3TX4A

Crystal structure of mutant (c354a) m. tuberculosis ld-transpeptidase type 2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
285
structure length
267
Chain Sequence
RYTLNATALHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGALNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mycobacterium Tuberculosis LD-transpeptidase type 2
publication title Targeting the Cell Wall of Mycobacterium tuberculosis: Structure and Mechanism of L,D-Transpeptidase 2.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Peptidoglycan binding protein
total genus 70
structure length 267
sequence length 285
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 3tx4A02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3tx4A01
5D7HA 5K69A 2MTZA 4QR7A 4XVOA 5DU7A 3VYPA 4GSQA 4LPQA 3ZGPA 4QRBA 4A1KA 3U1QA 5DUJA 4JMXA 2HKLA 1ZATA 4HU2A 4GSUA 5DZJA 4A52A 4JMNA 4QTFA 3TX4A 4A1IA 5DC2A 4ZFQA 3VYOA 5DVPA 5E5LA 3U1PA 4GSRA 4Z7AA 5E1IA 3ZG4A 3VAEA 5LB1A 4QRAA 4K73A 5DCCA 1Y7MA 5DZPA 5E1GA 5LBGA 4LZHA 3TURA 3VYNA 5E51A 4A1JA 3ZQDA 4HUCA
chains in the Genus database with same CATH superfamily
2P8PA 2ZCKL 4KTYA 1P4LB 5TD4A 3D39E 5DQ9B 4F8PA 5IQ9B 5F7FA 3II3A 3QCTH 4AQAB 1S7WA 1QEWB 3L17A 5C0JB 1TNNA 3ULVE 2PWFA 1LQBC 1FGVH 2YXVA 3QHFL 3L3OC 2ZICA 5I75C 2ED9A 5IJKA 1MHCA 3ULUE 1IL1A 2HYMA 2EDKA 4UQDA 4PJIE 4PJBA 1MCLA 4Y4KA 15C8H 3FO1B 4XWOD 5JPMA 1F4XL 4GRLD 3EHBC 4TNGA 2J8HA 4AC4A 4EE2A 3CFJB 4A63A 3BEWB 4Z7NE 5F9JB 2EDXA 4YSTA 4L1SA 1PQZA 1GYVA 2PCXA 2YGNA 4TULH 5FB8A 3SDAC 1F97A 5DHEA 4N20A 3N85H 4AENA 4AZ8B 1K5NB 2WWKT 1T1WA 1H19A 3BUQA 3RWDA 2WANA 3GJEB 3DHUA 3V6OE 4AW7A 4D0BB 4RIRA 1HCZA 2ALAA 4NO0D 2YGQA 1WEJH 4ZYKA 1KGJA 4CDGC 4LRIA 3CZJA 2GHWB 3OB8A 4JG9A 2AEPH 4NN7C 3ARPA 2F7IA 5AW3B 2ZKYA 3S37H 2ATPA 4OD1H 5D2LA 1WSST 4Z6AT 4XX5A 4LAQH 3NCCB 3TGXA 3VFPB 5DJDA 5I24A 5ABZA 4BH7B 5ACZB 4WI4A 4Q58C 3WJLA 3UBHA 4X6EB 4FLQA 1IKNA 4W9LC 1CJYA 2VLLA 3CFDB 3VFUA 4FQPA 1T83C 2WP3O 5DT1H 2VRAA 4KGJA 1F4HA 4XOAA 2JK5B 2W1NA 4Y5YB 1SOKA 1VADA 3WTSA 2HWZH 5E7FA 3K8KA 3QUXD 5BRZD 3NAAH 5HYJA 3CGTA 1R17A 2EDEA 4QWWC 3VWKB 5LNGA 1IMHC 1RUPL 4HQQH 4KHTL 1PEZA 3BH4A 1HH6A 5HDLA 2BVTA 4B9CA 4AG4L 4YBLB 2C7UA 2IBGA 4GAJH 4YPJA 1UWEH 5JTWA 3S2CA 2V9QA 1EEUA 2DBLH 3GNMH 1RL1A 3N55A 2QVTA 4JPVH 3ABMB 4NJ9L 2VM4A 2IV9A 3TH3T 1IVLA 3ZE0F 1ZA3B 4JGUA 3AM8A 1B6UA 4K2UL 3VH8B 2D0HA 2HN7A 1MFDL 2JWYA 3FULA 3K3QA 4ECNA 5KAQF 1BIHA 5CINH 3QS2A 4GAAA 3BPLC 1DDHB 4ZMOA 3A22A 3MJ9H 1D7BA 3D3VE 4XMKH 1P1VA 1FO0H 4W9IC 4HOZA 4ZJ9A 1DLFL 1R47A 3C12A 1U4EA 1MW2A 4IMKC 1UXWB 1L9RA 3QJHB 3B1TA 4ANVA 4K3HA 5ICXA 4J8QA 4LGPB 4PJEE 3JWNH 1RURH 1MFMA 3BE1L 4DVBA 1LJMA 5I8KH 4G6JL 3PL6D 2C3VB 4M7ZC 4NM4L 2XX1A 2WV3A 3TCLA 2BOCB 4Q14A 1QW8A 3VI4B 2HJKB 3RTQD 3TPUB 3PP3K 4WI8A 3IJEA 2HX7A 4DVRL 2VRKA 3QISA 1M7DA 4WI5A 3U2SB 1Z6JT 1KJ2L 3EBAA 4AM0B 4Q9QH 1FFNA 4QOKE 3KPMA 4OGYL 3UJTH 1JVOA 2V17H 2VDQH 4LBEB 4Y5XC 1YNTB 1IGJA 4F2FA 4L1DA 3L9RA 4JRXA 1ZEAH 1WV7T 1QZ1A 1JGUH 4PJXB 3RKPA 3VYOA 1C1EL 2VDOL 4UINL 2YKLL 1QUNA 1RI8A 4P5SA 5DSCA 2EINB 5CBEA 3QDME 5E5MA 2CCLA 2YK1H 1PJ9A 3PDGA 3FTGA 4M8UA 1JNLL 3CPLA 2B5IC 2KUTA 3DJRA 1NIAA 1JSYA 1IGYA 4I1NB 5F7HA 4PRIB 3A24A 1ZJBA 4MNGB 4MB3A 4Y4FC 1JFHA 2P4AB 4LLUA 4PIRF 3V5HA 4G8GE 4HD9A 2YD1A 3L48A 3UAJC 1D5ZA 1WZ1H 4NP4H 1HHGB 2JELH 1XTLA 3WIHH 4G6FB 4LCWD 2BY1A 3U79A 5T5NF 3GMPB 2DH2A 2K1MA 4TLKA 2AK1H 5FIEA 3TA3C 3UBXG 2JI2A 4CVUA 3HAEA 1RPKA 2AXJA 4M3JA 4PSPA 2ICWA 1H8NA 3AY4C 3S48A 1FNGB 4H1LB 5FUCC 1FO0B 1C5DB 5J5EA 5IM7A 1ZS8B 3QJUB 1GPOL 5I8EA 4KQ3L 1OCWL 1SJXA 4S2SA 1KB9K 1OE2A 4XP5H 2YLHA 5D2NC 3G6AA 4LP5A 4HCRA 3S3SA 3LPFA 3CDGA 1YMMD 1JGLH 2Z31B 5F1SA 3RDTD 2VZOA 3LTVA 4PR5B 5E9DE 2OJEA 3UZQB 1RK1A 3V0VA 1BFOA 4PVNA 5TE7H 1HKLH 4JN2A 7PCYA 25C8L 2ADJA 2GY5A 4JO4L 3QJFA 1MFBH 5I9QB 1Z5LB 1F6AA 2BOBB 3MNVB 4CC0A 3OLGA 2Z9TA 3O6LL 2OL3H 4P2OA 3LRKA 4NN6B 3B9KB 4NWTH 4S1SL 3DO4A 5HPOA 1CXKA 4HHAA 1FRGH 3EH5B 1AIFB 1I8KB 2EDWA 5FOJA 2LFGA 4PJ8B 2VKXA 4KUCD 1P7QB 1PNCA 1Q72H 4IRZA 1GJIA 3Q1SH 2PR4L 4H0HB 2VLJD 4OJFH 5LBSA 5SWSA 3UP1A 3TO2B 3BIKA 3FUMA 1CXHA 3CAFA 4KNQA 4BK4A 4E9RA 4JR9L 5BS0E 2PTTB 1MRCH 4FYQA 2FO1A 4UYQA 2R1WA 4IIQB 4Z7VA 1I9RH 3WJJA 1XVSA 2CK0L 3QDJD 3RUGF 4D9LL 2RFXA 4WI0A 4Z3EA 5B38G 4JFDB 1RIHH 1QFWL 4GSDH 5DUMH 4B7LA 2VSDA 2X5PA 3QO1A 1WBXB 3W5NA 4R3SA 4ZSOA 4BRVA 4IGBD 3UC0H 4GRLA 4GMSH 2RR3A 5D6CB 2E7LA 1HIMH 4NQEE 4O02H 2JF1A 1OL0A 2QR0B 3QZWA 5TPWH 3V55A 2G5UA 2F19H 4HXBH 4PBWD 5CJOH 1QPXA 3JV4B 3FTWA 3FO2A 1ID2A 1ZKAA 2GK0B 1MJ8L 1OY3B 3DX2A 4FQJH 4M93B 4P59L 5HHPB 4J8RB 4GS7B 2WWKO 4YDIH 2OMTA 4PGBA 3KJ6L 1YUHA 3X1GA 3I6GA 4UNUA 4WW2A 4XXDA 4Y5VA 1ET5A 2D7QA 1S2EA 4ODUB 1U30A 4HK0A 5I6MA 4NO0A 2H32H 4JQIL 3GMLB 4PJCF 3ZTJG 1Z9SA 2OTWA 4EDXB 2XRAL 3IBEA 3JSSA 3QEQD 3PDDA 3MPCA 1INEL 3IDMA 2YO3A 1QATA 2JE8A 5D9SA 1QFWM 3KBPA 4NRYB 1UZ8A 4CGUB 5MERA 2J8UF 2P7TB 1QTPA 1LO2H 4FS0A 1F4AA 2WBJC 1GH7A 5DLMH 3HPJB 5E6IC 4BQ8A 3AXLB 1A3RH 4IMLA 2VR7A 4QD2E 2A6IA 4FC3E 5FYLH 4B5ZA 3NJFA 4BK5C 4YDKH 3GSUB 4JHZA 2OL3B 4IHBA 5A2JH 5CBAA 