3C5SA

Crystal structure of monoclonal fab f22-4 specific for shigella flexneri 2a o-ag
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
218
structure length
218
Chain Sequence
DIVMTQAAFSNPVTLGTSASISCRSSKSLLHSDGITYLYWYLQKPGQSPHLLIYHLSNLASGVPDRFSSSGSGTDFTLRISRVEAEDVGIYYCAHNVELPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab F22-4 light chain
publication title Structures of synthetic O-antigen fragments from serotype 2a Shigella flexneri in complex with a protective monoclonal antibody
pubmed doi rcsb
total genus 51
structure length 218
sequence length 218
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5sA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5sA01
4FFZH 5JUEH 3GMOA 1NFIB 1T20B 1CBVH 4FA8A 1CD0A 3L95A 5SX5K 4ZAKC 1XGYH 4LPVA 5BOZG 3IS1X 4YIQA 4G8GB 3G08B 1FZKA 5D1XB 5CD5C 5GSVA 3JV5A 1LD9A 3TCLA 4IRZH 1YEJL 4ZUTB 3RVUC 5C6TL 2PN5A 4GG6F 2A9NH 3Q1SL 4EI5C 1C12A 4TSCH 1WCBB 3Q3GA 4NJAL 3R8BB 4P99A 4U1IB 2R8SL 4C55A 4MCYA 1Z0NA 4JZJA 3MNWA 4DN4H 1W0VB 2DQCH 5J13C 5F70A 3V6OC 2YD2A 3ARBC 3FN0H 1T2QH 3QHFH 3CFJA 4OB5L 1W8OA 5AZ2H 1RZIA 4LSSH 4GXVL 5K33A 5DHVA 3IDUA 5IF0B 2EO9A 3HI5H 4NC1E 5FA4A 3D0LA 1VFMA 2ATKB 2CIKA 3EFFA 1U36A 1WBXA 3CJJA 5KN5A 4FQCL 3FAXA 1JPGA 3CDCA 1XF2B 2IANB 4DTGH 4KQ3L 4JFDB 5D72H 4ELKA 1U92A 1QFUH 4PTUB 3ZE0E 5ID0B 4G7YH 3ARDB 1QSFB 4HC1H 2QQNH 1P1ZB 3RU8L 3BT2L 4MQSB 3EFDL 1G9ML 3L6FA 5J1AA 3LEVH 4JCLA 4OZGB 4PGBB 1LO3H 3DV6A 1E4XH 2DKUA 4K9EL 2HKHH 5GJTL 1CFQB 2NY7H 3LQAH 2B4CL 2B20A 3O2DL 3O3EA 4PJDF 2IPKB 3GSUB 3NGBB 1H5BB 4Z77B 1U91B 4KJWD 3GMLA 5ANMA 1CDIA 3SKJL 1GJIA 3WFHA 1GGYA 4Q9RL 4WW2B 2LV4A 4L8DA 3VFRB 3T0WA 3GHBH 2EH7H 2J1KA 3BD5A 2DMBA 3EO1A 1UXSB 2NXYD 1E4KA 1ES0B 4L9LB 2PXYD 5LXGH 1JPFB 5L0QC 1KB5B 1XGTA 4HUNB 1EFXD 4XMPH 3WEXA 2PTUA 4H1LG 3KLDA 2R4SL 43C9A 2NX5D 5EPMA 1QLFA 4LVEA 1MLBA 1I85A 4IRJA 2NTFB 4Z7OF 1A6ZA 2QHRL 3P73A 1V7NL 3QHZH 4YC2B 1BJ1H 5D7IF 2QHLA 3RVVC 2X42A 4M1DH 1IGFH 2QQLL 1TJHL 3REWB 4G6FD 3HNTH 1WAAF 3FQXB 4G3YH 2NY2B 5E4EB 4N0FA 1KUMA 5D1ZB 4NO3A 3UAJD 4HIXL 2DL9A 4H88H 1WWCA 3I84A 5EIIB 4MD0B 3SJVE 4CVZA 1INEH 3MXWH 3AM8A 3G9VA 2J8UE 4O5LH 4OZFA 2JIXB 3FQRA 4HS6B 1J86A 1DQDH 1HHHA 2YD3A 5DD6B 2VDPH 2OR9H 1AJ7H 4HZAA 4PJ8B 1E6JH 2AW2A 3GRWL 4Y5YA 1AXIB 3SQBA 5L2JB 2DQDL 1TCMA 4Z0BH 1NGQH 5I1JH 2RB8A 4L5FH 4U6TA 1DQLH 3KLAB 4XNYH 4PTTB 4XWGH 5KSBB 3MLXL 4Q0XH 5TGBA 4A6YA 1CXHA 4HWEL 2ADFL 2JJVA 2BMKA 1FSKC 3SDDD 2YK1H 1CD1A 5GRYA 4Z8FL 5BRZD 1KN4H 1H9VA 3VXPA 1FYHB 3ROLA 4X4ZA 3T4YB 4HUVA 3I6KA 4XC3H 3H9YA 1LP9A 5HHOE 3S37X 4KK9C 3GI9H 1TVDA 3IXTB 3CXHJ 5GIRA 5BXFB 3HNSH 1UWXH 1EBAA 1UJ3A 1G0YR 1HDMA 3CH1B 4EDWH 4PS4L 1I3GL 3GMOB 2W0LA 4G9FE 3VD7A 1ZSDB 4PD4K 3L95B 4ALAL 1G0XA 5FYJD 1KEMH 1J0KA 1OQXA 2R69L 3EYVA 4ZS6C 3MLTA 1TQBB 1FZKB 4EUPA 5GSVB 1HK6A 1L9NA 1JGLH 3TCLB 5B3NA 1BD2D 5EO0B 1QQDA 3ZO0A 4TSBH 1A4JA 3UTPD 4P2RA 5C0CE 2BNRA 3Q3GB 2EE3A 5E2UL 4S0TD 3MNWB 2IAMD 1XCTB 2LABA 3QIUD 3EYSH 5J6GB 1U2HA 5JR1H 3CFJB 3BEVA 2RHEA 4BSJA 3O6KL 4KJPD 5DHVB 4XCYA 1J18A 3HC0B 1GHFH 5D6DA 3D0LB 2CIKB 4QTHA 3EFFB 3V4PL 4YHZH 1REIA 1W0WA 2W59A 5JO5B 1JPGB 1WQVT 4PREA 3RGVC 1FNEA 1ROWA 1FFQA 3MUHL 4JFFA 4NKOB 4H8WL 2HT3D 1IEAB 2E27H 4RDQG 5IUSA 4ELKB 1U92B 5TE4H 4OFYA 3VA2C 1AO7E 3O2DA 3Q6GL 3VXUE 3GSQB 3LN9A 2ICWA 4KROD 2K7QA 1YNKL 3L6FB 4E41E 3GKWL 5J1AB 1GCFA 1E0OB 3CCHA 1AR1C 3DV6B 5HD8D 5I8CA 5HYSA 2EYSA 3O3EB 4WFHE 4OZIB 1QBLL 1YN7A 4NIKB 3GMLB 1CL7H 1H3PH 4TNVK 5CJ5A 3U6RA 3HR6A 5ANMB 2BSRB 3WFHB 3V6OE 1ZHLB 1GZQA 1SQ2N 4L8DB 2XI9A 5DQDL 1A3LH 3EO1B 5J7CC 2R0ZL 1IZJA 1SM3L 2LE9A 2I27N 5A16A 2I60H 4JM4H 3BGAA 43C9B 5EPMB 1QLFB 5MHSD 3VFUB 2SEBB 1R3IL 3CFKB 4IRJB 1MCRA 2QADD 1A6ZB 3P73B 2YZ8A 5D5MF 4OGAD 1MWAH 1GIGL 1S9WA 5J11C 2DQIL 3MXVH 5KW9L 4ERSH 2DQHH 3ZYZA 2HT4C 5J3HC 4N0FB 4BQCA 3ULUD 3IKCA 3INUL 4NO3B 2APWA 1K9TA 3GRWA 4WWID 5HHVL 1D5IH 4NDMA 4GBXA 3L7EA 5GHWH 1QYGH 2F9BT 3VMNA 1A5FL 1MH5A 4XNXH 4OZFB 3DVGA 1OAUH 2CLZA 1ADQH 4K94H 3W0WB 1NAKL 4FP8H 3IDIA 1PG7H 1AP2A 1EGJH 1DN0A 2A2QT 3PL6D 2AJYL 4Y5YB 3O6ML 2Y7QA 4UILL 1P4IH 2W9DH 1LO0H 2GHWB 4MD5A 4M62H 4QHKJ 5GS2H 2FBJL 1PKQA 5TGBB 3CMGA 3ESUF 3MTRA 4XMKL 4A6YB 3RA7L 1F02I 3OAUH 4NBYB 1DVFC 1M6OA 3M1BA 4U4BA 1CD1B 4R9HA 2GJ6E 2VLKE 1P53A 1S78C 4HUVB 4W6XB 2FLRT 3I6KB 1LP9B 2FJFA 3IDXH 1WZKA 2HFEB 4PB9L 4F7EB 5F9DC 1J7VR 2BRRH 1HDMB 3HI6H 1ZS8A 4LPWA 5IEHA 1CLYH 1C5BL 1FFNA 4P59L 4NOBA 2FHBA 3ILPA 2P5WB 2J6EH 2NY3B 3QXTA 4YBLC 4FFWC 5KG9A 1I9IH 1I1AC 1KIRA 4S1DC 4FHBD 3EYVB 4L8BA 2HTLD 3QNYA 4OD1L 3MLTB 2FB4L 4OFDA 3D85D 4EUPB 2AAVA 1RURH 4RFNB 5I1HL 4PJBF 5ALBL 1FJ1A 1QQDB 2BVQA 1A4JB 2GAZA 4P2RB 4LHUG 1IT9H 3QB7C 4V2CB 3EOTH 4S2SA 1UQSA 5HPOA 4HEME 1T0NA 4NO5B 3WDJA 1T7VA 1YMMB 2BJML 2A1WL 4NQCA 4H20H 4XPFL 1XGRA 4HEPG 3IJSB 4OIIH 3ZHDA 2H2PC 2XKSA 1XT5A 2A6KA 2PNDA 1YNTA 1OAXL 4DW2L 25C8H 4J6RL 4QTHB 4LLQB 3O9WD 5ISZE 4PREB 3HE6C 1FNEB 3HNVL 3GM0A 1BFVL 1P7HL 3LB6C 4JFFB 1EJ6A 1EZVX 2APBA 5HYJD 1NANH 4FQ1L 2ICWB 1RZGA 4ONFL 4MA1C 3U30B 4DGVL 3IJYB 5EO9B 1UACH 2DIBA 4M4PA 4FFZL 4E42A 1B3JA 2HLFD 