3TX4A

Crystal structure of mutant (c354a) m. tuberculosis ld-transpeptidase type 2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
285
structure length
267
Chain Sequence
RYTLNATALHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGALNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting the Cell Wall of Mycobacterium tuberculosis: Structure and Mechanism of L,D-Transpeptidase 2.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Peptidoglycan binding protein
molecule keywords Mycobacterium Tuberculosis LD-transpeptidase type 2
total genus 70
structure length 267
sequence length 285
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 3tx4A02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3tx4A01
5DC2A 5K69A 4LZHA 5DUJA 4HU2A 5DU7A 3VAEA 5DCCA 4GSRA 5E51A 5LB1A 3U1PA 3U1QA 4QRAA 4GSUA 3ZG4A 3ZQDA 4JMNA 4XVOA 1Y7MA 4GSQA 5E1GA 5E5LA 3VYPA 5DZPA 4JMXA 5D7HA 1ZATA 2MTZA 4ZFQA 4QTFA 4QRBA 4LPQA 5DVPA 3TX4A 4A1KA 3TURA 5DZJA 3VYNA 4A1IA 4A52A 4Z7AA 4QR7A 5LBGA 4HUCA 4K73A 4A1JA 2HKLA 5E1IA 3VYOA 3ZGPA
chains in the Genus database with same CATH superfamily
3H6JA 3DUUB 4JM2F 4ENEC 4ZMPA 5HYSG 4HT1H 5D6DC 3P73B 1E5ZA 1IC4H 3TNMA 2F68X 2Z31C 2A4EA 3UYOD 3G6JF 5F6IB 3JV0A 3S4SG 3L3OA 5I1HH 1CXHA 4IRSC 4YL4A 2OXHA 3H53A 5AKTA 1EANA 4B0MB 3IT8D 4DCQA 4HLJA 4QRQB 4PTTB 4IKJA 5DUPH 4FNTA 1AKJB 3IGAB 4DIXA 1N8OE 4N3TA 3BW9B 1I3VA 3RY4A 5F1SA 4XTRC 4U33A 2JELH 2BS8A 2E7LC 4W9CC 3UTSA 3X1FA 4Y1AD 3BZDA 3L3GB 3VGDA 2GBVA 1DLFH 2L4OA 2H6UA 4U1KA 4L3FA 1DO5A 1PZ5A 4WDIB 3HR5B 4OM0L 3Q3GA 1KIRA 3CH8A 1TQWA 5KYWA 3OTTA 4X5PA 3IU3B 4NPYB 5D70H 1QR1B 3N50A 3CDFA 1LDPL 5EA0H 3ARFD 4LHUG 3QORC 4AH2A 5E94A 5BMFL 3Q2WA 3M17B 3TNMB 1UOLA 4LPQA 1HEZB 4WTZA 4M4RA 1CF1A 3BD5A 5H4ZA 3KLQA 2IDTA 1NGPH 3OAUH 1BAGA 1O5DT 1X5KA 5AOKA 3EHBD 4YDVA 4AQ1C 3QO1B 5DURD 3QPKA 2NQ3A 1Z9NA 3EGXA 1OGAA 5BMFH 1DDTA 3PWJA 1E5UI 2RR3A 4PAZA 5EPMB 1JGLL 1I7TB 2W91A 4OU3A 3K4AA 4W9DC 3CVHB 4NNYA 3WDHA 3SGJA 5HD8D 2A6JA 2DLFL 3WIIH 1KENH 1HT6A 4XBEH 3I85A 1YJDC 3EG9A 4MNQA 1ZTXH 3UROR 5BV7H 3MLRL 4DQAA 1DVFC 1JHKH 3CHSA 1AKJD 2JSFA 3N41F 4JW3A 3MLZH 5DRXA 4MWFB 5AVYB 2R56H 2MSPA 5KS9F 4G9FD 5CLWA 1AD9B 3FF8A 1WTGT 5FUZL 1A6ZA 4P2RD 3VRJB 2GJ6D 4O9HH 1WBXA 4C56A 2TSBA 1GYWA 4IDLA 3M7FB 4ORZC 4Z3TA 4I13B 3ECWA 2F19L 5D1XD 2DQJH 2EH8H 3REWB 4WI2A 5K1VA 1JF1A 3PY9A 2OYPA 3SBWA 1OCWL 3K8KA 5JHLH 2XCMC 4HWNA 2GY5A 5A6MA 3U9PH 3ULVD 1HJBC 3JSSA 1HCYA 3MACL 1G1YA 3QJFB 4GG8B 2CRYA 2J4WH 4Q97A 4TQHA 4OI8A 4J8QA 5DJXB 1JYWA 2X2UA 4JG5A 2XWXA 4OV6F 2QQLL 1NPJA 2RIKA 2BO0A 5HHXL 1OCWH 4QRUB 4XP5L 4BCXA 3CFBA 4EDXA 1SVCP 1YCSA 1TF4A 2I24N 4CADB 4UNTA 3ZLQC 4M7KL 1LWJA 3DX2A 1J05B 5DZPA 1U8JB 4NZRH 3LKSB 4OZFG 3B2XA 6PCYA 1U8JA 1CE1H 4KX8A 1RUML 1N5YL 2MNWA 1U58A 3O2VL 1RK7A 4UQAA 5DHYB 3K0WA 4ZW8A 4MBOA 1E4WH 5D2LB 5GRVK 2ZF9A 3LN5A 3FTUA 2VDPL 3LSOA 1GMIA 3T1FA 4CNIB 1KZYA 4IRJC 3VFMA 2APFA 3GPEA 5I6KA 3RL2A 4JREB 1ZKAA 1GTNA 3A47A 4DK5A 3H3KA 2HTLD 2PF6A 4Q14A 3C5ZB 2XG5B 3V5HB 1M9SA 3BEVB 4K3JH 1ULVA 2C3WA 3B83A 4R3SA 1U8MB 4JFDE 3RTLA 1MXDA 5T33L 4IBUA 1RZIB 2CDFB 2EACA 3QG7H 1SBSH 4FJ6A 4WWNA 1G7MB 2F6AA 4P5SA 3VFUB 5HY9A 2J1KA 2V6HA 1KYOJ 1MPAH 3CXHJ 1WUZA 2R23A 5I6MA 2OP4L 1IFHL 2CBTA 3ABGA 3EO9L 4FQXB 3LZOA 2BP0B 3AXHA 2QSCH 4HZLA 5CEXA 5I2IA 3MUZ1 3ELQA 2J12B 3MRGB 4Y4KD 1O7DC 2EE6A 3VFMB 1PLGH 5J56B 4GRLC 3RX7A 5ES4B 3LSOB 4XNUH 5HDQL 1ADWA 1NUGA 4LHQB 3Q05A 1XQ4A 2EEBA 4DT2A 2Z7ZA 1QRND 1BHGA 5LAXA 3TJHC 1IUZA 3RUGF 2I9TA 3IJYB 5DMKA 3QPXH 1IBYA 4L4VA 3BRDA 4NN5C 1KIQB 2YAMA 5DEJA 5FDWA 1YNTB 1UENA 1TQUA 1ICTA 1F2QA 4M8QA 4HUVA 2F1AA 2E8ZA 5CD5D 2EXWC 3T3MF 3WIIL 2VDRB 4K7FB 3TN0B 2K0RA 3EYUH 2ITDA 4D9RE 4IRZL 4QTHB 4Y19A 2AI0L 2YA1A 5FGRA 1Q9WA 2X09A 3G04A 3HS8A 3OG4B 5KSAC 3B43A 1XIWC 3NCFB 3HS0C 3EG9B 1E4WL 3L1FA 1DANT 1NC4B 2WLIB 4LP5A 5E8NB 4YBQD 1F90H 2AJVL 2R69H 5C0RL 1NCBL 2VO5A 4HS8L 3IKCA 1FYTD 4OJCA 5ILTH 3IGLA 1LP9A 4PRPE 4MSWB 4Z7VB 3TYFB 1XO8A 1DJXA 1O9WA 2FECL 1VZHA 2JQMA 3UCRA 5AZUA 3U30C 4WV1B 1TLMA 2DLTA 3VGEA 2NUTB 2LU3A 3WD5L 3PIQA 2CWRA 3IE9A 3KM2A 4ZUWB 4H0HB 5F88B 1LO3H 2ZUXA 4WI8A 4RAUB 2QELA 3PDDA 3HZYB 2P52A 1X6LA 2WN3A 3ARQA 1XCTA 2ZPKH 5EOQH 4M93C 4TTDC 3MJ8A 1JNNL 4IYKA 4XN7A 1O5PA 3PV7A 2DQEL 2NY4C 2WBJB 4OF6A 5F93C 3QIUC 4HKXB 4JANA 1K8DB 2EDJA 4IKKA 1D7BA 3QFDB 4KROC 3BZ4B 1I1RA 3RIAF 1K8DA 2C4FT 1LO5A 2XXFA 4XRCB 1G9EA 4W70A 2CLRA 3AWEA 5KZCB 3ZKQD 3L2NA 4XZUA 2F53B 2H8PB 2D0HA 2NY0B 4EUPA 1EUUA 5CGMA 1AZRA 3QUXB 1MJUH 4DFHA 1U8PB 2Q3AA 3T4AC 2H2PC 3RBGA 3ZHLA 1A9BB 2FLRT 1LM8V 4FQPA 4P59L 1TZHA 3S3DB 5KZCD 1N8ZB 3WL9A 4N9OB 4NQDA 3U4KA 2CCWA 3W0WE 4JB9H 3Q13A 1WBZB 1TQBC 3TJPA 2AJ3B 2XWBB 1JN6A 4K9EC 4ADGA 4MZIA 5EUKB 4G82A 4ZMVA 1NBZA 1JYXA 4S0SD 1JPFA 1RUPL 2QZQA 4MQSB 4JO4L 3V6OA 4PJAF 3N0AA 4HALA 4RBPK 4YHZH 1E27B 4HPYL 1BREA 1L4IA 2NT0A 3C6LA 3KR3L 4YHYB 5DFAA 2X4RA 1BXAA 3V0VA 4D9QE 1E27A 5HYJA 2XG5A 3V5HA 4NO5B 4AGOA 3LEYH 12E8H 4R26H 2P5EA 4ZO8A 1HQ4B 4R96B 5CGYC 2CUIA 1NCOA 4QI3A 3VD2A 4PD4K 1R5WA 4R4BA 4JGJA 3OR7A 2OMZB 2VE6B 1JXFA 1AGDA 