3TX4A

Crystal structure of mutant (c354a) m. tuberculosis ld-transpeptidase type 2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
285
structure length
267
Chain Sequence
RYTLNATALHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGALNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptidoglycan binding protein
molecule keywords Mycobacterium Tuberculosis LD-transpeptidase type 2
publication title Targeting the Cell Wall of Mycobacterium tuberculosis: Structure and Mechanism of L,D-Transpeptidase 2.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 70
structure length 267
sequence length 285
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 3tx4A02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3tx4A01
4A1JA 4A52A 3TX4A 5DZJA 3VAEA 4QRBA 4HUCA 4K73A 2HKLA 1ZATA 5DUJA 3ZGPA 4JMXA 4QRAA 2MTZA 4LPQA 4HU2A 5LB1A 3TURA 4GSRA 5E5LA 5E1IA 5DZPA 5D7HA 4GSQA 4ZFQA 4JMNA 5DU7A 5E1GA 4Z7AA 5DVPA 3U1PA 3ZG4A 4A1KA 5DCCA 5E51A 5LBGA 3VYNA 5K69A 4LZHA 1Y7MA 5DC2A 4GSUA 3VYOA 4A1IA 4QR7A 3U1QA 4QTFA 3VYPA 4XVOA 3ZQDA
chains in the Genus database with same CATH superfamily
2EDQA 2K6WA 3UADA 3T6WA 4UQ2B 3C6LD 3WKQA 5IHZB 1H3XA 3N1QC 1OGAB 4NJ9H 4XTRD 3FU9A 4GXVH 2VDLL 2N7BA 1MCPL 2AV1B 2IMNA 4NQVA 5C0CA 3D25B 3S4SB 1F3JB 1X9UA 1T89C 2OP4L 1ZGLB 1EX0A 1QOKA 2WIMA 3RY5A 5SWQB 1JYWA 1L9RA 4Y89A 1CD9B 2IV9A 4Z7QE 4UINH 1QR1A 1U4EA 2C1PB 4LVOC 5KBLA 5DRXA 1TZHA 3G5YB 3MXVL 2R29H 1OHQA 2VXSH 2WO4A 2C3GA 3RUGB 3IS0X 1LILA 2GBTA 2WUBL 1TJGH 1P7QB 1Q1PA 1CFNA 3L95B 5J11B 4YHMH 1KBKA 1RK7A 1E0OB 2GG1A 4XNQB 2BSEA 3QUZB 5DHEA 2J20A 3STLB 1FFPB 3NJFA 4HKXA 2YXFA 3FK3A 5IIEA 5LGHL 3F8UB 2BSDA 5H37A 2YPVH 1KYOK 1U92A 3RVTD 1QWUA 2HTKC 3LNDA 2BIOA 2AERT 4I3RH 1LWJA 2D03H 4XO3A 3ZU8A 5I0ZA 2BRRL 2GEEA 3OMIB 5JOFA 2IH3A 1JNHB 1L0QA 4OB5H 4JN2B 2ORBH 1MLBA 1NZRA 2K45A 4QIRA 4U1MB 3SE9H 5I1KH 1KZYA 4NO2A 2X4QA 4DWHA 3DMMD 2YMXL 1A8JH 1FNEB 4OZHE 5KYNA 4Z3EA 5LJYH 2JH2A 1QNZH 1SJHB 4Z5RA 2PR4L 2DH2A 5DYOB 1BVOA 1U8OA 5EIQA 2EVGA 3DARA 3GHEH 3DA0A 3QRFM 4JDTL 3V6ZA 5JHLA 3PFQA 2RFXA 2BCKA 4HCIA 4P4KD 5I73B 3KLDA 1RLWA 1UA3A 1ZT7A 5CZXC 3ZE0B 3GS7A 2Z7YA 1S5HB 1C8QA 4FYRA 1L0XA 3RGVA 3WKMH 4NO0D 2YK1L 4MA1C 2ZCKH 5JA9A 1XXFC 2N1TE 1EIBA 2ZUVA 3BZ4B 2IF7A 2W5PA 5L2KD 4LEBA 1OE3A 3E7JA 3EYUH 4MD4A 4PJ6A 2A1WH 2XRAH 2EH7H 2ZX6A 5GRJH 1XF5A 5TDPA 1W72A 2Q2EB 2YXVA 5KSUB 4BKTC 3FB5B 1XSJA 3IE4A 1BFOB 1ZVSA 1AHWA 3AAZB 2QKSA 1EV2E 2CCLA 3ZE1F 1BVNP 2UWEF 2K78A 3LKNA 2QQNL 2BDNH 1I3GL 4HC1H 4WHDA 2GW5A 2X42A 3MODH 2QVKA 3BLKA 1JGUL 4YZWA 4JM2F 4FQXD 1IBDA 5I66A 5D71L 3TBTA 3UJTH 4K3HA 1BQLH 1PIFA 4KGJA 3HMXA 4UT6L 3SGKA 4Z7NF 4N0CD 1AQDA 1Z1WA 3LKPA 5AEAA 4WV1A 1FL6B 5FF6B 4BFIA 3QEQE 3RPIA 1MRFL 2YKLL 3TJEH 2YD5A 5EG6C 4KHXH 5IEHB 5KZCD 1JXJA 2OR8A 4YIQB 2Y0SA 1J1XH 1MFEL 3E8VA 1ZHKA 1I7UB 2DIEA 4YAQB 3J27A 2D0HA 1KGXA 3HZKA 2V7NB 2VO5A 2X9ZA 2F58H 4FHJA 5CXPA 1S9WA 3KGTA 4GEJA 4HZLA 1HXYA 1K2DA 1FF5A 3WFHB 1MCPH 4WO4C 4HWBL 4MDIB 1NGYA 1CF8L 4ZMWA 4ZNCD 2GFBA 2EVFA 4PRHB 1NCBL 1ULVA 3OGCA 4NQUA 2HVJA 3FSZA 1J11A 3MYZA 3NZSA 3WIAA 3ZKXC 5B39G 4OFVA 1K85A 2CKBB 3CFEB 3MXVH 7PCYA 3HC2A 3TP4A 3M6DA 2XFXB 1XIWD 2ID5A 2E56A 4M1GH 3KVDD 4OCSL 2VDPB 3CSBA 4WI9A 2YMOA 3CMGA 4X7FC 1W91A 4P3WA 1CE1H 2WQXA 3TFKD 1NIDA 4UU9A 2JKTM 2ADJB 1EHLL 1MFCH 5ELIA 4XGZA 5ITBH 1I85C 4UB0H 1TCRA 4AUJA 3P9MA 4L4TD 5AW4B 4NC1E 1BEYL 3WBDA 1XL6A 1IM9A 1MRCH 1T5KA 1RAMA 2OPCA 4OF6A 3S8WA 1U8KA 4LSPL 4UOQA 3UGEA 1OTUD 3AS0A 4Y2DB 2K3TA 1LQBC 1WBYB 4CADB 1F3RB 2FX7L 1U8MB 2ZG1A 2ADYA 3WDIA 3DVGB 4FHBD 1KTLA 4GI9A 2NW2B 4JZJA 3RIFK 4F9LA 1S9YA 2P5ED 2R39A 1CYXA 3LPPA 3QQ9D 1MI5E 1Z9NA 4UUJB 3A0OA 5C7ZA 5INDB 4KPHH 1BGXH 4J8RA 1T1ZA 4RAUA 2CO7A 4AK1A 1YEJL 3F62A 3TCLA 2WWKO 4HIJA 3AG1B 1LEKA 3TNMA 1GKEA 4H0IA 4XCEB 2JJWA 3DX8B 4K73A 2PPCA 5FW7A 1UFUA 4ZDHB 5IVXF 5A6IA 4HX1B 4XVUC 4PW9A 5B1KA 1E5AA 1ZPUA 3C6EA 5F6IB 3P4OB 3E6FB 3S5LA 3KWTA 3CFKA 4AVJA 4ANKA 2CAKA 5EUOE 3CDGA 1NCTA 1U3HD 1OE2A 2KDGA 4HKJA 4PJ7F 5I1LB 2FO1A 4AEHH 1TFPA 4LFHG 1O7VA 6TAAA 4GRWE 5E94B 3T3MB 1WT5C 5D9SB 2XZAH 1I3GH 3TXAA 5LKNA 3EOYG 4S1QL 1P4UA 5AW0B 5BRQA 3QYMA 4JFDA 2V17H 1NMCC 1WBZB 4PYGA 1JGUH 2EEBA 2Y72A 3RILA 4ZX6A 3BVTA 4HS6A 2K70A 5IKCB 1DHKA 5LB1A 2WB7A 1U2HA 1N2RA 2RJMA 4Y16C 3GMRA 3GDCA 1MELA 1QKZL 3I9PA 4OD2B 5E03A 4F8PA 1G5AA 2HLFC 1MRFH 1C5CL 1HESA 2YKLH 1E5CA 4XNDA 2G5BB 2IQAA 1MFEH 2OYMA 3O45B 3SCMC 2QLYA 2DICA 3VRIB 1YYLL 2YSTA 5E5MB 3BVVA 3V4LA 3NFNA 4CN1A 2HXAA 4DZ8B 1AD9B 4AT6B 3Q5OA 5LN8A 1PZUB 2FUTA 1CF8H 4GKOA 4ORGA 3QYNA 4FI7A 1NKRA 2HKLA 4XPTH 3OV6A 2W60A 2ZP0T 1AGEB 5DUPL 4PCKA 5DQJA 4KI5C 5GGVY 4ZXBC 4D9QD 3H9HB 3RDTA 3V5KA 4CDHA 1GTFA 1T6VN 3I9AA 4UT9L 3RE0A 3RZCC 2H8PB 3D1MC 4GBXD 4EUPH 3ME0A 2FQDA 5CP7B 5DC4B 3KBFA 1QW8A 2P5WE 3VNYA 3PWPA 1KV7A 2CXKA 2X7LB 4DP4X 3BO8B 5CMAA 5AOJA 1K5NB 3NCJH 2V8MA 5C0NC 3HI6H 4Y1TA 1XH2A 1W9XA 5ANHA 4MA8H 1F42A 1LO2H 2VXQL 4PJCB 3US0A 3SBRA 1CXEA 4YSUA 3UX9B 3K8MA 4U7SA 3BZ5A 1JV2B 4LSPH 1GW0A 2EECA 4OIAA 3W1ZA 4O2EA 3C2SA 3IMSA 3K0YA 2FX7H 4JB9H 1KPVA 5AL8A 2Q2LA 