4ONGH

Fab fragment of 3d6 in complex with amyloid beta 1-40
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
210
Chain Sequence
b'EVKLVESGGGLVKPGASLKLSCAASGFTFSNYGMSWVRQNSDKRLEWVASIRSGGGRTYYSDNVKGRFTISRENAKNTLYLQMSSLKSEDTALYYCVRYDSGSSDYWGQGTTVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3D6 FAB ANTIBODY HEAVY CHAIN
publication title Crystal structure reveals conservation of amyloid-beta conformation recognized by 3D6 following humanization to bapineuzumab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 45
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2014-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ongH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ongH01
4WV1B 3G5YB 1T1ZB 1NJ9A 3CX2A 1EBAA 2D7NA 4JB9H 5E5RB 3ESVF 5B4MC 1N8ZB 4FQLH 5FB8B 5JIHA 2MNUA 5D1XB 4O9HH 4JG0H 1BLNB 2JJUA 3N1PC 1KLFA 1NUGA 3BP7B 2WIIA 5GS1A 3SDCA 2W38A 4GMSH 3VRJA 4NOFA 4UOJA 4OFKA 1HXMA 2VXUL 4OCNC 1BZQK 2VQ1A 1QSED 4NQEE 1S7VB 2VNCA 3MV7E 4P5MA 3WDJA 1B90A 5T1KA 3WO4C 1J0ZA 2A1WL 3LH2H 1MRDL 4U0RB 4LFHG 3QUZC 3TVMC 2FECI 1INQB 1CGSL 3MNVB 5BS0D 2VXUH 1MFBL 4C54A 2BHYA 4L8SC 5E6IB 4RA3A 4K8RC 1TVDA 4LASL 5JPMA 3SY0A 3A0OA 4BELD 1CGSH 3CSGA 1DDHB 5JW5B 3IRPX 5M94B 4IMKA 5HGDA 2FJGB 1PQZA 4RFOL 1CYGA 5LWYL 5J06A 5IW3A 4XZUB 3QQ4A 3QQ3B 2JLLA 1OL0A 2FIKA 3P9MB 4LLQA 5EPMB 2DLIA 4YHZL 4HEME 4HUWA 4K23H 1HH9A 4I3RL 1SMOA 4O4YL 3UDWA 1QA9A 2X09A 3FO1B 4MJ2A 3WO4B 1A6TB 2BHZA 4M7LT 2GSIA 4U05A 4D3CL 5C07B 3O41A 2X40A 2XZCL 3QUZB 4K3DL 3TVMB 4N68A 1ULVA 2EZ0C 4XBGA 1RZFL 4ODTL 4L8SB 4P2RB 2P24A 5DMIH 2NY4D 3ROLB 1VFBA 1JPTL 3VD3A 2P8PA 2YN5A 5EDXA 3NN8A 3O2WL 2LE9A 3AROA 4K3DH 1UA6H 3LKOB 4PV9A 4FFZH 4LLYA 4KUZL 2YD9A 3P0YH 3DJ9A 1RZFH 3VFVA 4ODTH 4Y2DC 3CFJB 1NCWL 1S7XA 3UTQA 5F9WB 4LLVB 4X6CB 3KPQA 4PV8A 1JPTH 4J8RB 1H3TA 3CFKA 3ZHLA 3O2WH 2V5MA 2W91A 4KUZH 3OHXA 5CGYD 3MA7B 4P46A 2N7BA 1WBZB 1AXTL 3B5HA 1NCWH 3KPLA 2FX9H 3O3DB 3ARYA 4HFUH 5LCVL 3EHBC 2UZIL 3VFNA 1I8MB 4U7MA 2P4AB 3UTSD 1QBBA 1FZMA 4UNUA 2HG5A 4F37K 2VDPH 5KSUB 3V8OA 1TZGL 1NCUA 5HJ3B 1I3VA 4XXDA 4PGEA 1VDGA 2DWDB 1EERB 2UZIH 4JRXD 4X9BA 4M6OL 1B0GB 2IH1A 2X05A 4Y2DB 3KPSA 3L95A 3HR6A 3ULUF 1Z2KA 1TCRB 5HHPB 4WHYG 3KHOA 4R4NC 2YK1H 2WBWB 5HD8D 4R4BB 4M6OH 3LN4A 1N0XL 4G7VL 4U6YB 4Y4HC 4V1DA 4X80H 5EZJA 1NEUA 3LRGA 4BQCA 4HDIB 1ZA6A 4JO4H 4Z0XB 1QLEH 3ULVC 4P3DB 3I75B 2VXVH 1MCJA 3T8XA 3L6FB 3PV6A 4IJ3C 5E99L 2RB8A 2OX5A 1N0XH 1Y18B 1ORSB 3RTQA 4BSVB 2ZSVA 4ZMAT 4ONHB 3QDJB 2C5DC 4PRHE 4PBVC 2FL5B 1MJ7H 3SKOB 3WN5C 3EYFB 1FO0A 1DQLL 3C5SA 4PLOB 4FTVD 5L6YL 1U6AL 2COQA 5CS7A 1INDH 5SX5K 1KF9B 4KK5C 1T04A 5HHMD 4ZDHA 1CI5A 3QWOB 4YR6A 3KPTA 1MCWM 4FA8A 1MLCA 5HHNB 1HQRB 3FQRA 2JJVA 1S7WB 2YBRA 2A77L 2C4FT 2HT2D 3L5IA 4JRYD 3VFGL 1JZ2A 2NX5E 1P84K 2X6MA 1J1PL 5L6YH 5C0ND 2OQJB 4LF3A 4Y5YA 3JV0A 4P2QA 5DF0A 1LP9B 1PDKA 1SJEA 4Y4HB 1F3RB 3MRHB 1D6VL 3KPMA 4K8RD 1IARB 4EKXA 5L0QC 1NMCC 3DUSA 1F4YL 4OSUL 5DWUL 3WFDL 3VFGH 4MZ2A 2OS7A 3FQTA 3FTGA 1FAIL 4Z8FL 3QP3A 4IJ3B 1X6LA 1G7PA 4I4WA 1X5LA 4W6YB 3M07A 2QSQA 1YMMA 2JB6A 3DWTA 1D6VH 2LV4A 3SN6N 4G6ML 4UZGA 2IMNA 3U9PL 4Y4KC 5CD3A 1F4YH 5DWUH 1GGTA 4KK8C 3WFDH 3WN5B 2XQBH 1NCNA 4LARL 3IGAA 1K3IA 1FAIH 4Z8FH 4G9DA 3G6AA 2BMKA 4ELMA 2RIKA 1LDSA 2FO4A 1J0JA 4OIBA 1MIMH 3ARFD 4NO3A 4HWZA 4QWWC 5T1LA 3O3AA 2UWEB 3G6DL 4JN2A 1OOAA 4ODBD 3VU2A 5CP7A 4XPBL 4TSCH 1E28B 5CAYB 2X4UB 1NQBA 3MV8E 4ZYKA 2V5YA 1NLDL 1CXIA 3G6DH 4HLZG 4ZFZB 3AS0A 3P9LB 4HKZA 1AH1A 1EVTC 3L3JB 3MV7B 5L0QB 1NMCB 3IS0X 1JWSA 2L0DA 3ZKND 1XCQA 5LJYH 2D03H 4BSWA 3LKSB 4U3CA 2Q6WB 1OWRM 1PSKL 5ADPL 5SWSA 3T0AA 4BFGA 4LKCB 3PWPD 4OF0A 1G1YA 2GITB 4N8VG 5AZEH 5ABDE 2CLVB 2ICCA 1A3LL 4U1NB 4Y4KB 3U83A 1T66C 3TJEL 4BFBD 5J89A 3AXLA 4G42A 5ADPH 4PTUB 4Z9KB 3UPRA 3VXQB 2AQ1A 1OP5H 3SGKC 4ZO8A 5AAWA 5DHXB 3MLTA 1X5HA 2EDEA 3LN5B 4O51A 3TJEH 2VDKL 1FFOB 4HUNB 4JE4B 2E9BA 4WWKD 1PYWB 3IJHB 3RDTA 3KYMB 4ELMF 3DO7B 2Q20A 1VFAB 5SWZA 1KCRL 3X3GL 4Y4FB 4N5ED 4PGDA 2PN5A 3O2VH 4U6VL 3QSKB 4DW2L 3MMEB 5DI8A 4E9LA 3DMMA 1EO8L 2A0LD 1KCRH 4NCC2 5ACZB 3X3GH 1IC4L 3U79A 4HMEA 1BIHA 3NPSC 4MDJB 4U6VH 4XNQB 2FRGP 4EBQH 2CQVA 1EV2E 4Y4HD 3CFEA 1XAUA 2EC8A 2MJWA 1EO8H 1H3WM 2Y07L 3EGSA 1IC4H 2VZUA 3HZKB 4PS4L 3ULVD 1LQSR 5HTSA 2PW2A 5FYKU 3JWDC 4RBPH 4GT7A 1EUUA 4WU5A 3I9GL 1T83C 1SHMA 3KWWB 3GSRB 5BQ7B 1PG7L 2Y07H 5DFVC 3MLUH 3ROOB 3H8NA 3VDBA 1OP3H 4PS4H 2QSVA 1FNEB 5JW4Q 2JB5H 5IW1A 5K9QI 1F2XK 3FT2A 5IVZB 3AAZB 1ZK9A 2BY1A 4YHOH 3RZWA 1YPZE 3I9GH 1FBIL 4HJGB 3T0EE 1T1WA 2BY0A 4Y88A 3L3DA 1ZHLB 2YPKA 4DKAA 4Z7NE 1W0WA 1PG7H 