QDMD 3VGGA 2N4IA 4YAQA 3BO8B 1OAQL 3BHBB 2MHAA 4ERSH 5JORB 1WWWX 1ZGLA 4FQ2H 3SDCB 3D39E 3WFHA 2VXUH 3QNZA 1EFXA 4RBPH 5FA4B 5T33H 3QG6B 4RFEB 1JWMA 2E3VA 1R3KB 4HIEA 5DZOA 3QP3A 2HN7B 3KPSD 5CIPA 1L0XA 3VXOA 4M62L 4J1UB 4HK3J 5F93C 1FFOA 3ILQD 4DK6A 1VKXB 4WW2A 4K7FB 1TVHB 5DQDH 4YNYA 4QRPB 5DMIH 2X4UB 1SBBA 1A7NL 1AGCA 3BSZH 3P0YH 4A6YA 5GIRA 3QYCA 3WDJA 5IM7A 2PXYC 3ULSA 3EYFB 1R6VA 2DQCH 5ICXA 4G8GA 1A6WH 3U0TA 4YHMH 4PJ7B 2R8SL 3BRFA 2IANA 4LPXA 2OYPA 2ZPKH 5IMLB 3TA3C 5FYKU 1V5JA 2EECA 4PRPD 2QHRL 2GHWB 5H2BB 5C6PB 1INQB 3U1SL 2ATKA 5F1SA 3MRCB 4Z6AT 2YPKA 4PPTA 1JV5B 5F6HJ 3ZKMC 4HF5H 2MQ0A 3CFEB 3VFWB 1B2WH 4M9PA 5CP7B 1AQKH 4ENED 3HR6A 3JVGC 4JEGB 4NSKB 2B4CH 4TNWK 4OF8A 3X17A 3EYOB 2EXWC 5KG9A 3ROOA 4I77L 3BIBX 3AS1A 3BUYA 1AY1L 3WLBA 4I18C 4Y16B 4HEPG 3VXRD 1JYXA 2R0ZH 4KZDH 32C2B 5EBMB 5SWQB 1MAKA 1MHHA 3P30L 4L4TE 3E0GA 3RWCA 3BI9X 3IDGA 25C8L 5EOQH 4Y5VA 4JKLA 4OTXL 2F54D 4U7MA 5DMGC 1HDMB 5GPRA 1BZ9A 4UAOB 4W4NA 4YDIL 1S7UB 5HI5D 4YE4H 4L8BA 4JLRB 1BVKB 1SEBA 2R4SH 4C4KT 3LKOB 5FO9A 1JGVL 5F97E 1F00I 4EDXB 1EFXD 2J3SA 5DD0L 3G08B 5DYOA 4EN3A 1F3DJ 3EW3B 4WU7B 4NDMA 5D2LF 3NFNA 2Y06L 4ZSOE 1FNSH 1AKJA 4IRJC 1J5OH 1H3TA 1WT5A 2WANA 4PUBH 3LV3A 5TH2B 1YC8A 4Z7VA 3BP6B 3QULA 2FB4L 2NY7H 1QFUL 4HDIA 4L4VB 4G6FD 1JZ2A 3MOBH 1UJ3B 1VGKA 1T1ZA 4F7TB 1KLGA 1KCSL 4D9LH 4PRAB 5I75B 3P11L 3DYOA 3NZ8A 4G8GD 3OAYH 3G6DL 3RKDC 1N5YL 2Y25A 3LD8C 2IAND 1QKZH 3MRNB 2HFTA 4DQOL 1PY4A 1MUJB 1KN2L 1BF8A 4HKXB 5KW9H 5FUCC 1C1EL 3DWTA 1K2DB 3HNTH 1KLUB 1KFAL 3PV7A 1JHKL 3C8KB 2HJFA 4YHIB 4JN2A 2AK4D 1KCVH 1ZHKA 3EFDL 3LPWA 4YEEA 1D5ZA 1EHLL 4OCXL 1MVUA 2XZAL 1EEYB 4WEBL 3ARBC 5EBGA 5F1IB 1C12A 5B39A 3MXWL 3P0VL 1ES0B 3MLUL 4W6WB 1MFNA 1ZLVH 3W0WB 4KPHH 2Q87A 5ACZB 2EDOA 5T1KA 1QSZA 2PXYB 2XPGA 1OAYL 4MQXD 1A7PH 4JFPA 4DAGH 4NRYB 3UPAA 1KPVB 3IF1B 5LBSL 1UWEL 5IB3B 2H3NB 4HGWA 2IMNA 4PJ5E 1L7IH 4G6JL 5CEXB 1HH6B 3UP1A 3RNQB 3FQWB 3TA3B 2EDKA 3U36A 4U7KA 3IU4H 4MXWH 5F21B 3RGVA 4OGZA 4GW1A 3CDFA 1N64L 3C8HA 5B38G 5I19L 2WIMA 4ORZC 1MI5A 3MRBB 1UM5L 2UYLA 2E6QA 4G8IB 4PJAE 3ARGC 3D5OF 4EN3D 4N8VG 2GW5A 1DANU 1N8ZB 3A6BL 3ABZA 1IC7H 5DUBA 3HUJF 5BS0E 1J8HA 5D7IF 1RHFA 1QBLH 4HC1L 5HI4D 2Z91B 2FD6H 3PHQB 2XZCL 4I18B 3RBGA 5IMMB 4KK5C 3AY4C 2HT3D 3EO0A 5DK0B 3VXSD 2ED8A 1UA6H 5JR1L 5GS0D 2P24B 4FQQB 3UO1L 1X5FA 1X3DA 1PY9A 2IGFH 5EIIB 3QHZL 3BWAA 1KBGH 4GRMB 3FONB 1S8DA 3CLFL 1A6UH 2H6PA 5DHYA 4UUJA 4XPTH 3FRPG 3RGHA 2IF7A 2FWOA 2AEIT 5ECJE 5CILL 1J0KA 4RAHA 3S3JA 2HMID 1EH9A 4TSBH 3AVEA 3FB8A 4K8RC 4WWKC 5D6CB 5HPMA 5HDBE 4CJ1A 5TE4L 1EMTL 3EO9H 5IVZB 4IRJB 2QBWA 4X7CC 4NWUH 3DBXB 4KROC 4X98B 5A3IC 1VB9A 1LEKA 5DGQA 4RX4D 1DQQB 1IVLA 3HC3L 1V3LA 4OQ1A 2VL5B 5ESVB 3P4OB 3DNKA 1J10A 4RGMC 4YZFE 4D0BB 1I8MB 3UTTA 1QPPA 2HWZL 4N0FA 1CE6B 5TDPB 5JPMA 4PRBB 3DHMA 4NJ9H 5EPMB 4QOKE 3U9UB 5K9JL 5B22A 4M00A 3SJVA 4BFBD 3GSXB 1I8LC 4G6MH 1BBJB 4C54A 4GT7A 3S5LB 4U1HA 2AJUH 3RGVD 5GRYA 2HFEA 5EUOF 3TVMC 4WO4C 5DUML 3QXDB 4XVTL 2J1KA 5FKPA 4KY1H 1MI5D 3RWGA 4NKOB 3QUZD 3WNNA 5AZ2H 4HG4K 2HJKB 1L0QA 3REVB 3MNWB 1C8PA 1JBJA 4Y0GA 4U1KA 1J8HD 1XGYL 2ZUSA 4ONHA 3ARBB 4K2UH 1MPAH 5BMFL 4YQXL 3TYFB 1NSNH 5E2UH 3IXAB 5JHDA 2VISA 4LSUL 3PJSB 3QQ4B 2VKWA 1CD1B 1HHHA 4H8WC 3E6HB 1ZLSL 4F9PC 4P4KC 5SX4H 1L0YA 1OCWH 3QT2A 1NGXA 1MCKA 1E4WH 4HWBL 4X6CB 1PYWB 3MFFB 5E5MA 1MAMH 3WUWG 5ETUA 3DROB 4G7YH 2ICWB 1HKLL 4BFIB 3FOLB 2BSSA 3EGSA 3VGAC 4EBQL 2VWEC 1T1WB 4P0DA 3UX9B 5I0DA 3MCG1 4OCLC 2NYYC 1NAMA 1YNLL 1YN7A 3MUGB 3ARGB 1I85C 2ED7A 3MLRL 5FO7B 3C09C 5DZNA 3T4YA 5J6GA 5JXEA 2WWMD 3HPLB 4S1DD 4M7LL 1RY7B 1NAML 2F15A 4CKVX 5J06A 1NBZA 1D5MA 3S4SA 1AXIB 2NY1C 1OAXH 2B1AL 1LO2H 1R3LA 2OXHA 5D5MB 1E4KA 2H2PC 2VDPL 2AKRB 2IALA 1AGFB 1QQDB 2DKMA 4G3YL 4P2CG 4HS8L 1QVOB 3O3UN 2NR6C 4ZFFB 3TO2A 3UTTD 3O3AB 4Q9RL 4DWHA 1CS6A 4U1SB 1CZ8H 1A3LH 3OV6A 3SJVD 3QDME 1GGBL 2H2SD 3MRDB 3UDWA 4ZS6C 3RWFA 4HPOL 4NO2A 1GZPB 2JK5B 4FQHA 3EDDA 4L8SB 1CG9B 1I9JL 3O45A 4PY7B 1SVZA 3V6FA 1I8KA 3T0EA 3T0XA 1IM9A 4WWKB 5D7JD 4YEFA 4IMKA 1YEGH 4W70A 2VUYA 3W81A 3LDBC 3VXPA 4ODBD 4KROB 3L3KB 2FGWL 1ETZB 3MNZB 4ZUUB 3F12B 1MFDH 3EOBA 1CICD 2D7QA 5JHDD 1MLCB 3E8UH 4HWUA 4ZOCA 4BH7A 1JHTA 4OCRL 5IW6B 2VKXA 2YPLE 3V4PL 5KVDH 5CD5D 1ED3A 4YHOL 4RGMB 3ZTNH 5E99L 5CZKA 1I3GL 1U8LA 4K3EH 4PGDA 5B3JF 1MIMH 4MVBD 1JRHL 2NY5H 4AT6A 3EJYC 5D93C 4HUWB 4O00A 4K3JL 1RK0B 3MUHL 1H3WM 5EUKB 4PRPE 3DX6B 4PJBE 4PGCB 4AM0B 4ONFL 4WO4B 5HY9A 5DD3L 3RJDA 3VXUA 4M7LT 1NFIB 3O9WA 4D0DA 2VIRA 5KSBF 2BP3A 5MP6L 4PIRF 4P46A 4C58B 4W6YB 3QIUA 5JZ7C 1L4IA 4ZPVA 5E4IA 1J0ZA 5JXED 4N0RA 3IYLW 5DHVB 5T1DH 1YEDA 4F80A 2YBRB 5C3TA 3REWA 5MEQA 4MB4A 1QHOA 1U8PA 1DBAL 4QRRA 2OL3L 1WUNT 5DJ0B 5J57B 2IH3B 4P4KB 4P48A 4FQJH 1NFDF 3MRHB 5HJ3A 