4FNLL 4NP4L 2FWOB 5IMLA 1CDYA 4HUXA 5FOBA 4Z0BH 1IC5L 5DVKA 5G5DB 3GEWB 5D6CB 3R7RA 1I1AC 5D7LD 4TTDC 3F6JA 2ZKYA 1CDCA 5IW1A 3HRZC 2CJUL 3ZE2E 3QUXB 3VJ6B 1YLBB 3WJJA 3FB6A 2EXYD 3OD3A 4XB7A 3CVIL 1WAAE 3MLTB 2YKKA 3DOSB 5FV1L 2X4RA 4KWUA 3SDXB 3VFVB 3PQYD 4WHYG 3EOBB 1JNNH 5I0WA 5HPOA 4A04A 3UFIA 2VR4A 4GW5B 2YQGA 1DJIA 1RZFL 4L37B 1U3ZA 4N0YH 3KYMB 2A0LC 3IJHB 3IPEA 3QZLA 4AVHA 3CFQA 3ZT6A 4BK5A 4KY1H 1I53A 3HG5A 3UEZA 1NUDA 3QSKB 4JFEB 4Q52A 1G7PA 5CZRA 4YZFF 5SWSA 4ZMOA 3UC0H 2CSPA 3KPLA 4S1QH 3DPBA 3PP4L 3KXFB 5HI5C 1AE6L 3GBML 4E9RA 4F33B 3WXVH 1IKNC 3AXLB 3SYAA 4MMXA 4OCYH 3VWJD 1QKZH 1YEEL 3CH8A 4Y19A 5CD5D 2DWDA 4XP5H 3VM7A 1CLYL 1OPGL 4N3TA 4PVBA 1C5CH 2J55A 4FG4A 1UUNA 3EF4A 1JBJA 3UTSA 4I4WA 3TTSA 4E2OA 3WD5L 5GZND 2B3RA 2VRKA 3HFMH 3QS2A 2HTLD 2NSQA 1SJXA 2FCBA 1AC6A 5FW8A 1WRFA 3ARGB 3UZEA 3MV8D 4A7VA 2C9RA 4H1LG 1KB9J 1CC3A 4LSSL 4MB5A 4JY4A 4W9FC 5HY9A 2OXGA 4JM2C 5IFAL 4ENEC 5DUPH 2WUCL 2Y7QB 5D1ZC 2HRPL 4XE5B 2ESVD 3TPUB 4V1DD 3MLVH 4Z7UB 3T0XA 5GS1C 3T08A 2ITCA 2MQGA 3AJ7A 4JPSA 5D93C 2FAUA 4KJQD 4PREB 4KNQA 5IHZA 4PM1A 1OGAA 4PRDB 1MJUL 4ZOEA 2W07B 4RA3A 4GKZB 2AV1A 5I26A 3S4SA 1F3JA 1EXGA 4L3EE 5B8CB 4LHUG 4M61B 5ENWB 5SWQA 5BCAA 1JZ2A 3FRPB 3C8DA 2CHZA 2ENJA 2C1PA 4NZUH 4JCMA 3NJKA 5DEGB 1KTKE 3G5YA 3VYOA 1OZTG 5KG9B 2QBWA 5IJBC 4OI7A 1S3KL 1E4XH 4JL1A 5E23A 5D7IF 1JNJA 1EDHA 4DKEH 3EAKA 3I02B 3Q1SL 4Q56A 4TUJB 4XNQA 4HU8A 4MRBA 3TVMB 3QUZA 3S3BB 3X3GH 4TKWA 3STLA 1FFPA 2FJUB 2RA1A 2BVUA 1NLBH 1RPQA 3QORD 3SBWC 3C8KB 1DFBL 1ASOA 3QO0B 3OC8A 3MCLL 4P2RE 3O3AB 4KFMA 3CXHK 1BOGB 5EIVA 4JFQB 2PCYA 3WN6A 4NHUB 5LAXA 2VJ8A 5DFTA 1JNHA 3F83A 4YFLI 4JN2A 2QEJA 4U1MA 2TSBA 4LOUD 3NGBB 3P2TA 1XH0A 2FECL 1G7HA 4IRJD 5EIIB 1FNEA 2AEPL 4HJGB 4UTAH 3O3BB 1SJHA 3ATDA 2XQYK 1JF5A 3WXWL 2YO3A 3C2AH 4HBCH 5BS0E 1KIQA 2GHZA 4HJEA 3V6FB 3VA2C 2KQNA 4FNQA 3UAJD 2WVVB 5EA0L 1JPEA 4TQEL 4LHUB 1DL7L 3ASNB 1S5HA 2WLZA 3VCLB 3BZ4A 1T20A 5FHBL 1NCAL 3GKWL 4N2IA 2B2XH 2IOIA 4C57C 1Q8MA 1QZ1A 1WPCA 3BPLB 4K5MA 2KQMA 4BSWB 3IGFA 1PY0A 1QEXA 5KSUA 4EBQL 2CGZA 3FB5A 12E8L 2DDQH 3IFLL 5DI8A 4B95C 4ZFGH 3KJ6L 4KTDH 5SX5H 3AAZA 4BDVB 5JTWA 1LP9F 5EU3A 2C9UA 1OP3K 3WUWG 3HE6D 2HG0A 4G1EB 1DJZA 5AQ0A 5D7JC 1EFXB 5E8EB 1EVUA 1TSRA 1W0VA 4QHUB 4QPEA 2CZNA 4CVXB 4A6YL 4PJHE 3HNSL 5JZ7C 3K72B 2FQEA 4EZMA 3ESNA 5FF6A 1FL6A 5DMGC 2BNRB 4JVPA 4M5SA 4ZYKB 5I8OL 4G80B 4YIQA 2YEQA 2K3HA 3GLAA 2E9GA 1IAKB 1I7UA 1I9IH 1QA9B 2OJZL 4DW2L 4PJGE 4YAQA 2M26A 3AW5A 5C0IB 3NP4A 4ENZA 3WFBL 5AAWC 2DL2A 4EIZC 4WAFA 3HZVB 4APQD 4BFBD 3WFHA 4I1PA 1KFGA 3CQPA 1O6TA 4MDIA 4G6AD 3K6NA 2EP6A 4GSUA 3L7EB 4B9PA 5HYJD 5JXEC 5C3LD 4PRHA 4M43L 2VLLB 2AQSA 1ROCA 4Y7MA 2QGBA 3MRQB 3STZA 3ZKND 4ALAC 4HKBA 1A6UH 4J28A 4KX9A 3ARFD 2CKBA 3OLDA 3T77B 4NQXB 5TGBB 3VTAA 5AVRB 1S3KH 4ZW7A 4WWKD 4DKAA 5I8CB 1QLRB 1N3NB 2DLIA 4B3EA 4NZJA 2JKLA 5DJDB 5KOVC 4DVBA 4WEEA 5I8KL 1XT5A 4KFZC 3UIZA 3CFBB 3WFEH 1E6OL 1MW3A 1NSNH 2JCCB 2YFOA 2J12B 1B3IA 3LPGA 2EJ1A 2IGTA 1CIUA 3FHQA 4ZAKD 5GXBB 1WH0A 4PJXA 1CLOH 1CL7I 4Z95L 2X12A 4Y1AB 3E38A 4XCYA 4UQBA 3FO0L 1AMYA 4QR7A 4M7LT 1Q9OA 3PUCA 1QACA 1DFBH 1VB9A 4L5FE 4NAJA 1A1OA 1D5BB 2E8YA 2KS0A 1XCQA 4FF9A 5C08E 1EPFA 4J23A 4NPJA 2FX9H 5HDQH 3KYKL 4G7VH 3ATFA 4X2UA 2O6EA 5J57B 1OCOB 2NY6B 4P5TC 3RJDA 2CK0H 1ZTMA 2VLME 4XMPH 5IROC 1G7QB 4Y2DA 4CADA 4U3CA 1U8MA 4HCRA 2VLJB 3JT0A 1OGTA 3O4LE 1KENH 2NW2A 2HUEA 2IH8A 2EIMB 4YXLH 2G2PA 2L3BA 4YSCA 5F1NB 1KPRB 4UUJA 1LEIA 5INDA 4KNUA 3RYMA 1JVOA 5CSGA 3VXQA 5EA0H 4TQEH 1DL7H 4PJFF 3DIVA 1J9RA 1JN6A 4L3ED 3VFNB 2R2EB 2DYRB 5IBUG 1ID5I 3F84A 4Y4KB 4XCEA 1FH2A 3DX8A 5FHBH 1NCAH 3SKNB 5I76A 2QPDB 1JGVH 3L13A 4HX1A 2YLHA 5IK3B 1F13A 5EZPA 3P4OA 1CXKA 3E6FA 4ZS7L 4LARH 3IFLH 2NY2C 1FPTH 1QWNA 1YRKA 1UCBL 2EC9T 2J1XA 3QWQB 1AZNA 4OGAC 4ELMF 4G6ML 2JXMB 2QSTA 5D9SA 2YD6A 1SY6A 1E67A 3ZQDA 1GC1L 2ZCZA 1JI1A 4GKNB 3MA9H 5B7MA 1UA6L 1WBZA 1UADC 2YGOA 4O4YL 3N0PB 4PJIE 3GQFA 2FYYA 4A6YH 4LT7A 2EUXA 3HNSH 3N2JA 5DD3L 3SE8H 3CD4A 5T1LD 3UMTA 3VGHA 5IKCA 1HILB 4MD5B 1DCLA 4OD2A 5BZZA 3X12B 4I1NB 4KKCD 4CN6A 1L3WA 3GSNL 4OFQA 5D1XC 3ULVE 3ISRA 3H2WA 3O45A 4I8DA 1A5FL 2J88L 3TIDB 4DW2H 1XB6A 2PXYC 4O9HL 1F00I 3ARDD 1SRDA 4XHQA 1S9KC 2C3XA 1DUZB 4DN3L 4DZ8A 2IQ9L 3UBFA 5HDLA 3V0AC 3DHPA 4PG9B 4UTCA 4OCWL 4M03A 1XSOA 3BE1L 2NQDA 4M43H 4BQCA 4ELDA 2H47C 3HS0B 5B22A 4TNFA 1AGEA 1QTYT 3ZTEA 2HRLA 2X4UB 4XZ4A 1XDTT 1CXIA 1RSYA 4E9QA 2H2PC 3BT2H 2FZ3A 3S2AA 2XVBA 2B59B 4NQDB 1R1CA 2H8PA 1SUHA 5I8KH 4MQSB 3QIBD 4KZDL 3VFWB 1RUPL 1VDGA 3V6BR 3SO3C 4Z95H 5FYLD 3ARBC 2NNAB 3HG3A 3LDBB 4JRFA 3GYRA 2X7LA 1K5NA 3TO4B 4TPRL 2VDML 1BJ1J 1ZVYA 4MJIE 4JFUA 2ATAA 1ADQL 4GSXA 4PJCA 3KYKH 5EOTB 4X6DF 4JRWA 3HNTL 2A6KA 1TJHH 2YPLD 3OM3B 4GMTH 1TTCA 4GRWH 2C3VB 4X5XB 2F53D 5T3XD 3LTVA 4Z3TA 1J05A 2UZPA 3CVBA 5F96H 3Q8AA 2D0FA 2Q86B 4E9VA 3VFMB 4NN6C 4PMEA 3EGXB 5G5DA 4RMRA 5D6CA 2KUTA 3SKMB 2C7UB 2VXTH 2GQHA 1W15A 3MOAH 4GI6A 2EIJB 3QUXA 1QZNA 1Y18A 3VJ6A 4YHOL 4A2GA 4MWFA 2EE6A 1F90H 1UB5B 3DOSA 3BPOC 3VFVA 1MFDH 1X4ZA 3SDXA 3EOBA 1BECA 1R3IL 2W1NA 1JYNA 2V5RA 