3TX4A

Crystal structure of mutant (c354a) m. tuberculosis ld-transpeptidase type 2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
285
structure length
267
Chain Sequence
RYTLNATALHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGALNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting the Cell Wall of Mycobacterium tuberculosis: Structure and Mechanism of L,D-Transpeptidase 2.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Peptidoglycan binding protein
molecule keywords Mycobacterium Tuberculosis LD-transpeptidase type 2
total genus 70
structure length 267
sequence length 285
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 3tx4A02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3tx4A01
3VAEA 3ZGPA 3TX4A 4QRAA 3ZG4A 4GSRA 4LZHA 3VYNA 5E51A 1Y7MA 5DC2A 4GSQA 4K73A 4XVOA 5DUJA 5DZPA 4A1JA 3TURA 4LPQA 5K69A 5LBGA 4QTFA 4A52A 2MTZA 5DZJA 4QR7A 4ZFQA 4HUCA 5DCCA 4JMXA 1ZATA 4A1IA 5E1GA 4Z7AA 5DU7A 3ZQDA 4GSUA 5D7HA 2HKLA 4QRBA 3VYOA 5LB1A 5E1IA 4A1KA 5DVPA 5E5LA 3U1QA 4JMNA 3VYPA 4HU2A 3U1PA
chains in the Genus database with same CATH superfamily
4RMBA 2CIKB 4E9VA 1E4XI 3ZL1A 4TSBH 2VT0A 2E3VA 2BC4B 5FM8A 4LCYB 2WWNA 5DRWA 3WY4A 4RISL 5E8OA 4JUSA 3P4OA 1MIMH 3ZE0B 4UQ3A 3M07A 3RIAK 2CO7B 3AB0B 1MCSA 3RDTA 2VE6B 4G3YL 1PFOA 2UX7A 3EYUH 1TQBC 2LLNA 4ZOEA 2OLDA 4QYOB 3RFRA 5KVEE 1BX2A 5J56B 3VE0B 4YIQA 1OGAA 3MYZA 5FW7A 5GS0H 2WUBL 4N8CH 4YE0A 4AC4A 1J87A 3KLKA 5BJTB 5FO8B 2MPAH 3L4XA 3DXAE 3D69B 3PF2A 3VAEA 4MXWL 5EU6D 4XHQA 2OW6A 5IROA 1VESA 4PJGF 5HVWA 4NQED 2ZIDA 3HE6B 4AK1A 4GQPH 1TYRA 3KDMA 4JRYD 5E2UL 5GISH 2WQXA 1LO0H 1GGBH 2AJYL 3PIQB 3VX0A 1OT4A 1A7PH 1XGTA 4G6FB 1G7PA 4M62H 3UROR 4FRWA 2YWZA 4CW1B 1YMMA 4JFEE 5I71B 4HWNA 3ECBA 3PWPD 1AO7E 4Q56A 1HWWA 4M6OL 3KPSB 4NHCH 3D09A 1ACXA 3G6DL 3S88L 4OD2A 5D9SB 4Z7OB 1CWVA 5LGKA 4O4YH 1BFOA 4JFOB 1MELA 3L3GB 4WFHE 1N4XH 4P3DA 5ACZB 1A5FH 1OE3A 3G6AA 4JFDE 4PJBA 5A7BA 2W0KA 3QJTB 2PMZA 6TAAA 1KENH 2CO6A 2LU7A 3H85A 4LIQH 4PJ5A 2R0WH 3QO1B 4GAYB 4BFNA 3FB8A 4IDJH 4WWOA 3KPSA 2X4NB 2Y3AA 1F1AA 5C9JA 4TQPA 3E80A 5DO8A 1I8UA 1CFQB 2NNFA 4LEXH 2ZUQC 4NN5C 2OTUB 2ZKWA 3EO1B 2KZ1B 4JHVA 5DVKA 4NB7A 2JJSC 1P4IH 2UVFA 2XG4A 4QJ4B 4PJCE 5EUKB 1X44A 4R4BB 1GYCA 1N64L 1ZIAA 3HI1A 2BJML 4UT6A 4YDKL 4LGSB 4PSRA 4GI8A 1OP4A 3AAZA 2EH8H 1HXMA 4IBVA 1EMTL 3LQMA 1I3UA 4GB9A 3ZLQC 1NCWL 1TO4A 4FFZH 3QUGA 4X5XA 4KQ4H 5TDOA 4P06A 1XH0A 5DMKA 4YPGA 1CGTA 1A7OH 4EN3B 4TOYL 1BHGA 1SN0A 2WMPA 4JJ5B 4W4NA 2YMTA 4FNTA 7TAAA 2GT9A 3U48A 4PW4A 3PWPE 1U42A 1G5GA 4XWOC 3QAZC 2GJ6A 2ICEB 4BELD 2DQHL 5DRXA 4WDIA 5M94B 4XNUL 4X80H 4HIXL 4GUPB 3HZMB 5HHMD 3VUAA 1OAXH 1NPUA 4LBEA 3KL0A 4H5SB 3EOTH 1WHPA 3MLTA 1OT2A 4KJQD 4YDJB 4OZ4B 1ANUA 5HDQL 4FI7A 1U6AH 1UFGA 5DHXB 4K73A 3MJ7B 3PXLA 4AENB 1KYOK 1XL6A 4FXKA 2FX8L 4JDZB 1QASA 3JV6A 4NZDA 1T5XA 2AF2A 2PXYB 5ERWA 1KCVH 1X9UA 3DRTB 1OGAE 1Q9OB 4ZS7L 2AEIT 2Z8WC 1MLBA 3T0BA 3FOLA 2Q8AH 1I7TA 3SDYL 4LSQH 3V0JA 2GITA 1ULVA 1NFDB 1TEGA 1SBBA 3RURA 3ZTJG 3ULUC 5DQJA 3NZSA 2GBTA 3LZRA 1MHEB 4XXDB 1ACCA 4UZUA 3PJNA 3WXWH 3IDJB 3V4VB 3BGMA 1LL1A 1SDAB 5KANG 4FJZA 1R33A 2IAMA 1B9ZA 4JFHE 2QSQA 2IG2H 3ATBA 1TO5A 4UOJA 4DZ8A 4FFTA 3GO1L 3OKEA 4EQ3A 4LXFA 5CEZL 1SYVB 4J8RB 3UL4A 3LXUX 4L3ED 2XIIA 1G7HB 3D8MA 4Q7DA 1QKZL 4AEEA 5JOFB 3L3KA 1URZA 3VU1A 1ES0A 4EXKA 1BXVA 5L8JB 3EJZC 3CBKB 3A4FA 1CDIA 5TPWL 2OYMA 3BEWB 2BMKA 3GSQA 4UYPA 2HT3D 2YD7A 5C0RL 4GBXB 1EHLL 4Z7VF 3NTCL 1TTGA 3FQXA 3PCYA 3HB3D 1G9NL 2IGFH 3PYCA 4N0CD 4AVHA 5I19H 5I30L 3SCMA 5KW9H 1KCVL 4HK0A 3FUMA 3VFMB 3CDYA 4PJFA 2VDQB 4Z1PA 5C86A 2VLRB 1OM3L 1RULL 3CBJB 4M8UA 1F4XH 3GMNB 4IRJA 4PJDF 4WHDA 4PVNA 2QFRA 3WTUA 3BWAB 3RA7H 4HJ0C 1VACA 3RWHA 3FO9A 4OCLC 5I1AB 2J2ZB 3ILPA 3JV0A 4O9HL 1ZVHA 3OGCB 3WIHL 3PGFL 1WBYB 3EJUA 3PG2A 2DIEA 2YLHA 3HE7B 2VXQH 2J5LB 3RX8A 4K9EL 4PYGA 2ADJB 4QJ3B 4YNYA 5KVMC 1LK3L 4LKXA 3QFGA 3HZKA 2W1NA 4CW1A 2Z7UA 3I9AA 4Z7UF 3D39A 5F9JA 3VSTA 5HYSG 1O5PA 5DSCB 4YSQA 4FQ1L 1MLBB 3N1PC 2QKIC 5D70L 1SN2A 2JIXB 3KDMB 1V3KA 2NPLX 6PCYA 1SMDA 4HU2A 1BQSA 2F1AA 4RESB 3OB0H 3S34H 1X5FA 1T83C 3D2UD 4Z3JA 3AUWB 4HH9B 3WU1A 2D03H 1MCNA 1OP3H 4PGEB 1TQBB 5SWZB 3WFZA 1UCBL 3F2LA 2LAGB 2ZWNA 5KG9B 5T1KB 4NQCE 4CSSA 5D55A 3F01A 1S7QB 2H6OA 3E6HA 3EH4B 4WO4A 1CD0A 3BAYA 3WKQA 3RL2A 5DCCA 3D39E 2NY2C 2ICES 2ENJA 4QXTB 3BVWA 3BQVA 1BQHG 1Z9NA 2W0PA 3QORC 4IKNA 4JJHA 3QHFH 4GIAA 4L9LA 1V7NH 2JB5L 1E7VA 2VOTA 1JNHB 5D4IA 3VGFA 1YEGL 5BVJB 1WK0A 2PXYD 2RR3A 3CSBA 1YMHA 2VZ1A 2EACA 3SDCB 3EHBC 3ARFB 2NOYA 3LRSA 1WA2X 3HC3L 3S37X 5I8CA 2R59A 5DQDH 1JGDB 1IGTA 1CFTB 1N8ZA 2XJLA 1MUJB 2FBJH 3APCA 3DX6B 2Z7ZA 3DYMA 3QG6B 1ZLWK 1LNUA 3JYCA 1I3GL 4AGQA 1ZATA 4X8JB 1M7UA 1ZE3C 4PS3A 1G87A 2XBDA 2NY3B 2ZOWA 1A4KB 2CDFA 1N70A 3BUQA 1EVTC 2CRZA 4DQOH 1HFUA 1W6LA 2NT0A 2OMYB 2YUZA 2GTQA 2VLJD 2XXFA 4KI5F 1LMIA 2AV7A 4Z6AT 5D6DA 3HKFA 4OD1L 1F2XK 1JDCA 1VGKB 3DUSB 1BZOA 1JZ4A 5IQ9B 1FI8C 4HPHA 2ADGB 4WTQA 3LKSB 1J1PH 4C4UA 1JHLL 4K94L 2AJXL 1FP5A 4MMYA 5D9SA 4G9FD 2BNQB 2EVFA 3BO8A 1I8KA 3B7UX 2YK1H 3T0EE 3ZPDA 1L7IL 