3TX4A

Crystal structure of mutant (c354a) m. tuberculosis ld-transpeptidase type 2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
285
structure length
267
Chain Sequence
b'RYTLNATALHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGALNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mycobacterium Tuberculosis LD-transpeptidase type 2
publication title Targeting the Cell Wall of Mycobacterium tuberculosis: Structure and Mechanism of L,D-Transpeptidase 2.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Peptidoglycan binding protein
total genus 70
structure length 267
sequence length 285
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 3tx4A02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3tx4A01
4GSRA 5D7HA 5E5LA 3ZG4A 5DCCA 4GSQA 3U1PA 4QRBA 3TURA 4JMNA 5E1IA 4JMXA 3VYNA 3ZGPA 3VYOA 4QRAA 4A1KA 4A1JA 5DC2A 5DVPA 5DU7A 4Z7AA 4A52A 2HKLA 4A1IA 3ZQDA 4QTFA 5E1GA 5LBGA 4GSUA 4K73A 5DUJA 5E51A 4HUCA 4XVOA 3U1QA 4QR7A 2MTZA 5DZPA 3VYPA 5K69A 1Y7MA 4ZFQA 1ZATA 3VAEA 5DZJA 4LZHA 4HU2A 4LPQA 5LB1A 3TX4A
chains in the Genus database with same CATH superfamily
1UUNA 4GB9A 1SY6H 3V10A 3U36B 2CLVA 1IC7L 1E27B 2WVVB 2X7LA 3NIGF 2PXYD 5CJ8A 1TITA 1JL8A 4TLTA 3RLSA 5E8OB 3HNTH 3II2A 3HE7B 4GAYA 1DQVA 1XF1A 5I8EA 3WNJA 3W11D 1GOFA 5D1XE 4AMKH 3DV4B 4A52A 4TVPL 4W6XB 3REVB 4GI9A 2DL2A 2AEOA 3VWKA 2R0WL 1M56B 4Y7OC 5D7LB 1G43A 3FN0H 4TQPA 4IHOA 1TVBA 4MJ6B 5AQ0A 1OTUD 2FDBP 2LAAA 1Z3GH 4MZ3A 4HDIB 3VXPA 1S5HB 4Y4HC 4EN2A 4TLSA 4R26L 5KVGE 3ETTA 2Z8SA 4I77L 2CU9A 5JORA 3MX0B 2YAEA 2YZ8A 4DEWA 3S3JA 4MQSB 3SZ6A 3A22A 1AZUA 3OGCB 1G6VK 3IGKA 4IOIA 4EIUA 4JKMA 5DMIL 1D6VH 1DANU 3EGSA 5GGQH 2Y06L 5C7ZA 4EI5B 2P9RA 1KEGH 4CSPA 3EYFA 3L9RA 5FOBA 3TPKA 4GPVA 2FZ3A 4N2KA 4OFVA 4LAQL 4ECNA 1E9PA 2BSSB 4Z3JA 5AL0A 5FW6A 1F4YL 1C5CL 3X13B 4MA8H 4M7KL 4FEMA 4FTVB 5CHNB 2J73A 4LF3B 4O02B 3D85D 4LDCA 5KSUA 4RETB 4KY1H 1NLBL 3IYLW 3PAYA 2XV2A 3U7WH 5IESL 3CLEL 5MP6H 3S5ZA 2YPVL 3FTXA 5FCUH 4X6BB 4LCCA 2G5BB 5GRXG 3S4SG 5E5UB 3GO1H 2VL4A 4K2UH 1GIGH 3BKYL 5FX3A 5TDOA 3LEXA 5DWPA 4TQEH 1SHWA 4FFZH 2UX7A 2IAMD 3RX8A 1NCDH 4JCWA 4ZO9A 3HNVL 4PQXA 4P4RA 1XH3A 2B4CL 5JA8B 5ERWB 4LCIL 4M3HA 3MACL 1VFUA 2AZUA 4NNPL 4PJHF 1WRFA 3KEDA 4ONGL 5FWQA 4FABL 4PJDE 5KS9B 3FOLA 3D39E 4JY6B 4XGZB 2W1NA 3UC2A 5LLIC 1K4CA 2FGWL 5LWYH 4PWGA 5LGHL 3PHOA 2WCGA 4PJFB 2BIPA 1BD2D 1WBYA 3HN5A 4RNRB 4Z0XB 3BIKA 2GTQA 5CF3A 2WQVA 5EEUA 4JVWA 2QQNL 2EACA 5T5NG 3DOHA 2FVNA 1DJXA 2GJPA 3AGWA 3MBED 5EU3A 2NZ9C 1J0KA 1CLZH 4OF0A 4GUQA 15C8H 1HXYB 1ZWIB 4PAZA 3V5KA 1A9EB 2ATKB 5ANMA 4XMWA 3DGGA 4APXB 3CK0L 4XP1L 5FB8B 4NZDA 4R3SA 2AAVA 4EBQH 5SX5K 1P7QD 5IEKB 1B90A 2EJ1A 2ADJA 5ABDE 1P7QA 1L7IL 1IL1A 1DZBA 4GRLA 5LBSL 3S9DB 4F8LA 4JG1L 4ZTEA 2VLKB 1L7TL 4XPBL 2FQFA 3IFOB 3L7FB 2Q10A 3ECBB 1JPGB 1NBCA 2HFGL 1U3NA 2D3NA 4GT0A 1DBAH 4BSWB 4I85A 3KS0H 3QEQB 1KF9B 4D9RE 1PY0A 4ZUUB 3WHE1 2NXYB 3VXRB 1M2VB 2IBGA 4QF1B 5F9WB 1CLYH 2YKLL 1U42A 2Q20A 3TO2B 1GGIH 1C5DA 1QFUL 1JHKL 1IC4L 3K3QA 3N55A 2QSVA 3RKDD 4E9QA 4EZLA 1FO0A 5GQBA 2UWEA 5JIIA 3GSNA 4JY4B 4ZMAT 4JPVH 4CVWA 4FXLA 5KAQG 2PXYC 4PCYA 1S7VA 1XF4B 3ZHLA 2HG0A 1U91A 3BRFA 1NGQH 3C60A 1KIPA 3AUVA 4YUEL 1NCOA 5C0EB 5ILTH 2N1KA 1LEIA 4FXTA 3L1GA 2ZCHL 1EFXB 3HG1E 4X6EB 3QGVA 3MZGB 3A6BH 5JW4N 4WJKB 1LEGA 3FQWB 5FM8A 1OTUC 4HZLB 2AXFA 4J1UB 4OFIA 4S1SL 1SOKA 4KJYB 1GW0A 4WEMB 4ALAH 2E9IA 5I16A 2WBJA 2YD9A 3OC8A 3PWPA 3QIWD 3Q44A 1BMWA 4PRAB 2ENPA 1AGCA 4UAOC 4FQJL 4J6RL 4ZNEA 1HYSC 5I0ZA 3CG8A 1KXQA 1Z9SB 4UF7C 1URLA 2JCCB 1GYAA 4R4FH 1X4YA 2DIBA 3TEZA 4LLQB 1WZLA 1SHSA 3JZ7A 4MVBD 1WHOA 2J7LA 3X1BA 3JWDC 1TCRA 2V2XB 3F58L 3I9IA 4H26A 1DFBL 5HYSA 3VI3B 1NANI 3IETA 1LO5A 4DGYL 4ZUTA 2DQCH 5JHLA 3B2DC 5CLWA 2YXFA 3UTQB 2NDGA 2J8HA 4HGWB 1MNNA 4KQ3L 4M4RB 2CUIA 5DK0A 2ALAA 3DSFL 6FABH 2O6DA 5CEYA 4CSSA 2RTTA 4LVHB 5HHPB 4JFPA 2ZCKL 2YA1A 1TSRA 5FYLL 2NY6C 4OUUA 1ZJAA 3N40F 3VXNB 2IAMC 4FLQA 1AJ7H 4MHHG 4OF7A 2WQUA 4FNLH 1JGIA 4MDRA 4G3YH 5EF0A 5LKNA 3G6DH 5EU6D 5L6YL 5DRWA 4QI3A 1OT4A 1RURH 1U41A 3CU1A 4BFNA 4LEOA 4EAEA 1AD0A 4KAQH 3NEOA 5GIRA 5C71A 1GGYA 2DJ4A 1U93A 5KSBA 4YE4L 3CTTA 2CO7B 1J0JA 4Z7NB 5BS0B 2DJSA 2G60L 1N8OE 3MBEC 4LEXH 4U1NA 3QRBA 2GK0A 2NNRA 3ATDA 5C6TH 3RIFF 3ZBMA 5KWYC 1ZV5A 4QRUB 3UBHA 3BKML 2YWYA 3D3VB 4P3CH 1JMZA 5EBLB 2R0KL 1TJMA 3NABH 3STZA 4ZMTA 1S7WB 4PB9H 2SEBB 4GAGH 4ZFFB 3ILPB 5F1SA 3EJCA 3LZPA 4WFFD 3MCLL 4YXKL 4FQIH 1A2YA 1BZ8A 1ETB1 1SEBB 1MW2A 1Q8MA 4YGAB 1TTBA 3BPCB 2WYZA 1HHJB 1BJMA 2QSCL 4A2MA 1UZ6F 2WZ6A 2PCPA 4JLRB 2ZNXA 5E08H 4Z7UE 3QDGA 3I75B 1H3PH 4CMHC 5ALCH 4L2LA 1MJ8H 5T1DH 4H7VA 4FX5A 3MRIA 4UM9A 3FQNA 2H1LM 4OGQC 3T3PF 2K9UA 4JFFA 2A73A 3DJ9A 4KH2A 4PBWD 4X9IA 2NY5C 1Q72H 3OXSA 4MJIA 4RGMC 4UT9L 3W2DH 3H9HA 3GLEA 2DQJL 2OZ4L 3RKDC 1G9HA 4W9EC 1I8LA 4S1QL 4I18B 4M7LT 4X7SH 4KROB 4Y2DB 2HJLB 5LAXB 1ZD6A 3CVHL 2YUWA 5KUMA 5TFSH 3OB0H 1XGPA 2K8MA 2QFRA 3IU3B 4HS3A 1GL4B 4LESA 4MRCA 4XR8C 3BEWB 1I9JL 4EIBA 1FSKC 4KXZI 4BFGA 1FH5L 4ZNCD 1XGTB 3HS0A 1NMAH 2DJMA 2E7HA 1NFIA 5AVVB 5J9PB 2UY7A 3MRDA 1MFBL 