3T4YB 4GW5A 1C08B 5HGAB 1X3DA 3KYMA 2ISDA 3IJHA 3ZT7A 3KBEA 2VR7A 3TBCA 3WI9A 5JYMA 1OAYL 1FYTE 1KTDB 3EXJA 1A14H 2Y2YA 3K80A 4RBPK 1KTRL 4JFEA 3P77A 1R19A 3ZTJH 1GC1H 1YEIL 4GINA 1FN4B 3VB8A 3Q2WA 3EYOA 3KXFA 1VACB 1FZKA 4MA3A 4XWGH 2D8KA 3QNZA 4O4YH 2W9LA 4BZ2A 4DPBX 4M1DH 1ASPA 2V37A 5DD3H 4DEWA 4E41E 2JI2A 2K0RA 3AXLA 3NIDB 5GRVK 1U95B 3TA3C 5EF3A 3IM1A 4P2AA 3TO2A 3HG1D 3PYCA 5C08D 4HS8H 4AG4L 2MMXA 3WGUB 2VLMD 2NY3C 4Q9QL 4QRBA 2YEZA 4HH8A 4DP6X 2JI3A 5F1KC 3NIFB 4OR1A 2CRYA 2AJXL 3ARGA 2C9SA 1RZJL 3DX0A 3QDGB 1TQVA 5DURD 3NVQA 1R5IA 5LAPA 3IE9A 3KGUA 4OCWH 3A22A 3BIBX 5D2LF 4HHGA 1OQOA 2NYZA 3BE1H 4IGBC 4NXKA 2EDRA 3L3DB 5ESAA 4YLQT 5H94B 4YDVB 2X4NB 5DS8B 3LKRB 1KUMA 2Y7QA 3B6SB 3BAEL 4P2QA 1EUUA 3RWGB 3JBG7 3GRWH 4F57L 5IGXL 3TPUA 2XIIA 2J8UF 4Z7UA 2BWIA 2XPZA 3SY0B 2OBGA 4XAKE 2XYCA 2YARA 5JPNB 4PREA 4N25A 4PAZA 1KGIA 4QCIB 3O8XB 4X7EC 5AVYB 1SN5A 2W07A 4LCUB 1VFBB 2WOYA 1U0QA 3DNKA 4H0GA 2EILB 4MNHA 3UL4A 2Z0BA 5B8CA 3UTQB 5EEUA 1WVZA 1QSFE 3ZDYF 2E6QA 3FRPA 4O58L 1HL5A 1UEYA 5FPIA 3MUGB 4E5XB 3JUYA 5TQ2H 1P5UC 5DEGA 4PWJA 1AMXA 2RTTA 2R0ZL 3B7UX 4A66A 3ULSB 5KG9A 4FL4B 2W9DH 4RMWA 5CD3B 3N50A 2LT9A 3N91A 1J8RA 1KJ2L 1BZ9B 1PJWA 3EO1A 4P2OD 3ZMEA 5C0RH 2YAPA 1TJMA 3I9GH 3I02A 3FQ2A 3ULVD 3QIWC 1HOEA 3EJZC 4TUJA 3ZKQD 2NY4B 3QQ9C 4AH2B 1XL4A 4IU2B 5D55A 4OUUA 1P4IL 5GIRB 1WWCA 2BHZA 3BD3A 3ZDZF 1ILSA 4UMGA 1JYXA 1PNDA 3C8KA 1GCYA 1NMAL 3JZYA 3Q9QA 3QO0A 5TJWK 4N2OA 1WA0X 2OFQA 5HGGS 1KBGL 1QRKA 3MBEB 2WCPA 4YHOH 1BOGA 4JFQA 3O4OC 3Q8CA 3L4VA 4QTFA 4FXGB 4MD0B 3SYOA 4KRPC 1E4KA 1JVLA 3QDHA 4TLUA 5F1SA 2EXSA 3FUKA 5FYLL 1VZIA 3AREB 1QBMH 4NO5B 4QHKJ 1JDAA 4JKKA 2C4FU 1J0HA 1UT9A 4P2YA 5EIIA 4XI5C 1IBHA 4HJGA 4QAWA 2DF3A 5KUMA 4AYSA 1X5AA 1IQDB 3INUL 3GGWB 2ENPA 4QT5B 4QOKB 4X8GA 1CU4H 1BJ1H 2OXHA 2WN2A 2ZJSH 4QUOA 4WDIB 2WVVA 1YEIH 3FOLB 5JPMB 4PU2A 3EH3B 5FFGA 3MLRL 4AYBA 1BVNT 3ARVA 4X6CF 4YXHH 1N12A 1CBVL 5AB2A 4NDMB 3D69A 1ZHBB 3IU3A 3MO1A 4MJID 4Z3JA 4YC2C 4OCMC 4DP0X 4BSWA 3BQUB 3RIFF 3HE7B 3AQZA 4AG4H 5CFHA 1DJSA 4NNXB 4X4YA 1RY7B 2WCGA 3E9UA 4PYHA 1S7QA 1BAFH 4BDVA 8FABB 2FNBA 2XZZA 5IUCA 3ZYIA 4XPHL 1M9SA 2AJXH 3B3BA 1EFXA 3KW7A 5E8EA 3VXSB 1HK6A 4A2HA 2KERA 4CVXA 5IJDC 3TZVD 3HI1A 3MV7E 3K72A 4FTVE 5AW1B 1LM8V 5HDBF 3HNVL 1BZ8A 4R0LC 3AITA 4PJ9D 1H3VA 1YEHL 3VFTA 4F5CE 2BNRA 2EDXA 4FKHA 5KVGH 5J4MA 2QGEA 2X2IA 1F58L 4GBXC 4QF1B 1QA9A 5FGSA 2FGZA 2NZ1A 2UXTA 5DGQA 5C0IA 2WWMD 3GLEA 2GBUA 4L5FL 2VDQB 4F15B 1S7UB 3C60C 3HZVA 3PWUA 3ECVA 1ORSA 2KZWA 4BK4A 1H3WM 4Z23A 2CUIA 3WFCH 2ROYA 2BK8A 2HN7A 2OL3L 2ZX8A 3L7EA 3ZR5A 4OLYL 2R56L 2H6UA 2I07B 3D85D 3QARA 3WKNA 3FFCE 3MRQA 4NT6A 5GGVH 5AYQA 4X83A 3T77A 5TGBA 3UCRA 4DPRA 4WJG3 3KW8A 5T33L 5IY5B 1QLRA 1IIIA 1KACB 1TFHA 2EYTB 3ZZSA 1CGYA 4GW4B 5DJDA 4AENB 1GSKA 3REVA 1IE5A 3CFBA 5GSRA 2JCCA 3G6JF 2Z93B 4UBDC 1V8HA 3LS5L 1EEYB 3Q2VA 4XVTH 2CR3A 4Y9EA 3TT3L 5ISZE 1AR2A 5D2NC 1UM5L 4JQVC 5ACZA 5FGRA 2GBAA 3UROR 1D5BA 3K2MC 1MWAA 1KBGH 4FJZA 4AYMC 4AQOA 1DLFL 1ZLUK 4HQQH 4LKCA 4BD4A 3WFDL 2J4WH 1EUTA 2BY0A 3LY6A 5C0CE 2E75C 2NXYD 5FYLH 1TQUA 1IO4C 1G7QA 5KYWB 2F19H 2WXHA 2N7AA 3NQKA 1ET8A 1BM7A 1D9KA 3QNYA 3IDUA 3EH2A 4X99B 4KZCA 1T4KB 2HPOA 3B1TA 3D7PA 3INUH 5F1NA 4GOSA 3WUZA 2YRLA 1BBJA 2Y6SC 3K6OA 4NPYB 3QQ4A 4AQ1C 4WO0A 5A16B 5T3XH 4G8EB 5IW6A 5KVDE 3QYCA 3MOBL 4M6OL 3K2UL 3HFFA 5TK2A 4H40A 3VFNA 1AGDA 2KPWA 2R2EA 4MNQB 5BO0D 3ULVL 2IIJA 5D1XE 1PNCA 1QSFD 2MRYA 5AVSB 2UZXB 4L4JA 3NPZB 5FAAA 5IK3A 3WN5A 5JIHA 3MRHB 4YXKH 3I2CL 1DQDL 3NESA 4IS6B 4G8FA 3RX7A 4P0DA 4CVWA 2WQWA 5GZNC 1T0OA 2HTLC 4HJJL 3U6XS 5TDNA 1BOYA 4HBQA 2JXMA 4X0KB 1AZCA 3MRIB 2L7QA 4XPHH 5GRYA 3ERXA 4OW6A 1SMOA 2ZCLH 3IDXL 3NEXA 4W70A 4C56D 3FBQA 4KOCA 3WS3A 1P53A 1MVUA 2CK2A 2FUQA 2QDVA 3EF7A 3SPHA 3SKJH 2OZ4A 2A9NL 3TF4A 2FIKA 2FD6H 4P05A 2OR9H 1HILA 1T6WA 2ENQA 1OV8A 3GTTA 4IRZA 4MD5A 3X12A 5AVQB 4DTGL 3LHPH 4N2MA 5F0MB 2LFEA 1Z9LA 5DQDH 3K6IA 3D3VB 3FTZA 3S5ZA 5MI0C 3QFDB 4XC1L 3TIDA 4KJQC 3B5HA 4JM4H 3EJCA 4MYWB 4IK6A 1DUZA 3LIZA 3O6KL 1U8JB 4L5FH 5E4EB 1OB1A 1CG9A 4YHZL 4B9KC 4L3CB 4QRAA 5CGBA 2OL3H 3ZX1A 4OLYH 2R56H 2IGFL 5AL0A 2X6VA 5HTSA 1HWWA 5MP6H 3LZRA 4FCAA 1E7UA 3X1FA 2X4UA 4N8VB 4OGYH 3N40P 5EORH 1JZFA 5KSAD 5HD8C 3VXRE 2BNUA 4OZ4A 4B27A 1G4RA 4LVNC 1DBJL 4UV7L 1CT8A 5EF1A 2MPAL 3VFWA 3B2MA 4RZCB 5AFAA 3BN3B 1NAKL 4TULL 3DXAD 2NNAA 1JOIA 5DZAA 3EJRA 4S1SL 3IDIB 1J0IA 1S7SB 3NCXA 4R90H 3GJFK 1IQWL 4KMTH 1HZKA 1O9VA 4N8CH 4F7EB 1L4IA 4MA7L 1DLFH 2Z8RA 5EOTA 1MFVA 4LOUC 4OQTA 3K8LA 4FTVD 4IRJC 4FEMA 4X5XA 1MAKA 2A9ML 4KZEH 3L1GA 2IDFA 1JPSH 3P11L 2LVEA 1S78D 1AGCB 4WCYL 3OX8B 5E8OB 5J13B 1B4JL 1SQ2N 2Y1ZA 1LO3L 2NY0B 3QE5A 2OJEB 3EBIA 3UAJC 3VFMA 2HKFL 3B2UD 3EO0A 3Q01A 4HLZH 3NTCL 3CK0L 3QIUD 3SKMA 3LYRA 1JV5B 4GMSL 3RVXD 4K8RD 1H3TA 1VKXB 4LCVA 4M6OH 4LVHB 1RU9L 4ZTOL 3OF6A 4HP5A 3H9SE 1UB5A 3GBNL 3K1DA 3FF7A 2PYEB 5DJXB 1JXDA 2X4TB 4ETQA 3EDEA 4G8GB 1AFVL 3T4YA 3I2CH 1AKJD 2ZOKB 3LAFA 1C08A 5HGAA 4P06A 3BFWA 1TQWA 5BVJA 3AG3B 2FRGP 2A5UA 2C9AA 4KHTL 3Q5TA 1KTDA 1RMFL 2UZIL 3FO2A 1BM3L 1I9EA 3BP6B 1ZGLM 4AWJC 