2EXTA 4NJAL 4KHXH 1P7KA 5BVPH 4BCZA 5LB1A 2IALA 2N56A 2W94A 4ZPTB 2WKOF 3UDWC 2LU5A 3CFIC 3EJPA 4P4RB 2FDBP 5E70A 1N5YL 1Y07A 5EIIB 4BWTA 2BXYA 3DPDA 4A39A 2D3VA 1VKXB 5LO7A 3TJEL 1MFMA 1Q0XL 3NIFE 1W16A 4HFWB 2P49B 1KFGA 1J1XL 4P2CG 3BLBA 2NW3A 4B5EA 4RVBA 3MFFA 3S3JA 2N0MA 1SEQL 1A1OA 2EUVA 1MRDL 4UNUA 1XGQA 4LDCA 1V55B 4KV5F 3BUTA 5JO5B 2AGJH 4OZHF 1ZSDB 2WVVA 2G5UA 3EFDH 3FU6A 4DAGL 4Q9QL 5E8OB 3DX9A 4LSTL 3RKDC 2C9XA 3ZTCC 3O11A 4XCYB 2WXQA 1KTBA 1OZTG 4HUWA 3DMMD 4N3TA 2QGDA 1G4MA 2EXWD 3DXAD 3O6KH 1E3FA 2BCKB 3WEAA 1HWGB 1CDUA 1RFDH 1D5BB 1EO7A 4OTXL 2E9GA 4MD5A 3U7WH 4OZIE 1KNOA 1DUYA 2NTSP 4RSYA 2X9WA 4PRDA 5K1NA 3QEHB 2R51A 4IOSD 3QORA 3WXVL 3D39D 2CE6A 3QFDA 3WKNA 1MFEL 3IDYB 1YZZA 5H8DA 3K6FA 3JZ7A 1CXKA 4PJDB 3MACL 1HYRC 1AGBB 5CN1A 3WJLA 4RAHA 5FKPA 4F33A 4ZMWA 3BQUC 5CSZA 3H8NA 1NCJA 1BG9A 4MNHB 1PY4A 3TIEA 4ISVA 3U9WA 3DHMA 1Q9KB 3DOSB 3TEXA 3CH1B 1MFBL 5CXPA 4APQD 1UASA 3CLFH 4I1PA 4GLRI 5DMKB 3BT0A 3QORB 43C9B 5B7MA 4JFDD 2N4IA 5HYJE 5E5RB 4XOEA 2X4RA 1A9BA 4Z77A 1DVZA 1HINL 2WAHA 1AGBA 4M5YL 4N2GA 1TU2A 4LDEB 4D9RE 1ECYA 3FQRB 5KBLA 5KYXB 4MCYA 1Q72H 2X87A 3GSXA 4EVNB 3GDBA 5J1AA 35C8H 4XT1C 1BQ5A 3CSYA 1MJ8H 2WQAA 1IMHC 1FFRA 1XT5A 3GUFA 12E8H 1UWEL 3ZN6A 1MCHA 1G4RA 1CFNB 1UXWB 2EEXA 3MLYH 4UZSA 1W72L 2IO5A 2ZCHH 4QRUA 1MCIA 3OD3A 1KN2H 3F7PC 3P3RA 5TPWH 2ATAA 4PJBB 4C4KT 4LBEB 4OF8A 1URLA 4XPBH 3CFJB 5JDJA 4FG0A 1E4KA 2KI6A 4UU9A 4WGKA 1N6QL 2NW3B 3QJOA 5AQ0A 4LZKA 5F0MB 2I9TB 2WPGA 3H9SB 4XN1A 5BUPA 4ELMB 4Z7NE 2EDRA 4XN4A 4Z7WB 1QSEA 5IHUH 3O2DL 4PP1C 4LAJH 1DN0B 3HFFA 2XC8A 3EH5B 1WT5A 3OR6B 3W39B 3NIGE 4LQ1A 3BAXA 4GKZA 2VISA 1XF3B 1A4JB 3MUUA 5H2BB 3V2AR 1BQLH 1HN1A 1DBJH 1PMYA 1OXYA 1TJIH 3MCLL 2EDLA 3GHBL 1OSZA 3BP5A 1VDGA 4O02L 3BHBB 3LQAL 1MWAL 2Y5EA 1MCPL 2NSMA 1IGIL 1C16B 2EYTB 4LPTA 4N6QA 1PD1A 5IJDC 1WYJA 3BE1L 5LCVH 4K23L 2WSDA 1NPNA 2ADFH 4D9LL 2A9BA 2N1KA 1UZ6E 3FO1B 5KWYC 4R97B 1RP9A 2YZ8A 5TK4A 5IB3A 3KLHD 1XMEB 1PY0A 1A3LL 1PW3A 1WAAE 4OZIA 3PS6A 2W9LA 3LEXB 4L37B 1CIDA 4WGWB 1MRFH 2PPCA 4WSJA 1VZGA 4KFMA 2X1WL 4GRWH 3VFPB 2CSPA 2G0KA 2BZDA 2EIKB 5CIPB 5IB1A 3RWDB 1XGUA 4HIHA 3KLAA 4MASA 1SOQA 2C7UB 1TETH 1EAPB 4FFYL 5JXAL 4X6EA 4IIZA 4AJVA 2NZIA 1SZNA 1NSNL 2VDPL 2DWDA 3BMVA 4Y9FA 1MPAL 4YX2L 4UQ2A 3B2VH 5KVEL 3KYNB 5E9NA 5GIRA 4GKSB 4EDXA 3ARFA 1ILSA 5K33A 4MJIB 4QWWD 4R7NB 5E8PB 3LVEA 3ARFC 4Q6IB 2L8AA 3IFNH 3N0AA 2JJVA 5CN3A 2CGYA 4X7FC 1R17A 3FCBA 3CWGA 3TX4A 3WAKA 4LP4A 2CHWA 5IBLD 2GEQA 1LJMA 5I1DA 4PRPB 4D0CB 5J13B 1QX1A 4HS3B 1YEIH 3WLWD 4LARL 4MS8C 1KXVC 3JWDL 2VE6A 2L7JA 5F1OB 4UV4L 5EBWA 4Z95L 3QCTL 4HCIA 1W0VB 1RZKC 1QA9A 3BPLB 3ZT7A 3H3BC 3IJ8A 2D3LA 1R24B 5AYUL 5KSUB 4NZRL 1JD9A 4TQ8A 1ZHNA 4LBAA 4R7NA 5IQ7L 4N2IA 5D1ZD 4GT0A 3H9HB 3UJJL 4DESA 4J8QA 2OZ4A 2R2BA 5L88L 2OSLB 2AJXH 4PV9A 4MZ3A 2JMRA 1DVFD 3RTQA 2NY6B 3EYFB 4XP1H 2VJ0A 3V9EA 1HEZA 2JKSA 4LKXB 1EHLH 2HG5A 5DD3L 4KKAC 5J4MA 1F1GA 1BZQK 1NH6A 4HWZB 5ESQB 4WHTA 3LMJH 4L3FA 5DJ0A 3OKLA 5C0GB 3CZSA 5CJOL 3NFNB 4GSXA 4WTWA 4EDWH 3PWJB 1QBLH 2Y25A 5CEZH 3KYMA 2FJHB 3MZGB 3QDME 4RDQG 4FTVA 2HUHA 5DWUL 4PFEA 3CPLA 4QXUL 2WUBH 4N8CL 1ZGLM 1FZMA 1EAQA 4YHPA 2JKNA 6FABH 5IMMB 4X6DA 3HE7C 1XBRA 5H37A 1KJ3H 2J44A 1GCYA 4CNIB 3CVHB 3QUMA 4X4ZA 1VADA 4A6YL 4PWHA 4AEIH 5TH2B 4R26H 4JRYE 1GYVA 3CSYB 4TUKH 5T1MB 3TYFB 1YEGH 2BOLA 1N0XH 4QGTA 3PPSA 3EF4A 4RISH 1HHIA 4I89A 4GRLC 4NZRH 3GMOB 2V2TA 4GAJL 3ULVL 4BFRA 3SDYH 5KVFH 3VFSA 3K0WA 3VTMA 3HBQA 1AO7B 4NPYA 1GVIA 2B59B 3B2PA 1CFMA 2NYZA 3C5ZA 4ZMOA 1QSED 2FTAA 2X9YA 4AYFB 3NQKA 4EJ1C 4JREC 4ES9A 25C8H 1R3HA 1S46A 1Q9KA 3DOSA 4IKKA 5D4QA 5HJGA 4DEPB 3Q1EA 5DFVC 1J10A 1CJYA 2FHFA 3MXWH 4P4KB 5D72H 3ARGC 1Z0NA 1WUNT 4OBRA 3KYMB 4JG5A 4WI6A 4G7YH 1HH9A 3CHQA 1A6WH 2Q3AA 4UQDA 2QTEA 3FTSA 1MY5A 2CDEA 2Z8VC 5J9PB 4KPHL 1HHJA 5IHWA 1O6VA 2EYSB 3C9NB 4KJQC 1FFNA 1A4CA 1R6VA 3S5LB 1FORH 4TNVK 5A6MA 2ENPA 4QTIH 1MCOL 2X4OA 4HWBA 1I4FA 3WSQL 1ADQH 1Q9LB 3L1EA 4FQIH 1B4JL 1WWBX 3CN3A 4HPYH 5C08D 4J23A 1RIVH 4HMDA 3SJVD 1OOAA 4IEFA 3CMGA 5DYOB 4YSPA 4UBDD 4S1SH 3EAKA 5F8QC 3PL6D 2ZJSH 2HX9A 3S5LA 3VH8G 1KC5L 3ZTNL 5T3ZH 3FQNB 2D9CA 2OX5A 1RK1B 1BJ8A 1T7VA 4N22A 5CU9A 4DGVH 2VLLA 4GG8B 4BSJA 1IM9A 3BI9X 4NQDA 5EN3A 3MRHA 2A9CA 3L95B 3VW3H 2V9TA 1QO3A 3IDGB 3W2DL 4AQ1B 1F42A 4DVRL 1IIIA 2ERJB 2ICEA 3ME0B 5J8OA 1JF1A 3QO0B 4DVBA 3FTZA 1S7XA 3ARDA 2XVLA 1YEHL 3DUUB 3UIZA 4EF3A 3EH2A 4DCQB 4TNWF 1Z9PA 4K5OA 4PV1C 3EJZD 4KOBA 5AVWB 1QKZH 1GAFL 1CDBA 1SMAA 4KTDH 4OM1H 1F97A 4RZKA 2NX5E 1KNOB 3UAJD 3B5HA 4OKDA 2OXGA 2YBGA 2YPLB 4NQEA 2CD0A 4MQXC 4MDJB 1KJ2A 2VKWA 5F0PB 1DBBH 3GIVB 2YMOA 5C0IB 4C83A 1S4IA 1T21B 5FO7A 4HF5H 4OFYD 1L3NA 2ZF8A 4PJHB 5HDOA 1W72B 4L05A 5DJZA 2VIRA 1Q0YL 4KJYA 1I1CA 3L5XH 1A66A 5BZZA 4LPWA 3FB8B 2B1AL 5L8LB 3ATAA 1Y18B 1SLXA 3FT9A 5BW7C 2NSQA 3VJ6B 1LP9B 4Y1AE 2IBZY 2E27H 5HDLA 4XNZC 4PJFE 2XN2A 3ECWA 4X7CC 3LX9A 1EEZB 3VRIA 4ZX4A 2L7UA 4JY5H 4L5FH 4JFTA 4X8JA 1T66D 1JYNA 4NWUH 4WEUD 4LSRH 4QRRB 5T5FA 3LH9A 1X5IA 4F20A 1I3VA 1OANA 1S9YA 2PO6C 3NJFA 4X9FA 2R2HA 3DECA 4F7KA 1RURH 2BNQD 1C5BL 