5K9JL 5BRZB 4K9JA 4WUUA 4JZOA 5ESVA 4JAMB 1NAMA 1WBXA 1JMXA 3BH9A 3HZKA 3HR5B 1ZATA 2NY2B 2YD3A 4LL4A 5D2NB 4N0CD 2DWYA 4GS7C 4TNGA 1TQCB 2ARJQ 5DK2A 5DZNA 1J8HE 4TVPH 3CBRA 5BZWA 3UTTE 2AJYL 4I7ZC 2R0WH 5FDWA 3HC0A 1YECL 2ZNWA 3BWAA 2ZICA 3RZCB 1CE6B 1SDAB 5CJOL 4ZJ9A 4NO0D 1DQIA 1G1KA 3UABA 4YEFA 3S8FB 1FL6B 3QIWC 3V0IA 4DGIL 5IMKA 5IW3A 4LLYB 4MYPA 1ZS8B 1RHFA 3P4OA 5TE7L 4LSVL 4R26H 3TPUA 1JPFB 1A7PL 1TENA 3ARDB 1AR2A 3C6LA 2FLMA 2R56L 2XA8H 3FCSB 2BW5A 3BMVA 4JX0A 2Y06H 5DXWA 5C07B 4MVBC 2DLHA 4ELMB 2GCYB 5KVMC 4WQOA 3SGEI 5AWNL 4E41A 1FO0H 5DZ9A 3O8XD 5J13B 3DPDA 3ULUD 4YK4C 3QC6X 5KBDA 3RVXD 5E8PA 5IOPB 1EBPA 4PBXA 1JZ2A 1F4YH 1C5CH 1CI3M 3ELAT 4PRPB 4BE6A 4M7KH 2Q86A 5HY9A 4XAWL 4NO5A 1A47A 4RQQB 2JB5L 1OB1B 4ZFZA 4ODUA 3VGGA 3Q8AA 1CZ8L 1JGVL 1F3DH 4JVUA 1NFDA 3UCRA 5B1JA 4V1DB 3KWWA 5IBUG 2A99A 4YC2C 2JJTA 5L2KD 4EXPX 2YHGA 4HJ0D 2WW8A 3BKYH 5L2KA 1AACA 3RFZA 1QRNA 4Y5VA 1QR4A 3LNIA 2NYYD 5EEWA 4FCHA 1F2QA 2B4CH 4BUGA 3G6JA 5ICUA 3WFBL 1WT5C 1EXUA 3MACH 4L8BA 4ONGH 4ODWB 4D8PA 5F0JB 2FSEA 4FOMA 5JHAA 3BUYB 4UQ2A 3N1MC 1RL1A 2FGWH 2IWKA 5FKPA 3TF4A 2C3VB 4PG9B 4QHMA 5EOTB 1P5UB 2JKNA 4IJ3C 2HKHL 3S3DB 1ED3B 2J72A 1MCQA 1YEGH 1UOVA 3NFNA 1NMBH 5JR1L 4YDKL 3TCLB 3NIFE 4L8SA 4NQVA 3ARZA 3PCYA 2BXZA 2VLMD 2IDFA 3KCWA 4LSTH 4XC1L 4AT6A 3MV9B 4PMFA 1SF3A 3CK0H 4XP1H 2PTTA 3D7PA 3JV4B 3TC9A 2WVSA 4QYOB 3SY6A 5IQ7H 2XA3A 1KCBA 1L7IH 2WY3B 5LBSH 1R3JB 3VA6A 5KSVB 4N2AA 4ADGA 2K8QA 3EYSH 4JG1H 1MFCL 1CXEA 4O00A 3CFQA 3E6FA 3U6RB 1MRDL 3TXAA 3LQAL 1A21A 3KPRE 4ZOAA 3PV7A 3IRPX 1I8LC 5E1GA 3SEPA 5C0CE 4RAVA 4W6WB 2X40A 3U4EB 2FJGB 2P5EA 2WQSA 4B9PA 3T6QC 5FV2A 1EPFA 2HVKB 2OI9C 5DMKB 1LDSA 3H42L 4WTWA 3WFCL 1QFUH 1JHKH 5CZXC 3DJZA 1A7BA 3BWZA 3QG7L 4JL1A 1Q38A 1WVZA 2RMNA 2DOCA 2HX7A 1MIML 4CJ0A 1JN6B 2IH1A 2DQTL 3JZYA 4GSXA 4NGHH 4JUSA 3L3HA 4ZSOA 1I53A 1U3YA 3IGFA 4N0CC 3QWOA 3CMGA 4V33A 3T1FB 1QR1B 4YUEH 3OLIA 2ZCHH 2CG9X 5GZOD 3E6HA 2XC8A 3B34A 3S3CB 3VQ1C 2W0KA 4PGBB 4O58H 1HCZA 4NKQB 4PJ5E 5GGRB 1X5KA 4S1SH 2I26N 4PHXA 4UTBL 1QVOA 3MJ7B 2P44B 4W9ZA 3GT6A 4M8RA 5GSVA 3LAFA 4NM8L 1H15B 2ZCZA 3MC0A 4ZOEA 4DO5A 3I6GB 3CFKA 3OXRB 4FQJH 1T04A 4J6RH 1HL9A 4OCRH 4U05A 4ISVB 4NERA 3HNSL 4I9WD 1AKJA 1PGRB 1MH5A 4P5KA 2CRIA 3TZVD 5EN3A 2R1WA 3ULVL 3TZVA 1EIBA 5JIPA 2CIIA 3GXNA 3O8XC 3ULUC 4L0YA 4JRYE 3RVXC 1PPIA 4YL4A 1FNGB 5CLTA 3U9PL 2DWXA 2L0DA 4X5XB 2W5PA 2F15A 5AYTA 1DFBH 1MFNA 5KZCD 3QUYD 4L4JA 3DI2B 3APDA 3DHPA 1GMIA 2CD0A 4DGYH 1KYAA 4P2QE 4A66A 5BZDB 1ZHBA 4UU9A 1CK0L 5B1KA 3SYCA 1V10A 3CFJA 5INDA 4C56E 4KQ3H 2F2HA 4BA0A 4NHCL 4HJ0C 1J1OH 4KTYA 1D2OA 4KGLA 2I85A 4KTEH 4IRJB 4OJAA 1JTPA 4RBPK 3PL6A 4HEME 2ZCKH 3X14B 3MKKA 4FERA 1FN4B 1VESA 3E2HB 2NYYC 5FYLH 4FQCH 2G3NA 4HIEA 1O75A 1OD9A 5JOFA 4HWEL 4Q6IB 4RX4D 1P4LB 3LXBA 5D7JB 1J5CA 5E94B 2CR3A 3NSXA 4J8QA 3VSTA 4JMXA 3DUSB 3QIUC 5L6YH 1TTRA 1G6RL 4WGWB 5IJCC 3GSRB 5M7QA 1JK9B 2WM0A 4OCSL 5EUOF 1F4WL 2G4EA 3BO8B 4JKWA 3U2IA 3WS6A 4ZI8A 2QLYA 2VJ8A 3IGUA 1MVUA 2Q76B 2BNRE 1WYJA 3HI5L 4JO5A 2C1PB 3GXTA 4N8VA 2B9AA 2AK4D 3DV6B 3SODB 1NC4A 1NL0L 2AK4A 4G42B 5BV7H 4EUPH 1DSYA 2G60H 4MD0B 3NYKA 3UTSD 2WB1A 3BKMH 5AVTB 4NCC1 1JUFB 1J12A 1VZGA 1XO8A 3DTUB 4JPKH 3OJMB 3PWLB 2R0KH 1NGYB 3FSWA 4S2SB 4J27A 4DP7X 4NKIL 2H3NB 4X6CA 4B27A 4YDVB 3MCLH 3PQYE 4MD4A 5HJDA 4YXKH 3T6ZA 1J5OL 3U1QA 2O5XL 3KLSA 4HUMB 1P4IL 2QSCH 2AQRA 1OK0A 2ZG1A 5JIQA 1E4XH 2XWTA 3H3PL 3SDYL 2WNGA 2DQFB 3BZEA 3MXVH 1QFWM 1RJYA 2QGBA 3Q5TA 3H1ZA 1BDYA 4AVIA 3EBGA 2VITB 4UUJA 5AW2B 1AO7E 3ARBA 3JYCA 4I3RL 4JFXA 4M5ZL 2DMCA 4V2BA 4AQ8A 4PJDA 4JG0L 1DN2A 4LDOB 5ICXB 4TUJA 4N8CH 4UT9H 5BVJA 5MENB 4D2NA 1QTPA 4S1QH 3SPJA 3V0EA 4YIQA 2BIIA 4OJCA 2ZOWA 3OG6B 4UQIM 5ADOH 3CFBA 4WW2F 4LEBA 2Z8RA 3CVHH 5E8NB 1CXHA 1NGPL 3HUJF 1I31A 1SNRA 2BHUA 2OMVA 3Q0HA 1I9JH 1WIOA 1KCVL 1FH5H 3RNKA 4FYRA 4B7LA 2JLLA 1CDBA 1L3WA 4XCYB 2V8MA 1MFBH 2GJ6D 1HHGA 1IFHL 1MFAL 5FM5O 3KWUA 3EYUL 4OB5L 5GZOC 3RPIB 3LKOA 2XWBB 3BPNC 2BOLA 1QO3A 3DYPA 4Q0XL 3L13A 2J57A 1IAKA 3LSOA 1OAQL 3R4RA 4TQHA 4MWFA 4OF6A 4PJ9B 3BX7C 2ZG3A 3WENA 5DR5L 1HCVA 4UB0H 1YECH 4I48B 2CBMA 4F8OA 5TH2B 4UIMB 1TPXB 3MOAL 4AM0B 2E4TA 4G9FB 4DGIH 4FG6D 1IBZA 4OF3A 1U2CA 5FIEA 2FJHB 3HG3A 5FO9B 2YMXL 1TTFA 3BSHA 4LSVH 1SN5A 3RA7H 1PSKL 1CICA 1A7PH 4LOEA 1S8DB 3F7VB 2JF1A 4QJ3B 1AQKL 3KAAA 5I26A 5GGTL 3U1SL 3GMNA 1LXMA 3CHQA 1A1MA 4FZEL 3MDJA 2R56H 3OR6A 5IHUL 2IDTA 2D31A 4L3EB 4Z7VB 4H8WC 3S5LG 3OG4B 1MFUA 4PS4L 5T1MB 4IDLA 2A6DB 4PRBB 3QUYC 2ZWZA 1BREA 3O2VL 4I0PB 3TIDA 2DEXX 4FTVE 3ZDXB 4E5XA 3T3MF 4GQPH 2E9GA 4OLWL 4XAWH 3R8QA 3VNYA 1A4KB 2R83A 5T1KA 3TBBA 4IRSD 3HG1A 3B7YA 3U7YL 2X28A 3KPNA 3O6LL 5FHAH 4Y9EA 2VO5A 3ETSA 1CZ8H 2F8OA 1EANA 5MEPB 3BAWA 3FRUB 4E9XA 3HC3H 4CVZB 2OR9L 1MEXH 1YZZA 4I8DA 2YR3A 2HRGA 3BAKA 3SCMD 3TVMD 4KO7A 2WANA 5E00B 3SCMA 4QAMB 1KIQB 5FWRA 5HGAA 2Z4QA 3QJSB 4Q74A 1S2EA 3WFBH 3TEXA 3WMQA 1I1AB 4ES9A 4XMTA 2C1OB 5F72S 1JS4A 3QJUB 5KS9E 4X83A 3AG2B 5B38G 4KX8A 2LT9A 4LNRA 3IXTB 2VDRH 4MSWA 4F7PB 4PV8B 4PJFE 1KY7A 4M56A 3QO0A 4JKPL 3UO1L 5KTEL 1A9BA 4NN6C 2FBRA 5EIIG 