3BAEH 4K23L 1IQWL 4HD9A 1R24A 3GKWH 2H45A 3DURA 4XPFH 5DJAB 3DVGA 3M17B 2B8OT 4NT6B 5DJZA 2D7TL 3QNXA 4G80B 3QUMA 1LHZA 2NTFB 3S37X 5C0ND 5AEAA 3WIHA 5CJ5A 2EDXA 4H88H 4LSTL 2YEZA 1II4E 4UTAL 3NCEB 3C09B 1IM9D 3QUKA 4XNMB 3RKPA 2XI9A 4F7EA 1HIMH 1YQVH 3D39B 2FX9L 4MQSB 4HPYL 5ID1A 4PB9L 3GB7B 1QG3A 1RZ8A 5E8EB 2J12B 3SCMC 5CZVL 5C0GA 4P3WA 3CD4A 2AW2A 3MA9H 2NY1B 4Y2OA 5ILTH 3MA7A 4N5EC 1SEQH 1CFNA 4U6TA 1T1YA 2JCCF 5FYLD 4EXKA 1FSKC 1OGTB 2GT9A 1LK3H 3AC0A 4KAQL 5K9KB 1DE4B 1ZANL 3QFJB 1KB5A 1YEJH 4RMSA 4ZUWA 4XAWH 4RISL 1BD2D 1B88A 5C07A 3L3DB 3EOYG 4JHBA 2IANE 3MNVB 4HCRA 1NCBH 5BZWA 3RBSA 3MLYH 5SX5K 1D6EA 2AS5M 3FHQA 3QG7L 5CEZH 1M4KA 4PLKC 4XB8A 4W68A 5FYKE 4JQVC 4TRPL 4HW6A 1G7JA 4NFBA 5ICYB 1FNGA 4X99A 1MCDA 1AD0B 3VXUD 5EIQA 3QPXL 3UC0H 1LE5B 1G6VK 1CLYL 3O9WD 4FXKA 3BZFA 5HGDA 3RPIB 4AEFA 4KQ4H 1MFCH 3KVQA 2IQ9H 4GG8A 3QXAB 3QUXD 2FHCA 4ZS7L 3QIUD 3LDBB 2HVKA 3PWNB 1IC4L 2DBLH 4WV1A 3BYYA 3PP4H 1RULL 3IETA 4MMZC 2YZ1A 1KT2A 1JUFA 1ROWA 2ZUTA 4EI6A 2BZDA 4ODVH 4HLZG 4JN1L 4QRRD 1IT9L 2V5SA 2VZOA 4KKCC 4U6YA 4HS6B 5I2IA 1PG7H 4KRPD 2FX8L 2P8PB 4I1NB 1B9ZA 5BW7C 3CPLB 3KPLA 3FT4A 5IHUL 3S34H 4Y1AA 1T21A 3HAEB 5CS7A 2BC4B 3H9YA 1AJ7L 1LO3L 4XPGL 5D93B 4JHAL 1FCCA 4L4TB 4LQFH 4P3CL 1KN4H 1RZKH 1T6WA 3DHJA 4F8TA 2DLGA 3FT3A 1IGCH 1N0XH 3GSVA 1OSPH 1G7MA 4R2GD 2LU3A 5ESQB 5IW1B 3EJJX 3V5DB 2XQYG 1UM4L 3RDTC 2BNRE 2R56H 2V2XB 1SYSB 3NFPB 3O11B 1UB6B 3VGEA 1H3PL 1LP9E 3Q3GA 5EZLA 1F8TH 4MCZA 5C08D 1DEEB 2VAAB 3T77B 5DJ8B 1SY6A 3HG1A 1PFCA 4Z7VE 4ZXBB 4U1LA 2AJXH 4ZSOB 3ARUA 5LXGH 1NC2B 1WWBX 3QEHB 4OJFH 2VR5A 3CDYA 5GISL 1QRND 1R5IA 3RVWD 1KJVA 1U3HC 5I1HL 3F6IA 3MJ8B 5F7FA 4EEEA 1G9EA 4HBCH 3CH8A 1DZBA 3MRJB 4R4NC 3ZSTA 3CK0L 5C07D 1IQDB 2ZOKB 4PGZA 1ADQL 3QJFA 3ZKQD 5JNYB 5DA4A 5C7XL 2QQLL 4FQ1H 2A6IA 4PJ9C 4ZTOL 4ODSH 3EYSH 1Q1JL 3RWIB 1T7ZA 3UZEA 3L3IB 4R7DA 5KSUB 3WXVH 4GSDH 2EH7L 5CBEB 4KV5E 1OTSC 4P2QA 2R1XA 3H7LA 3RWHB 3VWKC 2GSIA 1OW0A 1UKSA 2G5BA 5GGRA 1OAUH 2CIIA 4WTXA 3IT8D 2QADC 5BOPA 5IMKB 1P9MA 3LEXA 1X7QA 5BCAA 3EJZD 1FSKB 2X9WA 2VDKH 3RVXD 3WL9B 2BVEA 4MA1C 4LOUC 3CX5K 3OKNA 4PJEB 3TBSB 3IFNL 3P73A 2AXGB 4WFHE 3WEXB 4Y1AD 3NABH 1YA5A 3T1FB 2DQEH 4X4YB 5ERWB 2HT2C 1H15B 4PJ5B 4X6FA 4YHNA 2DQJH 2HLAA 3OKOB 4J3TA 4HUVB 1XR8A 5JIPA 4UQ2B 4ZPTA 3HPJB 1J8HE 1ZS8A 4ODTH 3WKNA 2Z93A 3GJFH 4LPVA 4PJAB 15C8H 2CUMA 4YBHA 1MCOL 1WBZA 2PYEB 1F4YL 2RBLA 3HG1D 5DRZB 1M6OA 4RNRB 1G6RB 5BS0B 1WF5A 1UT9A 1XGPB 2BHZA 4FABH 1F3RB 1OAQH 3P4NA 2VXQL 2DI9A 4XCEA 4HFWB 1MHCB 2B5IC 3P9LA 2A83B 3C08L 2VERN 3N1FC 3U4AA 3C6SA 1FVCB 4MHHI 1FO0B 3RDTB 3TO4D 4OIIL 4M62H 4OV5B 1NL0L 2FECI 1B4RA 4CN4A 2VZTA 5E6YA 4FOMA 3LS4L 3OXRA 3VFUB 1WFNA 1NEZB 1UZ6F 1HQRA 1EGJL 5CIPH 3VXMA 1A7NH 35C8L 1G7LA 2MTPA 4HH9A 1F58L 3ARQA 1CDGA 5I73B 3PGDA 3SDAB 3LHPL 3ILQC 4I48B 1CXFA 2R8SH 1U3HB 3CVHL 3LN5A 3H0TA 5I8KL 4DGYL 1T03L 1S7RB 4UU9B 3L5WB 2D7PA 2EIZA 3SJVE 4A2LA 4J3OC 3VFOA 2QHRH 3MRQB 1I9EA 3U1SH 2ILLA 5JLZB 5TQ2L 3U0PA 4PJ9B 5B3NA 4NKDB 1T2QL 1VACA 5KJRL 5D7LA 5FB8B 2CXKA 3R06A 2W60A 4ISVA 5FK9A 1S5IL 4KKNA 4N1EA 4I77H 4P57A 1AY1H 3VWKB 1Y18A 2CUHA 4NGHL 3VWJD 2IPKA 3HA0A 4ORGA 5DS8A 1DLHB 3MMEB 5TGBB 4EQ2A 2QADB 3P30H 4XVJL 5JHDE 5TF1L 1I75A 3G5YB 3L7FA 4LVHB 25C8H 2CRMA 4MA1B 3MRIA 4NO5B 4OD2A 1EK3A 4OTXH 1S7TA 4J6RL 3HMWL 2ICEA 4YDIH 1G0DA 4HIXL 1KTLB 3KLAA 4R9HA 1AC0A 3TFKC 2JIXB 3HE6A 3IJYA 4X6DE 4HKJA 3EYVA 3O3BB 1JGVH 5DQ9A 5DFVD 3RP1A 1T7VA 1OTUD 2CR6A 2WBJA 4G8FA 1FFQA 3LMJL 2R1WB 5DD0H 1JTOA 1T2XA 1WIOA 4FFVD 2F53E 2DQUL 4ZUSB 2DICA 3K74B 4KXZH 2OX5A 4P4RA 5LG1A 2Y06H 5GRWA 2YSSA 3DXAB 3S36L 2AV1B 2XA3A 3MGOA 4N0UA 3BP5B 4JY4A 3X13A 5IR1B 1Z5LA 3ZYJA 4DKDC 3L3OA 4PBVC 4OQTA 2FB4H 3OL2A 1QFUH 3VXMD 2FEDC 3VI3F 4QF1B 1KIPA 3G9VA 4X6EA 1JF5A 3WCYA 1FVEA 2RFXA 4E41E 4Y2DB 1KCSH 3QWOA 3P11H 2BY2A 3KYOA 4MJ5A 3GSQA 1JJUA 4OQTL 4WW2C 3T8XB 4X7FC 3G6DH 2YMXL 4RAUB 1N5YH 3RAJL 2JTDA 5ALCL 4ESKA 1HOCA 2UUDH 3BP7B 2V5TA 4DQOH 2BVOA 3QWRA 1GIGL 1KN2H 3GSNB 5IROA 4AEEA 3F62A 5A2LH 1G7HA 1JPST 2B5IB 4XT1C 5HHNA 1C1EH 4YBQD 4DVRL 2GJ6B 1KFAH 1G7QB 2DTML 1JHKH 5D7LD 2YA0A 2J6EL 2MKWA 1X4XA 3EFDH 3T0EE 4JKPH 5CJQL 4YR6A 2CDFB 2Z8RA 3QCVL 5GGSB 4NQXA 5FCSH 4OCXH 1EHLH 2XZAH 2V17H 4WJ5A 12E8L 2W0PA 4WEBH 4XXDB 3X11B 1AIFA 2V2WB 3G5XB 3MXWH 1Z0NA 3P0VH 3MLUH 3SOBL 1YDPB 2HT4D 3H42L 4G43B 3V8OA 5AZEL 3W9DA 4OZIA 1OAYH 1BZQK 1HSAA 2C1PB 2Z35B 4FRWA 5FYLE 4KUZL 1UXWA 5HYQB 4PJDB 5J56B 2D0HA 4JAMB 2I9TB 4LSPL 3W9EB 4G6JH 1JWSA 1MVFA 2FJGB 1T20A 4GKZB 4QLRA 3I6LE 4UNUA 4EUPH 3HE6D 2YPLB 5BJTA 4EOWH 4OZGB 2CSPA 1L7TL 3ZT7A 2X7LB 4WHYH 2R69L 4MX7A 5KAQF 3GMNA 1UM5H 2BOCB 2WBJD 3BW9A 4FQCL 2X89A 1FN4B 4TOYL 1ERNA 4Y5VC 1J12A 2E8ZA 5L8JB 4CAGA 3A6BH 1HSBB 1P53A 4JFQA 5B8CB 2Q86B 