3GUTB 3QNYA 3QUYC 4L29B 1AQDA 4U2YA 4F9LA 1OAUL 5EBWA 2R1XB 3VFPA 3NPSB 4YHLL 1FBIH 5LGKA 4JKWA 3EO0A 2DN7A 3M17A 2BNQE 3EDEA 4NQED 3CZFB 3MV7D 2ICES 3KVQA 4Z7UB 5B8CA 4HWBA 4JHAL 3H3PL 1NFKA 1KACB 5ESVA 1KPUA 4JQIL 1R3HB 1B2WH 2OJZL 2OCFD 3CK0L 2XA8H 1A5FL 4YHLH 2RHEA 2OJEB 3F7VA 3WFCH 3GMNA 1QRKA 5GRVK 1F5WA 2VKWA 4Y4KD 2AXGA 4KMLB 4C56B 4KK8D 4JHAH 4P4RA 5HGGS 4UNTA 5F1NB 4JQIH 4QRPA 3K2MC 4ZOAA 4QOKA 2A6KB 5IQ7L 4Q2ZA 1RHHA 4MXVF 4R3SA 5L88L 3B9KC 3RWFA 1R5VB 1R5WB 1NGWA 2AJXL 3OKLA 3K4ZA 5DDHA 1QFPA 4Y5VC 1QFWM 1N26A 3QUYB 1BD2A 2FYYA 3IFOA 1PG7X 4XC1L 4HKJA 1AQKH 3MBED 1CD1A 5CLTA 5L88H 3E1F1 4NPYB 1U8OA 3WNNA 3DBXB 2AJXH 2J8UA 1RZIB 2CDGA 1B0RA 5DJYB 3C08L 4TNWK 4LNRB 3OG4B 1T1XB 4PR5B 4X98A 2NZIA 4GG8A 3HPLA 2AJUL 5J57B 4YPGA 2H26B 5EULV 1T22A 4HT1L 3TBWA 1KTRL 2FJFA 2J1KA 2DIAA 1Z0NA 3OAZH 1ES0B 3QULB 3C08H 2EDFA 1P1ZA 3V5KA 5GGUB 1HEZA 5HYJB 5SV3A 2AJUH 4KKAD 5ERWB 1FE8L 3TT1L 5D7IB 4HT1H 4LLWB 2R23A 1T3FB 3I84A 2X9XA 3B9KB 3V79C 2WSKA 1VGKB 4Y5VB 3D3VA 4GXVH 4PTTB 2YD1A 1TLKA 2CDEA 4GRMB 3TT1H 1FFNB 2NMSA 4MNQA 1OHQA 1ERNA 3C60C 3MCKA 1CL7L 1N3NB 1AD9B 1QBLL 1GHFL 1TFHA 4G5ZL 4GAGL 5EG6C 1D5MB 3MC0A 2JKXA 1KCUL 4MXQC 4ACPA 4HIHB 4CMMB 2VZ3A 4FP8L 1CL7H 2CR3A 2WV3A 2PNDA 2C9AA 1QBLH 5F7EL 3RY4A 3EOBB 1YN7A 2EE2A 3HB3C 4GAGH 3MRBB 5FYKH 3MJ6A 3VWJA 2J6EL 5C2BL 4FP8H 3QIWC 2O5XL 4ZUUB 1RJZA 1BAFH 4F7CA 1IGYA 5F7EH 2Q8AH 1I7UB 4ZOEA 4Y89A 3ILPB 1K4DA 1QLFB 1IGTB 3MLPA 3VGDA 3DUUA 2WW8A 2BSRA 2J6EH 2A6IB 1KENH 5C2BH 3C60B 2RAMA 1BFTA 5EUOF 1MELA 1J1XL 2O5XH 5GJTL 1VA9A 1GC1C 5CZVL 4YDVB 4ODXB 5EU6B 3NCMA 2C3VA 1CFTA 1YJDL 1JI2A 1R24B 3D6GA 1F42A 5EBMA 2VLJE 4XHQA 4XX1G 3U7YH 1JHTB 3F58H 1J1XH 3NFPB 5GJTH 4PRHD 4L8CA 2V2TA 4PY8J 5CZVH 4ZUSA 4MA1C 5EU3B 1QSEA 3MQIA 4U1JA 3QIWB 3T0EC 4KV5F 3I3BA 1X5XA 3QIUD 3S5LB 5EN2A 2NX5D 1NCAH 4P4KA 1U8LA 5FKPB 3FT4B 4AK1A 1QEWA 4LVNC 4MA3B 5DMYA 5C0CE 2AJVL 5I17A 1KCSL 4PYGA 5CEYA 1DQQA 1T2QH 4E41E 4OKVA 4UIMA 3ZKQD 4MNGB 4J4PD 1SEBB 1LEKA 2O61B 1CFNB 2HRLA 1E4WL 4WO4C 2BY2A 4WGWB 1BF2A 3VFWB 1RUPH 2G5RA 3BOVA 2B4CC 3PWJB 4N8CH 4NYLB 4HUXB 5ENWB 2BZDA 3VXRE 2XA3A 4KXZI 5KJRL 5GJSH 3QXAB 4YDJA 1AO7B 2GK0B 5CHNA 4MA1B 4JFZH 2X4NA 1YC7A 1UFUA 1F2QA 4POZC 5F3BA 2PTTA 3T0EB 5EC1B 3EYUL 2HN7A 1Q94A 3W11C 2R0ZL 4IEFB 5KJRH 3HRZB 4YGAB 1H0DB 1U8QB 3F6LA 4LLDA 5GRYA 3L7FB 3MV8D 4QXUL 4MQ7A 2W92A 4LVNB 5FO7B 4P9HH 1SVZA 4KTDH 5GRJL 2D7QA 2X7LA 3EYUH 3L3IA 3T3MF 3O6LL 2R0ZH 3STZB 4MMXC 2X4OB 5IR1B 2ADGB 4PG2C 4WO4B 1PZUB 5C9JA 5D70L 2XWBA 3SBWC 5DK2A 5GRJH 5E8EB 4YUEL 1X5KA 1MI5E 2PYEE 4X83A 5D71L 2VLRE 1F97A 5HYIA 5MEOB 2JTDA 4LEXL 4Z76A 2R2BB 1V3MA 5D70H 3RWHA 5IW6B 4TRPL 2RQ8A 4X7EC 5HYSB 4OM0L 1LEGB 5DVLA 4YUEH 3AREA 5E2VH 5D7JD 5C70A 5D71H 4A6YA 3WDIA 3SJVA 4MXQD 3OF6A 3ARBC 5D6DC 2X4SA 5J11C 4H25A 2HJFA 1KT2A 4TRPH 4GKZB 4XGZB 5IEHA 4OM0H 2FSEA 1I1YB 1PX4A 4OGXH 1UB5B 1Q38A 3BWAA 2YSSA 3THML 1EUTA 2AGJL 5C0BA 5DQJB 3AGVA 4JRXA 3KYNA 4K3EH 3U9UB 3WIFA 1LK2B 3QIWD 4QRSB 1OSZB 3EJZD 5FYJL 1N64L 1G0YR 4QYOA 4RMUA 1PG7W 2VC2L 1QKZH 2AGJH 4N0YL 1NBZB 1MWAA 1RU9L 4P99A 5TF1H 3LS4L 4Y8DC 1A7QL 3VXOA 5E56A 4MJ4A 1J0KA 1LE5A 1N64H 5IVXA 3IF1A 2VC2H 4HJ0D 5FHAL 1PW3A 4JZJA 5D1ZC 1RURH 3MRFA 4RQQB 4QHKI 3U2SB 1FJ1B 5FK9A 3GSWA 3ARBB 3CH1B 1VGEH 5J11B 4GXUM 3ZHKA 2QADD 4JY6A 4R90L 4JFFA 4PLJD 3QWRD 4RX4A 2BFVL 2QLVB 2YEZA 1F02I 5FHAH 1OCWL 4FTVA 1ROWA 2W0PA 2ICEA 3R06A 1QRNE 1UGNA 4KJYA 2IBZX 2O93L 4EIZC 1H3GA 3T0ED 4R90H 2BNUA 1MREH 1KXTB 4YLQT 3GSXA 2BFVH 3P73B 3I6KA 1OCWH 1UB6B 2OP4L 2A38A 5K9OB 12E8L 3WKML 1YY8B 3FQWA 3WLBA 1JHKL 1PX3A 5JDSA 4X6BA 1EFXB 4P57B 3MLRH 4Q6IA 4YO0A 5GQBA 3PWLA 3WBDA 1K2DB 4LVEA 2BNQD 3RU8L 4I0PC 4JY4A 2AXFB 1HKLH 2DQIL 5F7LB 2OP4H 5IWLC 1T2JA 2VUYA 4Z77B 5D1ZB 5DHVB 5T3ZL 3BDXA 1JHKH 1HCVA 4CMHC 1CCZA 3MLSL 3PP4H 1QACA 3RU8H 1CE1H 1K5NA 1MY5A 3V5DA 4XPGL 2DQIH 4UV7L 4LSPL 1KN4L 4RFEB 5T3ZH 5IFHL 2IQ9L 2A83A 5IVXF 3O6FB 5K9QG 3ARFA 4ZPTA 1S78D 2BSTB 3MLSH 3ME0A 3U0WL 5JQ6L 3RGVC 2ATPB 4XPGH 3ZDYE 5LGJB 4UV7H 2P5WD 4C55A 1KN4H 3BZEB 3BKMH 2FD6L 1KN2L 4X7SL 5IFHH 4FZ8L 1C7TA 1FYTE 4RWHA 4LGSB 1IQDA 2ATKA 2CKNA 1D5XB 4CBPA 3GRWA 1G7QA 3BPCA 2V7HB 1OPGL 3TBSA 4I0PB 1DJSA 1HHGA 3WFHB 5IEKA 2FD6H 1KN2H 4X7SH 4FZ8H 2CUMA 2DM2A 5K9JL 3WS6C 1E4KA 3DETC 1VPOL 5ETUB 2ZUVA 3R1GL 4DN3L 2FCBA 1EFQA 2J12B 5FUZH 3REVB 4CMHB 3JUYA 3NMEA 5MENB 1HHJA 5JDJA 1NEZB 1E0OB 4WUUB 5DQDL 4J2XA 1F3JB 1OPGH 1WQVT 5F9OH 5BJTB 4X4XB 4E41B 4ENED 5IGXL 2XN9E 3PWUA 4JDZB 4GW4B 5K9JH 4TSBL 2K3TA 4I5BA 1MHPH 1VPOH 1FL3B 4DN3H 1JI1A 4ZFOB 5ID0B 2F74B 3RGVB 3FT3A 