2H4EA 3I6LD 2PYFA 1WCQA 3OR7B 4NXSA 3R4DA 4OZGA 2A9ML 2HRGA 2NY3B 4FX5A 5GS1B 3LTVA 2OCJA 1TJGH 1ETB1 4MGXA 1RERA 2H6OA 2ORBH 4G8IB 3ZE0F 5BS0E 5GSVB 4OCXH 4XNMA 2YMXH 2OCFD 2QKIC 4O58L 1JRHL 2QV2A 3PAZA 1DTUA 3KCPA 3FN0L 4ELMA 4PJHF 5KBDA 2W9EL 3U0PB 1F6FB 5AW1B 3ERXA 1YY9C 3KNBB 3LQZA 2YIHA 4ZMAT 1E4JA 2V2WB 3UAJA 5F71A 3NABH 3SY0B 4F3FB 5C0BE 4C4BA 1TQCB 1KZQA 1BF2A 3VM5A 1N5AA 4NKDA 5JPNB 5DTFA 1Q9LB 4D9RD 1U3NA 3F7VA 3QZMA 1E6OH 1M7DB 2NXYB 4LHUD 1RZGB 2CHWA 5D2NB 5LN4A 4PLJC 2ZYRA 4I2XB 4KKNA 4BJLA 1YECH 4YGVA 5C7XH 1XB3A 4HCRA 3MCKB 4PJEF 4RZCB 1N5YH 1FFTB 4WGWB 3ZMRA 3QDGE 4MAYC 2I25N 4TTDD 2VXQA 2QADB 3LKPB 4MXVF 5BUPA 4QMEA 1FF5A 4OBSA 2Z92B 5I5IA 1M3IA 1BVLA 4P06A 3RE0A 3S3SA 3T0EC 4A2DA 4NJ9L 4K9JA 2F53E 4LASH 3QUMH 3FAXA 1XT5A 1RUKL 3GJFA 1T0NA 3CFKA 3L5WB 4NS0A 2F74A 4TQIA 5DT1H 5ISZA 4IBQA 3G3LA 5ABAA 4K3HA 3SY0A 3S5LA 4KRLB 4LCWE 4F7TB 2Q10A 2JKXA 3VFVA 2BS71 5L6YL 4IMLA 2K3HA 5GS0D 4DVBB 4AEHL 2R2CA 2BRRL 1MW1A 5GZNA 4J3BA 4M5ZH 2B59B 4JG9A 3RWIB 4BSVB 3D12B 4RZCA 5EU6E 1MPAL 4L9DA 3QNFA 2BIMA 3VXUB 2A9NL 3HG4A 1ROCA 3FOLA 4NRZB 3V5KB 3WNIA 2FQEA 5ICYB 1L9RA 1PFCA 3J2PA 3W39B 4ZMQA 1BVLB 4YVNA 1FUNA 5JA8B 3VVVA 1FVCB 2YD5A 1O6TA 3W39A 3UZVA 3RVXC 1C12B 2FX7L 4WGVB 4D7PA 5I1GL 5KVEH 3GTVA 4OB5L 5BVPL 2YEZA 1IIIA 3E0GA 4JO8A 4YHLL 4F9PC 4Z7QB 3X13B 3H8NA 1CICB 2AQRA 3CH1A 3R1GH 3T8MA 4MNHA 3RUGA 3SE4A 3MXVL 2YBRA 4Y5VC 4OW6A 3MV9B 1EFXD 4WHTB 3MOQA 4ODSH 1SN0A 3VFVB 3HZKA 3HMXA 3QRBA 4ANUA 5HPMA 3C6LD 3G5ZA 3HG0A 4IOIA 2APBA 3TNNB 2FO1A 2QVIA 4R2GB 4YO0A 1BG9A 3CXHK 1HXMA 3AUWB 3QPXL 2E9JA 4FNQA 4ES9A 3TT3L 1SOSA 3HFFA 2IAMC 1F18A 3CZUB 5EOCL 5I74C 3RGVD 2EADA 3V4LA 1S5IL 4UOW1 5I0XA 1UQSA 3H4FA 1G7IB 3BAEH 1CICD 5EA0L 4MS8C 2K3TA 1EEQA 4PI2A 1YEDA 3BKYL 1PSKH 2FECI 5K9OA 4H1LH 3TT3H 2AJVH 3L95A 3B9KC 3DC0A 5ESQA 4PJIE 3WKMH 4QXTA 5CP7A 1HINH 3GBEA 4GLRH 1OB0A 3ARUA 1XF2B 4PJ9A 5E00B 3I6SA 5D7IE 5IVXF 4J1UA 5AOMA 3MRQB 4S0TD 2KI6A 1MVUB 4O02A 3FC8A 4JDVB 1E4XI 2XWZA 3SDCA 4Y16C 3D2UA 4Z3JA 1A1NB 5FB8A 1XAKA 5MEQB 1P0SE 3DROB 3BPCA 4LPXA 1A1NA 1ET5A 4GXFA 2R0ZH 4QRSA 4K2UL 1VFAA 1IIKA 4EVNB 3FQRB 3BUYB 4D0BB 2J71A 5TJWK 2IH3A 1LO4H 3CSTA 4OGAD 5T3ZH 2WXPA 4TUKH 2CR3A 4HEPA 4GBXC 2ZPKL 1T22B 5IR1B 5DURB 3MLRH 3S88H 3U83A 2F7IA 2WD0A 1DBML 4TPRL 4XE0A 1ESOA 3WELA 4F8QA 1QUPA 4WAFA 4L29B 1R75A 4W9JC 5J9PB 2H6PB 4FFZH 1J5CA 2EH7L 5ESQB 1ZANL 1YY8A 2OR9H 3JWNE 1TU2A 1N70A 2EEFA 4L2LA 4QHKI 4WF7A 2C9XA 1J0IA 1NDMA 4IRSA 3KYNB 2QFRA 4NM4L 3KLKA 1WWAX 1HNFA 3G6AA 4D9LH 1E67A 1MHCB 4OCWL 3GI9H 2IMNA 4WW1A 4Y1AE 2NYZA 1LGVA 4XCEA 3NTCL 3LKNA 5C09D 4HGMA 2DS4A 3ATDA 2EIBA 4PJHE 4AQEA 5ACMA 3NFSL 3BWSA 4EN3B 5TF1H 3PWUB 4PP2B 4QUOA 5DQDH 1M42A 4GINA 3ARYA 3ET9F 4WU5A 3ZE0E 4OCYL 4RMSA 3ZT6A 1HVXA 4PB9H 4F7CA 3OJMB 4P46D 1J1XH 1CF8H 1QSFA 3C8HA 1TETL 1A6AB 4UQEA 4KO5A 1I8MB 3CXFA 2AQNA 4ZUUB 4JRYB 3JWDH 3FQWB 4AZ8B 4PJ5D 4N86A 5ITFB 4Y4KB 3WENA 1JDCA 1ZTMA 1SMAA 4AEFA 5HGAB 4GMSL 5FLVA 1B9KA 1TU2B 1AP2A 3KPPB 3KYNA 4PJEE 4YSTA 3VXQB 4FAAB 1IAIL 2XN9E 2C3XA 3QZWA 2R0KH 5CJQL 1HNGA 3MLWH 3OJDA 3ZT5A 1W80A 2RACA 3BP7A 1GPOH 4M9OA 2I7OA 3VXRE 1JWMA 4GW4B 1ZT4B 4K55A 1QFPA 1J9RA 3QUMB 4LARH 1N59A 4QWWD 4AXWA 3CVIL 5DT1L 4LSRH 3BVWA 4WEBL 5IQMA 4YHNA 3CAFA 1T4KA 1YRKA 2X05A 3MLPA 1U8IB 3RURA 1GY2A 1S5HA 1AXSA 1C5DA 2NXZD 3ARBB 5IREA 4AKOA 4HUUA 3DMMD 1WS7A 4XP1L 5FLUA 3FQWA 3HB3D 3RGVA 1ETZB 1U4FA 2PP9A 1T6BX 3UTQB 4P2QE 1OT4A 1EGJL 1RU9L 4KXAA 5EUOE 2QJDA 3V0FA 5ELIA 1RSFA 1FVDB 4B41A 4DZ8B 1NJ9B 2CBQA 4OBRA 4X9IA 1R47A 1P4LA 4ZFFA 3KXFD 3BP4A 3V52L 3HZMA 1LHZA 1AGCA 3NRFA 1U42A 2EAEA 1OCRB 1OK8A 1IU1A 5F2FA 2BSSB 4G5ZH 4HUWA 4LPVA 5JQHC 2DD8H 3SYAA 1EAPA 2GYSA 5LDSA 4CVWA 2EDLA 4HIHA 4PJ9D 3SY6A 1AHKA 2GTWA 2B3IA 3BE1L 4HIQA 4IRJA 2VAAA 1S7XA 4LSQH 4ZMLA 4MNQB 5E9DA 4XWOD 2W07B 4YHLH 1CL7I 1U92A 3IXTB 1P1ZB 3PAYA 1VPOL 2XZAH 3ARGB 2C9VA 1U21A 5LBSL 5FO8B 5GZOA 2PWGA 4NHCL 2ZUVA 4PJ5E 4BGDA 3DX8A 4NFDA 4OCRH 1UEYA 1XGYH 3D3VA 4LLMB 4XAKE 2GC7C 3M07A 3L6FA 3D50A 1JAEA 2AXHA 4PJFE 4LLMA 3RGVB 6FABL 2YRZA 2KQMA 5FS5A 1ACYH 2J1YA 3L6FB 5C71A 2IH3B 3VDBA 1YNLL 4HA1A 3MRDA 3RDJA 1B4RA 5EBMB 1KYAA 5I18H 2NR6D 2E8YA 2GJPA 3FO1A 4MNGB 4X42A 2DPKA 4BINA 4HG4K 2AZUA 5EOQL 3IU3A 4KI5E 1S7XB 1DVFA 5J13B 5DHVH 1PLBA 3OL2A 4ZUVB 3G08B 2D2OA 5GS2H 4KVCL 4HAGA 2VAAB 2EO1A 1SJMA 5GRUH 3BPOC 2EVIA 3TO4D 4X5XA 5D8JH 1J8KA 3C6EA 1NCGA 4S1DD 3QI9C 4DN3L 2W5PA 3WO4C 5IESL 2KH2B 4XMXA 1DZBA 1F4AA 1MCQA 5J5EA 2DQTH 2P28B 5JHDB 3AQYA 1K4CA 1AHWB 2VLJA 2YXFA 3APDA 4G2AA 5IB4B 1RZKC 1W9XA 2OMTB 3DUSB 3ESMA 3KXFE 3Q8BA 1OZTG 1TZGL 5JHDE 3CFEB 2YAHA 4JBSA 2HVJA 2AKRA 5FUOH 4ZPTB 1O9ZA 5T5FA 3VSTA 4K5NA 4NPYA 1BM3L 3F12B 3ARTA 1T3FB 5C08E 3GWJA 2XHNA 4R7DB 3WEXB 3DVNB 3WKML 3UTTD 3CSYB 3EXJA 1J48A 4NERA 4C56B 2WBXA 3TH3T 3BKYH 3WEOA 5AENA 5F7AA 1AIZA 1YZZA 4B97A 3GLEA 2C3VB 2YD7A 3HG3A 3QFJB 3Q01A 1TO5A 4XP9H 4JFZH 5D4QA 3S0PA 4B9PA 2PO6C 5J4MA 5I8KH 4EXPX 1TMQA 2JKSA 3KPLB 1RURL 4NENB 1IRAY 5C0NC 2Y07H 4JQIH 1ZLSL 3BAJA 1DUYA 1XHHA 1HHJB 3I3EA 3QHZL 4KH9A 3SIKA 4ZX6A 3O0RL 3NIDF 