4IBLT 1KCRH 1WC7B 3RNKA 3NAAL 1NMBH 3HUJA 2RJMA 1ZT1A 1INQA 1J88A 3T3MF 5HYSB 4N8CH 5I8CB 5JDJA 1XGYL 2EYSB 3LQZA 3EJZC 4RGMB 3UC0H 4RFOH 4IRZL 4I3RH 4OJFH 3U6RB 1FV1B 2A9NL 1GZQB 4TSCL 4X6DB 1KXQE 4DN4L 1ONQA 2DQCL 2E7BA 2YXMA 3C87A 4PJFA 3FN0L 3QHFL 4JZOA 1ZANH 3UEZA 5A16B 5AZ2L 1JCKA 1BZ9A 2BHZA 4ZQKA 5IW3A 2R1WB 3QDAA 1MIMH 2W60A 1OTSC 1ZHBA 2AXGA 3HI5L 1XCQA 2X41A 4N8VG 4F9LC 1YMHA 4PJ5A 3SGDI 1S9WB 2XWBA 3GJFK 5E2JA 4DTGL 1FRGH 1QSEE 1T1ZA 3HAEA 3FRPA 5D72L 4HJJH 1QFUL 4G7YL 1D3CA 2J12B 5IMOB 3MUZ1 4HC1L 2QQNL 2YUZA 3BQUA 3OKLA 2VDKH 5C70A 4NDMB 4GBXB 3L7EB 3QXDA 3LEVL 4PJGE 3RDTC 4F3FA 4XHQA 1LO3L 1PX4A 4Q6IC 1E4XL 3DVGB 4YDLC 2CLZB 1NCAH 4RSVA 1S7XB 2HKHL 5KSUA 3B2UD 2JCCE 3IDIB 4Z7UB 2NY7L 3LQAL 4KWUA 4FXGA 3DX7A 3OAZK 1OAQH 5MENA 1XZ0A 2DKSA 1YEIH 5EOQH 2DQGH 2IGFH 3GHBL 2EH7L 3WNNA 3PWPD 3QG7H 1JZ2A 1PKQB 5LXGL 4LHJB 5DGRA 4XMPL 5K59F 2Y23A 5E6YA 5FM4A 2FX8H 3LKRA 1N4XH 3VXTA 4PP1C 3PIQA 3FT2B 3S37H 4B53A 4X6EA 2DM7A 3VXQB 4HKXA 2F58H 1SVZA 4M3JA 4C54A 2WSKA 2FJFB 3QHZL 3QRGL 1FGNL 4PJEF 1MHEB 1IJ9A 1OP9A 4NKDA 4M1DL 1IGFL 3CFIC 1ZS8B 3HNTL 5IEHB 4G3YL 1E27A 3B9EA 1FFNB 4JFHE 2H8PA 3ILPB 4OFKA 1JPSH 5KG9B 4BJLA 4H88L 1I3VA 1KIRB 2PYFB 3P0GB 1B90A 4WFFE 3SGEH 4J3SA 3EYUH 1INEL 3MXWL 4HAFA 4ONHA 4JPKH 5FYKU 4CU7A 4XPBH 4O5LL 2YA1A 4K3JH 1FJ1B 1DQDL 3ZSTA 4JG0H 3T8XA 2VDPL 2OR9L 1AJ7L 5I74C 1E6JL 2NCMA 4OCWH 3UDWA 4OIAA 4Z5RA 4Z0BL 1FBIH 1NGQL 5I1JL 4RMTA 4L5FL 4JY4B 2HLAA 1X5GA 5D96B 1T0NB 1DQLL 4XNYL 4XWGL 3V6FB 5DS8A 4K2UH 1S9XB 4Q0XL 3MRJA 2YPLE 4GMTH 5AYQA 2A6KB 4PFEA 2EDBA 1YNTB 4JFYB 4M48H 2YK1L 1JF1B 4PUBH 1KN4L 1WBZA 2R2EB 4HGWA 2YD5A 2CUMA 4XC3L 4BA8A 1U8JA 2OS7A 5JW3H 5GRZA 3GI9L 4I4WA 1RZGB 2UWEA 3HNSL 4XX1G 4FG6C 4I0PD 2WWMD 4EDWL 5EOTA 4P3WA 5J9PB 5C9KA 4DOHE 1VSCA 1AFVH 3HUJB 1J9CT 4RGND 2BNQA 1INQB 4JFED 4M9PA 1KEML 4WVRA 4K8RH 4H0GA 5BS0E 1I1FA 1HYRC 4OKDA 5K9KB 1JGLL 4J3UA 2YN3A 4JHWH 3RWIA 3QIWA 4X7DC 3ULVF 5ADPH 4TSBL 1G84A 2X05A 2V9TA 4JVUA 3DXAE 1W72H 3AY4C 4PD4J 4C4KT 2G5BA 1MI5E 3EYSL 3IGAA 4PJFB 3OKKB 4QY8A 4O02H 5JR1L 2BX5A 3MRKA 4JZOB 1AC0A 3QDGB 1O7SA 4NQVA 4EEEA 1GHFL 4O2EA 1CGYA 1ZHBB 5GGTH 1I3RA 4PBWD 1YMHB 4PJ5B 3MX0A 1QA9A 3CZJA 3AROA 4YHZL 2BNRD 2XWBB 2AV1A 3BZFA 2MNUA 2PTTA 3T0DA 5SWZA 2VOTA 4F8QA 3PUCA 2E27L 1RPQA 3QCUH 5DVNA 5TE4L 3OG6B 4EXKA 5FGBA 4DWHA 2YHGA 2VZOA 1VFBA 2A77H 4OCXH 4X98B 5C09A 2YUWA 4HJ0C 4PJCA 4PP2A 4F3FB 3MBXH 3T77A 3IJHA 4KXZI 4I18A 1N6UA 5B8CB 3DIFA 1JI1A 1G6RH 3KXFA 4JZNA 2ICWJ 3DX7B 1KB9K 4MYWB 1XZ0B 4WWKD 4GXUM 3MRRA 1CL7L 1H3PL 4BK5A 1BBDH 1P84K 4WI5A 4OFYD 4TUJA 5F3HA 5C0DA 4P3DA 1MRDH 1A3LL 1WT5C 3QDJE 4BZ1H 4U0QB 1DSFH 3T65A 2I60L 4JM4L 4XBPB 4R2GC 3VXTB 2W0PA 3ZE1F 2F19H 3PIQB 3RIAK 4X6EB 3HE7A 1FNAA 1MWAL 1I7ZB 4WI6A 5HHPA 5L7XH 1OTUC 2PO6B 4DGIH 4JVPA 3AXLB 3MXVL 4KK6D 2DQHL 4OD3H 5D71H 3GIZL 2H8PB 1U8OA 3O81A 1YDPA 2PCPB 5F7UA 1T0MA 1D5IL 5GHWL 3DV4B 3VXSA 1QYGL 4ONHB 4XNXL 4OZGF 1OAUL 1RUPH 1ADQL 3QUKB 4K94L 4FP8L 1PG7L 2APFA 2XA3A 2EXYD 3T8XB 1EGJL 1O0VA 3ZDYF 2R2BB 2VLRB 1KPVA 4Z5RB 1P4IL 2X9XA 2W9DL 1LO0L 2HLAB 2VLME 3BIKA 5ELIA 4C4KO 4M62L 4WW2F 5IR1B 5DS8B 3FN3A 2R23A 4WU7A 3MRIA 3OAUL 1ODAA 1OWWA 4KRPD 2F54E 5CWSA 1T1WA 2BHYA 3OPZH 3S97C 2N7BA 5B3JE 1WBZB 4XVJH 2ZUQC 3X3GH 1BOGA 4XX1E 3L3HA 3TBVA 1U8JB 3IDXL 1CS6A 2AK1H 3O0RH 4I4WB 4PJXA 1J1OH 3PGFH 3QPQC 2UWEB 2GITA 3RTQC 2BRRL 4ELME 1JRHH 3HI6L 1CLYL 1WF5A 5IJKC 3VFOA 4H0IA 1A8JH 4PY8J 4OAWA 4U1SA 5D93B 2J6EL 3FQWA 1RUML 2BNQB 2GUOA 1NC4A 5LGHH 1GOGA 2ADGA 4RWYH 1I9IL 3WFEH 4R8WH 5GRUH 5T3ZH 3ZZ1A 3DMMB 5E6ID 1X5AA 2K9UA 4LBEA 2OCFD 2DWDA 3RWIB 1U9KA 4IS6A 4XP9H 2W0KA 4KGLA 4GRWH 1JL8A 1TTFA 3JTSA 2FZ3B 5FYKE 3S6CA 4KKLC 5KVEH 1IT9L 1HIMH 2CRZA 5I15H 2AGJH 5JOPD 3EOTL 2Y1VA 2G5BB 5F71A 1FAKT 3SDCC 2VIRA 4NFCA 3IGAB 3RWDB 1DQJA 1GGUA 1NPUA 1ZK9A 3MR9A 5HI5C 4H20L 1T66C 2BDNL 3FONA 4OIIL 5KSBF 1P7QB 4NQVB 4FQQB 1CI5A 5JNYB 2PYED 2H3NB 5HVGB 3HMWH 1L4IA 4HIEA 1QA9B 5F6HI 5JHDA 2NY1B 1H0DA 3Q6FA 5E2TH 1CGVA 2AV1B 3P0VH 2OZ4H 3AB0B 2PTTB 1S7TA 5SWZB 3FB8A 2H2SC 3SCMA 5IBUB 4PGDA 1IKNC 1A6AA 1UACL 1VFBB 3QQ9D 4NQCD 3VFVA 5ICZA 4PJCB 4PP2B 5DMGC 1J0IA 4Y5VC 3T77B 3G6DH 1NMBL 4I18B 1VFOA 3RBSA 4U1NB 4N8CL 4ONGL 1PZ5A 1MFCH 3BI9X 1F13A 3DHJA 3SDXE 2GIYA 4EXPX 1H3XA 4MAUH 5SV4A 1LEIA 3U9PH 1X5ZA 4JZNB 5CEZH 1LE5A 4KUCD 1G7HA 1QRNE 2X7LB 3UC0L 4RFOL 4LSQH 5FGRA 2CMRH 4JEGB 4I3RL 4LSUH 4TUJB 5JPMA 3W39B 5C0DB 5IROA 2HVKA 2EC9T 2AJZA 3F7YB 3L3KA 1S9KC 3CK0H 3CU7A 1KBGH 1ZANL 4NQEE 2CXKA 3WKMH 4PPTA 5AWNH 3DROA 5HJ3B 4L3CB 1YYLH 3E1F1 3HE7B 1BHGA 2AQ3A 4HBCH 3CSYA 2O26U 5DMIH 2UUDK 4FOMA 3C6LD 2BSTB 3OXSA 5HHPB 2J2ZA 3MRBA 2C3VA 4Q74A 1FRGL 1CE1L 1ADQA 4M1CD 4HJJL 5CJ8A 1U8OB 3BKJH 5C08A 3LS4H 1WVZA 1YDPB 3GMMB 5ENWB 3OXRA 1FN4A 2VDKL 3QEQD 4X9IA 2R4RH 3RWEB 4C56A 3TA3D 4PGJA 5EA0H 1NCAL 4GKOA 2IFFH 2VJXA 3E3QC 5DURB 4KI5F 3V5KA 3U4EA 4WHDA 4OZIF 1OAQL 3WV0A 3QXWA 4JRXA 1YEIL 2IH1A 3R1GH 5EOQL 4PRPA 2DQGL 2IGFL 3EOYG 3BIKB 2X4RA 2WUBH 3BQUD 2R23B 3MRIB 4K71B 2R9HD 3ILQC 1DCLA 4X7TA 2DTMH 5CSBA 5CWSB 1T1WB 4BK4A 3BP4B 