1RFDL 4HK3N 4PJBB 1S78C 1TZIA 3C87A 3SGJC 2XZCH 4O2FA 3UJTL 2I9LA 3JWOL 4L3AA 4Q58C 5SX4I 4EN3C 1T0NA 5JR1H 5DJCB 5A43C 3BE1L 4Z78A 3UO1H 1HWHB 1FZOB 1FL5B 3QHZH 1QSEE 2DWEA 1P5VA 1P6AB 4U1JB 2X4RB 4ZUVB 1WT5C 3CLFH 3C2AL 2DM4A 2OP4L 3W39B 4E5XA 3NCCB 2NW3B 3VG9C 2ZOLB 4OZFH 4FMFA 3QWRD 1U8KB 5CILH 4OGYH 4OLYL 2ADGB 2WM0A 1U8JB 3EZJB 5DC4B 2GFBB 4GKSA 1SJVA 1ACZA 3FJTA 3U6RB 1NCTA 4WI9A 4X7EC 1IJ9A 3ARXA 5TE4H 1GH7A 1EMTH 5IEKA 4YAQB 5IJKA 2VOTA 1JYNA 4KHTL 3WJJA 5HDQL 4QWWD 2VLRD 3BD3A 1E27B 2R0LL 1OP3K 5EU6E 3W11D 3JWDL 4P2RE 1JWMB 3HC3H 1HHIB 4R96A 5LGKA 4M93C 1KGCD 2HRPL 2IG2H 2OK0L 1KB9K 1GPOL 4YX2L 4Z7OE 4QHLB 4ZNEA 2ZWLT 1FFOB 2HWZH 5EA0L 1LE9A 1CWVA 3WFDL 4WI3A 4WW2B 5K9JH 4OUOA 3OHXB 5DK2B 2VYRE 5DJ2A 4A6YB 1IBGL 5EBWA 5F88B 1XMWA 1NMAL 5C8JB 1MCFA 1MCQA 1JPGB 3TJHD 4JFDA 3ULSB 5DUMH 3FO9A 4G9DA 4U0QB 4XVTH 3UAJD 5D1QC 1ZKAA 1T22A 1IL1B 2X89D 3U0TB 2J4WL 2AJ3A 3L5JA 1OOAA 3MRPB 1T0MB 3OB0K 4QGYA 2N7AA 4HHAA 4WW1A 1VPOL 3OG6B 3PDDA 4HIIB 5SV3A 4AEIL 4JO2L 1XGYH 1VCAA 2P7TA 3T0VA 5J11B 4KQ3L 5HD8C 2R1YB 1BOGB 3O4LA 3E3QE 4TUKL 5BMFH 4YQXH 4WFGE 4LSUH 2ATKB 2XWBB 2A73A 2D31A 4M1CC 4M48L 1ZLSH 1QPXA 3V0VA 1U92A 4OLUL 4FG6C 3EHBC 4HWBH 3I9GL 4NYLA 4M7ZC 3A0OA 5KG9B 2PYFA 3BUYB 2LAGB 4UDUA 1HKLH 4JKKA 1QEWA 4WTZG 4CBPA 4Y1AE 4EBQH 4ZFOA 1TVBA 2Q3AA 3J7HA 4PREA 3G04A 4BSVB 3RVTD 5IB2B 1YNLH 4Y4FA 1KC5L 4Y5VB 3MLRH 3VD5A 2VZUA 1QLRB 3KNBB 4CVWA 1NLDL 2ICES 5CJBA 3A6CL 1NAMH 5FYJL 4YLQT 4H5SA 4JFEA 3WS3A 5FO9B 1DVFC 3SDXE 4PV9A 1OD7A 2KKQA 4KDVA 1XF5A 3ARRA 2B1AH 2BNRB 1TCRB 3PDGA 2FX7L 2VDPH 3B8YA 1D5XA 4HSQA 5IF0B 4NDMB 3VH8G 4G3YH 3NFNB 4HS8H 1AKJB 1OARL 1LP9B 1UJTA 4Z7WB 4Q9RH 3FL7A 1F90L 1VFOA 4YC2C 1GGBH 5FIEA 1MRDL 4KI5C 3IKCB 3VG9B 3IFLL 4HDIB 1T4KA 2CKBL 3GFUA 5JMOC 4BUGA 1RUML 2B1HL 2GSGA 4JFDD 4R0LA 5DR5L 1I9JH 1JTTA 4PP1D 5IIEA 4FMKA 1K4DB 5I1LA 1UADC 2IEPA 4EI5C 1JIBA 2HYMA 3PHOB 1NCUA 4X7SL 3IJHA 4O5LL 1DLFL 3O4LD 1AGDB 4QHUB 1I8IA 4P2QE 4PGBA 3UMTA 4ZAKA 4OCRH 4M93B 3VXNB 3VJ6A 3V4PH 4Q0XL 4PJHF 4F3FA 3AXLA 4GRWB 2HJFB 4YHOH 3E2HC 5GRVL 2B7DT 5E99H 3IRZA 4ZDHB 1I3GH 4K3DL 3SKOA 2IADB 4C4KO 3DO7A 5I1KL 3NCMA 1D6VL 4HMDA 1AH1A 1JRHH 4H26B 4K3JH 3N85L 4Z0BL 4OI8A 1XIWC 1ZLUK 1U91B 5T1KB 4ONFH 2Q1EA 4JRXA 1BREA 2K1MA 5D1QB 5DD3H 5ISZB 1A7OL 4Y4FD 4FQLL 4HGWB 5MP6H 2ADJB 4K94L 4YFDB 2CRIA 3S5LG 5C0RL 2P48B 1CVSC 1GC1C 4AH2A 3GMQB 1B0GB 4NQEB 4JHZA 1BFOA 4JFED 3QNYB 4U3XA 1P7KA 4YDJA 1DBAH 5J8OA 1MRFL 1WSST 5FHAL 2OL3H 1EEZA 2OJEA 2UYLB 2BFVL 5AWNL 1SYVA 1X5XA 1IKFL 4LVEA 4FXLA 5F1NB 4PRNB 3T2NL 3S98A 4K23H 1IQWH 3MRGA 1J8HB 1JN6B 1GHFL 4PJGB 4M7ZB 1U8OA 4PG2C 2DL2A 2RQ8A 5JIIA 4RWYL 2C9AA 1F4XL 2L0DA 3MLWL 3EO0B 3TBYB 3E6FA 5GRJL 1TQBC 3W82A 1E4KC 1OQOA 4ZNCD 2XFXA 3V5KB 3Q48A 5DMKA 1EERB 3AAZB 4LSTH 1L9MA 1PX3A 3UBXI 2B39A 3WE6A 4UTAH 4MJ4A 4OIAA 5JIHA 5C09A 1PVHA 2BNQA 2QLVB 3KPQB 3BP4B 4L1DA 2H6PB 5IFHL 4LPCA 1LGVA 2FX9H 4NUJA 4ELKA 4HPYH 4WWID 4PB9H 2I27N 3UDWC 2VABA 4BKLA 5CZVH 3CFKA 4GXVL 4Y5XA 1DVFB 1H8SA 5FM8A 3EO1B 1FFRA 5IB5A 1WIPA 5TQ0L 1KIRA 3HC0A 4QXTA 3VXME 3T0EC 4R4FL 5HSFA 5D1XA 5KN5B 4ZAKD 5DQJA 4KAQH 1ZANH 2CUIA 1GL4B 2F5AL 4FFYL 1DBML 1FJ1B 3DETD 3I6KB 4YPJA 4DTGL 3PDOA 3IDXL 4RISH 3ARED 4HWNA 4FNLH 2E5EA 4QY8A 3QDJB 2R2BA 2H9GB 4YC2B 5EDXA 1RAMA 1LEKB 5IHLB 1J18A 4NRZA 3QG7H 1XF3A 3QA3A 3CUPA 4JM4L 4TRPH 1IARB 3D2UB 2OTWA 4HXBL 4JJ5B 4CADA 2OZ4L 4JRXD 3QPXH 1CLYH 4KJWC 1K8DA 3V8CA 3MJ9A 3MRKA 1J0HA 2C1OA 4KVCL 5D7LE 5BVPL 3IU3A 4QHKJ 4ZS7H 1NJ9B 4EI5B 4Q6YA 1IC4H 1O5DT 1RULH 1WICA 4HWZA 4OIBA 5JOFA 3MV7A 1D7FA 4GW4B 4JN1H 1IT9H 1S7SA 5EO1B 3RWGB 2R23A 3QAZC 2QV2A 3MRLB 3E2HB 2FX8H 4Z9KB 1BLNB 4P46C 4UQ3A 2MMXA 4U1KB 3VD4A 2KZ1B 5HGHA 4ONHB 5IHUH 3DRTB 4MJIA 1I4FB 4L8CA 1AJ7H 2W92A 1YNKL 4XPGH 1NDMA 1KCUL 4XX1E 2VISB 3ZKNC 4JHAH 5JHDB 3SN6N 5BQ7B 1XIWB 4P3CH 4DGIL 2V7NA 1CFSA 4NZUL 2O61A 5KVEH 1UM4H 5ACMA 1D9KA 4E42B 5ETUB 4TUOB 5C09D 3TNNB 4X6DB 5DD1L 2BSSB 1A7RL 2X1QA 3EGSB 4G8EB 2APXA 5KS9F 3FRUA 2EH8L 3IFPB 1A1MA 2F53B 1I1CA 1A6ZB 3ME0A 5A40E 4NBXB 2XN9A 5D1XD 1WFUA 1EXUA 5GISH 3PGCB 2VLJA 1U8IA 3MJ7A 4P5TA 4YHPB 5HHOD 4P9HL 5I1HH 5AD0A 4JFOA 5TE7L 3QQ9C 4XWGL 1G7IA 3HUJE 2KUTA 3CK0H 5D7IE 2OSLA 1FGNL 3DV6A 4R97C 1ADQH 4PTUB 4E41B 5GRXG 4ZG1A 2QQLH 3C5SB 1EJOL 5C0JB 1JF1B 4ZTOH 4P9ML 1Q1JH 3JUZA 1X5KA 4RGND 3F58L 3WS6A 3BKCL 4AK1A 5AYUL 2EH7H 4Z7NF 4ELMA 3FO0L 4L1HA 4ZQKB 1J88A 5IB1B 3B9KD 4MGXA 4FQHB 2Q76A 3DV4B 3ZT6A 3MV7D 4BFGA 3O45B 5IVNA 1JNHA 3T0EB 3X3FL 4PJ8A 4XHQA 4OZIE 1RIUL 2BMKA 2J2ZA 3TH3T 2OS7A 1HHJA 3IFNH 2E7BA 3FO2A 1CXKA 5ANMA 3HE7C 4MJID 3SY0B 2CLVA 4X7TB 5JW4N 3EOBB 1LNUA 4I8DA 5AUMA 3TZVA 5ADPL 1GOFA 3U2SA 1WC7B 1JPTH 3SE8L 1ED3B 1XCTB 3HRZA 4X4XA 1PZ5B 4Y4HA 1D9KD 2Z8VC 4PGDB 1KPRA 1HH9B 