3C5SA

Crystal structure of monoclonal fab f22-4 specific for shigella flexneri 2a o-ag
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
218
structure length
218
Chain Sequence
DIVMTQAAFSNPVTLGTSASISCRSSKSLLHSDGITYLYWYLQKPGQSPHLLIYHLSNLASGVPDRFSSSGSGTDFTLRISRVEAEDVGIYYCAHNVELPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of synthetic O-antigen fragments from serotype 2a Shigella flexneri in complex with a protective monoclonal antibody
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab F22-4 light chain
total genus 51
structure length 218
sequence length 218
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-02-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5sA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c5sA01
2YPVL 3HKFA 4LLQB 1A4KB 2QR0B 5D96C 5I8KL 2XG5A 1YEJL 5I15H 3A67H 3G6AA 3SPVA 3V6FB 1PX4A 4J6RL 4LLYA 3OPZL 5I19H 1NKOA 3CFBA 4OIIH 5D7IF 1EMTH 1U93A 2EZ0C 2J8OA 3GB7A 4I4WA 4ODTH 5I66A 2IAMA 3AS1A 5I17B 1J1XH 2HWZH 2VTFA 3FMGH 4JG1H 3TT1L 5DT1L 5FCUH 3OB0H 3QDMD 4RAVB 4P4KA 3FFDA 2AJXL 5KAQF 4HQQL 4NYLA 4W4OA 4I8DA 4ZQKA 4Y8DC 3WMSA 2ENYA 5DQDH 4PJGB 2QQNH 1LDPL 1EGJH 2QJDA 5FO7A 1KXTB 4G7YL 4KDTC 1F00I 5DSCA 2DQTH 4M43L 1OAYH 1A3RH 4S1QH 3V9FA 4U1LA 4PG2A 4YIQB 2ZKHH 2KDGA 4G9FE 3K4AA 2AJVL 4PJ9B 5LWYL 5HHME 3QEGL 4RAVA 5HHPA 1IGFL 3O8XA 2VZSA 5FHBH 1IM9B 1AP2A 5T5NF 3ZHKA 3H9YA 3ARED 2AABH 2E8ZA 2ITDA 4YXHH 4ZYKB 2VR5A 1P7KB 2W59A 4LLUA 4P5MB 4O58L 3GGWB 4LSSH 5CZKA 5JXED 3RI5F 2DS4A 4PGZA 2Y25A 2R0ZH 3FFCE 1TZIA 1F3JA 2YPLE 3ULVF 2YXFA 3OKDB 4ISVB 3T3PE 5FA3B 4XNQB 3BD4A 2APWA 4K7FB 2CDFA 3QUZC 5KS9A 4GKZA 1RZ7H 1QBMH 3TA3D 1JZ8A 3C60D 1J10A 3CLFL 3MSPA 4O2CA 2GEEA 2JCCE 1T2QH 3VXUB 5SX5K 5BRZB 4HUMB 1LK3L 4ZNEE 4KK8D 1GL4B 5F9WC 2DBJA 3U0TB 4QXGH 1PKQB 4PGBB 4LLVA 3EZ8A 3TBSA 2JB5H 3EYUH 2R2HA 4FG6D 4F7CA 3PDGA 3K8MA 4MQXD 4TQEL 2F8VA 2ED7A 2CR3A 5HGDA 3U0WH 4LIQE 4GMSL 1OP3K 2Z93B 3MRIB 4R26H 2I9TB 1KPRB 3LDBB 4LSVL 3MJ9L 1N6QH 3GSUA 1OAUH 4MAUL 4GW5A 4FFVD 4K3JH 4JFEE 4RMSA 1CLZL 2H26A 5IBTL 4BUHA 3CXDL 1FH5H 1DR9A 3BVNA 1U8OA 2F54D 4U1SB 2X1QA 3NPSC 1AY1H 2OBGA 3VRIA 4JM2B 1S7QA 3WDJA 1T5WA 4ZFGH 3VH8G 4X4YA 2VLKA 3JV6B 3HNTH 2VZVA 1PYWA 3U9UA 3K46A 1FO0B 3KNBB 4IBLT 3GSNA 1JWSB 2A0LD 3OAUH 3IDJB 5H35A 2WQ8A 5JUEH 2W60A 5I19L 4PJXA 3GRWH 2J7LA 4NKDB 5HHVH 4KTEL 4XP9H 1FL6B 1VFOA 3BP7B 3TCXA 3EBAA 5I8OL 4P5KA 2X09A 2V17L 5FKAA 2XY2A 4P99A 4OGAD 2XT1B 4PJXF 4LASH 2R0KL 1YJDL 1QRKA 3DLQR 4NCC2 5TE4L 3SEPA 3V4VH 4XP6L 3P4MB 2C9AA 5C6TH 5HHXH 2Y06L 4M1CC 4ONOA 1UCBH 5CIPB 4PJIA 3U2SA 3EYOA 1TZGH 4DVRL 1H3PH 3QUXA 5AEAA 1AIFB 1FVEA 4R7DB 1UEMA 5K59E 4AZ8A 5J1SC 5IHUL 5BS0B 2H1PH 4YHKH 3ARSA 3FN0H 3L5WA 4WUKL 3RUGE 4OZ4B 3ZKQD 3DSNA 4OGYH 3Q1SH 4XHJD 5IJKA 2GJ6D 2XNAB 4Y4FA 4PJHE 3EFFA 3HAEH 2OTWA 2ADFL 2JIXA 1NGZA 4XPTH 1KJVA 3C6LD 1T7XA 5CEYA 4K94L 3GSRA 4LKCA 4Y4KC 5B21A 4XMKL 2K7QA 1DQDL 5I8CA 3I3DA 4IRJB 4GS7C 2DQJL 4LRIC 5T3ZL 4CADB 4LU5H 3ROLA 3HFML 5IHZA 1AIFA 4BH7A 1T7VA 4JKPH 4NFDA 2IGFL 2BERA 2FIKA 3QCTH 3MRDA 3NVQA 2Q8BH 2QBWA 3DI3B 1JTTA 1TJIH 1U8LB 1Q0XH 3SCMC 4N9GB 3MFFB 1ZK9A 3HC3L 3MREB 3V5KA 5HJ3B 2XWBB 4CN6A 1TVBB 3ZYIA 3L9RA 5I1CH 3CVIH 1RQ5A 4NHCH 4PR5A 2EDBA 3WXWL 4I5BB 4KVCL 4M1GH 4M7LT 1R3IH 4TN9A 1H3UA 3SOBH 5FKAB 1T1ZB 5EH1A 1MIEH 3PL6D 4RMWA 4DCQA 1YECL 5KVDL 3NH7L 2B5IC 4KZEL 2FGWH 1PSKH 4F9PC 1MWAB 4DZBA 2GY7B 1E27A 5FDYA 4XMPL 1T5WB 1IEBB 2E5EA 3FAWA 1W8NA 2HAZA 2XA8L 4OF7A 1NGPH 2Y5TB 4ALAH 2BOCA 5JA8B 1OGAD 3JV6A 2UWEF 2VISB 2DDQH 5IR1B 3HTLX 4WWKA 4F7PB 3RVVC 2YD8A 2BSTA 5EB9A 3DBXA 1CL7I 3BQUC 2YN5A 3HN3A 4OSUL 5KSUA 5T33H 1A47A 2DBLH 4APQC 3OXSB 3G5XB 1F11A 4XXDB 3CVHH 2FLRT 1BM3L 1DLFH 1UACL 4PGCB 2A9MH 3Q48A 1RULL 4J3TA 3O9WC 4ZFGL 1SEBB 5JHDA 4HUVA 1FG2B 1IC4L 3VXOB 4OUUA 3RL2A 5I6XB 1BVLA 4D0DA 1L4IA 3BOVA 1N6QL 4ZUVA 4MCYA 4C83A 1Q94B 2PXYB 4P2QD 4YAQB 2XTJC 1T6WA 3W39A 1HDMA 1KPUA 3UXFA 4HH8A 1FVCA 1TZHA 2XWJA 4ONHA 1FNEA 3PQYE 3ABZA 4WI8A 1XR9B 2GCYB 5ACZB 4OJFH 4XHQA 1ZS8A 1MJUL 2F53A 4GW4A 3SDDA 1XF4B 3TT3L 3QUYA 1RHFA 1Q0YH 2IH3A 2Q8AH 3WV0A 1UKTA 4ZOBA 1YUHB 2VC2H 3MXVH 5D7KE 5A1AA 1KLGB 4XNQA 2XWTB 2A74A 1FGVL 1MCQA 2PW2B 4QGTA 5DJXB 3RVTD 4D0CB 3SO3C 5EZIH 4KQ4L 2I27N 2UZIH 2JELH 3H9SE 1U8QB 3PWVB 4HGWB 4GLRH 3PV6A 4EEEA 5D93B 3TYFB 4G8GD 5FV2A 3DVNA 4GUPB 2I26N 2DWDA 3T0XA 1I9IH 4WGWB 5HPMA 3T8XA 3AY4C 1TZIB 3WNNA 1N3NB 1QFHA 2J2ZA 5JOEA 3SE4C 2LTQB 1JUFB 3WLBA 4NKIL 4KXZH 5FHAH 1IKNC 4Z7WF 5M95B 5GRUL 2YS4A 4U1IA 5TQ2L 3Q1SL 4V1DA 1N8ZB 4PRPB 2QQQA 3IDIB 2AGJL 4S2SB 3HI5L 4Y5XC 1Q8MA 1R0AH 2XZAH 4FG6C 3G5ZA 3PWLB 3MLYL 5L8JB 2IH1A 4O2EB 2F9BT 2W60B 1EHNA 3DX7A 3HPLA 1S5IH 3V5DB 1JFQL 5HDQH 2BMKA 1QFPA 2C4FU 4PJCA 2EDTA 3M1BB 2P5WE 3UBXG 3HMXH 2VLJA 3O9WA 2Q7YB 2FJHB 5GZNC 4Y5VC 1Q9KA 3UAJD 1WFTA 4P46C 1OT1A 1CK0L 4XMKH 2IADB 5D2LA 5D2NA 4UOW0 4RA0C 4F7TB 1JPST 4PD4K 3MBXL 4U7KA 5GGSY 3BE1H 5ACLA 2VKWA 1P2CB 2YD1A 1ZANL 3WJJC 5F1KC 4U0QB 4PJ9D 2OZ4H 2D03H 2FDBP 1ORSB 5GRXG 2ED9A 2J5LC 2ITCA 4E5XB 4W6YB 4IMLA 1ZLUK 3I50L 2COQA 1KB9K 4LLQA 2XN9B 4K07A 5E03A 1YNTB 