2R23A 5MEOB 4Q8BA 4RGOH 3HUJE 2F54D 3D2UD 2UXGA 4MJIE 4QRSB 4M7JH 3CQFA 2HKHL 4P2OD 5E0FA 1L3NA 3N44F 1TDQA 2BH0A 4JKWA 4QTIH 2QADD 4WU7A 3QUXA 5BRZA 1BLNB 4NKMB 1OGTA 5KSAC 1NGQH 2OR9H 2CRYA 4L4VD 5H4YA 3BZ4A 3TN0C 5GSVB 1FGNH 3FYEB 1ZCRA 2E27H 4N8UA 3QDGD 1G7LB 3BIAX 4MZRA 3PV6A 2WUBL 4KZCA 4WHYH 5C1MB 4EMZA 2VWEC 4OCNC 2ZTBA 3LPPA 3T0BA 4GRWF 2FDBP 4G9DA 2QQKL 2ZD0A 3UTTE 1IKOP 2I07A 1T5WB 5FM5O 2XTSA 1M57B 3C5XA 3VFNB 4R7NA 4KROD 3IETB 3AADB 3EOYG 3K74B 3UO8B 5BPPA 1ML0A 3WY2A 3Q2LA 5CILL 4MAYC 3KLLA 4HG4J 2FJFA 2QPDB 3EYFA 3AROA 4Z95H 2QSVA 4EXPX 2F1EA 3BPNC 3GLZA 3DDGA 1J88A 1XGQA 2A1WH 3QIUC 1D5BB 3CFKB 1BBJA 5I18H 3VGFA 3UTQA 4X4ME 3TV3L 3OKNA 4KRNA 2CKBH 4M4PA 5F1KC 3LKRB 3UTPD 1MIEH 2OYMA 4OZIB 1UASA 4POZC 4Q56A 4R5VA 1KWGA 1IT9H 3DSNA 1TZ8A 5J12C 3PL6A 5EO0B 3L1OH 4PJ9B 4PLNC 2ZXCA 5HHNB 5AAWC 3QWOB 4RAVA 4DPAX 2NNAA 3IU3A 1N6VA 3RTQA 4C56E 2H5UA 4UYPA 2A0LD 3VW3L 1IM3D 1YEKL 5KS9A 2VR8A 1RPUA 3OMNB 3QZBA 4GJTB 3MFFB 3VFOA 3E3QE 1HHHB 2MTPA 2XWBB 3CLEH 3LPGA 3TBYA 1HQRA 1R3LA 3B2UD 3ARSA 3CFMA 2V5RA 4JO3L 4XN4A 1QPKA 3T0ED 3IDJB 3VFMA 4FABH 3TEYA 5FYJE 3VGHA 2DQJH 2APBA 1X5YA 3BAXA 4R0LB 4R9HA 4Z23A 4QRAA 1QFUH 1R3KA 5EBMA 3RWFB 4EQ3A 1UEMA 4XXCA 3C08H 3NPSC 4YHMH 4Y9FA 4PS7A 3VWJB 5I66A 1P4IL 2Q7YA 4KJYA 2BS8A 1KNOA 4PJAF 4NOFA 2XI9A 1YEWA 1I1RA 1NBVL 3PJSA 1WBYA 1KJ2A 3CN4A 1COBA 3NN8A 4OLVH 3G7TA 1UCBH 1WPCA 1BP3B 4W9ZA 2V2TB 1I85A 3D0AA 1IC7L 4U6VH 4YDJA 3T2QA 4LCWA 2YD3A 3CMOH 4PJBE 5CJQL 2EP6A 3RB5A 4L9LA 1ZTMA 1AAJA 4J3VA 2BP8A 4JG1L 2CXKA 4X50A 5T1KD 5KEZA 1UT1A 4F57L 5DJ6A 3MGTB 1I4FA 1FAKT 5JPNC 3F7YA 4NWUH 4LSQL 1CFTB 5IBUB 3ZHDA 1N2RB 3RI5F 4YE0A 5H37G 2ILLA 1N12A 1OAUH 4HKZA 5L8LB 3FUDA 1HK6A 1ZV5A 3B83A 1NMBH 1F6LL 1SY6L 4JFED 3R4RA 1YMMA 3FRUA 4NQXB 1JPGB 4XAWL 2ZYIA 1JPTL 2DLFH 4M02A 3RDTA 3ARQA 1NEPA 3BMVA 2AXWA 3R18A 1QMUA 3SBRA 4BXSV 4AMWA 3BGAA 1J1OL 1SJEB 2UWEF 5DFVD 3LKOB 5D2LE 3TYFB 1EEYB 3CN1A 4U3SA 3O6FC 4NHUB 4PV9A 4LQFL 4ZFFA 4P2QB 1EXHA 4ZFOB 1XGRA 1HWWA 1J5DA 4IU2B 1SHWA 5TGBA 4Y4FB 4C83A 2L04A 4ZPTB 2ZX5A 1JJUA 4E5XA 2DMBA 1L6XA 3Q8EA 3CFBA 4GMTL 1AZCA 1Y1UA 5HYJE 1T7YA 3OXRA 3OXSB 2E9WA 3GSWB 1FG2A 3D39B 2VLJA 3C5SB 1QUPA 4DO5A 3GSNH 2WWMD 5JW5B 2WBXA 4LRNL 4TVPH 3V2AR 4Y2OA 5BQ7B 1N7ML 1XZWA 5CCGE 4N2EA 5ILTL 1F90H 3P02A 4KX7A 2XIBA 5LDUA 1HC1A 2Y6SD 3QDJA 4M7LH 1KEGH 2WTOA 4PJIB 2ZYRA 3D69A 2NY1B 3QCVH 3T6WA 4U1NA 4Z7NB 3VXNA 4HOWA 1DVFC 3JYBA 3K46A 4ZUTA 2C1PA 3BP7B 3R8BB 4CADB 3EZJB 3I74A 1KJMA 4IGBA 4P9HL 1BREA 3P1VA 1TTGA 4KKAC 4P3DB 3DXAD 2WXMA 5KBMA 3DJSA 1X7QA 5D7KE 4ZTPH 2VT0A 5IWLA 4TV3A 3DROA 3UIZA 1YYCA 2VR5A 1J8HD 3HHMA 3RA7L 4M1CC 5A6IA 3L08A 2BINA 4D9RD 3WO3B 1RZ7L 5T33H 3H7LA 1DUYA 1Z5HA 5IESL 2HT3D 1MNUH 1YMHB 3QI9D 5DMKA 4PB9L 2GT9A 1TPXB 3WIAA 3EJZC 5BZDB 2Q86A 4F9LA 3PY9A 4F7MA 2YPLD 4AEFA 2RH0A 4ZMAT 2BXYA 5DJ8A 5C09D 3QEQA 4JM4L 1JERA 2BVQA 3ZTNL 2QLYA 43CAB 1AANA 4L1HA 2NY6D 2ZUYA 1AQDB 1N64L 5JOFA 3UZVA 4OTXL 3UBXA 1HJBC 3KDMB 1H8SA 1JXGA 3KLQA 3HLKA 2DH3A 4FL4C 3TH2T 1HHJA 3OPUA 5IBTH 2W65B 1MCPH 4D8PB 1XH2A 4L1LA 1XGYH 1DQQA 2MRYA 2PCFB 3NFNA 4BXVA 4JRXE 1QA9A 1OW0C 2AJUL 2H0FA 4FQXD 4J3TA 1TNMA 1IRAY 2E76C 2F54A 1D6VH 3D2UA 1IB5A 3BGFC 4LOUD 2E9JA 1JFQH 2V9UA 1CLZL 1RMFL 1S5HA 2G5RA 1WFNA 3MZTA 3OZKA 3U0TB 4ANWA 2D03H 3S3JA 4DZ8A 1PDKB 4WO4D 5IJCC 1PG7L 4JQIA 4U6YB 4L4VA 2CBOA 5BRQA 3CDFA 4CC4A 2R0WL 4FLRA 2DWTA 1BVKA 1NQBA 2F53B 5I1JH 2ZT9C 4PV8B 5AB1A 2GAZA 3ATFA 3HLAB 1W6WA 3E38A 1U8HA 2VMEA 5EUKB 3TU6A 3VFWB 1LYQA 1BBDH 3WXWL 4L4JA 2DM7A 4WY7H 3GMNA 5E99H 1IGMH 5EN2B 3ZL4L 3CC5A 4KV5F 4A2GA 5AW0B 4LNRA 3DARA 3OKYA 4M3HA 1WTLA 4JFPB 4WQOA 2AEQL 2F9BT 4E9QA 1MFEH 5IMLA 1LP9B 1C7TA 2CGRL 3ESNA 4NNYB 5C3LD 2FE0A 2Q3ZA 1LXMA 4QUOA 4IKKA 4QXGH 5I0YA 1VENA 2G75A 1AXSA 3LRSB 1TQCC 1CF8L 3D06A 4HULB 1SM3L 4PJEB 1EHAA 1LHZA 3Q6GH 5FGBC 5EF3A 1J1PH 4FNPA 1OLLA 2YQBA 5DF0A 3G5WA 1LLAA 2WBJB 3MAWA 3NIFF 1ZLSL 5D7JB 4CN4A 4RWYL 3L4VA 1JBJA 1MWAL 4JKPH 4NM8H 3QXAA 4JFVA 4E0RA 2DF3A 5AOIA 3T4AA 3EFDL 3E9TA 1BAFH 3VU2A 2Y72A 4WTXA 4MXVE 3FU7A 5EU3B 2Z91B 2WQ8A 4KZ0A 3SKUD 4M5ZL 4Z1PA 4IRSD 4P5TC 3QK0A 3ZTEA 1ACYH 1EGJA 1LE9B 5KSAB 1IM3A 1XXFC 4QOKB 2ZOKA 2DN7A 1MUJB 5T1LD 1RK7A 3TN0B 3QGVA 5DJYA 5E1HB 3D85B 5ALCL 4UQ3B 1OV8A 4XE5B 1S7XB 2E7DA 1QKZH 3T0EA 1X5GA 3ZL2A 3GJFH 3AQYA 3LQAC 3HG5A 2X6BA 5FUOH 5HTSA 3BDBA 2GJZA 2JB6B 3QDMB 4PGZA 4RA0C 3QR1A 5C86A 2OAAA 1BWMA 1CMOA 3PWJB 1W0VA 1FYHB 3I3DA 3O11A 1UOWA 1I53A 4OIIH 4A68A 2VSKB 2PW2B 2EZ0C 1O7DE 3B9DA 3LHPH 1Q9OB 4QLWA 2HJFB 5MI0C 3C9NA 1RULL 3IS1X 5SWSE 5DHVA 4HV8B 4X8GA 5ICZA 5ANME 4HGMA 1P4BL 2A74C 3QEHB 1N5AA 3LSOA 5ERWA 3TZVC 2Z3FA 3HIZA 1SLVA 4H8VA 4KKBC 4I2XA 5J1AB 1YNTF 3QZOA 3STZA 4Z7VE 5FFLA 2Y5TA 3DI3B 4PJXF 2IWKA 1U0QA 1TFPA 2JKXA 1M53A 1OHZA 2XKNA 1ZANH 1RZIB 4JLRB 4UV7L 3KPPB 2IDUA 4ZSOE 4C54A 3PDOA 3JVFC 2GBAA 3IGAB 5BVJA 5I1CL 3L3JA 3WHXA 5CSZB 3ECBA 5T1KA 3WDIA 1PZUB 2YHGA 4KOCA 1RFDL 5E5RB 4JFYA 1RUAL 2IBZY 4YMPA 3GI8L 1D9KD 1HCVA 4WI3A 3LNEA 4AQ8A 3BKMH 3ZOAA 1G0XA 4BFRA 4Z7OE 4AV0A 4PJHA 1IJ9A 2IQAA 1F13A 2IH3A 1BA9A 1B0RB 