3PL6A 4PLJC 1FL3B 2L7JA 4ZO8A 5J1SC 1IGJA 1DUZB 3J8F7 4IOIB 4JDVA 1XFPA 1VADA 1MCOH 1W2KT 2PO6A 1F4YH 2WMPA 3IS1X 2DQTH 3ZE2F 2BSTB 1XGUB 4Q6IC 5MEPA 2XN9D 4GO6B 2EIDA 2EZ0C 3PG2A 2HAZA 4P46B 2VLJD 3VFSB 4QHKI 2RGSA 1JWUB 3X12B 4RMQA 1YEDB 2VXQH 4NHUB 4PG9B 4Q97A 3STZB 3ARZA 1N2RB 3R8BB 4UIMA 5J1AB 5F7NC 1OSZB 1X9QA 4WVRA 3T3ME 4PJIB 3L5XL 3U48A 4CN1A 2F74A 1RZJC 4K9EC 5HYFA 2EDYA 1QSEB 3C08H 4JJHA 4WRLA 1QNZL 5I1GL 3ET9F 2DLIA 3DSNA 4KXZI 2AVGA 4OIIH 1NL0H 5D8JL 2HVJA 5DD6B 3VFTA 4GH7B 3LS4H 2H26A 4AIZA 3LQZA 2EEAA 2NY3C 1KACB 3QNXB 4JM2F 1EGJH 4OGAC 2IBZX 3BOVA 2ZUWA 4DKAA 1CF8L 1HXYB 2PCPB 35C8H 1NGZB 1MFAL 3QUMB 4QO1A 2OTPA 5EU5A 1F58H 1I7UA 4XPBL 2FR4A 4DEPC 1X5AA 2M1KA 2YEZB 3TV3L 5EIVA 2IPTL 4PJ8D 3LHPH 2EDTA 2FBOJ 4R7NA 3CVHH 1DUYA 1OTTD 4P59L 5EU6B 4ZNEE 3IDNB 5I8KH 3RIFF 5F7EL 4DGYH 1T03H 4P2RB 1RZ8B 2OTUB 5C0GB 3AROA 2YXMA 3V7AG 4R97B 1YJDC 4Z95L 4RSVA 3MA7B 4BK4A 1CFNB 3BH9A 4D8PA 1P9MC 3TZVD 2CGRL 3JZ7A 5TQ2H 4JZJC 4Y4KA 4GMTL 5KJRH 4JFDE 5GGTA 5C0CA 1FNLA 1CD9B 1KB5B 4WY7L 5LAXA 2F8OA 4Y4HD 1MWAA 1S5IH 1LILA 5FGCB 3K2MC 3PL6D 1ZHNA 5CD3B 2CH8A 2BCKB 3Q5OA 3HCVA 4OZHF 1UCTA 4JB9L 3PQYE 3LKNA 4NGHH 2VRAA 4M4RA 5F7WC 2VMFA 2NMSA 4J7RA 2PO6D 4LCWA 1T89A 4HX1A 1PW3A 4XVJH 1F6FB 3BDYL 5TF1H 3FTGB 4PJXA 5IVXA 1ZK9A 5HGDB 4U31A 3WIFA 1X5GA 3QH3B 3NZHL 3GRWL 4GRLA 3FT2A 3HMWH 4J6RH 5DT1L 2R4RL 4HIXH 5TDNA 4U05A 1UC6A 2APVA 1NFKA 5C86A 3HE7B 3IETB 3BO8A 4W4OA 3BHBA 4EI6B 5JORA 2NLJA 5I1DB 4JFZL 3UTSD 1OLZA 1MY7A 3B43A 4WFED 4LCIL 5HYEA 3LMJH 4U6YB 4NRXB 4RFEA 2O5ZL 1MIEH 4NBZB 4WI7A 4KJQC 1KENL 5F71A 1R3KA 2DQUH 1IC1A 5MHSE 4MNHB 4ZFZA 3F7PC 1EO8L 5KZCB 4RCAA 2Z4QA 4F7PA 3K3QA 1RHHB 3FT4B 4J1UA 4Y1AB 3S36H 2NY6D 1DBKL 2Y5EA 4LCUB 4PJFF 5J4MA 5HGGS 1TVHA 5B3JE 5CMAB 1XF1A 3I50L 4QRPA 2X4UA 1BM3L 4RRPG 1G7MB 4FFVC 1ZA3A 1T04B 2N7BA 1FYTA 4Q6IB 4LAJH 1M05B 1C16B 3SKJL 4OQTH 1OP9A 2YMXH 5K59F 3RAJH 4PJ7A 5ALCH 3SDXB 4L9LA 3IFOB 4BZ1L 5MEOB 5IMLA 1O7SA 1GIGH 3T4AA 3ARDC 5T3XL 2B0SL 2YR3A 5C2UB 4LIQE 1INQA 1QO3A 4DVRH 1MSPA 1OQXA 1R5IB 2DTMH 1IAIM 2IBGA 2J6EH 5SWZD 3CFEA 3VFWA 5CP7A 3TT1L 1V3JA 1BIIB 2NXYC 1W8NA 5CJQH 3QCVH 4NSKA 3TIEA 12E8H 2E9JA 2NY3B 3EYOA 2V2TB 5DDHB 1XGRB 3SOBH 3H42H 4HUXB 4Y16A 1ND0B 4NQDA 1FPTL 5AZEH 2VZ1A 4CVXA 3DRQA 5ID0B 2ADIB 32C2A 4LCWD 5EO0B 1RJLB 4KTYA 5SWQA 4DEPB 5CINL 5DJYB 3NFSL 4KUZH 2OQJB 1TENA 3DX7A 4LVOB 4ODWA 4LSPH 1HDMA 4GRLD 4BQ9A 4C56B 4NQCB 4P2QB 1S7UA 3SDYL 3L5IA 3RUGF 5HTSA 4JG0L 1JL8A 4JLRA 2Z8SA 1L7TH 3FN9A 3LB6C 2Q20A 2R69H 3LKOA 3VMPA 3LEXB 3B2UC 4FQCH 4EDXA 4JZJB 4LHQB 5CEYB 4RIRB 3G08A 4TOYH 2E7LC 5E95B 4JRXE 3OR6B 1UG9A 4MA3B 3N9GL 4FQPA 3ZSSA 1F02I 3BQUA 5TJWK 3OJDB 1RFDH 2GAZB 4HFUL 2GITB 3D1MC 5TH2A 2FH6A 3UJTH 1CXLA 3JWOH 4QRPD 2WBJC 3BP6A 5LKNA 3UZQA 5JIKA 5HBBA 3WKML 4L4VA 3EKCA 4YHNB 2YWZA 3BE1H 2ATPA 1UJ3A 3NGBC 1UB5B 4ZO7A 4F7TA 3KPPB 3NIGF 5T3XD 4PRAA 2FGZA 4B41A 2ZCKL 4OLEA 4YHZL 5I1AB 2YD7A 1R3JB 3C2AH 1QD0A 2OP4H 5DF0A 5J89A 4JVPA 2YC1B 3MRNA 4F37F 2EO9A 1MUJA 4OLYH 1TXKA 3ULVL 4GUPA 1K2DA 1PZUB 5CGYD 4APQA 3C8KA 3VFNB 5A2JH 3MV11 1UFUA 3OKMA 3P4NB 4BK5A 5C09E 4KHTH 2BNQE 1V7NL 4XWOC 5D96C 5HDQH 1BVLB 1EEYA 2R0LH 3QR2A 1NBQA 3QI9C 5F1IA 4XCEB 3RWJA 4UT6L 1ES0A 3UTOA 1EO5A 3JWDH 4NN7C 3W0WA 2LE9A 3P9LB 4Y16D 1EDQA 1OT2A 3UTPD 3UJIL 4X6BB 2HRPH 2OK0H 1GPOH 4YX2H 4NRYA 1RUKL 3FQXA 1I1YB 5EA0H 3WFDH 1KPVA 3LKRB 1YY9D 5IB3A 3UBXG 3FB5A 5FM5M 3LPGA 5EU7E 5CEXA 1HH6A 1JE6A 3JV5A 3FQWA 2LAAA 4OF3A 1IBGH 3FOMB 3ARDB 1NMAH 4TPRL 4WUUA 3WIIL 3H9HB 2XA8L 2IWGA 1QZ1A 3PGDB 1V8HA 4Z77B 1T80A 1IGTA 4TYUA 2PF6A 3MRBA 1NQBA 1HN1A 1FG9C 2J4WH 5D2LB 3ARWA 3LN5B 2NXYB 3BISA 1JZ6A 3H0TB 1VPOH 3RIFK 3JVGA 4RGNE 1ZGLM 4AEIH 4JO2H 3HNVL 3GM8A 1SM3L 1D5IL 1XAUA 4KQ3H 1CXEA 3VFOB 4TUKH 3CC5A 2JJVA 5C9JB 1BEYL 3UAJC 3PHQA 5IMMA 5A16B 1OVZA 4M48H 2ZUXA 1VACB 2IFFL 4L4VD 4OLUH 3MV7E 5IQ7L 2W60B 2P24A 4ISVB 4JCLA 2DMKA 2MCPL 3I9GH 1NCAL 1BQSA 2BXZA 2HA1A 3WSQL 5EIIA 4M3KB 3I75A 5F7MC 5E8OB 3ULVD 1JRHI 4GRMA 4P57B 3FONA 5GZNC 3HLAB 1MREL 1TNNA 2IPKB 3KYKL 5DS8B 5ENWB 3WFEL 1KC5H 4XI5D 4C59B 3MRIB 4OD2B 2WQRA 5L88H 5D6CA 1UH3A 5HHVL 3SE4C 3S8WA 4PLNC 1SBSL 1NLDH 1T5XB 4IRJA 3A6CH 2M2DA 5FYJH 3FMGL 3IJYB 4X98A 3DUUB 5D7KE 2VXUL 3W0WD 1DQQA 5E8PB 1M7XA 1QBML 2FX7H 4M6AA 3NGBB 2VL5A 4WI2A 3P4OA 5ESVA 5H35B 4DZBB 2PXYD 1MH5B 2F9BT 2YD6A 5IJKC 1OARH 3H9ZA 4D0BA 1HEZB 3QO0B 1RSFA 3ILPA 4P99A 2VLJE 4X4ME 3U9UA 1F90H 1Z5LB 2ADFL 4QNPE 3GSXA 3L3OB 1MRDH 3HNSL 1JZ8A 1TLKA 1BBJA 4UI2A 3IFLH 3TA3D 2C7UA 2CKBH 1KIPB 3BX7C 1RUMH 2B1HH 1YEHL 1JP5A 1OGAB 1AI1L 3ARYA 3E1F1 3QWOB 3LIZL 2XG5A 3ZDXE 4NM4L 4NKOA 3ZKMD 3HUJB 5D7IB 1QBBA 2E6PA 5DO2D 1RMFL 2HJKA 3Q0HA 1CXIA 1FLRL 2VLME 3REVA 4U6HA 3IKKA 3C9NB 3S37L 3IGAB 2XQYK 2EXWD 