4HD9A 2UY7A 1SVCP 3VSTA 1FN4A 3KCWA 4CGTA 4OLXH 1VACA 2L7JA 1WE5A 4JPVL 5EO1B 4EN3C 4LK4A 4D9LH 1OP5K 1Z5LB 1MW1A 3SPCA 1S7WA 1E9OB 2FLBT 4W4OC 2AP2A 1U95A 3KPRE 3Q7JA 4AC2A 1OPOA 5K1JA 3HC4H 2J44A 1QO3B 5DK2A 1AXSA 4P49A 1IVTA 2XOTA 5C0CD 3QFJE 4YHNA 2FH6A 1B0GA 4FD0A 4HK0B 5E2TH 1AQKL 4XCCL 4X5WB 2FJHB 5GGUA 4APQC 2P9RA 4ZSOE 4JS7A 1UENA 2LU3A 3QDGA 4G6AC 2EKSB 4YHZH 3GUFA 3MI6A 3U46B 1MG2C 4GKSB 5KS9B 2FR4B 3H2PA 2QR0B 3ZKNC 1NOLA 3W11D 3L3DA 2ZYRA 4MS6A 4AMXA 1H5BB 3JWDL 1FBIL 2R8SL 4G70B 1AQMA 5H94A 1HIMH 4NQEB 5DS8A 3LKRA 5JDSA 3RWGA 3B6SA 3DX9A 4KRNA 3FN3A 2BSED 1NL0H 3FULA 3KYOA 5BZDB 3WE1A 4M6NH 5CEZE 1U9KA 5EU4A 3UYOD 3ARPA 3MLYL 3FMGH 4DK3A 4OFIA 5LG6A 1DBJH 3SY0A 3QG6B 1EWHA 3QJTB 4XBPB 5JPNA 5K9OB 4QCIA 3IAQA 1YNTB 3O8XA 2WXFA 2BSRB 4LCUA 1VFBA 5C09A 1RUML 2E7BA 5KBNC 1EJOL 4J3UA 4JPWH 5BUPA 1F4HA 3MMEB 1IQWH 2F5BH 4H20H 2NY1C 4HV8B 1XD0A 2QV2A 5AW2B 2AAVA 3KE0A 4JY6A 5DR5L 1CE6B 1F41A 1Y0LB 3DECA 4ZUVB 3DO7B 3LIUA 3A3YB 1UB6B 4K3DL 5LO7A 4FNPA 3ULSA 5HVHB 5CD3A 4X9FA 3KR3L 1KCUL 1BZ9A 4IOIB 1NFAA 1RIVL 1WTLA 4WCYH 4OM1L 2V0AA 2XVKA 3RGVD 1UOLA 4L1TA 5GRUL 1LO3H 2A99A 1L5GA 3BRDA 3O2DA 5FR3A 4NAQA 1ED3A 1YECL 5A2IH 3LKSA 2BINA 4BUHA 1O7DC 4GMSH 3L5WB 1NAMH 3MBEA 3LEVH 1EO7A 5DFVC 1RU9H 3V79C 4H8PA 3QXTA 1JNLH 3MLWL 1EEZB 4FXGA 4WI3A 4OGQC 4MD0A 4L29B 4B9FA 2JE8A 2GCYB 5BPPA 3E2HC 2UXGA 2E9IA 3AREA 4NO5A 3LQZA 4HJTA 3BWSA 4A7QA 3KWWA 3UBGA 4FULA 2YD1A 3GMPB 1J8HE 2BXYA 4KHTH 4LSQL 3GGWA 1BA9A 3EDDA 4XNZB 1T7XA 4QOKA 4HGWB 4U3SB 3F7LA 1D5ZB 4WDIA 2DQCL 3FOLA 4G5ZH 5JPMA 2Z7UA 3HS9A 4WW2B 1OL0A 1M6OB 2W8CA 4G8IA 5EO9B 5EOCJ 4M8QA 2AJSH 4C55A 5HGHB 3QDJB 1ZHBA 4GPVA 2X6MA 4JO1L 3BQUA 4N2HA 1KDIA 1YPZA 5I1GH 1G0YR 4NNXA 1CICA 4K8RL 2BLFA 3RFRA 4CVZB 2FWUA 4XP1L 3U0PA 5ADPL 2ZPKL 1RSFA 4I0PB 1YEGH 2EICA 4LSTH 2OM5A 2LAGB 4R4FL 5DMKA 4BFKA 8FABA 1ANUA 1TQCB 3IN0A 5C6PB 5ERWB 3R8BB 1KEGL 3B3IB 3OAYK 5FKPB 4KQ4H 4ZW6A 3FU7A 1U8CA 1M2VA 5DDHB 4GRLC 5F97E 3VXSA 1YVLA 3TBBA 4AYGA 4Z78B 1I9RL 1Z66A 1EHNA 4TVSa 3FHEA 4YL4A 2RGSA 3R1GH 4MCMA 3JWDH 5DA0B 1V7NH 2NY5H 2O30A 1GJUA 4JZNB 5DF0A 2DQJH 5CBAB 3ZPDA 4N1HB 3VQ2C 2ZKXA 2VO8A 3UJIH 1JAEA 2VDLB 1G87A 2B39A 3FTVA 3MLYH 4LCIL 4WSKA 2YBGA 1Y1UA 1HE7A 1NC2D 2Q8AL 3SDCC 5KBPA 2HMID 1YMME 4J3SA 2FECI 3R19A 4K5LA 3AUVA 3PAZA 1S7UA 3SDDB 4UIKH 1MJ7L 1FGNL 1UWEH 1IM9D 5EOCL 1BPLB 1ID2A 2ED6A 2FEDC 3AQDA 5FCUL 3V4PA 4HWEL 3K5SA 4LL1A 3WNJA 2I07A 1CF1A 4RGNE 4GFXA 3SGJA 4ZUUB 2BSCA 2OLDA 2VLKB 5DUJA 4LSVL 4I9WE 4YN3A 1VLXA 5JHDE 5HYFA 4IBYA 3NACL 1INEH 5E8PB 2Q3XA 3VFOB 2AEIT 1RP8A 4MJ5A 3K91A 3KPRD 2DJSA 4BKLB 3W3BA 3FU0A 5KW9L 3BH4A 3RP1A 4GW4A 4KY2A 5CN1A 1PAMA 3BI9X 5KVDL 2N3JA 4ZO9A 5F1IB 4Z7OF 5ALCL 1P69B 2Z93A 3RL1B 4M7LL 2A77L 1DQQA 4OI8A 2GYSA 1WWBX 4QXTB 5B1JA 3VD0A 1YECH 1KV3A 2HJLB 3HR5A 5J06A 1WICA 3F05A 3MV9A 3FT3B 3OB0K 2XA3A 4WNQB 3OR7B 4ABWA 5C0JA 2ZWNA 5D5MB 2CDGB 2BIPA 3GHBL 1YQVL 4U0RC 2IXQB 1KGCE 1XXDC 4X7TB 3MLWH 4ZO8A 2GT9B 5FEBA 2OMZB 1AJ7L 2FEEI 1P4LB 1KXQA 3QWRD 4YSDA 5HHPB 3VGBA 2DEYX 1PZCA 2XUWA 3ZO9A 5JW4M 1U8QA 4F93B 5KYWA 2P45B 1MRDL 5E2VH 2XTJD 4ZD3H 5DZNA 2IPTH 1CWVA 4X99A 2AHIA 2X3AA 3F65A 2CE6A 3TEXA 3V6OC 2J1KA 3BN9C 4NPYA 2Z31C 4N8PA 2DQCH 3OHMB 3ZHFA 3MFFA 1FLTX 2ZTBA 5A16A 2JB5L 1HEZB 1NLDL 2W92A 3K1KC 2V2XB 3O11B 4MNQA 1UH2A 3M1BB 3CAFA 1S3RA 4HJIA 2UZXA 1A6TB 4EUPG 3LZOA 2E46A 2CLVB 4JE4B 5DVPA 2Z6FA 3DO3A 3UYPB 4BE6A 4K8RH 1R24A 4XP1H 6FABH 5ADPH 2W88A 1W72L 2ZPKH 2E7LA 3NABL 1OD9A 4M7JL 3QAZC 1MF2H 3GXUB 1VFUA 5F0JB 1KEGH 1U4FA 3MRIA 4N26A 2PKDA 3FZUD 2IPUG 2DQ6A 4P46B 5D2LE 1EK3A 1P7KB 2OTPA 4ODWB 1MCOL 3RDTD 1H6TA 4R3SB 3VFGH 4M3KB 2AK4B 2AJ3B 2A38A 3QB7C 4KKBC 1V10A 1GY2A 4WY7H 4XVJL 5I6KA 1HI6B 4FCHA 4A2MA 3EYFB 4BK8A 5C07B 1MJ8L 4GG6E 2NT0A 2WKLA 1TSHA 4OI9A 1NFDE 2EDWA 5DD1H 4DGVH 2DIBA 1ZLWH 3QFDA 2VDKH 2VQ1B 3KLLA 1DVZA 1KB5H 3ZTDC 5JORB 4JAMA 3LD8B 1OM9A 1MJ7H 2Z1KA 1DO6A 4NKQB 3T4AB 4JJ5B 4L3CA 3LXUX 1UZ8B 4KUZH 5E5LA 3D4YA 4OZIF 4XMTA 3UTPE 2AABL 1UZ6F 3OKLB 4LSVH 2UX7A 3HBZA 4HJSA 4KTYA 4AJ0A 1J1PL 1G6RA 3EFDH 4EUPB 1TXKA 3NFSL 4P2OC 2PR9A 3DUSB 4LNRB 1MCQA 4KKAD 2ATPB 2APWA 3BISA 4XZUB 2I7OA 1I7ZB 1AOHA 3UC2A 3X13B 2WZ5A 5ALCH 4KO7A 3CVHL 3TGXA 2PP8A 3MRMB 1HINL 5EDSA 4JRYB 3C6LB 4IJ3C 4PLKD 1OQXA 4KTEH 2LOEA 4RMSA 1MPAL 2EE9A 3IDIA 5DHXB 2UVFA 3CFDB 5H37H 3OLEA 1G1CA 3RWCA 3AS3A 1Z5HA 4F7EA 1NMBL 5FW6A 3GHBH 4OH2A 5IQOA 1JERA 3FS9A 1AIZA 3CVCA 1MCHA 4HUWB 2E74C 3CDYA 5ECJE 3HUJB 2DBLH 2UUDH 5SWSD 1SLWA 3MNZA 3LSOB 5D4IA 5E8OA 3MLXH 4LDOB 2HT4C 2BP0B 4DOHB 2OJEA 3BCDA 2IWEA 2VXUH 1JXKA 3QVAA 5I71B 4AMWA 3NCCB 4RH4A 3R0NA 3N44B 4IMLB 1YAIA 2G3ZA 5CEXB 2R2CA 1JV5A 5JHLH 3FFDB 1TZGH 4LLWA 4AEIL 4XX1G 3SOBL 3FAXA 4NUGH 3U1SL 4PJXE 3UTSD 1LO0L 5DJXA 2PYEA 2F74B 4BRVA 4NQCA 2X4TA 4OGXH 5ICYB 1PX3A 1R33A 2GI0A 2ITEA 4G8GA 2ZOKA 3LQAC 3CDZA 4XMKL 3ZDXB 3WY3A 4Y1SA 4P2CG 3S35X 3SBQA 1GTNA 3P3RA 4J3BA 3RAJL 3TBWB 5C9JA 1W72H 2VOTA 3GO1H 4U1SB 3DMMB 4F2ME 4KK6D 5C0AE 3GINA 1A7QH 2VCOA 3OAWA 1A21A 3RY6C 4XXCA 4GSQA 4RGOH 4Y2OB 1T4WA 2O5ZH 3U7AA 2CO1A 4OLWL 3L4WA 