3OBAA 2K7PA 1Z0MA 4QTIL 3LQZA 5IGXH 1T21B 3JV6B 4TSBH 3VXRB 2XG4A 5DTFB 1Q9KB 5IJVA 4QHLA 4S2SB 2EXYD 3L5WB 2R1WA 4N1EA 1YEDA 3KXFB 2OBGA 4FFWD 2AEIT 1Q9OA 4QTIH 4EI5C 3SDAC 5I1DB 3PDGA 2C7UB 3RHWF 1IEAB 2ADIB 4LFHD 5EFIB 4M4RA 1FP5A 1KJ3H 5DJ6A 5DS8B 1NBQA 3LAFA 5GS0L 1XR9B 4ISVA 2DKUA 3ZT7A 1CBVL 2XYCA 3ULUL 5JIPA 2DWEB 1HSAA 4B50A 3S7GA 2NXZC 3RA7L 4YBQC 5GS0H 4QCIB 3O9WA 3GMLB 4RMRA 4ZD3L 1CBVH 4MD5A 1D3CA 5HYEA 3T2PA 2B2XH 5F7UA 1YECH 2VLRB 5C8JA 1VERA 3ARDD 3QCVL 1TXKA 5GGVL 1JPFA 1OAZH 1XF4A 1MCQA 4XPTL 5CJXA 3UTZB 1ZHKA 4ZD3H 1Z9OA 4NQCD 4YBLC 1T03L 2BRRL 3SDAB 4LP4A 4LHUG 4DVBB 5GRUL 1OTUD 1A14H 3QZWA 5KVFL 1W8NA 4TPRH 3RUGB 2FBOJ 3DV4A 2VLJD 2OTUA 3BN3B 5H2BA 1RFDL 4XPTH 5DVMA 3HG1E 3C2AH 3OX8B 4OD1H 1PEZA 1MAKA 3OAUH 1I1FB 3DARA 1T03H 2IALB 4F7PB 3VRIB 3ZHDA 5GRUH 4KH2A 5D9SB 5KVFH 4NKQB 3ZT6A 4EUPA 1DZBA 3IVKB 1XH3A 2JK5A 4NQEA 5HY9A 2NXZB 4OV6F 4PJXB 1XR8A 3MRPA 3P9WB 2DMKA 3CZJA 5LBSL 4BQ6A 3IETB 3Q6GH 3MUZ1 1HIML 4J1UB 3E6FA 1TPXC 3ABZA 2HWZL 3O3BB 3RNQB 3C6SB 3TBYB 4F7TA 3RVTC 3MUGA 3VH8G 5C0CD 2WINA 3X3FL 3DROA 2PF6A 4HIEA 4E41D 3UTOA 2OSLA 4ONOA 3FL7A 1LNUB 5LBSH 4YBLB 1HIMH 5EC2B 3GMPA 2SEBB 5ISZB 3IS1X 3KLAA 2DTSA 5LVEA 1YEIH 1NGYA 1JNJA 1DQJB 1Q9LA 3RGVD 3X3FH 5JORB 1KC5H 5L9DL 4I48A 3S34L 4NIKB 2ZNWA 4LVHC 1S7QB 3WUWA 3PE9A 2EYSB 4HUUB 4PY7A 3CVIL 2UY7A 3MYJA 5D2NA 1R3LA 2X4TB 4FQ1H 4Z7WA 3L3GA 1OTTC 2GJ6E 4MYWB 4UTBH 3HN3A 4DFHA 2ICWI 3OKKA 3S34H 4D0CA 1LO0L 3MRCB 4M02A 1G7JA 4J6RH 1KB5L 1MFDL 4KMTL 1URLA 3HPJA 5KSAB 3IAQA 1TPXB 5GSVB 1T0NA 5F88B 1JFQL 5CILH 1LO0H 2VXTH 3MNWB 4JDTH 2UVFA 5GXBB 2OL3L 1RUKL 2YS4A 3V52L 4L9LA 1CK0H 1ZEAL 3SDXB 4KMQA 4KMTH 1KB5H 1KFAL 1EHLL 5DVNA 3C9NA 2VN7A 4OQTA 2EDBA 3QXDA 2VR4A 2ADJA 1KEMH 3K7UA 3D9AL 4U1KB 3TJHC 5DRZA 3WEXB 1DLHB 1XIWA 2OL3H 5E9DA 1JGDA 1MI5D 4IOIB 4F7EA 2PYED 4LVHB 1DUZA 2D0FA 3FFCE 4M5ZL 4F37F 3CLEH 1KFAH 5KN5B 1KJMB 2VLRD 5IMMB 2XKSA 4PJ9C 4PJDB 5I19L 2E7BA 1QPPA 2NZ9C 5I1JL 1MUJB 3H6JA 1D5ZB 4UMGA 1QFWH 1WT5C 1MHEB 4EI5D 4YHYC 5JNYA 2FH8A 2VE6A 4M5ZH 1VEMA 3QRGL 2AEQL 4UDUB 4R2GD 3TN0B 1AGCB 1RZGB 3ARWA 3JWNC 5EO0A 2M1KA 3S96A 5MI0C 2VLKA 3BZFB 1FORL 5I1JH 32C2B 1NSNL 4GS7C 3RX5A 4Z7WF 4MB3A 3QR2A 5T5FH 2F53B 4LLUB 1EJOL 4C4KO 1II4E 3VE0A 3QRGH 2AEQH 4WU7A 4LSTL 3TPUB 4HUMB 3L3OB 1TNMA 4BFIB 4GRWB 5IBLD 1FORH 1ED3B 1NSNH 4QHUB 4G6AC 3IXAB 3BKCL 2X4PA 3EYQC 4OUUA 3QEHA 4LSDA 3VXMA 4NQUA 2GYSA 2XN9B 4DGIL 1AI1H 4M9OA 4PJ9B 5E8NA 3FB7B 3U36A 2A9NL 3JWOH 4F2MB 1VKXB 2YMXH 5CIPB 1T4KA 5TJWK 3BKCH 1CF8L 3CXDH 1AC0A 4FQXA 4IDJL 4PGBB 4XCCL 4YHYB 1QFOA 3IJYA 4H5SB 1Z9SA 2JJWA 3LKRB 1XF3A 3ULSA 4JFDB 4ODUB 3QB7C 4NJAH 2MPAL 5MI0B 4WFHE 2O5ZH 4H1LB 5CCKL 1HH6A 1BPVA 4PJIE 5JIIA 1JRHH 4GS7B 1CF8H 1QVOB 5DD6B 3H3BC 4IDJH 4XCCH 5I8CB 3DIFB 1MY7A 4K3HA 1UJ3C 4F33A 1EEQA 1QRND 3F5WB 4ZUWB 3BZ4B 4F8TA 2H3NA 5CCKH 1H8SA 1N6UA 2WUCH 1WIOA 4ZTPL 2H1PL 5E2UL 4LCCC 3W0WA 3QUKB 5TGBB 2F54B 4EOWH 1I8KA 2I9TB 1C16B 5C0IA 3ZDZF 3RVTD 4PRIB 4IHOB 3VGFA 1MCWW 4Z7VA 4PRPE 3ZE0E 2P5ED 4J4PA 2H1PH 2KH2B 1WCBA 2I9LA 3IXTA 1C1EH 5EO1B 2IANB 3BP5A 3MRMA 2O5YL 1OAKL 4MHHI 3P4OB 5C0JB 4HZLB 4NRYA 4WFFE 1G6RL 3PGCA 3KJ4C 4JKPL 1ZE3C 1A47A 1Z6JT 3L5JA 4PJ5D 1N59A 1UJ3B 4K7PL 5DD1H 2R39A 2O5YH 1OAKH 3GJFK 1MFNA 1UWGL 3VI3E 1OLLA 1Z9MA 1G6RH 1DN2A 4OCMC 2VDLL 4JKPH 3HG1B 4LCCB 4K7PH 1NDGA 3CJJA 3P4MA 2VABB 4HBCH 2B7DT 1FYTD 1A7RL 4UUJA 1UWGH 3SE4C 5ANMA 4DVRL 4NP4L 5E00B 4DKDC 1AXIB 2V2XA 1JWUB 1LVEA 2R4SL 2Z8SA 4MMZC 4M1DL 3A67H 3CDFA 1N2RA 1ONQA 1I7ZB 2CKBB 3NZ8A 1VEOA 1I3RA 1YUHB 1D9KB 2C1PA 4HWBL 4XP5L 3TJHD 4DVRH 4NP4H 1NMAH 2EKSA 4Z7VF 3KJ4B 3K2UL 4QF1B 4IRJC 3GDBA 4M1DH 4PJBA 2DQTH 5EH1A 5AZ2L 4NC1E 3DGGA 2NY7L 4X4MA 2PXYC 4Y0GA 4KHXL 1WEJL 2Z31C 4XP5H 1NCBL 3G04B 3MACL 2VDNL 1MQKL 4L3EE 5D7JA 3AB0C 4BK5A 4TNVK 1JTOA 2ESVA 5DJ8A 5E8OB 4OZHE 4PRAA 2C3XA 1OQOA 1AGDA 2D31B 5AZ2H 4WHTB 3RY6A 1U92A 4K7PX 4O2FB 1WEJH 1JYVA 2GJ6B 1NCBH 3MACH 2VDNH 1QNZL 5B39G 1IEBB 4IIQC 2MKLC 3MR9B 2YD4A 1YYML 2KZ1B 3QEGL 3OGCA 1M7IA 4ZTOH 4K3GA 3WUZA 2LU7A 2RR3A 3FONB 4B7LA 1A7PL 1CN4A 3UP1A 4QXGL 4G6AD 1DCLA 4BUGA 1YYMH 3HAEH 5KSVA 4UBDD 4X6DE 3T0BA 4G8GE 3ARZA 4IRJB 5DC0A 4OGYL 5E1AB 3GI9H 4EVNB 4QXGH 5EU5B 2Z31B 4HK0B 3LV3B 4HG4K 3SGJC 3AB0B 2ARWA 3OAYH 5EA0L 2EICA 3ECBB 3QFDB 1B6UA 2AV1A 2CPCA 5TDPB 4OGYH 2C1OA 4JPIB 3QG6B 1XF2A 1UQSA 3B2VH 2AS5M 1F3DJ 4PJBF 3FQNA 3TWCL 2NY1C 1N6VA 1DN0B 4NFCA 1P9MA 1BREA 4IIQB 1F90L 1YMHB 1JBJA 4FFVC 5C7XL 4DZ8B 3FB6B 4JFYB 3VWKD 3VXUA 1ZT4A 3SKMB 5EWIL 4GQ9H 3ZDXE 5I16A 3D69B 4OAWB 4PJAE 3NCYS 3MV11 4UB0L 1JZ8A 1V3LA 