1ZT1A 5IQLA 1A3RL 3CFEA 3A5VA 3WE6B 3OX8A 5JIMA 3BPLB 3GUFA 1EFQA 1OL0A 3OR6B 4XRCA 5BRZD 5ITBH 1I8LC 3NFNA 1JNLL 1MG2C 3EW3B 1BOGB 2XY1A 2BSEA 2AQPA 2ICWA 1UZGA 2CO6A 4PJ5B 3WN5B 3ZYZA 2BSRA 5BQDA 3DVNA 3VI4F 2BHZA 2X4QA 1DBBL 1YG9A 2WXKA 4OCSH 1E30A 4HKBB 1KTLB 1LO2H 3S37L 4Z7VF 3MLYH 4HMEA 3RKDC 3MGOB 1VA9A 4M6OL 3SOBH 2ZT9C 2V5YA 1CDGA 3B56A 4KZEL 1YO4A 3IB4A 5J89A 1I3GH 4HT1L 4DZ8A 2A73A 4ODWB 1KPRB 4RGND 4O51B 2EKSA 2ESVA 2VLRA 2XXGA 4WW2C 5I8CB 3L3OC 4ODTH 3V0JA 5T3XL 3W38A 5E95B 3ZR6A 2UZPA 3GNML 3NSFA 3C08L 1I3RA 3HBZA 1S7SA 1DJGA 3NJVA 2BDNL 2H5UA 4GJTB 4MQ7B 3WG7B 1MH5B 5SWZD 3NTCH 5DD6B 3RVWC 2NTFB 4N2CA 3V0AC 3OLGA 2X4QB 1FBIL 1ZS2A 2L7JA 1CFVL 3WNPA 4FYSA 5C09E 4DP7X 4NZTH 5ACZB 4N5ED 2WKOF 1KB9K 1WBXB 1JWUB 4ZFQA 5DD1H 3NJIA 1KCVL 1PF3A 1QUNB 4HISA 4AV0A 3EFDL 5D2LA 5BUAA 1AGBB 4D0DB 4B5EA 5I8KL 3VFGH 4MXWH 4LL9A 1WCBB 3H2QA 1SRDA 4OD1H 4R8WH 1CFQB 2H2SC 4L8CB 4FEMA 2AV7A 1E8XA 2E46A 4JANB 4WUKL 1NCIA 1PD6A 1N7MH 2XFGB 4FZEL 1AQKL 3LDBC 1CB4A 1OAKH 3PWPA 1WAAF 5AWNL 1NBVL 1T89A 3OGOE 4U1JB 1VPOH 2G5UA 2XZAL 1ILSA 3WMPA 2W1NA 5I6PA 4M8RA 3K71B 2P1YA 2X4NB 3DO4A 3JWDC 4I9WD 2ZUQB 4KC3B 1FIEA 1WZMA 4NJAH 3QQ9D 5E9NA 5JIHA 5HYFA 3CHRA 3N1PC 1OCCB 2LOEA 2X4NA 5EZPA 1E65A 5FKPA 2R7EA 5FYLD 2AQ2A 1NCWH 1O6VA 2X70A 2VR7A 4KO7A 3F65A 4Y2OA 2N4IA 3DO3A 1I1FB 2DWYA 2CE6A 5JIPA 5IZ7A 2EYRA 2G9KA 1NC4D 1L0YA 1VRSA 4F7EB 4NCC1 1CC3A 5CFAA 2WVSA 4MJ6A 1CPUA 1ND0A 2V7NB 4L8CA 3BN3B 3JVGA 1OGAD 2AF2A 5AW0B 4Z7UE 1VFBB 2G5RA 3KG5A 3W11C 2IADA 3HNTH 1IM3A 1FFPB 3VACA 3UABA 3T0VA 3KGRA 2B9AA 5E2VL 1KXHA 3ENEA 3ZZ1A 3MJGX 4KKCC 3GXTA 4Q58C 5I6LA 2KUTA 5DRWB 3KPNA 3VD3A 1M1XB 3L4WA 3VWKD 1O7DE 4K7FA 3X14B 3U0TA 2V9UA 2DJUA 4FTVE 3ISYA 2NT1A 3NACL 4NUPA 4RSVA 2KKQA 4TNWK 1YAZA 2AK1H 2X2HA 3R18A 3TJEL 1SJEB 5B8CA 2VM9A 3N04A 4OF7A 1GAFH 5HHPB 3RZCB 3ZGPA 2AERT 3PFUA 1IC7L 3HKZA 4QYOA 3V0DA 3H0TA 2KERA 5IBTH 3WFDL 3MRGA 1P2CA 4ISVA 3OHMB 1PD0A 3P40A 2MMXA 4EKJA 3BDXA 1JL8A 4RQQA 4MQXC 1SDYA 4YC2C 3FUIA 3LOWA 5D7LB 3O6KH 1G7QB 1UWXK 4M3JA 3S3PA 3GJFB 1VFBA 2NUTA 3VWJC 3HUJE 1H6UA 5DVPA 2GQHA 2FDBP 5F3HA 4FQLL 4Y19E 5GGUB 4GXVH 5IMLA 1H19A 4U6XB 2CIKA 1A6UH 1RV6X 2UWEA 5CMAA 5D7IF 2XYCA 2BSCA 2CGRH 4U6XA 2GEEA 3L5XH 3CSFA 3ZTCC 3QUKB 1Y6NR 2WWKO 1JPEA 3OXRB 2ZD0A 5FK9B 2VQ1A 5GS0L 3L5IA 3TVMA 1MCSA 4LRIC 1P4BH 3AW5A 3GI9L 4XGZA 5JORB 3VQ2C 1GYUA 4NZDA 4LOVA 3UBHA 5JDJA 2JQZA 2NOYA 4AMKH 2E9WA 2Q8BH 4W68A 4DOHB 5B4MC 1MHPH 1T89C 3P4MB 4GIOA 1PEWA 3FU8A 5MI0C 3MA9H 1FVCA 4I0PC 4FZ8L 5HHQA 1IM9A 4H1LG 3DURA 5KSUA 4ZW5A 2F5AL 1RULH 4Y2DC 4WFGD 5INDA 3QPQD 3G5YB 2J5LC 4FFYA 2CGZA 1K2DA 3F7PC 4FHKA 2X0UA 4BSJA 4AQAA 4JFZL 1E40A 1MCDA 4L1LA 5T3ZE 1HZHH 5CEYA 1XGQA 3HHSA 3AAZA 5CN1A 4WI0B 4NC0B 3DJSA 4N87A 4M7JL 5EORL 3VU1A 4UM8B 5E0QA 1T1WA 2A6KB 5HYQA 1AC0A 1NWOA 4HH9B 3N9GH 1Y6MR 2NRDA 2YZ8A 2X4PB 3QNYB 4B9YA 2YO3A 2IC2A 4HQQH 3UL4A 3LVTA 3FB8B 2QL1A 5MENE 2IG2H 1GGBH 1S78D 4HF5H 4MA3A 2A4CA 2E9BA 1LO5B 3AREA 3F01A 2YD0A 3FCUB 5E4EB 2VDRH 1EMTH 1J8RA 2TSAA 1WQVT 5F89B 3T5WA 2PTVA 1RQ5A 2BC4A 3RHWK 4OLVL 2NX5E 2YJQA 3IDJB 1FHNA 5F7WC 4YHKL 4J3WA 4WU7A 1G7LA 1VFUA 2XX0A 3S4SA 2BOCA 2C9RA 3ES6B 2Q7NA 4EI0A 2EJ1A 5AW8B 4XCCH 5JW4R 3LS4H 4X8XA 3RWFB 3GB7A 3DV6A 4CL7A 1SBBA 2HUHA 4UWQB 3ARSA 3NMEA 1WISA 4FADA 1RL1A 3VD1A 5ICUA 2B4CH 4L3EA 4FQIH 2VIRB 3TA3D 5LN8A 3IN0A 4J3UA 3MODH 3NIGF 1FYTE 5B38A 4PB0L 4KOBA 3UG3A 2XIBA 4QRRA 4K8RC 3DIFB 4FQJH 5HYQB 5ICZA 3PQYD 2HT4C 5B1AB 4RAVB 5F9JB 1INQA 3MRRB 1FNEA 1YMMB 5CILL 1D5XB 3BLBA 3COOA 3BQUD 3ULVF 2W0FB 2GAZB 2G9HA 2N59A 3CCHB 1J5HA 2CRMA 1T22A 4WTZG 5D72H 5IR1A 2C9UA 2PWHA 1DVXA 3QHFH 4WJKB 3QEQA 2BIOA 1F8TL 4Q4EA 1U8KB 1MJJB 3CPUA 4G70B 4TQEH 3RZWA 1R3KA 3RNKA 3B1UA 5DEGB 5CCKL 3V5KA 2PXYB 1QVOB 2PCFB 5DEFB 4EZMA 3BCDA 4TNFA 5FB8B 3LPWA 4AUUA 5I1AA 3PDGA 4FD0A 2Z6FA 4X6CE 3VB9A 5I6XC 5JPMC 3EXLA 3MRFA 5DK3A 1CE1L 1N0LB 1R33A 3DXAB 5TDNA 5C6WH 3CN3A 3QFJD 5L8KB 4N2LA 2DLIA 3A23A 5HJBA 4BQ9A 5DR5H 2F2HA 3KPQA 3W37A 4WIQA 4GFXA 5SWSB 3GJFK 4U2ZA 4F15B 5CJ5A 1YMMA 1CQKA 4PJ7B 1WRFA 3BGFB 3II1A 4JHAL 5E2WH 5MP6H 4DVBA 2C1PA 2FB4H 4HHGA 1AXIB 4A7TA 5KS9A 1AOZA 1JYNA 1JXKA 4PRPD 2Z8VC 1ET7A 5MERA 1XGUB 4HP5A 4GAJL 3N41B 5FK9A 3WGVB 1UOKA 1WHPA 3FT9A 2ZIDA 1NUFA 4DFIA 4ZTPL 5HGDB 3DSNB 1G6RA 3MNZA 3ETSA 2CPCA 2D73A 5ALBH 4DKDC 3GHBL 5DJ2A 4BKSC 4PGDB 3KJ4B 1F4WL 4UAHA 5JZ7C 2CRIA 1KGCD 4H7VA 2P80D 4K8RH 4HAKA 2BPBA 4PLKD 3VMOA 4P23C 3BN9C 2V8LA 2VLLA 4A7VA 2YGNA 2V33A 3UG4A 1TPXC 4WU5B 2IPUK 5HHQB 4X9FA 2FBJL 3S6CA 2YEZB 2JKIS 4PJAE 4BWTA 3ZE2B 4G8FB 4ZFZA 4IS6B 3HE7A 4HWBA 3MV8B 4FG4A 3FQXB 5CM1A 5C0CB 1F02I 2G3MA 4TSBH 1A7NL 1TCMA 1P84K 3QUHA 4NBXB 3KPOA 1AJ7L 1YEKL 3G5ZB 5MENA 3TV8A 4NKMA 1PY9A 1JZ6A 3GRGA 5HXMA 4UM8A 2GJJA 1K3IA 4JDEB 1HL9A 4R0LA 2Y5QA 3RA7L 1T03H 3IFPB 1JGEB 4Z18A 2JCCE 3HNVH 2CMRL 4YPGB 4F8OA 1FVEA 1DSYA 2AFNA 3IFPA 3QQ3A 4TRPH 2DWDB 4PG9A 5DZAA 3SDDB 1N26A 5JQ6H 3LV3B 1TTUA 1UYWL 2PN5A 3WFHB 2AK1L 1TYRA 4KPHH 5B3JE 2BVOA 1FHGA 4YHIA 4LAQH 1FDLL 2X0VA 2WB7A 4MZ3A 5DGQA 1A3RH 3OKYA 3SE6A 4QRFA 1DFBH 5C0CA 