2GAZB 4H2CA 4NRZB 1HDMB 5SWSD 3RWHB 4ABVA 4ANWA 2I69A 2OJEB 4HUWA 5CEZD 4DUXA 5KYUB 3DJRA 3QISA 4ONHA 4KKCD 1NGWA 2YFNA 2LGNA 5CR1A 1UVQA 1HKLH 3Q2CA 4ILDA 4MA1C 5EBMA 1GZQA 4GEJA 4RMBA 4LSSL 1RUAL 1FC2D 5FECA 4IBLT 4XI5D 3MRCB 4IMKA 4LSDA 4OF8A 4PG2A 2QPDB 1RLWA 2V2TA 3NJNA 4Q7DA 3VACA 2NY4D 3OKDB 2VLKE 3GEWB 3T65A 1G7LB 1NFKA 1I9IL 3B9EA 3LQAH 1JZ3A 4U4BA 5KVGH 5D7SL 1I4FA 1KTJA 3FT2A 1T0PB 1U8LA 3LH8A 3P2BA 3R1GL 1TZAA 3FHQA 5AFAA 1G0YR 3SPVB 3QEQE 2YRPA 2BIOA 3VXRE 3F00A 1MCKA 3PXJA 2Z0UA 4LHJB 5BW7A 2OJ1A 1L5GB 4DETA 4NC1E 5ID1B 3C87A 4QXUL 4YX2L 1MIMH 1VIWA 3IDMB 3CDZB 3TP4A 1NGZB 1FVDB 3L5WB 2DQTH 3T6WA 1H9DA 1YNTA 4NZRH 2R2HB 3V0VA 1QFPA 3QJTB 4DWHA 5MEQB 3ZZ1A 5DJ0B 2PP9A 2C9PA 2YGPA 3V8OA 3TESA 3VH8G 2OYPA 4M48H 1HE7A 1L9SA 1UB5A 1R33A 3L4WA 3TBWB 2XG4A 3TLRA 3GKWH 5LG6A 3KPTA 3MNZB 4OFYA 4Z7UA 4GEIA 3F04A 4NKMA 2Y6SD 4S0HA 3OMAB 3AG4B 3TO4D 1XGZA 4EN3A 3EGXB 1YMHA 5DRNA 5DD6A 4ZFQA 2PLTA 3L3KB 4W9HC 4OZGA 1UG9A 2AK1L 3WTWA 4K23H 4XWGL 4PEEA 2BWQA 3ULVF 4XX5A 1FL3B 5DQ9A 1AQHA 2EUZA 2DYPB 4NWTH 2Z31D 3RRQA 2JCCE 2D7QA 2VZTA 1JWUA 5HVHB 3T8VA 1EDHA 4XNMB 4H25B 2RD0A 1VERA 2CPUA 3DK2A 1TO5A 3ZRSA 1FZKA 2P1YA 3FAXA 3RQ3A 4OTXL 2VR9A 1JRHL 1M1SA 3U4AA 1E3FA 3VI3E 2DTMH 1ZSHA 4XMKL 1OP5K 1NA8A 4IRSC 4CADA 1XTLA 3OJDB 5I5JA 1ROCA 4UDTB 4QAWA 4I1NB 1J8HA 2KL6A 4HIIB 3UTTA 3SDAB 2BP0A 3U7AA 3DECA 4P04A 3GSOB 4ZW8A 1J8SA 4R0LB 5ISZD 3NP3A 5J12C 5ISZA 2QQKL 2IGLA 4X50A 3TVMC 1CFQA 1DDTA 4GKZA 5CFAA 2YQ2A 4CRPA 4HWEH 3PGCA 1YRKA 1P9MC 1B4RA 4OAWB 1HL8A 4AGLA 4ZW6A 3H4FA 1JZFA 3NJHA 1D5IL 1G6RH 1UC6A 3FUIA 4TYUA 5AW1B 3NAAL 3F65A 5C09D 3S5YA 1NEUA 1XZ0B 1XCTB 1F4WH 1SRDA 3GIVA 4WO4B 4ZYKB 5C09A 2APSA 4AK2A 2H3KA 3VFWB 3IPFA 2V9TA 4UBDD 1VZHA 3BZ4A 4LVNC 3SKNB 3L16A 2AI0H 2ZUYA 5IUCA 4AKQA 5KYXB 1C8PA 2GEEA 1U2HA 1ZT7A 3PABB 1LEKB 1NL0H 5GRUH 3W38A 4JM2D 2NW3A 4Z7NE 5BS0E 3IVKB 3POHA 3UJIL 4A1IA 3LRHA 2PTUA 4JO4H 1FNFA 3CLFH 4KKCC 1ACXA 4XZUB 3VXTA 2DB8A 3HMWL 3QZWG 3D3VE 4HS6B 3OKLA 4YDJB 3T4AC 3WE1A 1RZJH 1LE9B 3L5JA 4FEIA 4QT5A 5AL8A 4UQ3A 1PAMA 4CN1A 1G7IA 3KGUA 2PWHA 1PU0A 3MRKB 4WGVB 3MHZA 5EIVA 4IMKC 4XI5C 2GIXA 2QZ5A 1CL7L 2VLRD 2CUAA 3G6AB 4YAQB 2C7FA 2NY4C 3BVUA 3AQDA 3FO9A 5FFOA 4OZIF 1UT2A 1FCGA 3SDYH 2BMKA 1XT5A 3NZ8B 1NCWL 3VXMB 4HXBL 5FO8A 4KO9A 1KTBA 1B6UA 1KELL 2OMWB 1BAFL 1OCCB 3LZRA 3GI9H 3QDJB 4WEEA 1QI4A 4I3RH 3BSZA 4M5ZH 4FYTA 4W4NA 4D9LL 1FQ9C 4PV1C 1K2DA 1T7XA 4JG0H 3IJ8A 3CIAA 1GGTA 1A6TB 2YPLD 2HFFA 4NPYA 3KYMB 5EOCL 4AMWA 2PMZA 4PRNB 2BP8B 1C5BL 2HFTA 1NGPH 5F0PB 1UD5A 1WCQA 4QRPB 3H6AA 3ROOA 3KYOB 5TK4A 3VCLB 4G9DA 4QY8B 1KCVH 2OSXA 5K9OA 3CZEA 4P5TB 2MNJB 3T04D 1VPOL 4N6RB 4O51A 3HBGA 5BRZE 3MGAA 5KW9L 1IFHH 1MFAH 2RJMA 4HEPG 3MJGX 3EYUH 2O5ZH 4OB5H 1I1YA 3D0VB 2O6PA 3HBQA 1FZJA 4G8EB 3QPKA 1Z0NA 3I6LE 1A7NL 1JZEA 4Q0XH 1CFNA 1KPVB 3QEGL 1OAQH 3ETBF 1MCLA 1D2PA 4R97B 4WENB 3W9DB 5EU4B 3TBCA 4JZNA 2Y6SC 3CVIL 3PWUA 1OK8A 1PYWB 3TO4C 2CK0L 3VG9C 5AW3B 2KERA 4QNPE 4K5PA 3IFPB 3ZOAA 4NN7C 2BVEA 2J25A 3BH4A 3GSXA 3G9VA 4YR6B 4DK3A 3V0DA 4G7RB 2DRUA 1EX0A 4JG9A 3UAFA 2YMXH 4XP6L 1IO4C 4L18A 3RY6A 2JNZA 3T2PA 2L7QA 1J1PH 3MLZH 2Z31C 3G5XA 5GGTH 3KH4A 5GS0D 4FZEH 1W8EA 2F1EA 3KJ4C 5JYMA 2X3BA 4LPYA 5C07E 1NDMB 1LMKA 3DDGA 3WDIA 4ELME 4DHLA 4PS4H 3SE9L 1E30A 2AQQA 4NO2B 4XRCB 4K3EL 1MJJA 2J4WL 4IDJL 2GBUA 3VWJB 3CH8A 3O2VH 2R2BA 4FQQB 2HTKD 1FNLA 4JE4B 4PRPE 5IOKA 1HWWA 2NNAA 5CR8A 5DUBB 4OLWH 4H5SB 3BUQA 4NN5B 1QZNA 3G5YA 3K80A 3VGBA 2YWZA 4FNQA 2BY1A 2QADB 3LDBB 4HUXA 4PJ5A 4V1DE 4PJAB 2W9LA 5DEGB 2QDVA 3II3A 2VZVA 2DYRB 2OR9H 3LKPA 3RWEA 5HYQB 4JMNA 1C7TA 2FUTA 3KPQB 2CGRL 1ICTA 3ISWA 3DARA 2BSDA 4HCFA 3LXCA 4CN4A 3OZKA 4QRSA 3DX6B 3LIZL 2IQAA 4RSYA 4B6ZA 1OP3K 5LBGA 4H44C 4JPQA 4XPHL 3TA3B 4HD9A 1OPGH 4JANB 1JHTB 4UBDC 3PFUA 2HX8A 5CO1A 5E6YA 3DX2A 5IM7B 3SPIA 4PJHA 2KC0A 2BERA 2MQCA 4HIHA 2PPEA 5HDWA 4JM2C 1G5GA 3MLSL 4HVBA 2FTAA 3NN8B 4DKAA 5CWSB 4JKPH 3UO1H 1AYRA 3BVXA 4BFIA 4U6XA 2FIRT 2BVYA 1AR1B 2VR7A 5JXEC 1KV7A 1LNUB 1SBSL 3V6BR 2N7BA 3UBXA 1T7VA 3ZGHA 1DO6A 2ZXDA 1ZT1B 4PJIF 2B08A 4P2QA 1A1OB 1Q0YL 3US0A 3QJFA 4LSPH 3AB0B 3MV9E 3T5WA 1WFJA 3L4ZA 4FNSA 1KXVC 3VYPA 3K4DA 4LSSH 4N20A 2H6UA 2ESVB 4QGYA 4X7EC 1AS6A 3MRNB 5DVMA 4HEMA 4GAFB 3MUZ1 4FQXB 3DVNB 1ZAGA 5KANG 4BIKA 2DQEL 1YMMD 5FA4A 2QHLA 3W82A 4KRNA 2BXYA 4GLRH 2IPUK 4Z7OF 1GR7A 2BIQA 3CQFA 3D30A 4C83A 1HFUA 1U3HB 2YEVB 1YEHH 5C97A 3S36X 5L4FA 3R1GH 2Q5BA 2X89D 3GS0A 3GGWA 1MZZA 4FNRA 5DS2A 1GS7A 2BNRA 4WRLA 5IQNA 3CCHA 2JWYA 5GGSA 1J87A 1EZUA 1N4XH 1VACB 2QQLL 4GUCA 1EHKB 3QFDA 4AKPA 3NCWA 1ZXQA 3N1PC 3WGUB 3VX0A 4QXUH 3CC5A 2OCJA 3QCTH 4WU7B 3GXDA 4MNQD 4R7DB 5DDHB 4BZ1H 2LHAA 5IWLA 3LVEA 5HJGA 4MNQA 3P73B 4NBZB 4N90E 3WXWL 1DQDL 3ME0A 12E8L 3QI9D 5JPMB 2EABA 4XBGA 5L8KB 4OIAA 2WUCL 3AM8A 2WBKA 3MBWB 4Y1SA 3PQYA 4FI8A 3N44F 1X44A 4HULB 3KM1A 4FXGA 2VISA 5L0QB 3ZDWA 3O45A 4XMLL 1CGSH 2F7QA 2Z93B 4FHKA 4Z3TA 1KWKA 4JFHD 5DEJA 3T8XB 3RY6C 3N3EA 1N19A 5B3SB 2ZXAA 1AO7A 1YC8A 2Q3AA 1BECA 4DGVH 3VU1A 3WO3B 1TG8A 1N18A 5GS0C 1S7XA 3DRTB 4PJGF 4XWGH 1INDL 4MXVE 4PJEF 5I1HH 