1MFEL 3QI9B 4X7SH 5CAYB 1YZZA 3D3VB 4O5LH 1DLFH 1X44A 4O2CB 3WO3B 4NN7B 3TYFA 2EDQA 2IPUG 3EDFA 2AEWA 4N8VA 2V5MA 3PJSA 1HXMA 5HYSB 3FN0L 1CD1A 2FHFA 3E6HA 5T1LB 7FABL 4Q0XH 1EFQA 5I1JL 4QRUB 3MRMA 4BQBA 1MCRA 2P45B 3NPSC 4NQXB 4DUXA 5IP4A 2B4CL 4X6CA 5I1KH 1NAKL 2YD3A 1D6VH 1N59A 3C60C 1VEPA 1GGIL 2ICWA 4PJCF 4BFIA 3FOLA 3N85H 1HHKA 4Z0BH 5ANME 3MRRA 3W9DB 3AS3A 1DN0B 1YPZF 5T5FL 3S3PA 4M5YL 4XCFL 1A7OH 2KH2B 3NIDF 4L9DA 3KS0H 3TM6A 4FQLH 1F2QA 3ARGA 1WVZA 5FO7A 4LRIA 1JWSB 4K94H 2R15A 5C0RH 1T20B 4HEME 3TH4T 3HPLA 4IRJD 4TVSa 3MCLL 1QUNA 2YD2A 5IBLC 5HPOA 4X8XA 5DMYA 1I1FB 1ZXQA 5DJXB 1MRFH 5FHAH 3LQAC 3AY4A 4HT1L 5AWNH 2DAVA 1IKFH 1PJ9A 2E7CA 1MCHA 4YPGB 1DFBL 2AKRA 2R2EA 3BIKA 3T2NH 1AGFA 1QQDA 4HUKB 2BRRL 3STBA 5TDOB 1GHFH 1QVOA 4I3GA 1GGCL 2WK2A 4ZFFA 3O3AA 5L6YL 4RWYH 5I1EL 1TZIB 4WIQA 4U1SA 3RKDD 1F4XH 3Q5TA 4OLWL 1WBXB 2FDBP 3DIFB 1AHWC 3MLWH 1G7PB 1U8MB 1ORSB 4J4PC 5EUOB 1KJ2A 2J88L 2W07A 5GRJH 3OKLB 1QTYT 1BF2A 1GZPA 2JK5A 2EYRB 4L8SA 1CDBA 2WUBL 2EDLA 2APBA 3PWVB 2DWEB 1I1RA 4NQTA 1IM3B 4WWKA 5F9OL 2X70B 2ZG2A 5IFHH 1GCFA 2OR9L 4E5XB 4GXVH 3L3KA 3ARBD 3MNZA 4HKZB 5I74C 4HLZH 3F12A 1A7QL 1BBDL 3N06B 4LGRB 5TQ0H 4K8RL 4R0LC 2XWJB 4MXVF 4GKSB 1MLCA 4R4FH 1A6VL 3BMVA 3WJLA 1KXQE 3A6OA 2F5AH 2DI8A 1ZWIB 3CZFB 1GOHA 4FFYH 5IEKB 1DBMH 4DTGH 5J7CC 3LZFL 3IDXH 4U1IA 2PN5A 2ITDB 5KOVC 4NQVA 1I8LA 5CJOL 4Q2ZA 4NUGL 1O0VA 5D9SA 4AQOA 2EE9A 4HUWA 4PD4J 4R96B 5EUKA 3VRJB 3DX6A 4GXUM 4HXBH 4PGCA 5FO8B 5EC2B 2OZ4H 4JVWA 1A0QL 3VI3E 2FIKB 3ARGD 2XOTA 3U7AA 1BQUA 4KVCH 5BVPH 5C0CE 5A1AA 3KPRE 4JPKL 4GG6F 5DHVA 5F9JB 1CN4A 1UVQB 3RHWF 5FGBC 1CFQB 4KK5D 4F9PA 1U58B 2IH3A 4P4KA 5LWYL 5JTWA 2AXHA 5BZDB 3MRHA 3NPSB 1S7QB 4PJXE 5IVXE 3PQYB 2FHBA 4AQ1B 4LL9A 2VN4A 2AGJL 3EZ8A 3SKNA 3C60B 3RY4A 4H8WL 5C92A 1YNKH 2BVPB 1A2YB 1KCUH 5DJAA 2YWYA 3O2WL 4U4BA 4XCCL 1ZMYA 2D31B 1BZ7B 4DGIH 4OKVB 1XCQB 3MV9E 4NZUH 2NTFA 1CGVA 5D2NC 2YHGA 4NYLB 1I85A 4LF3A 5B39G 2BRQA 4WWKD 4XAKE 3KLSA 3NAAL 4XNMA 4KKLC 5DD1H 1QEWB 4XP6L 4ODXA 1A7RH 3D39A 5DVOA 2EH8H 4PREB 3G04B 3GB7A 4F2MB 5E8EA 4UV4L 4BELD 1PG7W 5A3ID 4QXWA 5K93A 1HKFA 1FYTE 4JO3L 5K9KA 1E0OB 1DE4A 1NGWB 3STLA 3QFJA 1RUPL 4P9HH 3EO9L 2HH0L 5GJSL 5TE7H 4PLOB 4XWGH 3UEZA 4B7IA 3DGCR 4Y5XC 4PJ7E 1FGNH 3L3DA 1AHWB 4LBEB 3MNVA 2XRAL 1G9NC 1CXHA 1EJOH 4NZDA 1S7VB 2FYYB 2Q8AL 4P9MH 1BJMA 5J12B 5KSBB 4WO4D 5GS3A 5ICYA 1IAOB 3O2DL 1LE5A 3F58H 1OP5K 4CU8A 2HTKC 5FOBA 3BKCH 5GGVL 3QXAA 5AYUH 4F33B 2OI9B 1EO7A 2F58L 3FO0H 4QCIB 1H3VA 1S9WA 2GSGB 1M71A 3OR7B 1CFVL 2JELL 5FF6B 3X3FH 3P77A 4NQDE 2I60L 3T3PF 5I1LB 1RIUH 1IE5A 4HS6A 4P4KD 2EYTB 1G9MC 2P8PA 4KMTL 1CL7L 3CPLA 4GAFB 3IJHB 3HAEA 1ITBB 4N0CC 2BC4A 3MTRA 1MPAL 4PGBB 3KXFB 5E2UL 5ADPH 3OPZL 4TTDC 5JHLL 1CFTA 3SE8H 3Q6FB 5ESQA 4EJ1C 4HBQA 1WTLA 1Q8MA 2P49B 2V2XA 1SYSA 4PRHE 1Q94A 3B9DA 3NFPA 3O11A 5F8QC 1E6JL 2Y7QB 1TPXB 3D39D 1INDL 2YD9A 2LVEA 3OKEB 3VFPB 3C2SA 2VAAA 4HMCA 3T77A 5DJ8A 4MAYC 2AI0L 2NY1D 4JFFA 4LFHG 4ZXBA 1D9KC 3VD9A 2P1YA 4OAWB 4ZSOA 1QLFA 1P1ZB 3QEHA 4R6UA 2GK0B 3ULUD 2I26N 3L3JB 4EUPB 1U3YA 3QFJD 4AH2B 3MJ8A 2NR6D 1V3MA 1ZLWK 2VN7A 5JA9A 4UOW1 5C0BE 2CPCA 3SBWA 1IQDA 2ZOKA 3L5XH 5JNYA 1W72L 2O93L 4XNQB 3GIZL 3VXTB 1QNZH 3EAKA 4HJJL 5I1GH 3CU7A 5D2NB 3MRGB 4KK9D 4P5TC 2G60L 1F3DH 2WLZA 3K81A 5D8JH 3RWIA 1YEKH 5IHBA 3L3IA 1RUAL 2H1PL 5KSUA 3MOQA 1NPUA 5GGUB 5CBEA 4NC1E 1CF8H 3RWHA 1MFAH 4MSWB 2NCMA 2AJVL 2VLKA 1H3XA 1W0YT 3D0LB 4XPBH 5LJYH 3GBLA 3ZL4L 5IMKA 1I3VA 3TV3H 4Q9BA 2IPTH 2BNQB 2J8HA 4N9OB 5I8EA 1S7WB 4OZFB 4P59H 2MNUA 4PJEA 1ODAA 5F7EH 4PJFA 4BKLB 3CFKB 3WEXA 3UZVB 4Y5XB 5IB5B 2Q7NA 2H8PA 4Z95H 1KIRB 3EJYD 4L4TD 4WUUE 2CGRH 5ERWA 4JQVA 4GMTH 1ZA6A 4EQ3A 1H15A 1RUQL 4PJ5A 4WY7H 5D7SL 4K71B 3BRGC 1OTTC 2EDNA 5IEHB 1YNTB 3QEQA 4LLAA 4MA7L 3OKOA 2ENSA 3MLXL 4HUVA 1AXSB 3S4SG 4XNUL 4UQ2A 4JB9H 5JZ7D 5FUZL 5EWIL 4NRZB 5GGTH 2X4OB 1MNUL 3VA2C 5IV2A 5GGQH 4M9OA 1MFBL 2XNAB 1FFPA 3CUPB 4LMQE 3CX5J 3BDYH 1AGBB 2YOCA 2PYEA 5E24E 1MCEA 4Y4HC 1G6RA 4ZXBD 4K7PX 3PL6C 3MRKB 2C1OB 4XZUB 5F7YC 1NC2D 3GRWH 3NZHH 3V95A 1XGPA 4LGPB 5DT1H 3VRLE 5E2TL 2KL6A 2R4RH 4LLWB 4F57L 1NBVL 5GHWL 4HWZB 1FP5A 3ESVF 2YRZA 1G6RL 2C4FT 5H94B 4JFZH 4KDWA 2XKNB 1S7SB 1QYGL 3BESR 1CIUA 1WZ1L 4H1LH 3DGGA 4LCIH 5GSRA 1JGEA 1J7VR 1R3IL 5DA0B 5CLWA 1KENH 1FVCA 2DF3A 5INDA 1J0IA 4UQ3B 1EO8H 1FO0A 4OSUL 4WHDA 1DBKH 1ZLUH 4ACPA 4XPFL 3VFUA 1SJHA 1D5BB 3GJEB 4G9FB 2AXJA 5L9DL 3I50H 4JY6A 1BM3H 2C3WA 1S9VB 5J1TC 1PQZA 2C3XA 1GZQA 4MAYB 2BVUA 4N5ED 1BFVL 4GS7B 4URTB 3SDAA 1ZVSB 5CSZB 4BJLA 3SKJH 4I48A 1YQVL 1HQ4B 5I8OL 1U3HA 2MSPA 1U2CA 4BZ1H 1MHEB 3IAQA 1AD9A 1S7RA 4UU9A 1N5AB 2GK2A 2EDDA 3L5WA 5T3XH 4D9QE 1OB1A 4M6NL 2B0SH 3MRQA 4OBRA 2WLYA 5JLZA 4PLKD 4GBXB 5FUCE 4MJ6B 4PJ9A 4P5TB 3B9EA 4HZAA 