3BRFA 1V05A 1QPPA 4Y5YC 1G5AA 2Y7NA 1W0VB 2CXKA 1S3KL 3DGCR 4WNJA 2ROYA 5FYJD 4ZFZB 1ZLSH 3WY2A 4IOSD 3O9WB 5IF0B 3MJ7B 4TUOA 5I15L 4UTCA 5HPMB 4XXWC 4P3DA 4ODBD 3H2PA 2ZKMX 4I9WE 4HLZG 3V10A 2FZ3A 2CDGA 3D85A 3EFFB 3KGSA 5D1ZC 3I74A 4JKKA 4EI5C 4XPHL 1M57B 4M62H 2MCAA 3MCLH 1WTLA 4HPYH 1H3PH 1FNEB 5B7EA 1J0JA 5KYYA 3LX9A 4UQIM 3T6WA 5BRZE 3VXNB 2WLMA 4YR6B 2N7BA 3AREC 4XBEL 1S7TA 1EXGA 4NSKA 4HD5A 2KLTA 2DTMH 4XXCC 3SD5A 2FRGP 5DQJA 2H3KA 2OW6A 1WA0X 1T5WB 1WBYA 3K6IA 3OHXB 4JG0H 3N1MC 3TM6A 4KWUA 5EZLA 3JQOB 5T3XH 2MHAA 5B3JF 3VG0L 1NGQH 4M6OH 3SOBL 1TZ8A 4CVUA 5G55A 3SGKC 3P2DA 5C0AA 1MVUA 2YWYA 4O02B 3TV3L 3DX1A 3U6XA 2O30A 2BXYA 2G5BB 1L7TH 2NW3A 3D3VB 2DIEA 2LU7A 4R7NA 2Y1ZA 4DP9X 4X5XB 4NQVB 3IAQA 3FN0H 4URKA 3MRFB 3BZFA 1ES0A 2WAHA 4KK8D 5AVUB 2NY6C 3BW9A 3KDPB 3MODL 4I3RH 3CVDA 1PDKB 3E3QE 4A7UA 5IEHA 1TSRA 3SPJA 2FB4L 3QXDA 4MYPA 2HPTA 2VXSH 4ORGA 4NN6C 1U6AL 4Y1AA 3O4LB 1RZFH 2VXUH 3LZQA 3DI2B 1UJ3B 4L1HA 2RGSA 1W8EA 1PZUB 5B1JA 2X44D 1KGIA 5IM7B 4JRYA 5ADOH 4A1KA 3FB7A 3IJ9A 4BUQA 3FONB 3WLBB 3C2AH 4ACTA 1IGTB 2P26A 1T7VA 1AQ8A 4EOWL 2DV6A 4UTBH 1F3JB 1MXGA 2I9LA 2E59A 1EZLA 2VDRL 3SE8L 1UD5A 1NLBH 1X7SA 1E28A 2ROXA 4K3JL 4KU1A 5C07D 3H4HA 4PJAA 4YDVB 5CCKH 1L9SA 2ZX5A 4Z5RA 5IEKA 4H26A 1BFOB 3O3DB 3PHQA 4RFEB 5DK0B 5HVHC 1II4E 4N8VA 3DRTA 1EEZA 2G3NA 1LEGB 5C6TH 5A40E 2H0JA 2ODHA 3K6DA 3IS0X 3QIWC 2EZ0D 5AVWB 1QLRB 3EYFA 4BEIA 3DVGA 4YBLB 3QISA 4EZJA 3WGUB 1P5UB 4JM2C 1HDMA 3R7RA 4ZPVA 2D31B 2XNAA 3H42H 3NG5A 4M93B 3W56A 5AAPA 5KYWB 3O6LH 2K8MA 4AK2A 3NA9H 3NFNB 1M1SA 2NY4B 5D8JL 4BFFA 5DYFA 4XVOA 3IDYB 2VLJE 4CGUB 1EAOA 4XNUL 4GS7B 2XOTA 3UTQA 3T65A 2J25A 4L3EE 1CYXA 3GMOA 1RJLA 3D52A 3NJKA 5A2CA 3HC0B 1AGBA 3B6SA 4BH8A 1LO0H 1D5MB 5D1ZD 5AW7B 3ZDYE 2R2EA 3UTSE 3V6FA 5IW6B 1DFBL 1RIHL 1X5ZA 4IMKC 4MAZA 4TUJB 4F8NA 1KSRA 4PIRF 2IAND 3T1FB 1XCWA 4JFYB 4DP1X 3PGFH 3O0LA 2Y23A 2YAFA 1CGSL 2WWMD 1XGTA 3IU4L 3SDCD 1U8LB 4QRRD 2WXRA 4N8PA 4YJZL 2DN7A 2J43A 3PHOA 4LASL 3PQYA 2XV2A 3V9CA 1F11A 2XVLA 1WFTA 4LQFL 1J9TA 3D9AH 2CNYA 4JDTL 1URLA 1UOWA 4ICXA 2VUYA 4JZJA 3BOVA 5DD6A 3V55A 2VZVA 2NY6D 1QNIA 1F90L 2Z4QB 4PV1C 3X12B 4HG4J 1MCHA 4ZNEA 2ARWA 5AB9A 3QEGH 5D5MA 4ZO7A 2J8OA 5K1NA 4LRNL 2X6AA 5SV3A 2IQAA 3NIDB 1GC1C 1JMZA 2ED6A 4F8LA 3ROOA 1GGIL 3T6ZA 1GAFL 1QUNA 3BN9D 1AGCB 3DIVA 2VDMH 1E4XL 2C4XA 4U1LA 3JT0A 4ZFGH 4KKRA 1JGUH 2W80C 4OIAA 3I9IA 2JJSC 1KJMA 5EEZA 1CFQA 2UY6B 4GAGL 4ZTEA 1F4WH 1OK0A 2SODB 3H1ZA 5CEZD 1KJMB 1KXVC 4LNRB 4KV5F 5LGHL 3LKOA 1NC2D 3CFBB 3G5XB 2VN6A 1E2ZA 1JZDC 2VDNH 4EI5D 4D3CL 4JFEA 4KOCA 3TFKD 3MJ6A 4N0FB 4PLKC 1RZQA 2E75C 1JWUA 3P9WB 2I27N 2DWEB 3P1VA 4YVUA 6FABH 5HHPA 4PWGA 2YUZA 1VGKA 3VDCA 2Q7YA 1WFIA 3U9PL 3MRDB 4XMKH 3ZJAA 4YSQA 1AAJA 4PRBA 5E1IA 2DQHL 3DJRA 4WI7A 1OB1B 1SBSL 3B8YA 4WK4B 5D7SL 5GZNC 3A24A 4G1EB 1MW0A 4URTB 3RA7H 1VSCA 3LS5L 1SM3L 2V2TB 3TBSA 2YZ1A 2HRLA 4R7DA 4HKBA 2JWYA 5TD4A 4KKAD 4AIZB 1MKFA 3VI3E 4F7KA 1LQSR 2CUAA 3TEYA 1I82A 4M4PA 3WYRA 1IBGL 3FT2B 2FCBA 2N1KA 1OAYH 1HZHL 1IEAA 3PYCA 5TE7L 1VKXA 1XIWA 1KOAA 3TONA 4WNSA 4Q9QH 1DBKH 3SGDI 4AE0A 1IC4L 1UUSA 3DYMA 4H26B 4RGNB 2GVYA 5F7KC 1H3TA 4FDWA 2KBGA 1I53A 5JHDA 4GQZA 1EV2E 1QWUA 3WJMA 3X17A 4JFTA 1QFWM 7FABL 1OAJA 1GZQA 3DOSA 4KKAC 1DHKA 1A2YB 3S2CA 4PCTA 3O8XD 1JPSH 4D8OA 4PJFB 3IWVA 35C8L 4XP1H 2LLLA 4A7GF 4X6FB 5E1AB 3QUYC 5KBMA 4OLZH 4GAYA 4JKLA 2DQGL 2B1HL 3FU7B 3A6CH 2FX9L 3C8DA 3FFDA 3FT2A 3O11A 4YSPA 4FQJL 25C8H 3QSKB 4RQQB 3QUXA 1H5BB 2AEPH 4I1RA 5D7LA 3SKOA 3H7BB 2OR9L 3WE1A 1SPDA 2UVFA 4XT1C 1UXWA 4K8RD 5CSBA 4FNRA 1XSIA 4FQXD 2UY7B 4XO4A 4HFUL 4W93A 5CEYB 3WEAA 1YC7A 2BDNH 2E9GA 4L8DA 5AVSB 4JFHD 4APQC 2JCCB 4HJUA 1KLFB 5KSBF 3ECBB 3MFFA 3D09A 3D3VD 4L4VE 1MI5A 1ZK9A 3BH4A 1SYSA 5JHLA 1HJCA 4MKMA 4MMYA 2IH8A 4FQQB 4OZ4B 4RFNC 1SM3H 5J11C 2YN3A 1JP5A 4TQEL 3B2UC 1AGDB 1WZ1L 1MY7A 2FL5A 3C60D 1CK0H 5GGSY 1BM3H 4JVPA 1XF4B 2BNRA 1W72H 4A1RA 2XQYG 2L8AA 1K5WA 5FCSH 2CKNA 3I2CH 4JZOB 4E36A 3RU8L 3IJSB 3T0BA 5F3BB 2VTFA 4LO9A 3PP4H 3LXUX 1MCFA 5DO8A 5TF1L 5CUSL 4OIFA 3RNQB 4Y2OB 3BDBA 5CMAB 1GYVA 1YN6A 1I9RL 1MFAH 4HXAL 1RUAL 2YPVA 2GIMA 1E9PA 1NCDH 4M3HA 4ZOBA 1DBAH 4QRPA 2XX1A 1RH8A 1KCKA 1AMYA 3FUDA 3D05A 1N10A 4LLUB 2UX7A 4PD4J 4IU2B 5C0JA 4K5LA 2ZCHL 1A6TA 2HVKB 2RB8A 3EF4A 1N6UA 3NPSB 5D2LE 4E41E 3QPQC 4GMTH 2W60A 4WK2B 4Y2DD 3OKDB 2BFGA 1VGEH 3SEPA 3GIZL 2O93L 4Z3HA 4NUJB 5H37H 2QVTA 3QUYA 4U1JA 4ETQA 5KN5A 2FK9A 2OBGA 3AXIA 4XP5H 4BQ6A 3VG9B 2C3HA 3L13A 3PNWB 3MYZA 4OZIB 4KI1A 4U6TA 3EJZC 2BOBA 4B9CA 3B3BA 1U0QA 2VQTA 3CQPA 2ZTBA 4QXGH 4YGVB 3MRKA 1NMCB 5B8CC 4XN2A 5IHUL 2PWFA 4G8IA 5FUOL 3S35H 4Z95L 1Q94B 2WXGA 4L5FL 4F1ZA 4FGMA 3EO1B 4PLOB 2VSDA 4PIBA 4MA1B 3FB6A 5HI5D 2P24B 3F7KA 5KVEL 2FUQA 5GHWH 1DBJL 4PJCA 1KC5L 1BG1A 1AMXA 2ZXCA 5TF0A 3NT0A 4LLUA 7PAZA 2GJRA 3CIAA 3FQUB 1BXUA 2FEJA 3JVGC 2GBTA 4LPUA 4JAMA 5CU5A 4BFNA 4E0RB 1HQ4A 4FYQA 3FQNB 1KNOA 3PL6A 4LSUH 5L88H 3BUTA 4EN3C 3EOYG 4P2AA 1BECA 4GW1B 4QHLB 4LOEA 3T8XA 3TJEH 3VWKC 3K2UL 4BWUA 4ELMF 1BMWA 3FF7A 1KBVA 3ASWA 1OE3A 5KVDL 3G9VA 4QHLA 2A9DA 2AJXH 3BP6B 1MSPA 