4P4KB 5CEZL 1SM3L 4JG0L 5IB2B 1Z5LA 3ILQD 4OUOA 1E9OA 4PJ9C 3H4HA 5L2KB 1ES0B 3HMXH 1IM3D 5JIKA 1KGCD 1OGAD 3ABKB 5DZJA 1X7SA 3EJJX 4FFVC 4Z7WA 4FFYL 1UTDA 2OMNA 3L3OC 5ALBH 4HD5A 1ZV9A 1A3RL 1MY5A 2FJHA 4HPYL 3F6IA 2FBJH 3KHOA 2CBMA 3HC3H 3I6KA 4K3JL 2Y07H 3FQNB 2X2HA 4ABVA 4BFNA 1NFKA 3U46A 2KH2B 4GKSA 5KS9A 3IAPA 4JPQA 3T6QC 4M8UA 2FR4A 2HX9A 4ZK8A 4RX4A 1EZVX 2YZ1A 4FQXB 3RVVD 3BXNB 1H5BA 1TQTA 3CHOA 4P8QA 4R8WL 5CWSB 1E42A 5BZDA 3LN9A 2HFEB 4FQLL 4DK6A 5AVTB 4PJDB 4PV8B 4DP8X 3DGGB 2KZ1B 1U36A 3Q6GL 3QG6A 4XBPA 4YL9A 1IFHL 4NUPA 5BRZE 3G6JE 2WWNA 1NGWB 3NSJA 3NPSB 3CVHH 1O9WA 1P0SE 3GIZL 2BSRA 3OXSA 1O7DE 1HINH 3MGTB 2YS4A 1MCIA 3A6OA 1R6VA 1BFVL 1MPAH 3D39B 2C3HA 2AXHA 5EZLB 1SMDA 2OS7A 4TNGA 3MRJB 4HV8A 3WTSA 1A02N 2X0UA 4KC3B 4WVRA 1G1OA 2GJ6E 2QVFB 3WE6B 5CLZA 4MJ4A 1KIPB 3OKMB 4PRIA 5F9OH 3PIQB 4WTZA 4ZUVA 4F3FB 3DO7A 1GA2A 1UB6A 4IEFB 2AXGB 4UNTA 2D7TH 3VWKD 3RY4A 2BS9A 5DJ0B 3CIQA 1UXWB 4Y88A 4HIXL 4LP5A 2VNCA 2CA3A 1XIWB 5T3ZD 3N40F 2AI0L 4XP4L 3MNVA 1KELL 5GJSH 1L9PA 4RRPM 3OTTA 4Z7VB 2BVOB 1ROWA 4A63A 4UQ9A 1BP3B 1THCA 4O00A 1JMZA 2NR6D 5SX4H 1M2OA 3L5WA 5T5FL 4NM8L 4AEIH 5ABAA 3VA6A 5EZOL 4GSDL 3SOBH 4ZPVB 2ZICA 1HXMA 4L4TB 1WUNT 2QQLL 1EEZA 3UTPD 5D1QB 4ODSH 3U1SH 5C8JB 4L29A 2GCYA 4POUB 5F72S 2Q76B 4IQHA 4XWOD 5GGTL 4XMKH 4WFEE 2Z0UA 2YAEA 3H2QA 1MHPL 3QJHA 4XP6L 4KOBA 1KZQA 3RAJH 4YDJB 2NY5C 3AU1B 3GMPA 2A4EA 1FWXA 3FTGB 4OF5A 3D50A 1KBBA 4U3SA 4HGWA 4HIQA 4OZGB 3JWNH 5ECGA 2C8NA 4FMKA 1KCRH 3SDAD 3PS6A 4PP2B 4U6VL 3NZ8B 4K9EL 1M6OA 1ZT4B 4XVSH 5FHAL 4WI2A 5CJXA 2FH8A 4X4XB 1G7LB 4R4NC 1QTPA 5HGHA 3QDJA 5EU5B 2KLSA 3U4EB 3N04A 4RETB 3ARXA 3SYCA 3WSQH 2AEQL 1TVBB 1WHPA 4ODVL 1A3RH 1KYOJ 5ID1B 1YHPA 1OW0C 5CJQH 1NIFA 4N9GB 4JG5A 2C9VA 4ZS6C 1L7IH 1U3HB 5ERWA 5C0EA 2B9AA 1J18A 3QR1A 5FKPA 2QADB 4WTQA 1D3CA 1IKFH 4J7RA 5EC1B 1PG7X 1AI1L 3G5WA 2ZZUT 2CPCA 1S4IA 2IFFL 3BSZA 2N0KA 1EMTL 4R8WH 1AQ8A 4JZNA 5CBAA 3REWB 2XY2A 4JKLA 1IE4A 4FQLH 5AUMA 1WTGT 4ODUA 2VWEC 4HWNA 3ZG4A 2HX8A 2HAZA 5GHWL 4XO4A 3EGDB 3CSTA 3QXUA 5I6PA 1IFHH 3OJDB 3KYNB 5HJBA 2VJ0A 3SDDA 4AQ8C 5T1MB 4AJVA 5DJYB 2VDRH 5AKRA 4H2AA 1UWGH 3ELQA 4AOFA 1E5BA 1BFVH 1N6VA 3BLPX 1SXAA 1T7WA 2VDOH 1QX1A 2X4PB 2XT1B 4TN9A 4AGOA 4KKLD 5J3HC 4XNXL 2BIIA 5IREA 3QCUL 1RFDL 5BOPA 4JY5L 1T1WB 5E8PA 5CJOL 3VFOA 3VW3H 4CKQA 4PP1C 3GSVA 4XPAL 1D5MB 1Y07A 3T6VA 5DZOA 1S78C 4BKLA 3C87A 4TNVF 1BG9A 2B1AH 2A9CA 4HIXH 4MB4A 4NXSA 5CGYD 2UXVA 3B2UC 4YSOA 4AGMA 4HVBA 2NY7H 1BQRA 1FVEB 2V9QA 4FQ2H 5AKSA 4FP8L 2YUVA 4P2QE 1PEZA 3AABA 1L6XA 2HJLA 3ARWA 3RVXC 3WO4B 1GJIA 2M83A 4LLMB 3FT3A 4WNQA 4HFWB 3O6LL 1JGLH 2ARWA 4NM8H 3IPBA 2CDGA 5FA4B 4W9DC 2J5LC 4FQ1H 4GSDH 3I6LE 2IXQA 4PGDA 1GGIH 2DLGA 2GT9A 3BD4A 2OMZA 4OFYA 3IMBA 1IBGH 3RA7L 5DJ6B 5C0FB 2J72A 1C7TA 1ERNA 4QRFA 3OR6A 3DX1A 1ZD6A 4YGVB 4A37A 2V5YA 3WMQA 1A6AB 2E9BA 1R75A 3EIFA 2MCPH 2JKSA 1E9QA 5C6WH 1JSYA 3WJMA 1QBLL 5IHUH 3GM0A 1KWKA 4LLQB 3LMJL 3FQ4A 1BIHA 1N0XH 5FGCE 5EDXA 5HBBA 4U6VH 4YNYB 5D7LB 4M02A 5LN4A 1HEJC 2F18A 4WI4A 3WGVB 3VD2A 3KGSA 2K8MA 1I3VA 1KXVC 5FHAH 1AQHA 1AHMA 2DI8A 2OK0H 3D9AL 2OMTB 5E2UL 3D30A 3VXNA 1A6TA 4YDZA 2CLVA 5I5IA 2YAHA 2GJ6D 2K4AA 4ATTA 2WQRA 2B9BA 3UYPA 2G5UA 2AEQH 1DQVA 2F54A 3FH7A 1BZEA 4WSGA 1DZBA 3APMA 1V7MH 2VMFA 2GABA 4A6YB 3LRSB 2KC0A 3D08A 4UT6A 2QGDA 1DQML 3HHSA 3K4DA 4JFZL 4EI0A 2OJ1A 5E6SB 3AY2A 4P46A 3WEMA 1P7KA 1AI1H 2OW7A 1RPKA 4ONGL 4P5MB 4LRIA 1MCRA 4R3SA 5F9DC 2VABB 1A7PL 4H8WC 4MKTA 2AJ3A 3DURB 3QCTL 3EFOB 2LE9A 1A22B 1ACYH 1HI6A 4RFNB 3EYFA 5E1HB 5AZUA 5KBKA 3HBPA 3VWJB 3PFUA 4HWBA 4NWUL 4PJAE 5E99L 1MFBL 4QTIL 2GITB 2VQ1A 1F86A 5GHWH 3B7YA 1T7VA 4MXVE 3VXUE 5CFAA 3Q13A 5FB8B 3QXWA 3T4AA 1AR1B 4ICWA 1BX2B 4JJ5A 3N6YA 1UZ8A 3FRUB 1E6JL 3NAAL 2VSDA 2Q87A 4BCYA 1FIEA 2AVGA 3VI3E 3T8XB 4HOWA 3IJEA 5E4AA 3OKLA 1MI5B 1XR9A 3U9PL 4XNXH 3NA4A 3OG6B 1HXKA 5B7FA 3S88H 3T5WA 2DWXA 2HT2D 4LCYB 1YEKL 3H3KA 3MLSL 5CM1A 3HPLA 3O3DB 1PLAA 4MFHA 5F9WB 1KCBA 4BWUA 3E8UL 1OCZB 5IWLA 3ZTJG 3ZYOA 2ATPA 2PCFB 1RL1A 4XZUA 3DK0A 4PS4L 1I7ZA 3L5IA 3QJQB 3UPRA 4OCNC 2EXWC 3QUXD 1MH5B 3B8SA 4C8XA 3MRMA 4JRYA 4FE9A 5EUOB 1TPXC 4GUOA 1HHJB 4P59L 3U30B 3MBWB 1T0MB 3CFDA 3ELAT 3NQIA 4GRWB 4LHQB 4CJ0A 4LASL 4XNYL 4KK9C 1J88A 5J7CC 5GGSA 4Q6IC 1IGCH 3RA7H 5TH2B 4HUWA 1BSIA 1JRHL 4LXFA 1I8KB 3HUJA 1MCNA 2HCZX 2OCFD 1S7VB 3OHXA 4JFED 5AKTA 3LSOA 4PD4J 2OMVB 3LH2L 4HCRL 4PB9H 5DRNB 2RBLA 2BP0A 4L4VE 4YE4L 2RAMA 4Q9RH 1QBLH 5CCJA 5E0FA 4AM0Q 4WV1C 2ZG2A 5I24A 4IMLA 3LMJH 1PKQA 4OCRL 5TE7H 3FFDA 3FH5A 1Q0YL 3K46A 3QORB 4KK8D 5IB3B 5J12B 4X9IA 3KLSA 4RWYL 5E70A 3MUUA 5T3ZH 1UEMA 2F68X 4F8TA 5E2UH 5CKAA 2PCXA 3PGCB 5ANMB 4IKKA 1EBAA 5F0LB 3IAGC 4F80A 2QSCL 3ARGD 1D6EB 1DEDA 1J0KA 4JM0A 4Q9BA 4UDUA 3TBWA 1LGVA 2IAAC 1A4KB 2EC9U 4L8BB 4ZTPL 1R5VB 4AGPA 4R7LA 3RUGF 1Q9WB 1CD8A 4FX5A 2DMBA 3WEXB 4FNUA 1FNHA 1UWYA 3K6FA 3RX9A 4X6BB 5CEYB 4JO4L 3BC9A 2Y4SA 1PSKL 2ZNXA 3FSVA 5DYFA 1UM6L 4XMLH 1JZDC 4IOFD 4P2QD 4XO5A 3GSNB 4P4KA 2VIRB 4ONGH 2XXGA 2UVEA 1SDDA 1GY1A 3BUIA 2P5WB 1XB3A 3QCTH 1MWOA 1SFDA 1UASA 2K1MA 1K4CB 3I6LD 1R3JA 3MRPB 