4LLWA 1F4WH 2MJWA 3AVEA 3EHBB 2AXFA 4XPAH 5HY9A 2JKXA 2WGXA 2VDNH 4NYLB 4XNAA 4G42B 1LE9B 4J7RA 5FKAB 3VXOB 4TOYH 4PU2A 5HYQA 4YXKH 3UJIL 2GVYA 4Y1TA 5E2VH 1GGCH 3FN3A 4JMNA 4ZFFB 4D9RD 4F58H 2I9TA 3O3AB 2WV3A 1S7QA 3E6HB 4P2RB 3OAUL 3U2SB 4TS6A 5F9OH 1ESOA 1T1ZB 4XVOA 2WAQA 4ODVL 4U1HA 4Z0XB 3B7SA 4D0DB 2BIQA 2XWBB 4Z3EA 4WU5B 1ZLUK 1SOKA 1RK7A 3MJGX 1GMIA 1LQSR 1M7DB 1N59A 3V8CA 1GOFA 2VZ3A 3V95A 1DVFB 1CGUA 4G6KL 3VFWA 2CPCA 5DDHA 5A2AA 3EO9L 3NMEA 4NQDE 1X7SA 1DLHB 5DSCA 5TQ2L 4RCAA 3NJKA 3LRHA 1T3FB 2EDQA 2QADD 4JFYB 4XMXA 4FZ8L 3MRGA 3VG0L 3WI9A 3Q1SH 4TUOB 4M00A 3GKWL 3TV8A 5KBKA 3MLUH 3SOTA 1U91B 3RWDA 5IB1B 2B4CC 2X3BA 3DBXB 5DZAA 2R39A 4G7VL 1TKWA 1MIEL 2CLZA 1JNNL 3DA0A 1J1XH 1U6AL 3KYKH 3VFTB 4MA1C 2OAAA 1BWWA 2AJUL 3UTZA 1O5DT 1U8PB 3O8XB 3JVGC 2DOCA 1E90A 3LEXA 1OTSD 4FQXA 4L37A 1ZLEA 4HAFA 3KS0H 1XO8A 1QR4A 3LQZB 3N43F 5PCYA 3CH8A 2BVOA 4CVZA 1L9SA 1SJXA 3MGOB 3TGXA 3TO4B 3VWKB 4BDVB 1WAEA 5I28A 5EU3B 3SCMB 1S5IH 3WN5A 4A1JA 4I85A 1AMYA 3EO0B 5EORL 2WXMA 3MRPA 3A5VA 4A63A 1XGRB 1HL4A 4H7VA 3FONB 2P24A 3QI9D 5K9KB 1WIUA 2EH8L 2X4TA 4TVPL 1E50A 5EU7E 2CLVB 1KCLA 4TNGA 3UTQB 2WWKT 4ELMF 4HQQL 4ODHH 3QQ9C 4KC3B 2DS4A 4L2YA 1EAOA 2AQPA 5FPIA 1N6QH 4OV5B 1JSYA 1ZS8B 2Z6FA 4HH8A 4JO4L 1AGFB 3PWUB 1GC1H 5HI3D 3HR6A 2EDEA 5CZKA 3ZDWA 3WXWL 3FN9A 2AK4A 2CDGB 4Y4HC 4TNFA 2ORBL 3IDIA 2DMCA 1P69B 3OLIA 5IOKA 5LLIC 2E86A 2EE3A 5E8DL 3X13A 3LVTA 2UZYB 1ZA6A 2PWFA 2CZNA 2WANA 3KXFD 4QUOA 3RKDD 1GTFA 4QTHA 1DZ0A 3PWUA 1NBZA 2QFPA 3UAAA 4QD2E 1TVBB 3LIZA 3QUXD 1IM3B 4ZUSB 4HIEB 4FA7B 1A21A 5DJAB 1S7VA 3FONA 2QR0B 3PV6A 4GQ9L 3RVXD 4RLDA 2WNXA 4P46A 3RWGA 3L3HB 4ZUWA 2BSTB 3N9GH 2XQ0A 3WBDA 4F9PC 1IC4L 3UPRB 2DEYX 3K8KA 2RB8A 5A43C 3B6SA 3UJTL 1TTAA 4JVWA 1U92B 1OW0A 4F7EB 3MR9B 4F9PA 3EYVB 2CJ3A 2NY0D 1GOHA 1OB0A 2AJZA 4LL9A 5F3HB 5E8NA 3B9KB 4HHWA 4DUVA 4NZFA 4BBWA 5JXEC 3TH2T 3LQZA 3BLKA 1D5MA 1PG7L 3ARDC 5T3XD 4ISVB 2X40A 1SXAA 4QRRD 4FKEA 4BM7A 1PLAA 1DHKA 4PJAA 1CVRA 3FRUB 3O6FB 3BLPX 1GXEA 3QWOB 1EZLA 3UTPE 4Z3GA 1N9PA 4KK8C 3VXMB 4TVPE 3VWJA 1FG2A 3BW9A 3P4NB 4MB5A 1AR1C 3D5OF 5EC2A 5EUKA 3SGEH 3QVAA 1BXAA 3D85A 2KERA 5FHAL 4IBSA 1KIPB 1D7CA 1AYRA 2QSVA 2CM6A 1MCPH 2H1PH 4ZAKD 4JO1L 4KUCF 4E41A 3T2NH 4GFTB 3TH4T 2J3SA 2JKLA 5AAMC 3SDDB 2VITB 2DJMA 3QUYD 4U4IA 4U2ZA 4Z7UA 3BZFB 1Y1UA 4FKHA 4PVLA 5SWSB 1MCCA 1V7MH 4U1HB 4Z0XA 1BA9A 4GMTH 5E9DB 2ZXAA 1BFOB 2X2UA 1X5GA 3ZTEA 4A2LA 2FSEB 1GGIH 5GRVL 3SGDI 2K4WA 4X4ME 4HKJA 4P3WA 4GIOA 4P2RA 1DJXA 3PHAA 1TQVA 4OQ1A 4AKPA 3IS0X 4F2FA 1CZ8H 1BQKA 2R0ZH 2ZUUA 2DQUH 3LS5H 4ODXB 4HUNB 4PJIB 3MA7A 1XSIA 4NSKB 3AUVA 4NKDA 1C1EL 2R69A 4U0RB 3U9UA 4M1CD 4BXSV 2CRMA 1K85A 1OHZA 3FAXA 2E6QA 4O2EB 1I7ZA 3STZB 1CXHA 3ARBD 3D07A 2HH0H 4NRYA 3CDGB 1IVLA 1JWUA 2EIJB 1S9YB 1XIWC 4JLRA 3U2JA 4D94A 5D96C 5HGAA 1F41A 3W9EA 1VGEH 2HMIC 4WV1C 4G8GA 4HUUB 4J1UA 1TYJA 1NFKA 3F7VB 1FLRH 2GC7C 4YHMH 3DWTA 1T7YA 3KPNA 3P9LB 2JLLA 3WHXA 2EADA 3CLFL 4ORZC 3ATDA 1KLFB 2VDRB 5E6IC 1X7QB 4G72B 4LSQL 3NZ8B 3E3QE 4N2KA 5GS0D 2F54B 4NCDA 5D7LA 5ALCH 3UAEA 3MJ6A 2VIRB 5C0IA 2XZAL 4XBGB 2J8HA 1KZQA 4A38A 4I18A 3BC9A 3RPBA 1G1OA 2YPLA 4NQEB 3VNYA 1J9RA 3BAJA 2HVKB 4J39A 4E68A 4XOAA 2AXGA 2FZ3B 3MRCB 2RIKA 3DOIA 1MI5B 4H0LC 4P05A 2NMSA 3V5DA 5GGUA 3FOMA 1PZ2A 5GZOC 3V0WH 3U0PA 3IDYC 4L1DA 4LDOB 2D31A 4NBXB 3VXQB 1JPSL 1G7HA 4OCNC 2H0JA 4XCEA 4GFXA 1FRGL 5EHFA 3BD4A 4YDIL 2HJLA 4I0PA 3SPJA 3OR6A 2V5YA 3FN0H 1JZ7A 3ARZA 5DEFB 3T0AA 1DANT 1M6UA 2X4UA 4N90E 3NGBC 3B5TA 3B9DA 4FFZL 3FUHA 3WLWC 1FORL 3SBPA 3WEOA 4EEEA 3MNWB 4PB9H 1UXSB 5C0CB 4Y4KD 4CMMB 3S48A 1H8NA 1TZ8A 3CE1A 3HI5L 4R4NC 3SGDH 3CFCH 1BEYL 4XAKE 4Z76A 4GSRA 3L3OC 3KVQA 3BPNC 4UTCA 1KXQA 5F1NB 4CDGC 4JE4B 4HCGA 2VQ4A 5D72L 2JB6A 2BS71 1SXCA 4S1SL 1Q0XH 3EBIA 3DJTA 5IEHA 4PGDA 3ZT5A 1ZDQA 3N43B 3O6ML 1KXHA 4XXWC 2WLMA 5E5UB 4APXA 2CHDA 4G9DB 2WB1A 4GT7A 3VI3E 2JKIS 1TJMA 1K3IA 3QNZA 5SWSD 1AKJD 1GKOA 4K3EH 4WI9A 4F7MA 4GP5B 4IMLA 2CDEB 5J9PA 4EN3D 1ZSHA 2OYKA 1QUNA 2JCCE 1MHHB 1KELH 4NERA 5EWIH 3WNJA 5I9QB 2WYHA 4X5LA 5KSVB 5CSGA 1JFQL 3JUZA 5GPRA 4JQVA 3ZJAA 4OLEA 2HTLC 1F0LA 4X0NA 3PL6B 4LHUA 2ITFA 5E23A 3NRPA 3IKCA 4E9SA 1LO4H 2VABA 3IGAB 2OK0H 3FFCE 5KS9E 4IRJB 2BNUB 4OTXH 1SY6H 2Y7QB 5HHXH 2ZYSA 1A2YA 4XO4A 1RMFH 1E8YA 3DXAA 2EKSA 2EDKA 2XQYA 4NT6A 1Z9SB 3W0WA 3DC0A 2F7RA 3VD7A 4NNXB 5DJYB 2DDQH 1NAML 3TBSB 3V55A 1SFDA 1F00I 4FZEL 5IHZB 1CBVL 1OTTD 3HS9A 2DYRB 3IGUA 4GAJH 4OFQA 4JQXA 3WN5B 3CN0A 1SY6L 3W11D 4X4XA 3REVA 2VL5A 1N0XL 4P2QD 1XEDA 5I0YA 2EKSB 3DXAB 3TLRA 5LGYA 3WKML 3FO2B 3QP3A 5AOJA 3TEWA 3MRKB 4OVVA 1CK0L 1TQCB 2XTJB 4OKVB 4W9GC 2E4FA 4IU3B 1IZKA 1PDKA 5HDRA 5FUZL 2A77H 1KJ3L 3VI4A 3DUSA 1S7RB 2I26N 4DGWC 4NUJA 4XVSH 3TBYB 3WL9B 1QTSA 1QLEB 5I26A 5IBTH 3KM1A 4PD4K 3ESUF 1HEJC 2BSSA 3VFOB 1I7RB 3BZ5A 5J3HC 4HWEH 5IBUB 1JGLH 1WLHA 3PAUA 3EO9H 2V33A 1YMMB 4HWZA 3PAYA 4JFYA 5ESQA 2WXPA 4Y2NA 1WZMA 2FB4H 3O6LH 2FSDA 4HFUL 4POZD 3UTQA 3GKZA 2F08A 3MRJA 4Q4EA 3TZVB 1XZ0B 1UT2A 2IANB 2FT6A 2OJEA 4P4RA 1CXEA 2HX8A 4W4OC 5T8IA 1SJEA 5BUAA 1LP9F 1NMBH 2XIBA 3OHXA 2B15A 