2C9SA 4NZTL 4ZOCA 4Z8FH 4OIIH 1Z3GH 2R7EB 2DEXX 3L9YA 5J12C 1JHLL 4ZOAA 3EJYD 3U4EA 5LO7A 3ZDZB 2WUCL 2P24A 4GW5A 1CGUA 4Y4KC 4G7VL 3JXAA 2DZEA 3QDME 2PKDA 5FHBH 1HFUA 1CUOA 2PMZA 4KNSA 2WXJA 4PW4A 2MOGA 1FZMA 1PX3A 4OZGE 1IAKB 4JJ5A 2Z4TA 1JWSB 2V2WA 1CG9B 1Z5HA 3S48A 3MRHA 3CFTA 1MHEB 3H2WA 1M9WA 1ZIBA 4NHCH 1AGFA 4V2CB 5I66B 3EJCA 2AQTA 5D70L 4EQ2A 1G4RA 2YD3A 1ORQB 4RMVA 3LRMA 2O6DA 5FM8A 1J0ZA 4MNHB 1E4XH 1MG3C 1RFDL 3UTPD 5GS2D 2E7LA 1QEXA 4AYDC 1P6WA 3KWVA 1FFNB 4NKMB 2XN1A 1XSKA 1FZKA 5AVQB 3NCXA 2LLGA 3U9WA 5FGBA 3TBBA 5DR5L 3LEVL 4AL8C 1UWXH 3UP1A 4ANKA 3CFNA 1CIDA 5T3ZL 4YDLC 5C3IA 1AO7D 4Z9KB 2R1XA 2DJ4A 3PNRB 4XPHH 3ROLB 2BFVH 1N6VA 2FX8L 5CBAB 2XDHA 4LCYA 4IOSA 3TVMC 3BFWA 1NGXA 4ILDA 1KGXA 2ZX6A 2CHZA 4OJYA 5IHZB 1RZ8B 3QRGH 3L3KB 1ED3B 1UURA 4FXGC 5EU7C 2BRRH 5A2BA 5D7SH 3TFBA 5CZVL 1A14L 4YZFF 3UAFA 1CG9A 3HUJA 1PKQA 1X5JA 3L7FA 3TZVA 4ZMWA 2PLTA 1YUHB 4QXTB 1FZMB 4OD3H 4JZOA 4YFEA 2E4FA 3QUZB 4HJSA 2XWRA 4AWJC 1IX2A 3MTRA 1BF8A 2Q76B 2AVFA 4MWFA 2IV9A 2WYHA 5I19H 3ZO0A 1UM4L 4I1PA 1ZJAA 4IMKA 3QIWA 4DP2X 3TO4A 3U7WH 3ZZQA 3C6SB 2EVJA 4AENB 1KB5L 4YSSA 3RIFK 2RCSH 3TC9A 1I1YA 1N0XL 4UT9L 4G6AC 4AQOA 2X12A 4X5WB 4NO0A 4L4JA 3GBLA 1H15A 4DN4L 2Q3XA 1IZJA 5DC2A 2IFFL 3V79C 4PU2A 1A47A 4XCCL 2WXOA 1SDAB 4JO4H 2X89A 3MRJA 1NCWL 3PGDB 1YHPA 2GCYB 1IKFL 3VFRB 1QATA 3B9AA 3OSVA 1G9HA 5CJOH 4XNAA 5JO5A 3DO7B 2R8SL 2FD6H 1E8ZA 4W1TA 3VFRA 3KPOB 5AVXB 3FUNA 5FA3A 1QVOA 1D5BB 3W0WA 1CD8A 4PP1D 1UD2A 4BV1A 1VZIA 2XFXB 4WVRA 4OT1H 4D8PB 2H0EA 1HXMB 2CGYA 3O3EA 4KI5D 1KG0B 3K5RA 2ZUWA 3C8KA 4MXWL 4X4MA 3Q2LA 4FTVB 2K45A 1GC1H 1LE5A 5L4MA 4ZMTA 1GS6X 5GZOC 4OCSL 3BUYA 4FTVA 1Y0LB 2ADIA 4WI5A 4O58H 1FSKB 1WFJA 2LQRA 5DO2D 4KO9A 3WNNA 3R4RA 1YAIA 3X1GA 2VZUA 4WEBH 1J5OL 3NPZB 2HFGL 4G9FB 1J88A 1AHWC 3MRJB 4UQ2B 2BVQA 2VR4A 3DYPA 4TVSa 4X6DE 1KCWA 2X40A 5DFVD 5F1NA 4DUVA 3WS3A 3EBAA 4FQ1L 5E6YA 1B2YA 2YOAA 2VLME 1R6VA 2QMJA 4W9LC 1HSAB 4ADJA 4KXCA 5K9KA 4Y4FD 4TSAH 3SBPA 5I26A 4NFBA 1FYTA 4ERSH 3DV6B 5E2TH 1ZJBA 3S5LG 1S9VA 3VX1A 2R69L 3D8MA 1XXFC 4G8GB 4HSQA 3U2IA 1GIGH 3GO1L 3O3EB 4V1DA 4N8VG 1ZWIA 2IDCA 3W3BA 4E9RA 4JN1H 5ILTL 5JHMA 5FXCH 5JW4M 1QRKA 2HX7A 3BEWA 1FL6A 1FC2D 4ESKA 4BZYA 1A7PH 1LP9E 3MI6A 2ESVD 4PRPA 5F96L 1YPZF 4J4PD 4F9LC 1OP5K 4I0KA 1JK9B 1KLUA 1XF1A 2QQNH 3P9MA 2Y5EA 3ASOB 3EH3B 3O4OB 4EIUA 1SEQL 3C9NB 3GS7A 5EIQA 2OYKA 3RU8H 4ORGB 1QW8A 5F7DA 4CC0A 1BZDA 5DLLA 4LRNH 1MAMH 3FTVA 5JDSB 5F96H 1T5WA 1WBYB 2BERA 1N68A 1U8OB 4KHTL 1FORL 4F8PA 4AZ8A 1UB5A 3VGAC 1CQYA 4HEPG 1CBJA 3QCVH 3GHBH 3GMOB 1D3CA 4L8SC 2NY2C 5DHDA 1UH4A 1UA6H 4XC1L 4XNYL 5CBEB 2X1WL 2Z7YA 4HDIB 4WFHE 2AK4D 5CBAA 4L8BB 1NWPA 1FVEB 2YPVH 3EAKA 4UT6A 3REVA 4AK1A 4V1DB 4ZD3L 5JZ7D 3IFNL 3H85A 1QLEL 2X9YA 4P2QB 5HHOD 1OALA 3F5WA 3H9SA 1VF5C 2HT4D 2LT9A 3QI9D 1GW6A 1T7YA 4W4OC 3KLLA 2OL3H 5EU6D 2AXWA 4APXB 2P5PA 4FKHA 4PRIE 3ZRSA 1UXMA 4G8FA 4TPRH 1RCYA 5FOBA 1DLHB 1M71B 2DMGA 2XXMB 1IFHH 2C34A 5LKNA 5K93A 1FO0A 2IVFC 2R0KL 1UCTA 2DYPD 3DBXB 3IKCB 4NOFA 1HESA 3IKKA 4HWBH 2JLLA 2BNQA 1RZKL 2PPEA 2K9UA 3L16A 3N1FC 3OWEA 3S5ZA 3DVIA 1M3JA 3JWNG 2IIJA 1OO2A 5F6HI 2ZUTA 5I16A 2BNQB 1PZCA 2VNCA 4RESB 5E8EA 5I1GH 2Q5BA 3S8GB 4FLOA 1QWNA 2DH3A 3CTTA 1HL4A 4Z77B 5B22A 3PXLA 3F84A 3L5XL 3M45A 4PVBA 5JLZA 5JW4Q 1WHOA 3C09B 3H9SE 2WP3O 3GEWB 4MJ2A 4BA0A 2GSGB 4UM9A 3PHQB 4RFEA 1PYWB 3VD7A 3F7YA 2OMWB 3EDKA 1D5MA 3H9SB 1PS3A 4Z7NE 4LCVA 3FYIB 2R8SH 3V6FB 3OPZL 2K70A 5D1QB 4LCCB 2R69A 2OTWB 3T08A 4GQPH 5CZKA 3T3PB 5D7JA 4ZDHA 4WGKA 4I85A 3CGTA 5A2KH 3MJ9H 4G6AD 4KFMA 1QAWA 1LK2A 4XWOC 5HDBB 4RETB 3WLWD 1IGMH 4P2OC 2IWGA 3SQRA 1IV8A 4P5TC 6TAAA 4P5TA 4G6FD 4IJ3C 2ITCB 3CV5A 1OE2A 1YA5A 3QNXA 4B27A 3VXSA 3NZ8A 3V95A 1FA4A 3U4BH 3LHPH 1Z32X 3QZNA 1K8IA 5LCVH 3E1ZA 3B2VH 1IVTA 1DJZA 1HKFA 3UGEA 4F7PB 4ZNCD 4GAJH 4BK5C 4G8AC 3GLDA 4ETYA 4UM9B 2AXFA 2X42A 4DZBB 4S11A 1COBA 1UXLA 1BZOA 4H8UA 2D4FA 1SMOA 5JXAL 4WFEE 2GSGA 3MTXA 4YUEH 3HB3C 4G71B 4NQDD 2HFTA 3P0YH 2HG5A 2J6WA 4I48A 4O2CA 1MLBA 4PJ8A 3KBHE 3BUQA 4W81A 4AIZA 1WFNA 3KPTA 4DO6A 4KPHL 4WWKC 3WV0A 1ONQA 4U1LB 3HZ3A 4Y4FA 2F0CA 4FLHA 4ZAKC 3GDCA 4KTEH 4EUPH 2GJ6A 3QRGL 2WKLA 5LGJB 3ELAT 1U95A 1EEYA 2FD6L 2V8MA 1JGUL 4LCWD 4WSKA 2P5ED 3EDEA 4X6BB 4Z3EA 3GEFA 3HHMA 1A9EA 1D7DA 4PCSA 2V3EA 4CMMB 1A8JH 1U8HB 3LYRA 4N8UA 4DZBA 2LABA 4YGAB 2XPGA 2OAAA 3WN6A 2APSA 4NO0D 1NCAH 1W15A 2BP3A 1BLNA 1FV1A 1PQZA 3SJVB 4G83A 4FZ8H 4P9HC 1I8KA 3US1A 3SO3B 5D1ZA 3SPVA 2J8UF 3GYRA 2FO4B 1A6PA 3UPAA 1CFNA 1ZCRA 2ICWB 3A6OA 4PJ5A 3TESA 5F9WC 3D1MC 2E7CA 1UB5B 3IF1A 2FJHA 3NFSH 4H1LB 3Q0HA 3CHPA 1FL5B 4N1HB 5JNYB 3E8UL 4NKDB 1I9IH 2RCSL 3AXLA 5E94B 2XJKA 1AR1B 1RP9A 3VFGL 3QDGD 4OQTL 2V9QA 4BH8B 2Z93A 2A0LC 3ATFA 2ED9A 3EOBB 3DVFA 1TZIA 2J1XA 4XCFH 5ETUA 2VN4A 4Y9BA 3JBG7 4J23A 3HI6L 2NXZC 3MSPA 2ITDB 1U8NB 8PAZA 4IEFA 2P8MB 1F41A 3U2SA 1PQZB 4QO1A 4M7ZB 1RZ7H 1U8NA 3UGXA 2DYPA 4PSPA 1NUDA 1GZQB 3DOSB 5IQNA 1P5UA 3RWDA 1HDMB 1IFRA 1JZEA 1NTDA 2UX6A 4PS7A 4S10A 1LQBC 1JFQH 3RX9A 2FYVA 2OTUB 4YFDB 5IBUB 5AG9A 4Y16D 4MCZA 1XF4A 5DZLA 2XZQH 3I6GB 5TE4L 