3N9GH 1ZATA 3LS4L 2VE6A 3B7RL 1GPOH 4XBEL 4ZUSB 5B3JE 4OJCA 2VN3A 3AGVA 3WTVA 5CUSH 2BERA 4NC2B 1U8NB 5IJVB 3VFUB 3CUPB 3H9YA 5C71A 3WHE1 4NOBA 1T66C 3HE6B 2O5YH 4L8SA 1E6JH 1K8IB 4Z0XB 1U21A 4A39A 2WV3A 3RTQC 2WKOA 2IH9A 1VADB 4UILL 4FQXA 4JCLA 1NEZB 3FT0A 4A2FA 4UT9A 4FZ8L 2L0DA 3US9A 4L1HA 4BQ8A 5CWSA 4X5QA 4C83A 2BZ7A 1YEKH 2HFEA 3QPKA 1KIUB 4ZMTA 4PJDA 5GGQH 2CKBH 3E8UH 4PV8A 3IBOA 5GGRB 4P9HC 3DGGA 3BH9A 4X9GA 4Y4HB 4XXWA 1F18A 4PS4H 1RZ7L 3T2OA 1DQTA 2DV6A 2VDMB 1NGWA 5F8RC 4FQHA 4PW4A 4KMLB 2H6PB 1I1RA 1KXHA 3P69A 5AB9A 3MGTA 2VXQA 1PY4A 2BNQE 1CFQB 1M05A 1ADWA 2D31B 4FYQA 3D39A 3MGAA 5EZLA 4YJZL 1KTBA 4TUOA 1BQ5A 3H8NA 5JIPA 4N2DA 1N6QL 2H1LM 3TESA 4XNYH 5FYKE 1KIPA 4CGUB 4IU3B 4F3FA 4PJBE 4IEFA 2AXGA 4BGDA 4QI3A 1B4RA 3ARFB 3G6DL 3C5SA 1FNSH 1KPUA 3TN0C 1JRHH 2VMEA 4KGLA 1CFMA 3DETD 5AAPA 4NNYA 4WWKB 4OV5B 4PBVC 1UXWA 1NGPL 3BAYA 4P23A 3ABLB 4HCRH 1IGIL 2ZSVB 4K94L 1GHFL 4G1MB 2SODB 1II4E 2AC0A 2NZ9D 4D0CB 4WWNA 2A74B 4Z7VA 3L5XL 4H1LA 2BVOA 4ZAKB 3KPSE 1UWFA 4OCRH 4EDXB 2V3FA 1RH8A 3L17A 3GZQA 4L3FA 3HCVB 3GXFA 3FUIA 4WI6A 5D1QA 5CU9A 4NN5C 5C8JA 4FLQA 5TE6L 2FTAA 2ITDB 3NMEA 2Q76A 4LVOB 1BD2A 3Q8EA 4BRJA 4J3OD 4W9HC 2FO4B 3W81A 3FT1A 2BY1A 4EMZA 2YEVB 2H7WA 1EFXD 4NN7B 1JGEB 3AWFA 3IETB 4KI1A 2HH0L 3IMUA 3VFRB 3NUKA 5C92A 1Z9PA 2HVKB 3AU1A 2VZSA 3FTGA 4ZTPH 1S9VB 4G9FE 4QNPE 4OZGA 5CGMA 3LX9A 4KKNA 3LCYA 1GGBL 1SY6H 4PP2A 3RVUD 1UM6H 2JF1A 1Z3GL 5BOJA 5C86A 3WDHA 3ARSA 2DQEH 1ZT4A 4F1ZA 1X5JA 4X4XA 1G7LA 1CIDA 4OVUA 3VGAC 4GEIA 2BY2A 1LQSR 3P2DA 3EOTL 4L3EB 4BZ2L 4YR6B 1KJMA 5EU5A 3QRGH 4ZQKB 4DEUA 3F3HA 4MMZB 3EBHA 1GIGH 4FZEL 1UD2A 2WLHA 5ID1A 4YHLL 3QDAA 4M9OA 3FH8A 5K39B 2QPUA 1NM4A 3IJ9A 1NKOA 4UQ3B 1CURA 1U8PA 3CXHJ 2GIYA 2M2DA 4H8VA 4QRTA 2AJUL 4L18A 3VRJB 2OZNA 3LEXA 4UILH 2XPGB 1MVYA 3M17A 3NG5A 2ZCHL 4FZ8H 1DSFL 1DBAL 3NK4A 3REWA 4P2RB 3M45A 4JGNA 4AGNA 5FXCH 5J6SA 1D7DA 1T2XA 3DX6B 4YDIH 1IX2A 4NQQA 3HZMB 4Y5YB 1JHLL 1KBVA 2Q7AA 3DHUA 4BFJA 3EGDA 2NLJA 4AV5A 3WJJC 3OPZL 3RKPA 4KQ3H 2PP7A 3KYNA 3OJDA 3S98A 1BEXA 5T1MA 3ARDB 1Z6JT 4PJEE 5DJYA 1LDSA 4OZHA 3ILDA 1T21B 1IAIL 2X4PA 2XDHA 1K5WA 1FIGH 3UJJH 5BS0B 3T3MF 1KJ2B 3G08A 1L9QA 2HUHA 3WIIL 1D9KD 4KROD 4TL5A 3HJEA 4LAJH 3UO8B 4AUUA 4EI5B 2XZQL 1D5MA 2AJYL 4R7DB 3T1FB 4WHTB 3CU7A 1ACCA 4I3SH 1AZVA 2B16A 5D96C 2JKJA 1OSYA 5I16B 2XYBA 1HDMB 1CGUA 1BMGA 4K94H 5I0XA 3U6RB 1FVEA 1JIBA 2DLFH 4N90E 4X4ME 4MMXC 3F12B 1LWRA 2LLLA 1W2KT 4YBLC 1DQLL 1AXTL 1BW8A 4LLMA 1WS7A 4WO4B 3IU4L 1OCRB 4HFWA 5FA4A 2YQBA 3VI4E 1H8LA 2CD0A 2PO6C 2OW6A 1C5BL 2AQ3A 2L4OA 2PPDA 3PP3H 4FXLA 4TVPE 1XR8A 5D72L 5DJ6A 3IYLW 4PJHB 1WDAA 3UZEC 5C0FA 2EIDA 2YPLB 3FFOA 4AL8L 4M4RA 4KK6C 2EDTA 5J5EA 4N5EC 3BJ91 3HAEB 3QEQA 4LGPB 3WEAA 3GIVA 3MNMA 1FV1B 4F58L 4HSCX 2VUOA 4HOMA 2RCSL 1JMXA 4TF4A 4PJGB 4F7PB 2D7MA 4TMPA 1LNUB 5E6RB 1M7IB 1A65A 1X5MA 4NZFA 2NX5A 4R84A 4YNYA 2CIKA 4MQXD 4OIIL 4XO9A 1PZ2A 2DQTL 4GP5B 2OMTA 4BZ2H 4WEBH 3IN2A 3IFPA 1RJLA 4OLVL 5TK4A 1S8DB 4LQFL 1U2YA 2WQAA 1JFHA 4MSWB 5I2IA 5DZVA 4PJCF 3VB9A 3Q8FA 1MFUA 2DQUL 4JFPB 1IL1A 3H55A 5AG8A 3LRSA 4FXKA 5BVPL 4N24A 1N4XL 4XPGH 3SIKA 3PDGA 5DD6B 3QDME 4M6AA 3MLUL 3N0AA 1D7CA 1U41A 2V2WB 2HFGL 1YNKH 3TYFB 5I6XB 4U31A 3WL9B 4NM4L 4WTWA 3KPSD 4DN4H 1PYWB 1IGMH 4NAMA 2VABA 3GB7B 4RRPG 3RWIA 3WIFB 3EHBC 3DURA 4IBZA 1BQHB 3EFOA 2MTAA 3QUZC 1M9WA 5CCGE 2J57A 3FTXA 4WEUD 1JZ8A 1UYWL 3HG1B 4ONHB 3PJLA 5C08B 3PNRB 1NGQH 4HF5H 3GLZA 2GITA 2OL3B 4JREB 3SDXF 3ETBF 3D2UA 1DSYA 4K07A 2E27L 4WU7B 1BX2A 3O4LB 1AY1L 4R7NA 4KJPD 1QASA 1FRGL 4ONOA 5DURB 1IAIH 3WY4A 1MI5A 3TS8A 5FYJE 2W80C 3N42B 4NWTL 1MIML 3IEAA 4NOFA 3O3DA 2YQ3A 4CW1B 2IEPA 3QR2A 3U6XA 3CBJB 3BUYB 2PCFA 3I3DA 5AZ2H 4M56A 4NGHL 1A2YB 2FATL 4OD3H 4YMPA 3SCMB 3QEHB 2LW3A 1MH5A 4JRXA 3OF6D 5M94B 2Z1PA 5EUOA 3D18B 4R5VA 1I1FA 4QY8B 1HHJA 1G9HA 1AXTH 3MBWA 2DJUA 3T0BA 1B2WH 1VAHA 1MWAL 3I6GB 2D9QB 1OIOA 4PJIB 4RDQF 3O9WC 4JG1L 4XP9L 2DMGA 3QUHA 5HDWA 3UABA 1S7VA 3T0DA 2OMVA 4LMQE 5MHSE 1CI5A 3L4UA 1B88A 5DRNA 5T1DL 3VSUA 3ET9F 2H3XC 4F58H 3K71B 3O6FC 5KYUB 1NBVL 1GZQB 2AZAA 3QO1B 4Z7UF 1DBKH 1I4FB 4KXDA 3BP5B 4R83A 4LU5L 1NUFA 5FO7B 4M62H 4AZ8B 2DIAA 3GSOA 1OP3H 3QHZH 4PV1C 2DQTH 1ZWIB 1U93A 1RUQH 3EJYD 3WLWC 3E0GA 2VH5L 3OZ9H 1Q72L 3EYVB 1D6EA 3PDDA 5LXVA 1YYMH 1ZANL 3IS1X 5CU5A 7CGTA 1A4KA 1WS8A 1UGKA 1NM9A 3MCYA 4KDTC 4L8BA 4E42A 1R5VA 1Q9WA 1RXLA 4L1DA 1EHAA 4X80L 3OSKA 5IR1B 3DSFL 1N4XH 4J3OH 5FO8A 4S11A 3A6CL 1QR4A 4N90D 3B9AA 4AYID 3GSNA 2VGLM 2VIRA 1XH1A 4IMKA 4NKIL 1KTJA 2P5WA 5KYYB 4HLEA 1SHSA 2O6DA 2OSYA 4GS7B 2IJ0C 2WBXA 3O8XD 4E9XA 3MRPA 4MJIB 1UYWH 4IRZL 5SWZE 5IESH 3DSNB 5C09D 4ZUSA 1YEFH 4TVPD 3RWJB 1MCLA 4RIRA 5H4YA 5DUBB 3VD3A 1C12B 2D0GA 5HGDB 1U8NA 5IJVA 5JHMA 3ABZA 2Y7NA 4HGMA 5IOPA 2DN7A 3HPJB 4OY9A 5FYKL 4NS0A 1AY1H 1RZ8B 1K8IA 1GYAA 4KKLC 4Y2DC 2ZUXA 2FBOJ 3TWYA 4MJHA 1C1EL 4U0QB 1EEQA 1WZ1L 2JELL 5C0DA 5SX4I 1NEZA 3TZVB 3BLBA 4NWTH 4LF3B 4HT1L 4ZMZA 5LLIC 1TTRA 4R7XA 5IQMA 1J5HA 1YUHB 3VTMA 3ZSSA 2QHRH 2HWZL 3ARYA 2GUOB 3MRRA 4V33A 3DTDA 5GGRA 4BSVB 1J5OL 3EDFA 5CGYC 1WAAA 1X5XA 