4OZFB 2BVYA 4NO5A 1EA9C 5AD0B 5J56B 1FZOB 4OB5L 2IH3A 4HX1A 5EWIH 3DPBA 4OF6A 1OT1A 2R0LL 3NGBC 5A2IH 5IB1B 2DQFA 1LDPL 1OAYL 5L7XL 5D2LE 4EDXA 4UB0H 4S1QL 4L5FL 1S9YB 4OF3A 2A74B 3RI5F 4OB5H 1TQBC 1AKJD 2R0LH 1A9BB 3BEVA 4MX7B 2NY1B 4IM8A 3VFSA 5JUEL 4NRXA 1LDPH 5I1EL 1WBYA 4WTXA 1MIEH 5L7XH 4U1MA 3RVVD 5HHXH 4S1QH 4XTRC 1HZHL 3IDGA 4L5FH 4TNWF 1A1MB 4RMQA 5IB4A 2WK2A 3BJLA 2E8ZA 1VESA 3GB7A 4WTZG 5B38A 4O5LH 5JA9A 1E4XL 2E3VA 3DRTB 2P5WA 1EPFA 4MVBD 3HR5B 4CGTA 1ODAA 5JUEH 3GBNH 1X5YA 5I76A 4C4KT 3DYMA 1ZXQA 5F7DB 3QHFL 4MJ6B 1BQHG 4P48A 1E4XH 4Y16C 1YPZF 3NZHL 3W9EB 3NGBB 2A73B 4LQFH 2JJSC 4KJQC 1A4JB 3VD7A 3CXHK 1MRCL 4HJJL 3PGDA 4MA8L 4YHNA 2W9EH 3PL6D 2V7NB 3G08A 3QHFH 3BP4B 4KK6C 3KYAA 4H1LG 5A2FA 3RZCD 3GHEL 2EO9A 1TQBB 1JPSH 3WL9A 5F9JA 3PGFH 4MD0A 4U1HA 4ZG1A 4EEEA 3MGTA 4TVPE 1KXVC 1MRCH 4G6JL 4MA8H 2M26A 2UV3A 4CW1A 4U1GB 5E6YA 2NLJA 3SKNB 1I1AD 2PXYD 1NUDA 3QQ9D 4ZXBA 5ECJE 2I25N 3BUYA 4XPHL 2NY2D 3RKPA 4G6JH 3FFCD 5EIIA 1J18A 3B8YA 4QEGA 3ZKXC 4Z7QF 2YWZA 4LPCA 4XH2B 1DBBL 1G0XA 3EJYC 3KNBB 3KPRD 2HT4D 1FVCB 3T1WA 4J3VA 4Y16B 3SE9L 3ZMRA 1MAML 2HJKB 2Z92A 3O6KL 2XRAL 3BYTA 4KROD 3C09C 3C6LC 3W39B 3OTTA 2EEBA 1NFIA 5BMFH 4L4TD 1X7QB 1KJ2L 1S3KL 5I66A 2BOCA 3LKQA 2WQRA 4QNPE 1B4RA 5DO2C 43C9B 3DOSA 3SPVA 3MXVL 4M5YL 4LSVH 5FYLH 1KJ2H 1WBXB 1NGXB 5E95B 1UZ6E 1Y6MR 5C08E 4CVWA 1RPQA 3VDAA 4Q74A 4RIRB 1EEZA 3IFNL 3MXVH 4JREC 1AXSA 3U0TB 1A9EB 2VSCA 4M5YH 4PUBL 5F6HI 4HLJA 2ED8A 5DUML 4TULH 2NY1D 4HWNA 4BH8B 1MF2L 3SOBL 1JZ3A 2KZWA 1CT8A 1F3DH 4DGYL 1HHKA 1C12A 4NQCA 4PJ7A 3QO0A 4L3EB 3DRQB 4FFVD 3BW9A 3HUJA 1HNGA 3C09B 3C6LB 4XNYH 3HC0A 2VLJA 3U46A 3MNZB 4HH9A 5DUMH 4OLZL 5GGTA 1HOCA 1MF2H 4WFHD 3RIAK 3SOBH 4HIXL 4A6YL 4OLXL 4WI4A 3QUXC 4PJEE 4G43A 3UC0L 2J5LC 3D39A 4GAYB 1BIIA 2IPTL 1LO5A 1FAKT 3TT3L 4OLZH 4MQTB 5DFTA 4F80A 1GZPB 1YY9D 3UC0H 1BX2A 1D7FA 3VXSD 2DD8L 1UZ8B 2IPTH 3MV9A 4G9FE 3SKUD 2IGFL 1IL1B 5I8EA 3EFFA 4JREB 4X6DB 2VL5A 1RZJL 4G8GB 4XBEL 4EN3C 1PZ5A 3A6CL 5CJBA 1ND0B 5BZWB 4PRPD 4X5XA 5TQ2L 3ILQD 1LK3H 3SE3A 5SX4H 2BNRE 2IGFH 3TZVD 2LAAA 4AT6B 3CFIC 4NM4L 4OD3L 5IIEA 4DTGL 5IG7B 1JTTA 3IB4A 1RZJH 5IF0B 1XGTB 5F1IB 3A6CH 1NC4D 4WFFD 3AM8C 3QUXB 3OXRB 2J5LB 1W72A 4ZQKA 1NCDL 4RWYH 4ZOCA 3E6HA 4NM4H 3RVXC 3U0PB 4DTGH 2UVEA 4PJ7F 1YJDC 4YDIH 4TUKH 2J3SA 1PKOA 1ZHNB 1A2YB 5C2UB 1UM5L 1U91A 5C0AB 4BQ8A 5ESQA 2IAMD 3WFEL 5L2KB 4UDTB 1NCDH 2EYRB 4HC1L 4JFEE 1A7NH 4PJAB 3SDDC 5J7CC 4HPYL 5FDYA 1QR1B 5F97E 4P2OD 4EN3B 4NO2B 4GKNB 3BO8B 4YQXH 5DRWA 4LSRH 4O2EB 4UU9B 2EH8L 5D2LB 4K8RL 4HPYH 4M48H 3BIBX 4DWHA 1GGIL 1JZ7A 5E08H 1MI5A 2PYEA 1WUNT 2EH8H 1ZWIA 3O4LA 3RBGA 1YNTB 5T33L 1M7XA 4Y8AA 4K8RH 2BC4A 5CBEB 3HI1B 2RJMA 4HKBB 1CGTA 2WWMC 1YZZA 4QLRA 1CFQA 5I1LA 5IFAL 4URTB 3TBVA 1JUFA 5D93C 5I1KH 2D7TH 2FZ3A 2X9YA 3JTTB 5BRZE 3CMOL 1R3IL 5GGSB 3RVWD 3OKOB 1KJVA 3P3YA 4FQIH 2CDFB 4Q9RL 5F96L 3SDDB 3MUHL 4NOBA 4YIQB 3WHE0 2OR8A 5A16B 4NQDA 1G7MA 2I26N 5IFAH 4J3OC 1E27B 5FCSH 1GGYA 1R3IH 2VERN 2VWEC 1L7IH 4PY8I 3DX7B 3QHZL 2HKHH 3IYLW 1REIA 4Q9RH 3TCLA 5F96H 1RJLA 1D5BB 3HLAA 4PLNC 4Z5RB 1BZ7A 3IDXL 1DQMH 2GAZA 4I18A 2ZZUT 4MD4B 5J9PA 5HVHC 2YUZA 5C0DA 2H32B 1FGVH 2YRPA 2Z35B 3QHZH 4PJ8D 3PWNA 4O2CA 3VMNA 5CMAA 4G8GD 4ELKA 1I8IA 2NYYC 4FQQA 3ZYZA 4JJHA 3TYFB 1J1OL 3IDXH 2NY3C 5DJ2A 3VXTA 2DL2A 4X0KB 1FCGA 2VIRB 2IBZY 2W0LA 4NSKA 3VCLA 4L9DA 3V0VB 4CDGC 5HPMA 4HMDA 3IU3A 5IM7A 3GSNL 4ONGL 1J1OH 2DICA 4RAUA 3S36H 1DQTA 4GFTB 1M05B 3UZQA 3X13A 3N85L 4OLUH 2YRLA 1T1ZA 1YN6B 5E0QA 2KBGA 1P84J 4N0CD 1N8ZA 2G75B 3BHBB 3GSNH 5FB8A 4NT6A 5D1XA 5JZ7D 5KSBE 2HKFL 2RBLA 1HYRC 3ZE1E 2CUHA 4N8VA 4LL9A 5HVHB 2OZ4A 3BP6A 2GY7B 3OR6B 3N85H 5HI4C 4L4VE 4ESKA 2AVGA 3BX7C 3TO4A 3NH7L 3VFMB 2J4WL 1T5WB 2VR9A 3E3QE 2P5EA 4BA8A 1S7VA 1IZKA 2HKFH 1KTDB 1IAOB 3QJHA 3BQUD 2NY3B 5C6TH 4YAQA 1JPST 4MJ5B 5I1IH 1GGUA 2OR9L 4FN0A 3OKDB 3CFBA 3NH7H 3BPOC 3ULVL 4LKXB 3IKKA 5BZDA 1JF1B 3ET9F 4PJ5A 3DX6B 2N4IA 3V95A 3ZTNL 3RVXD 1NGPL 3OB8A 1WWAX 2OR9H 3S36X 4I3GA 2K1MA 2CLZA 5ALCL 3LPGA 5HVFB 5JW5A 3ULVH 1WWWX 1A6ZA 1DBJL 3O81A 4KZDL 4U4BA 5E1HB 4XZUA 1CDCA 5IQ9B 3QQ3A 3ZTNH 1NGPH 2F5BL 3LZFL 4I77L 1FYTA 1Q9WA 3UBXB 4W6WB 4YFLI 3BDYH 1HNFA 4XCFH 3T3PE 1JK8A 1P4BH 2HFFB 4OLYL 3X14B 4KZDH 3FO1A 1TZHA 4XXCC 1A6TA 5CINL 4LDOB 2F5BH 3ZTJH 5CWSB 2VL4A 2VTFA 3QUZA 3OQ3B 4H0HB 3OSKA 2JIXD 3BPOB 4LOUC 3QIBD 2VSDA 5HGBB 1CXKA 4L8SA 4P2RA 5IMLA 1WSST 5CINH 4DUXA 1G9NL 1EX0A 3ROLA 4TVPD 1AY1H 2Y7QB 1F6AA 2N56A 4GMTL 4ZFGH 5H94B 3NCJL 4NKDB 2IADB 2BNRB 3F7YB 4V1DE 1M6OA 3U4BL 1Q0YL 4LHUD 4N8PA 3GSVB 1EGJL 2NPLX 4P5KA 5MERA 