1T5XB 4KVNL 5E1AA 1QSFD 1ERNA 1TEYA 3HVNA 3QCVL 5BPPA 1MCJA 5I1HL 4QEGA 4AEHH 2WVVB 2DI9A 1K85A 4V2BA 2DM2A 3MREB 5CZRA 1CXFA 3LNEA 4LF3A 1SHMA 4EXKA 3CFUA 1MFNA 4UAOB 4MAYA 4N0UB 5M95B 1Z9MA 4KMLB 1JCKA 3K8MA 1NCJA 4GSDL 4RMRA 5JIIA 3APCA 3IVKB 4Q74A 5DXWA 1ACZA 4LKXB 1IAIM 4NZJA 3FO2A 2ZJSH 3RWJB 4WNQA 4QO1B 2KL6A 2E86A 4L8DB 1A6WL 4N2MA 4O2EB 5CILH 4K8RL 4WO4A 1JPTL 2AV7B 2LAGB 1M2OA 2P44B 1F11B 4OUOA 2AXJA 1DE4A 3N0PB 2ICCA 5CGTA 3QP3A 4GG6F 4B95C 4POZD 5I75B 1PZSA 1H0DB 2IJ0C 2P5WD 2HMID 3NRPA 1NC2B 5F44A 4N0FA 1I85C 5EU5A 1RMFH 3IXAA 1QOKA 1MCNA 2OJEA 4LRIA 3MGOA 3I3BA 5ACZA 1MREL 5BRPA 4Z8FL 2CBPA 1A9VA 1XGRA 2YBRB 3D07A 2IALB 1AI1L 3PJSA 2HLEB 4QCIA 4YZFE 2QQLH 4U31A 3TO2A 4B9ZA 3GSVA 4ONOA 2FH8A 1G7PB 4MS6A 1KJ3L 2C5DC 1BBDL 3TIDA 2KZWA 8FABB 2HLFC 3K4ZA 1DQQB 3SPCA 4QGYA 4JLRB 4FQHB 4O2EA 2BZDA 4G1EA 1CZ8L 5EV7A 2CO3A 4XC1H 4LKXA 2QPFA 2X3AA 1Q72L 3U0WL 1JV2B 2G60H 3B3IB 3MUJA 2J2ZA 1SQ2N 2X4OB 3GMNB 4H8VA 4RLDA 3RI5F 1UCBL 3BGMA 3LN9A 3LKOB 1CCZA 3TBYA 3HVDA 4NWUL 1CZ8H 4J3OG 3SYQA 3D9AL 2HFEB 2K6WA 1FRGL 5I0DA 1Q72H 3U0WH 1KBGL 3PWLA 3BVNB 2JI3A 4AJVA 5KSBB 2OMYA 1Z9PA 3NIFB 4TSCL 1GOFA 4RSYA 3P3UA 1EJOL 3PGCB 1UEMA 3AU0A 1AXTL 2ZICA 3GSNL 3QDMB 4LOUD 4RZKA 1MIEL 5DVNA 1QSVA 3TO2B 2P9RA 4K0OA 2CD0A 1I8KB 1EAQA 4JFVA 3RJQB 3VB8A 4Z7WA 4XE5B 1L9PA 3HTLX 3FSVA 4HIPA 1CD1B 3VA6A 5CKAA 3BPCB 3NCWA 1CLZH 4LBEB 1Q0EA 2G2RA 1NBQA 5ANHA 4NT6B 2C8NA 4TUUA 2IPTH 1FPTH 1N0XH 1KPUB 2Q8BL 1JVLA 4OLEA 2G2RB 4HZ1A 4KQ4H 4JFEE 5EOCH 4DVRH 1IILE 5EFIB 3U7WL 4LNRA 1P6FA 1S7VB 1TVBA 1PZ5B 2N7SA 4WDIA 2ED8A 4MJ5B 5E1QA 3RYMA 3IJYA 4TQPA 2OI9B 4B7LA 1XSJA 2UZXA 4Z23A 3N85H 4OJFH 4KJYB 1UZ8A 4PV8A 5CSGA 4JO3L 2RH0A 2C7FA 4LARL 3V6OC 4AGLA 5JYLA 3L7EA 2B1AL 5GSRA 2L04A 2WBWB 2OXHB 3QO1A 5F7LB 1LD9B 2VC2H 2XQ0A 4Y16A 2HJLA 1H3PL 3U82B 4BK8A 5LVEA 3U4EB 1Y7MA 2F58L 3HNSH 4OZ4A 4FXKA 3QJXA 5D7KE 5BO0D 2ZKHH 3E1F1 4GIAA 1ETJA 4JFWA 2HLAB 4PRHD 3FT4B 3QWRD 4PYGA 2DIBA 3QUZA 4F33A 3V4PB 1A21A 2CKBH 2GPZA 3FQNA 3KJ4C 3O6FB 4HIJA 4JFDA 1KJ2H 3IMBA 1OTSD 2P7TA 4N9GA 5LHDA 3V4PA 4KKPA 4WWPA 3T3PF 2O5ZH 1KB9J 2VDLH 2XN9D 5BVJB 1JIBA 1W72B 4FQ2L 4LL4A 1F4YL 1TJGL 4S1DC 3S35L 1WAAA 1GRWA 3K74B 4YWGH 4DK6A 3ZKNC 4KTGA 1GZPA 1U33A 1HEZA 3N42F 3MRPA 3WIAA 5CGYD 3IMRA 1TDQA 1PX8A 1QSEA 2IAMA 1TZAA 2BVPB 2WOBA 2WTOA 4PRDB 3UBXB 4DH2A 4ZO9A 3LQAL 1MJ8H 4ONFH 1MI5B 3E9UA 3L9BA 4PTUB 3GMRA 5T8IA 35C8H 4HK3N 3W9DB 3SE4C 1HEJC 5SX5H 1MF2L 3ZGHA 4EQ3A 1HNYA 4YEFA 5I66A 2YN5A 4OY9A 1JTOA 1CL7L 1YEFL 3PJSB 4KAQL 4EDXB 5KOMC 4P9ML 4N4YB 3UZEA 4CMHC 3FHAA 2WTPA 2VW7A 1NOFA 3TEXA 2HVBA 5J1AB 1X9UA 4Q9CA 5I17B 5I0ZA 4AH2B 4HWEH 3KYKL 4U3HA 2AGJL 4WJ5A 5AVZB 5AB2A 1QSEB 2GJZB 4XP6H 1MI5E 3KPSE 2Z0BA 4S1SH 1KCSL 1Z9OA 1F1AA 4FF9A 5CCJA 1OGAE 4KROD 1BFSA 2MTPA 3GSUB 4WO4C 4PH8A 4Y4HC 5IBTL 4YNYB 4AJYV 3O9WC 5FGSA 5C70A 3SKMA 1NM4A 4K23L 3GMRB 4P5KB 3K2MC 2CLVB 2IDSA 1T7XA 3GLAA 1BZ7A 3STBA 3BIKA 1H3GA 4GW1A 5K9OB 1WC7B 1GSMA 3BVNA 5IHUH 3FT1A 4P4KA 3VO0A 1JK8B 4GB9A 1GJUA 2W65A 2Y3NA 2XTSA 2YKKA 4AY0A 4R7LA 4XVTL 1QLEH 2W65B 2WGNB 1QFHA 3B2MA 4R26L 3RWFA 3GB7B 2IH1A 2W81C 3CPLB 3HJEA 4HGWB 3FB6B 4NNPL 3OMZA 4QNPF 3V4PL 3L5JA 1D5ZB 1X5LA 5IJCC 3AQZA 1GOHA 1CBVH 2PPAA 3AS3A 1EEUA 4JPIA 3QZOA 2AEIT 3WTUA 3V5DA 5C07A 3BUBA 4P5KA 5CN3A 2LR4A 5KVGH 4M5SA 4RBPH 2VDPH 1KGCE 2CDEA 4MJ5A 3LNDA 4ZJ9A 3JTTB 1QEWB 3CDYA 4YSAA 4KUCF 1N2RA 5C2BH 4ETQB 2XV3A 5KN5B 2B1AH 3WIFB 1UATA 2IBBA 1YJDH 4MBRA 3SBRA 3B8SA 2HA1A 3TZVD 4KMQA 2OX5B 4BH7B 5KANI 3WUZA 4W9GC 4MDJA 4HULB 1C8PA 4K7PY 3HAEG 4ZMXA 1BYNA 4XPFH 4JPVL 1TNMA 1SVZA 1ADQL 3GM8A 4AITA 3MOBL 3CXDH 1Y18A 4LT7A 1D5ZA 4H44C 1EXUB 1ZSDB 4LU5H 3K3QA 5B3NA 1IEBA 1MCIA 4ERSL 3G5VB 2BP0A 2PCYA 2EE0A 1T0NB 3CFKB 3L5WA 4IS6A 5DYOB 3BLKA 4NUQA 1MREH 1KELH 4M8VA 4NPKA 4F2EA 1E90A 3D39E 1NBYA 2BSTA 4NDMA 3TN0D 1P9MC 5MENB 4A2MA 3LEXB 4PJIF 4JN2A 4NKQB 5EU7E 3ZDXE 1CGVA 2ID5A 1CVRA 1SLXA 3Q1SH 4PRAB 1SXNA 4HEME 5E2JA 4GUPA 2BJML 5SX4I 2D7OA 2J8UA 4XXDA 4A2LA 4YPGA 3WFEH 1KN4L 1H8SA 5HGDA 5EEVA 1D7FA 2VZ1A 2V4LA 3V0WH 2WXHA 1RZ8A 3L3KA 4S1QH 5JXED 5D7KD 3ARRA 2PR4H 4N25A 2O1AA 3HIZA 1FGVL 1EPFA 5IB5A 5CJXC 3JTSB 4AGPA 4JDZB 3NCYP 4L37A 2FJFA 4DAGH 1IGJB 2EC9T 1U3ZA 2MIZA 1IEBB 2FJFB 1WWWX 5C0IA 3BWAA 1NCHA 2RAMA 3UYRL 2GG1A 4DOHE 2ITCA 3PUCA 5A2JH 2CLRB 3JT2A 2F7RA 5I1DA 4MSWA 1A7OH 5BV7C 4QRAA 1NICA 1CYWA 5D7JC 3TPKA 4OCWH 1KDIA 4CBPA 4D8PA 2J8UB 4GMTL 4CDHA 2NY5H 1KFGA 4U1MA 4E41A 5C08D 4JFED 3NIFE 2VT0A 5EOTA 3LS5H 3BKCH 1G6RB 3MNZB 4W6XB 3SKMB 3I6KA 5KSBE 2A9CA 5GRJH 1UD8A 4AQ1A 4ZMOA 1XEUA 2HSIA 4XOCA 5IB5B 4WHYG 4XWGH 1B0RB 3QEHB 3STLB 1G7IA 4N0YH 5I73B 1EA9C 1S7TB 1KB5H 2J4WL 4G43B 4N5EC 2F1BA 2OMWA 2WZ0A 3HAEH 4LGSB 4NFCA 1ZHLA 1KY6A 4X7FC 4I3SL 5E6RB 5H37G 4NO5A 1AFVL 4M7LH 3EFOB 1O7VA 1QA9B 4XP9L 4QGTA 2PUQT 4FI7A 4AW4A 1I9IL 1YDPB 4LGRB 3OKMA 3RP1A 3TZVC 1UA6L 3LMJH 4NN7B 4PJBE 4XMUA 3RPIB 5IG7B 3GBMH 1KN2L 3ILQD 3ISWA 1VERA 1BQHA 4O5LL 4UU9A 4BCZA 4DO5A 2OK0L 3OQ3B 4WFHD 1QQDB 1IBFA 4PRIA 4OZHB 1JMXA 5GSVA 1IGML 3PIQB 3E6FA 1A4KA 2OMUB 2FEEL 3DROA 4QF1A 