2TRYA 2I9LB 3AZUA 4Y4HA 4N85A 2XWZA 1R0AL 2FATH 2X1QA 4KK5C 3MBED 3SZKC 3G6AB 4CNIB 1ADQA 1CTNA 2H6PA 4F7TB 4YBQC 1CFQA 3WKYA 4M93B 2D31A 3FO9B 3FTYA 1PLCA 2KI6A 5F6IC 4XC3H 2R4RL 4HSQA 1FYTB 3JV0A 2QPEB 5DD5H 4J3OF 3QDMD 5HHVH 3X1NA 2BY3A 2G75A 4G71B 3RWDA 3T3PE 3UTZB 3D51A 2Q10A 1QFOA 1MWAH 3K3QA 4IU3A 1CK0L 2D2OA 1BAWA 4AGLA 2QVTA 1L6ZA 2CHXA 4QOKD 4XP9H 2DD8H 3N85H 5DGRA 5E6IA 4E41B 2C4XA 1JP5A 4WWKA 4OV5A 1T04A 3GMLA 1OSEA 1SLXA 4AKOA 3PWJB 1ZEAL 1SJEA 1AZRA 3P40A 3B56A 4LZHA 3EUUA 4D0CA 1TKWA 3QJZA 3OLGA 3H7BB 4KITB 2I60H 1QNIA 5AB1A 4L0PB 3LKOA 1TMQA 4EDXA 1T89A 3GRGA 4ZZKA 3HCVA 3UH8A 1DTUA 2OYPA 2WJ7A 4PCTA 1CICD 3UTTE 1GXEA 4R4BB 5KVMC 2ITDA 4R96B 5D7HA 4NZRL 4U2ZA 3FCBA 1T5XB 5DHVB 2FO4A 2NXYB 3N55A 3FUEA 1JGEA 3VFRA 4AEFA 4A7SA 3VXSD 5GRVL 2HVKA 3FO1B 2JNZA 4X98A 4FLSA 1S9VA 1CGVA 1HH6B 3QI9B 1MAML 1XGYH 3MLZL 4MQ7B 2JCCF 4JW3A 4L1LA 3DUHA 3ESUF 4NKIH 4DEPC 1ZTXE 3BUPA 3T2NH 1D2OA 1K4DB 2VM9A 2OZ4H 5CN2A 2ZWSA 4ZQKA 1QSFB 3CFIC 4MMZA 4XMWA 1A7RL 4IRZH 2NYYD 1AZZC 5LQBH 3UIYA 1RIHH 4OM0L 5DRZB 1VGEH 3QQXA 5K39A 3ZOAA 2WSKA 4UQ3A 1RIUL 3T71A 4JK0D 5MHSD 2WQ8A 1BBDH 3LIZH 1J12A 1KEML 1TVHB 3B1UA 4NX0A 3Q1EA 4FJ6A 3CLFL 1F4AA 5IJCC 4BSJA 1VERA 1SN0A 4P2RA 2GY5A 4TXVB 2O26U 1WV7T 4Y9CA 1QD0A 3DX6A 5ICXA 4Y5YA 1XX9C 1I31A 4G3YL 4AC4A 2CMRL 3CSPA 3QUXC 2JK5B 3MV9D 5A3IC 5PAZA 4GAJH 5IB4A 1FNGA 3LNEA 1J0JA 3WG7B 5HHXH 2RB8A 1E4JA 4Z7WE 1JPFB 1T21A 2IDSA 3QC6X 4KVPA 2GB2A 4TVPL 2R4RH 1JG9A 4ABQA 1DVFB 4G9DA 5BS0A 1KJ2A 3P1VA 2FB4H 4LPXA 2DLTA 2CIIB 3FL7A 2PMZA 3DIDA 1UOWA 4L48A 2WBJD 4EI5A 5FO9B 2J5WA 2MQCA 1G9NH 4R7DA 5HI4D 1NGXB 4WHTA 3T1FA 1GVIA 2PWFA 4OQTH 1C16B 5JHAA 5KSAB 5L0QB 2DM3A 4Z3HA 4G59C 5CAYB 2NNRA 2DRUA 3TJHD 1HDMA 2OR7A 4H8WL 3U6RA 1ZEAH 4DP2X 4MNQD 3QWNA 2CM6A 4JQIA 5L4MA 4WFFE 3D0VA 3F12A 1MCJA 3R06B 1T2QL 5J1AB 4WO4A 2VXVH 1GL4B 1JFQH 1KCSL 4MX7B 3FCSB 3D09A 2NXZD 4RBPH 3UEQA 3MR9B 1O5DT 2VZOA 5GPRA 4OAWA 2Y7OA 3IDYB 2DZEA 3ARGC 2WD0A 4JANB 5C7XL 3MV7B 3FQWB 5FA3B 1BDYA 2P26A 2QQKH 4FTVB 1WEJL 3G9VA 1CDGA 3HAEA 4PWIA 2IPKA 1K3IA 4V11A 3VGGA 3CH1B 1FO0L 4PRIE 3RUGE 1UCTA 3IKKA 1FV1A 3TT1L 1V3KA 3ZSTA 1VESA 1K9TA 4PJGA 3B37A 4UI2A 4F7PA 4ZG1A 2JJSA 2P43B 1LNUA 1M7IA 1EZVY 3QIUB 1TITA 2Y36L 4ZMXA 3W5MA 1I85A 3TU6A 1DVQA 2Z91B 3VX0A 1GZPB 3CU1A 4WI7A 1LO4L 1I82A 2ADFH 4BINA 2EKJA 1ITCA 2RD0A 4HOZA 3UAEA 2BZCA 3FFCB 1A7RH 2F1AA 1XD1A 1N9PA 3C12A 1NKGA 3QP3A 3JV4B 1GCFA 1AKJB 5CILH 1CMOA 4XNAA 1F0LA 4YDMA 4JFPA 5H37G 4HUCA 3A24A 1XCWA 4X7CC 4U1GC 5EV7A 5FYJL 5BO1L 3BIKB 3NFPB 4ODBD 3LPWA 2R0LH 4QD2E 3U4BH 2J3SA 2V2WA 3TYFA 3WL9A 2ZG3A 1PYWA 1A0QH 3GB7A 4CU7A 3I84A 1UT1A 3CLFH 3WIFA 3GJEB 1BQHA 5IMOA 3TVMC 5ISZB 4F2FA 5LHDA 5FGBA 3KLHC 3RJOA 4BA8A 1IBBA 2QTVA 3ZE0E 2R4SL 4PLJD 2WSPA 1N64L 1DBBH 5C08A 4LSUH 3ORJA 4NQVB 5C0CB 1XGTB 2O5NA 5A43C 3TWCH 1L9NA 1E4KC 1IAOA 4DVRL 3O4LA 1WT5A 1XTMA 3NGBC 2JJUA 1H8SA 4M5ZL 4JGUA 1N10A 4K23H 3U4KA 4BKSC 2NUPA 3L9EA 1PZ3A 4QRSB 4Z76A 1FE8L 2LHAA 3CBKB 1RJYB 4PWKA 4FQIH 1P6WA 5FOJA 1P6AB 3DETC 1P84J 2BWDA 4X6FB 4CW1A 3NJVA 4ZMQA 4PVMA 5GGSY 3BUYA 4LLUB 3NIDF 3ZYJA 1K6QH 4MZIA 1Z5YD 2NZ9C 3TEYA 3SCMA 3QEHA 4A68A 1M53A 1U92B 4CN4A 1TJIH 4MLSA 3L1FA 2AV7B 4G83A 3D18A 1SEBB 4QY8A 3LNHA 4BZ1L 2PYED 3O2DH 3A67H 4NQCD 3W0WE 5I0DA 3PWNB 4G8GD 5JOFB 4OJFL 4AJYV 1CPUA 3JVGC 3NIFF 1IT9H 1FCCA 2WO2B 3I6GA 4NO2B 4U05A 1O9ZA 5CR1A 4J3OC 2W9EH 4MJJA 2N56A 4PJIA 5B1AB 2XKUA 4NQSB 5EU7C 4UMSA 4ZXBA 2G30A 3P2BA 1QUNA 4K3EL 4Y7OC 1M7XA 2IPUK 1KC5L 1WEJH 1MCWM 3ATAA 1RHFA 4L2YA 2YD0A 5IMMB 3RZCA 1NBQA 2YAFA 4TV3A 2P28B 4MKMA 1SZNA 4HPOL 1GZQA 2OTUB 3QO1A 2OV0A 3QJSB 4EO5A 3GMOA 1I4FA 2MOGA 4GIAA 5DJAB 5DVMA 2K6YA 4Z77B 4P9HL 4QXUH 4XT1C 3UGUA 1PZDA 5DD0H 3H42L 3VH8B 4JO3L 1DSWA 4H0HB 3AY4C 2VR6A 1XF5B 1ZWIA 4TNEA 1W72B 1LO4H 4PBXA 2I5YL 1T22B 3ZT5A 3CC1A 1ZVSB 4Y4FD 1AHWB 2EABA 1TTUA 2Z64C 1LDPH 2IAMC 3EYVA 3PAYA 4M48L 4DK5A 4BQ9A 4ODTH 1Y6NR 3NZHL 3QCVH 4ONFL 3VXRB 4RX4D 4AQEB 1YN7B 1OALA 5I6OA 2UXFA 3QZWB 2V9UA 5IR1A 1E5UI 3ATBA 4XB3A 3BKML 4Y5XC 4M7ZB 4NN6B 5BO1H 2ZYHA 1RZKH 5JMRA 3LKPB 4WFFD 3UBXG 2MJWA 1J8SA 2XCMC 2LLNA 1U91B 3CNKA 3RB7A 5KYYA 3MSPA 1XV8A 4QRQB 1ZHKB 4DGYL 1PZAA 1UJ3B 2R4SH 2HRGA 4MJIA 3HZKB 3DSNA 4DAGH 4LZKA 2R0KL 4HUUA 1HXYB 2H9GB 4QDGA 3RWJA 1JRHI 1SLVA 5DUBA 5HGDA 4MVBD 4EZJA 1L9TA 4FS0A 1BIIB 4ZOBA 5LBGA 3HPJA 2NY6C 1LEGB 3OGCB 4DVRH 4PRID 1RZ8A 5DA4A 2G60L 2EXTA 3IDGA 4N22A 3BDYL 3T3ME 1USZA 3J8F7 2E59A 4QGTA 1OTTD 3V4PH 3D4CA 3S5LG 1IKNA 4AIZB 1FE8H 2XZCL 2VR3A 3WCYA 1LJMA 1OTSC 1XGQA 3C5XA 1VRSA 1BZ7B 3CVHB 1IAIM 1G6RL 1MXGA 4DERA 2FJFB 1TJXA 2Q3ZA 2XXMB 2CU9A 3JWNG 3ZLQC 1EO8H 3H9SB 1URZA 2I9LA 2WP3T 1H3PH 3AT9A 3U9WA 2BOLA 1S7RB 2CM5A 4Y4KC 1NC2B 3M07A 4F7TA 5E95B 1YPZF 2YAOA 1TCRB 5BZXA 1KBWA 1ZE3C 4L1BA 5BV7L 3ZN6A 2M8XA 5DLML 5L6YH 2V5TA 3DOHA 1IM9B 5DT1L 5BJTB 4XN7A 1FYTA 1MREH 2E6PA 2NDFA 2XWJA 1EZUA 4ILDA 4YFLF 5EZIL 3HKZA 3UTZA 4Q0XL 3LZFH 3D2TA 2EDHA 5EF2A 1OY3B 3FT4B 5GJTH 5CZVL 4MXQD 4JZJB 1S9YB 3GNML 4E41A 3AMKA 1AZBA 3L5JA 3KPRB 2QZQA 2XG5B 3PWJA 4ES8A 5E00B 5A2KH 4J8RB 1T1ZB 