1JHLL 1OO2A 5E9DB 1MRDL 4GUOA 1RJLA 4JFEA 4N87A 3P40A 2CDGB 2R8SL 2Y5QA 4HDIA 1G1CA 1R3IH 4WFGE 3X3FH 5F72S 2CJSA 1T1YA 4LVNC 5DVLA 2WZAA 4F7EA 1GC1L 2VNCA 3PUUA 3SDXA 2YPKA 1CO1A 43C9B 3EH4B 3B3IB 3G9AB 3P4NA 5BUAA 3LXUX 4YHLH 5A1AA 3V7AG 5GRUH 2CDFA 3HHSA 3IMRA 3LKPA 1X5MA 4XMXA 3E1F1 4OLYL 4XRCB 4YXLH 4AEIL 4KXAA 2CUIA 3DETD 4QNPE 1SY6A 2VXSL 3ARFD 5SV4A 5BRZE 3GTTA 5C2UB 5AENA 5KUKA 1E4WH 1KB3A 4J3SA 1AC0A 4XGZA 4AL8C 1F45A 3AG4B 4CDHA 3ML8A 4M1GL 2AITA 4PRAA 5BS0B 2Q3AA 4IBVA 4XBPA 4R6UA 4J3WA 2O61B 1ZATA 2JIXB 2WXOA 1GL4B 4J3UA 1AFVH 5JPNB 5CSBA 4HUVB 4X9YA 5ESVB 3FRPB 4MZ3A 1JXKA 1MLCA 4PJGB 1JNJA 3RGVB 4ZMNA 1M42A 4OI7A 4N68A 5HYSG 1BQLH 4NQEB 2J2ZA 1AGEA 5TFSL 5KJ7E 2AV7B 4G6MH 4AITA 4C4KT 3NQKA 3II1A 1IO4C 5I1LB 4QYOA 2AERT 3DXAA 3P9WB 3MBWB 3DBXB 1BVLA 5DJZA 1SDAB 3O6FB 4P4KC 1J8HA 3HOGA 2MNJB 4HX1A 1K5WA 3ASNB 3PUCA 1OVZA 2KERA 2OMXB 3QJVB 3IDGA 3VM7A 4ZMQA 2AJVL 2APVA 3OJ2C 3T0DA 5D1ZC 2CO3A 3QI9A 3TO4D 1QR1B 5HI3D 1RJZA 1IEBA 3QR2A 2YPLA 3HZMA 4IBSA 3AWGA 5C09A 5F0JB 5IEKA 3GF8A 5CKGA 4C8XA 5AD0B 4I3SL 2FBOJ 3L54A 3H4FA 4PBDA 5DURD 4F8OA 1ZDSA 1RIUL 2QGEA 3GJFK 3QUYA 4ZUWB 5KS9E 4UIMA 4W6YB 1A8ZA 2B1HH 4KK8C 3GRGA 3EYUH 1AKJD 4Q2ZA 4GBXB 1LO3L 4OT1L 2BVUA 4K5LA 4NQDD 3MOAH 4OUUB 4CN1A 4FQXA 5H37A 4R5XA 5E4EB 1PVHA 2YSSB 1KTDB 3B9AA 3IFPB 3LEVL 4X7SL 3VX0A 4HOMA 4WO4A 2CJUH 4BSVA 3IVKA 4H0GA 2NSXA 3RVUC 4AW4A 1W8EA 2X6CA 4YHPA 4MA7H 3RWEB 1Z0NA 3QXDA 3S98A 2NY2D 4LF3B 2X7LB 1LDPL 3GS0A 4NO2B 2UXVA 4WWKC 3PWVA 2B0SH 4IRJB 3SY0A 5D7IA 3BP4B 3KWTA 4WU5B 4YGAB 3UTTB 1LTXA 3MGAA 5EZJB 4WUKL 1T1XB 2L7QA 4FDWA 5AWNH 4AMKL 1A02N 5I15L 2X9XA 1M71B 4QRTA 3NABL 1AGFA 4LCWE 1CT8A 4JZJA 4XNZB 1KPUB 5CHNB 5J3HD 4R7DB 3PIQA 1U8KA 3D05A 3DO7A 1EO8L 5IT2L 1OP5H 5IVXA 4ZZKA 4UDTB 4KI5C 2OXGB 5AOZA 4DK5A 1DQLL 4OFQA 4DAGH 4MJ6A 1RZQA 1GYCA 1WUNT 2AQTA 3NOIA 4EF3A 4EDWL 5C0AD 1RK0A 4FL4B 3LX9A 1YMME 3DTXB 5K1JA 2ENSA 2HLEB 3MJGX 3QJRB 1AGBB 2XNAA 4NQVB 4ZS6C 4AX3A 5H35A 3LQAH 1U8CA 3LB6C 2ZSWA 4WNSA 5A2FA 3BEVB 4ACTA 2ZUQC 1ZVNA 4PTTA 1G7QA 2P8MB 3RHWK 1J10A 2UUDK 4A55A 3DHPA 1V8HA 4H25A 4IRSA 3SYCA 1BV8A 2EDHA 4PG2A 2OPCA 5DEZA 1U8OB 1H5BC 1U3HD 5T1LA 3T0AA 1P84K 1I8IA 3P73B 2EADA 3IJHA 1F3RB 2CSPA 1I3RB 1AHWA 1NCJA 3DX7A 5B3JE 3U0PA 3X2QB 4MSWA 1HFUA 1OEZW 2WUCL 3ABZA 4H2CA 1KIPA 5KYUB 1MWAA 4J5VA 1PD6A 3MNZB 4JL1A 4DPCX 1OXYA 4MXWL 2P8PB 4HFWB 1U58A 2GCYA 5DEGA 2Y7LA 2VLJE 3I50H 3KPLB 3R06A 2ATKA 4WEEA 5SWZD 5L8KB 5DQJB 4YDLC 4XCYA 1JXFA 5EFIA 3DYMA 1JTOA 4TXVB 1F00I 4OZ4B 1CXFA 4P05A 3WFEH 1MHCB 1IL1B 3QDJE 1BPVA 2EH7H 2F18A 1JZHA 3BJ91 5H2BA 1S7SB 4TSBH 4CJ0A 1JOIA 3UJIL 2BSRA 3L45A 5GS0D 1Y07A 4WEBH 5I18L 3FO0H 1O6TA 3V6FB 2HFEA 4HWEH 2NY7H 2NXYC 3WSQH 1JWSB 4ZOCA 4CILA 2ZJSL 1FH5H 1Z3GL 4U1GC 3GXDA 2EE2A 4GXVH 1A0QL 5FM5M 3T77A 5I17B 1EJ6A 1D9KA 3A4AA 4EUPG 3VSUA 1EZUA 5F9OH 4P5TB 1XB8A 1IBZA 2VDMH 4PWHA 4RFNB 5E2VH 2PCPB 3RIFF 3T6XA 1UA6H 2ZXAA 4RIRB 1X5JA 4ZYKB 4TN9A 3BAEL 3DUUA 4LKXA 1KGIA 4UNIA 4MRBA 3QRGH 5AEAA 4RGND 3KJ4C 1WFMA 1BJ1J 1CS6A 2A77L 5DJDB 4TVSa 3A21A 2R4RH 4I0PC 1F3DJ 5DJXA 4A7GA 4WGWB 4YHOH 4AL8H 1DSWA 3QPQC 4PJDF 1A6WH 4LSTH 2GC4C 4NZTH 1XF2A 4WSKA 2VLLB 1JZ6A 4M6MH 1NCDH 2DIJA 5HI4C 1K2DB 1JDCA 3FSWA 1T66C 3MLXL 1C08B 1M6OA 1VADB 3EJYC 2XICA 1CCZA 3MRRB 4LARL 2F54E 5HYJB 3O2VL 4PRPE 1MFVA 3FCBA 3GHEL 1F58L 1OHQA 2IH8A 1KBWA 3W11D 2YBRB 3K91A 1PSKL 3ARFA 3UYOD 1WRFA 3CZKA 2ADFH 3UTSD 2C7UB 4I5BB 2H9GA 5LHDA 2A9BA 4QRBA 4L4VE 4N2CA 4EI5C 3ZRSA 4MMYA 1NL0H 4OCLC 1VIWA 3NDYE 5C6TH 3ILEA 1R5IA 1WIUA 2AQ2A 2WQSA 4LSVL 5GJSL 4TTDC 3G6DH 4H20L 1TETL 3SE4A 3TJPA 3O3BA 4ONFL 1NTDA 1R24B 1GZHC 2OXHA 4LCCC 1OP5K 3Q5TA 4C4KO 4AWJC 2B1AH 4XWGL 3D0LA 4Y2LA 3HC0A 4DCQA 2YIHA 4WFFD 1H15A 2XA3A 1TTAA 2J57A 2DDQL 4OM1H 3QIWC 2XZQL 1N67A 2MPAH 3GXUB 3FO9A 5ICXB 3K81A 4LVNB 4XPTL 1IAIH 1E4JA 1QACA 3CE1A 1NGXA 1N0LA 4DVBB 3UYRH 2K9UA 3P69A 3UTPE 1E43A 1WFJA 3CVHH 2BIMA 2YXFA 5DZPA 4AIEA 4QI3A 3TCLB 1F8TL 4Z7NF 3EFOA 3TO4A 1CIDA 1KTJA 3BP5A 2GSMB 1WD8A 4ZO9A 2K3HA 1RJCA 1KIUA 5E6UB 5CEXA 3KS0J 4HJGB 3EO1B 1U6AL 5F7NC 1CFVH 1MKFA 1KSRA 2X87A 4PRHD 3TBWA 1HXMA 2IXQA 1TR7A 2DQDL 2K8MA 2X2IA 4L9DA 1SBSL 5D1ZI 5DO2C 4OIBA 1SYSA 2EACA 2HT2D 2Y2WA 1IGJB 4XPBH 1AKJA 4JRXB 3DX3A 4LSSH 5D1XC 3UTZB 4NQDA 3T0EE 1ASPA 1NJ9A 2A3TA 2AJZB 2C4XA 4GQZA 4KOBA 4W4NA 5CBEB 3K71A 1IAII 4FG6D 4HT1H 1PFCA 2YAQA 3FTGB 2Y4SA 3CPLB 5DDHA 1VKXB 4F33A 1MFUA 3DMMC 1IGYB 5E9NA 5JW3H 2E7BA 1J0HA 1IC1A 4MJ2A 4HBQA 5D72H 2EYRA 1HCFX 5IIEB 4LLUB 3E6HA 1WH0A 1J7VR 2C3GA 3KPOA 3TF4A 2DJ4A 2FAUA 4EZJA 1D5ZB 3PGFL 5HJBA 5FO9A 1XH0A 1J87A 3QNXB 4I2XE 1U8JA 2IOOA 3S2AA 5EUOA 5AKTA 4X7TA 4YC2C 5IMOA 1C5BH 1HJCA 1YEFL 2ED7A 2YEVB 2F5AH 1OTUC 3WEOA 1A7NH 1XBRA 1RZJL 1CG9B 1XV8A 1UWGH 4EKJA 4X9HA 1Q0XL 1OF2A 1MY5A 5I8OH 1HWHB 1OTTC 5CFAA 3KGSA 5IM7B 1BVOA 4PS4H 4OLEA 1ZLEA 2CNZA 1IIKA 1RLBA 1YCSA 5DEJA 2GSGB 4B96A 3ZT7A 3DGGA 3QC6X 4PJFA 4HUWB 2OMNA 3CDGB 2Y25A 4PJHE 2K6ZA 1DBBH 1T03H 2CMRH 5C0AA 1BQKA 1RK1B 1RZPA 1KZQA 1S7QA 4JFEE 2HG5A 3SY6A 3V0VB 1EO7A 4XVTL 1KIRA 4HHGA 4XMLH 3RDJA 4TMPA 