4HPYL 1J11A 5DA0B 2IALB 1AJ7H 4H88H 4IJ3B 1HC1A 1W91A 4ZBJA 4J2XA 1MJ7L 4M1GH 3K6SA 3F3HA 4OCYH 4QOKB 4KXZI 2NRDA 4BH8B 1UOWA 3CHXA 3BH8A 4H5SA 3EYOB 3JSSA 5FFGA 3DJSA 5E5MA 4H25B 5LBGA 4ADJA 3FYIB 4XXCA 1GS8A 1GS7A 2X89A 4PJ7E 3COOA 2Z93B 2D4FA 4HXAL 4XBPB 3WDHA 4EI6B 4X5WA 1AQHA 4X99B 4BEIA 1AJ7L 4P59L 2I85A 4H2CA 5EA0H 2KMWA 5SWZA 3EDFA 3K6SB 1RCYA 3N3EA 4DKFH 2FNWA 3WTVA 1JNJA 5AOIA 4LDLB 4RMTA 5CCGE 1CDCA 1UVQA 1T0MB 1B0IA 3CFEA 1N6VA 3V0AC 3H9SD 3CN1A 2APXA 2B1HL 5I1EL 4E9LA 4U3SB 1IAIL 4PH8A 4ZOAA 3RVWC 1JGLL 3Q2NA 2AI0H 3CU1A 4P5TC 5J7CC 1IV8A 4L0ZA 4JKNA 3MBWA 2AXGB 2FZ3A 4PB9L 2ZCZA 3OKKB 5HGHB 3QDJA 3RTQD 2H8PB 2IPUK 2WZ5A 3TU6A 3RVUC 4RFNB 3MROB 1UVQB 2O1AA 3IBEA 4UT6L 2K7QA 4M93C 4Y5XB 4ZMLA 5HGDB 4YC2B 5AL8A 1FBIL 1V05A 3VDCA 2BHZA 1U41A 3AXLA 4AMKL 4A6YH 3ZL4H 1PDKB 4WFED 2DEXX 5DJ8B 4GQQA 2QELA 3RHWK 1BIHA 4H8WC 3RJDA 2NQCA 4LSSH 1T0OA 4OM1L 1FPTH 3W1ZA 4UV7H 1NCBH 3HPLA 5LG1A 3D4CA 5JXEA 5FB8B 1AKJB 5BPPA 1UA6L 2RALA 1YLBB 3RJOA 1N19A 3DVGB 1HSBB 4JO3H 5ESAB 3UPCA 3LTVA 3QPQC 4LU5L 3ABZA 2HWZL 1GGUA 2AV1B 4BJLA 3OMZA 3HE6A 4F8TA 4FABH 4D9QE 3BAEH 5MEND 2GI7A 3E8UH 4LSVH 3MNVB 1TVDA 5A3ID 1UD2A 4V2BA 2GFBA 3Q8BA 1B9KA 1YA5A 4UTAA 2AXHA 3IAQA 5F0LB 2PYED 2VLJB 5IHBA 3GJFH 2VN6A 2PTVA 4PRPE 4QRSA 3CVBA 4LPXA 4JFWA 3IDJA 3PHOB 1PLBA 3V4VA 1HINH 2GSGA 2R7EB 4M5YH 4XB3A 5HHVL 5CJ8A 2D2OA 1U3ZA 1LEIB 1V3MA 1AMXA 3PWPA 4NRZB 1DJYA 1ZIBA 1WFUA 2QL1A 2XVBA 4NN6C 2V0AA 4JCLA 4QCIA 4UT9A 4ZD3L 2BVPA 43CAA 8PAZA 2F2HA 2EAEA 2QLVB 1L0XA 2VLRA 1RXLA 5CNHA 5GS2H 1WA0X 2EE2A 2JTDA 3OSVA 5IMOA 5HYSB 5CKAA 3EFOB 3G08B 3P11H 3VSQA 1IFHL 4R2GC 4HISA 1D6EA 1OAUH 1HAWA 3JV5A 1S8DB 4X9BA 1FC2D 1KLUB 3FYEB 1T5XB 1T2QL 3A24A 1NGXB 1N64H 1P84K 5HDBB 3BFQG 4OIBA 3SDAC 5JMOC 1WZLA 2J7LA 3FQRA 1XV8A 4NO0D 4RMUA 5F44A 1R5WA 3T3PE 1NKOA 1TZIA 4LCVA 4QRFA 5TGBA 3CSGA 1JK8A 2VH5L 3NABL 5D7LD 3KH3A 4KK5D 5BQ7A 1O6TA 2YIHA 4WENB 1A8ZA 3T4YA 3H0TA 3HI6L 1FVDB 4XMUA 3U30C 5B3JF 2NY6C 3S8FB 1JGEB 3UJTH 2UZIH 2NY0B 3FTVA 4IRSC 4TNEA 5EBLB 1IIKA 5KOVC 2NCEA 5DS2A 5C3TA 2VXQA 4HC1H 5ANMB 1IBHA 1A4AA 4HZ1A 2WO4A 2X12A 4ZTOL 2IH9A 1NC2D 5FOJA 3V5KB 1TLMA 3L2MA 3QUHA 3QI9A 3QUKB 4ZPVB 4BK5A 1CURA 4X50A 3WY1A 3SE9L 3IU3A 1S6NA 2ZX6A 1U3YA 4HZLB 3K5SA 4HZAA 2VLKD 2XTJD 4YLCA 4P59H 2PXYA 3GZPA 2YS4A 5MP6L 4LPCA 5DJCA 1EJ8A 4X5QA 1TJIL 2AERT 4Z7WE 5D1XC 2K8MA 4A7GF 1NGQH 3ZZQA 5I6KA 4LSUL 3IMBA 1KLFA 1S2EA 3HRPA 4NKQB 2NTFA 3FQYA 1QSFB 4KK9D 4MRBA 1X6LA 3O9WB 4PS7A 3OM3B 2MOVA 2BOBB 4CBPA 1WA1X 3UGUA 2OL3B 3FUKA 4FN0A 4G6JL 4HUKB 4YQXL 4JM2C 3PDOB 4AG4H 3AG1B 3BDXA 4DP2X 2C4FT 4NYLA 1LE9A 3NG5A 2W59A 4JM2A 3HRZB 4UT6H 2ZUTA 3RTQB 5BMFL 2DJSA 4BFJA 3OJ2C 3QQDA 1DR9A 4P9HL 3H9HA 2E0PA 2J12B 4JFVA 2FO4A 3P3YA 5KAQG 1U8IB 1SDYA 2H2SD 4B60A 5EEVA 3JWDH 3D0VB 1WC7A 3H2PA 4AM0A 1OCCB 4LCIH 4NO3B 5LUMA 1NCIA 1VFBA 3QEGH 1IEHA 4BDVA 2AITA 4KBPA 4FHJA 3Q2VA 3RGVC 4ZMXA 4YHLH 2DKMA 1BJMA 3IMUA 4JKKA 4X6DB 5C6TH 1ZT1B 2DJUA 2F18A 2Q8BL 4MA3A 3V7AG 1RQ5A 4JPKL 5JXED 3FU5A 4RFNC 2XZCH 5HGDA 4D8OA 2J72A 2NXYD 4ENZA 2OMYA 4A2GA 1LEGA 1ZAGA 4Q6IA 3FT0A 1TIUA 2CK0L 3O2WH 3VRJA 3WS3B 2YKLH 3EOBB 1OAZH 4LCYA 4U1IB 4YHOL 4P5TB 2HTKC 1JPTH 1MOEA 2L7QA 3C60D 3JWNH 4H40A 4W9KC 2Q1EA 4Y19D 1XIWB 4XP5H 4Y4HA 3W9EB 3I50L 5LDUA 1UXMA 5C6PB 1YY9C 4KI5C 5CJOH 4CDHA 1MZYA 3K1DA 3LRSB 4YDIH 2X4QB 4OZFH 2F54D 2FBJL 5FV1L 1IGTB 1N8ZB 3PY9A 3DIFB 5TDPA 3KPQA 5F93C 5E4OA 2Y69B 1JNLL 2FR4B 3ZKMD 5C97A 2H3KA 1ZEAL 4YMPA 1SOXA 4U1IA 1U3HD 4XVJL 2FB4L 3SY0B 1E4XL 1RZ7H 4AJ0A 5KSBA 4NKOA 1P0SE 3UJJH 3WE6B 5MHSE 3L45A 3JYBA 5CD5D 3FUDA 4WU7A 2YD5A 4R5VA 1CF8H 4K8RC 1KJ2H 4M4RA 4KKNA 4X9YA 5ELIA 4K3DH 3QIWD 2EDJA 4YGVB 5D6CA 3U4EA 1BLNA 4OFYA 5T1KA 4Y8AA 2D7NA 1YPZE 4BH8A 1F8TL 3T8XA 4TTDC 2RQ8A 1C08B 4ZQKB 1CLYH 2O6DA 1BOYA 3WE6A 3B6SB 1DCLA 1HWHB 3DX3A 1QWNA 4PWEA 5HD8D 3VFNA 3LKNA 1I1AB 1VA9A 3AQZA 4F3FA 2OS7A 3GGWB 5I1CH 4CADA 4JS7A 1I4FB 2IQAB 1ZWIB 5LXGL 4FQHA 5F9WC 2BRQA 2ZX9A 5JHLL 1D5ZA 5I74C 1DVTA 1IKFH 4H8QA 2OJZL 4B9ZA 1A9EB 4GXVL 4GRMA 4A52A 2ZP0T 1CTNA 3MODL 5GSVB 5C0BE 4OJAA 2ZOKA 2PUQT 1G9ML 3GMMB 5DGQA 1W6WA 3NZHH 3SE4A 1MI5E 3FRUA 2BSSB 4XNYH 3AB0C 4MB4A 3I6LD 7FABH 3CNKA 3FQWB 3PV7A 1FUNA 1LE5B 1ZT1A 3BVVA 4MA3B 5E6ID 3WIHH 3BAIA 5DZLA 2F8IA 2VC2L 1AVAA 4HQQH 5GS0C 2XWCA 1SDDA 3TWCL 1Q90A 1P6AB 1UXWA 4QLWA 5LXGH 1OV8A 1UZ8B 1B0RA 4P5KB 3T1FA 4LSRL 7PCYA 3K2KA 4J4PD 3NBNA 1A64A 2F58H 4ODWA 4JHUA 2EEFA 4MGXA 1WHOA 4K7PL 3X1NA 2DYPB 4KXDA 5C0DB 5HHNA 2Y2TA 3ZL2A 1M2VA 4P9ML 3ROLA 2IADB 3OJDB 4EI5C 5FYKU 1YNTF 2VLMD 4Z7AA 1M4KA 4WTXA 1CE1L 1FLTX 4KMLB 4Y89A 4E2OA 4IDLA 1FZKA 4A6YA 1B0RB 3BVTA 3VVVA 3MCLH 3RJQB 4J6IA 2LU4A 1CGXA 4N2BA 1N6UA 5JDSA 3SGJA 1MKFA 4Z7WA 3T4YB 5IMMA 1NCAL 3ULUH 5B1KA 3TIEB 3Q13A 1JZ8A 1F3JA 2G3XA 2IBZX 3ME0A 1NAMA 1TG8A 3LH2H 4F33B 2PO6A 4UU9B 4P49A 3NN8A 1V7NL 4N8VA 4Y4KC 4KROC 5HDBF 2AQSA 1M05A 4YR6A 4X80L 1MHEA 2EDYA 3R06A 2X88A 5I1IL 4R5XA 4IBWA 1NDGA 1CI3M 2Z7WA 4MJHA 3K91A 4W6XB 4XPBL 4AGOA 1C1EH 4KRPB 5IGXH 5LNGA 1RK0B 1U8QB 4PRAA 4HZLA 5IV2B 1ZWIA 2O5YH 1NGYB 3RIKA 3R19A 1A6ZA 