4OBSA 4PJ5D 3VGHA 5FB8A 4LHJB 3TT1H 4YIQB 4NKQB 5EO9B 4R3SB 4JZOA 3H3PL 3QXWA 3VGDA 4JFOB 5CJXC 4X5WB 1G7IB 2BOBA 2OSLB 2DQFA 5SWSB 3O2VL 5IJVA 2MQCA 1FPTH 2VR9A 4Y4KC 1B4JL 1N0LA 5TGBA 1DLHA 4G7VL 3QDGE 1AR1C 2PYED 5CINH 3X14B 3WNMA 3NFSH 4JANB 3UC0L 4KKCD 4BH8B 1NUFA 3G5YA 5BS0D 4LHUB 3ZYIA 3F7VB 2NTSP 4GLRH 2Q6WB 4X6CE 4X7DC 1KTLA 2CK0L 5LGHL 5KVMC 4BQ6A 3SDYH 4KK6C 2JIXA 1I7ZA 4L3EB 1MAJA 3EYUL 3QHFL 4JG0H 3SEPA 2YXFA 1YMMB 1JNHB 3MACL 3KPTA 3O3BA 4MDIB 4TSAL 5J13C 1MCWM 4Z7UF 3RNKA 2R1WA 2BMKB 4JQIL 4MS8C 2X1PA 3I84A 1HHJB 5DEFB 4ZUSA 3N9GH 5FOJA 3RDTD 1L9NA 3BRDA 3ES6A 3DXAA 4W4OC 2AV1A 4PV8A 2DKUA 3BP5A 4HFUH 5AUMB 3S96A 2G75A 3WKMH 1FDLL 1LWRA 2VLLB 1IAIL 5KTEL 3IS0X 1KPRB 4Y2DA 1PGRB 3SDAD 5BV7C 3PUCA 1VGEH 2ZCKH 2X44D 4YHZH 3MJ6A 4DKFL 4AG4L 1JYVA 5E2VL 4CDGC 3RZWA 3FB6A 1U3HD 4RAUA 4JDVB 5GZOC 2RAMA 1TITA 1VADB 3BP7A 4R4ND 3WDHA 4UOJA 3GSNA 3PIQB 5D1ZC 2H32A 3ULVH 5MEPB 4WFFD 3IDIB 1YYLL 2GJ6A 4PJ9D 1NCDL 6FABL 2A74B 3T65B 8FABB 3L1OL 2CDFA 3MR9B 4L9LC 4S2SB 1V7NH 1HWGB 1GJIA 4XXDA 3X11A 3U4EB 2V2WA 3G5XA 4NM8L 4UT6H 1OTSD 5IMOB 1YDPA 4G43A 3VWKD 3FKUS 3V0AC 3GSOB 3UJIH 5CGYC 2QADD 1CLOL 2GTWA 3HI5L 1RUKH 2OXGA 3OAZH 2Z35A 2A9ML 3QPQC 2H26B 4PJDA 2QQKL 4JAMA 4AIZB 3QFDB 2I9TA 2JJSA 4LOUD 3W9EA 2FJGA 4Y16C 3NCBB 2A2QT 4GKZA 4TPRH 2JIXD 3WIIH 5EU5B 2YPLA 3JV4B 1U36A 2XA8H 4OZGA 2FR4B 1ORQB 5TE6L 3CX2A 2J8UF 2D4DA 3HR5A 3DI3B 1FN4A 1YY9C 1IGML 5IOPB 3QSKB 1DUYB 1CDUA 1HSBA 2Y6SC 3SGEH 3CCHB 3B2VH 3Q2CA 3HNVH 1SM3H 1D5IH 5B8CA 3V7MA 3WUZA 3DXAD 3LQMA 4WEUD 2Q86A 5FGRA 4PJBA 3D9AL 1BEYH 3BH9B 2BVYA 4NIKB 2LFGA 4Y4KB 5DMJB 1U8QA 2IFFH 5IQ7H 5C0CB 4XNYL 3KPRB 1MWAB 2MCPH 3SO3C 1NCAH 1FZOA 1UGNA 4Y2DD 1FL5A 3WSQH 4CGTA 3BQUC 3N1QC 4CMHC 4U1JA 5EZJB 3KPMB 4LDEB 5C0FA 1NUDA 1BMGA 1FIGL 1FZJA 1MREH 2FEEI 3LKNB 3W39A 4Z7NE 1IFHL 2NW3A 3KYKH 2ZOLA 4AYFA 1P7QA 1U8KA 2ADGA 3WFEH 1FIEA 4YDVB 4Q9CA 1INEL 3MJGX 1YQ2A 5IVXB 3OGCB 4LSQL 2W65B 3WIFB 5I71C 4N0YL 1N3NA 3U6RA 1YMHB 2GJ6D 5HHVH 1Y0LA 1KIQB 5TDNB 1QSVA 1SBSH 1CGTA 2YA2A 2CMRL 4BSWA 1Z9MA 3FMGH 4JZNB 5E5UB 5JQ6L 1RIVL 3MV9B 2NLJB 1E27A 5HVHC 4XI5C 2CLZA 1QBMH 4TNVF 1HHIA 2X4QB 3BKJL 4ZFZB 2Z4QB 4APQC 4F7PB 5CJ8A 5BV7B 1C5CL 1YN6B 4QHLA 5I6XC 1V05A 4LCYA 3PXJA 4NC1C 3FHAA 3ULUE 5DUPL 4YGVB 3QFJE 4X5LA 2ADFH 4XNXL 4LLVA 3HNSH 3OHXA 3JXAA 5DK2A 2D3VA 1HCFX 4XBPB 4JREC 4QRTB 5F88A 1ZA3B 1FH5L 5C8JA 1FYTB 1YEHH 2YPLD 5D1ZB 4AIOA 1JPGA 4DGVL 5KSVB 2XWTB 3ISWA 4XGZB 5JW4R 1AI1H 3LIZH 3U7YL 1IL1A 3QRFM 1QBAA 4NM4H 3ZE2E 2M26A 1TDQA 1ZLVK 1RMFH 2DJ4A 1T0MA 3MRPA 4A6YL 3QISA 1FLRH 4L9LB 4YFLF 4HIIA 3S37H 1XR9A 3T4AB 1MFEH 3BPNC 2R1YA 1BOGA 4HWEL 1KB9J 3BKYL 4JRWA 5JO5B 2XWBA 1BIHA 1QO3B 3FN0H 3HB3C 7FABH 4M4PA 1E6OL 5DO2C 2HTLC 2DMBA 5I1JH 2F8XC 1NH6A 3BZ4B 5FYKL 3TIEB 1DL7L 1NAKH 4J3SA 3NA9L 1GGIH 4G6AC 4O02L 2LQRA 1U8NA 4J2XA 1UXSA 2AQ1A 3TFKD 4NQDB 4CVXB 4XTRC 3DRQB 4D0CB 2WW8A 43CAB 4MNQA 1WLHA 3FCTB 1P7QD 5T5FH 3KHOA 4BSVA 4M5YH 4XCFH 5IB2A 1T7WA 4N90E 3DX7B 2GEEA 2PNDA 4ODWB 2N56A 4J3XA 5E94B 3SO5A 2E8YA 3ESUF 3OBAA 1QLRA 3BDBA 3KNBA 4TULL 5GS1C 3MCLH 4OFDA 1XF4B 4QHNA 1E28B 5FDWB 5MENE 3SGJA 3EFFA 4LU5L 4HT1H 3D25A 2BNRA 1TCRA 4S1SL 2FEDD 1DFBH 3VDBA 4ODUB 4PRHB 4JFFE 5IF0A 2BRRH 3C6LA 3SO3B 5JW5A 5HDBF 3BXNB 1ZGLP 3BQUB 4CMHB 1GGCH 1LP9A 5L6YH 2YD4A 2Z92B 5I1EH 4Z7WA 5H37G 4OLWH 2J5LC 1A4KB 4LLYB 3IKCA 4KTEL 5E7BA 2J88H 3CDGB 5C70A 2ATPB 3BPOC 2A0LD 2QL1A 4OCYL 3SQBA 3BYTA 2WUBH 5I71B 1K4DA 3BJLA 1CDHA 3PP3H 4YZFF 5F9OH 3D69B 3GI8L 4XBEL 4HAGA 3INUL 5C0BB 3PHSA 2OR9H 3G6JF 1J1PH 5GS0L 2UY7A 3PHOA 5FYKD 1A7QH 1BBDH 4KGLA 5HVHB 1AGDA 3D0VA 2FBJL 4K8RH 4QHUA 4U49A 4GUPB 5DVMA 1A6VH 3UTQB 1WTGT 3ROLA 3VXNA 2VLKE 4XMLL 4APQB 2A6DB 2GCYB 3IAPA 5CGTA 3OKMB 4JKPL 2A6KB 5I6XB 4ZDHA 2PTUA 3LZFH 2IADA 2V17L 3RWJB 3BD5A 5C3LD 2ENYA 4PJEE 5CJOH 4NUGH 4PJFE 4MWFB 5E6ZA 4H26A 1K8IB 5A2IH 2DQDL 3JBG7 2CDEB 4JREB 3KPOB 1U91A 3HI1B 1A0QH 5D1QA 1AFVL 4Y89A 1A3RL 5ISZA 1NMBL 3FQXB 4K3HA 5JOPE 4MQTB 4WUKL 4RMUA 1OWRM 1EA9C 3O3EA 3FB5B 2ADJA 4KJPC 3QEQE 4JPKH 5K59E 1FQ9C 3GMQA 4WUUB 1KTKE 1B0GA 3BPNB 4NQEA 4EOWL 1TJHL 1S78D 3QNYA 4IS6A 4FHBD 4U33A 4TVPD 1IGTB 1QLEL 3CVHB 4TUJB 2BNRD 3RZCA 2P43B 5LWYH 5CZXC 4KUCD 5CP3H 3EOTL 5DHVH 5F1NA 4PRNA 4HUMB 2PYEE 1NCNA 2GIYA 1LD9B 4LRIC 1JN6A 4PJGA 3S35X 2C3VA 1AKJD 5K9QI 2AGJH 4H8WH 3CC5B 3IDJB 3O2WH 4XCCH 1BX2B 2FSEB 3VH8A 3TBYA 5HGBB 5F6HI 2DQHL 2YZ8A 3V5KA 4MQ7A 3PGFL 4LLQA 3AAZA 3ZTJG 1TJGL 3I75B 2OR8A 3DVFA 4M1GL 2NXZC 1R5VB 3NAAH 3KPQA 3BP4A 4XP6H 4NNPL 4UILL 4QXGL 4OUUB 5GS1B 1E4XL 1IEBA 1PEWA 3F7RA 1KYOK 1HYSC 3MOAL 2FATL 3PABB 3OF6A 4OGYL 1CDCA 1DVFA 4UV4H 1KG0A 3EO1A 4WHTB 3RUGE 4L8SC 5F3BA 1PKQE 3QEUA 4RZCB 2ZUYA 2EDRA 1FGVL 5KN5A 3CSBA 2GTZB 2V9QA 4JO3H 2VDRL 