4WW1A 2NW2B 3EFDL 3DXAD 4LDEB 1JHLH 4U7KA 1P7QB 4NKOB 5KVDL 4GMTH 4AG4L 2YWYA 3LVEA 3MA7A 1QO3A 3V6FB 1Q0YH 3NABL 1EGJH 1WBZA 1DTUA 3RWEB 3BGMB 4KK9D 1G7IB 3O3DA 5HGAB 5JXED 2H2PC 1ZLSL 5EOCJ 4HS3A 5ITFB 3CUPA 4AG4H 1FFPA 1I8MA 3B2UC 3QA3B 5BO1L 4JFEB 1CG9B 4A2MA 1WC7A 1V7MH 3ZYJA 5HJ3A 4N1CA 4X9FA 1IM9B 3I02A 3I85A 1S7UB 2DWDA 3SDCC 4P2QE 1WIPA 2DB8A 4RGOL 2FBJH 2NYYD 2X70B 1IVLA 3WS3B 2ZUWA 3NCBB 5BO1H 4MCZB 3CU1A 3PJSA 1A1OB 4PJHE 4Y2DA 2NY3D 2Q7NA 1CXLA 3HC4L 4K3JL 4OQTL 3P2TA 5C08D 5HHPA 4IRSD 3O0RL 5C09B 3MBXL 3QEQD 1HHHA 1TENA 4RGOH 4FXKB 1CICA 4CVZA 3P40A 2R56H 1YMME 5GIRA 3RWCB 5DRXB 5D1QD 1UXWB 1CLCA 3QNZB 4Y19B 5SX5H 4K3JH 3OKEA 1R6VA 1A6AB 1CIUA 3O0RH 2PCPB 2ENSA 4ELME 3BIKB 3MBXH 3I75A 2Q76B 4ZNEA 1A22B 2OXGA 2QQKL 3L6FA 2QR0B 1KG0A 3P30L 5KAQF 1ORSA 2E5EA 4L8BB 3TF7C 4EXKA 4ONHA 3MA9L 4WI9A 2FL5A 3TBTA 3BPLB 2CIIA 3SKOA 5CSZA 3QPXH 2HT3C 2FR4B 4QRRA 3SDCB 3MLVH 3VRJB 1V7NH 2E7LA 4HGMA 1KELL 3V7AG 2VQ1B 1TMCB 1KPVA 5HHNA 1FRGH 5T1KB 1YEKL 1S7WA 1IM3B 3TFKC 4G9FD 4KPHL 1A1NA 5LGHL 3EUUA 4YHPA 3NIGE 1KELH 4APQD 3ULUC 3MRHA 4JQXC 1HXYA 1HHIA 3JWDL 4BJLA 1T0PB 3NCEB 3E3QC 2X1PA 3QJFA 5DJDB 1U93B 5GGVY 3MJ9H 5I0DA 4JLRB 4KPHH 2R4RL 2K7QA 5JPMB 4HV8B 3SY0B 1B4JH 5FEBA 3B5TA 1B9ZA 1F6FB 3KLHD 3FKUS 3JWDH 5HGDB 4XNMB 1PQZB 3NA4A 4L1HA 4O02L 5HXMA 3QQ4B 5J6HB 2R4RH 1L7TL 3QXTA 1UXSA 4P46C 4LLQB 3PXJA 4ETYA 1HH9B 1OF2A 3EOAA 2UWEA 1MJ8H 5IP4A 3RX7A 1DL7H 1QFWI 3QCUL 3EDDA 1L7TH 3O41B 4TSAH 1YC8A 5B3NA 2X4UA 5C0FB 2XI9A 4OF8A 4LOUD 5AG8A 1NAKH 1TJGL 4XMLL 4ZFZA 4EDWL 3P9LA 3FOMA 4AYFA 4EQ2A 3QCUH 2NY0C 2P8PB 1I1AA 2WLYA 3Q6FA 4OLWH 4PV9B 3UAJC 4LLYB 3S4SB 2KPNA 3HE7D 4PFEA 4XMLH 4LKCA 4EDWH 2GITA 4MXVE 3S8WA 1FH5L 1BBDH 2CLVA 4YNYB 4GJTB 4U1NA 1Z3GL 4PV8B 4L1DA 1QLRA 1GIGH 4FOMA 1FNFA 2VKXA 3CFKB 4AEHH 4NO0D 3OHXB 4PTUA 3KPRA 3VXQA 3GKZA 3KPLB 1FH5H 1K9TA 5BRZD 1BFVL 2H2PD 1FZKA 1ETZA 3LN5A 4L4TA 4M8QB 5EOCH 3QDMB 1OAQH 1PYWA 3IJHA 4P49A 1OP9A 4PLKC 1U58B 3KPNA 3P0VL 5FUCE 1BOYA 1I9JL 1NLBL 5GS2D 2PUQT 3DO7A 2HG5B 3UYPA 4LRNH 1JRHI 2Q86A 1VFAA 3Q3GB 2OK0H 1UH3A 3GSOB 4Y4FA 2NY0B 2XTJE 3C8KA 3GJFA 1ADQL 2DDQH 3KR3L 1DQDL 1KIUA 2IH1B 5ICXA 2DM7A 4XT1C 3UJJL 5JTWA 1VHPA 3KPSB 5ACZA 4JHBA 4FABL 4HFWA 4MDJA 3UBXG 1ADQH 4Z7OF 3DO3A 2HAZA 4Y5YC 5C3TA 3U1SH 1QFHA 4JPWL 1JNNH 4B0MM 4WY7L 3V6OE 4U6XA 4DKFH 3UJJH 1UH4A 3F7PC 3GMMA 3IAGC 1ZA6B 1FL6B 3EDKA 4QOKE 3EYOA 4FABH 3J7HA 3TESA 1OD9A 1INEH 2C3HA 1SEQL 3F12A 4JR9L 3NAAL 2LVCA 1UENA 2H2SC 4U1SB 2DRUA 5A40E 4JPWH 1L6ZA 3V4VL 3MO1B 2ZSVB 1BD2E 4KKCD 4PBWD 1WWBX 4HGWB 1FNEA 5GRVL 3L7EB 3C5SB 1SEQH 4UAOC 3NAAH 4LEOA 5IBUB 4YHML 3WDHA 4ZDHB 3GKWL 1QG3A 1KB5B 2XY2A 2J8UE 3BEWA 3AMKA 4HXBL 3VXSA 1MLCB 1F13A 5I1CL 3PQYE 4L29A 1KLUB 3FQRB 1JGLL 2YBRB 2R1XA 1PLGH 4HF5L 3D2UB 1UG9A 3GSQA 4L4VD 4OI8A 4JFPA 4YHMH 4LF3B 4Y5YB 3GKWH 1BOGB 5I71C 1CE6A 4HXBH 2ORBH 5SWQA 3K80A 3MJ9A 4Z7UA 5JIKA 3V8CA 3DUSB 4S0SD 3TZVA 5JHDB 1CVRA 4HF5H 1RK0A 3M1BB 5DMKA 4QHMA 1VADB 3FTGB 3BE1L 5DMJB 2OJEA 1G7PB 1HE7A 2IFGA 1TJHL 4I4WB 5CZXD 3FHQA 1LGVA 1PY9A 1YMMB 1WFNA 5EORH 3W2DH 4D0BA 4C56A 3D3VE 5CD3B 5CEZH 5F1NA 4LHJB 1FHGA 2CJUL 4LSSL 2ZG2A 3O2DL 3IGAB 5J6GB 4P46D 2FX7L 1IGIH 3BE1H 4KI5E 1GC1H 4LGRB 4MNQE 4G9DB 4UAOB 2BMKB 2R2EB 3D5OF 3GI8H 4L3CB 1TJHH 2IC2A 4D94A 5T1LB 4NNYB 1R5VA 3O3AB 5A1AA 1GL4B 4XC3H 3HZYA 4KY1L 3WLWC 4PJIF 4OGAD 3O2DH 2FX7H 1K6QL 4ZYKB 3RDTC 3ALPA 3MRRA 1X4YA 2DTML 4HUVA 4QTHB 5I71B 2DQGL 3DBXA 4JFOB 1RZIA 4KY1H 4HKZB 2NY0D 5E4EC 2L4OA 3D0VB 1T1XA 4PR5A 5D72L 5D7KE 5IBTL 1KBGL 5D4QA 4TNVF 4E42A 5AUMA 5DSCA 2CSPA 3ZO0A 1XCQB 4BSWB 2H26A 2DTMH 2MQ3A 2YD3A 3D0LA 5SWSB 1MHCA 3DMMC 1JV5A 3RJDA 2ZUQC 2DQGH 1ES0A 1ZTXL 3ZE0F 2CIKB 5IBTH 2MMXA 5HYJA 1RZ7L 4JGJA 4K7PY 4Z7UF 1JIBA 4N0UB 5ERWA 4V1DD 4G42B 5D7IA 1Z9LA 4MLIA 3B9KA 1CDBA 2QQNH 1VGKA 1ZTXH 5IESH 2B4CH 2VAJA 3MLTB 4CU7A 4O51B 1X6NA 4OZHA 4WTWA 5BVJB 1RZ7H 4PTTA 1MNUL 2E7MA 3RPKA 4DOHE 1BGXH 3RTQD 1FFNA 5F8RC 3RDTB 2XFXB 1S5HB 4UQ2A 2MCPL 5SWZB 1GGBL 5E4EB 2NY5C 1MNUH 1X4ZA 1FFRA 3PIQA 1OP5K 3VFUB 1QSEE 1G7HA 3RKDD 4H0GA 4HIHA 1ZSDA 4LRIA 4CMMA 3T3ME 2BJML 1U95A 5DI8B 4R26L 3DMMB 5FUCC 2ZUQB 2EXWC 1I4FA 2MCPH 5F7YC 4F9LC 1I9RH 5I18L 4PJ8A 3ZKSD 1HN1A 3QNXA 5FGCE 3LOWA 4MS8C 3FB5B 4P2QD 2XTJC 4JQVA 4KQ3H 3CPLA 4I2XA 4JN1L 4XP6H 1VEPA 4QGYA 2ZP0T 4MAYC 3OPZL 3QDAA 1ZA3B 3RPIA 5LG1A 4OI7A 4CVXB 1JWMB 5GZND 1J8HB 1G7LA 5ADOL 1WFUA 3OJ2C 5KVMC 5I18H 3EGSB 3FB8A 5F44A 4HCRL 1IGTA 2R9HC 2H2SD 2PW2B 3NBNA 1YMMD 2A6IA 4JN1H 3BISA 3OPZH 4WU5B 2GQHA 4ALAL 1L0QA 5JQHC 4HBQA 6CGTA 4H8WL 4ODXA 1A0QL 5EU6A 