3H53A 1JPFB 1AO7D 2JH2A 5AW8B 4GPVA 2DMBA 1UWEH 5KYXA 2KQNA 3C60A 1LWRA 2X0UA 43CAB 2TAAA 4QR7A 5F9OL 3MJWA 1GGIL 1QA9B 4A2MA 5C8JA 3TESA 3QUZD 4M8RA 3IMRA 1KELL 4JFXB 5I0XA 1T1ZA 4XBMA 1QFWI 2GT9B 3HNTL 4DQAA 4DKFL 3QDGE 5JIIA 5KSAA 4C8XA 3O3AA 5KAQF 4WDIB 3WHE0 1MRCL 1E67A 2OULB 5J89A 2C1OA 4MJ5A 2HT4C 2JCCA 5SWZD 1UWGH 1FG9C 3HA0A 3LS4L 3S35H 1G7MB 4FXGA 4OJFH 3AT0A 3V7MA 5I0DA 3NH7H 4FOMA 5M7QA 4GO8A 5GIRB 3UTSE 5E9DD 2AXWA 3HG1E 3B8SA 1R47A 1XB8A 4F15C 3AXHA 2Q0ZX 1MAMH 5EC1B 3TWCH 4JZNB 4ETYA 4NO5B 3N1FC 2GAZA 3TIDA 1KXQE 4TQIA 2C7UA 2F7IA 5I19L 4FADA 3MOAL 2F54A 5DHEA 2VSCA 2PPAA 5IM7B 1DLFH 1I75A 2P44B 3VFWB 3BWSA 3N04A 2V5MA 4PG9B 5DR5L 1H9DA 1J9QA 1XBDA 1LEIA 1WBZB 2WB7A 4HKXB 3QUYB 3KWWA 1W2KT 5BQDA 2F9BT 1CR9H 3OMAB 5KVGE 1XTLA 3QJHA 5C6WH 4X7SH 5F7YC 3WIAA 4L48A 2EE9A 3L2LA 3NCJL 1CF1A 1YN6B 3SKNA 3LD8C 4NN6B 1IGJA 4L23A 2I9LB 4YZFF 5TQ0H 4BUHA 5MERA 4DEWA 5F7MC 3R7QA 2VLKA 2VAAB 1MUJA 1K2DB 2ODIA 1EFXB 2HG5B 5C6TL 1D5ZB 1OIOA 1B2WL 4JDTH 5F72S 4BSWB 1BMZA 1GYUA 4U6VH 4LO9A 3MLVL 3O6FD 3T1WA 1TTUA 2XG5A 5D71L 3HS8A 4DP4X 2C9PA 4O02H 1EJFA 2AK1H 5H2BA 3T2OA 4C54A 2VDKB 4H8UA 3L5IA 1YJDL 3VRLE 2H7WA 4H20H 5I66B 2VAAA 2A9AA 4YXHH 1AHWA 5JOEA 4KZCA 5FO8A 5IP4A 2B1OA 3NIDB 5BO1L 1SPDA 1H3XA 1OGAB 3W82A 3QDJE 4YDVB 5H94B 2LR4A 4AOFA 3HB3B 3QIBD 4KKQA 4ODHL 2J6WA 1SVZA 4JFHD 1JN6B 3L7FA 5GSRA 3VMNA 1M3JA 1XSKA 3IDUA 4PJIE 4NXSA 3TNNB 2H1LM 5KANI 4LCCB 3UYRH 1JD7A 2GSMB 1WAPA 3L54A 4B50A 1TETL 4AYBA 4UTAH 4B9PA 4MJIE 2C8NA 1OAZL 3R1GH 3ALWA 4CU6A 1ASQA 4E9QA 4XODA 5C70A 5DHMC 5EBMB 4TKWA 1TZGL 1MFCL 1P1ZB 2CM5A 3B2UC 3WL9A 4DCQA 5LN8A 5JMRA 2GTWB 3AMLA 3NIDF 2FX9H 1Y6NR 3QE5A 2C9VA 3MRNA 5CJXC 1MZZA 3TFKC 1RZJH 5GZND 4L4TA 1WP6A 3M7OA 1JZIA 5D2NB 2X3AA 4XAKD 3STLB 4FDWA 4ZNEA 4WFFE 1OQXA 2VQUA 4ZJ9A 5DJ6A 1J9CT 1KSRA 1I9JL 4E41E 1BVLA 4Z3FA 3FQNA 4LF3B 3PABA 1OCWL 4XB8A 1QFHA 1RPKA 4X4KA 3DK2A 3WN6A 5KYWA 4I48B 2UYLB 4F5CE 4QRPE 3AWGA 3TT3L 5BZDB 2ZXGA 3IETB 1D5BA 4Z3HA 2CUHA 4C56B 3JT2A 1JPSH 1S3KH 4IGBC 1XFPA 3WKMH 4K07A 5C0DA 3K5RA 3NCYP 4F9LA 3VI3B 2I60L 4KKAD 2KT6A 3RX7A 3BP7B 2YJLA 1ZKAA 5CUSL 4XWGH 1XWVA 4P2AA 2K6YA 1V10A 2QPUA 3EJRA 3LHPL 4PY7A 4UDTA 1EHNA 1CBJA 5GXBB 2CJTA 4ONHA 2J57A 4J3UA 1RIHL 4HJ0D 1FNEB 1ZV9A 2PW1A 3B5GA 1K8IB 3MV01 1M05B 2X1PA 2YOAA 1OCWH 2PW2B 4X6DE 4Y4FD 1TZHB 3TV3H 1CICD 5D1ZA 3H7LA 2QHLA 3ARGB 3VD2A 1GC1C 2J2ZA 3ILPB 3F83A 3ZE0E 4K5MA 4S1QL 5GRXG 2MFNA 1T22B 3IFLH 3PP3K 4XOCA 4KXCA 4XTRD 4F8LA 4UDTB 1NGWA 4GINA 1CXIA 4NAQA 3U83A 4B97A 5I1EH 1Z5HA 1AE6L 4WV1A 4ZFOB 4UQBA 4CSPA 1E28A 4LQFL 1DBKH 2HFGL 3QEGL 4JQXC 3T3PF 3MLSH 1ZVYA 3GPSA 1A6AB 5A6LA 3WFEL 1AKJA 4AKQA 4ETQA 1Y6KR 5HGBA 1CDHA 4WWKD 4LLMA 3NRFA 2Y7OA 4UV4H 5BRZB 2FO1A 4ONFL 1KPVB 4GXFA 1ETZA 1BAWA 5E6IA 5AUMB 4CC0A 7CGTA 4E9RA 3VD9A 5AZ2L 3R1GL 1KJMB 4NJAH 3DUHA 5EDXA 2Y7NA 4KVCH 3N42F 3KG5A 1EBAA 3MUJA 3QA3A 2NY2D 1AS6A 2VERA 2WBXA 2XTJE 3A4EA 2GSIB 4YGAB 3BPCB 3FQ4A 4OLYL 3QUXB 4OGXL 4PJDA 4FE9A 5IROD 1K9TA 3SDXF 5BCAA 3QDJB 1NZRA 1CD9B 3VI4F 3WFHB 2WQSA 1KLGA 5AW1B 2Y2YA 5T3ZE 4YHIA 4UCFA 1G6RH 3QIBA 4IS6B 1XCWA 4YXLH 2VSMB 2G4GA 2BCKA 1WFNA 4L8CB 4ZXBA 1L6XA 2X4NA 1MREH 4Q9QH 1D7BA 1XGUB 1KBBA 3LXBA 3RUGA 4C59B 1YJDC 5E51A 2I27N 2ZCLL 4D0DA 4XPTH 4OZGA 3QHTC 4QNPF 1IAKA 5FR3A 2G3MA 1N0LB 3OSKA 4HCFA 5C0BB 3IMSA 5I15L 1D9KA 1ZLVH 4MWFB 2OBGA 4LT7A 5JHDD 1JZEA 3VXRA 5IFHL 2Q2LA 1T1YA 3A47A 2ITCB 4F2MB 4ZDHB 2PKDA 1JGUL 5JQHC 2CUMA 1OZUA 4HUUA 4AYGA 2CGZA 2JELL 1KYUA 4YPGB 1ROWA 2W0FB 3L4ZA 4X7SL 1JRHL 3SPVB 5LBSL 4R6UA 1SBSL 2F0CA 4WNQB 4CVWA 1OSZB 3BP5B 4DPCX 4HJTA 2WXHA 3G6JB 1GGTA 3ES6B 2DQJH 4NOFA 3WFDH 3U0WL 4M1GL 1K2DA 1BFSA 1F2QA 4L8DA 4NC0B 1KGIA 2YPKB 3QXWA 4XN5A 2W0FA 2EVHA 32C2B 4JN2A 4AQEA 1NANI 5EO1B 2X2HA 3OAYK 1NC4A 1KT2B 4CJ1A 2YPVH 4G80A 5GJSH 3QNFA 5E2TH 1WVZA 2DF3A 5CF3A 4HKBB 5CZVL 2XV0A 2X0WA 2QV4A 3F8UB 1WBYA 4L5FE 4XMKL 2UWEB 1LHZA 4LCIL 2XWXA 4M29A 4UAHA 2E9BA 2NXYC 3DI3B 5DZPA 2BVUA 3GMNA 4WI7A 4EQ2A 3EUUA 3RGHA 2PCPB 3VTTA 5A16A 2A1WH 1N4XL 2CIIB 1MVFA 3IN0A 2WVUA 4K15A 3P0VL 1AGCA 4ZOCA 1BXUA 4XNXL 4JN2B 1JYVA 2IMNA 4P2OA 2DLTA 4GAGH 3QDMB 4MJ4A 4RGOH 2BNRE 4KAQL 3BD3A 2HJKB 3DMMA 1P5VA 1BEYH 5A1AA 1EZVY 4M56A 4PEEA 5I74B 1MY7A 3CQQA 4DIXA 4Z7NF 5JOFA 1U3HC 2F61A 4W9HC 4ZW8A 4NKMB 1Y0LA 2P42B 4BFEA 5IWLA 4HUCA 1VB9A 1Z0MA 4BKLB 3KW7A 4ANXA 4NM4H 3HFMH 4ILDA 4MAUH 3C6LC 3KJ4C 4WQOA 1FPTL 2P9RA 2ZSWA 4F8NA 2ZF9A 1T1YB 2PNDA 3ZDYE 4F2MA 1UC6A 4RNRB 4J5VA 4U4BA 1A02N 3RX5A 1KACB 1NMBL 1FDLH 1DBBL 2Y9RT 1L0PA 1LD9A 2DQIH 4NJ9L 4MMXB 3RBGA 2JI2A 4TSCL 3PWNB 5CBEB 3ZX1A 2C3XA 2BC4A 4LGPB 3PU7A 4ETQB 4UTBA 1QPKA 3ULUL 2NDFA 4JFFE 1CFVL 5B4MD 5IHHA 3GI9L 5CHNA 4MMZB 4BZ2L 5DURB 1A6TA 1LVEA 4NFDA 2FK9A 1QFUH 5F1NA 3PWNA 2OMTB 3AFLA 4YR6B 2BNRD 4FG4A 2WVVB 3M86A 4LHUG 4NAJA 4F7CB 1HQ4A 2APFA 3UBXG 1TZHA 2CCLA 2WQUA 2VZTA 1KCKA 4O58H 2OYPA 3Q8CA 2APSA 1P7HL 4EBQH 4Q58C 5DTFA 3G5YB 5AW4B 1XCTB 5D7JA 5JHBA 4LOUC 2XXMB 1X5ZA 4WW1B 1P7QD 5CLYA 1X5YA 2Z35B 2IAMC 2F53B 2IGLA 2B59A 2DH3A 2DTSA 3LN9A 1NFIA 1NLBL 4J4PC 4S2SA 4Y16B 1CN4A 