2XYCA 1BW8A 2FK9A 5T1DL 1LP9F 5ESAB 5JORB 3QJFB 3VM5A 1F6AB 4V2CB 4ZT1A 1FCCA 3LS4L 1DANU 3U4BH 5LUMA 3R0NA 1WC7A 3CDZB 5FWRA 1LEGB 3ARUA 2ZP0T 3F5WA 4MCMA 3SDXE 2BP0A 4HPOH 1U3HA 2IOMA 1ECYA 2VZ1A 4RNRA 2XWJB 2D3VA 1LO4H 3GTVA 4NI3A 1ZA6A 1DBMH 2JKWA 35C8H 3PP4L 2NXZD 3OG6B 1GCYA 1P7BA 3SE9H 1KXTB 4WHTA 4BZ2H 3QWRD 1U3ZA 1ULVA 3SZ6A 4FRWA 2OTUB 5I0DA 5LWYL 4AVHA 3A3YB 3TJEH 1BQHG 1TTBA 3BVWA 5K9OA 2E3VA 3FC8A 3BIKB 3JT2A 5ANMB 3WKPA 1E4XH 1XB3A 3BOVA 3PWLB 5E8EB 4YBHA 5SWZA 1F86A 1PMYA 2KMWA 5DMJB 4Z7VB 5JNYA 5I1DB 2LAGB 2IMMA 1GSKA 3CFUA 5J6HB 1MELA 2EKSB 4CSTA 5K9JL 5DK2A 4KRPC 1ICTA 3H3KA 4PY7B 3LNGA 3CH8A 5T8IA 3IT8D 1T0NA 4R3SB 3FQ2A 4ZSOB 4OB5L 3BAJA 4GRLB 3N40F 1FVDA 2X4TA 3SQRA 3QZWB 4QKTA 4Y1AD 4DSYA 2IG2L 4KX8A 1J9CT 3FO2B 1WISA 4AG4H 5CFHA 4KMTH 3DXAE 1MH5A 5CZXC 2DKUA 2VAAA 3ZJAA 4IOFC 5DS8B 4NPJA 1CZ8L 2NZIA 4G43A 4XH2B 4JVPA 4PGBB 1J8HE 2IALA 2VXUH 4HWZA 2QGBA 4WGVB 3I6GB 4WW2B 2DQUH 4YFDB 4D9RE 4N2FA 3PHSA 1E4XI 3JTTA 2E4FA 4NO0B 2XN9D 1EAJA 5JIKA 3C8KB 2BZ7A 3V9CA 1KLUA 1Z9SB 2PLTA 1WG3A 2HFGL 5GRJH 4HWBL 2VDNH 1XWVA 3APCA 2NQCA 4FJZA 1INQB 4HISA 3WN5A 3U48A 3ZE2F 4UTBH 3IDMB 3W9EA 4LLQB 2Y07H 5CUSL 2GIYA 2W0PA 5MERB 3HE7C 4IIZA 5CXPA 3TBTB 1FIGL 3LDBB 5AVSB 4IMLB 4ZTOH 1JZ4A 1TO5A 3ELAT 1NLBH 3WKNA 1NEUA 3GXFA 1CPUA 3QUHA 2G5BB 3WMPA 2Q76A 4HIJA 2OCJA 4L18A 2UYLA 3BFOA 4WU7B 1SEBA 2ESVD 3QUKA 3QUXB 5DA0B 1KCRL 1OGTB 3EBIA 3PQYE 3FB5A 4OCRH 4GKNA 2PWEA 1IKFH 5JA8B 1TSRA 3NH7H 4J3XA 1AHMA 2HLAA 3UTSA 5AYQA 5EU7C 3W81A 4EBQL 3ZYJA 4J3OC 5GGVH 1DUZB 4F7CB 4UDUA 3DOHA 1GZPA 1LWJA 3BISA 4NJAH 2NY5C 3M8OL 3KLKA 1SN2A 4GSUA 3MRDB 4APQD 4ZMVA 4QCIA 2QKIA 1SDDB 5I0WA 1F42A 2WYIA 4G9DB 3M17B 2P1YA 3CBRA 3UG3A 4U1GB 4MCYA 4KMQA 4MNHA 4WNJA 5LJYH 4R7NB 4JB9L 2DPKA 2OMWB 2DQTH 5JQ6L 1AG0A 1A9EB 1YEDA 4Y16C 4ODWA 2H47C 3PREA 2UX6A 1UD8A 2GUOA 5A2IH 5C0EA 5ID0A 3BKJH 2M83A 1HEZA 2CO7A 3V4PH 1XEUA 1BBJB 3IEAA 3UTQB 3OKNB 5IVXE 2VQTA 1MJJA 2O4EA 4AVJA 5C0IA 2DWSA 4PHXA 4X98A 1JDAA 3CPUA 1Y1DA 2H3XC 4WHDA 3KGRA 1BG1A 3ALXA 1AO7D 1A7RH 4PJGF 3DSNB 1HHIA 4TSCH 3PL6B 1PPIA 1D5XA 1LILA 3IBOA 5F9WB 5EEZA 1M4KA 4RAVB 3OMAB 4MASA 3ZDXB 1KXVA 1U8IA 1A3LL 5C9KA 4W6WB 4DZBB 5IOPB 1U93B 4QRRD 2ZX6A 3NUKA 1AQKH 5E70A 3B3BA 2LT9A 4P2YA 3UO1H 4QHNB 2X6VA 1PZ5A 4PRHA 2UY7A 1USZA 1Q9WA 4KTEH 4QHUA 4W9KC 4JX0A 4OZHB 4J2XA 4TVUA 1BF5A 3T65B 3CVBA 1ZT7A 3DI2B 2VDPH 4H13C 2EIZA 1UWFA 3V52H 5F6IB 2DQIH 3VFMB 4Y9BA 1C12A 3QORB 1CE1H 4XX1E 3KPSB 4PS3A 4L8SC 4EUPA 3W2DL 3WMSA 3IPEA 5KANI 4L3ED 1R3KB 4Z7WA 3RIKA 2VDLL 2DIBA 4YGVA 3S34L 2MCAA 5IVZA 4GT7A 1T2QL 1IJNA 3L3DA 2D4DA 4F7KA 3QA3A 2CO2A 2BC4A 1Q9LA 1QYGH 1E7UA 2AI0H 4G83A 4YLBA 1NBZA 4CVXA 4FP8H 4F58L 5EIVA 4PLOB 1KNOB 1UC6A 3RPIA 2CM6A 2OMYA 4QAWA 4HYTB 1YPZE 3WIIH 2QQQA 3PJSB 1KJ2B 3QIWB 3M1OA 3MLVL 3EBHA 3NN8B 3MREB 4LP8A 3ZZSA 4M7KH 3RHWF 4Y2NA 1KBKA 3FTZA 4YJZL 3TNNB 1UH4A 1NPNA 4WDIB 2Y3NA 4MCZA 3DUSB 2DQEH 3EGSA 4L9LB 5TK2A 3QNYB 2BP8B 2VDOB 5KBKA 2VC2H 4XP1L 5E8PA 5G5DA 3P2DA 1JK8A 2Z64C 3OZ9H 5DJ6B 2KH2B 1I4FB 5F96H 3QFJB 2NUPB 2XQYK 2AV1A 2YN3A 2Z8WC 4JQVC 3TFBA 1J1XL 5TJWK 2I25N 4KQ4H 4RFOH 4K8RC 2E59A 2YC1A 1TJIL 3TBSA 1YMMB 3WV0A 3I6SA 2PXYC 3LRGA 3C75A 2AEWA 3MR9B 1AOHA 1UZ6F 32C2A 1MCJA 5D1XB 3QXTA 1QBAA 3Q8FA 1OSZA 4MDJB 4U3SB 5FFGA 5I6KA 2CIIB 3RWIB 4YFEA 1LEKA 2TAAA 2ICEC 3SE8H 2LU4A 2A9MH 4ZO7A 2I24N 1XGRB 4NNPL 1JYVA 1CLYL 2R1YA 2H0JA 4WCYL 3BH9A 5TGBB 2VLRD 3SYOA 4OH2A 1OANA 3IJSA 1QNZL 3ZSSA 4NT6B 1KPVA 4E5XB 4Z76B 2EO1A 4KQ0A 1J0JA 3FU8A 4R97C 1T7ZA 4TPRH 5B3SB 2FGWH 3CFBB 3QQ4B 4A1JA 4IEFA 3ZQDA 2HJLA 2FLMA 1E50A 1OPGL 3OXRB 4ZUSB 3ASOB 1RQ5A 3QWRA 4OAWA 1L7TH 1CBJA 2Z7YA 5KSVA 5LVEA 4WGKA 3P11H 3GM8A 3R0MA 3L3IA 4HKJA 2VLJB 4OLZH 2EIMB 5D1QC 3H85A 3Q2VA 3GSRA 3A6BH 2DEXX 1OQXA 2YGOA 3D4CA 4PN6A 4NO3A 4L1BA 1FFRA 1MI5D 4OGAD 1P2CA 1CGSL 3QUGA 2W0FA 3HRZC 5J8OA 1MW0A 5B4MC 1S9YA 3D69B 3UJJL 1OT2A 2X1QA 3ZL1A 2NZ9C 5IW1A 3KLHC 1KT2A 1S5IH 4U1NB 4ODTH 3VXNB 1CL7L 4PTUA 1JPEA 4ZUTB 1TCRA 3TIDA 5HI5D 1KJMB 3U36A 3V4UH 3W37A 5CIPH 5T3XH 1UYWL 2VC2B 3IDIA 5LO7A 1KG0A 4FNLL 1RUKL 1NGPL 3LNFA 1X7QB 2BWIA 4F7TB 3FQNB 3KHQA 1A1MB 3DROB 4XZ4A 2ZPKH 1JZEA 1XEDA 2EDTA 1KTLB 1YC7A 4Y89A 1ZGLP 1K8IB 2V6HA 4H0LC 2DIAA 1DUYB 4MQSB 1DVZA 2NY0B 4OFIA 3MYJA 3GMMA 3DIFA 3BUBA 4Y19D 1WS8A 4GP5B 4ZFGL 5F7DB 2GT9B 2DYSB 1MEXL 2XN9A 3VXTA 3UOAB 4F7MB 2KBGA 2WLIA 1J9QA 4YLCA 4M9PA 2BVQB 1XAKA 2X2YA 1A6ZA 3GHBL 4UBDC 1E42A 1WLHA 3ETTA 4CNIA 1AQMA 5DMYA 2IPTH 3T6VA 2DWEA 3UZVB 4PD4K 1R3HB 1N6QH 4XHJD 1MVUA 4RA3A 3I9AA 4BBWA 4J3OH 4N90D 1A14H 4XBEH 3M1BA 1DQQB 1EFQA 1YYLH 2NY5H 3HG1E 3FL7A 1QA9B 3RLSA 1J5CA 4KJQC 1XGPA 3D2UB 1ODAA 5TF0A 5BZWB 1DJIA 3NIDE 4PRPB 5AW7B 3VFRA 3L1FA 1RZKL 1SLUA 3K6NA 4DZ8B 4TNFA 2ESVA 5E00A 3FONA 5I71C 4O9HH 1A7OL 2P9RA 4Y4HD 1V05A 2YQ2A 3AG1B 4U1HA 4K3JH 4XVUC 2B4CL 2BSBA 4HWBA 3SODB 1SYVA 3SPJA 3ULSB 2AEIT 3HI5L 4QHKJ 5LN4A 1E0OB 1CTOA 3IF1A 3UABA 4X5RA 1D5IL 1U8HB 5PCYA 4APQA 2D7MA 1U91A 3QZLA 4M6NL 3H7BB 2ZXGA 4N8CH 3QUZB 4FLSA 3HNTL 1YEJL 1MCOL 2J6EL 2ICCA 5EUOE 3X13A 2B59B 3CC5B 1NOAA 