2A6JB 5DQJB 4I2XB 3ZDXF 2JJSA 4HUVB 1T1XA 3KG5A 1NMAH 3LS4L 5H94A 43C9A 1YPZE 1BBJB 5IG7B 3O6LH 3V8OA 5E8NA 1P84J 4WENB 5HHXL 5C6TL 1G0DA 2EECA 1EHXA 3L3OA 4EXKA 4OI7A 1F2XK 1F3DJ 4HWEL 2Z31D 3VI4E 3QISA 5IKCA 1FZMB 4OLXL 4YDLC 3VXSB 4RGNB 3DO3A 1RK0B 4UILH 4JRXE 4JDVB 1FZOB 4QT5A 2DMBA 5F1SA 4R26L 3QG7H 3OB0K 4HZAA 4QOKE 5JIKA 1TJGH 3MXWH 1C7TA 1T3FB 3ZLQC 3EZJB 2WP3O 2YUVA 3FO0L 4TQEH 5JTWA 1VFBB 4NJAL 4HJJL 3DNKA 2VLJD 4RGOH 3I6LD 3O9WD 3WYRA 4AIOA 3P77A 1G6RA 1RUKL 1NMBH 4YDJA 1FVEB 1YEHL 1UFUA 1G7HA 1R5IB 3IJSB 1IGJB 2GFBA 3WE6A 2ITDB 4YHML 4JANA 2YD7A 2YSSB 4JLRB 3WHE0 4KPHL 3DXAD 2CSPA 5KZCB 5GGQL 4TTGA 1CG9A 4JPWL 3T8XB 5HGHA 2AK1L 3MRNB 1WC7A 3NABL 1UADC 5D2NC 1FC2D 4GBXC 3DVGB 3WFDL 3LPWA 4NKQB 4R90L 4MQ7A 1A7QH 3KYNA 4NRZB 3BKYH 4BH7B 3O3BB 3OG4B 2AABL 2ZJSH 4BUGA 4NQDE 4Y2DC 3VXUE 25C8H 3MRHB 2A77L 1LK2A 4QHUB 1DBBL 3TT3H 5EORH 4BZ1L 1IC1A 5I30L 3B2UC 4U6VH 3MRNA 5HHVL 3RY4A 1G84A 3RNQA 4KK8C 4MX7A 4OV5A 5HGHB 4IJ3C 5J6HA 3PHOB 3HNVH 1HQ4B 4L8BB 4N5UA 3D85B 2FATH 4R4BB 4XP6H 3R8QA 1EAPB 1ZLVH 3G6JA 2OYPA 3BP5B 2EXYD 1CICB 2L7UA 4LL9A 1FDLH 5D9SB 3U30C 5EC2A 1REIA 3IS1X 1S7SA 4M03A 1RZJC 4XXCA 4Q9CA 3UTTD 2FEEL 3KXFB 5D1QA 2DL2A 5IBLC 2H3NB 1CGSH 2FL5A 1R24B 2UZIL 1UYWL 3FB6A 3INUH 1MPAL 1EUUA 1I9JH 2OQJB 1FFOA 4H8WH 4Y19D 4JO2H 2RIKA 3O4OB 1RJZB 4K9EC 4PJAB 5AYUL 4BQ9A 1NCDH 1DANU 1XGRB 3V0VA 4DAGL 3BDXA 2VABA 5E9DE 4RMVA 1CFTA 4KKLD 3WKNA 1MOEA 1CVRA 4LVNC 2NXYB 4IRSB 5I15L 4EJ1C 1INDL 3GSXA 4LQ1A 5AUMA 3MLWH 3OTTA 2W92A 3NACH 4U1MB 3TH4T 4X6DF 3V4UH 1XCQA 5E8DL 3CFKB 3TYGL 3WKML 4CAGA 5EUKA 1QG3A 4I3SH 1H0DB 4R0LB 1H3TA 4JN1H 2GHWB 4FNLH 1BD2B 3UTSB 2WBJC 3V4UL 5C9KA 4KRMB 3KPNB 3WBDA 4QGYA 1JGUH 3O0RH 2LQRA 4JM2D 2X9YA 1G7LA 1TQCC 2Q3AA 3OXRB 2WM0A 1MHEA 5C0BD 2VLLB 1F4HA 3MOAL 2XZCL 4Y2DA 5JDSB 4ODTL 5JW5A 4ODXA 4XXCC 3KR3H 3QUYC 4HJGB 3EIFA 4FXGB 1KPRA 4PJEE 4PUBL 3WE6B 2J6EH 5ADPL 1FPTH 3MRDB 4EI6B 4XVSH 3VGGA 3LV3B 1MCEA 2Y4SA 5HDLA 1XEDA 5MEQA 3EOBB 3C2AH 2VLJE 1W72A 5T33L 4X4XA 1TNMA 4UTAL 2X70B 2YN3A 3S9DB 4QXGL 4HWEH 3RU8L 1FC1A 4XI5D 5MERA 4I77L 1KEMH 5HVWA 2P8PB 1HH9A 5GS0C 1OTTC 5CD5D 5I2IB 5LXGL 5CHNB 3CFCH 5DHVB 1A14H 4XPTL 3I2CH 1MI5A 5IB3A 3DO7B 4LCWD 2CMRL 1F6AB 1G1YA 2R1XB 1I8LA 3FN0L 1OTUC 4MXVE 5CD5C 4PRPA 1YMMB 5CILL 4HPYL 1AGCA 3EAKA 5A3ID 5M7QA 4XB7A 5KVGL 4P5TC 5FUCC 4HKBA 3TH3T 4LKXB 5LVEA 5HBBA 1ZLWH 4F58L 2D7QA 4FZEL 1AGDB 3C9NA 3RBSA 4F2MA 5D7SL 3CMGA 4HXAH 3PWVA 1SBSL 2B4CL 2BNQB 2GAZB 4K3GA 5JZ7D 2C7UB 4PY8J 1CLOH 5LGJB 3PQYB 2LTQC 3BDBA 1B2WH 5FF6B 1R3HB 32C2A 1RUQL 2BNRE 5J13B 3V0WL 3OGOE 4CVXA 3ARVA 1EXUA 1XR9A 2GCYA 5ACZA 3S4SB 5JLZB 4OZFB 4EKXA 5F1IB 4NYLB 5EA0H 2YD5A 5CFHA 3L6FA 4P3CH 1BQUA 2NY1D 3HE7B 2YRLA 3MNZB 3UTZB 1WCBA 1U8OB 3T2QA 4YFLF 5D1ZC 3FRUA 4EUPB 3JUZA 5IT2H 1S7RB 4POZC 1S7UB 4KKCC 3TJHC 1VPOL 3HE7D 4HZLB 5MEOB 1T4KA 3JWDH 1RVFH 4JY4A 3BVNB 4DTGH 4L3EB 2RGSA 2ZCLL 3UDWA 5BOPA 1U9KA 2DQIL 5I1LB 2ZSVB 2JLLA 3IT8D 3GMNB 5IVXF 4NOFA 3WN5A 1NEZG 5CZXD 2PN5A 3MXVL 4PJ5B 2X1WL 2QQLH 3MNZA 5T3XH 3VXMD 3T1WA 4EUPG 1TIUA 3IFOB 4IMLB 4P2RB 5GRVK 3CDFA 1ZT7A 3DTXA 4LHJB 3ARFD 5DZNA 5JPNB 2VN4A 3MR9B 2EICA 3OAUL 5ICZB 3U36A 1IKNA 3MA7A 1BJ1H 3U1SL 3I50H 1FBIH 3PWPE 4QXUL 5F72S 1X4YA 1X5AA 2RFXB 3QPXH 3VD5A 3VXUA 5A40E 3M1BA 3QUXD 1EBPA 3P11H 5TH2A 3I9GL 3DUUB 4WI2A 3HC4H 35C8H 3QDMB 1TVBA 1QO3A 4ORGA 4M7LL 1BBDH 3CIQA 5FB8B 1OSPL 1UQSB 3HS0B 3ZTJG 2FSEB 1ND0A 5T3ZE 5J3HC 3MBEC 1P4BL 4PB9L 5J3HD 5F7EH 4RCAA 4ELMA 3T0EA 4PJ9A 3MCLL 4K7PH 4HBCH 2XKNB 1O7VA 2UV3A 1R0AL 4NO2B 1G0YR 5DK2B 1JYXA 2WUCL 2YK1L 2XKUA 4Q9RH 4KMTH 3MGOB 4P3DB 2NY2C 1R3JB 1JMZA 1VFAB 4ZUUA 1XIWD 4XTRD 4UBDD 4MJ2A 5EO9A 4JFDB 5L7XL 1Z0MA 5DZLA 4LSRL 4F37K 5C0EB 3BT2H 4WTWA 2GTZA 1ORQA 3RUGA 4J23A 3QNYB 2Z31A 4Y4KB 2C3VA 3KYMB 2G5BB 4UDTA 3MODH 2IH3B 4BK4A 1UB5A 5AG9A 4MWFB 5K9OA 3T0BA 1A1MB 1A1OB 3PWJA 5MEPB 1NUNB 4O9HH 1EEZB 2XY1A 15C8L 3Q5YA 4OM0L 2VLRB 3FKUS 4XBGA 1TVHB 5DJ2A 3CZFB 5FK9B 1X5JA 3NCCB 4NC0B 4NKDA 4ZUVB 5HHOE 4R8WL 2UWEB 1FLTX 4ENED 4LLMA 1PBYA 4ACPA 2H32A 3CU7A 2FZ3A 3SDDD 3O3DB 5J1AB 4PPTA 3ZE1E 4PRIE 3VXME 1J11A 2XA8H 4RGNE 5B4MD 4K23L 5GQBA 3OZ9L 3VFGH 3TNMA 1ZXQA 3GIZL 1S3KH 5IBUB 4OSUH 1URLA 2O93L 1JRHI 5I18H 1N5AA 3C6SA 5CGTA 3B5GA 1V3JA 1GGCL 3PGCA 1C16A 4GRMB 5J12C 1NAKL 2PO6C 4U31A 5EA0L 4GRLA 1DLFL 2QQLL 4HC1H 1E28B 1CS6A 4CDHA 1XGPB 1FV1A 3LV3A 5T1KD 3H2WA 1AO7D 4PJBB 2E9BA 1D5XB 2FX7L 3C08L 3QDJE 3VCLA 1NSNH 3N1PC 4KAQH 2Y6SC 4YBQD 5IBUG 1MPAH 3BN9C 1S7WA 3PWJB 2ZCLH 1JGVH 1L7TH 2MPAH 4A6YA 3QHTC 4NRYA 5I6XC 3NCFB 1F4XH 1AGEA 4P5TD 5DHYB 5I0ZA 1VKXA 2YUWA 4WFEE 4X5XA 1A9EB 1WWCA 3EJYC 5ICZA 3K7UA 3V6OE 1NFIB 2VSCA 1S9YB 4G8EA 2P7TA 1QSEE 1MQKH 3UC0L 2YD4A 5ANMB 5C08E 1CR9L 1EH9A 6FABL 4I0PB 2AJUH 1CGWA 4ODVL 4WCYL 2OSLA 2VITB 3QO1A 1CDGA 4PJ8C 5ESAB 5GGVL 3CFEB 2HRPH 4P5MA 4R90H 1KC5L 3K0WA 2ARWA 3HUJE 4P23B 2G9HA 2ZJSL 4FTVB 1GGIL 4J8RA 3S5LA 3MRQB 3ULUE 1OWWA 1QPPA 1SY6A 2NY5C 1YPZA 4IDJL 4IRJC 1G6RH 1FVDA 3QIWC 5BRZE 4D2NA 4M7ZC 1R5IA 3IJSA 5F89A 3X3GL 1GSMA 3P0VH 3R8BB 3Q6FA 1J8HB 4OFKA 2B2XL 4WW2F 