2FX8L 3MV9B 4L3EB 1N4XL 3QFJE 2I26N 4KJQC 3S37L 2BZDA 4POZD 2ZNXA 5MEND 2F58L 5F7LB 3TBVB 4LCWA 3FTGB 5DVLA 2DM2A 4OI9A 5A2KH 4EN3B 3SPVB 2GITB 1C16B 2Y4SA 3LSOA 2CUIA 2ZUXA 5GZOD 3X13A 3QO1B 1IM9A 3UTTA 4PJ7E 3KJ6L 4MJ4A 5I75C 4WTZA 1UFUA 1I7TA 3E0GA 1MCNA 7FABH 4U1SB 4F80A 4LVNC 1Z9OA 1JPSL 2GUOB 1X4YA 2ADGB 4U6HA 3WHE0 3EYUL 5JIIA 1OT2A 4JPKL 4XPBL 2DWDB 4HBQA 4K3JL 1F3JA 3V0VA 3SY0A 3VCLA 4JG0L 1KJ2H 5FDYA 4X80H 4OCWL 3LMJH 1UG9A 4NO0A 3OAYH 1FBIL 2VIRB 5E24E 4JHBA 1DQJB 4K2UL 3FONB 2FEDC 3E8UH 4GMTL 2EDXA 3JV6A 5I1CH 3VDAA 4F15B 4M48L 2D0GA 3S4SG 1N5AA 4GSDH 4HIEB 4PUBL 5JHDB 4YDVA 5B39G 1H0DB 3JWNC 1KACB 4MDJA 4TULH 4ZPVB 2EIZA 2BSED 4G8EA 5DZNA 5EUKB 2X9YA 3SHSA 3KPRE 1YPZE 5EBLA 5JW3L 3FB8B 4NM4H 5L88H 4LMQE 3I85A 2D2OA 1LP9F 4PGDB 1G7LB 5DC0A 3DWTA 3ARVA 4OV6F 3VFVB 5GRVL 4X9GA 3CFCH 2ILLA 3TBTA 1AFVL 3I9GH 1D6EB 4M7LT 4Z7WB 3BP7A 4Q58C 1PZ5B 5C2BH 4K8RL 2XWTA 3PJSA 1U8PA 1LE5B 1KLUA 1G7HB 1IVLA 3P9LB 1M7DB 4JHWL 4QRRA 5CJOH 1WV7T 4U31A 5ADPL 4NCDA 4K3HA 4LSDA 1IAKB 2B7DT 2X2YA 5MI0B 4Z7VA 5J06A 4D94A 5JPMB 5IJVA 1W72L 4G6KH 3VGHA 4NQTA 2HVKB 3PQYB 2X1OA 5TF0A 1HHKB 3KPLA 4NRZB 4P2OA 4WNQA 3L3KB 1MWAB 1KCUH 1VEMA 2ARJA 4O02L 2AQ2A 3QRFM 3O8XA 4NC2B 4XNZB 4BFGA 4G8FA 2IMNA 1IM3A 5GGTL 4F9PC 3QIWD 2G75A 1RJLA 4AL8H 1OF2B 5L9DH 2LTQB 1RZ8A 2C3VB 5TDPA 5M95B 3QCUL 4UT6H 4XB7A 5C08B 5DA0B 4PRNA 5IFHH 2A77L 5K9QI 2V2TA 1FN4B 4OCXL 2V5MA 1RHHA 3MBXL 4C56B 1OGTA 4GS7B 4HFUH 1WFNA 1Z9LA 2BNUA 3V5KB 1G6RL 3LRSA 3TBWA 3U4EB 3VGGA 2Z93A 4NRYB 2YD8A 5C0BA 3IXAB 1VENA 5SWZD 5D7SH 1BBDL 4GW1A 4PRPB 2WIMA 2VZUA 2WAHA 4WFED 1MRDL 2X4RB 3RUGA 3SO3B 1ZVHA 3E2HB 3FOMA 4NFDA 1DDHA 4X6DF 5C09D 4ZSOA 3MV8A 2CK2A 4X6CA 3TC9A 5E94A 1DSFL 1CICD 1S7VA 1KJMA 5FUOH 2O61A 1UM4H 4IRSC 4RBPH 1MFNA 3S36X 2F19L 3CAFA 3KXFD 4J4PC 1FNGA 4UNUA 3OB0H 4LCWB 3BUTA 2ICCA 5L7XL 4FXLA 4O00A 3LS5H 3T0EC 4DN3H 3LSOB 3X13B 1IM9B 4MQ7B 4OD3L 5D71L 3UTTB 4JFPA 1KYOJ 2H32H 1I7TB 1WGOA 5KZCB 5DQ9A 3VGFA 4U6HB 3E3QE 4C57C 1NCNA 1SMOA 1XF5A 1N2RA 1GGCL 3KLHD 1RUPL 3CZFA 4MNGA 3PHQB 1F3JB 3KPSE 1RULH 2AJ3A 3VCLB 2NW2A 4Z7UF 4NGHH 1J1XH 2EC9U 2ZSVB 2CXGA 2XN9E 1IAOA 4NO0B 5ICXA 5I66A 1AQKH 3K0WA 4S1SH 1XF3A 5CZKA 1RK1A 2OI9B 4QGTA 3UTSD 4QWWD 3VXSD 5BV7H 4ODTH 4HULB 3JV6B 3WS3A 4Y19A 3DECA 2J7LA 1N5AB 3AU1A 3OPZL 1EEUA 1L6ZA 4BFEA 3V8CA 1KJ3H 3BOVA 4MDJB 3X3GL 1RUQH 4G8EB 4AH2A 5EBLB 3MNVA 1L0QA 2AK1L 5L8JB 3O0RL 5J6HA 1J1OL 3PGFL 1Q9KB 5IP4A 5F88A 3SKUD 5D7IE 3HC3H 3VGAB 5IMMB 1JRHL 4I2XA 4XP1H 4ZUSA 3MCLH 2EDWA 2HAZA 2V2WA 1D9KA 5EN2A 4QXWA 5E8EA 2NXZC 4KGJA 3CGTA 3O45A 1FYTA 5LGHL 4RWYL 2PUQT 5JOEA 2EIBA 3QCTH 3TVMA 4M7ZB 3WD5H 3SDAA 3WFEL 3PJSB 4R8WL 4UQ3A 5E6ZA 5GRUL 5T3ZL 4B0MM 2IADA 1KLUB 3ZKMD 1JYNA 4OF7A 1N3NA 4QRRB 3ZYOA 1FZJB 4PV8A 3MV7A 1J05A 2RQ8A 2PW1B 3CX5K 2CH8A 1D5XA 5KVEL 4XAKE 4NQDA 4FFYH 4Y4HC 4ZOEA 4CN1A 4DVRH 1HIML 5GGTA 1UH2A 5I15L 2AGJL 4ODVH 5IVXB 3KPLB 4WNQB 4P2OB 4YK4B 5H8DA 5A2FA 2ARJB 1CTNA 4P4KA 4DJMA 1NC4D 4PIRF 3O8XB 3OHXB 3B9KC 1CDGA 2ZCHH 1NDGB 1PX3A 4KKCC 3FCTA 5DRXB 1RJLB 4MJ6B 3HMWL 3SGDH 43CAB 1BFTA 2P43B 1U8IB 4BQ6A 4DUXA 2OZ4L 1RZ8B 2GT9B 1NC2A 2IBZY 3THMH 4CNIB 4LLWA 1C7SA 1SYVA 3O4OB 4XP6H 4PRNB 1G6RA 1VEOA 4FXKA 4Y1AD 1JN6B 5MEQA 4NKMA 2D4DA 1INDH 5GSRA 4OZHA 1RHHB 2J8HA 1VKXB 3G6DL 1JIBA 1OGTB 5F1NB 1OTTD 2VERN 3HUJF 1MFCL 1JF6A 5JHDD 4MAUL 2BNUB 3U9PL 4UNVA 3LRSB 5CEZL 3TBWB 4KJYB 4NM8H 3QXAA 2Z93B 4LSQL 2CMRL 5C0BB 3I02A 4LMQI 3SCMD 4GW1B 5E9DD 4LSUL 1FDLH 3X3FH 5GS3A 1NFKA 4LNRB 3RUGB 3U82B 1DDHB 5GGSY 5JW4R 4ZSOB 3MV8B 1QO3A 4X6CB 1Q38A 3CK0L 4PRDA 3VFWA 4OSUH 1KBGL 1S7VB 4LASH 4JANA 4PJFF 3VXRA 5AWNL 1Z9SA 3QULA 1L9MA 1YYLL 2VR4A 4OTXH 2COQA 5HHMB 3QIBA 3HR5A 3WE6A 4HBCL 1X9QA 3QDME 1CDJA 5DMIL 1SBBA 2JJTC 4C58B 5CJQH 4QRPE 5LG1A 1QFPA 3RZCC 4MX7A 4JFPB 4CU6A 4P2CG 4HGKC 4P9MH 5ESAA 3LS4L 3JTTA 4ODBD 5DQ9B 1BECA 3JUZA 2R4RL 4J1UA 1JGEA 1XF5B 4PRID 2XIDA 3G5ZA 2XNAA 3NMEA 4MHHG 3RWJA 3TZVD 1QLRA 5EA0L 5IG7A 2F53D 2ZG3A 4PJHA 3ARBD 4MNGB 1IC7H 3UZEA 2IFFL 3TYFB 2AJ3B 2YRLA 3ZDXF 4KZDH 1NFDE 2NW2B 3EYFA 4J7RA 3MRGA 4OZ4A 5CHNA 2NXYC 5DJ0B 2NNAA 3VXMD 1IAOB 3R1GL 4ZFFA 5ICXB 5I66B 1MCSA 3T1FA 2WUBL 1TZIA 2VQUA 1RK1B 1PY4A 2W9LA 3B83A 4O51A 3ARQA 3WS3B 1PFCA 3WN5A 2DTML 2DB8A 3VMPA 4JG1H 4HLZG 1SJVA 2ESVE 3T0EE 3BH9B 5FDWA 2DMCA 4OFVA 4NQSA 3U0PA 4JRXD 4G9DB 4V1DE 4FTVE 2J3SA 5J6HB 1KELH 2HFTA 1HSBA 4D8PA 1JZ4A 4IHOB 5D5ME 3UAJC 2VC2H 3PXHA 4I2XB 4ZUSB 1I7RB 1D9KB 5E8EB 1K5NB 3O45B 4XC1H 4U2YA 4ZXBA 1W72B 2ZCKH 2CLVA 3NCJH 3TVMB 3V5DA 1KXTB 2MWCA 4X8JB 3SDAB 4YHYC 1S9YB 1T89C 4JRYD 4RCAA 2IADB 1ZLSH 4QHMB 1N3NB 1F6AA 1HQRB 1VFUA 2YC1A 3AC0A 3MV7B 5J1TC 4P23A 3N06B 4I1NB 4A2LA 1KJ2L 3TCXA 5SV3A 4JFOA 4X80L 4NQDB 2Z8SA 3LMJL 4FQHA 5KS9A 5ALCH 3EJYC 1MVFA 4YZFE 2OLDA 3GSNH 4QRQB 4P4KB 4P49A 2CKBH 5DJZA 1ZLUH 4Y88A 2OZ4A 5C86A 3UP1A 4OLVH 3E8UL 3ZTJG 3NFSH 5I1CL 2IBBA 3HG1A 4U6XA 3IFNH 5D7LA 3FCTB 1PKOA 1KIPA 2V2XA 3QHTC 3T2QA 1DQQA 3T0VA 3IETA 5J89A 3LY6A 4TULL 4WI3A 4CAGA 3IDYB 1NC2B 3BIBX 4JGMA 1R3LB 4NO0D 4Y16A 4DKAA 4NM4L 5L88L 1N5YH 3W82A 4LLWB 