5FUZH 4F5CE 2O6EA 4D0DA 1SEBB 1RUPH 3QB7C 1CE6B 5F6IC 1SQMA 2Y06L 4CU6A 5E6ID 3FSOA 4KRNA 3RFZB 2B0SL 1XCXA 4H13C 5C97A 3II2A 3ILPA 4DUXA 2NX5A 4R4NC 2IOMA 1MHPL 4HS3A 5E6SB 5GJTH 1GCFA 1XEDA 4MDJB 3E38A 4QTIH 4JFDD 3BEVA 2M2DA 4BUGA 3NZUA 4AVJA 3B9KD 1BZQK 3N91A 4XVTH 1S46A 2JIXB 1IQWH 4FFZA 3FO0H 2XUWA 3PWPD 4OLWL 5SWZB 4F93B 1NAKL 4M43H 1I1AA 4GXUN 3GSNA 4GRWB 3S97C 5AG8A 3BVDB 3RGBA 4N8VB 5C2UB 1BQLL 5CLTA 3O41A 4DP6X 5I28A 2IAMD 2VLJB 3OB8A 4IIZA 4M8UA 5KWYC 2VDPB 4BKLA 3QWOA 3EKCA 1QSED 1OE1A 4DJMA 3QCUH 3A4EA 3ARFA 3LHAA 2ERJB 2AQ3A 2EVGA 4OZIF 3LEXA 3C5JA 4O02H 4S2SA 1X5HA 3N5AA 3WLBA 2DQIH 5DHMC 5KUMA 4XMTA 5FM4A 4W9HC 4ZD3H 3CN2A 2EYTB 3D0AA 1HOCB 2I9TB 5CAYB 5LQBL 3MREA 1T1XA 4PJXA 2OSXA 1KCSH 4GKOA 3F64A 4OKVA 5K9KB 2QZ5A 4NP4H 3RL1A 2D7TL 1FFOB 2FJUB 3GSNB 4R6UA 4YC2B 1EZSA 3KW8A 1GA2A 5EBWA 3BFQG 5IEKB 5SWZA 3PUUA 2FBJH 3RWJA 1PLAA 4XI5C 3S7GA 1IGYA 1JVKA 1A0QL 1UACL 5HP5A 3IRZA 4UCFA 3D06A 3GSRB 2XWEA 5CJBA 3RZCA 1G84A 4KJQD 1JWMB 4GW4A 3L81A 2NXYD 4GO9A 4IK6A 4XHQA 2A77L 3ZQDA 3OR6A 2AC0A 5C09A 2QR0A 4MMXB 4QYAA 3DDFA 3CX2A 3EJPA 1MHHA 3K81A 5MEND 2E3VA 4Q6YA 5AZ2L 2CM6A 1OEZW 1E0OB 2IPTL 2P47B 4D3CH 1WK0A 1WFMA 3L9EA 4BFIB 3EBHA 4YS4A 2QGCA 4KQ4L 2D2CC 3ESOA 1ET8A 5E4OA 2NR6C 2X6BA 5FWRA 1OT2A 5HDQH 5HJDA 4WV1A 4E9SA 1CBVL 1FFOA 3OLEA 1RJLB 1HHGA 3FU5A 4CSZA 1LDPH 3K6SA 1AANA 4PG2A 2KLRA 4LEBA 1HHHB 1L5GA 2B59A 1GYCA 1IE5A 1USQA 2Y2YA 2YWZA 4P3CH 5I1LB 3BP4B 2ARJA 2QLVB 2JELL 3IJEB 4C83A 4F2ME 3ZSSA 1JSYA 3B2DC 4M02A 2FWOB 4I4WB 1EAJA 3GJEA 1YYLL 4K5MA 3TWCH 1R3LA 4H8WC 5FM5M 1NOAA 3FZUD 3FUHA 3QDJA 1L6PA 3R0NA 5DJXA 1FO0B 3DETC 4M6NL 5JW4N 2ITFA 3GSWB 2E56A 5A3IC 3DLQR 4JVWA 3X12A 2V17H 1J87A 3RVVC 1Y6KR 1DJWA 5HJGA 3NPSC 3SDYH 3D0VA 3IS1X 1IGIH 1I31A 3HZVA 2JF1A 3QR0A 4PS4H 1S7QB 4JREC 4HPOL 5SWQB 4CUCA 5ICXA 5ID0B 4UZGA 3GUTA 1XH3A 4BWWA 1XGQB 3HHSB 5A2LH 2F54D 2ZG2A 3V0WL 3KJ6L 5CJ8A 4P99A 4KKZA 4HFUH 3TIDB 4YXKL 3LRSA 3S3JA 2BIQA 1S4IA 4JPWL 4DW2H 2X2IA 3ILPB 2NUPA 1R3HB 4NKOB 2JFCA 3VWJA 2QDWA 3GXNA 5I71C 5IFJB 2NUPB 3JV6B 2ZWNA 1FH2A 2FX9H 5CINL 1MDTA 3AXLB 3ETBF 4Q0XH 4DGYH 3GSWA 4M1CD 2LTQB 3JV6A 1KEGH 5EULV 1ZEAL 5ESVA 5HYJD 5IY5B 1AY1L 2W92A 1A9EB 3LQAH 3TA3C 1XGPB 4QHMB 1PX4A 1UM4H 3DTDA 3FFCE 3KWWB 4P2OA 4AIXA 4UINL 2XA8L 4QHMA 2YQ3A 3UIZA 2CO7A 4XP4L 5TQ0H 1OSZA 1MELA 2QBWA 3GSQA 3I2CL 3C08H 4JGNA 2ZYIA 5HHMB 4G8EA 5GJSH 1SDDB 3QFGA 3RFRA 3VQLA 5ICXB 5ID0A 1PL3A 5FCUH 3KYOA 1KBBA 4UZSA 1HZLA 3TV3H 5DLML 4OUUB 1WDAA 4Z7WB 2WLZA 4MA8H 3Q44A 3I6GA 2EDYA 4ZPTA 3P9LA 5D5ME 2X4OA 4RDQG 2ARJQ 4OF5A 3Q6GL 3BH8A 4D2NA 3DHPA 1UZ6F 2AGJH 2I07A 3ALXA 4NWTL 1N5AB 4FA8A 1QSFB 4P46C 5LGJA 1MWAH 1MI5D 1X7QA 1XIWB 3ATEA 3WDJA 3L95B 1XZWA 2BW5A 4UI2A 4Y0GA 3VD0A 3QJQB 5IP4A 3LKQA 5K59F 4E42A 1A1OA 5DJZA 2HKHL 2PP7A 2Z65C 5AB1A 3AGWA 2ZXWB 4KXDA 3QG6B 4HMCA 4I2XA 1GKOA 3IMSA 3KLAA 1CXKA 4QHPA 2W0LA 2DWEA 3FN3A 3QIBA 3CDCA 3SDXB 1OSPL 1VEOA 3GIZH 4R90H 3BGFC 1MQKL 1T6WA 4X6CF 3ZR5A 5I1AB 2EC8A 5A6LA 4NLHA 1FJ1B 2XACC 4AYFB 4LBEA 1ZHNB 2A4ZA 5I0YA 1P2CB 5T33H 5IBUG 5JQIB 1HQRA 1P4UA 5AOIA 2WANA 1KCUL 1JZGA 1NGZB 2CO6B 4UF7C 1T83C 3KPQB 4UNIA 2WC7A 1QLFA 1V3MA 4Z1PA 4KZDH 2VISA 4GSDH 4JRYD 4MJIB 1LP9B 3SGEH 1PKOA 4XZ4A 5B7MA 1A6AA 3UMNA 1N19A 1OWRM 2IMMA 1SJHB 2FEDC 3GKZA 3HC3H 3AT0A 3BT2H 2ADYA 2MCG1 1GSKA 4P46A 1W0YT 1CFSA 1KCRH 3GXUB 5C7ZA 1HZKA 3HJ0A 1ETZA 1WSST 2D3JA 5LGKA 5D4HA 3LPPA 5INCB 4JN1L 4IU2A 5C0JB 3VXRD 1JJUA 3B3IA 5KG9B 4LCUB 5DJ0A 2WSDA 3CSGA 5E2TL 3EJQA 1R5IA 4X6DA 3NQIA 3NDYE 4BFEA 1UFUA 1WC7A 3GMMA 1IAMA 1XDTT 3OKOA 4NRYA 4Q8BA 4JZJC 5ECGA 5JYMA 1H9DA 4F33B 2B2XL 4EDWH 4WKZB 4WCYL 1NEZA 1XGRB 1E4KA 3BHBA 3TJHD 4L18A 1P4IH 2H1PL 4K73A 1U92B 2LE9A 2V7HB 3N55A 5JXAH 2AS5M 5D93B 3BAYA 4F37F 4QRPD 3QRLA 2BY3A 1MFBL 1XF3A 1P53A 2Y6SC 3O3UN 3VUAA 3HE6D 1D6EA 4JGUA 5DD5H 5HGAA 3SE3A 2E47A 3ULUD 3K7UA 2P45B 5LNDA 4S0HA 3IFNH 1TJXA 1KEGL 2O5NA 4B9JA 3JYBA 3BAEL 1BQUA 1JGDA 2VDNL 5AQ0A 2A83A 5IW3A 2HJKA 2YJLA 3WUWB 4B9FA 4HS8H 1A3LL 2HJKB 2YAPA 3CZKA 1P4BL 1OP4A 2QPDB 4KJPC 4DEUA 2VR5A 3WHE1 4HJGB 4BDVB 5IB3B 2OZ4L 3O6LL 1NCAL 4U6VH 5B3SB 5JOFB 1HX0A 1NMAL 2ZOOA 3IXTA 2VLKE 1UGNA 1BQKA 4OZGB 4PV9B 4XAKD 1Q38A 1GGYA 2WQSA 4X99B 3SOTA 4HPOH 4ZQKB 4PM1A 2GBAA 3CUPB 4X6CA 3EUUA 4HJ1A 3J8F7 1MJUL 3NN8B 3QQ9C 4IKNA 5DVKA 4MVBC 3HHRB 5KBPA 5ERWA 1C08A 3Q48A 1XZ0B 4NQEB 4I18A 1JPST 4F91B 1FGVH 4DKEH 2QLYA 4TLTA 3PREA 5D2NC 1OIOA 4X4YA 2YD6A 3INOA 4LZHA 5E8DL 2BY0A 4JPIB 4DPRA 4Z95H 5TE6H 2ZX8A 1G94A 2I07B 4P2QD 4YSUA 5I19L 2AEQL 2BNRE 1R4XA 5KBLA 2CO1A 2QTEA 5ADPL 3TASA 2HFEA 1MW2A 5C0ND 4U1HA 1TJIH 1C7TA 5D6CB 2NY6B 1ZS8B 4MTMA 2H2SD 4G6FB 3N40P 4R7XA 2AK4B 5JOFA 4EDWL 1UH3A 1KCVH 1YY8B 5HTSA 3BDYH 2D7QA 3BP6A 4BDVA 3EH5B 2YBGA 3M17A 1LVEA 3Q2VA 2IPUG 1MJJA 2BP5M 5D4IA 5I24A 4AMXA 5TGBB 1O9VA 2B8OT 1Q94A 3FTWA 4GKLA 3O3BA 4Y2NA 4NQVA 3VNYA 3G6DL 4BZ1L 2DIAA 5F72S 4KGLA 3B37A 4FXKB 4X5LA 3FU6A 1DQVA 1XZ0A 4OT1L 5FYKE 1H3UA 3V4UH 1PD1A 2ZAIA 4FFVC 4JY6A 2QGBA 3BPNC 3WE6A 4JPVH 3QR2A 3VI3A 1RVFH 5T1KB 1FG2B 2QGDA 3UEZA 4NYLA 1FAIH 4H8WH 3LRLA 