5IJBC 2LVEA 2GJ6E 4DGYH 5EIIA 5JHDA 1GGCL 1DVSA 1R3IH 2JNZA 2UZPA 3E9TA 4J4PA 1D5XA 4F2ME 1KTDA 4YHYC 5K9JH 3QI9C 3ZW3A 3DPBB 3HAEB 1MJ7H 2H32B 4NN7B 3RWGB 1KB5B 1LK2A 3ARED 2NNAA 4QRQA 3EO0A 3ILQC 3PJLA 1C5BH 3KPOA 1B0WA 1CLOL 4XPAL 4QOKE 3BVNA 4I0KA 1J1OL 2QPEB 4RDBA 3WJMB 3QO1A 2JVUA 3NZ8A 3WKYA 4TRPL 1RUKL 4TNVF 1JPST 4O5LL 4HLZH 4Z7UE 4YS4A 3I75A 9PCYA 3UDWA 1NQBA 5FAAA 3L1OL 3L3GA 1UGNA 4KU1A 1KTCA 2D4DA 3NJIA 5DTFB 1VPOL 2YO3A 5T5NF 5BZWB 1MAKA 4W9EC 1A5FL 4UTBL 1I8MA 3MV7B 1YNKL 1PU0A 3MROA 1JDAA 5I8KL 5MI0C 1F02I 2C5DC 4GSDL 1UEMA 5JR1L 2CA4A 4RZCA 2IH1B 1NBYA 4JGJA 1R0AH 4DUXA 3E1ZA 1E2VA 2W92A 2GCYB 4OLWH 2QKIA 5JZ7D 2R0KL 4JKWA 3KPPA 1OP9A 4NQXA 5ICYA 1KTLB 2HB0A 5CUSH 5SWQA 3JVGA 1MCDA 4GY4A 3CLEH 1K4CB 3L4WA 1YEDB 4ZPTA 2X5PA 2X6VA 1ZLUH 1D2OA 2J1WA 3FU3A 4F92B 5LQBH 1JXJA 1PGRB 4AUUA 5DMJB 3D6GA 2WSKA 1IQWH 3U0TB 1LDSA 2ZUQB 4XNYL 3HZMA 2ITCA 1CYWA 1QLFA 3KNBB 1GHFH 4KMTH 2FSEA 2J1KA 2XPYA 4I9XA 4PS4L 3L3DA 2DTML 2V9UA 1SUHA 4M8VA 2E47A 4AWJC 5I1DB 2IFFH 4UIMA 4IYKA 4RRPG 3TM6A 4XCNB 5T3XE 1MCEA 1QFWM 4X5XB 4FX5A 4J3OG 3NESA 4GQ9H 2NY3C 2Z8RA 2X09A 2AXFB 4QRAA 4BFIB 4V1DD 3VXQA 5LCVL 4FHBD 1OTUC 4Y9BA 5CGTA 2NW2A 2XV3A 4JN1L 3SQOL 3HI1B 3FNKA 5D1ZC 3WNIA 3JWDC 3LEVH 4LEXL 3MV9A 1ZCRA 3ETBJ 2ZTBA 3MRCA 3KLAB 5EA0L 1OPOA 4LRIC 3SJVE 4X6EB 4ZUVA 2R8SL 5AVUB 1DVFA 1JCVA 2I25N 2KKQA 1U8OA 4G8EB 1C5CH 1A1NA 3PP4H 4ONGL 4N2NA 3D85D 4OI7A 1W0YT 2DQTL 4OZIB 4FMKA 3AGWA 3FFCB 2NNRA 1EMTH 1PD0A 3BIBX 3GZKA 3ZIMA 1Y18A 3HN5A 3FUIA 5KTEH 4E5XG 2E9JA 2OXHA 3WHXB 1THAA 1TCRA 4PP2B 1QZNA 4FG2A 5BS0E 1E4WH 5IW1A 3IFLL 4W6WB 5F1IB 1OSPH 3MRDB 1S9WA 4KJPC 3K71A 4HPOH 4UNTA 2VL5B 3DO4A 4Z78B 4BGDA 4QO1B 4N2EA 1VZIA 3PE9A 1MN4A 3P4MA 4PCTA 5IIEB 2OV0A 4UV7L 4MXWH 2R2HB 4C4BA 1JV5A 3UABA 3OZ9H 2VISB 1I82A 5ICYB 4Y19B 4PV8A 1F1DA 3MLSL 3H55A 1FIEA 4BGLA 3DKHA 5IF0B 5EU4A 4PG2A 1AGDA 3RG1C 3V4PH 4NHCL 5I1GH 2AJUH 2YSSA 3MC0A 1IGFH 4P5MB 1N5AA 2WZPA 1JZGA 4ZDHA 1V27A 1L9PA 3RWCB 4J6RL 2A6JA 5DUPH 1U3HB 5TQ0L 4CA4A 4M7JL 2AZUA 4HKXA 3RVTD 1RZ8B 5I1KH 2BNQE 5BV7B 3S8GB 3DLQR 4BHUI 3UAFA 4JHAH 1ET7A 3ULVD 1HIMH 1UEYA 1XD1A 2NT1A 2YC1B 4OJYA 1IX2A 3G5XB 5H37H 3BPNB 3PNRB 1KB3A 1MCWW 1KBWA 4ELDA 3QJVB 4UYQA 3FTGB 3O2DH 5DD3H 4G7SB 4W70A 5LDSA 1Z3GL 4FS0A 4BWUA 2OK0L 3EYUL 3KL3A 3WNNA 3PGCA 4G8GE 4PJGB 2FUQA 1IM3D 3VG9B 2BVQA 2QKSA 5ANMA 1E5BA 2MKWA 4ZMAT 1L5GB 3IKKA 3QJFA 2Q7YB 5C7XL 5JW4N 2ZT9C 1SY6A 1AP2A 1NWOA 3BT2H 4WCYH 3QULB 5C09E 4JUTA 4NQCD 2H2PD 1MDAA 4IOFD 2LTQB 3GM0A 2XVKA 3TFKD 5F7UA 4GI9A 5DEGA 4K3GA 2P48B 1JV2A 4LRNL 1F90L 1S9VA 2C34A 1RERA 4Q74A 4CVXA 4OCYL 3TL5A 2OQJA 1KIQA 3PAVA 1XX9C 3O4LD 3DBXA 3PGFH 5JORA 4Q9RH 5DJDA 5TGBB 4CGTA 1AP2B 2YXMA 3RDJA 4F7EA 2D31B 3ZGHA 4PPTA 5E5LA 1KLUA 3TBBA 1L5GA 4P07A 4ZX5A 2VR4A 1JXKA 4NQSA 3DMMB 1FFPB 4NRXA 3IE9A 1WZ1H 4A2FA 1ECZA 4W68A 2QQQA 1IEBA 3J27A 5ITBH 4IHOB 1ZVSB 5B38B 4IDJL 5L2KE 5H4ZA 2HAZA 5FWQA 1NCCL 2FEEI 4CBZA 2H26B 3GKWH 5KW9L 5E9AA 1QOKA 4X83A 1OALA 2DTMH 1OAKH 4KKBD 4Y5YA 2CBTA 4J3SA 1NBZB 5I73B 1UT9A 1HL8A 4YJZL 4OR1A 2DQFA 4XRCB 2H1XA 3LKQB 4I3RL 4XMKH 3FPXA 1ZT7A 1I9IL 3ZHNA 1GC1L 3O4OB 2ZWZA 4ZUUB 5IEKA 1WFOA 3RWCA 4LCUA 1GSKA 1AD0A 3ZKXB 2YPVL 2CLRB 4R26L 3QNYA 3FH5A 2WLKA 4KWUA 5GGQH 5LQBL 4YH6A 1WS7A 3OKLB 2CGRL 2NY4B 1E27B 2VXVH 4S1RH 1HKLH 2ZE0A 3IRZA 2ZCKH 3MGAA 2G9KA 5I66A 3F85A 1QW8A 3WFCH 3FCTA 4JRWA 2P5PA 4N2FA 4DF9A 4HG4K 5I17A 5DZJA 2GK2A 3MNVA 1AO7A 2J8UF 3A6BH 3TOPA 1YEFL 2XZAH 3AS2A 5FGBA 3SKJL 2NY5L 5JIPA 3VFSB 1HSAB 1RJLA 2PO6D 1IT9H 1KB5L 4KTGA 3T77B 3EOAA 4AYID 1RMFL 2D0FA 2ZUYA 4BA8A 4GQZA 3H3KA 2BNQA 5EMYA 2K3TA 3TYGL 1OSPL 4LOVA 5JHMA 5F2FA 1UHVA 5L88H 1UH2A 1TCRB 4PP2A 1TQSA 3VE0A 4KK6D 3EDKA 3MX0A 1IAIH 2CCWA 3P77A 1ZS2A 2ADGA 3P73A 2FX8H 3TA3A 1FN4A 3HG1D 3MRDA 5TK2A 5DEJA 3CFNA 6PAZA 3FFCA 4F57H 3BISA 5MENA 1Z5LA 1J0ZA 1IGCL 1ZXKA 2DQHH 5J3HD 4Z7UB 4BCXA 4LCWA 5TQ2H 2VZVA 5AL0A 5DUMH 1BVNT 1BZ7A 3QNXA 3K8LA 4JFQA 3HZVA 4X4MA 5EBMA 3ZG4A 5LN4A 2KC0A 3GIVA 1QVOB 4P57A 3KJ4B 1SJVA 1DJHA 3MOAH 3GB7B 1ACYL 4O2EA 1YO4A 4B9KC 3CFEB 3D2UA 4ENED 4GAAA 5EUOE 1F3DJ 3V6ZB 3EW3B 3CJJA 3IJSA 3BEVA 4FQJH 3V5HB 2P80D 4P5TA 4FQ1H 1X4XA 4JBSA 3ZQ9A 5D2LA 2UY6A 4HSCX 5CAYB 5AVQB 1S7XB 4YL4A 4DOHB 4O58L 3VXNB 4A37A 1V7ML 4FP8H 2EVIA 5CEZD 1P4BL 3T0DA 2BP0A 4XN9A 3S7GA 3NIGB 2YN3A 4U1NB 5E8NB 4JW3A 3UG3A 5JIQA 3EYOA 1E3XA 4G8FB 1R9FA 2VLLB 4GG8A 2ARWA 5I8OL 3WNPA 4ADGA 2XX0A 1UA3A 3GRGA 4ZW5A 3H3PH 3TO2A 1U92A 2UY6B 1KPVA 1NCDL 3OHXB 2FWSA 1K4CA 1GY2A 5DI8B 1FNGA 3VXOA 1RULH 1OW0C 5C07E 1DFBH 2FR4A 4Y0GA 3R4RA 4JHBA 4LVOC 2XYBA 5CWSA 3D3VA 1K8DB 1WTGT 3E6FA 4UQCA 3NTCH 4YHIB 1ZHLB 1JK9A 3RTQC 3BGAA 5KUKA 1E4JA 1X5XA 1NDGB 1QSEB 4H8VA 1A7BA 4F1SA 2FWOB 4G6AC 5KVDE 1NC4D 2WQVA 5HI3C 4NM4L 1BOGA 3MNZA 3CDCA 1BQLL 3FB7B 3MV7A 1J05A 1JPTL 3ESMA 3S34L 1ZK9A 4ZYKB 3OZKA 2BOCB 2XRAL 3MRFA 3ARQA 1ETJA 4MD4A 4OGAC 1KXTB 5INCB 2H45A 3NZUA 1YYCA 3MCG1 3ZDXF 1EEUA 1A1MA 1JFQH 4OB5L 1ETZB 4HFUH 3LKOB 3VG9C 2JJTA 3L3IB 1E5UI 4TUUA 5CLTA 2Y2WA 4TULH 3F12A 3GZOA 1QQDA 5L0QB 5IBUG 4PJ9A 1BZDA 2Q10A 