2HVJA 1B4JH 4OZIF 4R3SB 2K3TA 3TIEA 3NBNA 5FYKU 5F6IC 3NZHH 1OSZB 4F7CB 4GAJH 4EN3A 3QULB 1OM3L 3MROB 3MOAH 5I75B 2GT9B 1CFQB 4I18A 2EE6A 3RPIB 2CMRH 3F7YB 5ILTH 4WFGD 1Y0LB 1MHPL 3BD5A 1CD0A 3LDBC 2IAMB 5B3JF 3MGTA 4YFLI 5C0BB 4HCRA 4JZJB 1RJLB 3GSWB 4PJCE 1G7QA 4PG2C 3WKMH 1BBJA 3DUSA 3RU8H 2NTFA 3UPAA 1BOGB 1U58A 5GGRB 5JW4Q 3EJYD 4HFUL 2AXFA 1KULA 1I9EA 1WZMA 1MAJA 1S9WB 5GGUB 1AGCB 2A38A 5IQ9B 4K23H 43CAB 2VR9A 1FZKB 1WTGT 3VD4A 5FGBC 3NH7H 1N6UA 3NIGF 3LD8C 1UXWA 3P4NB 1S9KC 3L3HB 4L9DA 1S7TA 2DM4A 3QG6B 4ODSL 5DD1H 3U4AA 1JNNL 1UB5B 3X14B 4KRPD 1QNZL 4EQ2A 3HAEA 4M6MH 2ZUUA 3BPLB 3P77B 2X70A 3H9HB 2JJWA 5DJ6B 3I75A 1W72B 3JWOL 5HI4D 3WS3B 2KQNA 2P5WB 3S8WA 4XP1L 4D94A 5EO1A 2BVUA 2FX7H 2NY6D 3FCTA 5DI8A 1CTOA 5CSZB 2YPKB 4HLZH 3MLTB 3C60A 5GISL 1VEOA 3W2DL 5JPNA 3BPNB 3VE0A 3KPLA 1ONQB 4G43A 3F7VB 3FB8A 5DURD 2VR4A 3NN8A 3EO1A 5FA3A 5GS1C 4F2MB 3O11B 4DQOL 3QDAA 5D96B 2ADJA 1S3KL 1A6WH 3TBTA 5FHBL 3HR5A 5FO9B 5JNYA 1NAMA 3AREA 4PG9A 2IPUK 3N9GL 4KJYB 1T22B 3G6AB 1JGDB 3N85L 2WUBH 2R2CA 3GSNH 1UWGL 3HG1D 2DF3A 3ARZA 3KPLB 3N9GH 3HCVA 4BSVB 4RMRA 5B38A 2X4OA 5GGQH 4ODBD 4FABH 1I3RA 1E6OL 4RQQA 2I25N 4N9OB 2PKDA 2O61B 3RAJH 1HHKA 3VXMA 4X4XB 1G0XA 2G60H 1FP5A 3AC0A 4G5ZL 4S10A 4PY8I 2KQMA 2D0HA 2ZUXA 5EPMB 2C1OB 5KZCD 3VGDA 3S4SA 1DBKL 5JR1H 2PYFA 4DVBB 4NGHL 3MV7B 3O6KL 2ZCHL 5J0BA 1MQKL 4M8VA 1H8NA 3QRFM 4ZD3L 4H0HB 4H5SA 1X4ZA 5FYLE 2YXMA 1MCDA 1R3KA 4CU7A 1UM5H 4X6CA 1KN4L 5JOPD 4UUJB 1QFWM 3VW3H 3PJSA 1T2JA 1CFBA 2MMXA 3TN0C 3IDXL 2HRLA 1V7NL 5J7CC 1QD0A 2GK0A 3FT4B 3O3UN 1D5BA 4N1CA 2HFFB 4BH8B 1XCQB 3I02B 5IBTH 1VERA 3GJFA 5KBNC 3FOMA 4EI5A 3AAZA 1ADQH 2FJFA 4J1UA 4PJHF 2JF1A 4X7CC 3SO5A 4HW6A 4JFQA 2WIIA 4LARH 1TNNA 4JQIH 5F7EL 4PJDE 4QRTA 5CJOL 2NPLX 2CJUL 2VLKD 4ZXBA 5DJDB 2Z8VC 3S35L 5DMGD 4NO3B 1VFAA 4YHNB 3B9KC 5CSGA 3LQZB 4JFHE 2HJKB 1MCSA 4LSUL 2CJUH 1FNAA 3DX8B 4YDKL 3GBML 4HK3J 4NJ9H 2Q87A 3OGCA 3OF6A 2HN7B 3W0WE 1NH6A 4LEXL 2YRZA 2WWKT 3M8OH 3ZKND 1JNHA 3V5KB 5CUSH 3HG1E 2HLAA 3GKZA 1FFNB 1KN2L 3OWEA 3S3JA 3P4OA 5B3JE 4Z5RA 1U8NB 5C1MB 4E0RB 2X7LA 1IFHH 5D6CA 1QBML 4LCWA 3EO0B 3DX8A 4HPOL 3QIUD 5IB5A 4Z18A 2HJKA 2VQUA 3EDDA 4G6AD 3LCYA 3O3EB 5JHDE 5IMOB 4L8DA 4RBPK 1D9KD 4X4ZA 4R7NA 4U2ZA 2FRGP 1DN2A 4NCC1 3QXAB 4YHOL 4QXTB 3GK8H 15C8H 5GS3A 4PGDB 1MEXH 2X1OA 2JB6B 3C6LA 3V52H 5HXMA 2N7BA 4MAUH 2C4FT 4KV5E 3ARBD 1QFWL 2J3SA 1GJIA 1U8NA 2GKIA 4Y5YC 4PRDB 1U95B 5F88A 1IAIL 3MCKA 3STZA 3MNWB 4X4ME 1BF8A 3EHBD 2IQAB 4Y5YB 4CKVX 3DVFA 5GSRA 1MFEH 1ED3B 3EYQD 5IB4A 1KNOA 4YDVA 2ARJQ 4M6OL 1AP2B 4KDVA 1A14L 3GUTB 5DJ2B 5K9JH 2G5RA 2OQJA 4PLNC 1WBXB 4NWUL 1TJHH 4XPBL 4UMGA 1JHLL 3FQWB 5D1XD 5DC4B 1MHEB 4OLUH 1IGCH 3F58L 1OGAB 1KACB 1RZKH 2NY0B 3WNKA 4PJBA 4IRZL 1NGQH 3U7YH 4OFYA 2H2SD 2OCFD 4NM4H 1AD9A 5GSVA 3MREA 2VDLH 3BP5A 3PP4L 1JWSA 1G1CA 2Z92B 2HKHL 4JVUA 1MHCA 4PRHE 3DRQB 4NO5A 1A4JA 4LGSB 2BRQA 3ESVF 4RGND 1KB5B 3WIHH 1A6WL 2XTJE 5C0CE 2YOCA 1MJUH 5DK3A 2AK4E 1IZKA 2VZOA 4HDIB 5SV4A 3RWHB 1F6LL 2X4QA 2BNRA 2XV6B 4L3CB 3MX0A 1ZE3C 5CEYB 1OGAA 1AY1L 4RFNB 1A7NH 4FFZH 4HIJA 2X1PA 4OZHB 5I18L 3GBNL 1PZ5A 4XGZA 3GFUA 3O2DA 3OJ2C 3RWDB 3D2UD 2XQBH 5GS2D 3EHBC 4H20L 3V5HA 5D2LE 1AR1C 1NDGA 3QDJB 5ICXA 3VRJB 4S1DD 3X17A 4KK9D 3CCHA 1ZEAL 2PXYC 3MNWA 2BY0A 4RRPG 4G43B 2Y23A 1FBIL 4XPFL 4DAGH 1I7ZB 3O8XC 2VDMH 3MV9B 5IIEB 2XWTA 3TO2B 1P4IH 3BIKB 2NR6C 3O6FA 4MD5B 4OFYD 1MCJA 3GBMH 2YA1A 5FGSA 1N6VA 2GY5A 1ZA6A 2V2TA 4HUWA 5HHMD 3B9KB 4DOHE 1ZVSB 4CVUA 2O5XH 4APQD 4K8RD 4F80A 1NCCL 1NCNA 1ITBB 2NLJB 3FZUC 3OKDA 1OP5K 1IM9D 1JGUL 3O0RL 3BKML 4D8PB 4PG9B 5DMIL 5AD0B 2MSPA 4OZIB 2R0LL 2VXTL 4WGVB 1S7XA 4XRCA 3GIVB 2HMIC 1SYSA 1ZLWK 2OJZL 1KIRB 3QG6A 5DA0B 4F9LA 2WAHA 3QA3B 5LJYH 4O58H 3FO1A 4LCIL 2AEPH 4MAYB 1R3IL 1BGXL 4H0GA 2ZOKA 2CRIA 5KOMC 3AMKA 2P43B 2AXFB 1M05A 4S1SH 5KS9E 3R1GH 4HK0A 5HTSA 4PB0L 4R4FH 3GKWL 3HE6A 4GW1A 1FLRL 4Q0XH 1UM5L 1G7HB 4X9BA 5FOBB 1KTLB 5IHBA 4P2OB 4N5EC 3KPQA 2FBJL 1BVKA 1N64H 3GKWH 3QCTL 4LPVA 3WUWA 1F6FB 4L4TB 2FBJH 4QY8B 4HMCA 4OGYL 5IVZB 1AXIB 2YD3A 1Y0LA 3S5LG 3B2UD 3B9DA 4X7FC 3L3DB 4K94H 5FYJU 3GBLA 1BREA 1BWWA 1ZT7B 5BS0E 3T3PF 2BVQB 2Y07H 5E2WL 3I6KA 5GJSH 1J8HD 3NGBB 2X4NA 3DROB 3WNPA 5DRZA 3SKOB 4YGVA 3QXDA 4NUGL 1DQTA 1UJTA 2GSGB 4OCWH 3KLHD 1UB6A 5EWIH 3ZKMD 1D9KB 1IRAY 4YEEA 4WEUD 1WUNT 4KZDL 1FYTB 1X6NA 1SVZA 1NJ9B 2WUBL 1CD1B 4UT6L 3S5LB 2VDNH 3P9LA 5L2KE 4AQ1B 4G7VL 5D71L 4WO4D 4MGXA 3SE8L 1WSST 1YN7B 4GAGH 5GGTA 3VXTA 1LWRA 3HNTL 5HHOA 3BP6A 5ECJE 2Z4QA 1WBYB 1BIIB 1NQBA 1F4YH 3NCMA 4MJ6B 4EN3C 1TQCB 4O51A 4XCNB 3WFHB 5IT2L 1WAAF 2DQFB 1LEIA 4PRIA 1GHFL 4HLZG 1JYWA 3MRLB 2BJMH 4XH2B 4ETQB 3L1OL 5FECB 3BPLC 2EH7H 5MEND 3ARWA 4U3XA 2X4OB 4R0LC 4ZD3H 4WHTB 1VKXB 1S7WB 4RGOL 2HVKA 5EU7E 3NN8B 5D72L 1N4XH 1T89C 4LK4A 4DKFH 4ELKA 1A21A 1QSED 1UH3A 4H26A 3RPKA 2EE2A 4Z5RB 4RZCB 3HRPA 6CGTA 3BKCH 3CXDH 3TO4B 2NXYC 2IQAA 4IRSC 5EO0B 1BVLB 4XWGL 4D0DB 1LEGA 1RULH 2X89D 1I8MA 2ARJA 2J88L 3TBTB 5GXBB 3U0WL 2IF7A 2YBRA 3RZCD 5C2UB 4PJHA 1BQHA 3U7WL 3NIDE 3P73B 4WV1A 5FUOH 4PGDA 4XCNA 3WFHA 1LEIB 1K4DB 3D85D 