5JPNC 2L3BA 4NKDB 2EDXA 5E8EA 5C9JB 4FJYA 4DK6A 5TTRA 5F71A 1Q94B 3K4AA 2OYKA 2G3XA 2M26A 2ICES 1A6VL 1E4XI 4BD4A 2MWCA 5GRWA 2EXSA 2HTKC 1HHKB 4L1LA 1T0OA 3ZRFC 1C12B 1JRHH 5AAWA 1Q1JH 1E27A 2KPNA 2WVVA 2WWNA 4OT1H 1TZOA 5T5FL 4L8CA 1W0VB 1NCJA 5EO1B 4LVOB 4XMKH 1IUZA 5E8OA 2BS8A 4AJWA 3N6YA 2IXQB 4AQ1C 5F9AC 3DV4A 4P59L 2DLFL 2EE0A 5DUPH 1OWWA 1E3ZA 4JZJB 4KI5F 4WI5A 2JI2A 3EDKA 2BDNH 4HWBL 2P80D 3VFGL 3G08A 1SMAA 2P80A 3PF2A 4MJ6A 4X5WB 3ARGD 3KHQA 3RDTB 3X12B 5DZAA 2H9GB 3O0RH 3PHAA 2EVIA 3V6OC 4HDIA 3MRGA 2IBBA 4KUCF 5FLUA 2ZPKL 1IE4A 3FU9A 4G71B 2DM4A 3ZTNL 2JKWA 1RULH 1YEJL 1EZSA 2XJLA 3A4AA 3MX0A 4Y7MA 3WN5B 3IDIB 3NAAH 3AS2A 1FHNA 3OGCA 4X7TB 3QDMB 4G43A 3NPZB 6PCYA 1OCZB 1PCXA 4MNGB 4EI5A 1ZDQA 5KVDL 1PQZB 2R15A 5FUOL 4E0RB 1EDQA 2A74A 3K7UA 2YUZA 3NSJA 4K71C 4YSPA 5DJ8A 4ZMZA 5I1JL 3B9KB 3VW3L 1SM3L 5LUMA 3EADA 4KKLD 1N59B 5E4AA 3X13A 4FD0A 1T0MB 4FTVA 5CHNA 4LF3A 3BPLB 3EFOB 3RJQB 4O02A 4QOKB 4UV4L 1EUUA 2MOGA 1IGIL 1JVKA 4TNVK 1JTOA 1XR8A 2IQ9L 4UV7H 5H37H 3V6FB 4H8VA 4PGDB 4W9CC 1NEPA 4HUUA 2G5BA 1THAA 2FL5B 3BZFB 1B0IA 2DN7A 4LLVB 3ML9A 1KLFB 1YUKB 4A38A 5HDOA 1OVZA 5CMAB 4JFSA 2UZIL 1KELH 2CO6B 5EO9B 3FYIB 1T1ZB 3NEEA 1U6AL 5AZUA 3MA7B 4D9LH 4RBPH 1BMZA 3ZKQD 5KS9A 2BOBB 3GMLB 3E9TA 3QORD 4JY6A 1M42A 3V0WL 4DFHA 2OS7A 1KBVA 1XWVA 3P3RA 1GHFH 4NKOB 4ZPTB 2Z35A 2ZYSA 5EOCH 2DQDL 4KXBA 5DGQA 3QUXB 1C5BH 5DGRA 3D33A 2I07B 3GLDA 2GIYA 1ONQA 4Z0XA 5I66B 5I74B 2OR7A 4M3KB 5IR1A 1WUNT 4YL9A 3SGDI 3QI9C 4BKSC 2AVFA 2QPFA 5FUCC 1VPOH 2VDMB 3RL2B 2O93L 2EDRA 3S5LB 3QBTB 1ZWIA 5ALBL 3BDYL 1FGNL 1NEZG 3L3GB 1ZIBA 4APXA 3DIDA 3P4LA 2CLZA 2IFFL 3QEGH 5FB8A 1MPAL 5IVZB 3ET9F 2VWEC 1P5VB 1U8KB 5IEKA 4ALAC 2VQTA 2YC1B 2RR3A 1DQKA 3ATBA 2ZUQC 5FYJU 3AQXA 3O9WD 3C5JB 4G9FE 4RDBA 5GRJH 3UG4A 3AT0A 4Y16A 2NYKA 5I17B 3L7FA 3STLA 3ECBA 1JPGA 1D9KB 1XMWA 3JBG7 3V79C 5DURB 1S3KL 4WCYL 3PNWB 4NQEB 4ZMVA 4GSQA 2BRRH 1IM9A 4POZD 4ZUUA 5I73B 1KBGL 2L7EA 3VXRA 4QF1A 2VZOA 1OW0A 3TO2A 2YD2A 4XAKD 3GMQB 4L3EE 2A1WL 1V27A 2IH9A 4Z7VE 3BRGC 1HU8A 3FQRA 4AIOA 4JY4A 3VJ6A 1J9SA 3L45A 5CNHA 4D9QE 3IK2A 1B4LA 2J8UB 4A6YL 4E9RA 4Z1PA 3HRZB 2DM3A 4K3EH 1WEJH 3DOSB 2QR0B 2J4WH 4IDJH 4NUPA 1DN0B 2ADFL 2I9LA 4HD5A 5JIMA 5DA4A 4P05A 4B97A 5C0EA 4HCIA 3PJSA 3O6FB 4XOBA 1CBVH 4X6EA 4DVRL 1KN4H 5L4IA 1A8ZA 1QKZL 1F5WA 2VOTA 4DFIA 1GXEA 2DLEA 3ARGC 3ZE0B 4LLUA 3DGCR 2E47A 4HZLA 4PJ6A 3H4HA 4OGAD 4POYA 2ZP0T 4J1UA 3GDCA 5AOZA 2XXCB 2AQPA 4KJYA 4HFUH 3CZUB 4X6DF 4OM0H 3EXLA 2J55A 3V8CA 1TQWA 3G7TA 1CGTA 3PJNA 2XUWA 5AZ2L 1NH6A 3QR1A 4GBXD 3CHRA 4XPHH 1ES0A 4U3XA 1E50A 4UZGA 1Z9SA 1YQVH 1EGJL 3AMKA 2E59A 4WFHE 3QAQA 1CYXA 1VGKB 1RPQA 3B6SB 4LLQA 1OZUA 4KKLC 1OAUL 8FABA 2BSRB 3MRMA 4HZ1A 5HHMB 2V2XA 2CJUL 4LIQE 4TS6A 1CLCA 3HB3B 5EBGA 2XN1A 5DLLA 4AH2B 2FECL 1U3JA 2H0PA 1KG0A 4AYGA 2Y7MA 1Q0YH 2A9BA 2H5UA 3CV5A 3HHMA 3UTQA 3IDJB 1WWWX 3VUAA 5D55A 3RTQD 3VG0H 4C58B 4NQCB 1YPZF 4DO4A 1H5BA 2E46A 3OZ9H 5HHPA 1A0QH 3TBTA 4GRWB 2C9XA 4LLWB 1MCSA 2NCEA 3QUKB 5JW4M 5CJBA 2KS0A 3I9PA 5JDJA 1KN2L 3BIAX 3OKNA 3I9AA 5I6NA 1Q9KB 3VH8B 1UZGA 4FXKB 1UKQA 1TMQA 1N70A 1NCUA 4U1MB 4QCIB 2K70A 3QORC 2JQZA 2XV0A 4N9GA 3D2UD 4LB8A 3VXUB 3HHSB 1U8OB 1I9RL 3MJ9A 4HJTA 2GVYA 1B0WA 5C3LD 2Y07L 2RB8A 4PW4A 1QSEB 1PZ5B 1MWAB 2QQLH 5LN8A 2NY7L 4IGBD 2CO7A 3TU6A 5ID0B 3QUHA 5BS0A 3ILQD 3C5ZB 5C1MB 3GXPA 1OGSA 4QRUA 3D3VA 5DD5H 3NCYP 1TTUA 4J2XA 3WXWH 1AQ8A 1DQDH 5EBLA 2VR5A 4JRXB 12E8H 1M7XA 4O02H 5C70A 1S7WA 1E65A 2SEBA 2TRYA 2JJSC 3GHBL 3IJ7A 2AP2A 4ZFFA 3ILPA 3S3SA 2WUCH 1MFVA 1PCSA 2EQDA 4KRMB 3H85A 2H4EA 3HZMA 3ZL1A 1S5IH 1AC0A 1USZA 2KLRA 3BPCA 4RISL 4APQB 3R0NA 2Q7YB 1HHJA 4W9DC 2BW4A 3B1TA 4XMLH 3PHSA 3O9WC 4JLRA 5HVFB 2B77A 4NHUA 2FX7L 3I75A 2Y7SA 2MPAL 4EQ3A 3MAWA 1VFBA 3BLBA 4UQCA 3RVTC 4ZUWB 1TQBC 1F6LL 2IMNA 1FFOB 3BP4A 4FFYA 2A9MH 4POZC 1OW0C 4XCCL 1A7QH 1OCRB 2WCSA 3P30L 1WLHA 2QGCA 4J7RA 3WKYA 4YFLI 1INDH 1NOAA 3CZNA 3OHXB 2OL3B 2Z0BA 4GXVL 3TX4A 3APNA 4I18A 3DTXB 2MKWA 3OQRA 4Y2DA 4L9DA 2HJLA 2BVOB 5LAXA 3GZQA 2WQWA 5E1IA 3O3EB 4NI6A 3EO9L 1OGAB 4QYAA 3FSZA 3B83A 3O3AB 3BEWA 4RAUA 2FLRT 4UT6A 3UZVA 1XGTA 5IVXF 3D34A 5J9PA 2WO4A 5BRZA 3KVQA 4BELD 3QVAA 1V3JA 4X5LA 4JAMA 1ZSDB 4NXSA 5FXCH 1ZS2A 3S96B 2L8AA 1FZOB 3S37X 2C4FU 4QIRA 4P59H 3ES6B 5F7EL 3IWVA 4F9LA 1KTLB 2J1KA 3DVFA 1IIKA 4OGAC 3B8YA 3AW5A 4B9IA 3CU7A 5FYJD 1KXHA 3QZWB 3QIBD 5CZRA 3RZCA 1CXLA 3TNMB 1CE6A 4U3CA 3VFGH 2DMKA 2KKQA 2E6QA 4Y19B 3TJHD 1FL6A 5AKRA 4A7TA 3GJFB 4Y5YC 4DUVA 2ZPKH 2ZIDA 1E4KC 4OZFG 4GBXC 1AH1A 3R19A 4WKZA 1JPFA 4F80A 5I6XC 3MLXL 3ARDA 4AKOA 3RBSA 2XFXB 3U6XA 4K7PY 3V7MA 4BK8A 1MCWW 3G5VA 2RQ8A 1BZQK 2AEWA 4ODXB 4FQHB 5EUOA 5C07A 5F96L 2HH0L 3U0TB 4ELMA 2ZOTA 3E8VA 4ZX5A 1TETL 4XP5L 4H13C 3HZVB 4IS6B 3H2QA 3V0GA 3R7RA 4N3UA 1SM3H 3GS4A 2YGVA 4Z78B 4PRPA 5I1IL 4YQXL 3VFSB 4UZUA 4TLKA 4NRYA 2ICCA 3RUGB 4TN9A 2GI7A 2V2WB 3MLVL 1IKNC 5HI4D 1IGIH 3RTQC 1OB1A 1H5BC 2C9RA 3UBFA 3N43F 4L1HA 3RBGA 3ZE2F 2VZ3A 5DJDB 3L1FA 2ZD0A 4V1DA 2YLHA 4QRRB 1E8YA 4C4KO 1DVXA 4M29A 5ACZB 1EEQA 4YHML 1DBJH 1OP5H 1T22B 3NCJL 2W38A 1Z2KA 