3GF8A 5IJVA 3A21A 2WHVA 2Y7SA 3CIQA 1NLBH 1X9LA 1ZK5A 2ADIB 5E0FA 3MOBL 2ZXWB 3W39A 2XKSA 3N40F 4P9HH 1RZJL 1MRCH 1PZBA 4NQDD 1HCFX 4PJ8A 1S9VB 1VAHA 2E6PA 5HDQH 5AFAA 2FJGA 4GP4B 1H0DA 2CBMA 3EGSB 4ELMA 3O3DB 4MJ5B 3FU7A 1LGVA 5IVXF 1JK8B 1CLOH 1AD0B 1WWWX 2L7EA 3Q2WA 4AQAB 2G5BB 1SGKA 5KVEH 2KZBA 4WI3A 4UAOB 3CCHB 3Q9QA 4BYHA 4GOSA 3RWFA 1UOLA 3WFDL 2XWZA 3L9RB 3P3TA 2XRAH 4LLQB 1TQUA 3HAEG 1MHHA 1WSST 1ASOA 3ULSA 4JO3L 2YD1A 4AT6A 4B3VA 3MJ8A 3HEIB 2KLRA 1PX8A 3WIHA 4ZMZA 3R0MA 3VWJD 1QHQA 4HBCL 2DM3A 4TVPD 1KIUB 3V5KA 5F9AC 1RAMA 2HFEB 3DYOA 3B9KC 5DQDL 5CN2A 2DN7A 1K6QH 5EN2A 2E7DA 3DJRA 4QRRE 5BUGA 1RJYA 2ZXDA 3A67L 4OIFA 2D73A 3TF4A 3ULSB 4AT6B 3QUYC 1ZA3B 5CCHE 1H3WM 3TPKA 1FBIH 4H8HA 5EBWB 3P9MB 3SKOB 2A6JB 4CVZB 1HI6A 3HG4A 1LM8V 5KVFE 1BG1A 4D0CA 1AR1B 4JG9A 3WGVB 2G3ZA 2DWXA 2A9NL 4J3XA 3HCVB 5AW7B 3S3PA 3QWNA 4LZHA 1RJZB 2PWGA 4KRMB 1PX3A 3QBTB 3UTZB 4PJEF 3B7RL 3SY0A 1YPZA 1CFVH 1ZXQA 5FYLE 4I0PB 2VDOB 1CYXA 1JV5B 5BRQA 3UTTD 2Q8BH 2IDTA 1E43A 1PZ3A 1U58B 4RGOL 5HXMA 3QXVA 1CMOA 1JBJA 4AE1A 5AW0B 4LPYA 4OIIH 5INDB 1OSYA 3BUYB 1MLCA 2VO5A 4M1CC 3DVIA 4PMEA 5DK2A 1VGEL 4ZW6A 5E8EB 5HYJD 5EEWA 2XPGB 3QRBA 4Y4HB 2E5EA 1Q0EA 2IPTL 5ITFA 2CIIA 1S9KC 3WY3A 3NP4A 3PNWA 3NEXA 3TNNA 2HMID 4ORGA 4FERA 3HS0B 1MEXH 3D3VD 1P9MC 2GPZA 1UH3A 1IAOB 1IILE 3SKUD 3QZWB 1PX4A 1DDHB 2ZOTA 1IAII 2C3WA 2ZCHL 2WK2A 3EZJB 5F7DA 3CFKA 5IVNA 3GHEH 4AV5A 2ICWJ 4GXVH 3FUEA 1T0NA 3Q01A 4EPSA 4XVUC 4X5PA 4QF1A 5CJ5A 3GTTA 2R4SH 5CEYB 5AAWA 4L29A 2J5LC 4MD0B 2HVJA 2ITDB 2LOEA 2D3NA 1JK9B 3S0PA 3PXHA 3U4BL 4A2DA 1EZVX 3EYFA 1HE7A 4BCYA 5AVVB 2E7LC 4LKCB 1HHGA 2GY7B 3GMQB 2MHAA 2DZEA 2YPLD 4AI7A 2NUPB 3KR3H 4MJJA 2DQMA 1K4DA 3DTUB 3RNKB 2R8SH 3LKNB 1UB5A 4F3FB 5KVFL 4PWFA 3HPLB 4DPAX 4WAFA 2WQWA 5FGRA 5T5NG 1GL4B 3MBEB 2W8CA 2FO8A 3N2JA 5ACLA 1CE6B 2GIXA 4HYTB 4AIEA 3LPFA 4U6VL 5DRZA 5KSBE 1ZGLA 5EZPA 4AJYV 3P30H 3GMRA 1QLFB 3AG3B 3B4NA 3VCLA 4TTGA 4HD9A 5D1QE 2NZ1A 2DWEA 2X38A 5HHPA 5EU7C 3TCTA 2CGRH 2HH0L 3V4VH 3VQ1C 2HTKD 3II2A 1SXBA 2PXYC 4E41B 2WUCH 4KO6A 4EDWL 4DT2A 1NGQL 4L3AA 3I02B 3MRJB 1I3RB 3DMMC 1FA4A 1PKOA 1WE5A 3TVMB 2XPGA 3FS9A 4MZ2A 4ATWA 2Y6TE 2EEAA 1FZOA 3IK2A 3RKPA 3G9AB 2A83A 1M3IA 1BF2A 2ICEC 3FFDB 4HIIA 2A7BA 3AADB 3VFOA 3R06B 3Q7JA 3PQYE 2P45B 4XMWA 2VUOA 4EN3C 3E2HC 3P2BA 3EOBA 2YA0A 1IFHH 3VFUB 2L04A 1T4KA 2FBOJ 1Z9MA 3JTTB 4PJAB 1OAYL 1Z5LB 5DGRA 5L4MA 1BZ8A 4MJ6A 1JF1B 3O81A 2N7AA 2WSPA 5C71A 4EE2A 5JDSB 4OJDH 2XZZA 3CLWA 5KBMA 2YPLE 2ZYHA 3KPRB 2KL6A 4DSYA 2CUAA 4Z18A 1EK3A 2A9ML 1RK1A 3KPOB 1KJVB 2MCPL 3WFEH 2A0LD 3OC8A 1NGXA 5C0FB 3QJUB 1QSVA 2V37A 5IJVB 5JQIB 3WN5C 2ZUXA 4H1LB 5BMFH 2IADA 2N3JA 3OJDA 3BEWA 3WNOA 4WGVB 5BO0D 1WIPA 3ZK0A 2MEJB 4MMZC 1M57B 1B2YA 4KHTL 5HHNB 5DHYB 3VA2C 5B3JE 3QIWA 4FFYA 3MLWL 3WHE1 1QBAA 4WV1B 4FABL 4GKZB 1CL7I 4WEEA 1CQYA 2V5TA 4PTUB 3QZMA 1UM4L 5HSFA 4XMZA 2NZ9D 3RFZA 1R3IL 3FUJA 3BGMB 4FA8A 3WDIA 3SZKC 4R5TA 2R56L 2VRAA 3O3EA 4ONFH 1N5AB 3K80A 1FAIL 4DP9X 3TTSA 4ZFQA 2ZOKB 5I9QC 1NMAH 1H0DB 5B39A 3ISYA 2WQ8A 4QYAA 4HLZG 1YYLL 4UQAA 1JI1A 1NFDA 4PP1D 4Y8DC 4IBTA 4AYMC 2DJ4A 4WI5A 1HNGA 3X1GA 4ANWA 3IB4A 1UOVA 2L4OA 1QFOA 2CMRL 1L9NA 2P28B 2BWIA 4FNLL 3RUGE 4H1LA 1BP3B 3CZEA 2IXQA 3QI9B 3QUKA 4G7VH 3K72B 2I7OA 5C92A 3DOHA 1H5BA 4HCRL 4JGNA 4MZRA 4OLUL 5JPMB 1BREA 5D4JA 1MFBH 1F8TH 1ZHNB 5ABZA 1F11A 3TO4A 4UTBH 3P3SA 1FYTD 3K71B 2OZ4H 5HBBA 5C0CA 4ZO7A 3I6KA 4G59C 2Y7QA 5FYKD 2BHYA 1D9KD 4G8FA 5BVPL 3H9SE 1JVKA 1FFOB 1E6OL 4D7BA 2GEEA 5HHXL 2WXGA 3KXFB 4JY6A 1QHPA 4O2FB 1FV1A 2CHNA 3TBTA 1OAJA 3UTTB 4BH7B 3SO5A 5AOKA 4FXTA 4G8EA 4YN3A 3FU9A 1RZGB 4OM0L 4N2LA 5DQJB 2QGEA 2HJKA 3LRKA 3P11L 4YBLB 1F6AB 4QKXB 1G9MH 5HVHB 2EECA 3ZZSA 3HNSL 2BIPA 4FNQA 4PBVC 3MLYL 1K5WA 4I18B 2VERN 5E1IA 4LHQB 2DWSA 2HJFA 2CR3A 3CTTA 4FYRA 3JVFC 2PP8A 4KH9A 3HMWL 4ZD3H 1T1WB 4H88L 1WF5A 1UZGA 1ZANH 3EGXB 3OHXC 5HHVH 1HEHC 3GBLA 2VR9A 2OKMA 1E40A 4PUBL 3P0GB 1RZ8A 1MFVA 3VD0A 1QLRB 1TNMA 3BESR 1AY1H 2J21A 3RL2B 4RIRB 3MBEC 3WE1A 5E4EC 4P8QA 3QPXL 4JJ5A 1NUFA 4H25A 2X4UB 3KPRD 3GMRB 1KG0B 4Y1AA 1QFUL 3B1UA 4H20L 1M1XB 5KG9A 2VLME 2MH4A 2P8MB 3OJMB 1VIWA 5M95B 5F89A 3M1BB 2D7OA 2A9NH 4HC1A 4I2XE 1XSOA 1KJ2L 2A6IB 2Z4QA 2J71A 1JS4A 2JFCA 2WLIA 3BJ91 3FSOA 4MJIA 2Z4TA 2FWLB 4H2AA 4IRZH 2CO2A 5DK3A 3KPQB 5DHVH 2FJFA 1EFXA 3QPQD 2WIIA 4BFFA 5EIVA 2PP9A 1KPRB 3AS1A 4XPFL 3EJQA 1TPXB 3PAZA 3ARXA 2QSTA 4P2OB 4NNYB 3V0IA 2W9DL 1K6QL 5CJBA 1O6SA 1NGZB 2AMUA 3GD1C 4G6ML 5IUSA 4NEHB 3BXNA 4KK6C 4H8WL 2D7QA 2XPZA 1M71A 3FK3A 4WJ5A 1TDQA 5C0BD 3GT6A 3KLHC 1IC5H 4WY7L 1QLRA 1TEFA 2GY5A 2JCCF 3HS0C 2B3RA 5E9DA 4N5EC 4XMPL 5IBTL 3DURA 4I88A 3RNQA 1YHPA 1KCSH 3HS0A 5I8KH 2DLFL 4MYWB 4NHUA 3D9AL 1PCXA 1CU4H 1OGSA 3BXNB 4JB9H 3VSVA 4G3YH 4B53A 4Z23A 4JZJA 1A4KA 1OL0A 1CK0H 3G5ZB 1HDMA 1N3NB 3RGBA 1KGXA 1U95B 3A0OA 3OKKA 1XF4B 4WUKH 4NQQA 1RUKH 1F6AA 1U8IA 4FD0A 3HN3A 1JMXA 3QHFL 5DJYA 5CMAB 4BWWA 3DX8B 4XX5A 1HSAA 1RJLB 4K7FA 4R7DB 3BKML 3RZCC 4N9OB 4PJ7A 3UO1L 4FYTA 4Z95H 4XC3H 3D69A 1A9VA 5K5YA 1FF5A 3BPCA 5FFOA 5DJXA 3KPMB 3Q5YA 4G7RB 2DPKA 4YSCA 4DK5A 