1G6RB 4HUUA 5FB8B 2UWEF 5MEQB 2AJUH 4NKMB 4O4YH 4BFIA 4JGJA 3BSZH 4OZHB 3EDFA 3CFCL 4XH2A 4DAGH 5C2BL 1OP5H 2GW5A 5DEGA 4DGYH 2DTSA 4ZYKA 1NBVH 4XI5D 5LJYH 3I02B 5CJOL 1MQKH 3OTTA 4NUJA 3I6LD 3KPTA 4QOKE 3QIUC 4X4ME 4MXVE 3Q5OA 1OSPH 2NW3A 4G6KL 2DDQH 2FO4A 3ZE2F 1H3UA 2LAGB 4KJPC 1QO3B 3C8KB 1KCUL 4JKMA 4PRDB 4DUWA 3HB3C 4WU5A 5GGRY 5EORH 3QULB 3MMEA 3CIQA 4K7PX 3STLA 1QVOA 3QIBB 3HR5B 2XYCA 4RZCB 3AAZA 1M4KA 4BQBA 3KLSA 2HWZH 4AL8L 5L9DL 4AEEA 1DQML 2G9HA 3JV0A 4S11A 4MX7B 1X5IA 1UA6H 4KROC 3VH8G 5HGDA 3PWUA 4U1LA 4UT6L 3W81A 5ESAB 2B0SH 2LFGA 5HD8C 5IFHL 1JF5A 5C07A 5AG8A 3JVGC 4MLSA 4J1UB 1JGEB 3U46A 1AGBA 2XNAB 3RWJB 2FRGP 4PJCF 1FL6B 1QLRB 5IG7B 1UC6A 3O3AA 1BFSA 1X5YA 2AEWA 4PJHB 3WJLA 5JW5A 4PJ9D 5ACLA 2BOCA 4POUB 4OZ4B 1LDSA 5C0AA 2QSQA 3QJHA 5D7SL 2AJVH 2VSCA 4ZFFB 3WLBA 3GSOA 3LDBB 5GGVL 3MRPA 3T1FB 3CVHH 1QFWM 1QKZH 2FWOA 1JTOA 2VLJA 4DFIA 1H3GA 1TZIB 2YD6A 2CO6B 3HTLX 3WN5B 5HDBF 5FUOL 1UM4L 5L2KA 4IOIA 3GO1H 2GTZA 1FZMA 3WMSA 2D7NA 3OJVC 5DJCB 2AXJA 2R1YA 2X4PA 4LF3B 2XACC 3BRFA 1HSBB 4D8PB 1CLCA 3LS5L 3QP3A 4DN3L 3VWKD 4NYLA 5A43C 1X5HA 1BJ8A 1UM5H 4GRWB 1GL4B 4ZXBB 1KJ2A 5F21B 5B4MD 1OT1A 2CLVB 2XV6B 3B3IA 3V5DB 2KZWA 5HBBA 1BIIA 1BF2A 1F6AB 4JJ5B 4JO4H 2E6JA 1FHGA 2YC1B 5F44A 3MJ8A 4P23B 1RULL 3CC5A 4ODWA 3ARDC 4NGHL 3TBYA 1J1XL 4JFOB 6FABH 3F62A 3NIFF 1E4JA 4FQHB 2NX5E 1QR1A 1KGCD 1AGDA 1AQKL 1GGIH 4S1SL 1T03H 2XXCB 1H8SA 3M8OH 2A6JA 1B2WH 2XICA 35C8H 4GRLA 5BV7L 4ODTL 4YO0A 3HZMB 3HG1B 4U6XB 1XMWA 3UCRA 1KIPB 2V2XB 3RIFK 4KH2A 4CUCA 3C60A 1DQQB 4WV1A 3IETB 4F7PA 5F7HA 1KJ3L 1RUQL 4ZODA 2YKLH 1VA9A 1ZA6A 4Y16B 3DNKA 1MJUH 1S5HB 3IKKA 5IQ7H 4WFFD 3KS0J 3HC3L 4XP1L 4JR9H 1BP3B 1UCTA 3FB5A 4BFIB 2YA0A 1MOEA 2HTLC 1LHZA 4Y19D 4XH2B 2BXYA 3QZWB 1ITBB 3P11H 3WD5L 5DEGB 3UBXA 4U6YA 3QEUA 4YJZL 4ZYKB 4XCNA 2HA1A 1K2DA 5EC2A 3TN0B 3FOLA 1YY8A 2EIEA 1DVFD 1EERB 2C3GA 2NY2C 1HWHB 2FCBA 3GJEB 1HHJA 2NW3B 4FFYL 2FO4B 4DVRL 1QNZH 5IT2H 4ODVL 5BRZE 1TPXB 3HKFA 5DD1H 1MREH 1Q9OB 1FYTD 4UV7H 3O9WC 3KPMA 2ZCHL 2D3VA 4PJ8C 1WWAX 1WTLA 2VNCA 5I76A 1B0RA 1HILB 4FFWD 3B9VA 3Q5TA 2OBGA 5A40E 4S1DD 32C2B 2G9HB 2EYRB 1J8HD 3L3DA 5FYJE 3ZKSD 3BGFC 3D39B 5ID1A 2FBOJ 5HGDB 3THML 3PWUB 2HLFC 4U1LB 4BH8A 3O41A 4XP6L 2MKWA 1B0GA 1BD2E 5C07B 5JPNB 3TO4D 3LN5B 2FO1A 1INDL 3UTPE 3U46B 1AGBB 3O3AB 5F1KC 3OGOE 1UADC 2R15A 4B41A 4Z7WF 2X4SB 5KAQF 2BOCB 5FK9B 3UTQA 4NM8L 5D8JH 1NC2D 4F33A 1ZHKA 4Y4FA 3GSOB 1OLLA 5HGBA 1FDLL 3SE9H 1S3KH 2FWOB 3FFDB 1CCZA 2VLJB 2L4OA 3TWCH 4IIQB 3CFEA 5T3XE 1U3ZA 3V5HB 4D2NA 2BC4B 1MLCA 3GMPB 1F6LL 3CVIH 4OSUL 1IGCH 5EU7C 5I73C 1EEYA 4IOIB 2H32A 5IIEB 4OTXL 3AMKA 4AEFA 3GNMH 4JZJC 4FZEL 3MZTA 3BKMH 2R1YB 2X4PB 2ZKHH 5HHQA 5CJQL 2YN5A 2DLGA 1PAMA 4NYLB 4X7CC 1RV6X 3EJZD 1Z6JT 2MSPA 4P9ML 1KJ2B 2GI7A 2CK0H 4APQB 4BSWB 3VXRD 3B2UC 2KBGA 1BIIB 3HS0A 1IAIM 1UZ6E 3MLRH 5E8PB 3TV3H 3EOAA 2EDJA 1IC7L 3AREA 3SJVA 3MJ8B 2F8XC 1CGWA 2H9GA 1JV5A 3CC5B 4KZDL 5CBEA 2J8UA 3R06B 3OQ3B 1DR9A 5MHSE 2QL1A 4G8GE 1KSRA 4MHHI 5E99H 1AGDB 2VWEC 2A73B 1HQ4B 2A6JB 3V4UH 5BZDA 5D7JA 3X17A 3QI9B 1NGWA 4GRLB 4YO0B 3VE0A 4LPTA 4JG1L 3T0AA 4MZ2A 3GSXA 3C60B 4Y2DA 4F7PB 4RGOH 1GOHA 1SBSH 4NN6C 4HXBH 3BP6B 1OAKH 1E4KC 3C5ZD 4NNYA 1A02N 1ZA6B 2ED9A 3NPSB 1KELL 3DYOA 2VC2L 2XY1A 1RIUH 5HHOA 3QSKB 4WUUD 3FB5B 2OMNA 4WDIB 4IRJC 4LU5H 1OP3H 2ITDA 1MRCH 3ARGA 3IRZA 4XC1L 2ZCKL 3QXUA 3NCJL 1F8TH 4GMSH 1XGUB 3D9AL 5CJXA 3UBXB 5LQBH 3QEUB 1ZLSL 5C8JA 2ED7A 5EC2B 3FOLB 2Z31A 1YY8B 2VLMD 1UVQB 1P7KA 2W65A 1EJOH 1HHJB 4XPGH 5IHUH 5T3ZD 1UKSA 1Z9MA 2VDQH 2VABB 1OLZA 3GZKA 3DVFA 1WAAA 1Q1JH 2DYPA 5ALCL 4MB3A 3AM8C 3ZDYE 1A6WH 4P5KA 2BFVH 2CKBL 2J88H 5DC9B 1IC5H 2AV7A 1UEMA 5IHZB 4OLVL 4PR5A 1X5KA 3RJQB 1A3QA 3NFSL 3GFUA 5BJTB 2JB5H 3IFNL 5I76B 5JXAH 1DUYB 3C09B 3U1SH 4NQXA 1RVFH 3L3DB 4I0PC 3QUXB 2A6IB 2WWMC 5CP3A 1AHWC 4OUUB 5ID1B 1N5YL 1MIEH 3P4MA 4ORGA 5E0QA 1CN4A 3QWOA 4XP5H 4RGNC 1B0GB 3DVNB 1ZTXH 4GAJL 2AJUL 4O4YL 3TJEH 3BD4A 1AO7A 2AEQH 5HI3D 4JREB 1SEQH 1NBZA 5D7LD 4ZAKA 5FKAB 5EBWB 4DAGL 3C08H 4S1QH 4BSVA 3F6IA 3UXFA 3JUYA 4HS3A 4J8RA 4DGYL 3UTQB 1UJ3C 1NBVL 3FO9A 1CFNA 4L8SA 1MQKL 1YY9D 1ZHKB 4Y16D 4Y4FB 3C2SA 5B38A 1JMXA 5HGBB 2Q8AH 1OSPL 2DDQL 4TSAH 1NLDH 1MLCB 2XKNA 5IVXF 5AEAA 2H45A 1VACB 4RFNC 1T2JA 4MJ2A 3W11D 5EORL 4NPYA 4L1HA 2H32B 4MZ3A 1E28B 3WDIA 2AK4A 1UWGH 1NEZA 3F58H 1UA6L 3VFGH 5M94B 4PRBA 2H41A 2FH6A 5IK3A 2X44D 5DK3A 2B0SL 5D6DC 4JDTH 3S5LB 1Q0XH 1YN6A 3BPCB 1N6QH 4ISVA 2EXWD 5BW7A 3H9SD 5F89A 1G9MC 1I1CA 3IU3B 3MJ9H 3AREB 3SJVB 5DDHA 5DUPH 1IGMH 2H9GB 5L8KB 1JV5B 3UMTA 5CBEB 2J8UB 2PTVA 3QH3A 4DZBA 5BV7B 2AJVL 5DHXB 1D6VH 3CVHL 1QKZL 3IFOA 3SE4A 4HF5H 3MACH 1PG7W 4HXAH 4QTIH 5EU7E 3RUGF 4BKLA 5BZDB 3P9MA 2EDDA 3NCMA 1NGWB 4MJ5A 2DIAA 1UM6H 3R4DA 3W2DH 3VFNB 3S34H 2B2XH 5SWSA 3GO1L 3GSXB 4Y2DB 1HHIA 5IFJB 4URTB 3NFNB 5C0AD 4XNQA 3TFKD 4KK6C 1CD9B 2HVJA 2Q6WA 4X9BA 3EHBD 3GMNA 3T4AB 2IQ9H 1DANT 4F2MB 2CLRA 3D48R 3SE3A 1CXKA 5HHOB 4KMQA 1DQTA 3RL2A 1T1XB 2ITDB 4HG4K 1UM5L 4X9HA 5I1AA 1L0XA 3ARFB 2DWEA 5L2KD 3PDGA 1JWUA 4G9FB 2VKXA 4AJ0A 4TOYH 2EXYC 