3WN5C 1RUPH 2HH0H 1FJ1A 3TBWA 5GJSH 3I6KA 5MI0C 3BN3B 3N1PC 3QDJA 2J5LB 3KG5A 2H9GA 4DCQB 2R2HB 3G9AB 2XRAH 3EDKA 2EXYD 3BPOB 1TQCC 2Q8AH 3I2CL 5T1KD 3WJLC 3D2UA 4XC3L 2IG2L 4JJ5A 4WFFE 5C0DB 4XH2B 2WAHA 5D1QD 2X42A 4CMMB 5ISZD 3O2DH 3ILPB 3ALWA 4WFHD 4O2EB 4WI6A 3NIGE 5GGVH 2DJSA 1ONQB 4XVUC 3CU1A 4RAVA 2F58H 3BPLC 1MJ7L 1NJ9A 4EI5A 4MJ2A 5DRXB 3FFCA 2C7UB 4YWGH 5L2KE 5HD8D 3V2AR 4NQED 5F7UA 4L8DB 1CFVH 4GW4A 4AZ8A 2JELH 4OM0L 4PTTB 2DWDB 2UY6A 4M1CD 2I60H 1WITA 5EO1A 5FA3A 4FG6D 3MRLA 1BLNA 3EHBD 4KMTH 4U6HB 3BH8B 1CL7H 4O9HL 5B38B 1A14L 3TF7C 1DANT 1KNOB 3DRTA 1I4FA 2XQBL 2X4TB 3QUYC 4N8VB 3QDGB 1HXMB 4IRZH 4DK3A 1XIWA 5BQ7A 5BRZB 3QQ3B 3OPZH 1X5LA 4M02A 5JHLH 5BO1L 3OAUL 3MRMB 5EZIL 4PBXA 4LKCB 3T04D 4E42A 1N59B 4TUOA 3TNNA 1TNMA 3CNKA 1I1AA 4X6DA 1HHKB 1E6JH 2BNUB 3MRRB 4G8EA 1INDH 3DXAE 3W2DL 4I9WD 5KOMC 3IFPA 3OF6D 1MOEA 1DVFD 5E2JA 2F53A 3TBVB 1A6ZA 5FV1L 2AI0H 1KULA 2EEDA 3LCYA 3B3IA 2EKSB 1GC1L 1K4CB 3PGCA 2NZ9C 2WV3A 4BYHA 4YHPA 4PG2A 4MCYA 4OF7A 1A6TB 5T5NG 4OD1L 2A9NL 3G6AA 1FBIL 1HNGA 4Y5YB 1G0YR 1KEML 3QDJD 3HI6L 4WW2F 4KI5D 4PTUA 3NN8B 1W72H 4E41A 4H25B 2VXTL 3K2UL 1UZ8B 3C5SA 4P23A 3GIZH 1G1CA 4HJJH 2R2EB 3BIKB 5F44A 5C0JA 1RJYA 1EVUA 1P2CB 2PW2B 1JF1A 5I18L 2J7LA 3D2UD 1F97A 3ULUC 1I7RA 2G60H 4DN4L 1EAJA 3K8LA 5C71A 3HC4L 4LFHD 2NXZB 2GJ6E 1FVDB 1RUAH 2H1PH 3AGVA 3TCXA 3WHE0 2V9TA 1TTUA 4EI5D 1OT1A 1KJ2B 4ZQKA 5IB1A 2AJVH 1SMAA 1RK1A 3DV4A 5FHBL 4YXHL 4KK9C 3ZL4H 5C0IB 2WZPD 2V5YA 4RMTA 4XRCB 1NBYB 2QR0B 3N0PB 3Q6GL 1DJSA 3WN5B 3VI4F 2CXGA 1RZGA 1X6NA 4MLSA 5MI0B 3D85A 1JI1A 3GMMB 4PJDE 2AERT 3QO1B 3RVVC 2RCSL 1MHPL 1QSFE 3SY0A 3CAFA 4PP2B 4X7TA 1HINL 2R0WL 2CKNA 4NZTL 3NA4A 1FV1B 1XIWD 1TQCB 1J0YA 1MJ8L 2V5RA 4F8QA 4OFYA 4NQUA 1WC7A 3LKSB 4OZGE 3V6BR 1XCTA 1RUQH 5D7SH 1N4XL 4CW1A 3WNOA 3I85A 5HHQA 4MA7H 1PZ5A 4U1IB 3RFZC 3MLXH 1HH9A 5CKGA 1FL3A 4XNUH 5KS9B 2AP2A 4NQVB 3BPLB 4Q2ZB 4V1DB 5FYLL 1Z9OA 5D9SB 5FUZH 4Z0XB 1DUZA 4HXAL 5EWIH 4BQCA 3K46A 4IOIA 1MNUH 1Q0YL 2Y4SA 1WCBB 1MFBH 3WUWB 1YUHA 1I7TB 2F53D 3NCJL 2X1XR 2BSTA 1XGUA 4LSDA 4OGXL 4GLRI 5KSAC 2FNBA 3RIAF 5I76A 2LTQC 5E2TH 3VFSA 2BERA 4F57H 4KI1A 1NBVH 3P3YA 1JWUA 5GHWH 3X12A 4NWTL 1EX0A 4PG9A 4NHUA 4I5BA 1NGPL 3STZA 4JDZB 1G6RH 3QUYB 2JKXA 1N2RA 5FFLA 5J1AA 1OSZA 1QYGH 4PJIA 1WZ1H 3MLVL 4ZXBC 3O8XB 4E41D 4Z7VF 1R3IH 1QSEA 4X9HA 1YC7A 5I16B 3QIBC 1LK2A 5EU3B 3HHRB 4OSUH 5ITBL 4JO1L 5DD6A 3SKNB 1DP0A 2ARWA 5C9KA 5B21A 2ZSVB 4F7MA 5C2BL 3SBWC 2LU7A 5L9DH 3DVNB 3MPCA 2PCPA 1HXYA 1NGZA 1S5HA 4NKMB 3DTXB 4JRYE 2NY2D 1QR1B 1BFVH 1YPZE 3DYMA 3MGTB 4LF3B 4ONOA 4NFDA 5INCB 3T0ED 4BSJA 2X4PB 5EORL 4PFEA 4JGUA 3NIDE 3O6FC 1NANH 5I8OH 4ODXB 3QUML 1LEGB 1ITCA 5EU6A 1QP1A 3IDNA 3VG0L 2V7HB 4P2RA 3WIHL 3GZKA 2OTUA 4M6NH 1OM3L 2CD0A 2E7HA 1NLBL 4OFYD 3QHTC 3STLB 3QCTL 3I6GB 3H3PH 4KJWD 1VFBB 3MROA 4FNLL 1TTFA 3I6LD 5CD3A 2BCKA 4MXQC 4LLMB 3UYOD 1AP2B 3O2VH 4R4BB 4XP5L 5GRUL 1KB5L 1B4JH 3CDCA 4IMLA 4G7VH 4X83A 2ICWJ 3R1GL 3OSKA 4UMGA 1QHPA 1SMOA 3ELAT 3FTGA 4HCRL 5FV2A 5FOBB 3QH3A 2I5YL 3MCKB 4P46D 2CKBB 4ZYKA 2NY0C 2CK0H 5LGHH 3S9DB 1R5WB 4PY8J 3HE7A 2EDHA 3EYUH 3QHFH 1S9WB 1M71B 3MLTB 3KYAA 1IEHA 3ZKND 3MACH 5I1DA 2IMMA 4TSAH 4LLUB 3P77B 4I2XA 2YD5A 4HGMA 2GUOB 4JQIH 4UOW0 4NRXA 3GKZA 4MNQE 1WCQA 1RJZB 1QSED 4M6ML 5E00B 4QRQA 5H8DA 2WINB 4MNHA 2QSVA 5JOEA 1FRGL 3GJFK 1RHHA 1RV6X 2CJUL 2MQ3A 2X41A 1RPQA 2QTEA 4LCUA 3V9FA 1BECA 1P4IL 5CMAA 5F9DC 1CFTB 1CGSL 1FDLH 4PR5B 1YEIL 1IAIH 5KVEL 1T04A 5KTEH 4TVPE 4Q6IA 1J05A 4XP9L 1M05A 1QFPA 5KSAB 1IAMA 1C16A 4S0SD 2LTQB 4DKFH 3EBAA 4AG4H 1Q94B 1RURL 5E2VH 5MENB 3V5HB 3SDXA 1JNNL 1JK8B 5EU6D 2C26A 1B0RA 3IFOA 4P2RD 5MEOA 3QQ9D 4Z7WE 4GG6E 2ESVA 2JLLA 3IXTB 4X8JB 3GUTB 4JFFB 3H3KA 5I73C 1QLFB 3SDAC 1BFSA 1RJCA 1P84K 1YYLH 3KJ6H 2P5WE 1NCDH 3QIBB 6FABH 3PWPE 1WAAA 3PE9A 4JR9L 2FJFA 1FNHA 1BIIA 3GSNH 2EC9T 3L1OH 4UZGA 4O4YL 3UPRB 1SY6L 4OZHB 1S9KC 3DMMB 5ACLA 1RZJL 2V2TA 4K9EL 2DQIL 4NM8H 5DDHA 4G5ZL 4OCMC 1XGRA 1JGDB 1KIUA 1J11A 1T3FB 5DEGB 4HUXA 1ND0A 3IRPX 2XACC 4Z7QE 4GAJH 5ID0A 3MXVL 2ADIA 3K4AA 5EO0A 1RJLA 1TTGA 1CLOH 3HI5H 5DJYA 2A9MH 3O6FB 2OQJA 2QQKH 4GRWE 1QOKA 4ETQB 4C56A 5IBUB 4NQCA 2Z9TA 4WFGD 1Y6NR 3HE7D 3RWDB 5EFIB 2VLKB 4HUNB 5TE6H 3WFZA 1KTDB 1X5YA 2UZIL 4Q9QL 4GMSL 4JZJA 4LVHC 5I8EB 4KC3B 5CEYA 4RIRA 3VE0B 2XIDA 1IGMH 5EOTB 5GS2D 3OR6A 2QSCL 5ISZE 3L5HA 4MA3A 2LABA 1RVFL 3V52L 4PJFB 5KZCD 1YJDL 1CTNA 3F8UB 4PLJD 4NO3B 3OJDA 2GAZA 2H8PB 1ZE3C 4OD3L 3D9AH 3TYGL 4R90L 1L6XA 3LOWA 2GITA 1CR9H 4X5XB 5CGMA 5IESL 4NQEE 3I02A 1ZA6B 2WBKA 1JPTL 1OP5H 4XNYH 3TIDA 3QEQB 1UB5A 1RQ5A 3LY6A 3KPPA 1N26A 3QIWA 2EZ0D 5I1AA 5M7QA 1A6AB 1R3JA 1E4JA 1FIGH 2NY0B 4WI8A 4PJGE 5IV2B 2RHEA 3VRIB 4NPYA 2M8XA 1IFHH 2YC1A 1FFPB 2O5XL 5F70A 4OI7A 5EN2A 