1ASPA 4TL5A 4KDTA 3V0AC 1IX2A 1THCA 1EJFA 4Q6YA 4FFVD 3MLTB 4EO5A 1ASOA 3VXME 1X6LA 5MEOA 4G82A 1JXJA 2UZIH 3NZUA 3QDJE 1Y6MR 4JN1L 4R90L 1LQBC 1CDIA 1A64A 1BVKA 5C7XH 3Q8EA 4ODWA 3QCVL 4W9LC 1OGTB 4MAYD 1YN7B 5DFWH 3ZXAC 3FQXA 5C86A 4XPFH 4HWUA 4BWWA 3PWVB 4JFEB 4IGBC 4YPGA 1XB3A 1QNZL 4BEIA 2EXWD 1GGBL 2DQDH 3FUKA 3RURA 2C3VA 3ILQC 4PG9A 5LQBL 4JQVC 1JHLH 1RJZB 4K07A 1N5YH 4QRPE 1F1DA 1ED3A 3FONA 3TTSA 2I9TB 2F6AA 4ENED 1BXAA 1J9RA 4NM4L 3EUDA 3FO2B 3US9A 1UFGA 1X9LA 3TCLA 4FP8H 4JPWL 2DL9A 4XN9A 5GHWL 1MFDL 4P5MA 1BX2B 5KVFE 2OYMA 4NXKA 5ALBH 3BDYH 1FGNH 3MV9A 4FQPA 4MA3A 5SX4I 4GIPD 1LGVA 4IBTA 1T5XB 3JV4A 4W6YB 1D7FA 1M3JA 3ZZLA 3C09C 1SEQL 1LK2B 4QYOA 3A47A 3O41B 3IMBA 1OSZA 3QR0A 1R3JA 5KSVA 4XODA 1B2WH 3QUZD 4IMLB 4NC2B 3QUZA 5DS1A 4TPRL 2G9KA 1I8UA 4XVJL 3A5VA 5D1ZD 3FPXA 1BYOA 3TM6A 2WLLA 2C7UB 4K73A 1NWOA 2BZDA 5H35B 3OKMB 3REWB 1T1XB 4P46D 1KT2A 3MJ9H 2XIIA 2N01B 3MV8B 1GOHA 4P46A 2A1WH 5I75B 3S97C 2IV8A 3FUMA 1F2XK 2A4ZA 1JN6A 2CRYA 2QSQA 5LGYA 3ZVVA 1EAQA 5H94B 3UPAA 1MW0A 3RWDB 3T1FA 2BOCA 4CC0A 4NENB 4DP5X 5HDBB 3ZUCA 2VQ1B 1FVEB 1MNUL 1NBYA 1O6TA 4QRQB 3MN8A 3QIBC 1YJDL 1JF5A 4L9LC 1QKZH 3TJHC 3HPLB 4PJAE 4L4TD 1M6OB 3VFRB 3KJ6H 1KIUA 3FO0H 1A65A 1VSCA 4X5RA 5EEYA 4GMSL 4G59C 4M93C 4DNLA 1ZA6B 5AZ2H 4M61B 4YLQT 4DCQA 4FFYH 3OXRA 4TOYH 5EIQA 3ALPA 4ISVA 1RK0A 3HJEA 4ORGA 4J3XA 4Y4HB 1X5YA 1A7OH 2MTAA 1FFPA 3UOAB 4PIRF 4HPHA 2P46B 2YEQA 1A4JB 1FNGA 3GK8L 4YSUA 4HCGA 2OTUB 2WV3A 3K6FA 1A6PA 4GXFA 4UT6H 3S98A 2WCPA 4U6VL 1SJMA 2JIXB 5HI4C 1A6ZB 2GBVA 1NGXB 3LZLA 4YMPA 2FT7A 2X41A 3AC0A 4Y1AD 5LGKA 4F33B 4XC3L 3H56A 5D5MB 4YWGH 1G1YA 4Y1AA 1G7JA 2BRQA 3IKKA 1PAZA 3KCPA 4WTQA 1CFMA 4ZXBD 1LP9B 3ECQA 4J28A 4K5OA 4OLUH 1TR7A 2ESVE 1RAMA 2F0CA 2AQ1A 4FFVC 4AIEA 4X7DC 2AJVL 4TQIA 2EIBA 3A67L 3QQXA 1IFGA 4Q6IA 1P4LA 5D7JA 1I7ZB 5E94A 3DTDA 2OBGA 4OD2B 2ZXQA 1KPUB 4MAYC 1AY1L 5HHOB 3GSRA 1JK9A 1HQRA 2DIAA 3FRPA 5MERA 2EXWC 2PPAA 1HSBA 1I9RH 4LPXA 1WGOA 3KWXA 1EMTH 1BOYA 1QA9B 2CHNA 4WW2C 1ETA1 2Y07H 1QP1A 1DVFD 2NNFA 4F58H 3DV6A 2EYTA 1WJ3A 5I18L 4ENEC 5DZJA 1Z9MA 2NY7H 4IQHA 3MJ8B 4G42A 4PTUB 3SYPA 3U0WL 2YAQA 4MD0A 5IG7B 3T0AA 4QHNB 4GW1A 3QHFH 4JB9L 1JUFA 4ELKB 3W1ZA 3JV0A 1KXTB 2P8PA 3PWLA 3W5MA 4NIKB 2XI9A 4S2SA 5DHVB 4JUTA 3GMRB 3U30C 3MNDA 4G8GD 5EEZA 3RWGA 1JZJA 1XR9B 3FU0A 4PJCF 3SO5A 4EIZC 1BZ9A 5D7KE 3RVUD 5BXFB 4HH8A 4RISH 4KFMA 5HPMA 3QUZC 4ADJA 2XNAB 1ACCA 2X4UA 5CGTA 1GYUA 2QVIA 2FX7H 1IBHA 5D1ZC 2DYSB 5I15H 4YHIB 2VITA 2YKKA 3EGDB 1JG9A 2ZTBA 4YBHA 5CBEB 3WHXB 1A1NA 1IQDA 3P30H 5ICXA 3E80A 3K8KA 4HMEA 4Q14A 4P46C 1S7QB 2BIHA 2QPSA 3X1NA 5IW6B 2YSTA 3ARED 3ULVD 1JFQL 4GUPB 2F53B 4H0LC 3L1EA 1HQ4A 2VLJD 5E8NA 3EO9H 5K69A 1BQUA 2VLJA 2PPFA 2VE6B 3PP4H 2NX5D 2GTWB 3WNPA 3HLAB 2BK8A 4KPHH 3QQNA 4M1CD 2FUQA 4LIQL 1KB9J 1S9YA 4RMVA 4AZ8A 2ROXA 4XCYA 4P48A 4DKDC 3ZHDA 1YN6B 4IBVA 1PG7X 3SSGA 4G8IB 2XWBA 3WOVA 2AS5M 3UMNA 5K9KB 3OLGA 2PXYB 3GBDA 3BUIA 4GAYB 3F3HA 4U6TA 4LGPB 3WUZA 2VSMB 4HBQA 1UCBL 1CPUA 4RRPG 2OP4L 4PJ9A 5F9DC 4YX2H 4K3GA 1BM3L 2AXWA 2BLFA 5I5RA 4NUJA 4G7QB 4DZBB 4UIMA 3QEHA 3UL4A 3FCBA 4AM0A 1TVBB 4XNAA 1BXUA 4G9FA 4IBSA 1WFTA 4CBZA 5CN3A 1ECZA 2XZAH 4XPGL 3H2PA 2FJHA 5FO9A 5CCJA 3S4SA 3UBXI 4MJJA 3WEBA 4BJLA 2LE9A 5F7DB 2J44A 3MO1A 2IG2L 1S8DA 2Y2YA 3MLXH 3WLWD 3DURB 3MA9L 3T08A 1L0PA 1Y6NR 1V3LA 3QDME 3LN4A 1D6EB 1QMUA 3PAZA 4HK0B 4MCMA 4MNGE 4L3EA 4RFNB 4IOIB 5B3JF 5E2WL 4UAOB 3EGSB 2QHRL 4Z7VA 5F96H 1W72B 1MRCL 2HH0H 2YD5A 4G6JH 3UAAA 2A6DA 4EEEA 1ZPUA 4PRBA 3F6JA 4HJGB 3QS3A 4HISA 4GNKB 1E9PB 2OMTA 4OGXL 2ZXCA 5IBTL 1SXBA 1UEYA 5I1IH 4YQXH 4CC4A 5D1XC 4GSRA 4QOKE 2Q3ZA 2DIEA 2DMBA 4E9WA 3MLVH 5TE6L 4ZXBC 5J11C 3KW8A 4M6OH 1L9QA 2IOMA 1NKRA 3BD4A 4F37F 4NFBA 1ET7A 1KZYA 2ZOKA 4ES8A 5MEPA 4A7SA 5T3ZE 3FT3B 4FNUA 4YHMH 4CVZA 5C0AD 3NCJH 3R4DA 1O5DT 1NEZB 2E9BA 3LQAC 1TU2A 3VD0A 4F2FA 5DZPA 4CNIB 1YNKH 2XETA 2XN9D 5E00A 4OZIA 1GKOA 2Y72A 4JRFA 1WSST 4P9ML 2UYLA 5CS7A 1I1AA 2CRMA 2IAMB 3B56A 2C1OA 2UVEA 3F05A 3QCVH 2J21A 1W8NA 5ENWB 4LOVA 2D9QB 1JGUL 3FOLB 1DVFC 3CPLA 1V3MA 4F92B 3ZHKA 5E2UL 1Y07A 2AKRB 2LVEA 1K4CB 3IPEA 4F7PA 2VRAA 1HILB 2VERA 2ZAHA 3ZJAA 1W91A 3PHOB 1JNLH 4LDLB 2VKXA 4WI0A 3LHAA 1BD2B 4H8PA 2GAZA 3BIKB 4LBAA 2OYLA 4NRZA 4PFEA 3GBML 5I71C 4FI7A 3IXAA 4JPWH 1UWEL 1WCBB 1AGEB 1F1AA 5KYUA 3GINA 5AZEH 4HHAB 5A6IA 3MBEB 3W3BA 2KQMA 3LZQA 3RVUC 3V5KB 3KLHD 4WHYG 3DGGB 4G7SB 4ZZFA 1KC5L 1R0AL 4FG4A 2X9XA 3O2DL 3N40P 4R3SB 2QVFB 2H1XA 1QYGL 1SEQH 2EXYD 1OCWL 5DHEA 3WD5H 4H88H 4TL4A 1P7QB 2IWFA 4GRLB 5GGUA 3OKDA 2ZF9A 3KR3L 1I85C 4QHUA 1G7LA 5JLZA 5FYKU 3WKML 4MTMA 4TPRH 1ADQL 4KVCL 4HCRA 4XVJH 3UPCA 1E9QA 2YK1L 1BJ1H 3AREC 4PJ8D 4NQEE 3B7TA 2XWRA 4CMHB 1TZIB 1LL1A 4RIRA 5DD1L 5CZVH 4PJ8A 4M8QB 3B2UD 5AALA 2OA9A 2YA0A 2QLVB 4BSJA 3EJSA 2MTPA 3LKSA 1L5GA 4RGMB 4MS6A 5IB3B 1AGFB 1BFTA 1IC5L 1T2QH 5LXGH 4M1CC 4G8AC 4Q4EA 3TT3H 4ZX4A 5EZIH 3ZYOA 5ID1A 3GSNB 2D73A 3IDMA 1OQXA 2J8UE 3CDZA 1NGZA 1DVUA 4OCLC 3L5WA 4LNVA 1S7VB 2PYED 2AV1A 3NSDA 4XB8A 3WE6B 4RA0C 1W16A 2J1ZA 3HW7A 4X5PA 1FSKB 3C60B 5KBLA 2F5AH 5CILL 5DJ0A 