2HJLA 4LDEB 1A2YA 5C8JB 5E8NB 2BERA 3GSNA 3PWPE 2HMID 2Z31B 1BWWA 1F4WH 1RIVH 2CKBA 4JO4L 3ARRA 5DK2A 1LEGA 1JGDA 3DO7A 5HGHB 2W65B 2VWEE 4X5XA 2ZJSH 6FABL 2Q7NA 1NDMA 1P4LA 2Q87A 4KV5E 1BVLA 1S7SA 4GBXC 4ZMAT 2DYPB 5C0CB 5MEOB 1GGIL 2DJUA 5HYSG 1T03L 1J0HA 4KRPC 1DLHA 3M8OL 1R3KB 1OTUD 3K81A 4M61A 2EDNA 1B2WL 4PR5B 1VCAA 35C8L 5KSAA 4XTRD 4HK0B 1RI8A 1U8HA 3WO4C 4OM0H 1LVEA 4NQXB 5H37H 2YKLL 4P2QA 3P4MB 4ORGB 1IEBA 3ZDZF 5IQ7L 1YYMH 3Q2CA 5DYOB 3GKZA 4JR9L 3WUWA 2EIDA 1AO7B 2AQ1A 4GRLD 5I17A 3BE1H 4L4VA 4MMZC 5E6IC 3TH4T 1EAPA 4ZAKB 4TVPD 1JWMA 3MRHA 1UB6B 3P11L 4BSVB 4E41B 4J8RB 3FQUA 3MCKA 4ODXA 4OLXH 5I1LB 5CBAA 4L8SB 4OCNC 4LQ1A 1CE6B 3MRCA 4U6VH 5EZIH 5IGXH 3LQMA 1CFTA 1QNZL 5IT2L 2VITA 4LLUA 4U0RC 5J13B 4HK3J 2KKQA 4MJIA 2DLTA 3RWGB 1MREL 3OL2A 2AABH 4TQEH 1GC1C 3MRLA 3AMLA 4UV7L 1NUNB 5CIPH 5EULV 4Y8AA 3PHSA 2VUOA 4D9RE 3VGDA 3MLZH 3VI4F 2C1OA 2J5LC 4W6YB 4PJBA 4H5SA 2XTJD 2WK2A 5LGKA 5D96C 4RGNE 4JFEE 3D6GA 4PRBB 2X1XR 3KPPA 3ZKQD 3V2AR 5IK3B 4KHTH 1SJHA 3MRMA 4KRLB 3ME0A 2HT2D 1LP9E 1QSEA 1YN6B 4ISVB 3MRNA 5F89B 4HGMA 3ROOA 3MGAA 3A6BH 1VERA 4OZHF 3SDCD 2UZYB 5B21A 3MUGA 3PP3K 2AJXH 1T66D 2A74B 4JN1H 5D8JL 3BPNB 2DL2A 2JCCA 4OBRA 1G7JA 1WICA 1FLRH 4RWHA 3SE9L 1S3KL 1RD6A 2NY0B 2P7TA 5IMKA 3BW9A 3TWCL 1FG2A 2C3HA 1R3HA 3EGSA 4M7JH 4P2RE 2BNRE 2VL5A 4MJ5B 3CVIL 1JNHA 1IGCL 4PRHA 1UYWH 5SWSB 3WO3B 2P8MB 1YEDA 1P6FA 2UY6A 3GNML 5DMGD 4XNQB 5F9AC 2Q6WB 3FRUB 3FT4A 5T1LA 3BKML 2GJ6B 4M1CC 3VRIA 3GMNB 1IAII 3DRTA 4HX1A 2GK0B 1RZJC 2CLRB 3EJJX 3WFZA 3BMVA 4N9GA 4X7SL 2YBRA 5DVOA 3TA3C 1U3HA 1JHLH 2Y36H 4AMKH 1F00I 5I1AB 1QTYT 2Z4QA 2DWEB 2CK0L 1J5OH 1JWUB 3B9DA 3A6CH 4GKSA 4L4JA 3MLRL 4WUKH 3TV3L 3S3JA 2QSTA 1IGIH 4M03A 5DK2B 5F8QC 1LEGB 1JGDB 4PJHF 4BELD 3MGTA 2MHAA 1U8LA 4X5XB 2QBWA 2DI9A 3BQUC 1NDMB 1P4LB 3OKEB 3LD8C 3MCG1 2NY6D 2R9HC 3WL9B 5IV2A 5E99L 4Y4KA 5IB5A 3UJIH 1DLHB 1OQOA 4MA3A 3V4UL 4U7KA 3RKDD 5KSAB 4POZC 4TTDD 2VZTA 2WINB 4B50A 5DJ6A 3GMRA 2VAAA 4RX4A 3ALPA 3KDMA 3MQIA 3V95A 2YPLA 4E0RB 4L4TA 1RFDH 3IYLW 1FVDA 1SBSL 4RGOL 4HXBL 5CMAB 5SX4H 5GZOC 2E7LA 1OAKL 4M5YH 3P77A 1IEBB 4I9WE 3WNMA 4WW1A 5HDQH 3RWFB 1RIUL 1RK0B 4ZFZA 5D7JD 4JM2A 1RZ7H 3DX6A 2F74A 4Q97A 3E6FB 1G1YA 4LU5L 4W68A 4JHAH 5I17B 1MRCL 4L4VB 2P5EA 1KG0A 1EAPB 3JZ7A 1AKJA 4RAUB 4GRWF 1Q72H 1JWMB 3FFCA 5GGQL 3FQUB 4LHQB 1BPVA 3MCKB 4Y2DD 1VPOH 5HYEA 5LQBL 5CBAB 2E9IA 3N1GC 3HAEG 3L3IA 5FO9A 3FRPG 5IWLA 3MRCB 2QHRH 4PJEA 1RJYA 4P5MA 5DJYA 4KDTA 5ABDE 1EJOL 4XPGL 5IHUL 3MJ7A 1CFTB 2VDQL 4CVXA 4R7DB 2VITB 4U2ZA 5CEXA 2KZ1B 1Q1JL 2OMBA 1A6WL 1HI6B 1KCSH 1SJEA 2BFVL 3WFDH 3DXAA 3ARGD 4QHNA 3TYGH 2IJ0C 2J88L 1IC5L 3HPLA 2E6QA 1R5IB 5ADOH 3MFFA 3SN6N 4P3CH 5F7FA 1X4ZA 2JB5L 2C1OB 3UDWC 1HEZA 5JXAL 4H5SB 4UB0H 4YPGA 1KEGH 4X0KA 5FYKL 3BO8A 3WKNA 3RGVB 5GRJH 1RVFL 4S10A 4K3DH 2C4XA 1CTOA 1MIEL 1TZGH 4Y8DC 3MRMB 2DQDH 4I48B 5C6WH 1X6NA 1N8ZA 4XP5L 3C5JA 1QSEB 1ZTXL 4QT5A 3PWVB 2X40A 4QF1B 5D1QD 5HDLA 3TJEL 2AEQL 3ROOB 3RHWF 2HTKC 3CVHB 1GPOH 1SEQL 1I4FA 5JOPE 3C08L 4XAKD 1UH4A 3MUGB 2P8LA 1LE9A 3VFPA 3MGOA 3D3VD 2JCCB 4GAFB 2YOCA 4N90D 1EH9A 1YECH 4I0CC 1AIFA 4YDKH 2Q8AL 1X4XA 5TQ2H 3B43A 2P7TB 5E5UB 3K74B 2PYEE 5IMKB 4TSAL 1MAMH 3DTXA 3L7FB 1NLDL 3TNNA 3EGSB 5FOJA 1BX2A 3QDJA 1UH3A 3QIWC 1JNHB 4TUKH 3LKSB 3BH8B 1OARH 1YEDB 2EDRA 5I2IA 4M43H 3BDYH 3FN9A 4NQCE 1S8DA 3FT4B 5T1LB 3SKMA 3ZT7A 3CX2A 3DRTB 1UWGL 4HX1B 3K4AA 4FN0A 4GOSA 4KY1H 3VDCA 3D87B 4DFHA 3F58L 3VFGL 4GJTB 5C0JA 4N9GB 4FQXA 4MNQD 2YBRB 5GGUA 3EDKA 5C0GA 1A9BA 1LDPH 4JDTL 1Q0XL 2Z4QB 4J12A 1VFAB 4OQ1A 1N6QL 1C08B 3RDTA 1T04A 2NY1C 4GKSB 1A22B 2W92A 3P3YA 3MJ9L 1FGVH 3QNZA 3L3OA 4G43A 3S96B 3U0TA 3IF1A 1M05B 1MY7A 2JE8A 1JVKA 3OKDA 3X11A 4K3EH 1GXEA 5DUPL 1W8NA 1IGML 2AK4D 3WLWD 3LQAC 1U8LB 4LHUB 3HUJE 5FGBC 1ZT4A 3MV11 5IV2B 3I6GA 4H8WH 1D6VL 2QSVA 3GM8A 4W4OA 4Z7QF 4XXDA 5IB5B 2AKRA 4HF5L 3MACL 5MERA 4HXAL 5HYIA 4QTIL 3D69A 2EE9A 5C0NC 3HZKA 1UM6L 5DJ6B 3W2DL 2R0KH 3GKWH 3S34L 2B2XL 3KDMB 4P46A 2YPLB 5F93C 4L4TB 1LMKA 3QEHB 2WBKA 4UAOC 2F54A 5EOCH 2CR3A 4TVSa 2KPNA 3QEQE 5BVJB 4OM1H 1KT2A 2IQ9L 4WW1B 1PBYA 2NY4D 4HKBB 4PJ5E 4OGZA 4ZFZB 4M6MH 5TJWK 4JM2B 4U1IA 3O2VL 4PBXA 3SGKC 4GXUN 3HE7C 1CK0H 2P5EB 1W0VA 4JY5H 4ELMA 3KLHC 1AKJB 1I1AB 3FFCB 4DOHB 4OF5A 1XAUA 2CSPA 5JTWA 2FDBP 1RIVL 1F4WL 3L3IB 5FO9B 3IB4A 5BS0B 4P5TA 1RJYB 3WNOA 2JF1A 4P5MB 5DJYB 2ATKA 1YQ2A 1RJZA 3QO0B 3DUUA 4IMLB 4KDWA 2ZJSL 1GIGH 3G6JA 4CVXB 3CFDA 1W2KT 4J4PD 1BQSA 5I1KH 2IANA 4QWWC 1OB1A 1SJEB 5MENE 3DXAB 2ESVD 1MI5B 4ZTPH 3CMOH 1P1ZA 4M6AA 3P4LA 5DXWA 4N8VB 3V0WH 1A7NH 3GJFH 1HEZB 4OZGA 3A0OA 1J0YA 4YPGB 4X0KB 3BO8B 3HE6B 3N1FC 3F7VA 3TNMB 2X89A 3C2AH 4NP4H 1U91A 3VG0H 1AQDB 2ID5A 2ENSA 4MA1B 1YYML 4NZTH 1N8ZB 1NUDA 4WW2A 3FMGL 4QT5B 4AM0B 2DLIA 3CDFA 5L8LB 4BH7A 1UXSA 1V3JA 3OR6A 3BE1L 1FFPB 3VMOA 3ZKMC 1FNSH 1I4FB 4YGVA 1DLFH 1FO0H 1KB5A 3OAZH 3B5GA 2OJZH 4ZNEA 5IM7B 2DD8H 4XNMB 3TBSA 3VFPB 5KANI 3MGOB 3SDXA 4P2QD 4U6VL 2I9TA 1A1MB 4DK3A 4ORZC 5EZIL 1QRNA 5IGXL 5DC4B 1CXFA 3IFPA 3BZDA 3REWA 2RIKA 5GS0D 4TQEL 3QDJB 2VTFA 2GSIB 3SBWA 