4I4WB 5F3HB 1J1OL 5HHXL 1INEH 2DQTL 2ICWI 4LSQH 3QWQB 4JKMA 1Q0XL 4Y2DC 4ZOEA 4N0YH 1CDYA 1MCPL 3VFNA 2CMRH 1CDIA 4M5ZH 1QFWM 5JQ6H 1RIVH 1BVLA 3JTSB 1X5JA 2NY3D 4JFYA 5K9QG 4OGAD 3N50A 1FNEB 3DGGB 4I9WE 5GSRB 1JGEB 3ZDZF 2IFGA 5KVFL 2BSRB 2UZXB 4NCC1 5INDB 2NX5B 3RX7A 3BKJH 4X6BA 2UUDK 1Z3GL 5EU4B 1C5CH 4G6KL 1I1YA 3ALXA 3LKRA 1SJHB 5DUPH 3TNMA 4F9LC 4XNXH 3RUGB 4C56D 4NQCD 4JY6B 1PKQB 1F11B 4M8VA 4P2QD 1PQZB 1GZQB 3FOMA 3ARDA 3QDJE 1FH5H 2FJHA 3OGOE 4DGVH 3H9HA 2XTJE 4KI5E 1YECL 2OMBA 1ZHBB 3U7YH 4Z77A 2X9YA 1T66C 2BHYA 5F9WC 3MSPA 4WDIA 5D2LA 3BZDA 2JJSC 1N6UA 3I3DA 3T0AA 4A6YH 2IC2A 1AD9B 1BQHG 3QJHB 3JSSA 1T2JA 2GKIA 5E4EC 2BK8A 1OB1B 1XF2A 4HWEH 3BKYH 3MLPA 1W0WB 5C9JA 3FFCE 2DLHA 3UROR 1G0XA 5A16A 4YHLL 2ERJC 1J9CT 1BWWA 1E6OH 4IOFD 4GQ9L 4YJZL 5D72L 4IRSC 4JZOB 2HFGL 5EBLA 5FYKH 3TPUA 1XGQB 2JJUA 4UTBL 5B8CC 1DL7H 2BOBB 3QIWD 2XZZA 3ZE0E 5L2KB 5E8OA 3NA9H 2DQFB 3G6JA 4O02H 4YH6A 4ONGL 3HLAA 2A6JB 5IJVB 4TNWF 4JPWL 5ENWA 4QT5B 4MAUL 3F7QA 5JUEL 4KJQD 2E7LA 1DR9A 4WU5B 5CHNB 3L3GA 1VDGA 4ZUTB 1OF2B 4TULH 1T5XA 3VFGH 1I7ZB 4OLZL 4CL7A 5E5RB 4M8QA 1WBYA 3SDDC 3DUUA 4LU5H 2CIKB 2K3TA 2HFFB 5J6HA 3RNKB 4GW5B 5E8PA 4S1SH 1MIEL 2EIBA 2OM5A 2VITB 3BEVB 1YEEL 3VMNA 4K3GA 1KJMB 4FTVA 3ZE1E 4DZBA 2G9HB 5H35A 5GRZA 3W5MA 1MH5A 3RU8L 1HILB 3ES6B 2FL5B 1HEZA 3QO0A 4PV8B 1LEIB 5M94B 4U2YA 1K6QL 5HYJA 2NNAA 2IQAB 3S96B 4EDWL 3LN9A 2XTLA 3K4DA 4KTEH 5E9DB 2G75B 3RX5A 3ARDD 4RA0C 5CBAB 5T1MB 2W0FB 4OCYH 1OGAA 4OLXL 2KZWA 5DSCB 4PGJA 4Z7OF 3HUJA 3GI8H 4XBEH 5D7IA 3FB6B 3INUH 1FE8L 2NXYD 4L5FL 5FEBA 5GS0H 5L8LB 3LRGA 5FCUL 4KMLB 3C9NA 3ZDYF 5KVGL 3IGAA 3QI9A 4JDTL 2A0LC 3D3VA 2H32B 2O26U 2FBJH 4O2CA 3MUJA 4NJAL 4H1LG 5HYSA 2EDWA 1XZ0B 4I0CC 5T1LA 3VFMB 4XMLH 2DIBA 1CGYA 3L6FA 4QRUA 4KZEL 4XCYB 5J11C 5AG8A 1ZT7A 1EZVY 4LPYA 5MERA 1FCGA 5C6TL 1Y6MR 2DQDH 1XEDA 3H3BC 4JFHE 1RD6A 3FAWA 2E9BA 2CLRA 2WSKA 1DN0A 3Q1SL 3LB6D 4FFWC 2PTVA 1AFVH 2GTWB 1A3RH 4WENB 1NMBH 3B2UD 4JVUA 4WUKH 5F9WB 3LRHA 1QSFB 2Y07L 4DZ8B 2Y36L 5E4EB 5I15L 4X0KB 1TJHH 1I1FA 5DJXA 1CGUA 1QLEH 2ERJB 2FO4A 4KWUA 3HR5B 1F4AA 1L6ZA 3HZKB 2P5EE 1QRKA 2R29L 1A8JH 7CGTA 1H8NA 2APTA 3EOTH 4YPGA 3U9PL 4IRSB 1CL7I 5M95B 3M1BA 5TDOA 2YUXA 4LKXA 2AK1L 1F6LL 3TWCL 3OX8B 5F9AC 2B2XL 1WBXA 2GY7B 3DIFA 1G7PA 1U8MA 1QFHA 1ORSA 1U8QB 5EUOA 2YA1A 1C5DB 3T0WA 2G2RA 6CGTA 2DQHH 3OKLA 1TZHB 4PJIE 4U6XB 1NC4B 2EYRA 3C6LC 3OTTA 1OGAD 3PGFH 4ZFGL 1TJGH 3PWVA 4WGWB 4M1GH 1GYAA 1IM3A 5C0FB 3OXSA 3SE4A 2X70A 4NNPH 4RDQG 3DX8A 4QXGH 1FZJB 3GJFA 4UILH 1E4XH 5IBTL 4UDTB 3T2OA 4LLDB 3PNWA 3MOAH 4MDJA 4XWOD 2FATH 1P7QB 3IJSB 4L29B 4HKZA 3QI9D 4WEMB 3SDDB 3D3VD 3ETBF 3VD7A 2XWJA 1YEFL 3VXRA 3BDXA 1FGVH 1N3NB 4LPUA 5T1LD 3ZKXB 3IAGC 1REIA 3OMZA 1Y0LB 2VDRH 2VH5H 2XY2A 1CVRA 5DJDB 5J0BA 1ZWIA 3CZFA 2VDNL 4BSWB 2D7NA 3O6KL 4PJCB 3EOAB 1ZSDB 2F54A 1A3QA 5ALBL 4JRYB 2ITDA 1FORL 1YPZB 2CLZB 2BHUA 5AAMA 1DQLL 3I2CH 3VRJA 3GIVB 4XC3H 5FO8A 5EC2A 1IAKB 4LCYB 1ACYL 2FIKA 4LLVB 5GSVB 1F4HA 1MJ7H 5FGCE 1I9IL 5L0QC 5F9JA 4HKBB 2EXYC 1CTOA 2B20A 5DFTA 1UVQA 3SGKC 2GI7A 1CFQA 5DI8B 1MCSA 4OM0H 1RZFL 2X9XA 1U58A 1MY5A 3WFBL 3MLZL 3HMXA 1OAKL 3CLEL 5BZDA 1S7QA 4O9HH 1OY3B 1U6AL 3CH1A 1A14H 3PQYA 5C0AB 1XR9B 1UWGL 4IM8A 2XQBH 4W6XB 3C60A 1N6QL 3U83A 1AQDA 1M7IB 2BVPA 1A2YA 2YUZA 5GZND 5IK3A 3DPBA 1WEJL 3HMXL 1BZ7A 4Q7DA 4OKVA 3RZCC 1XCQA 2ARJQ 4N1HB 5BO1H 3OAUH 3MC0A 5EZIH 2QQQA 5IWLC 1HZHL 5HDLA 4I2XE 1MLBB 5EG6C 3D48R 1CIDA 2BVQB 2AK4A 2DI7A 4YFLI 1U8NB 5HHME 1UXSB 2P47B 3W2DH 2EE3A 1FAIL 4JO4L 4MNQB 3WBDA 4F2MA 3EDJA 4HS3B 4M61A 1GC1H 5L88L 5IG7A 2OCFD 1XGTB 2J8UE 3MO1B 1AGEA 2X09A 4ZFOL 1NGWA 3RI5F 1HHGB 1I9RH 3MQIA 2UVEA 2A9NH 4OD1H 4JQXA 3FZUC 3LQAL 1ZOXA 1FBIH 3DOSA 4QHNB 2IH1B 1KEMH 5LGJB 1AHWA 3EFFB 3HI6H 4LBEA 3V6ZA 3OWEA 4K7PL 3D25B 3BZEB 2VXTH 3K2UH 4J4PA 3SE9L 3H9SB 2ESVE 1S7VA 2FYYA 5I18H 4RMWA 1FYHB 1SVCP 3C6LB 4F7CA 5KSBA 3KLHC 5JW5B 1IAOA 4DN4H 3HC4H 5E6IA 2HJLB 4GG6B 1WAAE 3EDEA 4DVBA 1AC6A 3V7AE 2AABL 4F33A 2XTJC 2V6HA 4QCIA 4XPAL 3LKQB 1U3JA 2ZNWA 4P3DB 2P5WB 5FHBH 4YXHH 3PWPB 3L7EA 4PRDB 3CFDB 3OR7A 2D0GA 4LSRL 5E8DH 5J9PB 3VXSA 4YDLC 5FF6A 1NFDA 3TEUA 3IDMB 3Q6GH 1NANI 4LIQL 2EYTA 3P4MB 1Q9KA 3WNPA 3PQYD 5FM5O 2UWEF 2RCSH 1MHPH 4ZOAA 3GHBL 1HINH 2R0WH 3C60D 3D0VB 4C56E 4NQCE 4NZTH 3KXFA 4CNIB 1AO7B 2A1WL 3ROLB 1MJ8H 3P9MB 1KLFA 2PW1B 3UTZB 3Q6FA 2GQHA 1N4XH 4XCNB 3CJJA 2OR7A 4JPIB 3SGDH 3GM0A 1KEGL 5C0EA 1DDHA 5FYLH 3EYQD 4HXAH 4I3RL 4YGAB 1DQMH 1Q0YH 5L0QB 2Y7QA 1MQKL 3OKEA 4KTDL 3VFPA 3GDBA 3NCFB 5IBLD 5FGBA 1JHLH 2B4CC 3NCJH 1H5BC 4KKAD 2JCCA 4RX4A 2O5YL 2FCBA 5MHSD 4H0IA 4LVNC 4OGXH 5F89B 2DQGL 4OAWA 3O3EB 1P1ZA 1F45A 4MNGB 4AMKL 1I1AC 4TN9A 4IHOB 2GK0A 1T83C 4UBDC 3L3JA 4EUPA 3QEGL 5I66A 4NWTH 4R26L 3MV8B 2DM7A