4FEIA 5T1KA 1T5KA 3TBTB 5J0BA 4AGNA 2Q8AH 5J13C 2G3XA 3V0IA 3V4UL 3N44F 3ZOAA 1WGVA 3IAGC 4G6JL 1SYVA 4L0PB 5KEZA 1RVFL 2ADGB 2HT2C 4JZNA 3UTPE 1NBCA 1NGPL 2ZCZA 1P5UC 4JM2B 5BZDA 3DIDA 1KT2B 1ASOA 3VXQA 4NO0B 3WTTA 4KMTH 4TSAL 1R5IB 3MRNB 4L05A 1QMUA 2EDFA 2VAJA 4XN9A 3APNA 4PGDA 1TLKA 3GMMB 1J7VR 4F7MB 4FQ1H 3ML9A 4GY4A 4WEUD 2D9CA 1TG8A 1IBZA 3FT3A 3VGHA 5DF0A 2EH7H 3U7AA 2VMFA 1HSBA 2BP8A 1UADC 2C9AA 2MCMA 1MIMH 4XX1E 1HC1A 3FTGA 3D69B 4K5PA 1MFVA 2OMVA 4MDIB 5I74B 3SODB 2R9HD 3QORD 2NY2D 4JKWA 2PWEA 5DDHA 2VXSL 3RPIA 2PYEB 2MKLC 1AOHA 3MBWA 4J2QA 5DZ9A 5K1JA 4JHVA 1IJNA 1ZGLB 3MV01 1WAAE 1AGEA 1QFUH 2NY7H 3UTSD 3TU6A 4JPKH 2VZSA 1M6OB 4UU9B 1NAKH 4M43L 5AEAA 1JHTA 3QIBD 4HC1A 4DK3A 3GSUA 5D1QE 3RTQB 3WTWA 1F58H 2ZJSL 2WZ5A 3MBED 4MMZC 4X5WA 4AIEA 2AQSA 7FABH 3GRWL 1KTJA 4PTUA 2IEPA 4JFYA 3ZDXF 4QXVA 4XP6L 1SEQH 3O9WD 3ALPA 4L37B 1YPZE 5D1XE 5I8EA 3UO1H 4HH8A 5C9JB 1NSNL 5TQ2H 1G1CA 5J06A 4AEIH 2AJSH 5A6IA 5T1DL 2V2XB 3MBEA 1RUQL 4GUCA 1YEFH 4KAQH 1OPOA 2JKWA 3D2UD 3BZ5A 1FCGA 1G7HB 1MCLA 3ZTJG 1OAKL 1UT2A 1DVUA 2OV0A 4I18B 1K5NA 4J27A 5LCVA 4AENA 1A6ZB 3SDAC 4W9ZA 4E5XA 2J56A 4U05A 1NCDL 1CTNA 3S96B 4ZK8A 3MZGB 2CUHA 2R23B 3PPEA 5FYJL 3W1ZA 1F4XL 3DX9B 3VX0A 4M7LT 4H25B 5DYOA 2W9DH 4OGQC 4H25A 1M05B 3FO1B 1RZPA 2VMDA 3ASNB 3C5JB 4S2SB 2AJZA 3P2BA 1EO8L 4X6DF 3AY4A 3FW6A 4IOFD 5FGCB 2P8PA 3O2WL 4IU3B 1V27A 1MIML 2MQ0A 1DVSA 1J9QA 3MBEB 1CK0L 5D1XB 3CSBA 2FVNA 4HKZA 4DKFH 3CFQA 3J07A 4HS3B 4RMBA 2HX8A 3ZL4L 4CC4C 2HKAA 5DTFB 3UG5A 2F08A 4M3KB 2VJ8A 3OBAA 2ENQA 3X14A 3K71A 1GZHA 4XO9A 3QUXC 1Z7JA 5HGHB 1YJDL 2LAAA 5C92A 4PFEA 1P7QA 3S96A 4XPGH 2AZAA 2BSDA 4OAWB 1DQDH 5GGTH 2IFFH 3WHXA 1OPGL 2X4TA 2A38A 4ZX4A 3UYPB 2EIZB 3MCLL 2AI0H 4B3VA 1MWOA 2R4SH 3NK4A 4LSVL 3LD8B 1Q4NX 1MCPL 3QEUB 4PJ9C 43C9A 2UXGA 3STZB 3K2IA 2X4RB 1U8OA 4MB1A 1I7RB 1RXLA 4ONFL 1BJ1J 4PJIB 4JM2A 4QKTA 1AS6A 1A4JA 1JNHA 3GS4A 3OAUL 1ZLWH 3MA7B 2JJVA 2UXFA 3CVBA 3N1GC 3IJHA 5KBKA 3DRQA 5L8LB 1SGKA 2HZHA 4U1GB 4XBGA 5K9JL 3TBVA 5HSFA 5GS1C 5JXEA 3NFPB 4EIGB 2JXMA 4BSVA 3DX6B 5E99L 3GBDA 3SDXF 2B77A 2BP8B 4MDRA 5BXFB 3F5WB 3NJMA 1LO3L 4GI9A 5F0JB 3OF6D 1XH1A 1Z0NA 2DQFA 3EGSB 4EBQL 4WUUA 5BOPA 5KVEE 5E4IA 4AMWA 2ZOWA 2QDVA 2XRAH 5EOCJ 5IJKA 4ZNEE 2WQUA 5IB1B 3PFQA 4F9PA 1V54B 4WO0A 3QEQE 1JXDA 1GKEA 3FFDB 2VLKB 4Y5YA 3WEMA 1E8WA 4UMGA 1WZLA 5DUPL 3MV7D 3GTNA 3THMH 5HI4D 5B39A 1I1AC 1NANH 4UT9A 2GB2A 4P57B 4TN9A 3ZQ9A 4Z7WF 3MGAA 3EYOB 4QF1B 4GAFB 4U1IA 3RDTC 4FTDA 5FDWB 5GJSL 2V5RA 1L7IL 1FNAA 3N85L 1RZKH 3CZSA 4HV8B 1F1GA 2H1XA 2DLEA 1MAJA 1TETH 1AFVH 1N67A 3ECBA 4M7LL 2UXVA 2JNZA 4PJ8B 1PG7X 1T66C 3GSRA 1QX1A 1JDDA 3LV3A 2HTKC 1SJEA 2Q0ZX 4MS8D 2VMEA 3BZ4A 5GRYA 3NIGE 2ZZUT 4OFIA 3RZCC 3OZLA 3WCYA 3RGVC 1J86A 4M9PA 4Q6IB 5IQ9A 3MRCB 5BQ7A 5TDPB 3IK2A 5E6IB 3IDXH 2ZOUA 1EBPA 5KUKA 4UTBL 1NKOA 1HE8A 3BXNA 1VACA 3L9RA 3MC0A 4GAAA 2Q7AA 2BNRB 5SWZE 5E6IA 7TAAA 2QMKA 1VLXA 4X6BA 3ME0A 1B4JL 3INUL 3AT8A 5EZOL 5I1CH 2DRUA 3JV5A 1TVHB 3BT0A 3MYJA 5KAQF 1KBKA 4YWGL 3JWOL 3PV6A 3CZFA 5LWYH 1ETA1 3MJ9L 2NYYC 3T0ED 3RNQA 1QASA 5EOTB 4AQAB 3S98A 2HFGH 3S3CB 4R9HA 3BVUA 5KJRH 1GCYA 5GGVY 3ABKB 3BD3A 3DECA 1ZVYA 4RAHA 3C6LB 1E6JH 2N7AA 2ALWA 2J7LA 3QUKA 2VQUA 4C59B 4KO6A 1NMCC 2P8PB 2QVMA 2ZSWB 5EUOF 4XH2B 1ZV9A 4PSRA 2JJTC 4LLWB 4PHZA 5EU4A 4J2XA 1R5WB 4R4BB 4JK0D 2O5XH 4LCWA 3ARED 4ZYKB 2H3NB 2XKNA 4KVNH 4OKVB 2UUDK 3ZRFC 3O6ML 1I9JH 4WW2A 2VCOA 3AB0C 1J12A 4LQFH 4MLIA 2YXMA 5DZNA 4QXGL 5ANME 2GBUA 4XOAA 5EO0A 4L29A 4L1SA 1PVHA 4GI6A 1TR7A 3QZPA 4CW1B 4PPTA 1CGSH 1U2CA 2RHEA 1CICC 3QQDB 3B1TA 4P3CL 1CICA 4MCYA 1TITA 2PYED 1XBDA 3GUTB 3QDJE 2GUYA 2Y5TB 1JBJA 4LMQI 1T2JA 5IUSA 4AM0B 4W6YB 5ENWB 4ABWA 1PSKL 5E9DD 4RX4D 2XTJB 3US9A 4HUCA 4QRRB 2HVJB 5IWLC 3SO5A 3FRPA 3TN0C 2VYRE 4L9LB 1UTDA 1DBAL 5CP3A 3QZBA 3HNTL 3ZL2A 1UQSB 2P42B 5EEWA 2CHXA 4CJ1A 2J8UE 1RD6A 2GSIB 5E6ZA 1P7HL 4MKTA 2Y7OA 2SEBB 5DMIL 4Z76A 4HETA 1YNKL 5FFLA 4GKSA 2BWIA 4E9VA 3IDNA 3KBFA 1JDAA 3B7TA 1WEJL 3RB5A 4YAQA 1G6VK 3T3ME 4DAGL 1IGYB 2ARJB 3AM8A 4ZFGL 3RVWD 1I1CA 1QRNE 5DSCA 1UKSA 1O6SA 1OW0C 3K80A 1AP2B 5DJ0B 5I9QB 3WJMB 4UT6H 1KIPB 4V1DD 3TYGL 4NWUH 4HJJH 2R1WA 43CAB 4DSYA 1WT5A 2DQTL 3QXTA 2BY2A 1FE8L 4GYBA 3RB7A 4C4KO 3D39B 5T3XD 3S5YA 4AYFA 2X1OA 4ZX3A 4DN3H 3B5TA 1LMIA 4FKKA 2JI2A 2HN7B 2OMNA 4DPAX 4PRNA 3H3PH 1KC5H 4QRBA 2QADD 4ACPA 4NNPH 3A0OA 1PLGL 2DKSA 3JWNH 4WWOA 5IHBA 4GBXB 2ZXEB 5L6YH 1DSFL 3EZ8A 3EHBC 4WQOA 1EHXA 2SEBA 4GBXA 1BJ8A 5H35A 3RJDA 1VFMA 4PG2C 4X7EC 1AS8A 5K9JH 4OH2A 2YQBA 2F7OA 4I3RL 2IH9A 1CDBA 3OKLA 1BFTA 5DUBB 4DW2L 4YPJA 5IW6A 3MDJA 1AQMA 5FO7A 3ARZA 4OTXL 3BLPX 1KLGB 5E8DH 3BKJH 5LDUA 4E9QA 3MCG1 3RWDB 1IM3D 1OSEA 1SY6A 1GGTA 1QG3A 4MMZA 1UT1A 4OKDA 3HNVL 2KLSA 1MHHB 3FQTB 3P69A 4Q89A 2ADFH 1QNZL 32C2B 3T4YA 5H2BB 4RCAA 4MD0A 4OFDA 1NFDB 3MYJB 4MX7A 5FA4B 5EU5B 2HN7A 4YH6A 4AI7A 3CX5J 4F15C 5CNHA 4X4ME 4YXKH 1SUJA 4JO1H 1VESA 1NFDE 3FTYA 3F7RA 2WQAA 4LF3B 4ODSL 3RVVD 2KYIA 3NN8A 2IQAB 2FHBA 1WPCA 1KENL 4NCC2 3SZ6A 3VFWB 2J55A 1GGUA 2ADJA 1ZAGA 4XH2A 4PS4L 1NCNA 4U3CA 1EO7A 3VDAA 2OSWA