2IWGA 4PJIE 5CGYD 5D1ZA 4ZOCA 2OYPA 5I2IB 3MLZL 5K9OA 4LP5A 1S8DB 3SKMB 3K3QA 3DUSA 1TZHB 5DD6A 1EA9C 5C0JB 5TQ0H 4FQXB 3ECBB 5T5NF 4MJID 4KHTL 1PG7X 5GGUB 3LZFH 4XNUH 4TNWF 2DLHA 2M1KA 4U7MA 3T3PE 3RDTB 4PTTA 1T04B 4XPAH 2A1WH 2QQQA 3A6BL 3ZE0F 3L3OB 4G43B 3NCEB 3P0YH 1OM3H 3SCMC 2AJXL 3BP5A 3VXOB 4JN1L 2YWZA 4KKCD 1ZT7A 1FLRL 5I6XB 1A1NA 5JW4M 4XXDB 3U9UB 3GDBA 3IXTA 3KPQA 5BXFA 3O4LD 4ONFH 1JUFB 3FT3A 3D69B 4M7JL 3AS3A 3HZKB 2V5SA 5CLTA 5AUMA 3ZE2E 4U49A 4CKVX 4JO1H 1KXVC 1ZSDA 3NAAH 1QEWA 1JHKH 4P46B 4ZO8A 4WHCA 1UYWL 4G8IA 3JBG7 5MI0C 5EU6A 2F54B 5IROC 4Z0XA 3WIFB 2QKIA 2FSEA 1KT2B 5EO0A 5FYLD 4KHXH 4LP4A 1ND0A 4HLZH 2OR8A 3NIGE 3WIHH 3GHEH 2UZXB 4HLJA 1JHLL 4JRWA 2Y36L 3WHE1 1XCTA 3TZVC 4ELMB 4AMKL 4PJ7A 5SWZE 5J6GA 1F45A 1J5OL 4PRHD 3A6CL 4I0KA 4WFEE 4WUKL 3LAFA 2EO1A 3LPFA 3STZA 3HC0A 1CGSH 5C09E 4HDIB 2EDTA 1IGIL 2Z92A 1GGTA 4K94C 4PJCE 4P5TB 3QA3B 1RJZB 5I74B 3DUUB 4K07A 1T5XA 2X5PA 3MRQA 3G6JB 4UQ2A 5JO5A 2J8UF 3CFDB 2APXA 1FAIH 3KXFE 4NKOA 1OB1B 1U3HD 1IEAA 3UJIL 4LDLB 3DHMA 3GSQA 2C9AA 2DS4A 3RZCD 4NN5C 3QWRA 3TT3H 1KCVH 5F6HJ 1MCLA 2I9LA 1RFDL 2HRLA 1A14H 3F7VB 4OZIA 4GQPH 1BQUA 2R2CA 2VDOH 4NJ9L 2D9QB 1NH6A 1UZ8A 3ZTJH 4M5YL 5E2WH 1CIUA 4X6FB 3RTQA 3TIEA 4Y4KD 2BSRA 5HDQL 1ZHLA 5IJKA 3KPRA 3RWCA 1OPGH 3SKNA 1RZ7L 4BH7B 3DGCR 4JHAL 4POYA 3OR6B 3ZKXC 5FUCC 4YAQA 4NBXB 3BDBA 1KTDB 1Q72L 4YGVB 1XIWD 2MOVA 1JZ7A 3VRLE 1JTTA 2YZ1A 1VPOL 2L0DA 3TBSB 2SEBA 3CFKA 3VFUA 3UTSE 4H25A 5CIPA 3SDXB 2EYTB 3VXSE 2I9TB 3QRGH 3U83A 2VN7A 1FGNH 3BD3A 1QRNB 4CN6A 3UYRH 3IFPB 3RI5F 1UGNA 1OVZA 3H8NA 5I1IH 5H2BB 1KCSL 3SE8H 3WFDL 2P5ED 2BY3A 3V6ZB 3TYGL 1B88A 4OF0A 1RHFA 1DUZB 2FNBA 3FFCD 5TF1L 3F8UB 5ADOL 3D2UD 1KF9B 5K9OB 4P3CL 4XXCA 4YHMH 3DRQA 2Z9TA 4UB0L 4EJ1C 1KEGL 1FP5A 3W0WA 3BKYH 5GRJL 5C71A 5GJSH 1VGKA 3DUSB 4QHLA 4ENED 4K3DL 5IESH 3O6LH 1TZGL 1IKNA 4I5BB 3EDEA 2FEEL 3K4ZA 3OGCB 1DTUA 1VDGA 3ZKNC 1DBKH 2N1KA 3H7LA 3QISA 4AYFA 4PJXE 1GPOL 4XI5C 3EJYD 4FNLH 3HHRB 3MUJA 2WM0A 2YS4A 4MB4A 5FYJH 3BP5B 3DYMA 4ZNCD 1D5BB 5I0ZA 4WTZG 4ZFOL 1ZT7B 1YECL 4LCIH 4YDKL 2CUHA 1ZV5A 1A1NB 5TQ2L 3G6AB 1WZ1H 3KPQB 3K8KA 1SHMA 1MAML 2HFEA 2OTUB 4HIJB 4F7EA 5FM5O 3FT3B 3RQ3A 5ACZB 5AUMB 1V8HA 1BREA 1AE6H 1JK8B 2P5WA 1QEWB 4R2GB 4TUKL 5AZEH 4G8IB 2RGSA 3EZJB 1OARL 1A7RH 4QNPF 5EU6B 1WCQA 5D4QA 4Y1AE 4Z0XB 2Z8RA 4M43L 3BDYL 3O2WH 3RKPA 4ZO7A 2QKIB 2FSEB 4P2OC 4WEMB 3O6FD 4KY1L 1ND0B 4U3HA 3O8XC 5C9JB 4NHUA 5JHDE 5EB9A 1MHCA 2PETA 3NPZB 1LDPL 2MKLC 4PJ7B 4PJ9C 3BEWA 4FQ2H 2ZCLH 5E9DE 3NA9H 2PR4H 4NO5A 1YMMA 5HGAA 1IC4L 3IJSA 1FGVL 3IDMB 3STZB 5CGMA 3AGVA 4QCIA 2Z92B 3DSFH 4K3EL 3ULVD 2LU3A 3HB3D 3CDGB 3OF6A 4LLQA 3O4OC 5T3XD 1T5XB 2D0FA 3MRQB 4UQ2B 3HLAA 4PG2A 3MC0A 2XQYK 1OAZH 2P48B 3BWUC 4UIKH 3IJYA 5EO9A 1A6TA 1X5LA 4R26H 2R0KL 3S4SA 1WC7A 3CH8A 5CZVH 5C0RH 2GJZA 2XZCH 2I9LB 5B39A 1QPPA 4NWTH 2N4IA 1FCGA 4OGXH 5EOCL 3VWKC 4LLVA 4LLYB 1UZ8B 4PLJD 4PRIE 4OM1L 3RPKA 3G04A 5T1KB 3RTQB 2UVEA 1FV1A 3TIEB 2F53E 4MA7H 4OKVA 1HXMA 4WO4A 5B4MC 3KPRB 1YPZB 4QYOA 3RWCB 4M6ML 2X70A 3SKNB 4MGXA 4X6DA 4YAQB 1CK0L 1CU4H 4JY5L 4Z18A 3VXME 1FNFA 4P46D 3ULUH 1ZXQA 3L3JA 3ZSSA 4PGCB 1CDBA 2R1WA 4NO2A 4WIQA 4FFVD 4G8GD 4WI4A 5D1XD 4H25B 4MXWH 4WENB 5CIPB 4CMMA 4C56E 1CXLA 5DSCA 3DGGA 3UPCA 4JQIH 1P5VA 1A7OH 5I1KL 4K55A 3QJFB 2Y07H 3GIZH 1ACZA 4JRXE 1E4XI 5IMOA 4IOSD 4ZTPL 3CMOL 4QLRA 2UUDH 2B5IC 3ARXA 4MXQC 4W4NA 2C1PB 1A7NL 3HZYB 3V0WL 3CDYA 3CSBA 3DRQB 2RBLA 2XA8H 4OQTH 3R0NA 2EICA 2YUVA 2DIJA 4MAYA 1S7XA 4Z7UA 1VGKB 5DWUH 5IQ9A 2Y5TA 4QHLB 1DN2A 3WNPA 3C2AL 4NP4L 3BAEH 3VG0L 2IAND 4JRYE 4JFDD 5FUCE 1OGAA 4NZTL 3MLWL 3DO3A 3ARDD 2XOTA 1QFHA 1QSFD 2AEPH 4ZFOA 1MPAH 1MCHA 2V17H 1FNSL 3IS0X 3MRDB 1DLFL 1FO0L 1KCLA 3GMQA 1F4YH 4NN7B 1OL0A 2OJZL 1TXKA 4K8RC 2DD8L 4HPOH 2XRAH 3FT2A 3OKMA 3VXQA 1D9KC 1T83A 2C4FT 3GBLA 1ZGLA 1F3RB 4RRPG 1MHEA 1U8MB 2Q76A 2ZOLA 5E00B 3WJJA 3TVMC 1M7IB 5BMFH 2NR6D 4ZUUA 1NGPH 3K2MC 2CIIA 3LKNB 1KJVA 3BXNB 3RX7A 3MOAH 4IDJH 2HG5A 1RUMH 2O5XH 5F96H 4GQ9H 2PYFA 4KZEH 4WRLA 4F9PA 1JNNH 2WLZA 3VRJA 3OV6A 2V5TA 1RZKH 3QDMA 3DSNA 4YHNB 2P47B 5TQ0L 4D9LH 3TO4C 4NHUB 4R7NA 3PGCA 1MVUB 1QD0A 4DEPC 1EUUA 3LZFL 4QRPA 1G7IA 1MHCB 3O3DA 4XNUL 2NY2D 2ZUUA 4N5ED 1QOKA 4ZUWB 4JY4A 1B4RA 3BEWB 5D1ZD 3I6LE 1EXUB 3V6FA 4XPAL 2EDFA 1S9XA 5HGAB 1Y6MR 2BDNH 3GBNL 1J1PH 3IDYC 3P0YL 4Q9QH 4QCIB 1OM3L 2NMSA 4MQTB 4JFYA 2JIXD 1EMTH 1JF1A 4BFBD 3CSGA 2R2EA 3HLAB 4HUMB 4PJ8D 2OTWB 4B7LA 2C3XA 1O5DT 1NFDA 2JCCF 4N1HB 3ULSB 4I3GA 4CN4A 4LKXB 1CDYA 4GW5B 2X1PA 1PLGH 3FJTA 3IAQA 1A6TB 4Z7VE 4JPVH 1WIPA 2BVYA 2P4AB 5J9PA 4IRSA 4JO1L 3S4SB 1HE7A 2VO5A 1JHKL 1FE8H 1GYAA 2W9EH 1KIQB 2GJZB 4HD9A 5E95B 5B39B 4ONGH 1SVCP 1B0WA 5JZ7C 4LLVB 5JA9A 4EIGB 5CSZA 5K9KA 5I8KH 5LBSH 3G04B 1KNOA 2ZUSA 4PBVC 4KHXL 4OKVB 1HXMB 4WO4B 5I75B 4QYOB 2ORBH 3WIHL 2X70B 4V1DA 4FTVA 3GHEL 5ECJE 5FAAA 4LVNB 4F7TB 3QIBC 4M02A 3ZYJA 3OKKA 3L3JB 3IRPX 3E6HA 2WIIB 3QDGA 4NO2B 5EU6D 1YNLH 1K4CB 1CGSL 4CMMB 2FX7L 5IW6A 3HI1A 4HW6A 1DFBH 3VI3E 5DSCB 3RFZC 3DGGB 2NLJA 3TESA 4XAWH 3GJFA 5I16A 1N59A 1FAIL 4D0BB 1CE1H 4P48A 2DOCA 