3EJJX 3HB3D 4PS8A 3VVWA 3E6FA 4LNRB 3RPBA 5IMLB 4Z7QE 1RZ8B 1UKQA 4KK5D 5IUCA 1QO3A 1XGTB 4JUTA 1EZLA 1BEYH 5CIPB 5EA0H 1N6UA 3NQIA 3V7AE 4UZSA 2VH5H 3CHRA 1B2WH 1RIVH 4B41A 4EPSA 5B39G 1NDMB 4JPIA 4C4BA 1B90A 1U2YA 3HE7B 2RGSA 1BQHA 4QXTB 2B9BA 3MACL 3LEXB 5IY5B 4QGTA 4PJFE 4AE1A 3LQZA 1QLRA 2FX8H 3M6DA 3HC4H 4YZFE 1AO7A 4E0RB 2WSDA 4OGZA 2DQMA 1CFMA 3L9EA 5C0AE 4ATTA 4AYFA 1UTDA 1IFHL 4M7LT 4ELDA 3FU7B 5CCKL 2EDFA 1P0SE 3UDWC 1VGEL 3HC3H 1WE5A 3OTTA 4E9TA 3H2PA 4X6FB 4QRRA 1IM3B 3HR6A 4AEHH 2DTSA 1T6BX 1RUQH 5F1IA 1I7TB 4HUUA 4YN3A 5L88H 1PAMA 1ESOA 3T0EB 3EZ8A 1BGXH 1EDHA 3IDXL 4BQCA 1RKRA 4UT9L 3RU8H 3AMKA 1GS6X 4ORZC 1W0VB 4LIQL 4R83A 5CGMA 4L3EA 2B2XH 1WYJA 3MA9L 4R4ND 3C9NB 3U4EA 4BCZA 1AI1H 3NBNA 3GMOB 5IBLD 5ICZB 5EIIG 1U8LB 1N5AB 3LSOB 3SO3C 4HIHA 2ALWA 4IM8A 3ILQD 1UFUA 2ITEA 3EAKA 3FB7A 5SWZE 5KW9L 2D7PA 3STZB 2OR8A 2BRRL 1L9PA 2Y5TB 1J18A 3L4YA 1G0YR 2IBZX 4NUGL 3MCG1 4K8RH 4Z0XB 1OGAD 3ZZQA 4MDRA 1BAGA 2D7TL 3LEYH 4YO0B 4N8VG 1BYOA 4GO9A 2HTLD 5BVJB 2FWLB 3L3JB 2FO8A 5T1KB 3WHXB 3DVFA 5HGHA 4AI7A 5I1AA 2ADYA 1OALA 3MLUH 1CK0L 2FL5A 4JFYB 2XV6B 1GGCH 1YECH 2FWOA 1YUKB 5LGJA 4V1DD 3P0YH 4JKMA 2O93L 4YWGH 4NCDA 1BEXA 1DDTA 2BSTA 4K7PH 3ZTCC 1W72L 4YS4A 1N68A 1K4CA 2IQAB 2OKMA 4LLYA 2BSCA 5E1IA 2EQDA 4HPYH 5DUPH 5H8DA 2WIIB 5DD3L 3FTVA 2WLJA 2XXCB 4JFEB 3TCXA 2G9HA 2QSCL 5CLYA 5DHDA 1X5ZA 2L8AA 5JLZA 2OX5A 5DU7A 2GQHA 1QP1A 3BKCL 3GXIA 2DQGH 4RGNE 1OB0A 4BQBA 2XBZA 3BESR 4NIYE 3T6QC 3GBNH 4F7EB 1E4KA 3CVIL 3AG3B 3MVSA 4FTVD 3U1SL 4MQTB 5C0RL 3SDXB 5CJXA 5AAPA 2YPKB 2FEEI 3GIVA 4I9XA 5IP4A 2F6AA 4UZUA 5D7SL 5DK0A 5GQBA 2J8OA 1QABA 3ALPA 3Q3GB 4OF0A 5FUZL 2IV8A 3WFBH 2ITDA 2VLRA 2Z7WA 4Q7DA 3V8CA 2YUVA 1P6FA 2PPCA 4JE0A 1BMZA 1ZWIA 2IMNA 1WWCA 4E2OA 3LKPB 5AG9A 4YX2H 2VTFA 3MRGA 2GJ6D 1T4WA 1U8QA 2IDQA 2Q7NA 4DGYH 3KVDD 5DJCA 1UJ3B 4LESA 4BFIA 4PLKD 4Q52A 2WBWB 4PRAB 5KG9A 1PLAA 5J1SC 5BO1L 3UTSE 3KHOA 4KTGA 3GMQA 4DERA 1FQ9C 3QZPA 3VGDA 1IE4A 1KIQB 2DWXA 1MHEB 1YEIH 4JFHE 1BVZA 1MI5A 2P47B 4PU2A 3KPRD 2L4OA 1J12A 1X44A 3O9WD 2AJUH 3SBQA 4L8DA 5C08B 2X12A 2PCYA 1T04A 2J2ZB 4BFFA 4ZI8A 4ZK8A 2KZ1B 4LVEA 1IM9D 3LPOA 4QYOB 3HZVA 4ZX5A 1JGDB 3DXAB 5IQNA 4YHYC 1T0OA 5DJZB 3Q43A 1S78C 4I8DA 5MENB 1P53A 3T04D 1J8HB 4S1QH 5CAYB 4FMFA 2VZTA 5AVVB 4HZLB 4BYHA 2A6DA 1CBVH 3IDGB 1MCWM 4GYBA 2NCEA 3I2CL 2CLRB 2I60H 1ORSB 3QI9B 2EEBA 2EJ1A 4KI5F 1I9JH 4ISVA 5LAXA 2IWEA 3FUFA 3K1DA 1XF3A 4HPHA 1P7KB 1RJZB 3G6JB 4ZXBC 1HSBA 3GWJA 1PIFA 1KC5H 3DK2A 3H0TB 3QUYB 4UIMB 3BT0A 2H6UA 1W91A 4Q9RH 4PRHE 1G9NC 1UA3A 5CWSB 4LOFA 4Q2ZB 1KCSL 5D1QB 2ZNXA 2YSTA 2EXYD 1YQ2A 4X7EC 1G7IA 4G5ZH 2O30A 4FQXB 4XZUA 4IW4C 2FX9L 3GXPA 4OKVA 3P4OA 3PQYB 4Z7WE 2EVJA 1HOCA 2ENPA 4R90H 4FG4A 4BSVB 3H9SB 1MW3A 1UM5L 4NKIH 4Y4HA 4ETYA 4OJDH 4YHPB 3L7FA 3SZKC 3M7OA 2CAKA 4HIQA 1HVXA 4IDJH 2VERA 2VISA 3O6MH 2V3DA 3SY0B 5EOTA 5J11C 5EB9A 3Q05A 5EF2A 1FL3B 4G1EA 3HEIB 1FCGA 3ME0B 4ELMF 5EU6D 2IAMC 1UM6L 3VH8G 4F8NA 1U21A 5I1KL 1CT8B 5AQ0A 1SEQL 4TQPA 2AMUA 3CN2A 2RBLA 4J1UB 4DPBX 3RUGA 3CXDH 1HAWA 3CVCA 2FATL 1OARL 5IJVB 5HHVL 2XN2A 3DVGA 5IVXB 3KM1A 2VZVA 3WKYA 1K85A 4JN1L 3LHAA 5JPMC 1L6ZA 1XXDC 2Q2EB 4LSUH 3ZO9A 1KJ3H 1CFSA 4MJ6B 4U0RB 5DJAA 4ERSL 3B56A 3D4ZA 3CSYA 4CVWA 3B1UA 3JV5A 2L7UA 4N0CD 1CGVA 4EI6A 4WI6A 3VI3E 5E51A 4Q89A 1CXIA 2LGNA 3NK4A 4HAFA 3V6BR 2XNAB 4YSSA 1FAIL 4Z7IA 2J6EA 1OAYL 1U8CB 4HEMA 2OK0L 1PZ3A 5BOZG 1VPOH 3K8LA 4D0DA 4PTTB 1G7QB 1QW9A 2EEXA 4B9PA 2ZCLL 5D4QA 4FFYH 4IRSB 4XVSH 3MRKB 4W68A 1FBIH 5I71B 3ZKQD 1I8LA 2NW2A 3RNKA 1T89A 4PJCA 4Q6IB 1SN5A 5T1LB 2JCCF 1CLVA 4I7ZC 1I8IB 4X80H 4M1DL 5G2NA 3STBA 2VR3A 1AHWB 2J8UA 3U0PB 4ATWA 4URKA 4AGNA 1S9KC 1N0XH 1FORL 1Q38A 2Y7QA 4PRDA 4YDNA 1ZD6A 5D8JH 4BHUA 4Z5RB 2WGNB 3D2TA 1KIPB 1IKNC 1MWAB 2YQ3A 4JO2L 3ZDXF 4RH4A 3EF4A 2X4RA 2GCYB 1OAXH 4B7IA 3VG0H 1L5GB 3R8QA 1MG3C 4GB9A 3WHE1 3R06B 5IREA 2ATKB 2XG4A 2Z35B 3UCRA 3U9PH 2FX7L 4K9EC 1YPZB 4XCCL 3X3GL 5HSFA 5GGSY 4XCYB 4OZHF 4MNQD 3RVVD 2YMXH 4OFKA 1TIUA 2WVUA 5TE4H 1CGUA 4I18A 4D0CA 5HVFB 2KC0A 3CSGA 4NEHB 4OU3A 3QCTL 4JHBA 4UTAH 1DQJB 2D4FA 1E65A 3F00A 3V9FA 1OGAA 5H2BB 1FGVL 1FYTD 1KF9B 3UC2A 3REWA 1MLBA 2IOIA 3POHA 1A4AA 2BSRB 3LD8B 4HZ1A 5HHQA 4UT9A 3OKEB 1CVSC 2WXFA 5DD0H 3UPCA 2CALA 4OCSH 4PH8A 4Y7MA 15C8L 2OW6A 3K6DA 3T1FB 1XCWA 4H1LG 4P0DA 3VXQA 2MIZA 1JZDC 3DK0A 1H8OA 3MV7D 2JJSA 4V1DA 3ZIYA 1TQUA 1HDMB 1NH6A 2JJTA 2NY4C 3HCVB 1OPOA 2CNYA 4GXUN 4TULL 2QVIA 5I30L 4LDCA 3BLBA 2OSYA 1JTPA 2SEBA 3AFLA 3ZHLA 1JZ8A 3O4OC 4DESA 4LKXB 3JWNG 3N85L 4LDEB 2QV2A 1KDJA 2X89D 4KXCA 3VX1A 2PTVA 2ZKMX 2XN9E 3TVMC 1LQSR 4NQSB 2VIRB 1WEJL 4GUCA 5DZNA 3RL1A 1U3JA 3O8XB 4HJSA 2AEPL 4RMRA 1L9MA 3S37L 2OW7A 2CLVA 4FTVA 4OD1L 4LAQL 3V4VH 1XF2B 2PABA 3FHQA 4U0QB 2HRLA 5GRYA 1TMCB 4FD0A 5EOCH 3O2DH 5B22A 1A65A 1KTRL 3I75B 2WNWA 5TTRA 1W72A 4MCNA 2CPUA 3ZKMD 1FN4B 3SGKA 1MZZA 3L5WA 4HAKA 5DT1L 1F11B 4OJCA 4BWUA 2WZ0A 4D2NA 4OR1A 3ARFB 2GJ6A 2HWZL 2IO5A 2H9GB 2QZQA 3ETSA 4NQQA 3NAAL 5I26A 4I48A 3IKKA 5L7XH 5AOLA 1CFNB 3O3UN 1E8ZA 2YZ1A 4M8VA 4PB0H 4HQQL 3MRFB 4NQUA 3MGOA 2AW2A 2NNFA 1JRHH 