1U8HB 4JHUA 1LEIB 2EKSA 2BPBA 1MNUH 3BFOA 2X1OA 4YBQD 2D03L 4U1KB 1YJDH 3EH3B 5AUMB 2CXKA 2Q2LA 3TBWA 1JBJA 3ZE0E 1LEGB 5EBWA 4GS7B 3TBYA 3MNZA 1P1VA 1PLGL 3HMXA 3LZNA 4GQ9H 3TF7C 1QASA 3EGXA 1SN2A 2MQ3A 2IJ0C 1MG3C 5I16B 3WLWC 4ZMOA 3L3KA 4FE9A 2Y1ZA 4I2XB 2APXA 5GGSY 3S3PA 4DZ8B 3QIWB 4G1EA 1X3DA 1ZEAL 4K8RH 1FL3A 1PFCA 1ZVNA 1RSFA 2I32A 2AXJA 3SPCA 2DYPA 1PZ2A 1H0DB 3SQOH 2EZ0D 1QX1A 4AX3A 1RZ7L 4P2OD 4XNMA 2B7DT 4NQXB 2QDWA 4XNQB 1QPXA 2ZOOA 4UTCA 4J8RB 2VW4A 4YXHL 4RLDA 4JFOB 5HHME 2R29A 2Y0SA 4FI6A 4WSGA 4IK7A 3OVUB 1RHHA 4IKNA 3AQYA 4U6VH 3SQRA 1R1CA 2ZOLA 5I8OL 1EJOH 3EYOA 3OJDA 4YK4B 4XC3H 4KK8D 4UDTA 4N2IA 4ZUTB 4JKKA 3MJWA 4Z3GA 4HIIA 1XBRA 3SDAA 1T4KA 1COBA 2C5DC 5EZPA 1HWHB 4MRBA 4Y8AA 3GSOA 5F7WC 5GGVL 3FXIC 3MRRA 4NQCE 4R0LA 4Y2NA 4G70B 1FIEA 5DK0B 5K9QG 1MJ7L 4Z8FH 1RK1A 2F18A 5CEYB 3A6CL 4MDIB 5JXAL 1PG7L 3C8DA 4GRWE 3DMMC 3B43A 1YEEH 2X1XR 1SVCP 2ZP9A 1VEOA 2Q9OA 1QFWH 4NIYE 4OUUB 4QHKJ 3DLQR 2X6VA 5FFGA 1ZTMA 2LU5A 4OAWA 1YY8A 4YC2B 3EDJA 1CQYA 1MREL 5HGBB 3WJLA 2XXGA 1AY1H 3VFVB 1GZHA 5EU6B 1NM9A 2FYVA 4HA1A 1XZ0A 2V7HB 1Y18B 3JTSB 4WO4A 1U3ZA 2OJZL 3VXUE 4ZYKA 3SB3A 4PJXB 2QGEA 3VFWA 5JOPD 1JCVA 2ENQA 1U93B 2BS9A 5KYXA 5IHZB 1UGKA 3QQ3B 1K72A 1QSEE 3T2LA 4W68A 3EBHA 1LEKA 2CKNA 4GI6A 3IVKA 4EZKA 2JMRA 1EFQA 2XTJB 3U0WH 2MRYA 3EJQA 3HS8A 4XZUA 2F8IA 4PI2A 1D5ZA 2GK0B 5G55A 3D8MA 3RHWF 2IDUA 4IJ3B 3FUJA 4JB9H 4LARH 4YDJA 2IPTL 2PWDA 3EBIA 3KLHC 4OJEH 1R17A 4JRXE 4NOBA 4LKCB 3SKOB 3STZB 1U0QA 2TAAA 3MRKA 1A22B 5TQ0L 1OCOB 5F9JB 2EXYC 4DKTA 3FHAA 2R4RL 3HCVB 3G6AA 4YAQA 4Y4KD 4ZFOA 1SF5A 2W9DH 3O0LA 1ZT4A 4Y4KA 4UI2A 3PUCA 2FJFB 1IGML 3IRCA 2A6JB 4I3GA 3SIKA 4K3DL 2HAZA 2NRDA 1OF2B 4X4ME 1VGEL 3QHZL 3RX5A 3QDJA 1G9NL 35C8H 4PJ8C 4OM1L 1ADWA 3FQNB 4X4KA 1OOWA 5E1QA 1CFSB 2KI6A 1JYWA 3B2UC 1AFVH 3LS5H 4JFFB 5I8KH 3N41F 4MJIB 4TLUA 1LQSR 5GRVL 3H9HB 4HJ1A 1A6TA 4B60A 4FHBD 3KL3A 3CSYA 3IMSA 3LZFH 1J0ZA 4PJEA 3BH8A 4DAGL 4LQFL 5E2TH 4HJEA 1OGAE 2WKOF 4QRPA 1XGPB 3KYOA 4WTZG 4HS3B 4C55A 3A4FA 2OI9B 4QY8A 4R5VA 2WP3O 4W70A 4P5TA 4BH8A 3RNQB 4LIQH 4N6RA 1NFIB 3LD8C 3ZKMD 9PCYA 3FTVA 2CHXA 4K5LA 4OZHB 4MYWB 4JZOB 5HDQL 4N87A 5D71L 2O61A 2I7OA 1NAMB 1WBXB 2JKJA 4WWOA 4YBQC 3BH9B 3UXFA 3HZKB 4URKA 3B7SA 3ARUA 5DK2B 1KPVA 3W9DA 4KJWD 5EU4A 1KGUA 1X7QB 2QKIA 3O3DB 4KI5D 4Z7WB 3Q01A 5BMFL 5F3HA 2P48B 4I5BA 3HC0B 3WGVB 1M7DB 4U1HB 1MCOL 3HAEG 4GOSA 4I0CC 4Y19E 5FYKD 3I3BA 4H1LG 4NQDD 4YR6A 3X3GL 4XPGH 3TJEL 4KUCD 4ZK8A 3VVWA 1OHZA 5E4EC 3K91A 1XFPA 2EIZA 1HHIA 2IG2H 3KBPA 3MA9H 2EZ0C 3FN3A 4P2OC 4BFKA 2FWOB 3D08A 3NCCB 5DK3A 1ITCA 3K72B 3K0YA 1RUMH 1NDMA 2FWLB 2ZKYA 2V5SA 3F7QA 2ZYRA 5KVEE 1V54B 3H55A 4F1ZA 4E41B 4XRCA 4YO0B 4ZT1A 4H8HA 2YD7A 5E8PB 4NUQA 3O8XB 4FTDA 3WEXB 2UZPA 4KK8C 2OW6A 3RUGE 2IIJA 5DUBA 4H5SA 3OAYK 4NO5B 3L2MA 5D2LB 3BAJA 2CSPA 1X4XA 4UINL 4ZFZB 3GJFK 3O4OC 3QJHB 1RP9A 2J1XA 1QTYT 4HIQA 3ZL4H 4WU5A 5DEGA 4QRRE 4Z18A 2O5NA 4RA3A 2NY1D 3KWWB 4JNXA 1JYVA 5HYQA 5BO0D 4HKXA 1VA9A 1YO4A 3HMXH 1FORH 3KPQA 5L2KB 3RFZB 1GZHC 2W9EH 1QRNB 5ITBH 2AMUA 1A5FH 5JHBA 3DX4A 3VMPA 5AW4B 1MQKL 2NNXA 3DX6A 1U8PB 1SJHB 4OLXH 2WLYA 4P9MH 3GSVA 3G6JB 3HBPA 4GMTL 4JANA 1OARH 1LO3H 3BAYA 5IM7A 4L8BB 1NLDL 4K94L 4UYPA 3NCYS 5KJ7E 4JHBA 4JFEE 1SOSA 4UQ2B 1OKEA 4PS8A 1HINL 5FKPB 4LHUD 1E0OB 1NAKL 5AVZB 4QHMB 2DI7A 4MDJA 3IMWA 3KWVA 4FLRA 4NC0B 1BQHG 3NFNB 2V17H 1UWEH 4BFJA 4YFEA 4NQVB 5DEZA 1A1OA 3GRWL 2DH3A 4AT6B 1AG6A 1EAPB 1ZY9A 1SLWA 4U2YA 4Y4KC 3MYJB 1KC5H 1R0AH 2ESVA 3O2DH 1OP4A 4LKXA 3V9CA 1QYGH 2DDQH 4FQXA 4ODVH 3K6DA 4J4PD 2DKMA 3D87B 3LRLA 1R3IL 2NUTB 2OQJA 2X4OB 3KR3H 3W39B 1Y1DA 3FAWA 3IPBA 1NCHA 4L8DB 1SOQA 3WKMH 3BYTA 4MFHA 4KVCH 3DYOA 3X3FH 5F1NA 3BC9A 3IFNH 5HP5A 4X4XB 2F5BL 4HW6A 5JYLA 1KJ2L 2NY0D 3MUHL 4HQQL 2KHAA 3T0VA 4BWUA 1HSAB 4FMFA 4PI0A 3PY9A 1VACA 3MV8E 1ZLWH 4TSBH 3WNMA 2DQGL 3QWQB 3UG3A 2IH3B 2C3GA 5H2BA 2WUBH 4WU7A 3ZKMC 4R7DA 5DDHA 1Y0LB 1IAMA 2A4CA 4FS0A 4ZMLA 3P73A 2IH1B 1XAUA 3F2LA 2OMYB 4Z3IA 1RZKL 5JPMA 2CO4A 5HDBE 1TMCB 2UZYA 5IT2H 4KJWC 5IJKC 2I7SA 4G5ZL 2R69A 4AG4H 3MBWA 3AU0A 4KI5C 2V9RA 4U1GC 4FAAB 5HHNA 2D9CA 1RFDL 4NZFA 3BPNB 3NDZE 1A66A 4BK5A 1F3DJ 2BIMA 1WS8A 1PLGH 1ZHNB 4HF5L 5DC4B 4G83A 1NBZB 3T8XA 3X11A 1CE1L 2WLJA 4MJ5B 2ROYA 4X6DA 1EJ8A 3VXSD 5EO0B 3VM5A 3VI4F 3IJEB 2J88L 3GF8A 3HZYB 2JQMA 5E70A 2NT1A 4A63A 2IC2A 3CFKB 1KJMB 1T04B 1A4BA 1KTDB 2GB2A 1RSYA 3TGXA 2YZ1A 1MH5B 2JQAA 3SE8L 1UM4L 2CO3A 2R1WB 1Q94A 4OU3A 4B9JA 1RZ7H 1UM5L 3TZVB 2Q7NA 4RFOL 1WA0X 1M9SA 1ZTXE 2WWOA 4YLCA 1HHKA 3EUUA 4YXHH 3LOWA 2HJKB 4B41A 1C12A 1QHQA 5C0FB 1FV1A 3BWUF 4HWZA 5HYJE 1E5AA 1W0VA 1LVEA 1M3IA 4JM0A 5I8OH 2G3MA 3NJKA 3KHOA 5D5ME 1MUJB 3QUYB 1JZ4A 1RJLB 4DEPC 2BNQD 1JZHA 4JZJA 1E8WA 4TVUA 1PS3A 1LP9E 2NY1C 1WO2A 1LWJA 1RUKH 3CFJB 4HUCA 1UENA 5C0ND 5D7LD 5GGVH 4QXVA 4GQZA 1F4XL 1PJ9A 1MJ7H 2WN3A 2C3WA 3JWOH 2P52A 4X5WA 1H9VA 3A6CH 3MR9B 3X12A 5JXAH 5A40E 1INEL 1M2OA 5AB0A 5TE4H 3QUMB 2MCMA 1G7PA 1CG9B 3IWUA 4RRPM 2ZXBA 3WO4C 3CZGA 4KKNA 4WFED 3FT4B 5HHOE 2JKXA 3QAZC 5I1GL 5J1AB 4NZJA 3WN5A 3VRLF 1T03L 2F7RA 4X7TA 3QDMA 