2DLTA 4HCRH 2EC9U 1R24A 5IW1B 2EECA 3S4SG 2HFGL 4P23C 5FM5O 4WFEE 3ZZ1A 2UYLB 4OZHF 4ALAH 1JHTA 2YPKB 3L3DB 3RX8A 3WNLA 3QBTB 3NFPA 4JM4L 2EYTB 2F19L 5L8JB 3QNYB 4H8WH 3TA3D 1A0QH 3H7BA 5I8OL 2CUIA 5EBWB 4HMCA 4QRTA 1NGZA 1MEXH 4Z78B 3BMVA 1EMTL 4GRLC 1OP3K 3BRDA 5E8DL 1C5DA 4PJGA 1KB9K 1YEEL 1JGVH 2IJ0C 4MAYB 3M17B 1E4XI 4FG6C 3PHSA 1Q1JL 5KANI 4S0TD 4MXWL 3PWVA 1KPUB 1I7RA 5I30L 3FT4A 4MWFA 3GSUB 4IOFD 4MA3A 3BUTA 1T7YA 1YEEH 2C4FU 3F7VB 4R96A 4TTDD 3VJ6B 1Q1JH 2DJUA 3NCFB 2AXGB 4MNGA 4GG6B 2O61A 1K8IB 4P4RB 2D9CA 1BVLA 4MXWH 1QBML 1CTOA 4QRPB 5F7NC 1OY3B 3LEYH 4U1IA 1UCTA 5DMGD 4P5TB 5I30H 1EBPA 3VFWA 4P23B 4Q2ZB 5DHVH 4IMLA 2JELL 5F7MC 3MLXL 3UJTH 1UJTA 2EDXA 3RWFB 2QBWA 4NYLA 1NGWB 3MGOB 2DQEL 3SJVE 4V2CB 1HI6B 3QFJA 1QBMH 2WIMA 4Z95L 3CVHA 3IFOB 5GGTL 4HKXB 3RDTD 5FM4A 4HKJB 4V2BA 1QUNA 3HAEB 3MRQB 4GRLB 3MFFB 2VISA 3MLXH 3RL2A 2LU3A 2B0SL 4EXPX 5EC1A 1U8OB 5C0BE 2DQEH 4M6AA 1BHGA 5FF6B 4X98B 1KIPB 1OGAA 4JHZA 2X4RA 3HRZA 4TOYL 4GG8B 1U8QA 3HPLB 4YX2L 1TQCC 2JIXA 1SYSA 5HHVL 1NPUA 3DMMD 4YPGB 4IDLA 5FO7A 2AKRB 3CSYA 2FJFB 2RFXA 2EDOA 4PJGF 3LRSB 1P1ZB 3CMGA 2Y1VA 3V5KB 3REWB 1HEZB 2GJJA 2X4OA 4KTYA 1NBYA 2ADGA 3A6OA 4TOYH 4UNVA 3ARGC 4YX2H 3RVUC 5IHUL 4WO4A 5HHVH 2YN3A 5EUOB 4LHUA 3VWJC 2H9GA 5GSRB 2GTWA 3DXAA 1T20A 5EOTB 3UJIL 1EZVX 1F4AA 3RNKA 4YXLH 5FDWA 4M6NL 4AEEA 2CDEB 2R2BA 3OAZK 5IW6A 5HI5C 4OM1L 2Z4QA 3E8UH 4JFFE 4MNQB 1UH2A 3VFTA 1LEGA 5I8KL 4PBXA 4RFNC 4FTVE 1VACA 5JXEA 4X8JB 3CGTA 5TE7H 4XCNA 4M6NH 3MJ7B 4XVTH 2VZ1A 3H9SD 4KUCD 3QUML 5F71A 3PHOA 2OM5A 3RWGB 1TQCB 3DHJA 4OM1H 4OZ4B 4XGZA 2BXYA 4JPVL 2HH0L 1UB5A 5I8KH 3VH8A 2NQCA 5CGTA 3IDUA 4QY8A 1KUMA 1KPRB 1YN7B 4MS8D 2XTJD 1LK2A 3QUMH 5BVPL 3ARGB 3VWJB 3OR7B 2ZG1A 4JPVH 4M7JL 5AWNL 1OSZA 2RGSA 2CXKA 5HVWA 3CLFL 1JVKA 1N5AB 1RJZB 4IRSA 5GISL 3RIAF 4PG9B 4F7CB 1IGYB 2CRMA 1NBZA 3V4UL 4YDKL 3QEQA 1L4IA 1MFEL 4P4KC 3IJSA 3SO3C 5BVPH 3DUUB 5IROC 5AWNH 1IKFL 4MJIB 4OIAA 1DEDA 2FJHB 1UVQB 2APTA 4RFNB 4Y1AA 4QOKD 4RQQA 4X6FB 5SX4I 1RZ8A 5DVKA 2C3VB 1CFTB 2YZ1A 3U2SA 1KCLA 3LKNA 1FJ1A 3MRKB 3UPAA 3QRFM 3ARBA 5D6DA 3CH1A 2W59A 5EBMB 1G9ML 4ZPVA 1MCRA 2AERT 4NBXB 5LXGL 2NW3A 3T08A 1BD2D 4P0DA 2V2TB 4NCDA 1T80A 3H9HA 1XGYH 4ZUSB 4LPWA 5JA8B 3K4AA 4DGVH 4S1RL 1QSEB 4U1JB 1CLOH 4AIXA 5KS9A 4X6EA 3PQYD 1UB6A 1R3JA 1NCCL 1P4IL 5DGRA 5EN2B 2VR5A 5K9OA 1U3ZA 3QXVA 1YY8A 3FN0H 5BS0B 3SO3B 2H8PB 5JW4M 1EFXA 4P57A 3CFDA 3CAFA 1K2DA 5ILTL 1S9WB 5CEYB 3N9GL 3DSFL 2IPUK 4OKVB 4UIMB 1YNLL 4XPAL 2VXSL 5KG9A 3UX9B 1NCCH 4XP1L 1UZ6F 4Y5XA 3V6BR 1X4XA 2DIJA 2AJ3A 4M6ML 5ILTH 2D9QB 4XPAH 3WJJA 1YNLH 2VXSH 3D3VD 1DFBH 4RFEA 4XP1H 4JO1L 5CGYC 3O6FA 4KI5D 4MNQD 5CHNB 2L7UA 2X4NB 4YFDB 5TDNB 3X11B 5BV7L 4LQ1A 4M6MH 4ZOBA 4F9PA 1Q8MA 2DI7A 2EIEA 1BFOA 2YD5A 5F3BB 3AREC 2PTTB 2HN7B 2IQAB 4JO1H 4PJEF 3S3JA 1H5BA 3W81A 4LLDB 2DLGA 5TE6H 5BV7H 4JDVA 4MQ7B 1D5XA 1U8IA 4IBLT 3W82A 2ADFH 4WVRA 1F4WL 3I6LE 2X7LB 1TETH 3WFHA 3L3IB 5D7KD 5GHWL 3VWJD 3RQ3A 5KS9F 5ETUA 2VYRE 3GIVB 5LAXB 5C9JB 1MQ8A 1MH5B 3LQAL 2XWBB 4UT9L 5GZOC 2BSED 2YPLD 5DK2B 3JBG7 5AAMA 5JW3H 1GCFA 1QHOA 2AI0H 5D7LE 5HD8C 4GW4A 5GHWH 2F5AL 1MHHB 5HI5D 1FL3A 3RWHB 4UT9H 4ZFOA 3HRPA 1ZV5A 3AREB 2CLRA 3TNMA 4JZJC 4PJFA 4A6YB 1U3HD 1T21A 4NWUH 2F5AH 4NZUL 1C5CH 1GOHA 4H20L 4S2SA 4H25B 4FFYH 4W6XB 1CLZL 1KCKA 1KT2B 3L5WA 3UTSB 3KXFA 1IC5H 3BT2L 5IEHB 2FSEB 2FHFA 4ZUTA 3BWAB 3JTSB 2YSSB 5ACLA 1PBYA 5I73C 2XOTA 4NZUH 5I1DA 4JRXB 3KYNB 1DBML 2JJTA 2E9JA 1IEAA 4H20H 3WS6A 4NKMB 1FYHB 2HT2C 5A43C 1XR9A 4QYOB 1TTUA 1AHWA 3EO1B 1RUML 4P4KD 4B5EA 5C0NC 3OJVC 1HWGB 3EDFA 4WW2A 1MWAB 1DBMH 3HAEG 1LO2L 4ONFL 2A1WH 5C6WH 4K9EL 3VXOB 1MRDH 4GRWH 4JCMA 1LE5B 5IVXB 5C0RL 1IAMA 3IF1B 1RUMH 4JZJB 1W0VB 2NXYD 4LPTA 3VG9C 1MFBH 1LO2H 3TGXA 1FPTL 3CNKA 1P4LA 3R8QA 3O3EA 1XCTB 4JY6B 4YHIA 4JFFB 5FGSA 1AR1C 4LASH 1FNGA 5C0RH 1Z5LA 3UTZA 2HP4A 2YEZB 3G5ZB 3PP3K 5TPWL 5CIPH 5D2NE 4FTVB 2DLFL 4Z7WE 3B4NA 1JGUL 5A3ID 5HHMB 2VDRL 1FPTH 3ARFC 2E9IA 4N9GB 4ORGA 4NUJB 3UTTD 1YEHL 3Q48A 4RFOH 2BSSA 4KJYB 4PJFF 4WFED 5LWYH 3ARTA 3I50L 5KSBA 1GOGA 3GSXB 4HIJA 3OX8A 5HVGB 4H1LH 4G8FA 2NY6D 4JRYB 4YHZH 2DLFH 4L4VA 1JGUH 2J7LA 3B9DA 3VRIA 1TJIL 4I3RH 1ZT7A 4O4YH 1GPOL 1YEHH 1F8TL 3L1OL 5I1HL 3IVKA 5JDSB 1BQSA 3I50H 4GKSB 3WNPA 1IQWL 3PWLB 4I0CC 5E94B 3W9DB 4D3CH 1SY6L 4PJXA 1NANH 1A7BA 1DBKL 2B8OT 4HS6B 2XZCH 1F4XL 3ZKNC 3IETA 1TJIH 4BZYA 2ZCHL 1I85C 1E4KC 4J1UA 1GPOH 3VG9B 1F8TH 3L1OH 1WVZA 3RNQA 3C6SA 3TBYA 3MRIA 2FLBT 1IQWH 3JSSA 4OFPA 4WW2F 5E9DE 1Q0XL 2I24N 3DTXB 5KOVC 1PKQB 4PD4J 3V5DB 3WJLC 5B39A 1F4XH 4Q9QL 1LNUA 4KVCL 