4ADGA 2YAFA 2AJ3B 4GAJL 1UWEL 4MZIA 1ZSDA 2DBLL 4H8QA 3GNML 2V9RA 1G5GA 1TCMA 3KPRA 4JPVL 3O3BB 1AP2A 1UGNA 3ECQA 3NSYA 2OXHB 4PJAA 3O9WA 3X1BA 1I7UB 4NGHH 3D0LB 2BMKA 2O5YH 4A6YH 3V5DB 4DCQB 4PRNA 5E2UH 3HZKA 3HS8A 1IM9A 3HR5A 4FFVC 5CINL 2BVYA 5CN2A 3BQVA 3K72A 3BD5A 3BD3A 3OR6B 3L95B 4XMKL 3MJ9L 4HC1H 4WJKB 1FO0L 4G6AC 3CDCA 1G9NH 1NGXB 1N0LB 2DIEA 3II2A 3LH2H 5AYTA 4PRID 1W2KT 1T21A 2COQA 5EIIA 1JYNA 2J3SA 1CICC 2APFA 2Q87A 1AO7E 4DP8X 1JRHI 4WJ5A 1RURL 2HLFD 3Q8BA 4RZCA 3SDCD 4C47A 1Z9MA 5I8KL 1V5JA 1NGZA 1KIUB 3GINA 5FW6A 2YR3A 1GW0A 5HGDA 4MX7B 3BSZH 1HXMB 2NY3C 4WV1A 1MAJA 1WT5A 4N8VA 4QRRE 4FQ1H 1WZLA 1I1AD 1Q94A 3U2JA 1E3ZA 3V4VB 5EEWA 2UWEA 2JKRM 1AKJB 3HG1B 3ZKND 2ZWNA 4DQOH 3TNMB 1JN6B 3NIDB 2WM0A 4AIZA 3SPVB 4Q9QL 3UJTL 3LZFH 4R2GC 2V17L 2VDQL 4UM8B 2YD4A 1NGYA 1ED3B 3DX6A 1Y18A 5EV7A 4RSYA 3FBKA 1JGUL 4L3EE 5DDHB 2HPOA 4F33B 5C3TA 2EIJB 2Z1PA 3GT6A 2Q7AA 2PN5A 1IAKB 2I9TB 5M94B 1MQKH 4FMKA 1EVTC 1L0YA 3N42B 1DQKA 1UUSA 5HHOD 4GY4A 2EYRB 2CPCA 5T3ZH 2YK1L 3E6HB 2NY2B 3H2QA 3KPOB 3LZRA 4RISH 3I84A 5FO9B 1J5HA 1S3KH 3QW9A 1U8JB 1X6LA 1TQSA 4KKLC 4PJ5A 5DEFB 5E4AA 1XL4A 4FA7B 4OVVA 1IUZA 2O5NA 3X1NA 3KPNA 5EU6A 3MRJA 1A6PA 3W39A 3BI9X 4ZQTA 1WZ1L 3G5VB 1E27B 1E9QA 1TTRA 2ZWLT 4NP4L 4NZJA 2JELL 4P99A 1TZHB 3B9KD 1TUPA 3EKCA 1OF2B 3U46B 4IKLA 3WIHL 2Y3AA 3IMWA 4CW1A 4U1KA 1TZIA 3EYSH 2V7HA 3ZE0E 4CVZB 1OF0A 4MS8C 4PJ8D 5T5FH 1WICA 2AK1L 3VJ6B 2X1PA 5E6ZA 1UA7A 2J71A 3DOSB 4PGEA 3LH9A 5KVGH 1NC4B 4G7VH 4PJFB 1UT9A 3PHOB 4YVNA 2WAHA 1CE6B 2DMGA 2H0EA 2DOCA 5HHMD 5C0AB 2QVKA 5DQ9A 1I82A 5IQ9A 1S7QB 4XP5L 1PLGH 4AQAA 1QEWA 3K0YA 4ODVH 3WE1A 1JGLL 1HT6A 4JFDD 1URZA 5FDWA 3NA9H 2ZWKA 4LLDB 4Y5VC 2G0LA 3BUIA 2J21A 1CD8A 4UWQB 2C9RA 5TE7L 4YXHH 3F5WB 2PUQT 1HKLL 2BP0B 4PBXA 2WWOA 1MFBL 1U3HB 3W9DA 3BEWA 5F9JA 4RNRB 4FQIH 3MRQA 1HE8A 4K9EH 2DI7A 1ZA6B 2VLRE 3E8UH 1XF1A 3EW3B 5F3HB 3R7QA 4HJ0D 2OL3L 4A38A 5JXEC 3L3HA 2WQAA 4HS8H 4NWTL 3PNWB 5DVNA 1HEHC 2V3FA 1OP9A 2O5ZH 4MJ5B 1EAPA 1K5NA 3BCFA 1SVZA 2X4SA 1P9MA 3BGMA 1Q72L 5E23A 1V3KA 3Q1SL 4I4WB 1TZGH 4LSRH 4OJFL 2Q8BH 3MRLB 4MNQA 4J3OF 1USQA 2VW4A 3VFPA 2WB1A 2WNGA 2W60B 2YD8A 2ZQKA 3H6AA 3K2KA 1MRCL 4GKSB 4I87A 4BH7A 5ACZA 1E2WA 4HJJH 5KJ4A 2ISDA 1T0NB 1I9RL 3QZMA 2HMIC 4X6EA 5LXGH 1FYTA 1VLXA 3ZSTA 1FVDB 1RIHL 2X4TB 2PW1B 3CFDA 4GSDL 1CB4A 4YE4H 1O6SB 3RJQB 3WGVB 5DUML 2E74C 1Z9LA 1HZKA 3BFQG 3WEBA 1A5FH 5ESQB 5ITBH 3RVTC 5LNEA 3UC0L 3NSXA 4GMSL 1HIML 4O02L 2H26B 2VM9A 5TPWL 5D55A 4G43B 2F19L 2WKOF 4HXBL 4OZFB 3MV7A 5CJOL 2IALB 2ICWJ 5IBUG 4WI7A 5ICYB 2W9EH 5AVXB 5FV1L 2FWUA 1J0ZA 3FSAA 3EHBD 3IKCB 4FQJL 1KXHA 2D0FA 3MV8B 3JTTB 4H2AA 2HFFB 1DL7H 2NTFA 2ZWZA 1U41A 1AZNA 4GW4A 4JJHA 1T7WA 4YDIL 2XWEA 3L2MA 1KLUB 4D8OA 2QMJA 3RAJH 3GGWA 3VFVA 4CU6A 2VCOA 3TWCH 2X89A 4RGNB 1XL6A 3MN8A 4QXUH 4XCNA 3EJTA 2F74B 3W9EB 1M3JA 2VSCA 1DSFH 3SDAD 5LXVA 5J6GA 2X88A 1M6UA 2OZNA 2XTJC 2ZIDA 3AU0A 2WN3A 4ZMZA 1ZA3A 4QT5B 1WWWX 4UQCA 1NCTA 1N4XH 1PEWA 4LVOB 2BIOA 1KXQA 2X0WA 3GZKA 5AFAA 1DDHA 3EDFA 5HPMB 1LO2L 3ZRCC 4GLRH 4N90E 5DLML 1HZHH 4HW6A 3FFDB 2Q76B 1A3RL 4HIJB 5FYLL 1HCYA 4KK6C 4YDKL 2DV6A 1SEBB 2WXLA 1UXWA 4PI0A 5E95B 1NCAH 2RIKA 2Z6FA 3QJHA 2XX0A 4BEIA 1ZHNB 2AABH 4KITB 4RGOL 1EHKB 4TL5A 4ONHB 4M7JL 4M43H 4YSPA 2HLAB 3UTSB 2AQPA 4QTIL 1MFCH 2R2HA 2WGXA 1GZPB 1NGQL 2OR9L 3FDWA 5E2WH 4LASH 2XXMB 2QKIB 2N59A 1FGNL 2X09A 1ACXA 3BD4A 2VXTH 2E27L 1MXDA 3MOBH 2HJKA 3EO0A 5F9DC 3TPUA 3OD3A 5MHSD 4XXCC 1DSYA 4QWWD 1LD9A 2CJ3A 5JYLA 1HL4A 5FK9A 3U2SA 1QVOA 4AM0A 5FYLD 2DTMH 3P9LB 3S8WA 1YEDB 4LBEA 1YNTA 4ODWB 4GLRI 1TEGA 1G5AA 2GUOB 1MWOA 4UOZA 3RUGE 3WEXA 1B88A 4PJXA 1CUOA 3V5DA 1N59A 1UKTA 4X83A 3LXBA 1I85C 5ADOH 2XLLA 5C0IB 2AMGA 4M29A 3L4CA 3ZDYF 4Z95L 5IG7B 2A1WL 2O5XH 2L0DA 3C2AH 4HKXA 4PY8J 5AZ2H 4NC1E 2NSQA 1HHIB 4PRIA 5EZPA 2C4FT 4Z7UE 2CKBL 3MDJA 1D5XB 1IBDA 2QJDA 3ECVA 1MIEL 3FQXA 3MRBA 4YDMA 2VUKA 2V5YA 3CXFA 3SDCA 4HEME 1FLRH 4O51B 2DL9A 4F8TA 3WXVH 1IT9L 1YNLH 2VITB 3AQZA 1HHGA 3GBLA 4G7YH 3L1OL 3EYVB 1PZ5B 4PRHB 4BQ9A 4KRMB 2KDGA 4B6ZA 4QHUB 1I1AA 4PJCE 4XNBA 3L4WA 2WBKA 1O5DT 2FBJH 1NM4A 3MJ9A 4PP2B 1C12B 4H1LA 1FO0A 3CLWA 1C5DA 3IDNA 3CLEL 2J8UE 4OBSA 4EZLA 1R0AH 3ZPDA 1HYSD 1NCCH 3G6JF 2KZKA 4RMQA 3RX8A 1PU0A 1SVBA 4JG0H 3OMZA 4JMXA 2ZKXA 4MLSA 2BC4B 4MLIA 1Q9LB 2DQJL 3DHJA 4M56A 4FABL 4CVXB 2XDHA 4JL2A 3D0VB 5I23A 1QFUL 5DRWA 5HHOA 4RFEB 3RPIB 5HVHB 3K80A 2OMYB 3RIAK 3B2VH 3C08L 5FO7B 3GXTA 4YHML 1SN0A 3GLDA 1JE6A 4JDEB 1M7XA 1E2VA 4DEUA 1Z5LA 3LXCA 3HBQA 4DUWA 1OTSC 3IPBA 3K6SB 4MCZB 1OGAE 3EGSB 3KDPB 4FNRA 3SPIA 1WGVA 4FCAA 4KDTC 2F58H 3N0PB 4OLVL 5F9AC 4KX9A 1UCBL 3D48R 5G5DB 4Y4FD 1JK8B 3B9KA 3Q9PA 2WXQA 3IAPA 3VFGL 4U6VL 3CMOL 3CUPA 4LIQE 3UAJD 5I28A 3RZWA 5GGQH 2X41A 4PJ8A 3RP1A 3ZYIA 3IJYB 2D3JA 4JPKH 1W8OA 4V1DE 5FYKH 1GR7A 2NY3B 2YC1B 4CKVX 1I8UA 4NWUL 3VI3B 1B9KA 3TO2A 1NIDA 1A66A 4Z77B 1ITBB 3VQMA 3ULVD 1CURA 3B2PA 1YN6A 1OAUL 2D73A 3S37X 5L4JA 1QTYT 1TYEB 32C2B 2DS4A 3BUPA 4LO9A 1NMBL 1OSZB 3ASWA 3OHXA 4IIQA 1BOYA 4JFDA 1LEKB 1PTZA 2DLFL 5F3BA 3SDDB 2NY1D 4ZOEA 4FULA 2HVKB 4ZDHA 