5BS0B 1O0VA 4P48A 2XBTA 2WBWB 1FSKB 1P7BA 4X99A 3U36B 4JO4H 3P2TA 3VD1A 1MHCA 2VW4A 4MNHA 2B2XL 1CDJA 2Q5BA 3N50A 2YEQA 4PWKA 4UOZA 5FKPB 4KPHH 2XSKA 3L3OA 5CLXA 1PL3A 1EBPA 2BIIA 4NQDB 5EF0A 2B9AA 4IRSD 4HF5L 2F54E 1I8AA 2IOIA 2X6CA 3QFDB 1HS6A 4UDUB 4WRLA 4WW2C 4U6HB 2BSTA 3UPRA 4EBQL 5CILH 3GI8H 2QQKH 1CTOA 2M2DA 4V1DE 1F6FB 5F70A 3HC0B 1YQVL 2CKBB 4IEFB 2YPVA 1E28B 2P5EB 2TRYA 4RAUB 2BSED 5LWYL 3IFPB 2ZWKA 4Z7NB 3MN8A 4WKZB 4F1ZA 1J5HA 4L3CB 3HG3A 3T2QA 5HDBE 5JA8B 3WJLC 2ZXEB 2KH2B 3P40A 3WD5H 3O41A 1NBYB 5D7IE 1DDTA 3NSYA 3VWJB 3T6VA 3GJEB 5D2NE 5CD3A 4FQXD 1QWHA 4PWGA 4TUJB 1HAUA 1CVSC 1FV1B 4HLJA 1QABA 1YEEL 2V7HB 3HHRB 4Y2DB 3V4PB 1QRND 4X42A 4POYA 5B8CA 3NN8B 4MHHI 1NOAA 4N8VB 3CH1A 3OVUB 4X6BA 1NCDH 2XQBL 3HTLX 5KN5A 1W0WB 5HPMA 4MX7B 3ZXAC 3I75B 4GP8B 3FQ2A 1MREL 3LZPA 1PG7H 4E42A 2B5IB 4GW1A 1YEKL 3EIFA 2R9HD 3B3IB 1TLKA 3U9PH 3TEUA 2VUYA 3J07A 2ZSVA 4LEOB 1MCOH 4X9IA 1QFWL 5JPMA 3V6OA 4KRLB 1VJSA 1XF1A 4HK3N 3FQXB 5LHDA 4AXWA 2QT6A 2E56A 3ARYA 5CILL 4EZJA 2AGJL 3QRLA 4LVNC 3UGXA 1NUDA 2K6ZA 2DI9A 1G5AA 4WNJA 3KPRA 2ODHA 3IPEA 3MGTA 4PTTA 4RFEB 3CXFA 1L4IA 2R4RH 4JPKH 3NJNA 1S3KL 4JEGB 1A47A 5EUOA 4AQ8A 1PBYA 1E4KC 4MJ6B 1EHXA 2Z35A 3OKNB 2ZXCA 2Z3FA 3NDZE 2BINA 2GJPA 2J20A 5B8CB 1BOGB 1KGUA 1KCBA 4JNXA 3SKMA 2Y23A 2NYYD 3JV4B 2JV6A 5I6LA 4FLSA 4ONHB 5E8DH 4UINH 1WT5C 2DLEA 2F53D 1H8LA 3GMMA 3C09C 4ZODA 1VCBC 1RZKL 3CFUA 4QRPA 2XX1A 3FO0H 5GSVA 3E6FB 5ITBL 4ZZFA 1KPRA 2QSCL 2X6BA 4YDZA 1OP5K 2RH0A 4DGVL 5FUOL 1J0IA 3OLDA 4Y19A 3DV6A 3PIQA 2VL4A 1ICTA 2FATL 5MEPA 2X53A 2ZKYA 4HHAA 4AGLA 3BOVA 4IBYA 1YEJL 2R29A 2Y6SC 4WNQA 2J8UB 1WPCA 1IZJA 3MLZL 3PJSB 2IPUG 1GJWA 2XNAB 5MEOA 5E6YA 4OZ4A 2EKJA 4H1LH 4HXAH 1VFOA 1G7QA 2AJYH 1NUNB 5DVLA 5C09D 1H3TA 4A67A 3CHOA 1ND0B 5E9DE 5GGSB 3JZYA 2Z7YA 1NIEA 4NN7C 1NM4A 2B39A 5B1AB 1IQDB 4G70B 3TJHD 5JOPD 1O7VA 3T9WA 3QIWC 2BSRA 2WTRA 1I53A 2VUKA 5C0BA 4P04A 4PGBA 3WFCL 5IQNA 4I77L 2JELH 1TFPA 1IL1A 3C6EA 5LCVA 2I60H 3APDA 5MEOB 4PRIE 2XNAA 3VACA 5A2IH 3OKDA 5EO0B 3LY6A 2CIKA 3SDDD 2MMXA 4XN8A 2FEDC 4HEME 3ZRSA 2C4XA 4BSVA 1QZ1A 3VTAA 2ZWLT 5C0JB 1AXTH 3UTSB 3DV6B 3OKMB 4PGCB 5E99H 5GS1A 4LIQL 1GPOH 5LGHH 1XIWA 1J8KA 1U8CB 2FH6A 1DEEA 1DQJB 4HOMA 1W8NA 5ES4B 3O45B 3HHMA 5B7EA 5C0AE 3Q0HA 4K71B 2WZ0A 3O2WL 4BFIA 2DKSA 1XH3B 1JN6A 5GSRB 2C3HA 3LQAC 3RE0A 4J3WA 3ECUA 1PEZA 3L6FB 4BZYA 2X4PB 3GJFB 4BK5C 1KTRL 2VXTL 2WBJD 1VENA 2GJJA 3IGFA 3MCYA 2HUEA 5IVZA 4MJ2A 4QHLB 4X5WB 2UWEA 3HBPA 1GYWA 1FL6A 1YYLH 4WO4B 1R5VB 1OARH 5AVYB 1WFMA 4IRJC 3VO0A 2HLEB 3J7HA 2AAAA 2CAKA 3PRZA 5D5MB 4KKRA 3DK0A 2Z92B 4M5TA 3HUJB 5LJYH 3UERA 4UMGA 1O75A 4U2YA 2G0LA 5EC1A 3P2DA 4A2EA 5IHZA 5C07A 2PPDA 4FLRA 4B9YA 4N0UB 3QRGL 3D2TA 1ZHBA 1EXUB 3VXUA 1IM3A 4XP1L 5FF6A 1VFAA 4JKPL 5J5EA 3D39B 2YAQA 1SLUA 5F9JB 1GY1A 3HOGA 4BZ1A 4D3CH 4MLIA 4OZFB 2Q6WA 2X70A 1GTNA 1D5RA 4PI2A 5CEZE 3SE3C 2EDBA 3I9IA 3OF6D 1M1XA 3QZLA 2IDSA 4B95C 4EUPA 4A1IA 2A99A 2XQYK 3ZQXA 1EIBA 1AOZA 2R1YA 1T04A 2WCPA 5HHOD 4TSBL 4DQOL 4XNDA 3LKQA 3B2MA 2W60A 4JFED 3AG2B 4F7CA 1ZTXH 4KROD 2HCZX 2A2QT 3K6IA 3MUZ1 3TPUA 5I8EA 4Y7OC 4FI6A 3PNWB 4KNSA 2J43A 5TE4L 1SMOA 2OI9C 3SQRA 2JLPA 3F5WB 4ANVA 3RP1A 3LSOA 3FXIC 2JXMA 3B7YA 4DFIA 1NBQA 4DP1X 2KZWA 4JZOA 1JMZA 4OSUL 3RVXC 3AC0A 2BFVL 1NEZA 4L9DA 4DO6A 3KPRE 4L8SA 4BHUA 4CGUB 3GNML 5C0ND 2HN7B 6FABL 3GSUA 2GW5A 3NFPA 5BXFA 2UY7B 2R2EB 3AY4A 1LEKA 3UAJA 1QW9A 4KRPD 5EIQA 2EDTA 1BJ1H 3X3GH 3QUZC 1SBSH 5DRXB 3UXFA 4F7TA 2KPNA 3T0ED 1KV7A 1QG3A 2EC9T 2P26A 4XWOD 3JTTA 1R3HB 3LN4A 1SEBA 4Z8FH 5GS1C 1FSKC 2DQDL 4AYFA 2VMDA 1PPIA 3DSFH 3NFPB 12E8L 2AEPH 3ABKB 1E2ZA 5DMGC 5KVDL 2A5UA 1MRDH 1YNLL 1J5OL 2ED7A 5F7EL 2EE6A 5AUMA 4K7FB 4R7DA 3VGAC 5IVXA 5K59F 3SPCA 3CG8A 4PGZA 2R2CA 2V5SA 2HRLA 2ATPB 4XNMA 1RP8A 1EDHA 3D51A 2BVPB 4KTEL 4AQ8C 4ACTA 1U2HA 1NGWB 3QRFM 2ZD0A 3O11B 3BH4A 1FFNB 1ODAA 3HBGA 1RU9L 3BRDA 2OMNA 2FIKA 4MMXA 5JIKA 1KOAA 3RNQB 3L1OH 3ARWA 1T04B 3PGDA 4J3BA 3IDNA 1MJJB 4WI4A 4I87A 1LO5A 2F58L 4TQHA 4EUPB 5EO9B 1MCBA 1SFHA 4NWUL 3FAWA 4OD2B 4WO4D 5ALBH 3HR5B 4J28A 4AM0Q 1JF6A 4JFSA 1FZJA 3OAUH 2E46A 1PZDA 1ZY9A 2E7HA 1J8RA 4M61B 4HFWA 2EDNA 5LAPA 2CKBH 4PY7B 1NEZG 1N2RB 2NXZB 2NY1B 1ZTMA 3HE6C 4M6NL 4U1MB 5J6HA 2V2XB 1UB5B 4L4TE 4K94C 3SBWA 4RGND 2Y4SA 3NIDE 4Q0XH 3GDCA 4U1LA 4KRNA 5AKVA 5KVDH 4EI5B 2G5RA 3T5WA 2HSIA 4XAWH 1F4AA 4FMFA 5JIDA 2YWYA 4BSWA 2ZOUA 1XXDC 1QRNA 1YJDH 2XQYG 4AVKA 1NLDH 1BQUA 4GKOA 3TJPA 4AV0A 2LLLA 3MKGA 2F6AA 1CC3A 2BIMA 2EDHA 5IVZB 3RI5K 2FJSA 4RMSA 4EXPX 2B77A 2DY2A 1IU1A 4UB0H 1RY7B 1R5VA 5DD5L 2P43B 3D05A 5F6IC 3VXRB 1AZNA 1TZAA 2NY4D 4KTDL 1MIEH 5FYJD 4X4YA 2WLYA 3L6FA 3MRRA 4S1QH 2XHNA 4KVPA 1DQIA 5ETUB 3AW5A 3LEYH 1PJWA 5HI4D 2YD3A 3FTYA 4HS8H 4YWGL 3B2XA 3RGVB 3SE8H 4EMZA 3ASOB 1AR1D 2GHWB 3F7RA 4JVUA 4UQ2B 1O6SB 3C5ZC 5KYNA 2GAZB 1EDYA 2YBRA 2IC2A 5E2JA 5IB4A 4HUMB 5D7IF 4QHUB 3ASWA 1BAFL 2WO2B 4OCXH 3O4OC 2EUXA 1RZ7L 2DIJA 3EKCA 2J73A 2YUVA 4MNQB 1X5AA 1YDPA 2YEZB 3TBVB 5I76A 4MAZA 3MV7E 2VXUH 1L9MA 3L4YA 5F3BB 3QDMD 1U3JA 2YFNA 4L9LB 2H3XC 5DZNA 1O7SA 1GAFH 3QEQE 5DD6B