2ENYA 1REIA 5F7BA 5GS1A 3IFNL 2UY6B 3H7BA 5I6MA 3QFJB 1ZTXL 3NYKA 4HPOH 4XCNB 4P3CL 1A4BA 3QDJD 2WZ6A 3W39B 4MQXC 4NRXA 2YGPA 1M7DB 4LDCA 2E9JA 2BO0A 3RURA 1EDQA 1T7YA 2WXGA 3CFKB 5L8LB 2JIXA 3AB0C 2B15A 4R96A 3KD4A 3CDGB 5F0PB 1YSOA 4HULB 5FUCE 1PL3A 1T5XA 2CR0A 5DHVA 4J6RL 1G7MA 1UUSA 3X14B 3ZUCA 3MFGB 2EC8A 4JFHE 1MDTA 3FO1A 5GRZA 1BPVA 3NZHH 3HS0C 2Y9RT 3BKJH 1HH6A 4FQJH 3QI9A 4LGSB 1FZOA 5EU6E 4AGQA 4KRLB 3N41B 5H2BA 2OCJA 4GQ9H 2V4LA 3DROA 2F8XC 4MQ7A 3KEDA 3II2A 2EADA 1SYSB 1UD5A 1MW2A 3GMRB 4KXBA 4U4IA 3SBWA 1JHKH 4E9YA 4N2EA 1RQ5A 5EHFA 2GTWA 4W9JC 3CZLA 2IQAB 1ZA3B 3O4OB 1QSFA 1FFOB 4KRPB 3SDDD 3LDBC 4LAQH 2Q8BL 2R0KH 3H7LA 4EOWH 3TO4C 1FNAA 3ULUE 4UOW0 2MCG1 5DRZA 5HYQA 4CBZA 2YOAA 4B9CA 2YD3A 1VF5C 2C7FA 1I9JH 3V0WL 5IBTL 1CZ8H 3L3KB 5SX5K 2XBTA 4KJPC 3L2NA 1QLFB 3MZTA 3TURA 3MVSA 5FYKU 1I8AA 1TU2B 1XZWA 3RDTB 1JI2A 4TNWF 5K5YA 3ZL2A 1PW3A 1G6RH 2ZWLT 3EH1A 2ZONA 2IMMA 1A9BA 3UERA 2WXOA 3A23A 1V55B 3B7SA 1F8TL 4JFTA 4WUKL 5BNXD 2ZX5A 2EAEA 4PWHA 5CMAB 4P5KB 4RESB 3W9DA 2NCMA 1JPFA 5BV7H 4OFYD 5DLMH 1J8HB 3VGFA 5DT1H 4E0RA 2LU7A 3BPNB 1DVFA 4WWOA 4KXAA 2ZQKA 2YC1B 4XMXA 1W0YT 5EZIH 2CIIA 5K9JL 4D8PB 4O2EB 3V8OA 4Q0XH 3V7AG 3WLBB 2AK1L 1VPOL 3K0WA 3FQXB 5IMLB 1KGJA 3LN5B 5DC2A 1NGXA 2V8LA 4HUXB 1AYOA 5KSAA 1C16A 1XWVA 5DVLA 4FGMA 4DUWA 1Y6MR 5FIEA 4OSUH 3P3SA 4O02A 4QHLB 3LRLA 5I1HL 1BXXA 5I5RA 4X7SL 2JLLA 3LZQA 5EO0B 1HE8A 3MACH 2DQMA 3CGTA 4HPHA 1FUNA 2A2QT 2QELA 5J1AA 2Q7YA 4PY7A 1SBSH 4NCDA 5FX3A 4EQ2A 1CGTA 2B1OA 2X4RB 5EBWA 1AOZA 2DYPB 1EVTC 4MX7A 1KNOA 2Y22A 4PHXA 1ONQA 3IRZA 4S0SD 2F54D 4TUKL 3HOGA 4JN1H 5I1IL 5IBLC 4M5TA 5JR1H 4Z8FL 5AAMC 5E7FA 4FABL 4JANA 2QDWA 3MV7A 5FA3A 2IDUA 3ZK0A 3E6HA 1ZJAA 1OP5H 3CZFB 4J6RH 4D0BA 1D5XA 5SWSB 3S4SG 2DQIH 4F5CA 3BZEB 3CH1A 4QHPA 4IRSD 3RG1C 3DPBB 3RNQB 1Q1JH 1QFWL 3H56A 2ZIDA 5ESQA 1ILUA 5KJRL 4MHHI 4ZOCA 5DMIL 4Q6YA 1YMMB 3OQ3B 4OLUL 1QQDA 1Q94B 2HFTA 1KCKA 2DWDB 3S3SA 4F7MA 2Z91A 2NTFB 1GZPA 1IAII 3CXDH 5JPNC 4XE0A 3KM1A 3O8XC 1IC0A 3W9EB 4K2UL 3UTSB 4RGNB 2GIXA 2D3VA 4I4WB 3FFCA 5AZEH 5E08L 5J6HB 5JHDB 3JV4A 3AUWB 1FORL 2COQA 4WTXA 4R2GD 5LWYL 2DQGL 1JUFB 2XTLA 3NFPA 5HY9B 3KPMA 1TO5A 1WCQA 3SE3C 1YDPB 4AQ1B 2LU4A 5IP4A 2X28A 1IGFH 5E9DE 2YOCA 3P30H 3GJEA 2NY4C 4UDTB 5ISZA 2C9PA 1SOKA 3WS6C 1XZ0B 2ZXDA 4G7RB 1T1XB 3KMDA 2ITCB 1OM3H 3WKPA 1BZOA 4XXDB 4JRYD 1IM3B 1ZLVH 2H3KA 3PF2A 1FSKC 4HMDA 1MCSA 3MBEC 4WFHD 2B0SL 1XGTA 1NCDH 2LLGA 2MHAB 1GH7A 4FXGC 2O6CA 4JFHD 4EEEA 3AREC 5FS5A 5IMKB 3MRKA 3O2VH 3WTYA 5EU6D 3KWXA 3NBNA 5K69A 3POHA 2DQHH 3BAKA 4XPBL 4QRSA 5GSVA 4S0TD 4J2QA 3QUYB 2CGYA 4F8QA 1RJYA 3DJTA 1VPOH 4PLOB 3WNKA 4X6FA 5IW3A 3K81A 3UMNA 4FNRA 1AXIB 1HS6A 4MAYB 2WAQA 5D1XA 5JPMC 2OULB 3AM8C 3L54A 4LLUA 4O2CB 2VDPL 3LRGA 3S36X 5DFWH 4YDKH 3CMOH 4YHKH 2EE3A 2N7SA 3ULUD 3F64A 1NCWH 1UQSA 2AV7A 2V9TA 4QRUA 3ZHNA 1SEBA 3PLYA 2Y24A 3BQUC 3HE7C 3QG7L 4OCXL 3FSWA 5LAXB 3OAUH 4HHWA 3PWNA 4D7BA 1QSEE 1PX4A 2QPSA 2YD9A 4U2YA 1QLEL 4N8UA 4PR5B 1HHGB 4TUKH 4W9GC 1G7HB 2QTEA 5KS9F 5DC0A 1RZKC 3S35L 2PTVA 4NQSA 3VWKB 2RMNA 2WQSA 4DQOH 4IBUA 1KIQB 1IEAB 4N2GA 4PSRA 2YGVA 5IMMA 2DWSA 2ZX7A 4OVVA 1P9MA 4GUPB 15C8H 4TOYL 2IV8A 1QFWH 4YVUA 1NFDB 4GG8A 2OTUA 4UF7C 2GJRA 1T20B 5DJAA 5DMIH 2R9HD 4Z77A 3ARBA 2X38A 4OLUH 4BE5A 2NSMA 3RL2B 3OMAB 3U2IA 3V4UH 1YNTF 3VH8A 2CXGA 3HMWH 1LLAA 2EVJA 2QSVA 1T22A 1UXSA 2P7TB 5DQ9A 1YG9A 1TETH 5DI8B 3KPPB 5HHME 4F15C 7TAAA 4K2UH 4B7LA 3MKKA 3VSVA 4FFTA 5EU3B 3W2DL 3E9TA 43CAB 4ZX3A 1RVFL 3UACA 1IZJA 1F97A 1IFRA 2LV4A 4RGMB 1XF2B 4XBGB 4ZUTA 3SGJC 3MZGB 2B7DT 1B9KA 1FORH 3VXRA 1W0VB 1YN7A 4AQEA 4MMYA 1I8IB 5LWYH 3QZWA 2DQGH 4KO5A 3FQUB 5DZ9A 5ACMA 3BAXA 4H5SA 1OAXH 7PAZA 4I77L 1RULL 1FYHB 3VE0B 1UD6A 4S1DD 5FYJU 2HT3D 3SDAB 4Z3IA 2XN1A 3L3HB 2VMDA 3K2KA 1U91A 3NCFB 2O72A 1A6WL 4QRQA 2B4CL 4RQQA 3BSZH 4AV0A 1PCXA 1UJ3A 3MX0B 5B1JC 4XN9A 1MCEA 3NJXA 2NX5E 3GC3A 5D7SL 5FM5O 4HFUL 2H9GA 3B5GA 5EMYA 3D39D 2VDLH 4WIQA 4YSAA 3ECBB 5GGRY 2OP4H 1QPPA 4FA7B 1YNLL 1BIIA 1AD0B 1LEGA 1N18A 5FM5M 5JIQA 2AQ2A 1N59B 3PL6B 3STZB 4M6ML 4HKBB 1L9OA 4AXWB 5EWIL 3T0EE 4XPBH 2R69L 2WUBH 4QLWA 1Z9SB 1VGKA 3NIGE 4P23D 4AIZA 4FN0A 1D5IL 3SQOL 1EJFA 3IGAA 1JWUA 2Y7LA 5B38A 1BZ7A 3CVHA 3MJ7A 1HL8A 4WW2F 1RZQA 2FJFA 2TRHA 1ECYA 4D0DB 1I1YB 3NCEB 1HJCA 3UBHA 3H9SA 4L0ZA 4NPKA 4EPSA 4PJXB 3S3CB 5FM4A 1UOVA 1X5FA 4ZMLA 5LGHH 1S7RA 4XCYB 5F7LB 1NC2A 4TL4A 1Q9OB 4JDEB 5C6TL 2OMXB 1A1OB 4NKDB 8PAZA 1KT2B 1XCQB 5D1QD 1VFOA 4F2MB 3OAZH 4OCXH 4PY8J 3MXWL 1BD2D 5C0AB 1UM4L 2BRRH 2IC2A 5BJTA 4DFIA 5KVEE 1X5KA 3J7HA 2MCAA 3BWAB 4IGBA 1KYFA 1AGBB 3RZWA 5J0BA 2YMXH 2X1WL 1GGCL 4LCWE 1OGTB 5E9DD 4HETA 3S35H 4J3VA 2XKSA 3FT4A 3SE4C 4J3XA 2PR4H 1CN4A 3PHAA 3KPRA 2XG5A 1LEIB 1QYGL 2D9CA 3AADB 4JDTH 3UDWA 5E00A 1HHKA 2WAHA 3BJLA 3VXQB 1MNUL 1E30A 1MFAL 1YO4A 3K4AA 3THML 4N0UE 2UY6A 3VYPA 1JN6B 3QFJA 4XCNA 1W8OA 3MV01 1CFVL 2YK1H 3X11B 1ZPLA 3ARRA 5I76B 3W39A 2Y6TE 2CLRB 3NJLA 3SOTA 2EIEA 1M7DA 2JJTC 4ZSOA 3GM8A 5E8DL 3O0RL 1X5HA 1R17A 2NY1B 3VXME 4HAFA 3WHXB 3ULUL 2GUYA 1D6VL 2EO1A 4JRXE 2EDDA 1WIUA 1QI3A 5E4EC</