3WIHA 1KZYA 4TNWK 4FTVE 1WBXA 2QPSA 2R1YB 4FNTA 5B1JA 1KV3A 2VZUA 3IU4H 3CX2A 4WRLA 4F9LC 5D6CA 2JJVA 3NIGF 1KPVB 4GH7B 2RA1A 3JV4A 5I0VA 3DECA 2BHUA 1IAOB 2GK0A 3MV01 2HJLB 4N5EC 3VXSD 4J8RA 4N6QA 2FEDD 3GB7B 2NT1A 4AOFA 4OAWB 1Y6NR 3BWAA 4YR6A 2GJ6E 3L3IB 3P30H 2N3JA 4HETA 4MXQC 2YRLA 3MX0B 1YZZA 4MYWB 4ODUA 3VACA 3ARZA 2IPKA 1QHOA 1OZTG 4RBPH 5J56B 4OBRA 1JD7A 3WMQA 2EC9U 4G80B 2W0FB 2J72A 4WFHD 4DGVH 3GSNL 4X7DC 5F0PB 2ODIA 4LBAA 4NRYA 4TVPL 4QHPA 1AMXA 2B15A 4CC4C 2P7TA 1EUTA 1CVRA 3KPRE 3MRCB 1QLEH 3HPJA 1F90L 1FG9C 1XDTT 4PJAE 1PAZA 1TCRB 5CZKA 2MQ0A 2K7QA 4M7LL 3VGAB 5I16B 2OL3A 1KEGL 5MEOA 4UAOB 3QCVL 1XSIA 2XBDA 4QRSA 1YN7A 1TQWA 1VEMA 4X5XA 2KZBA 2B7DT 2R27A 2LOEA 4QO1B 1BLNA 2ED6A 2X4PB 5FW7A 1K8DB 3S36X 5ANHA 1BMWA 4ZUUA 1RJYB 4L4TE 4ZTPL 3MYJB 3GMMB 3EJPA 5HDBB 5A2CA 4D7BA 3VUAA 1MAKA 2F53D 2LTQC 2XN9B 4TVPD 3VXTB 3AB0C 1BZ8A 5T33L 2HZHA 5IKCA 2WLIB 4F93B 1B3IA 1TEFA 1GKOA 3SDAA 1A3ZA 5BVPH 1IGTB 4K5MA 2DWEB 3WS3B 4PP1D 3VFNA 1UACH 3VDBA 2EUZA 3TTSA 2DEYX 3IETA 2DEWX 4W81A 3T4AC 1SGKA 3MRNB 3TYGH 3IRPX 4HH8A 2UWEE 4W93A 3WNMA 1S6NA 4O02A 4ZX6A 2A0LC 5E0QA 5IBTL 4YK4C 4P23B 2WQVA 3Q6FB 1MCPL 3VGGA 3QG7H 3APFA 4TKWA 1XGYL 3U7AA 2ZXQA 1VEOA 2AFNA 4BCXA 3T8MA 2WBJD 2DBJA 4OQ1A 1WUZA 1D6VL 1VFMA 4PWEA 5D4IA 4KNUA 5D7JD 1JFQL 4M61B 2X53A 3KMDA 1SYVB 4PD4J 2D03L 1ZMYA 3RJDA 2GBVA 3ILPA 1T83A 4APQB 3CNKA 5HHNA 2I69A 5BV7C 3IJ7A 3S3CB 4BFEA 3L4TA 3BAIA 4PJ5E 4X4XB 2W0KA 5I1JL 4LPYA 5KSAD 4QOKD 4DW2H 3FRPG 3E6FB 3TN0D 5J7CC 1BBDL 5EU6E 3OAZK 3W57A 1QLEB 3WFDH 3D85D 1HHHA 2KLTA 3I3EA 2XKUA 4WY7L 3LN5B 4FXKB 4JZOB 6PAZA 1CD0A 1QO3B 2ZG1A 5HJ3A 2CBPA 1IGML 5E99L 1LDSA 3IDJA 1ZT1A 4M5SA 2C5DC 1XIWC 4MA1C 3ZYOA 3PHQA 4R0LA 3MLZH 1MFEL 4JPIB 2J25A 3GSQB 1SQMA 1KBPA 3ZKXB 4UQEA 4I88A 4QXGL 1QLRB 1JCVA 1WAPA 1HZLA 3O4LB 3Q6GL 3CXHJ 4AYSA 1J1PL 4BFBD 4AYFB 1A6UH 3ZUCA 1OT4A 4DPRA 2HRPH 4ES8A 1G6RH 1H9VA 4R7VA 3IGLA 4JQXC 4JKPL 4NM8L 4IMKA 4N9OB 4QRRB 1BAFL 1YYMH 2V2TA 5FKPA 3WUWB 1ADQH 3DDFA 4RGMC 1MHHB 4PIBA 2EE0A 4POZD 4TUOA 5F1IB 4YSCA 4XO8A 3FAWA 1ACYL 4U1JA 2O6EA 3MGTA 1MXGA 3QS3A 1ZLVH 3BRGC 4TNVK 3OKLB 2O26U 5C7ZA 1NIEA 1BSIA 1CFTA 3UROR 4PJDA 1M2VA 3NGBC 2JLPA 1DN0A 1OIOA 1N2RA 4L3EB 4RBPK 2PYFA 3PXLA 1MIMH 3QHTC 1QKZL 2IWGA 3G5XB 3NEOA 5BJTB 2CKBA 5FUOL 1QLFA 4NUMA 5E9DD 5F89B 2H0PA 1F18A 4I13B 4OIIL 4X5QA 2HSIA 3EG9B 4Y5XA 1JPGA 3QRLA 3OSKA 5IB2B 3LHPL 5JZ7C 2ID5A 3H56A 2LVEA 1SJEA 4HCGA 4POUB 5DTFB 3LKOA 4LGRB 1JZ3A 5F7BA 1EEYA 3W0WD 1YNKH 2MKLC 2G30A 1A2YA 3IAQA 3QJSB 1R5WB 2A4CA 4LPCA 4MNQE 2A9NH 4KKQA 4NHUA 4NCC1 5CGYC 1JWMB 2J56A 4RMSA 4ILDA 1JK9B 3TT1H 3BN3B 5CU9A 1FYTE 1WFOA 2MJWA 2MNUA 3B5TA 5I1AB 4Y4FA 1FIEA 2VDLB 4IHOB 4ZAKC 5E6SB 5KSBE 3N42F 1ZANL 4M03A 2FWOB 1H3XA 2Y6SC 3KD4A 3UAJA 5LGJB 2DQFB 1ACZA 2Y7MA 4KV5E 1AS6A 1EK3A 2BSTB 2W91A 4RESB 3QC5X 1K4CB 3MV7E 4LLYB 2Q8AH 5GZOC 2VABB 3GSWA 3TTYA 3PAZA 1HINH 3BKML 4P3WA 4JM0A 5JW5A 1W0WB 5BQ7A 4F3FB 4QEGA 3IE4A 3NIFE 1UYWH 4CMHC 5AW4B 4TQEH 2V4LA 1R3IL 3X3FL 3OG4B 4NQED 2ZUTA 3RVXD 1PJWA 1WFIA 2VJ0A 4ANUA 1KCUH 4X42A 5BMFH 2ITDB 4HGKC 1MDTA 2VLRB 4GUQA 4U33A 3VTTA 4GSXA 4MBOA 1OCCB 2HUEA 3O6FD 2OV0A 3L13A 3MRGB 2NY6C 3MCYA 2WVVA 3VXSA 4PWIA 5EDSA 4DUXA 4G42B 3V6OA 4YHLL 3ABLB 5GRUL 3UBGA 4BFIB 4LLWB 1FNHA 1OAQH 3FPXA 4YXLL 4P49A 3GMQB 1YMHA 3Q48A 3KBHE 3WS6A 1E4WL 2H2SC 4LOUC 3U7WH 2FHCA 2GB2A 5GIRA 4JRYE 1ETB1 1C5CH 1PY4A 3BUYA 4Q0XH 43CAA 4EQ2A 5FFOA 4AQEB 3WNJA 3B6SA 1AQDA 1PZSA 2WWNA 5GGVY 5JW4Q 2FQEA 5AAMC 4GBXD 4KZEH 1DQIA 4BE6A 5I74B 4XPGH 3X1FA 4AMXA 2RB8A 3EH2A 2PCFA 2QSTA 4KGLA 3HZVB 4PJXE 1TJHH 1SUJA 1BQLL 3ZBMA 4Z3FA 1ZK5A 1J5IA 3NFSH 3L5XH 3AAZA 4G6ML 5BRPA 3DVNB 3BLPX 4JZJC 4C4UA 3PG2A 4U6YA 4HUKB 1DVFD 4PRIE 4ISVB 2F53A 1KEMH 1R9FA 1QBLH 3BW9B 4KKAD 4OD2A 5ID1A 1P7HL 3HLAA 5HY9A 3CC1A 1EGJH 2J5LC 1XD1A 2OBGA 5K39A 4G7QB 3QZNA 1HSAA 1ZLVK 2NW3A 5G55A 2PP8A 4JFPA 3S7GA 3SBWA 3ZKSD 1LP9A 4MMXC 2Y1VA 2DYRB 2NNXA 2XUWA 4OI8A 3EJZD 1G7IB 1EZVY 4NNXB 1DJHA 3QAZC 2B1HL 4XZUB 5BV7H 4DK6A 3SBPA 1KENH 3ARYA 3EYUL 5D96C 3LRSA 1AXTH 3FZUC 1HOCB 3MOAL 1UB5A 2DQHH 2MQCA 4IYKA 1ZS2A 3TS8A 2WBJA 3L7FB 5D7JA 4EAEA 2NYYC 3JWNE 4NO5A 3ZR5A 4YNYB 5DC2A 1IGCH 1PX4A 5HHOE 2CJUL 2F1AA 4JUSA 3WKMH 3JYCA 4JREB 1MCFA 2O6PA 3DV6B 4MA7L 1V10A 1JGIA 5EU3A 3BP6A 3VD4A 2CU9A 1FC1A 3C60B 4I9WE 2B0SL 1LE9A 5KSAA 4QOKA 1MUJA 3HB3B 3TN0A 3EUUA 3D85A 1IVTA 4UQ3A 1I7ZA 1ZSHA 3DHMA 5AWNL 1PY9A 3RUGB 3TWYA 4XNYH 2LTQB 1S7XA 4MD4A 5DO8A 2ODHA 5CLWA 3MV11 2DM4A 5FA3A 2JB6A 4WKXA 3VSQA 5AALA 1AD9B 1GGYA 2VE6A 1CDCA 4JHUA 5DJAB 2PW2A 3O41B 1Q9OA 1UH3A 2HJFA 3CSFA 5F71A 4XO9A 3WAJA 4Z7UB 4EI6B 4MFHA 2MTZA 4GKZB 4HV8A 5ABDE 4P2RB 1PBYA 2WK2A 1R46A 5HHME 4DAGL 1U2CA 3RIAF 1GIGH 4LLAA 5EBLB 1IZKA 4E42A 1D9KC 5J1AA 4PVBA 2BCMA 1RZGA 2C9QA 4UT7H 3VA2C 4YK4B 4R4FH 3FUJA 5IR1B 4X6DE 3SD5A 3LQAL 1SNRA 5GSRB 3CSTA 3VQLA 4X9GA 3OKOB 3NZ8A 4JLRA 5KYYA 4L3FA 3U9WA 4UB0H 2J8UB 2DI9A 1JZIA 1HAUA 5J9PB 2BIQA 3JTSB 1DFBH 5AAWA 5BV7B 4PPTA 4E9XA 5IB3B 5TK4A 5A3ID 2Y5EA 4P5TD 3NVQA 2I7OA 3NJKA 3LV3B 4B27A 1S9XB 4EJ1C 2VUOA 3FB8B 