2WBJA 3QAZC 4X98A 1OP5K 4U7SA 2IBGA 3C5ZC 3TT3L 1KCKA 1KCVL 4MAYB 1BAFH 4X6CE 1PQZA 5B8CA 1AGFA 1A14L 1R5WA 1U42A 2VDOL 5IQ9B 2Y5TB 5JXEA 4O58H 2QQKH 1FO0A 5E2WL 1MCCA 3OKOA 5F1OB 2BY0A 1OGAB 3WN5C 4PV9A 4LCCC 1OPGL 1A64A 3VG9C 4ZFOB 4O9HL 4EBQH 4JM2F 5ICYA 1KLFA 4HIHB 3NN8A 4WEBH 3GMQB 1UJTA 1KGCE 4L8CB 3GGWA 2CJUH 4KI5D 4XBPA 3TO2A 2MJWA 2EKSB 5KVFH 1NKOA 3NTCH 3OKMB 2P49B 3UYRL 4ZXBC 4DQOH 1ZGLB 1SYSA 1I7ZA 4YQXH 2Q76B 3ARUA 2PO6A 1I8LA 2ZOLB 3HZVB 3ARZA 3AXLA 1BEYH 4QOKA 4JCMA 4X4MA 4ZUUB 5I1IL 3KJ6H 2CIIB 3SE8L 4ETQA 1KJVB 2DICA 3B9KA 2HG5B 3M07A 2ADJB 1T7XA 2FL5B 2PCPA 3VGBA 5F9JA 1B4JH 4IRJD 3DV4A 3VRJB 4YHML 3MREA 1YEGH 5F8RC 3QUKA 3BKYL 5GJSL 1ZA3A 4Y19E 3MBEA 3QDMB 1RUKH 1P69B 5IESL 3O6LL 4R7NB 2F15A 3PGCB 2R2BA 2VLRA 4FS0A 5HI3C 1N0XH 4QRPB 1G7IB 3O3DB 2L7JA 3H7BA 3WHXB 4RQQA 1T6VN 1DBKL 1FL3A 2Q86A 3H3BC 5IR1A 2HFFB 2HYMA 3SEPA 4FNLL 1YY9C 4KMTH 4Y16C 4TPRH 5A3ID 2DQFA 3W0WD 4LOUD 5FYJL 1FYTE 2VDRH 3N1MC 3IDNB 5I30H 1EV2E 2OTPA 5DJAA 3QG6A 2VISB 4LCIL 1NFDB 1IGYA 2CQVA 4D9RD 1WZ1L 3W11C 4G42A 3KS0H 1VGEH 2JJSA 2ED8A 1QBBA 3VA6A 1MFBH 1M7XA 2VMFA 5T33H 3VD9A 1J8HE 4IRSB 1AE6L 2HN7A 5C6PB 2DM3A 2AXFA 5AZEL 3WIHA 1XEDA 4Z9KB 1A7RL 2B8OT 3ESVF 1J0JA 1T4KA 3O2WL 3L3GA 5CSZB 4HS8H 1TPXC 3DMMA 2Z8WC 3UROR 4M6NH 1KNOB 1W0YT 1G7PA 3NCBB 4JFZH 5E5MA 2EXWC 2FZ3A 4V1DB 4FTVB 3SGJC 3KVQA 4CADA 1WZMA 2FECI 1XR8A 1ZEAH 4EKXA 3BIAX 5FF6B 2P5WD 3RWDA 4FQ2L 2ZCLL 2NY3D 3NA9L 2PR4L 3OJDB 3VD4A 3E6HB 5EU5A 4Z7NE 3MFGB 2Z91A 1P7QA 3QEGH 5IB3A 1JMZA 3DSFL 4FQQA 3U79A 5IW6B 1EEQA 3HI1B 5JNYA 5K9QG 4HC1A 1NANI 2H3NA 2MQCA 4KRNA 5J12C 2G60H 2ICEA 2NLJB 4P2RD 1KN2H 5DD0H 2PXYA 3GJFB 5DEFA 5I16B 4G5ZH 3N9GH 3LKQB 1N59B 2YMXH 1JE6A 1EFXA 2WANA 1OAZL 5E7BA 1GSMA 2NX5A 2E7MA 4UIKL 2WBJB 1A1OB 4R26L 1YMMD 2WW8A 5D2NC 3B4NA 4U1MB 3D0VA 3TFKC 5CZVL 3EHBC 3KNBA 5C0RL 1EUTA 2XZCL 4U1NA 2EDOA 1OSZB 1PQZB 2UZIH 4NWTL 1VESA 1AGFB 1R5WB 5C2UB 4XVUD 4F37F 4OGXL 3TP4A 3VXRE 4LLMB 4LVOC 2X7LA 3VFTA 1FO0B 5F7NC 3OKOB 4JFFD 3UJJH 5B3JF 3BN9D 1I8MA 4PV9B 4MA7L 4MB5A 2G5RA 3W39A 4LSVH 1AGCA 3V6BR 2NXZB 1A47A 2DLEA 5ICYB 3F5WA 1CU4L 3F7YA 1YUHA 3NN8B 2HMIC 4ELMF 2XZQH 3ULUL 3U48A 1T89A 3RL1A 3GGWB 2A83A 4BM7A 4DCQA 4UUJA 1Z5LA 3TO2B 4F58H 1A7BA 5HJ3A 4L3CA 5HGGS 4X8XA 4PRAA 4RMQA 4MXWL 3RVTD 1AGEB 1P2CA 2WMPA 1DEEB 1MCJA 1F11B 2BSTA 4Y4HB 3ELAT 4JQIL 5DI8A 1SYSB 1JNJA 1IGTA 4YFLI 8FABB 1J11A 1NL0H 1A7OL 3G6JF 4QOKB 4PB0H 2Y07L 5I71B 3UPAA 4ETQB 3QUZA 3SDDA 4XTRC 3B9KB 5BRZA 4U33A 1R3JA 3DPBA 3GMMA 5ENWA 5F9JB 1ZLWK 2WWKT 3MA9H 3RWEA 4Z78A 4I9WD 3CUPB 3MREB 1RSFA 1GGCH 4UU9A 2XA8L 4WUUE 3UYPA 4OQTL 2OP4H 4JGUA 1U8KB 1PSKH 4JDZA 4J2XA 1ZA3B 5DFVD 3MBEB 5DWUL 4GT7A 3CXHK 4G6JH 5TH2A 3BAEL 3PNWB 1VADB 4GRLC 4U1KB 4J3XA 3H7BB 5JMOC 5LGJA 3BN3B 5FGSA 4RQQB 3QQNA 3NIDE 1FL3B 2Q86B 2FH8A 2AEPL 1ZE3C 4KTDH 4TN9A 1MPAL 4WV1C 2V17L 4GBXD 4JN2A 3RNQA 5T3ZE 3T2OA 3BPLB 1BD2A 1BQLH 2LVCA 3PE9A 15C8H 1F4YL 2DQFB 4MAYD 3BP4A 1M71A 3DX8B 3MV9A 4L3EA 4HPOL 3KYMB 2XRAL 4MD4A 2IAMA 4YFDB 1XGQB 4YEEA 1U95A 1R6VA 5DJAB 2E9JA 3QG6B 3FTGA 2IG2H 2WBWB 4HKZA 3SDXF 1IGYB 1R5VB 3O11A 1JFQL 4EN3A 3SPVA 4G42B 1C16A 2CR6A 3SGEI 5BMFL 3QO1A 1NGPL 5IB2B 3MOAL 1MQ8A 2HN7B 5KS9E 4IDJL 1BBJB 2AXFB 1H15A 2XTJC 2O5XL 5F96L 4GQ9L 4KZEL 1UB5B 3M45A 1JNNL 4U1JA 1T4KB 5JORB 3L3GB 4PLOB 3CU1A 3UTZB 1BFOA 1QLEL 4HIIB 3TT1H 1GC1H 1RZKL 9CGTA 1G7PB 2HT2C 5D7LE 5E5MB 5EIQA 4D9LL 4PLNC 3Q5YA 4X6BA 4CADB 1G0DA 4C83A 1XR8B 4A2MA 4JFQA 1S7WA 3G5XB 2FR4B 2RAMA 3WXWH 5IW1B 4PJAE 1A7QH 2NTSP 1Q9WA 2Y6SD 4JKKA 5EU5B 5LKNA 1T21B 2BVTA 1J1PL 2Z91B 4QRUB 4Q9QL 2IALA 5IB3B 3C6SB 3ETBF 2GSGA 1EMTL 2H26B 2ICEB 2NXYB 3A6OA 3G5VA 1G6VK 2PXYB 5DEFB 4JQXA 4ZPVA 5EUKA 4QXUH 1EFXB 1BF8A 1G7LA 2NX5B 3F7PC 1PLGL 4KK8C 1GZPA 4JPVL 4JKPH 4AY0A 1JJUA 4M4RA 4ZFGH 3D0VB 3KNBB 1FE8L 4XCEB 2W9EL 1D6EA 4QKXB 4Z7WA 2WWKO 4LPYA 2ATPA 4G6FB 1P4BH 1GH7A 5EOCJ 5IVZA 3H9SE 3VFTB 3OBAA 3P9LA 1M7DA 1MHHA 5I8KL 5LBSL 1I8MB 1IAKA 2ORBL 3CFBA 2VB5A 1AGCB 3PQYA 3F5WB 2E8YA 4KAQH 1HHKA 4NRZA 1YUHB 1MWAA 4LFHD 4YHYB 5FO7A 4PJ7F 3RL1B 1RZJH 2A83B 5DEZA 2Q1EA 3PL6A 4DCQB 4UUJB 1Z5LB 2X09A 5EZLB 3EYQD 5CFHA 2LU4A 1YNLL 3I50H 4MDIA 3UJTH 3R8QA 3K7UA 4PRAB 3PV7A 1CDHA 5E70A 1OOAA 5JOFA 4OI7A 2NY6C 1DFBL 1P2CB 3VXNA 5BO1H 1OF2A 3RJDA 5DI8B 3S35H 4XAWL 1JI2A 1IGTB 2ZUYA 1K8DA 1MCKA 4Y0GA 5HYQA 3RKDC 3K2UH 4OQTA 5D2NE 4TTDC 5JW4Q 3HAEH 3F7RA 3QUZB 5C0AE 3SDDB 2RCSH 4MA8H 3AREC 5BRZB 1R3JB 1EGJA 2W38A 3J7HA 3QDGD 2ADIA 1IMHC 5BV7C 4Z78B 4UU9B 3OJ2C 1BAFL 4PJ5D 4JDZB 5C3TA 4GW4B 2FJGB 5L2KE 3VH8B 4O58L 1PJ9A 4Z6AT 1MY5A 2QQKL 5D7JC 5TH2B 2DQUH 1XF1A 4NRYA 4UOJA 4CDGC 3N1PC 3IXAA 5ITBH 3L5WA 1P9MA 5LGJB 3TIDA 2BCKA 4QEGA 1WIOA 3OJMB 1YPZF 4Y2DC 4EBQL 5MEPA 4JN2B 3RNQB 4ESKA 5BVPH 1RU9H 3L5XL 1BD2B 1AI1H 1C5DB 4UOW1 4JJHA 1TQCC 4OF3A 4WEBL 5I8OH 4KVCH 2CJUL 1M71B 1CZ8H 2VRAA 4QXTA 5EUOE 1FVCB 4MD4B 3LEYH 2IAMB 1G1CA 5KVFL 3NTCL 4M1GH 4WFGD 1U95B 3QIUB 3KJ4B 2J6EA 4GH7B 2R2HA 4HKZB 2ZG1A 3ARGC 3O11B 4DQOL 4XHJD 4BZ2L 4YQXL 2DF3A 3UZQA 1BEYL 3GSRA 4E9LA 4MQ7A 5CJXC 2E6PA 1ZAGA 