4MB4A 5F88B 1NUDA 4PJ9C 3P9MA 1A0QH 3PP4H 2AK4A 2VDLL 4UV7H 3V6ZB 3WIFA 4HGMA 4RDQF 3DI2B 1YUHA 1G7JA 3OKLB 1AQKL 1QFWI 4O2FB 4PRNB 5EZJB 5I0DA 1G7IA 1YN7A 2HJLB 3O3DA 1FZOA 3AROA 2JK5A 4F57L 5E7FA 4TSBL 2FO1A 4LSTH 1G9MC 4L9LB 3TEUA 2D03L 2AQ1A 4NC1C 3LKRA 3NAAH 5CGYD 2FJFB 4JR9H 4LLWB 5HYQB 5H37G 1RMFL 1U8KB 1A7NL 3W39B 3PXHA 5CIPA 4M02A 1G9MH 1PEWA 2EIEA 4PB9H 1E28A 3MRPA 5E2UH 5FFLA 3IKKA 4UTAH 1ZKAA 3N1MC 4LP5A 1E0OB 2VLLA 4Y2DB 2ZUQC 5C08D 4PJEF 1A3LH 1E4XH 3EFDH 2VERN 4X6CB 4KHXH 1GOHA 3DURA 2V2WA 2HVKB 2X4RA 3QIBD 3KHOA 3OGCB 1INEL 1ZA3B 5BV7L 4FQ2L 3MOQA 1OTSC 2WIIB 1MCPH 5DFVC 1FORH 1IAKA 3N50A 1MEXL 5EZLB 2DTMH 4M43H 3GSWA 3QXTA 4ZXBB 4UV4L 1A6TA 5LBSH 4QHLB 3ZYOA 1AI1L 5F7DB 1BIIA 4M6NL 5F9DC 1MAMH 3STLB 1I4FA 4JPWH 1I3UA 1XR8A 2R1WB 2WP3T 3DURB 2PO6A 1YMME 4IJ3B 5DD0L 3D1MC 3VFSB 3EW3B 1EEZA 2WBWB 3ARDB 1HXYA 3T0DA 2XXCB 2YZ8A 3QEUA 1RZJL 3B9AA 3VU2A 3OHXB 4PJEA 3BRFA 1ZGLM 3OR6B 3MBXH 3JV4A 3EO9L 1KJ2H 2EC9T 1UEYA 5HYIA 3JWOC 3WFBH 5FIEA 1NFDF 4JRYD 4JFDA 3U82B 1LE9A 1PKQA 3HI6L 4AT6B 3QIBA 5T5NG 4O5LL 2LU7A 2W65A 1ZVSA 1MY7A 1IC7H 1KCVH 3VWJB 3C60B 1L0QA 3N1QC 2AK4B 3UZVB 3ZTJH 3X13A 1AC0A 1NBZA 1U2CA 1ITCA 4BKLA 2BDNH 4NRYB 4XWOD 1KJVB 3O6FB 3RTQD 3WUWB 2NY1B 3LKSA 5DC9B 4GG8A 4XX1G 1NFIA 5JNYB 2K9UA 1A9EA 5SWSD 4Z78B 5FYJH 4A2LA 3HE6B 4ELMF 3RIAF 1Z0NA 4JY4B 1FG2A 4YZFE 4CUCA 5C0AE 2OMNA 1Y18B 4N8CL 2J1KA 5EOCJ 3L5XH 1G9NH 5IW1B 4P23C 1CFSB 3W2DH 1GZQB 1NL0L 3KVQA 3HZMA 4F3FA 4YUEH 4BA8A 5FYJE 3VFVA 3VJ6B 4JM2F 5SX4I 3UC0H 2EDRA 2VZUA 1U0QA 4OZIA 5FO7B 6FABH 2OJZH 4NP4L 3OKEB 4PJ7A 5J11C 4TRPH 1CGXA 3UCRA 1G7MA 4PJBF 1X5KA 5H2BB 4JDZA 4PTTA 3WS3A 1S7TB 4AY0A 2WWMD 1U8IA 3QIWB 1E27B 1YMMD 4HWNA 1YEIL 3VXTB 5DJ6A 1PX3A 2L7JA 3T2OA 3CK0H 3SDYL 3DV4A 4ZO7A 3D87B 1YPZF 3GEWB 2EEBA 4I18B 1EIBA 3KGRA 5IKCB 1DVFA 2NY3C 1NMCC 2F74B 1BP3B 3BGFB 2V7NA 2Q8AL 5I73C 3NMEA 3MLWL 1N0XL 2H45A 1MCWM 1MQ8A 4WI6A 4XPGL 1JGLH 1YYLH 1M71A 4KHTH 1PDKA 2GI7A 1IT9H 5CCKH 1VSCA 1FRGH 4AMKH 3MRBB 1V8HA 4OAWB 1WCBB 2DLTA 3H3BC 5F89B 2VAAA 5DRZB 1CDBA 1NC4B 1Z9SA 4P23D 1RUAL 4KRPB 4LDEB 35C8L 3TN0A 3KPSA 3W11C 1U6AH 4I3SL 1U8HA 5C7XL 4R6UA 3SE9H 5DMIH 4GKSB 4CDGC 2ZKHL 4R2GD 3MFGB 3TVMA 3ROLB 5IB3B 5IHZB 4PREB 3S88H 3BZEA 2D4FA 4CMHB 4JQXA 3TF7C 4Q2ZB 4N1EA 3CFEA 2XG4A 4PJDB 3TBYB 1MCCA 1KPVA 2VSDA 1A6UL 3VRLE 1K4DA 5SWZE 1HINH 5A2KH 3HRZB 3P4LA 4F7EB 2EIDA 4P2OA 2RB8A 2GSIB 1MIML 1TCRB 4WUUE 5D6CB 4E42A 1X3DA 4KUZH 1I3GH 1WFUA 3VXUD 1PVHA 1RURL 3DX7B 1NFKA 5DYOA 4XVSL 5E9DB 2PF6A 2A9NH 2RHEA 4BFBD 4RZCA 3H0TB 5DK2A 3K2UH 3OXRA 3UTOA 2X4SB 1FNSL 3GM0A 4RNRB 4YNYB 4JFDE 3UTPD 3QA3A 4NM4L 5CJBA 3DMMA 1MIEL 1T21B 1F58L 4U1NB 5KN5B 4GAGL 3CFIC 3OR7B 3O2VL 1NKRA 3U9PL 5EU5B 4UDUB 1NDMB 4GBXA 4M7KL 4Y5YA 2EH7L 4Y4HA 3PIQB 3MCKB 3GSQB 4KI5C 4LCCC 2D0FA 4PRDA 4AEIL 3V8CA 2YK1H 4R2GC 5L0QC 1VFMA 1CWVA 2EYSB 1EHAA 4G9DA 3VXNB 4HEME 1KJ3H 5D7LE 2Y7QB 3F12A 3IJYB 1WICA 4BZ2L 4HUKB 5BMFL 3THML 5SX4H 1RUPH 4HIIB 1DBAL 3MLUH 4X5XB 4M4PA 3G08B 5JW5B 4X99A 1U3HB 1RHHB 2VABB 4FXLA 1YN6B 2XWJB 4P2OD 3PGDA 1IBGH 4Y1AD 5I66B 5GPRA 1LE9B 3E6FB 3ZE0F 3KXFD 4HKZA 2AJVH 1RZKL 3B6SA 3ARGC 5DWUH 1QEWA 1V3MA 2R0WL 4OCSH 4R97B 1H8OA 4OF5A 5I1AB 3LN5B 1NBQA 4P48A 4YWGH 3EUUA 4F58H 3SHSA 4X6DE 3PGCB 1JNHB 5FYJD 4DVBA 4Y19E 1NAKH 3V6BR 3RQ3A 4FQLL 4U7MA 3LPFA 3AM8C 1A02N 4X6BB 4ZNEA 5HI5D 4LSDA 5F8QC 3G6DL 5JW4M 5AAMA 3KLDA 5DLMH 4MA3A 3G5YB 1JK8B 4QHUA 3FTGB 1OWRM 3X12A 4Z0XA 1ZGLP 3MO1B 4N8CH 5FF6A 5KS9F 1U2HA 3UJJH 4OZ4A 3O8XD 4OFDA 2R39A 2FX8H 1KJMB 1YY8A 1HYRC 4P5TA 3MLZL 4CVWA 4HUUB 1JV5B 2CDFB 2YC1A 5CJQH 1JZ7A 4PRHA 4HULB 4TYUA 4YHLH 4WW2C 4IOIA 3I84A 4NQDA 4CL7A 5D9SA 4G42B 5ESQA 4FN0A 4LSQH 3WS6C 4R4BA 1PQZB 3M07A 2XKNA 3Q6GL 4C58B 3ILQD 4URTB 4F9LC 2GFBB 3HE6D 5BVPL 5DQDL 5I8EB 3IXAB 4K3DH 4EDWH 4LQFL 2BC4B 2F8XC 5EU6E 1W0VA 4GO6B 1UM4H 5D8JH 1J5OL 2BCKA 1FN4A 1NCWL 4QTHB 2NLJA 2XQBL 3OAYK 3AM8A 4EDXB 4WFHD 3BGMA 8FABA 2X6MA 3DIFB 4NM8H 3ULVH 3SKJL 3QO0B 3F65A 1XF2B 1XMWA 5C08A 4NZDA 2OL3B 2QQKH 5JO5B 4ZG1A 4RFOH 2IAMD 3FHQA 2GQHA 1GGYA 3OKOA 4OGZA 4PJGA 2JK5B 5IUSA 3SJVB 1J7VR 4ZSOB 1UWEL 4R8WH 1G7JB 1DTUA 5JHLH 2OXGA 1CTNA 1S7VB 2UZXB 2WINB 4OZHE 4G6KL 2DQJH 1I85C 4O00A 5T3ZH 43C9B 2YSSA 4KROC 2IFFH 2R4RH 1JYNA 3SGJC 5IWLA 4BFIB 1CZ8H 4F15B 2HJFA 1I1FB 4J4PD 5IEKB 1ND0B 1YC8A 3KXFE 1Z5LA 1LK3H 4UV4H 4YO0B 3VXPB 4M7JL 4CMMB 4ODXB 1AHWB 3O41B 4WU7A 4ZPTB 3OAZK 3VD9A 3WFEH 1EFQA 2YMXL 1AHWC 1ORSA 1T04A 3GI8H 2CLVA 1NLBL 2BSSB 1T2QL 1CFNA 3MODL 4QTIH 4TNVF 5D70L 3GZKA 1UWXK 1H5BC 1EZVX 4Z6AT 4YBHA 4QRTB 4Q9RL 4M00A 1S9XB 1UJ3B 3WD5L 4LSSL 3K81A 5CP3H 2AJXH 2FLBT 3QIUC 2R0ZL 3IFOA 3K74B 3VRLF 1ES0B 3HG1B 5EC1B 3G6JF 2HFEA 3PHQB 1P7HL 4WI4A 2P45B 4PS4H 3LKQB 1DN0A 1FFQA 4W4NA 5GRJH 1MVUB 1NFDB 1Q9WB 5ICXB 4X6FA 5T3XD 5C0IA 1CFVL 1FE8L 1NDMA 1QVOA 4GBXB 3ROOB 4N0YL 2H26B 5LWYH 2Q1EA 2J88H 2DIBA 4MXWL 1T7YA 3DGCR 3SGJA 1LDPH 2HFTA 1CGUA 1XCTB 3BRDA 3G04B 4RGMB 1DVFC 4PIRF 4HUXA 3TYFA 1IC4H 2BNUB 2P8LA 3T0AA 1CE6A 3TWCH 2BJML 3W0WD 4ODHL 3LD8B 4UB0H 4V1DE 1AE6L 1EXUB 3LEYL 5C0RH 3MBEA 4Z77B 