4R8WH 3U9UB 1ETZB 5E9DA 4Q9CA 2CHXA 4TSAH 5D93C 2CDGA 3MXVH 5IUSA 3DV4A 1BAWA 3NCBB 5DD6B 4Y2DC 5AYUH 4MA1B 4D0CB 3I50L 1CDBA 3W0WA 5E9AA 5HHXH 2EZ0D 5I6XB 4PWJA 3Q8AA 2C9AA 1NCBH 4JG5A 4R4BB 2WSKA 3WFEL 3KH4A 4S11A 4CKQA 43C9A 2KYIA 2EH7L 3US0A 1R6VA 1X9UA 2WXJA 2YUXA 4OIFA 2A2QT 2C9UA 1BJMA 4TSBL 3WE6B 2K3TA 3TLRA 3EF7A 3TOPA 3GJFA 3VXQB 4JFUA 5JO5A 4WEBL 3SE4C 5CP3H 3FO0L 1GY2A 5BO1H 2V2XA 4KY1H 4HWEL 1EV2E 2NY7L 4JFZH 4LCUB 4YSDA 4CSSA 4RDQF 4ZZFA 3WSQL 3EOTH 1FH5L 2SEBB 4GXVL 2RAMA 3WGUB 1TT6A 1TZOA 2FJGB 3KCWA 4YSRA 5F9OL 3S3PA 3DX8B 4DP6X 4NKQB 1TJMA 2VDML 5E2VL 2O61A 3WCYA 2AVGA 1UA6L 1HOEA 4YHIB 1A1OA 5JPNA 5K9KB 1S4IA 1PKOA 1T0PB 4FERA 3RL1B 3PPSA 4HUVA 5ESVA 3FRPA 1F4YH 3QRGL 2YMTA 5DA4A 2FH8A 4PJGA 2CLVB 2QTEA 4GKLA 4HF5H 2ZSVA 3D7PA 5BW7C 1KV7A 4GO6B 4NQEA 2NDGA 4KTDH 3TO4C 2R4RL 3WO4B 5KJRH 3AXIA 4LHQB 5D7KD 5HI3C 5FGSA 4AL8L 3NEXA 4PREA 5E2JA 1THCA 1A6WL 1W72B 4I3RH 4LSTL 4NZTL 5H37H 3RX5A 3L5WB 4M6ML 1NCDL 3D12B 1LNUA 3MBWA 3DBXA 3QXWA 3GKZA 2C26A 3O6FA 3UAFA 2BWQA 2GJ6B 3KVPA 2GEEA 4RMWA 3QWQB 3U6XS 1U4FA 4I48B 5F21B 3A47A 3OKDB 3DA0A 4G7RB 2D8KA 1FC2D 1SLWA 3MGOB 1IBGH 3OHMB 2ADFL 1E5YA 2BDNH 5LLIC 3BRFA 3I02B 4ZAKB 1EHNA 1O9WA 1ZSDB 2WINB 2WW8A 1DJSA 1G9MH 4UQBA 5AD0A 1NL0L 1TENA 3KPRB 1DLHB 1AP2B 4OJAA 5C6TL 4ZUWA 3WTYA 1A7QH 2QPUA 2X70A 4XXWA 3U4KA 4U6XB 1X5LA 4AJWA 2ZX7A 2BMKB 5C71A 2XV0A 4GBXA 5FYLE 1ERNA 1MHPH 1FNFA 3G6DL 3G5YB 3HZKB 4OSUH 4DO6A 2ERJB 3QZWG 1IM9B 3HR5B 4OUUA 2B1AL 2Q1EA 3K72B 1PF3A 3MUZ1 5LGHH 2HG0A 5HYQA 2XV2A 3JZYA 4L4TB 1XSOA 2XXGA 4OM1L 4QHLA 2FT6A 1DVYA 3RZCB 2MPAL 2Z34A 4YEEA 4CSPA 1T21B 3C2SA 1ROCA 2WQUA 5J3HC 2QHRH 3LVEA 1TU2A 2AC0A 3BPOC 1DVFA 3RWCA 2DMCA 4NUJA 1IAIL 4LF3A 1SXSA 4NO2A 4X8CA 3RJOA 1T22A 1OAJA 4MKMA 3UYRL 1GYWA 3BP4A 4YUEH 2ZKHH 3CVHL 3MBXH 2KT6A 1I8AA 2R4SH 1JMZA 1XH1A 2CGYA 3RILA 3W1ZA 4NERA 3SD2A 1PY0A 2UWEB 1X9QA 5D1ZD 5IB4B 1CFVL 4YHKH 1QBMH 2AHIA 4NHCL 5HDBF 4H5SB 1GYAA 4AIZB 4P9MH 4DEPB 5DHXB 3H2WA 3WBDA 4ZMPA 5DVKA 1NGYB 3UX9B 4PJDE 1SDYA 2BVPB 2OXGA 4LSSL 3DKHA 3IJ9A 4ABUA 5IHUH 2DQCH 2FLBT 1MCHA 1T0MB 1IAIM 4BJLA 3C6SB 5FM8A 3WAKA 2AXGB 1SMAA 4J4PC 1AGBA 2DYPD 3VTAA 3FW6A 1OW0A 4G1MB 5JW3L 1UATA 1FNAA 4OCMC 3N3EA 2GTWA 4PJ5B 5D72L 3TURA 3D9AH 1A6TA 3WTXA 1CF1A 1IGIH 3KPNB 1QSFE 5EU6B 4TUKH 3F7RA 3RVUD 1E9QB 4FJ6A 3VU1A 4XB3A 2Z65C 4OLWH 3WLWC 2AQ3A 3CFNA 5D5MF 4CW1B 2Z8RA 1C5BL 3P73A 3VMOA 1EA9C 4WWKD 2F5AL 1IC5H 4YBQD 3TA4D 1A7NL 1G4MA 1I3RA 4TNVF 4UAHA 1UWGL 5C0FA 2QFPA 2J5LB 3RI5K 3RWGA 3L3GA 5I8OL 3MYZA 1F2XK 5B7EA 5LNDA 1E8XA 4K71C 5GS0C 4PS4L 4HFWA 5ITFA 3KPLA 2XQYG 4MMXB 2P5ED 2Y2TA 3S6CA 5DQJA 1FVEB 3X12B 3AABA 2K4AA 3QAZB 5FUCE 2IQ9H 4K7PY 4NN5C 3QFGA 1DBBL 4FE9A 1UADC 4LB8A 2CMRL 5FDWB 4OZ4A 5D96B 4DKFH 1T03L 1BXVA 2WSPA 4LU5H 2GC7C 4KI5D 1RZFH 1S7UB 4S0TD 4XMLL 5FGBA 2CCVA 4OFYD 5JDSA 1S7SA 3VMNA 4PGCB 1NMCC 1GGTA 3CCHA 2APSA 5D2NE 1D5MB 4FCHA 3W9DB 2DY2A 4JO8A 3PFUA 1FZKA 3MRQB 4N2LA 5C7XH 3U4BL 3DURA 3V6FA 5JW4M 1JWSA 1L3WA 3ECUA 5I30H 3LB6D 5J13C 2BOLA 2DWYA 4HPOL 3L3HB 2ORBL 3ZYZA 4R7XA 5I17A 4J6RH 4QF1A 3VXRB 4PCSA 1LO4L 5JIQA 3R1GH 2FO4B 1EAPB 4HJ1A 4P5TA 1DBML 1GHFH 3O81A 5G4NA 3VB9A 4Z3GA 2PCPA 35C8L 2X4SB 3L4ZA 1HXYB 3BGMB 1WA0X 3SE9L 2F8XC 3VB8A 3APNA 4BZ2L 3A67H 5CMAB 4WFGD 1X7SA 1RHHB 3TJEL 5HD8D 1T5XB 2J73A 5EOQH 2KLRA 4MNQB 2ENJA 4NLHA 4GG6F 1VHPA 4F9PA 1TKWA 1E4XL 3W56A 4WFHE 5G4OA 2Y36H 4NRXB 1ZGLM 3EYQC 4IU3A 1PCSA 1B4JH 1FYTB 3OAWA 1J9SA 1GJWA 2P5PA 4P04A 4UILH 5AVWB 4BA8A 3QJTB 1FJ1A 1K2DA 2EICA 3PS6A 5KSBB 1TYRA 3N50A 1C08A 2G60H 2GTQA 2A74A 4XNQB 4HJEA 3MRRA 4LHUA 2ZOUA 3RFZB 1N3NB 1NCNA 3MV7B 4BZ1H 3TL5A 2YBRA 4FFWC 5C2BH 4ZTEA 4I5BA 1YC8A 3NJIA 2M1KA 4KMTL 3AXHA 3NPZB 2NTFB 4GW4B 3W5MA 2H45A 1P1ZA 3GGWB 4ZW8A 3VFVB 4A2EA 2VXUL 2CHZA 2F53E 4XCNB 2DQUL 2NXYD 2JV6A 4TVPE 5J6GB 4AV5A 3UACA 2WVSA 3T71A 3NIFB 4BZYA 1N8ZA 5GRJL 2VDNL 1JS4A 2CO6A 5F6HJ 3CQPA 4UTBL 1R24A 3OGOE 2Y07L 3AU1A 4JHWH 4QTHA 4I1RA 5ALBH 4GP8B 4LCIH 2VJ8A 2BLFA 1H8LA 2FSDA 1LP9E 1M9WA 4ZTOL 2CM5A 2NZ1A 4Y2DB 1NLBL 2OR7A 2H3NA 1XR8A 4E5XG 8FABB 1SJVA 3BVDB 4I0PD 4X8JB 3QPQD 3IWVA 4RDBA 2YD2A 5HI4D 2R2HB 3BZDA 3HW7A 1DEDA 3PXHA 1H3PH 4OCRL 2Y7OA 1IKFL 2EDYA 3EJYD 4KUZH 3NH7L 5JYMA 1X4ZA 4JRYB 3EO0B 4RMBA 4FYRA 4BGDA 2AXHA 5GGVL 1G1OA 4FG6C 4U1MA 1LD9B 4HJGA 1KB5H 3EO1A 4H7VA 4NJAL 4K4KA 4R5TA 5FK9B 5A7BA 1QVOB 1KFGA 4EI5D 1XB6A 4KO7A 2BW4A 2A4ZA 1SMDA 3AS1A 2P49B 4HIXH 3WEXB 1YQVH 2WD0A 3QORD 4CGTA 3KPSD 1N59B 3L9YA 4K3EH 4L3CB 4KO5A 5KSUA 2DQTL 2CG9X 3UTZA 2PWGA 3TASA 2VWEE 2AJZA 4CN6A 3BYYA 3GXNA 2R7EB 3FOLA 2CHWA 4TTDD 1G1YA 5KTEH 3GZQA 3BKJL 3BMWA 3LKSA 1VKXA 1H3GA 3EGXB 1X5KA 3V4PL 4HKXB 4UUJB 1HEJC 2QSQA 4P5RA 5IIEA 3RURA 1JL8A 4N0FA 3FQXB 3P9MA 3KCPA 1TJGH 3MRBB 4IKIA 2WTRB 1EEZA 1I75A 2WO2B 3QIWD 4FJYA 2LE9A 3QNXA 3SDCB 1JF1B 4ALAC 1A7RL 2Q0ZX 4R96B 1BQUA 4TSCL 3X17A 5C9JA 3MBEC 4JW3A 2EYTB 2E7MA 2E8ZA 1I1AB 5CCHE 2P52A 4DN3H 1CG9A 3CLFH 5BOPA 3L9BA 3HG4A 2IGFH 1AQKL 5D1ZA 3UP6A 3ZE2E 3UO1L 3FSVA 2MCPH 2DLIA 5IQ7H 3QFJD 4S0HA 4P46C 4KTEL 3IDNB 1DO5A 3EXJA 2X4UB 2GYSA 3NJHA