1WFUA 4X0KB 1GPOL 1JK8A 2OJZH 2YS4A 3K81A 1AZCA 4A1RA 1O7DC 1MVUB 5I5IA 1PQZA 5FGRA 1U8JB 1QBMH 5I23A 4Y2LA 3B9KA 3UTZB 5KJRH 1BW8A 2AK4B 4PJ7F 3P0YH 1KENH 2UY6B 1MJUH 2WXGA 4W9KC 5HHXL 3WY4A 4HU8A 1SDDB 4QOKA 4YHOH 5LCVL 5D1ZI 3ZO0A 3CSFA 4NN6B 3UYRL 2CCVA 3H9SD 1BLIA 3VFMB 5DVOA 4R7NA 7FABH 3H9SA 5TQ0H 4X6CB 5FUZL 4GP8B 1QAWA 4Y89A 5INCA 4J4PC 4YBLC 3AY4A 1F1GA 3RYMA 4MA1B 1IGMH 2QQQA 4LLVA 4OV6F 5EF1A 2XWTB 2GJZB 3EJZD 3BZEB 1F11B 1GKEA 1KLFA 2VSKB 1NCTA 3ARFD 2A6IA 3L7EA 1QABA 2CO6A 2Z91A 4FKKA 3W0WD 2NY0C 3FTZA 4OM1H 4MA7H 1T1ZA 4UUJB 5EO9A 1NCGA 3MA7A 4HAGA 2JB6B 3ARBB 1RZIB 2XWJB 1LO4L 2BOBA 4TUJB 1NC2D 3OMNB 4NKOA 4ZPTA 2IDQA 4XN8A 1NC2A 2F53E 4DAGH 3MROB 3CFBB 3BUBA 2I07A 2BJML 5C0GA 5HYIA 2JSFA 1VB9A 2ZP8A 4L2YA 1DSFL 3ESOA 4Z7QB 5I66A 1P69B 1K6QH 1Q9LA 2C9UA 2G5RA 1NIFA 1X5FA 2FEJA 3T0DA 1T2XA 2BHFA 5IVXA 1FNAA 3ABLB 4UANA 3S5LA 1HHGB 5HDQH 5D71H 2PPCA 2VXSL 3L3GA 2GJ6B 4XT1C 2ICWJ 3IDGB 4KZ0A 5B8CC 4BK5C 1ANUA 2WKLA 5AENA 3WELA 1IAKB 3LSOB 4WGKA 4Q9RH 1P5VA 2R7EB 3BKCH 5BMFH 2P7TB 4OIIL 5EPMA 3VTTA 1AZVA 2A9DA 1AZZC 4R6UA 3X2QB 1CIUA 2OKMA 5I17A 3X3GH 1VDGA 1GC1H 1D9KA 4H8UA 2QVTA 2VN6A 5CJXC 5FW8A 3VD7A 4TMPA 5EWIH 3PNWA 3LV3A 4NBXB 4NQEA 4IOSD 4RMRA 5E9DD 4GINA 3NSCA 3Q6FB 3BAXA 1JSYA 5E9DA 2NXYD 1AZBA 3GMNB 5BO1L 4FMKA 2XQBL 2CIKB 1SFDA 3L3OA 3OR6B 3GMQA 3MUY1 1MXGA 5A2JH 5A2CA 3STBA 1MWAL 2ZKHH 3L54A 3RVTD 2J8UA 4UT7L 1AAJA 1O9WA 2QR0A 3DOSA 5E99L 5B38A 1DN0A 2H6PB 2H0FA 2WPGA 1T89C 3HE7C 2FE0A 3BP6A 1G94A 3TIDB 4E5XB 2PO6D 2EC9T 3KYKL 3O6FA 4PVBA 5C0NC 4OFQA 5A2LH 3RFRA 5EIIA 4LCWD 1EFXD 2E7LC 4UINH 1UH2A 3KPNB 4LCWA 4IRSB 2F1AA 1NBVL 4E9YA 1OAXL 2MJWA 1V5JA 3OX8B 3MV7D 3VGEA 2DY2A 1LDPH 2OK0L 4O4YL 1S7TB 3GM0A 2YBGA 3LKRB 3NJGA 3MOBH 1YC7A 3QWRA 4KQ4H 3RY5A 5J12B 1MQKH 3SCMB 3TVMB 4JFQA 1JTTA 2Z4QB 2WSKA 5TJWK 3LPOA 1O7VA 4GMTH 4M5SA 1E2ZA 3T09A 5T1JA 2OL3L 2ZUWA 2RA1A 4AUYA 5J89A 4K94H 3CFEB 3QRGL 4LNRB 1UACL 1HXKA 1HINH 4IRZL 1VJSA 5CJQL 4EOWL 2BSRA 2XRAL 3RI5F 3FFOA 3QO0B 4N28A 3V4UL 3THML 4DW2L 4F24A 1BD2E 1KB5A 4OI8A 4LVNB 1AE6L 1UHVA 1UXMA 2O6CA 3P2TA 4IKKA 3ZL2A 1FNSH 2TRHA 2DKUA 3EDDA 3QO1B 3ZQWA 4AH2A 5SWSB 4HXAL 3GRWH 4GO8A 3G5ZB 1T21B 2ZG2A 4FZ8H 3FNKA 1IBYA 2Y22A 3AROA 3A23A 1HI6B 1NKOA 1GZQB 4OLYH 3T4AB 4NQCA 4PYHA 4KRPD 5AG8A 1SXCA 2B39A 1ECYA 4GG8B 3IDXL 4IU3B 5EA0L 2IWEA 1ML0A 2PWFA 3ZKND 5FECB 5DC2A 3NESA 3EJZC 3ARFC 4WKXA 4D0BA 4AUJA 1D7DA 1R3IH 2V2TB 3VH8A 1E90A 2CBQA 3NRFA 1HT6A 3DUUA 3P3SA 3D0LB 2NY4B 3NGBC 4S0SD 4QCIA 4U1MA 3T65B 3UPRB 4GH7B 4NS0A 5F7UA 1NIBA 2VXTH 3JUZA 1E5CA 3PWNA 3FT2B 1U8QB 1J5HA 1ILSA 2F5BH 4TVSa 3WAKA 3EF4A 1KTCA 3VXUA 1U8OA 3PDDA 4HQQH 1CTOA 3QC5X 2CHWA 3ESUF 4YHKL 3GBLA 1UT1A 3B2VH 1QSEA 5I0DA 5TDNA 5C0DA 1QFWI 1U8IA 2R51A 4JM4L 5BJTB 2A0LD 2XVGA 1ACYH 4XVTL 5G4OA 4L05A 4LGSB 3BD3A 2K3HA 4MXWL 4G5ZH 5G4NA 5T3XD 4YSEA 2AF2A 4AEIH 1P7BA 1RFDH 4F1SA 4HPOL 2VDPB 4APQA 3JXAA 3F12A 2VN7A 5DWUH 5T3ZH 1QEWA 4B9GA 3HJ0A 5LXVA 3AQZA 1H8SA 2D7MA 3HN8A 2XXMB 3SOTA 1KDJA 1C16A 2H6OA 4NKMB 4X7CC 4X4MA 1CE1H 2DWEA 2PWGA 1PZSA 3VE0A 4J12A 4Q4IA 1KY6A 5IFAL 3TONA 1EO7A 1FFOA 1YMHB 5DRNB 3TO4B 2GSMB 3VG9B 5DD6B 2J88H 1TJXA 2NXYC 1B3JA 1NANH 2HT2D 4I2XE 3L3OC 4NN7B 2VXQA 4OZGB 1U30A 1YQ2A 3OHXA 1MDAA 1P84K 2WLHA 1CR9H 5A7BA 1KXQE 2FEEL 1DQML 2BVOA 3D25A 4MB1A 3PDGA 1ZRUA 4LO9A 4GY4A 4ZOCA 4P9HL 1EHXA 1UM5H 3LCYA 4RFOH 3E8UL 4YDMA 2EIJB 2YMTA 3KJ4B 2L04A 1FFTB 1NIDA 2HRHA 1TT6A 1FZKB 1MAML 2PO6C 1SY6L 1QSZA 2WIIA 1F3JB 2VDMH 3JV6B 3VXQA 2JTDA 3MNWA 1JZDC 2WLNA 4CADB 1FZOA 1UD6A 4B95C 4AMKL 1KTLA 3X1GA 2WWKO 2YXVA 1YLBB 2YO3A 3US1A 2XXFA 3QZWA 1PD6A 3KYAA 1T66D 1WAAE 1TJIL 4Y19A 5ISZB 3D51A 4FGMA 4YDLC 1CFQB 4UNIA 5ICZB 1YYLH 2J6EA 5F44A 1F97A 3PGCB 5FA3B 2P24B 3DX0A 5DVLA 4MJHA 1E5UI 4GG6B 3TH2T 1TEYA 4QD2E 5ESAB 3M6DA 5I1GH 5EU6E 3EJJX 1H8NA 2BZCA 1Z5LA 1TCMA 1GPOH 3EFFA 1U92A 4PJXE 5C09B 4ODXA 4FQHA 1D6VL 5GGQL 1KEGL 4HHGA 2ZWKA 3U0TA 1E4HA 4YSCA 4PBDA 3ZDZF 2VMDA 3BZ4B 2ZZUT 2CQVA 3LXAA 3HZVA 2XV6B 1QLRA 3VD9A 4QHPA 2J1YA 1PL3A 2BWDA 3TWCH 3QJXA 4KNSA 2W0FB 1I3RB 2E86A 4JM2B 4MA8L 3GYRA 3VFSA 2ZWYA 2UUDH 5DJYB 2JI1A 5LJYH 2ZF8A 2YGOA 3OKLB 5LCVH 1ZHKB 3HE6D 4QT5B 4KRPC 4UQ3B 1G7IB 1VRSA 1Z9LA 3ABMB 2HJFB 3QT2A 5DJDA 3ZKNC 4N1EA 1TQUA 4UTAA 5MP6L 4QRRA 4DP0X 4WFFE 4HEPA 2EEFA 4PLKD 1T22A 4WJG3 3BYYA 4JQIA 1Y7VA 2VLRB 3GO1L 4FYQA 1JPTL 3GZKA 3ARYA 4O2CA 4K2UL 1WC7A 1N7ML 2FT6A 1DCLA 2BMKB 5DJXA 4KXZH 2R59A 4MCYB 4TQEL 1D5MA 1X5HA 1FG9C 2VM9A 1PBYA 3BMWA 1K3IA 2Y1AA 4AEFA 3HOGA 1V55B 3HAEB 1OGTA 1LO4H 5D1QD 4OCXL 1J9QA 3WIHA 4H1LB 4P2RD 3PWVA 5D1QA 4JFEA 3CFTA 5HHVH 1DDHB 4EUPG 1BV8A 3R18A 2HFFB 4NPYB 5FM4A 2YPLB 4MCZB 2BJMH 2VW7A 2I9TA 4OLVL 4QKTA 4FNTA 2A0LC 5DEFB 3VYNA 3FO2A 4G9DB 2O1AA 4IW4C 3KPSD 1PX3A 1B3IA 3SGJC 1CLZL 3N43B 4O51B 5DT1L 4OZHE 2DQUH 4WWID 2R0ZL 1E8XA 1JDAA 2VXSH 3CBKB 1NCCH 1G1OA 4JE0A 4N24A 3SE4A 2FEDD 3N42F 4MHHI 3WSQH 1CFNB 1ORSA 4LCUB 3UYPA 4EBQL 4Z7WE 1UA6L 5AW8B 4E36A 4FYSA 3DUHA 2B3RA 4JZNB 2B5IC 4OIIH 2AJ3A 1L0XA 2I60L 4GRWH 3WFEH 2EO7A 3SGEH 3V0HA 2KBGA 4NQTA 2XBZA 4DESA 