1QRNB 4HV8B 4OKDA 5ANMA 1PG7L 4ZUTA 2CIIB 4KTDH 5CD3B 3QUYB 3BEVB 2JJSC 2VJXA 5D6DC 5A2IH 4R9HA 2F54A 2A73A 3IETA 3C08H 2AP2A 2YPLD 4L4VD 1HILA 4QCIA 3KYKH 3S36L 4MD4A 1HE7A 1SJHA 3UP1A 4DFHA 1RVFL 3U83A 5D7IA 3O3AA 4I3RH 4OKVA 3LKNA 1X4XA 3MRPB 4UNTA 1ULVA 3ZE1F 3NZHL 3VDBA 1NCAL 3TLRA 2VDRH 5TDNB 2VE6B 3F5WA 2P4AB 4G9FD 2AK4D 4MMXC 4MAYC 4FXKB 4WUUA 3UTPE 5GHWH 3TGXA 2B7DT 3VE0B 1T7ZA 4W70A 3W81A 3LRHA 3VDAA 4YHLL 4ZUWA 1HHHA 2RBLA 4PRNA 5C92A 4LCCB 3MC0A 3IDXH 4F7PA 1ZWIA 1AR1D 1QZ1A 1HH9B 2VZTA 5EDXA 1JPTL 4H1LA 1OCWL 3BN3B 3GMQB 5E7BA 4M7ZB 4L3CA 3W0WA 3NFSL 3LEVL 3OAYH 3RWHA 2MQCA 5DRXB 3P0VL 1DDHB 1LO5A 4DEPC 3MACH 1I9RH 4K3HA 2ZUSA 1A7OH 5IB1B 3HZVA 2IMMA 3QUZA 1Q0XL 2X4TB 3AY4A 1PY9A 1KB9J 4HJGA 4DZBB 1UJ3A 3JTSA 2NZ9D 1IAMA 2Y36H 5ALBL 2R2BA 3AGVA 4GG6B 4U4BA 1A7OL 2VLRD 5DFVD 3JUYA 5AZ2H 4NN6C 1MF2H 3ZKMC 4G8GB 3IFLH 2FEDC 3BXNB 4I0PC 3B43A 5CEZD 4QYOA 3TBWB 4ZXBD 4HQQH 1TTUA 1T83A 1HN1A 2E9JA 2QHRH 1BOYA 5KSUB 4LSTL 2ADFH 1QSVA 2XYCA 3MV8D 1U36A 4PP1C 5EBGA 1P6AB 5GZND 1JPFA 2V7HB 5GRUH 1GGTA 4YDKH 1ED3A 3A6BL 5ELIA 4UT9L 4ZOCA 3HLAB 4KK6D 3WN5C 2Z35A 3TZVC 4HIHB 4KGJA 3MYJA 3IFNL 5EO9B 5CEXB 1OAQL 1UCBL 5IF0B 4PJGE 2HFFA 2X10A 4BH8A 3RWGA 1QA9B 1F2QA 3EFFB 3RNQB 4FRWA 5FUZH 4JFEB 3EKCA 3K2UL 2X4PA 4AQOA 4ZUWB 4N5ED 5CZVL 3ARBB 4L4VE 3CMOL 5C07A 3LQAC 4ZFZB 4JHAL 3IDGA 4KRLB 3ARBC 3ARFB 1EJOL 3B5HA 1IL1A 1A4JB 1QLFB 4PGEB 1T22A 3LKOB 1RZKC 1S7SB 4AT6A 3EO0A 3D25A 2SEBB 4TSAH 4KUZL 5DRWA 2E7MA 2IALA 5ITBL 5DXWA 5I71B 2DLFH 4KDTA 3SKUD 2HLFC 1JGVL 3LQMA 4NZRH 1ZANH 4JGUA 4CN4A 3QQ4B 1MRCH 5ETUB 5IB2A 4WI3A 3BEWB 3MNVB 1B88A 3RTQC 5E1HB 5I1JL 5DK0B 5ITBH 3GIZH 4NQVB 4NZTH 4F9PA 1CICA 4LCWE 2NXYD 4IRSD 4H1LG 4NZRL 4YHPB 4G6ML 3IDGB 1LO2H 3QCVH 4RGNC 1GH7A 1UT9A 5C07B 5BQ7B 3KDMA 2ICES 3W5NA 2FEDD 4G6MH 4PRHB 4JRYB 2F53B 4GMSH 4Q9QL 2DBLL 4Y4KA 3GO1H 3QUML 1PKOA 3D3VD 1DLHB 3RRQA 4NRZA 4YEFA 4GOSA 4LSVH 3MRHA 4P49A 1LD9B 5EIVA 5I16A 2NXZC 1WBYA 4QHKI 1RZFL 5F7DA 5CJXC 4U05A 1X7QB 3OAZH 3RTQB 3K1DA 1RZ7L 1IEAA 4DKEL 3PE9A 2QKIA 1TMCB 3TWCL 1N0XH 4PYHA 3O2DL 3C2SA 3HB3D 4NFCA 4JJ5B 3EYQC 5HVHB 3G5YA 3INUL 3VMOA 2FGWL 1BFVH 1MJ7H 5HHMB 3GSVB 1A64A 4OD2A 4ZAKD 2A6DA 3T08A 2VLRE 3QXWA 2C26A 4ELMB 4QYOB 2X4RB 3QDJD 5CMAB 4ZAKB 2FYYB 1LO0L 1FDLL 2AEIT 5I1GL 1INDH 1S7RA 1EHLL 1KTKE 2IEPA 1U8JA 2NXZB 5DRWB 3IVKB 5E8EA 4JO4H 1U8PB 3MLVH 4Y16D 4HHAB 1K85A 4CJ1A 4DZ8A 5I1KH 3IDUA 3EYSH 4JPVH 1I8KB 1QBAA 5CKAA 1NSNL 4KAQL 5BOZG 3PHQA 3P40A 5DVMA 1QSEB 2VXSH 4OJFL 5E5MB 1BQHG 2DLIA 5BZWB 1PZUB 3HNSL 4LOUC 5DJCA 4GS7B 4YHZH 4YX2L 3VA6A 3FRPA 4OCYH 4K71B 1IZJA 5GGTL 1NCWH 1FZKA 1BIHA 3DPBA 3CVHB 1LP9B 1NBYA 5I74C 3VXPA 4CMMA 4YBQC 4OBRA 3HUJB 3UJIH 3SKJH 5CINL 4DZ8B 2VAAB 3T1FB 4GG6E 5D7KD 2APTA 3QR2A 1JGDA 3NFPB 2YD9A 5D6DA 1QR1A 1FVDB 4MDJA 1CL7H 3KPRE 2HWZL 3FMGL 5DMGC 1QBBA 1IM9A 2DTSA 3IU4H 1YEJH 3IDIA 2BVPA 4M7LH 1NC2B 1OGTB 4FQIL 4FMKA 2VXTH 1GGIH 4LVHB 3E0GA 5HJ3A 5ADOH 1RJYB 4M4RA 5HDOA 4XMPH 1NBZB 4ZFFA 3UTQA 4NQEA 2FJGA 2OTWB 5ILTL 3B4NA 2HMID 3S3PA 1XF2A 4RFEB 3MXWL 3QULA 3ILPB 1MREL 4LLDB 2BMKB 3BGMB 3UYPA 1ADQL 2VXVL 2BZDA 5GGSA 4QRSB 5I71C 2FECL 3FZUD 3NZ8B 1OL0A 1MRCL 1PJ9A 4PLOB 4DGYL 1B4JL 1JTOA 3OR6A 3Q3GA 2WLYA 4FQCL 2NY6C 4HJ0D 3OKNA 1TETH 32C2B 1DUZA 1E4WH 1U92B 5C0NC 2R4SL 3GB7B 5BV7B 3T04D 1EJOH 1V3LA 1I7UA 4GBXD 5E0QA 1MAKA 4JHWL 3HMXL 4NQVA 5IVXA 1ZHLA 4X80L 1X5ZA 1EUTA 5CZVH 5LAXB 4DK3A 1YY9D 4X8JA 3T1FA 3GMOB 1MVFA 1BFOA 4JGMA 4P4KD 1T0NA 5F7FA 4S1DC 3BZFA 1A7PL 3IS0X 3ULUH 2B4CH 1MRFH 4O4YH 4FFZL 2R23B 3S7GA 1G7QB 3QEHB 5E5RB 4D9RD 4MD4B 4Q58C 1XIWC 2EO9A 2GK2A 5CBEA 2VC2L 4HGKC 5GS0L 3MLXL 5FA4B 1KUMA 3LHPH 2A74B 4N90E 2X4QB 5A43C 4XMLH 3ARYA 4L8SC 4XCFL 1L7IL 4UU9A 1H8SA 2YA2A 2FZ3B 1DUYA 5DEGB 3U9UB 2YPLB 1RIHH 1ZS8B 4MCYB 4L4TA 3CFCL 2BNQD 1UZ6E 4PJ7B 4CN1A 2IAMC 3RDTA 4UTBL 1UWGH 1JBJA 3KHQA 3LN5A 5I1AA 4TNVK 4IIQA 1NCAH 1FNGB 4PP2A 3VXQB 1OAXL 5C0ND 4Q9BA 3BYYA 2R8SH 4RBPH 3ZTNL 3E3QE 1YEEL 3VXOA 5L2KD 2O5ZL 3FQWA 4N0FA 4PRID 4LCUB 3MRRA 4PGBA 4WNQA 3MA9L 1MCHA 3O4OC 3P0YL 3U0TA 1S9WA 2XICA 1P7QA 2JELL 4XVUD 1AGFA 4HS8L 2DQCH 1BZ7B 2F19L 3U7WH 1DSFH 1J0JA 1U3HD 5JO5A 5AD0A 3O4LD 4U1HA 2EO1A 5J1AA 1UWEH 5J57B 3W9EA 4XWGH 1K8DA 2ESVD 3QPQD 4G3YH 2X05A 5EU5A 2EEAA 2XXMB 4YBLC 5EU6B 1T20B 5T5FL 1K8IA 3ZYJA 4AENA 4NO2A 4PJ5E 3PQYA 3I6GA 5EO0A 4G3YL 3EYVA 4HFWA 1P7KA 4DK6A 3VWKC 1J5OH 1PEZA 5I8EA 4JRYE 1CG9B 5DK0A 3QWOB 1W72H 4KK6C 1FAIH 1N0LA 5DJ8A 3BUTA 5IB2B 3RDTD 5KN5A 3CUPA 1MFBL 3U7AA 3CC5A 1FGVH 1CDCA 2D7NA 2DQUL 4Q6IC 1A1MA 4OV6F 2IANE 5KJRL 4R7DA 2FNBA 3L9RB 2DLEA 4KQ3L 4LNVA 1OAZH 4K8RC 4PGEA 4K8RL 3BX7C 1EAPA 2C1OA 1WVZA 4WW2B 5IEHA 4UILL 5DYOB 3ULVL 2VL5B 2RR3A 1MNUH 4PRBB 5L2JA 5KAQG 3E2HC 3WD5H 1WQVT 5B39A 2CO6B 1P53A 4UZGA 1HHGA 4KKNA 3RI5K 2XRAL 4OLZH 1N26A 5KSVA 4YHNA 1CD9B 4K3DL 4EDWL 4XNYL 3CFDB 5AZEL 5BV7C 1CGSL 2A6IB 4X5WA 3IAQA 2Q6WB 1FJ1A 3MYJB 4X6DB 4I4WB 2CIIA 4DN4H 5C6PB 1UZ6F 3QPQC 4MA1B 3BQUA 3AB0B 4U1HB 1CD1A 5E8PA 2CPCA 2DYPB 3VFMA 4J3VA 4R2GB 5L0QB 3SDAC 5IK3A 3IXTA 1M71B 1V7ML 1OW0C 1A4KA 2QR0A 3UBXA 