3BMWA 2H41A 3B6SB 2ZCHH 4FQHB 2SEBA 5ISZA 3WKNA 2A83B 4AEIL 3BKJL 2BVOA 3ARFB 5F1OB 5B3JE 1DQJA 3TV3L 5IHBA 1Q0XH 3ARED 1G1CA 5JORA 1M71A 4Q58C 1S7QA 3ARRA 4Q9QH 3SJVD 1MCOL 4KVCH 1LE9A 3OF6D 4WWKC 3T2NL 2VLKE 1AXTH 4AEIH 2FECL 2X4TA 3BKJH 1KTKE 2ATKB 3VDCA 5L2JB 5FYKD 3ZDZE 1G7QB 5LCVH 4ODSL 1N7ML 5C0BD 3NIFF 3MRCA 4N5EC 1MCOH 4OCYL 5KSBF 3GMOB 4K2UL 3LEXA 1SBSL 5KANG 3T2NH 2AEPL 3ZE1F 5CD5C 5KSAA 2A9ML 5GZOD 5IKCA 4M61B 5GSVA 3PWPB 2HFEB 1TZGH 2CKBL 2A0LC 4ODSH 3MNWA 4H88L 3GMQB 3VXME 3SDXA 3SKJL 1AD0A 3PWUB 2AEPH 1MJJA 3HMXL 2PTUA 2EC9T 4I5BB 1ZVHA 2A9MH 3WSQL 3LKPA 5F7WC 1HINL 2CKBH 4U1KA 5IVNA 1DLHA 3FT3B 4IOIA 1T7WA 3O9WC 1J12A 3GSNB 3LQZB 3N0PB 3BH8A 5KN5A 1KJMA 4G7VH 4JFXA 4XBPB 4WWKB 3HMXH 3IFLL 4D9QD 4UTAL 5IMMA 1XGUB 4PJDA 5IJVB 3WSQH 5DT1L 2R1WB 1YEDB 1XGPB 1AGFA 4JFFD 1HINH 1MUJA 2CRYA 4RX4D 1U8KB 1WIUA 5CJXC 5FO9B 2X1WL 1Q9OB 3WYRA 5E99H 1VCAA 1K3ZA 1L9NA 4OLVL 3TN0A 2KDGA 5T1DL 4UTAH 3IFLH 4UOW1 1T5XA 1S7TA 5DT1H 2G2RA 2NTFB 3BZFA 1OT2A 2YA2A 5DJ6B 1DQLH 3T3PF 3W0WE 2AJSL 2F53A 2DI8A 1WGOA 5DD5L 1U6AH 4ISVB 4OLVH 1KCVL 5CKAA 4JZOB 3L3OA 3LPWA 3DURA 4Z7VE 5DEZA 3EYSL 2C26A 4PJHA 1TZIB 1HSAB 1ED3A 1T89C 4WTZA 3VA6A 2A77H 3G6JA 3JV4A 2AJSH 1J1PH 3QHTC 3O9WB 4OCWL 3P77A 4MD5B 5FA4A 1G9NC 4BSJA 5IB2B 1G9EA 4PJ9A 3O8XD 3FB7A 3RWDA 5C8JB 4HK3J 1BQHA 4OSUH 1AR1D 5CIPA 2QQQA 4OQ1A 1JPFB 1QTYT 2Y5EA 4NC2B 4PGBA 1WT5A 1DLFL 1LEIA 2KL6A 1ZHKB 4OCWH 4CN6A 1FN4B 4MB4A 4G6MH 3QZWB 1P6AB 5M7QA 3U9PH 4H1LA 4F3FA 2F8VA 5H2BB 1XGRA 4LARH 3TA3A 5DD6A 1DLFH 3NIDF 2GSGB 5DD3L 1NAML 4NNXB 2XZZA 4P3CL 4JY5L 1GZQB 3MBEC 3F5WA 3QXUA 5ANME 4ZUWA 4ERSL 2XZAL 4EUPB 1OVZA 1XH3B 2JK5B 4NQEB 4XPBH 5BOZG 1KEGL 3SGDI 1YEGL 1J5OL 5FIEA 4MNHA 3QUKA 2F54A 4JY5H 1FNSL 3WXVL 1JYXA 1NLDH 7FABL 3E6FB 2VLLB 4PRIA 1DUYA 4OZFH 2XZAH 3HCVA 4RDQG 2WANA 5F7HA 2WINB 3DROB 1J5OH 5ITBL 4L9LC 2G60L 4PJHF 2OSLB 4PJBE 2ICWA 1FNSH 3WXVH 3G6JF 2YUVA 4I8DA 5EO1A 1PSKH 5TF0A 2IANA 4KKAC 1JF5A 4X4ME 3GMPB 5DD0L 3P4OA 5C0JA 4HZLA 3S98A 4JKLA 1PD6A 1A3LH 2ESVE 4RNRB 1XF5B 1XIWC 4I48B 4AY0A 3SCMD 2G60H 4XI5D 3WUWB 1HILA 2R29L 4PY7B 4FZEL 5DD0H 3Q1SL 3MBEB 5DQ9A 1R3LB 3CC5A 4M43L 4Z7WB 3L3GB 4GLRI 1I1CA 3KLSA 3OKKB 2VDKH 1KTLA 2MQCA 2R29H 4LCCA 5I6XC 1U9KA 1CDJA 5CD5D 2V5TA 5GRWA 4FZEH 5EZIL 3C5ZD 5JR1L 2Y4SA 2VABA 4E0RB 3VW3L 1SMAA 2YA1A 5C71A 5TE4L 5IV2B 1PVHA 3GK8L 4XB8A 1T0NB 1TTGA 5E00A 1U3JA 1JWUA 3I6LD 4L9LB 4DW2H 5JOEA 1CU4L 5EZIH 5JR1H 2AJYL 1I7ZA 3QH3A 3VW3H 1CFSA 1YUHA 1D9KA 5DZLA 4R8WL 5TE4H 3GK8H 3IKCB 2KKQA 3QXDB 2ADJB 2XG5A 3B83A 2HMID 2XKNB 3NIGF 5DRZB 3DVGB 1MCNA 3O9WD 1XIWB 4TUOA 4KRLB 5D7LD 1CU4H 3UZVB 4K55A 1K4CA 2E6PA 1RD6A 2FHBA 4R8WH 2G5BA 3VI4E 4OJFL 4QGTA 2VH5L 1RUQL 2APWA 4LBEA 4FQXC 4HD9A 5JNYB 3G5XA 2VE6B 3H9SA 1EH9A 3B8SA 4FNLL 4NUGL 5I6XB 5I2IB 2D31A 3VXUE 3MOBL 5SV4A 3S96B 1JZ4A 2AXJA 1OSPL 3PV7A 4OJFH 2VH5H 4P59L 1RUQH 2JE8A 5K9KA 1IEBA 3K8MA 1QQDA 4JANB 2X5PA 4NUGH 3UMTA 4WU7B 4ODWB 3QI9D 3MOBH 3FONA 3UCRA 5D5ME 2P47B 1OSPH 2W65B 3QIUC 5IJKA 1OAUH 4P59H 2DYPD 5FV1L 3LPFA 4KJPD 4OUUB 1BQUA 3HNTL 1DEEB 1OLZA 4AJ0A 4OCRL 5E1AA 1S8DB 1W0YT 3V6OA 3T0VA 3RY5A 2QQLL 3U36B 3H3PH 4J4PC 3V0AC 4WUKL 4Z7QE 4HK0A 2OJZH 4G80B 4DAGL 3CK0H 3LQMA 4FQXB 1A5FH 1N5YL 3ECBA 2GHWB 4KZEL 3BXNB 3P11L 3HNTH 3IJYB 4OCRH 4JPIA 1XF3B 3ULSB 1LHZA 3U48A 1ACZA 3N06B 4ZS7L 2QQLH 2P5WE 1HH6B 4PB0L 4WUKH 4PRHB 3RI5K 1AP2B 5IQ7H 4KZEH 4F33B 4OFYD 2V9RA 4FMFA 3FB6A 35C8L 1RUAL 3MZTA 4KUCF 4LCIL 2H3NB 4KFZC 3WE6A 3GHBL 2ZUXA 3QIUB 2G9HA 3PQYA 5CUSL 4XC1H 5CP3H 4DN4L 3D69A 5MEQA 4OAWA 1OB1B 3B3IB 4RAVA 5F93C 2NX5B 2BY3A 1V3JA 3EZ8A 5AD0A 2R2HB 1RUAH 3K1KC 2AEWA 4D9LL 2GY5A 4LCIH 4RISL 4BH7B 4Z7VB 4KTEL 5GRZA 3GHBH 5CUSH 3MZGB 5IB1A 1EXUB 1WCBB 3SEPA 3VXNB 2IMMA 2I9LB 1ZKAA 3DI2B 3MRMB 1S9XA 5I75C 4WEBL 2A74A 1Y0LB 5IFJA 4RISH 3AU1A 1FV1A 4KTEH 3IFPA 1XIWD 5E9DD 4P2YA 4IS6A 5CEXA 1N59B 1FE8H 5AYQA 4YH6A 4BZ1L 1N4XL 4D8PA 4HIIA 3GJEB 2GI7A 2VB5A 4QHNB 3DRTA 1YDPA 4YXHL 5D7JC 5T3XE 2Q3AA 3VFRB 5C0GB 1ZHBA 3K4DA 5DRNA 4MA7L 4RGMC 1NDGB 2QKIB 1N4XH 4BZ1H 5F7DA 3MV8B 2VLKD 3CFCL 3QWQB 3WCYA 1EEUA 1JCKA 5ANMB 5TDOB 3W9EA 4YXHH 3EOYG 1GHFH 3OKMB 4G5ZH 2A73A 5IUSA 2V2XB 1ZLUH 2J8UF 1A4JA 1KCUH 2WUBL 4MA7H 4BZ2L 1N2RB 3BP4A 2VQTA 3NZ8B 1I3RB 3ZTJG 5I75B 3EJZC 2YPLA 1IILE 2GKIA 4J3TA 5DJCB 2CXGA 3VXMD 1F11B 2EKSB 4G8IA 2EE6A 5INDA 25C8L 4PJBB 4BZ2H 4NNPL 2ZUTA 5HDLA 4KAQL 5E4IA 1FZJA 3G9VA 4U31A 3MUJA 4PJ7E 4NQCE 4FQXD 4HJ0C 3CCHA 5D7JB 3U4EA 2ESVB 4UQ3A 1U3HA 3GGWA 4XVSL 2XNAA 3HUJE 3OWEA 5DJ8B 3BD5A 3ZKMD 4NNPH 4PRAB 4TUJB 4RGMB 1AGDB 1XT5A 2QADC 