3EFDH 1C1EL 4PJBF 5DFAA 4K3JH 2HT2C 3F6IA 3NSFA 2CPCA 2ARJB 2CCLA 1WWCA 3D2TA 5CBAB 2IGFH 2Z8WC 4N2EA 2M8XA 4KROC 1MWOA 4RFEB 3RPKA 4CKVX 4U4IA 2O5YH 4YEEA 3G5XB 1A6AA 3REWA 4PRID 2XQBH 3M17B 1TZGL 3MV8A 4AV4A 2YD1A 4AQOA 5CM1A 3FF8A 3NH7L 1FE8L 3NA9L 1MWAH 1ZK5A 5JPNB 2GY7B 5J56B 1MOEA 3RL1A 3AZUA 3GLZA 2Y25A 3RWDA 3S36H 2GSIA 3ULUE 5D2NC 5LAPA 4ATTA 4NENA 3N2JA 1N67A 1OT2A 5ILTL 3KYKH 2VQ1A 1FVEA 1K4DB 5I5MA 1IU1A 4GT7A 4JO8A 2VT0A 3UTOA 2BSTB 4QRQA 3ABGA 5D2LE 3D0AA 1T66C 3A6BL 1BQHB 2FK9A 2VR4A 4M03A 4AQ1B 4HUXB 1KPRB 1M6OA 2R8SH 1ZLVK 3VFRA 5CP3A 4K0OA 4AY0A 3A3YB 1KGCD 3HI1B 4JFZH 5D7HA 1GVIA 4P23D 4FRWA 4N2BA 4WIQA 1HE8A 3RWEB 1G5AA 4KVNL 4P23A 4X9GA 4Y9CA 4LP8A 5L2KE 4FADA 4KXDA 1D5XA 5DUML 1GH7A 1N0LB 3C5XA 1ZA6A 4ZO7A 4CSTA 4M61A 1W15A 3QH3B 5IQLA 4Q9CA 2DBLH 4M7LH 3GMPB 2IQAB 2WYTA 3G6JE 4YPJA 1GCFA 5LNGA 4Y4HA 2YMOA 4AYID 3NT0A 2OL3H 1JIBA 3NIDF 4PJHB 3NTCL 3DVGB 2HFEB 5E7BA 4QWWD 3DO4A 4L5FE 1WD8A 5J13C 1L6PA 2FSDA 2Y7NA 4IRZH 5B7MA 4JREC 1I1FA 4KV5E 2OTUA 2ZCLH 5BVPH 5IKCA 5HYJA 4K5NA 2JIXA 4U6XB 2X6MA 3S7GA 3HE6C 1A6ZA 1NGXA 3OSVA 4K71B 2W8CA 5GSRB 3UBXB 3PS6A 4AGNA 3LB6D 2DQCL 3ECUA 4I4WB 4HXAH 2FIKA 4JJHA 1X4ZA 2VLME 3PIQA 2EEAA 1BPVA 1LP9A 3WNKA 2XWXA 3Q2NA 2FATL 4PLKC 3K74B 4HZAA 1OIOA 5L2JA 3ARXA 2J2ZB 3QG6A 3RVVD 5EA0H 4IRJD 3CC1A 3ZDYF 3FOMB 2AXGB 2AXHA 3MBXL 1QBLH 2LU4A 3ETBJ 4FKHA 4GSDL 1JI1A 1AJ7L 5FA4B 1I7ZA 1V7MH 1YMMB 3GJFH 1OAJA 1GZPA 1NCAH 3UJTL 4OD2A 3G6DL 4BXVA 1R24A 1KPUA 2BFVL 4L23A 2W80C 1YHPA 5D1QC 5HHOA 1RURL 2CKBB 3CN4A 3N50A 4N3TA 2H2PD 4KAQL 4BE5A 4GAAA 2IPKA 2YAOA 3GGWB 4AL8L 3NVQA 1ZPLA 2VN4A 4L4VD 2J1WA 3BVTA 5AVRB 1NIAA 1X5IA 2GHZA 3PWJA 4L4VA 4NUMA 5GGSB 4F7KA 2B2XH 3MJ8A 2EE6A 4PTUA 4A55A 5KVEH 2WJ7A 2HVJA 3W9EA 4BQ9A 4EDWH 2N4IA 5L4JA 3VD1A 5IG7A 4JM4H 3I85A 4LEXL 5F0LB 5DJ2B 1AD9B 4QHNA 5DJAB 1JD7A 1VCAA 4U6HB 1RXLA 4PCTA 5IZ7A 1BSIA 3N85L 4ELKA 4MNQB 2H8PA 1BXVA 1KXTA 1U33A 2FEDC 2Y7LA 3NABL 1MFEL 3I6KB 3I2CH 4NJAL 3GMRA 3T2NL 3LZOA 4PB9L 4MXWH 2NZ9D 3WTSA 3SE6A 3QI9B 1XR9A 3U82B 3C6EA 4FQIL 2E9JA 4L0ZA 5D72H 3T0ED 2NW2A 1JDCA 3EDEA 3MZTA 4FXGB 3NMEA 4HPOH 4M7JH 4B50A 4UTAH 4X9BA 2VISB 3IGAB 5I30H 2EYRB 3B8SA 1UATA 5E08L 1UOWA 3BD5A 2NY3D 3MLUH 5ALCL 4ZAKD 5AW0B 1MJ8L 5B39G 1JERA 5T1DL 4AIZB 3SHSA 2CBPA 3QCUL 1YYMH 3SY0A 2A9CA 5IFAH 4POUB 3WHXA 2ZUQB 5BRPA 1RQ5A 3W2DL 3BQUD 3QP3A 4QDGA 4AW7A 1TSHA 5MEND 1Y6KR 1FGVL 3L9BA 3GRGA 2F53A 4GUPA 2E27H 1DQLH 5E8EB 4IIQA 2NSMA 1EDYA 4L0PB 4I9WE 1CL7I 1K8IA 3D4ZA 1CDGA 3LRMA 5T1LD 1BQLL 5TFSL 1YEWA 3PAVA 3E8UH 2OMNA 2GTWA 3M46A 5F6HJ 3BHBA 3M45A 1CI5A 2HRLA 1MAMH 1YN6A 2BSED 4L8CB 4G8IA 5IREA 3I3EA 5K9KA 3NJLA 4RESB 1JAEA 2PXYA 2I25N 4F3FB 2XPYA 1VKXB 4UNVA 4RDQF 2VLLB 2WLIA 4UMSA 4CA4A 1HZHL 4N25A 4TM9A 2VN5A 2XPGA 4KITB 2CCWA 5AAMA 4P23C 1F0LA 3G08B 1TJIH 4DZBA 2F1BA 1CB4A 1IC0A 4AYBA 1YDPA 1SXNA 3P3YA 4B5EA 1UD2A 1IARB 2X2UA 3DHMA 3MRGB 3K46A 5F7DA 3BCDA 3O6MH 1WZAA 3DURA 4PH8A 4QWWC 3QULB 1GTFA 1WWBX 2XA8L 4HK0A 1D6EA 4P99A 5I28A 3D4CA 4DP8X 5CEXB 4G43B 4PRHD 1HYSD 3ABZA 2Q87A 3CXHK 1W72A 2AJZA 3HFMH 1BOGA 3LS4L 2FB4H 4JFDD 1SXZA 4ZW7A 3WLBA 2A74B 1FO0L 1HZKA 3UGUA 4HJGA 4JFDA 3GSNL 5DJ8B 3TIEB 2AK4E 1P7HL 1WTLA 3CDCA 3LB6C 1WICA 2D3VA 2VH5L 4YZWA 1FHGA 2XV3A 4KC3B 3UTSE 3U6XS 3BJLA 2Y7QB 1SYVB 3D85A 4N2NA 4KK5D 2PETA 2ATPA 1PY9A 1XR8B 3RVVC 1A14L 1GSMA 4IRJC 1CUOA 1J8RA 2WAQA 4X6CE 4PRDA 3GXFA 4WDIA 3H7LA 1J88A 1KNOA 3E2HC 3QB7C 2MCAA 3FT3A 4HUUB 4HBCL 3WCYA 5L8JB 2APVA 1NEZA 1JPTH 2WNWA 1ZLSL 4CNIA 2JELH 1N7MH 1WISA 5JIDA 3E0GA 2NY6D 3L5IA 3MRBA 4KQ0A 2H2PC 1UA3A 2IAMA 3FBQA 1VEPA 4YZFF 2HUEA 5IB5A 3BRDA 1DL7L 5ENWA 3CH1A 2DTSA 4OCXH 3T3PB 4LSRH 1F02I 1CGVA 4HOXA 3GSQB 3QORB 2AKRA 2HUHA 3U2SB 1IT9H 4WI2A 2Z35B 1HILA 4Z95H 4F7EA 1GGCH 1XH1A 1FFNB 2M1KA 2NDFA 4GKSA 4IJTA 4D8OA 4OLVH 4Z7QE 1BD2A 1ONQB 4W4OC 2QBWA 4K3HA 2WKOA 1YEGL 2NQDA 4WWNA 1NMBL 5IR1B 3CHXA 3MTRA 1WCBA 1AGEA 2CWRA 2ILLA 5JMOC 3LHPL 4HHAA 3VB8A 1PZ3A 5DT1H 3K0WA 3MBEA 1YJDC 4LSTL 2R0ZH 2VDLB 4NOFA 2GJ6E 5I6OA 3SKMB 2OCCB 3ASNB 1QI3A 3T0EC 2VB5A 2Z7UA 5JHLL 3FU7B 2CLZB 1L6XA 2A83B 1DLFL 1EHLL 4N0RA 1BZ7A 1UA6H 3OHMB 4ANXA 3KBEA 2NY3C 5IQ7L 4ZAKC 2I60H 2M83A 3FU6A 4LBEB 2DBJA 3KVDD 3EYSL 1C1EH 2ITDB 3O9WB 4Y16B 3IE4A 1P4BL 3STLB 5KEZA 3BQUC 1H3WM 3QE5A 3TBSB 3BQVA 1IJ9A 1AS7A 2BHZA 1HCFX 2VCOA 2CMRL 3FB8B 1TZIA 4IIQC 4OSUL 3DNKA 3RVWD 4M8QA 1TQBB 1IM9B 5C0RL 5HYEA 1T4WA 4N9OB 1TZGH 2F54D 1NMCB 5IB3A 1LE5A 1AGFA 3ARVA 3NH7H 1FE8H 2N3JA 3NA9H 5E5RB 1KCKA 3FQRB 1CDHA 3VJ6B 4MZ2A 5CSZA 5F21B 1X6NA 1UFUA 4LQ1A 4NGHL 4CGTA 2W95A 2I9LB 3WE6A 1F45A 2RCSL 3FFCD 5KYWB 2YIHA 5KOMC 1U8HA 2ZAGA 3K8MA 4JGJA 3PJSB 1XVSA 4KKZA 5DHVH 5AAMC 1FYHB 4X8JA 1JF1B 1DBML 4U1KA 1JYNA 4TRPH 1IB5A 5AUMA 1FUNA 1GYCA 1BF2A 3N1QC 4PW3A 4O58L 1TPXC 4LLUB 2BO0A 4DTGL 2EE3A 1HWGB 1QSFD 1KGXA 3KLQA 4XBPA 2AERT 2EDOA 2FCBA 4KVNH 3X17A 5E6RB 2LU7A 3OKYA 5DUMH 2X6AA 1D7CA 3MNVB 1QWHA 5HJBA 3GSUA 4I2XA 4DZ8A 3OMZA 3QIWA 1XF2A 5EC1B 3TN0D 5J8OA 2DEWX 4Y5YB 4OCRL 1ES0B 4YE0A 4GBXB 4X8GA 1H0DA 3FH5A 1I8AA 3NTCH 5I6XB 4NQXA 5JMRA 1AHWC