2AJZA 4U1SA 1IVLA 2Q8BL 1MUJA 1D6VH 3LHPL 4LCYA 1YN6A 3HC3H 4Y4HC 1OAYL 1I1YA 4PJ7F 1HWGB 3KPNA 4X7DC 4X99B 4ZDHB 3SQBA 1CXHA 4KKBC 3RKDC 1C8PA 4G42A 5K59F 2ZSWB 1CXEA 4J12A 3NTCH 3NCEB 3NCJH 4Z7UE 1AD0B 3G5VB 4NO0D 3I3EA 3LRSA 4OZFA 4QRRE 2C1PB 2F54E 5CUSL 4BFEA 3O6MH 5DS8B 4MQSB 1KJMA 1YY8B 4GQ9H 4Z8FL 4L5FH 5F6IB 5FCUL 4YHMH 1GGBH 3MV01 5I9QC 5INCA 2FO4A 1XF3B 1MLBA 2DM7A 3L3HA 5D7JC 4Q97A 4N8VA 4N8PA 3NGBC 5F7WC 1GVIA 3KLSA 2EH8H 4JFDD 2E9WA 3ZKXB 5HPOA 3ZMRA 1YMHA 4GRWE 2CLZA 3D3VA 1I8IB 1B0GB 2H3NA 3BIBX 3DV6A 5D1QB 2J8UE 4RNRA 5T3XE 5K9QG 3QJFB 4OZFG 4G9FA 4OD1H 2CIKA 1PG7H 1BOGA 1U58B 1JUFA 1OARL 5KVFH 4KFZC 5D7LB 2K1MA 5IFHH 1N3NA 4P4KC 2W38A 1I1FA 3A0OA 4XVTH 1N7ML 4DKDC 2M8XA 3WUWG 1IEAB 4LVHC 3MLPA 1JHTB 5F9AC 1QO3B 4LBEA 5FYKH 1DUYB 4QRPE 1MSPA 4MJ4A 3F7VA 4WTXA 1FFPA 1G9NC 4HS6A 5F44A 4XCYB 3MUY1 3L3DA 3QHZL 5CIPH 3SCMD 2IMNA 4OCWL 4KVNH 3PF2A 4WWKD 4Z7UA 5TQ0L 4JRYA 3RX7A 1DUZB 1YEFL 5HHQB 4H8WC 1I1RA 2AV1A 4R3SA 3Q3GB 2AXGB 4O02H 4QRQA 5BRZA 4JO3H 5TE4H 5KSAA 5F7YC 3KPSB 1A7RL 1AC6A 3OZ9H 2UWEE 4AIZB 2DJUA 3FT2A 2WWMC 1QQDB 2WW8A 8FABB 4JFED 1WZLA 3PG2A 3NA4A 1TLKA 2AJSH 3SO3B 5LAXA 5IFJA 3WLWC 4ODWA 5ADOL 1ZHLB 2EKSA 1RUAH 1GGCH 4ZFFB 3JXAA 5I1DB 3SE3A 4P2RD 1OLZA 4APQB 3LEXA 1KLFA 3BRGC 2NW2A 3MV8E 1FORL 1LO3H 2VOTA 3BISA 4S2SA 4Z7WB 3EFDL 3RVWC 5LGHL 2E6JA 3O81A 3OXSA 1QVOB 5DMYA 2IFGA 1U93B 3OKNB 1CVSC 3K8KA 4M1CD 4U49A 1FIEA 1D6EB 1NCDL 1DVFD 1NCUA 1T4KB 4JFZH 1ZLUH 2BVYA 3TJEH 5CHNA 4GUPA 1ACYL 3B3IA 1FAIL 4TULL 2VYRE 1U8QA 3UJIL 4WEBL 1IEBA 3STLA 5F1IA 4GH7B 3T77A 2GTWA 2Z92A 1I1AC 4NQEB 3MJGX 3EDJA 4BYHA 4ODUA 2A0LC 3IYLW 3MGAA 5D1ZD 2OMBA 5IW6A 4PRPE 1ZHKA 1T04B 2V7HA 3U36B 2O5YL 1GOGA 5ADPH 1J86A 1X6LA 1IKFH 5T1LB 1U41A 3J7HA 4HBCL 4NKOB 4YPGB 3UMTA 2XZCH 3PWUB 1KPUB 2IQ9L 4OF3A 5D1XA 5F9OL 3ZYZA 1J1OH 4YDIL 2BSRA 1NMCB 1HSAA 3HC4L 4C83B 5HGGS 1RURH 4G8FB 5DJ0A 4P57B 1X5XA 4EOWH 4J3XA 2D3VA 4CVZA 4DOHB 4HG4J 4HPOH 1I1CA 4N8VG 4AL8H 1EZVY 1LGVA 2CIKB 3PWNB 1ZHNA 5E2JA 4Z7OF 3QAZC 2B1HH 1HQ4A 4EBQH 2P5ED 3MMEB 2QQNL 4UNVA 5SX5H 1OPGL 3L5JA 3DXAA 3QAZB 4HCRL 1DFBH 5BXFB 1KCRL 4NZUH 4P23A 4CMHC 5HGBB 3GIVA 1J1PL 5HYSB 4XTRC 1JE6A 4OCRL 3X13B 4XMLL 4LGRB 4Z76A 2NY2D 3UTZA 3H7LA 4Y4FB 1T66C 1P4BH 3QEHA 2ORBL 1F3DH 2UZYB 3O3BA 2IANB 2OTUB 4LCWB 3ULVD 3BZFB 4UT7L 3C87A 4KJPD 1IQWH 2ATKA 4XVTL 3TZVA 4HUWB 4O5LH 1NUGA 1ZLSL 2C5DC 5JIHA 1KJ2L 1OTTD 4POZD 3ULUD 2DQIH 3HZMB 4QTHA 5BQ7A 1GAFL 4NPYB 1N8ZA 4PFEA 1CXKA 4L8BA 4QEGA 1MWAH 2XTJB 5C0CB 3CFJA 2BNQA 4MWFA 1HILB 1VADA 1T1YB 4RISH 1CBVH 3F7PC 4V2BA 3DMMD 4BZYA 4NQCE 3FFCB 4U33A 5SWSB 3UBXB 4TSAL 4AENB 4LPTA 3BUYB 1AO7A 1DJSA 5FYKL 4EVNA 4LRIA 5GGRA 2A77H 4X83A 1M7DA 2VWEC 4AJ0A 4JM2C 2OZ4A 4CADA 5A2JH 1VESA 4DN3H 1FNFA 1D5BB 1RFDH 2ZG2A 3V0AC 3QNXB 3P3YA 3BKYL 4JFXA 5AUMB 4E41E 1JGEB 3TNMB 2X4PB 3VWJA 5DEFB 1S78C 4EIGB 1KB5A 3V0WH 2AI0H 4YE4H 3O4LA 5GS1B 4J4PA 3DRQA 4KROD 1I7TA 4PRBA 1AXTL 1T1XB 3TFKD 2OR8A 1MELA 1CR9H 1S5IL 4N0UE 4U3HA 3QFJE 4MNHA 5C09B 3MV7A 1B6UA 1YEIH 4PGCA 5DD3L 3CX5K 4Y2OA 4PJIB 3U2SB 2HG5B 4X6CF 3LIZH 5FEBA 2H1PL 3ULVC 3PGDB 4YPGA 2DM2A 2F5AH 3ET9F 3OL2A 4PP1D 5L9DL 3HHRB 5JXAL 5F9WB 4M93B 2RFXA 1ES0A 3NPZB 4NN6B 3TBWA 5C3LD 4JY6A 3D0VA 5EOCH 1HHIA 4WTZA 1F3RB 3OKLA 5EZJA 4ODUB 3VFPB 3S96A 1VHPA 3EOYG 3KPOB 1F8TH 2MQ3A 5H35B 3V6ZA 1OAKL 3STZB 3UYOD 3QNYA 4JFQB 5T1KB 3L5XL 4J3SA 4KV5F 1T20A 1B0RB 3LVEA 4DUXA 5KS9B 1I3GL 1MNUL 2D9CA 5JZ7C 3AMLA 3HC0A 1X9QA 4JO1H 1KCLA 5FM4A 5I76A 2JJUA 1JFQH 3QZWB 5IVOA 5HY9A 1QLEH 5JHLL 4XAWL 4U1NA 5FOBA 4YC2B 4YHYB 4XNZC 2PYEA 4PJ8A 4YNYA 4NQSB 4OD2B 4NZUL 1KIQA 1EFXD 3SDCC 1PSKL 1XFPA 5C8JB 2XWBA 5DUMH 1P2CA 4D9QD 2BY3A 1IM3B 5A16A 4GJTB 5AZEH 3LS5H 2DLHA 4M7KH 1JNNH 2Z93A 3T2NH 5F1OB 2XFXA 3LKPA 4Z0BH 2AQ3A 5TF0A 4K8RH 2E6PA 2ZCKL 3GHEH 3QEQE 2VDOL 3VXSE 5CCKL 4FQHB 4Z7QF 3T0EE 3PHOA 2OTUA 5KJRH 1K2DA 5CEZE 4OCXH 1K5NA 3PL6C 3VFNB 2CH8A 3ZHLA 3L3IA 3T09A 4GKSA 2CLRB 4BSVA 5SWZB 1ZGLB 2CD0A 3MUGB 3K4DA 1KTDA 2E27H 1QTYT 4GXVH 3L3GB 4E41D 1JMXA 3FQTA 3EOAB 3V95A 3VH8B 4PJFB 4HLJA 3L7FA 4V1DB 4Z7NE 5EULV 4NFBA 3QRGH 4PS4L 3GJFB 5TFSL 2O5ZH 1OARH 3BJLA 5I1JH 3CLFH 1T0NB 2GK0B 3FT4A 3DWTA 1CIUA 1NCBH 1I8MB 3KPRB 1CDHA 5DA4A 3MOBH 1OB1A 4P5KB 2WANA 3SKOA 4NWUH 4JO3L 1FL6A 2BFVH 3I6KB 1F6AA 3WXWH 3L3GA 5SWZA 1JF5A 2V7NB 3ROOA 1QA9A 1I8LC 1Z3GL 4OLYH 3L5IA 5K9OB 2HFGL 1ZHKB 5INCB 4NO5B 1L7IH 2D31A 5E1AA 1B2WL 5FAAA 4XNZB 4NNXA 4PJXE 2GJJA 5KSBE 5DS8A 3WL9B 1JWUB 2Z0BA 3S37X 2UVFA 2OLDA 1IGYB 1PKQE 1BJ1J 1JYVA 1T3FA 4QXWA 25C8L 3ILPA 4QRPD 3GK8L 5IFHL 3NABH 3EJZC 3HMXA 1T0PB 3VDCA 1OAXH 5BVJB 5FYJL 1R3JA 2E7BA 4XPGH 2AKRB 3U4EA 1YDPB 4HS3B 2NY4D 4J3WA 2E7LC 1S8DB 2KUTA 4JAMB 1NC2A 3QHZH 3S6CA 1W2KT 1DBBH 1U3HA 3QFJB 4BZ1H 4YHKL 3RGVD 4X6FB 3L3JB 5IVNA 1A1NA 5IK3B 4LFHD 5GRWA 2I9LB 2AEQH 2EIZB 1D9KA 5K93A 2E8YA 4DWHA 1NEUA 1U95A 3HR6A 2AI0L 4WFFD 2V9RA 5DVKA 4MA7H 1JI2A 1WAAA 3C6LB 4KC3B 1CQKA 4BSWB 2EYRB 1KG0B 3PQYD 1UJ3C 2GW5A 1LD9A 3WHE1 3W11D 4CW1B 5A3IC 3U0PA 4MNQE 3B9KA 1DL7H 3F62A 2RCSL 1WIPA 1WZKA 3LKSB 4ODVH 2UY6A 5KVEH 3MLTA 