2AJSH 3VFMA 1TMCB 3QXVA 4U3XA 4LVHB 4J23A 3O9WA 1ORSA 1H15B 1G7MA 4YEFA 1B4JL 3JSSA 3FO2A 1EEZB 4GO6B 3P4NA 4U1JB 1YEGL 5HYJA 3NCFB 1BFOB 1QPXA 5KVDH 3BYYA 3PHQA 1RUKL 4KROB 4TVPE 1Y18B 2PO6D 4O2FB 5D1QC 4X6BB 2ZSVA 5F1IA 1KV3A 3V9FA 1N0XL 4C83B 2RFXA 4JFQB 1S7WB 2CD0A 1JPTH 2XQYG 2P8PA 1EHLH 2QR0A 1Q9WB 4R6UA 4KMTL 1L7IL 2IALB 4MNHB 2GSGB 4TPRL 1CGTA 4P9HH 1NMCC 4WY7H 1F4XH 2VDRL 1YEKH 3MBED 3G5VB 1JRHI 5I30L 1I1RA 2BY2A 2VLRD 1P5UA 2OSLA 3MLUL 3RY5A 1KC5H 1JYVA 4XPHH 1Q9KA 1VGEL 2XTJE 1HKFA 4XZUB 5IMMA 1CT8A 2QADB 1GZPB 1MFBL 4XWOD 5T33L 5K9JL 1RAMA 1ACYH 1HHGA 4L8SC 1FFOB 3T0BA 4CW1A 4F57H 2ATPB 1F6FB 5IBTL 4YXKH 2HTKD 4HS8L 5IVZB 5GGSB 1MHHB 2QSCL 1TVBA 1FZJA 4M6NL 4X5LA 2PW1A 4JFZL 5GGRA 1JBJA 3CFBB 1U8QB 4Z76A 4M5ZH 5IVXA 1ZEAL 4TYUA 3MOQA 1OW0C 5FO7B 2BNQD 3IVKA 3WLWC 1IGJA 3PL6B 3OHXA 4MDIB 1MCOH 3L1OH 1NDGA 1IKFH 3QEGL 4HH9B 3OKNA 4X7EC 3DMMD 5JOFB 2YR3A 1I9RH 2DJ4A 3FB7A 5DRXA 3VXNB 3DBXA 4MJ6A 43CAA 4YX2H 2G60L 2DQJH 3PWPA 1U8IA 3Q0HA 4LAQL 1KN2L 3IDGA 1DQMH 4MSWA 1CYGA 5DD0L 3G5YB 2NY5C 5BW7C 1NCDH 4G5ZL 3N9GL 1K8DB 4NRXB 2GT9A 5HYQB 2YMXL 2NQCA 3FL7A 3BHBA 2KL6A 4CNIA 2GK2A 1HCVA 1YJDH 5E2VH 4GUPA 4KPHH 1MEXH 1JN6A 3B5HA 2ADIB 2YSSB 3U36A 5HHNB 1P7QD 3BPNC 4LARH 1VKXA 5B38G 2G2RB 5F1NA 3EDDA 4S0SD 1IE5A 5GRXG 2UZIL 2NY0C 2NY4C 1CFVH 3SE4C 5E1AA 2NY1D 1IARB 4L29B 4KJYA 2O93L 1Z2KA 2P1YA 4W70A 3UJJL 5AD0A 3L5WB 3TIDB 5GGVH 4WJ5A 2C3WA 4TNVF 2BCKB 4LSVL 4LNRA 4GG6E 4JVWA 3D85B 5MEPB 5F7KC 3BPOC 1PYWA 2Z8VC 3C9NB 3OB8A 4Q2ZB 1F3DH 2XZQL 3D25A 1CLOH 1KB9J 1S7RB 1QSZA 4F58L 4QXTB 3EKCA 1NEZG 5C0ND 1D5ZA 1P84J 4XCCH 3SE3C 4LK4A 5DZOA 1NBYB 5DRZA 1DBJH 2R2HB 2BSSA 1CQYA 2EZ0D 5J1SC 4OCMC 1NL0L 3GSRB 1I1YA 4PB0L 3JWDC 4YWGL 1IL1A 3VFMB 3MLYH 2D9CA 5INCB 1G9NH 3O9WB 1ORSB 4U05A 5C1MB 1G7MB 5D7KD 2AEIT 2X4NA 3MA9L 3FO2B 3LRGA 3P4NB 3HE7D 3VGEA 5HYJB 2N7AA 3MLVH 2OP4L 1EX0A 1PSKL 2GTWA 4I0PA 3TYFA 3BGFB 5HY9B 5H35A 1AHWA 1ZOXA 2GKIA 2UY7A 4G6JL 5DD3H 4N0UE 4PJDE 5F1IB 2J8OA 5KSAC 5DJ0A 2H1PH 1YA5A 1FNLA 5EIVA 4HHAA 4JFEA 3QUZD 2RFXB 7CGTA 3RX5A 1BJMA 2P8PB 3OSKA 3PF2A 2QR0B 4KTDL 2VDML 1RZFH 1ZWIB 5IHBA 1DE4A 1BQLL 15C8L 3LKOB 3NFPB 1FLTX 5DURD 1JP5A 1AH1A 5EBMA 3BH9A 1NCCH 1RIHH 2IG2L 5H94A 2OSLB 5GS0C 4G9DA 4AZ8A 4Z7OE 1WWBX 5DRNA 4IHOA 4YIQB 2V6HA 5CGYC 1CT8B 3S98A 2ARJQ 1I7RA 1YEHL 1CD8A 1CXIA 1LD9B 1BGXH 1HHGB 2HKFH 3MPCA 5F9WC 4EQ2A 4O2CA 1K5NA 1WAAE 5I73B 4CW1B 1C12B 1W72A 3MV9D 4L3ED 4ONOA 4X8JA 2D03H 4MCYB 4JZJB 1S9YA 5F6IC 4J3OC 5T1DH 4QHMA 3SQOH 2BVEA 4YHKH 3TT1L 1GC1L 1TVBB 1UEYA 5I9QC 4AT6A 1HQRA 5ESQA 3MLSH 3TPUA 5TDOA 4EN3D 1RZIB 5GGRB 3WXVH 2A38A 4Z76B 5FA4B 1K3ZA 2XQBH 3D3VE 3WXWL 1WBXB 1A7QL 4QRQA 4N90E 5KN5B 3ARTA 3IVKB 1IGJB 4WWKA 4OFPA 1UCBH 4K23H 3OKNB 4N1EA 3TJHD 3FB7B 3DBXB 5FFLA 5EZOH 3PWPB 1IRAY 3IDGB 1ULVA 4MSWB 1MF2H 4NOFA 3WUWG 4QXUL 4ZTOH 4ZS7H 1R3LA 4LSRH 3BHBB 1NFDF 3B5TA 4R97C 1IQWH 2A0LD 3FO1A 4GUPB 2EH8H 5FB8A 4JKPL 3U36B 4ZFGL 3IAPA 3AS2A 4MNQE 4OV5A 4HUWA 4NN6B 2BVUA 3EYOA 5E1AB 1P4BL 3V4VH 2GEEA 4R4FH 2JK5A 4QNPE 4ODUA 3UBXI 1XGTB 4NUGH 5AD0B 3WEXB 4WJ5B 1MLBB 2AK4E 1ZLVH 1MAKA 1LILA 5E56A 3LH2H 5HTSA 1S9VA 3MUY1 4KAQL 1PYWB 5D6CA 3ARWA 3C8KA 4GKZA 3D25B 4LPXA 1RZJL 4K7PY 3MRFA 4UNTA 5HVHB 3UJTL 3I50L 1NAMH 1D5ZB 5DRZB 4RZCA 3FAWA 3K8MA 4J3WA 2X4OA 5BO1L 1U3HC 4FZEH 2BSSB 3QT2A 3S35L 2DQTL 4CVZB 4H1LH 1I1YB 2ZOKA 3PQYD 3K2UL 2E5EA 4L9DA 5LVEA 1IL1B 3PP4H 2RCSL 4MA8L 3FQRB 1HHHB 4XP4H 1QHPA 1CGXA 5DMYA 3RZWA 3BDXA 2X4NB 4YZFF 3NACH 4CVUA 1HYSC 1FL6A 2OK0H 2GTWB 2IQAA 4Y4KC 4I0PB 5H35B 3U7YH 1AHWB 2Y06H 3NZHH 2C26A 5SWSE 2DQUL 5ITBL 4RGNB 4TRPH 3AS0A 1I3UA 4HHAB 2VZSA 2BMKB 4JFEB 1PEWA 4Y2OA 4YPJA 5C08D 1XIWC 4IMKC 3VXPB 3ROLB 5EH1A 5E6IA 5BVPL 1ETZA 1RU9L 5IKCA 2E7LC 4C56D 1AI1L 1DE4B 5GIRB 5I8OL 2GQHA 4JPWH 4KVCL 1L7TH 5GS2D 1UJ3B 1CZ8L 1KTKE 3EBAA 4YDJA 5GS1A 5D2LA 3LEYL 5EBMB 1CG9A 4M1GL 4JM2C 1S7UA 5H94B 5DJCA 4LSTH 4PRPD 5DRNB 4LF3A 4AIOA 2F5AH 5DJ2A 2J4WH 4KKAD 2ITCA 1U2CA 4U1GC 2AJSL 4MXVF 5JDSA 2PYEA 3PWJA 3A67H 1FH5H 4O2CB 4UV4H 2VR5A 1ZVSA 2LAAA 2P24A 4N0RA 4R0LC 2VDLH 5IWLC 2BNRB 2BRQA 4CMHB 4KDTC 3ALWA 1DEDA 1NQBA 3D9AH 4XBEH 4ENEC 4LCWD 2DBJA 5KVDL 4JJ5A 2W1NA 2I07A 4AT6B 5ESQB 2EDLA 1TJIL 3TPUB 5TDOB 3BEVB 4OF8A 3VFSA 5CZXD 3X14A 4XCYB 1IM9D 3UTTD 4LDOB 1A4KA 4OLYH 5KBNC 1QFOA 1WITA 1JPTL 3U4BH 4P2QE 1EHLL 1TETH 2UV3A 1W0WB 4YE4H 5KZCD 4IJ3C 1KTRL 5E03A 2R56H 4WWKB 4DKEH 3HZMA 4P9HL 2DMKA 1KIUA 4L4VE 4WY7L 4Y5XC 4Q9BA 1F4XL 1YEKL 5JUEL 3QUMH 1CBVL 1PY9A 3CCHB 1BMGA 1KC5L 1S5HA 1FQ9C 3U7AA 1HKLH 4XPHL 1LO4H 3FO1B 2X9WA 4GAJH 1DBMH 1YN7B 2O5YH 4ZOBA 1ACYL 4KXZH 3C6LA 4OV5B 4LQFH 4HUWB 4MJIE 1MNUH 3ZKND 4F57L 3QZWA 1X5FA 3EYOB 3O6FC 4AQ1B 3N85H 2JK5B 4YXKL 4UTAH 2PF6A 4OCLC 4ODUB 3TN0A 4LIQE 1T2QL 1S7QA 3QEQA 2E7HA 4PJBE 4LSSL 1B6UA 3GJEA 3AUVA 4Q9CA 3TA3A 4M5ZL 1S9VB 4JAMA 4HZLA 1AD0A 5D6CB 4GKZB 1Q9OA 1AR2A 4D0CA 3ULVC 1JYXA 3MRFB 3N1QC 3TGXA 3LN4A 2IEPA 1MCOL 3L1OL 3O4LE 1IKFL 4FQXC 1I9RL 2X4OB 3ORJA 3IKCB 2K3TA 4QRRD 3VJ6A 1HILA 4YX2L 2DQJL 5CAYB 4JQVA 4WCYH 2VN4A 32C2A 2EYRA 3QUYA 5E8OA 1NCDL