1IAIM 1MI5B 3DO7A 1XGYL 1YJDH 3CX5J 1RJZA 4PJAA 3CD4A 4ZSOA 3EOTL 1Q9KB 1HNFA 1JCKA 2VIRA 5EFIA 3DETD 3RVTC 4PV8B 4HAGA 4NM8L 3VW3L 1TENA 4PR5B 3CSPA 4JZNA 4KKAD 1CL7L 1UM4L 1X5HA 2M1KA 3CU1A 3BKMH 4BSWA 2LU4A 3V5DA 4XAKD 3K4ZA 3WFCH 4FTVD 3RFZC 2NYYC 4B5EA 1U8MA 1EA9C 2CXGA 2IH1B 2FIRT 2QADD 1H3GA 4QCIB 1I7TB 3RKPA 4H26B 3QUMA 2B20A 2HT2C 3BE1L 1WEJL 4N1HB 4MS8C 5CGMA 4L3EA 1F11B 1PQZA 1J8KA 4R96B 3OJDB 2QADB 4WWID 3PDOA 4RAUA 4ESKA 4OI8A 2NY5L 2OSLB 4I0CC 4C59B 2BNRB 3RHWF 2P24B 3GSNB 1QKZL 2XN9D 4I9WD 4EOWL 4NQUA 5J9PA 2NW3A 1H3WM 4A2MA 1N64L 2DQFA 1NMAL 3HPJB 1MLBB 5JOPE 2BRRH 2MWCA 2CRZA 2B1AH 3DYPA 3LN9A 2X1XR 5HI3C 4LSPL 3CPLA 3NFNB 1MFAL 1AGEB 3V7AG 4EI5B 2EEDA 4JPKL 1FL3B 1XCTA 4GW4B 1DQLH 3ZKSD 5HDQL 3BAEH 3RDTC 2PTUA 3H9SB 4OCRH 4MA3B 5IW3A 2P24A 2VDOH 1P1ZA 3NTCL 1TVHA 4G80A 5ISZD 5FYKE 4ZDHA 4JANB 4QF1A 2ZUWA 3OJDA 2YHGA 5LCVH 3TIDB 1JZ6A 3D39B 2QSVA 3DMMC 4G8GA 4U1KB 1FGNH 3BHBA 4XP5H 3OKMA 4Y8AA 4WEMB 3UPRB 5EORL 4YLQT 1UC6A 3ETBF 5SWSE 3S36X 3H6JA 2R2HB 3SCMA 1T7WA 3QQ3A 1Z9OA 4M7JH 4NSKB 3NIFE 1WWBX 1HHKB 2SEBA 4XXDA 4MNGB 1X5GA 3QFJD 3C8KB 4L3ED 3RWCB 1V5JA 5DHXB 5C9JA 4HWBL 4G5ZH 4JKLA 4L4JA 2GITA 5I73B 2OR9L 5FUCE 5E6IC 4UIMB 2CLVB 1LK2B 5CGYC 4HDIA 2IBZX 5KW9L 3CFDA 3ZDZF 4K55A 3IJYA 1MCKA 3O3EA 5DHVA 4I0PA 2YRPA 1UCTA 5LQBH 1CLCA 1OY3B 2A83B 1L9MA 5IF0A 4Y5XB 4YXKH 2NMSA 1QRND 1YEEH 1KIUA 5C07D 1BVKB 1JPGB 3E8UH 5C0JA 1HXMA 2D7TL 3RBGA 3DXAE 2EDLA 4FMFA 2CR6A 3O2DH 5BS0A 5EOCL 3FB7B 1FL5A 5IMMB 4GKOA 3KLAB 4M3KB 1NAMB 1CXIA 4JFZL 1EX0A 2H8PA 3TH2T 3LB6C 4HJJH 1WBXA 2DLFL 4JRWA 5DDHB 5J12B 5E6IB 2HTLC 4PLKD 5LG1A 3GUTA 3TV3L 3T2PA 4X98A 1Z9LA 4KXZI 4HT1L 3UTSE 2IPTL 1QACA 2I5YL 2W9EL 1KENL 1MHHB 3SKNA 1PG7W 1NGWA 3MV7D 1XH3B 5DJDA 5CBAB 1QFUL 4ONGL 4OLVH 1GIGL 1H15A 2IG2L 2X4TA 4Y4HB 2AQ2A 2VQ1A 2AJ3B 4P2RA 3MPCA 5DD6A 4M61B 1WFOA 5DUML 1KGCD 3P4NA 1YY9C 4QT5B 4FOMA 4LEXH 3QH3A 1NGZB 5E24E 5DLML 2LV4A 4KJQD 1FQ9C 2ENSA 1SY6H 5I1EL 4HXBL 4S1RH 1CYGA 2X4SA 3J8F7 3BW9B 5TE7L 3SDYH 4MXQC 3CFBB 5E8NB 2Z31C 4ZO6A 3NACL 4PJDF 5MEOA 5HVGB 4NQDB 2WBJD 2CUIA 1FFNA 2H2PC 5HPMB 3C8HA 2NTFB 1T03L 5C0DA 3RWIA 5GGUA 1ZMYA 5EN2A 3QDJA 5LKNA 1VGKB 2Y36L 5ALBH 4X9IA 1G6RL 1MVUA 5D1ZA 1ZT4B 3VXSD 1UB6B 3PHSA 2HT3D 2GJZA 3QNZB 4LSQL 4FP8H 4TNWF 1FSKC 4HAFA 3VGFA 2Q86A 4X6EA 1PLGL 3VFWB 3L7FB 1CFQA 2B39A 4HC1A 4HKJA 3RZCB 3GDBA 2R2EA 5HHQA 1OCWH 3EYSL 1LEKB 2Z91A 1JPSL 1EO8L 3TN0B 3AB0C 4D9QE 5L88H 1YEHH 2QHRL 3RWJA 4NNPL 1BGXH 3D18B 4ZFOL 4MYWB 5D1ZB 1K5NB 4Z77A 4LLAA 1JP5A 2BFVL 3IDYB 4ZUTB 4FFYH 4LHUB 1ZTXL 1A7PH 2R0LH 3IGAA 4ELME 3AU1B 4Z7VA 5H8DA 4HKXB 3GGWA 3MACL 5JMRA 5FDWA 3CJJA 2MQ0A 3FB8B 1E6JH 1BPVA 4LSUH 1I8IA 1JF6A 3VA2C 5D2NE 2ZOKB 4X80H 5LXGH 2MKLC 2YWZA 5C8JA 1A7QL 2BSTB 1SVCP 2HJLA 4IOSD 3DHMA 3CSGA 5IB4B 5I1HL 1G7IB 1DEEA 2C3XA 2V5MA 1JRHH 4JDZB 4PTTB 1XF5B 3ZKXC 5J11B 2WSKA 1AO7E 1YNLL 2LFGA 3ARDC 3C6LC 3GJFH 3QI9D 3FT3A 1YEDB 5HGAA 1XAUA 3WDIA 3HG1A 5EC1A 5ISZB 1LO4H 4PV8A 4QOKB 4NZTL 2XZQH 3QO0A 5IESL 1YA5A 4PB0H 3SKMB 4WRLA 3NA9L 5EU4A 1I3RB 2WBJB 1MH5B 4P4KB 1KCRH 4XB8A 1YJDC 2A9ML 4I5BA 4JKMA 5D7JA 1MUJB 3WHXB 4PV9B 4DGVH 4JFYB 1KBGL 3KPPA 3CCHB 4JPVL 2AXJA 3MV9A 5IIEA 4XC1H 1AGBB 1X44A 3LRGA 4N0UA 5HY9B 3ELAT 2RCSH 4GRLB 5C0FA 1N59A 3OV6A 4KJQC 1GZPA 3GMNA 1EGJA 5E00B 2ZSVA 5HDBF 5IEKA 1DBML 4UB0L 2DQHL 1HOCB 1FE8H 5GS2H 4BFIA 2HN7A 3BESR 1KOAA 4GRWB 3LEYH 5C0RL 1XIWB 5GRYA 4U1MA 1NFDE 3TC9A 2PXYD 2HYMA 4P2QB 4IRJD 3NIDF 1LILA 3C60C 4MA1C 4OFIA 3ZE0E 3I3BA 4PGJA 3CVHA 4L29A 1TJHL 4AH2B 3DBXB 4TUOB 5CSZA 5FYLL 3F7YA 4GMTH 4FQ1H 3BP6B 1BFVL 4PRAB 3SJVA 1EERB 4ZFOA 3ZSTA 4PJIF 4LVOB 1HSBB 5KG9A 1P9MC 3D9AH 2VKXA 3FO2A 1SJEB 2VL5A 5LGKA 2ADGB 2HTLD 4JR9L 4PLKC 4JB9L 3IFLL 1KCKA 3D69B 2HTKC 4U1KA 3LMJL 1L6ZA 2OL3H 1DSFL 1A0QL 2LU3A 2WUCH 1O5DT 3VI4F 5JORA 3FONB 5DD3H 5EBWA 4FQXB 4FTVE 1PG7X 4TRPL 3H3PH 3T65A 1QKZH 4QKXB 2ESVA 4YJZL 5FM5M 5T1MB 4X5LA 3BD3A 1A3LL 1E4XL 1GRWA 4U6VL 3DX9B 3FQXA 1OAKH 2FYYA 2CUHA 3HZYA 2DQEL 4JZJC 1U42A 1I9RL 5KANG 5ENWB 3LSOA 1OGAE 2G9HB 4RMUA 2A6DB 1AXSA 1JN6A 3QIUB 3REWA 2OX5A 3EYVB 3UTSA 3NAAL 4ORZC 1R3LB 4NPYA 3L95B 3QPXL 4NHUA 4LKXA 1KF9B 1Y6KR 4ZS6D 3HFMH 4RAHA 2Y7QA 5E6ID 3D69A 4IMKA 1OF2A 3P11L 2EYSA 3RTQA 2EXWC 3LIZL 3C5SB 4WUKH 3SE9L 4IRJA 4M9PA 2ATKB 1BZ7A 2F53E 3VFUB 5FXCH 2AEPL 5JXAH 4YXHL 1NGWB 2RQ8A 4MDIB 2LABA 5J9PB 4H25A 3MO1A 2GT9A 4NQCB 3EOTH 4KUCD 3GMLA 4Z76B 1F4WL 2DB8A 3ECBB 3B2VL 3UYRH 2H6PA 3WFBL 5CJ5A 3G9AB 2IJ0C 3S4SG 3MTRA 2XTLA 3VG0H 4EXPX 3AREB 5I8KH 3S34H 4OCXL 1CU4H 3A6BH 3B9EA 3LY6A 1U8MB 4OUUB 3RL2B 5SWZD 1RPQA 3NCYP 1JPGA 1D6VL 5JDSA 4NT6B 3NOIA 3B6SB 3CSYB 3I9GH 1A6VH 3QWOA 4DW2H 3TCLB 5JA9A 4TOYH 1VENA 4OGAC 3GI9H 4UIKL 2H6PB 5HD8D 3O6LL 1NCTA 2VXUL 4K3EH 4HG4K 4NJAH 1HYSD 4L8SB 5EU4B 1GYAA 3MRLA 4TTDC 1NEZB 3T3MF 1YNLH 4JFEA 2XTJD 5C0CD 1VGEH 3RWGB 3TPUA 4GQ9L 4Z8FH 3MR9A 4OZGF 4MAYD 2NY6B 1BZ9B 4MQ7B 1F3JB 4GRLC 1V3KA 3H9HA 2ZOLA 3FQUB 2NQCA 1S5HA 3HAEB 1JRHL 3NCJL 1LEGB 1BD2E 2EZ0D 1ACZA 4WDIA 3H9ZA 4NIKB 5C3TA 3EO9H 4NNPH 1IC7L 1KCVL 5EU3B 3G04A 1DEEB 5J8OA 3FOLA 5AG8A 3VG9B 3D39A 4UT6H 1FIGL 1MFDL 3QXVA 1ZLSH 4PD4J 3T4YB 4XPAL 5FECA 2F74A 3SGDI 1RUPL 3SDAA 4HH9B 5B38G 3HE7A 3BZ4B 5D4QA 1CDIA 4OFVA 2HKHH 5F8RC 5JPMB 1Z3GH 2VUYA 3HAEG 4OLYL 5IW6B 4MJID 4MNHB 1IGYA 4TUKH 1OD7A 2PUQT 1D5ZA 4P9MH 2IWGA 4P46A 1A6TB 3SGKA 4MD0A 4IRZH 3QI9C 2DD8H 4FZEH 2GSIA 3PABA 2X4NB 1IARB 1N5AB 2OS7A 2R0WH 4OCSL 5IB1A 1RU9H 1T5XA 3CXHK 1IMHC 1QYGH 3IKCB 4YWGL 3HPLB 5CBAA 1WWAX 3MGOA 4AEIH 5B38B 4JDTH 3T0WA 3UTQB 3FL7A 1RK1B 5DHVH 1A6ZB 4U6HB 5TE6H 3DRTB 5F70A 4JJHA 2FECI 1Q9LA 4RSVA 2XNAA 4WY7L 1TQBB 1VCAA 4P0DA 2OK0H 1IGMH 3ARFC 4MLIA 4N68A 4P2QA 1INQB 5D5MA 1ADQA 1FFPB 1LO0H 4FZ8L 3C5ZD 2YD6A 2NY4B 3RAJL 2Q76A 4MVBC 3O11A 1QSFD 3B9KD 3L7EA 4E5XA 1MCFA 3KPRA 4TSCH 3DUHA 2ICCA 4UQ3B 2F53D 3HR5B 5FO9A 3WHXA 3AVEA 4JB9H 4XBGB 3VWKA 5I1EH 4G9FB 2JJVA 4YHIB 5J6GB 5HSFA 5F96L 2AJSL 1I9IL 2H9GB 4MQTB 2WBJA 1ZLVK 1GGUA 3GJFK 1EK3A 1MY5A 4P4RA 5EO1B 1OQXA 3DRTA 3VGAC 2VLJB 3FQRA 4LEOA 3OBAA 4IEFB 1YYMH 3TJHD 4LNRB 3BFOA 4M8QA 2HT3C 3IDJA 4OQ1A 1FNEB 2LE9A 3RWCA 4DUWA 1DCLA 2NY1C 4PTUB 1DQQA 3DX6A 1FO0A 3ZL4L 1YEFH 5HI3D 1S78D 2JKXA 1EMTL 5FUOL 2AXHA 2XA3A 5C7XH 4JRXA 1LE5B 3RA7H 5AWNL 1J1XL 4JG1L 3ZL4H 3DECA 5E8DH 5I1HH 1NGYA 2UY7A 1NC4D 3OHXA 4Y1AE 5HI4C 5HYSG 2ZSWA 4HK3N 1GZQA 4KK5C 2GYSA 3IFPB 5D1QC 2P47B 4JJ5A 1JGLL 3KYAA 2DL9A 4XH2A 1ZSDA 5ALCH 5FB8A 1CT8B 4XZUA 5IQ9A 2AV7A 1C5DA 1VEPA 5DD1L 4KHTL 4MDIA 4WWKB 1B6DA 1XF3A 3QXUA 4IOFC 2MCPH 3CLEH 1KJ2B 3VXQA 2DIAA 5KSAC 3DUSB 3PXJA 2BNRD 5I9QB 1BJ8A 3FOMB 1BZ9A 3LPGA 4OCNC 1OP3H 1NANI 3RVXD 4DCQB 1CLYH 3D18A 2PTVA 2P5EA 3GHBL 3IRZA 2R29H 1K4CB 3KPMA 3U48A 1DBJL 1F90L 3WNOA 1OHQA 1DQLL 2NY7L 1OAQH 3LB6D 1DE4B 3IKCA 3KJ6H 4Y4HD 1UVQA 4NO0B 1QHPA 2CGRL 5E70A 3V52L 3QWRD 2GTWB 4FP8L 4JPIA 4PJCB 3GJEA 1G7PB 1J05B 3Q6FB 4NSKA 3VRJA 2R9HD 4NZJA 3MJ8A 1RSFA 3KJ6L 4LMQE 5IMKA 4ISVA 1BZQK 1G9NL 4L4TE 1LE5A 5JW4R 1K9TA 1JHKL 3FRPG 4N9GA 4HKZB 4KWUA 1BFOB 5L88L 2DYPA 3VFMB 3UDWC 2BY2A 1IQDB 3BN9D 3JWDC 2CO7B 4J8RB 3T4AA 4NNYB 1HCFX 3CZFA 1PAMA 5HYJE 1IL1B 5D1XC 4Z7WA 3U79A 3TESA 4BZ2H 1KXQE 4B41A 1MFEL 3WLBB 5IJVA 3PUCA 5F3HA 1QSFB 2NY4C 1JVKA 1K6QL 3O2VH 5TGBA 5EOQH 5EU3A 2DWDB 5D7LD 3WSQH 4H25B 3H9SD 1PY4A 2VQ1B 4ERSL 1T83C 2CKBH 3V6OA 2VDPH 1AXTH 3MLZH 3STBA 2QSCL 4AEHL 1HOCA 4XPHH 4WW2A 3RX8A 3VXRE 5IEHB 3FFCA 1HKLH 5IVXE 2E7HA 1RZGB 4PJ8D 5IGXL 4KJYA 3U4BL 3WFDH 4LLDA 3IDMB 3GNML 4EVNB 3H3PL 4U0RB 5TJWK 3TZVD 3L95A 1T03H 1I1AD 3RNKB 2QV2A 2C7UA 3KPPB 4KQ3H 4PJBE 1IGTB 4M1DL 1KNOB 1S9VB 3P30H 5MP6L 2UUDK 1KCUL 1KB5H 1XGPA 1Q94A 3V4PH 3VWJD 1TPXC 1YYML 5E99H 1V7NH 2YKLL 5DGQA 4N0FB 2VDRL 4S0SD 4MJ5B 3JTSB 4ORGB 1U91B 5IBLD 4MXVF 3EDEA 3SPVB 3V6FA 3KNBA 3LAFA 3QQ9C 4I3RL 2B0SL 3B8YA 1XGUA 3ZKNC 4O51B 3WL9A 4JGJA 3Q6GH 3DVIA 1HNGA 5GGTH 2D7PA 5DRXA 4LKCB 2VZ3A 3FO2B 1CLZH 4E41A 1AFVH 3CZJA 4ZFOB 5ERWA 5EZOH 2IGFH 5HHOB 4LVNB 2O5YH 4UI2A 3TO2A 4CNIB 4HT1H 2BVEA 4Q6IB 4OIAA 2YPVH 1I7ZA 4JY6B 3VFUA 2G60L 2X2YA 4UBDC 1OT2A 1QSEA 4ONGH 2XIDA 2EC9U 3O6FC 2WK2A 4WV1B 3P9LB 5GJTL 3QUXB 4JN1L 2P5EE 3BHBB 5DJ0B 5K9QI 5K9KA 3P73A 1CXLA 3QFDA 5B4MC 1T2XA 1ZHNB 4KKAC 4TULH 1QRNE 4QNPE 1FYTE 4OF0A 3ULUC 1XGQB 2IAND 1RY7B 4RIRA 1FFRA 1XGTB 2W0KA 3D85A 1P1ZB 4F7TA 4PJFA 3O4LB 5GS1A 4GSDH 4LPYA 2YWYA 2ZNXA 3S35X 1FL3A 1IGTA 3WNMA 2XZAL 5GS0D 3F6LA 2CGRH 2R0KH 4F15C 5MEPA 3BT2L 2EDKA 4XBEH 3CX2A 4LSPH 1C1EH 4ETQA 2VXQH 2DN7A 3C2AL 3F12B 4I48B 5BMFH 4M6OH 1FO0L 3TIEB 2VLKB 3MRGA 1HI6A 1CE6B 1CZ8L 1J0HA 4CVXB 5IM7B 4JM2A 2PTTB 3KPQB 2Q6WA 3RVWD 2D7MA 2VXQL 5DURB 3LKPB 5FUZL 3GI8L 1DLHA 3PIQA 4RQQB 5D7JD 5HYEA 4JFHD 3CLEL 4RFEA 1M7IA 1WC7B 5D1QD 4MJIE 2NCMA 1CICC 3OR7A 3VI3E 1KYOJ 3BH8B 3MUJA 4NUJA 2YMXH 1U3ZA 1FFOB 3JVGA 1D6EA 4BFGA 1B4RA 1NLBH 4QTIL 1JHLH 3FB6B 1B90A 4X7SL 5DUBA 3EJZD 2G75A 2WQRA 3JWOH 2H41A 3QUMB 4M93C 3U7YL 4TVPE 4XNXL 1QYGL 4QHMA 1EEUA 2JTDA 3U9PH 1QQDA 5BCAA 2D0GA 3P4MA 3M45A 3ZE2E 5DO2D 3CC5B 4FQQB 4JQVA 4FHBD 2AJ3A 3KS0H 2R4RL 3EGSB 1FG9C 1TCRA 2HKFL 4L8SA 3V7MA 2XZQL 4U0RC 1JNLL 2B8OT 2C3HA 3ULUL 5DJAB 2FJGB 3WEXB 4W4OC 4OCLC 4ENEC 1KLGA 3QJHA 1CFNB 3GHEL 3GMRA 5GGRY 2MHAA 1N4XL 2OR7A 4N90D 1D5IL 1JJUA 2BSSA 3QG7L 4P46D 4WHDA 3QCVL 1RUMH 5FYKD 5CAYB 5IQ7H 4U6XA 4YBLB 3KYNB 3IAPA 1I8KA 3WIHA 1GHFH 1RZ8A 4QRUA 4L5FL 5L8LB 2IBGA 2J8UB 1IC5L 4G6JH 4JFPB 3L1OH 4MNQB 2PXYA 4YAQA 4ZYKA 4TSCL 3DV6B 3ZDXE 3RWDA 2AV7B 2ICWB 4NQTA 1D5MA 2DI7A 1YNKH 4MCZA 2FEEI 4JLRA 4XP4H 3OF6D 1LP9A 2DJSA 4NQSA 4X8XA 4QRPB 5T1LA 7CGTA 3TPKA 3VGHA 5J06A 4KVNL 4GRWF 4HKXA 2V5TA 4MZ3A 3MJ7A 1ZHBA 1MJ8L 2UUDH 2VH5H 4FFWC 1JF1B 4G7VH 1BD2A 2WLZA 1NLDL 2J8UA 2C3WA 3NFSH 4C55A 2V5YA 4Z7NF 1CLOL 2HFEB 4U6XB 5GIRB 3LRSB 3JV0A 4PLJC 4L3EE 3D39E 1QBLL 3WS6A 5CLTA 2CRMA 2PCPA 4WVRA 3X3FH 3TVMD 3MRCA 4TNWK 2GJ6A 5KVEL 5J56B 5GSVB 1JN6B 2N7AA 5E1AB 5EG6C 2IPKA 4YH6A 1T66D 4P9ML 4O2EA 5C0BE 3IJHB 3SDCD 1MF2L 4WU5A 2J4WL 3BMWA 4HKJB 3UTSD 4MNGE 1HQRB 4JN2A 3ARPA 4GAFB 3KDMB 3D0LA 4ZAKC 2EDXA 4K7FA 1QR4A 4LHQB 5E6IA 4AG4L 5JQHC 4S1SL 4Z7VF 4YO0A 4P9HC 5TPWH 4YDVB 5DC0A 1BLNA 3ES6B 4OI9A 5TE7H 3FOLB 2X4UB 4AK1A 4PY7B 4LLWA 5HYQA 2DQD