3OXSA 4KAQH 1U92B 4PLJC 3KNBA 4KI5F 5FYJU 2PETA 1AGBA 1Q72L 2Z8WC 4G8EB 3D39E 1YJDH 3CVHL 5F9AC 2HJKA 1P9MC 4QRQB 3OGCB 1M7IB 3ZT5A 1XF1A 4XVJL 1ORQB 2P7TA 1ZGLA 3BPNC 1Q72H 3FQUA 3W0WD 4MAUL 1EAPA 3MV9E 3OV6A 2OTPA 5KSVB 4BQBA 4KKNA 4GBXD 4XVJH 1QP1A 5BXFB 4AH2B 4TVPL 3FMGL 2QHRL 5IHZB 2YD2A 4LCYB 1GXEA 2VXQL 2J2ZA 1U3YA 4TYUA 2V2WA 9CGTA 1A3RL 1IT9L 2P1YA 4RIRA 4NFBA 5JOFA 2AV1B 3V0WL 1QD0A 2AJVH 2X2YA 1A9EA 1KCSH 2H32H 4A2LA 2C1OB 2Y06L 2QADB 2X89A 3I2CL 1XF2B 4UIKL 1FC2D 3C8DA 1EHAA 3BH9A 1CXFA 2VXQH 4D9RE 2HTKC 1E4WH 4D0DA 2DF3A 1A3RH 1XMWA 3MPCA 1QSFA 3DRQA 1NC2D 4NC0B 3UTTA 1I75A 1KNOB 1S78C 1YPZB 5EBGA 1RULL 3OAYK 1ZT4B 1CZ8L 4UIKH 3RL1A 3BPNB 1BP3B 4E5XB 3CDGA 5D6CA 4JO2L 3WIHL 1RQ5A 3BVNA 1RULH 1CD0A 1CZ8H 2BNQB 2IH3B 4HX1B 1GZPA 5FECA 3TYGL 5T1MA 5AG9A 1MLBB 4MDIB 3WIHH 4QXUH 1IL1A 4WIQA 3CD4A 1ZT1B 4NZTL 1JL8A 3SO5A 3T2QA 4UINL 3O6LH 3BEVB 4YPJA 2XPGA 3TYGH 3IAPA 4ENEC 1WBYB 3O4LE 3KYKL 3HI6L 4AT6A 1F4HA 3QEUA 3IDGB 2DMBA 2B20A 1CLYL 2F58L 5IG7A 4DCQB 1MPAL 1XGTA 2QV2A 5F1IA 5B38B 1SQ2N 1A02N 4UINH 3FHAA 2ESVD 2VUOA 2P5WB 4LEXH 4BKLA 3KYKH 2BX5A 4OF5A 1B6DA 2EXYC 1CLYH 4H8WC 1MPAH 4NQDE 1YYLL 3MLZL 3BAEL 4FFWC 4J3SA 1ZANL 5E2WL 4PGCB 5C0AA 5DLML 3BRFA 4JGUA 2HVJA 5EBLA 3R4DA 4GSDL 4L8DB 4RMTA 2EIZA 5FYLE 2EYRA 3NTCL 4YHNB 3PGDB 5E8PB 1IAIM 3FRUA 4GQPH 3G08B 2OMNA 3MLZH 5FKAA 2DBLL 3BAEH 1QR1A 1EZVY 3THMH 1X44A 4NO2A 5E2WH 4GKNA 4NQXA 3WL9B 4GAFB 4MD0B 3FO0L 2J6EA 4U1HB 5DLMH 5F9JB 4O2EA 3IDMA 4GSDH 3NTCH 3WFBL 4CW1B 3H42L 5CBAA 4OCXL 2ARJA 2DBLH 5FYJH 2Y72A 3WXWL 4N0YH 3AM8A 3QPQC 3FO0H 3TO2B 3OKYA 5E5MB 1RU9H 1IC7L 3LS4H 3BUYB 2Z91B 1FG2A 1BVZA 2CD0A 1A7QH 1NGQL 2GJZB 1UWXK 1BQLL 2DQCL 3H42H 3HI1A 4KQ4L 3ARDC 3BI9X 1T7ZA 2FEEI 5DHYB 4M7LL 4RZCA 1O0VA 1IC7H 5J8OA 1DSFL 1P7KA 2A2QT 2Z92B 1W2KT 3G5VA 1NGQH 1OTUC 1BQLH 1UEYA 4KI1A 3VXUD 2GIYA 4KQ4H 3SDDA 4G6FD 1U8HB 1A7OL 5EO9A 1E27A 2VRAA 3GMRA 3DGCR 5F89A 3LKQB 2BOCB 1DSFH 5K93A 1MCIA 4NHUA 3DX7A 2X42A 2R1YB 3SPVB 2DQJL 2P5EE 1A7OH 2WMPA 4Z5RA 2D4DA 1OGTA 3BJ91 4MD4A 3QDHA 4X4YA 12E8H 3WKMH 4XHJD 2Z35A 4W4NA 4C83B 3OB0H 1EEZB 2DQJH 3O8XA 1UKSA 2MKWA 3DV6B 3ARDB 1BBJA 3TYFA 1WITA 2HTKD 4PJ5E 1CT8B 1ZLWK 1P53A 2ITDA 3BKYL 1HHKB 4OT1L 1C12B 4NQCB 3SE3C 1HDMA 3QO0B 4XNXL 2VIRA 3BW9B 4W68A 3V0VA 3HC0B 5IB3A 2VLJB 5ALBL 1C7SA 4LSPH 1HOCB 5J13C 1UC6A 1WV7T 3G9AB 3BKYH 4G43B 3C2SA 2IQ9H 4XNXH 1M05A 4X4ZA 3D39B 1TTFA 1LO5B 5FXCH 1I7TA 5JQ6H 3U0WH 3DUHA 3ZYIA 1OWWA 2G75A 5E2TL 2XZQL 4ODVL 4S11A 2GUOB 1RY7B 1RIVL 2OTWA 4YEFA 4PB9L 4M03A 5GS2H 4CDHA 4G7YL 3VFMA 1FIGL 5C86A 4CJ1A 5C0CB 1T5WA 4LIQE 5IK3B 4P2RE 1PZ5B 1RHFA 5ICYB 5E2TH 2XZQH 4ODVH 2UUDH 1KTDA 5B22A 1RIVH 3MOQA 4JZNB 4PB9H 1UWEL 5HSFA 3R1GH 4KKLC 2VITB 1ZLVH 4G7YH 5DQDH 1LO4L 2B1HL 4ZXBD 1KXQE 3STLB 3S5LG 3SCMA 1OAXL 5J13B 3CSBA 3EZJB 4B7IA 4N0FA 3C5JA 3E6HB 3RIFF 4XRCA 4LCUA 2B1HH 2JF1A 1JZ5A 5C0EA 4JJ5A 1U8MA 5C6PB 3QUMB 1OAXH 1G9MC 5T3XD 4C59B 3FRPG 1LILA 2FGWL 5ESQB 4R2GC 2EDQA 4MQXD 3C5ZA 4WCYL 5J1AB 5DEFB 4FQCL 3UBXA 3RBSA 3D48R 4M3KB 3T4YB 5DRWB 4JCLA 4KJWD 5EUKA 4Q9BA 1R5IA 1BEYL 4EIGB 2R0WL 4M62L 4WCYH 3RWJB 1L6XA 5CWSA 3WNKA 4FQCH 5IBLC 4YJZL 4R97C 2WWKO 5DK0B 5HGBA 4YDLC 3QPQD 2ZKHL 1MI5B 2PYEB 3ULUH 5D7LA 5H37H 1BEYH 2K9UA 5GGQL 2R0WH 2YRZA 4M62H 5H94A 4HEPG 1RV6X 4TTGA 3O4LB 2IADA 2BC4B 2DL9A 3RA7H 1X5IA 1J05A 5J12C 1MCPL 3O45B 4U6HA 1MCEA 4OV5A 5I1LB 3L3HB 4EI5B 4OKDA 5EZLB 1P7QA 1RVFL 3HE6D 4R2GB 3TPKA 4ZNEE 2VZSA 5J4MA 4LCWA 4X5WA 3QCVH 3V6FA 1H3XA 5GGVH 2BVQB 3QDJE 5DEGA 1G7MB 5KW9L 2KQMA 3MRGA 3S37L 5JW4N 4OUOA 3S88L 3BGMA 5BV7C 1U41A 2BRRH 3D39D 4PP1C 4XXCA 2CO6B 5HGAA 1RVFH 4QRRE 2P8LB 2LU4A 2P49B 5HYSG 3QI9A 4K94L 4M1CC 4HS8L 2UZYB 1RFDH 1U2HA 4B53A 2DQHL 1RJLB 3HLAB 1RJCA 4YDLB 3S37H 2DYPA 3LIZL 2EH7L 4JM2A 2GAZB 3MV9D 5J9PB 5LQBL 1IM9A 1RIHL 1T0MB 4MQSB 4HS8H 3N1FC 2X70A 3TO4C 4ELKB 5F1SA 1NBVL 2DQHH 1WZKA 1A1OA 3MREA 5J12B 1IE5A 3LIZH 3H2WA 15C8L 1MVUA 3LQAC 1B88A 1VSCA 1NANI 5HGHA 3T1FA 2YC1B 5DJ2B 2AQ3A 2HWZH 2DQDL 3O6ML 4JKKA 1JNHB 4FXKA 3DHMA 4NSKB 3RWCA 1UXWA 5T5NF 5HPMB 4JB9L 3IU3B 1CQKA 4Y19A 4RAUB 4O9HL 4D9RD 3TIDB 5BV7B 4MSWA 2PO6D 4OFYA 2PCPA 4JG0L 3X12A 4KWUA 3L5HA 4DUVA 1QRNB 2ZOKA 4GMSL 4NQVB 1FO0L 5L9DH 3C87A 1AE6L 2UWEE 4L8BA 1FFQA 2A6JB 3LB6D 4NT6B 2Q8BL 3CVIH 1H15B 3LH2L 4QT5B 1AIFA 1EEYB 4N8VB 2FR4A 2BXZA 3BP6B 3S37X 4TVSa 2XKUA 1FO0H 3TO4B 1AE6H 4Z7OE 2P5EB 2XT1B 3AC0A 2Q8BH 4X7TB 1ZS8A 3DECA 4HQQL 1MFDH 4KGJA 3MTRA 3QJHB 1IM3A 4YAQB 1CGXA 4CVUA 1U8JB 4KKLD 1DVFA 3IDIA 4JM2F 3CFBB 1JFQH 2DOCA 3OG6B 4XX1E 1RUKH 3V52H 1HK6A 5DJDA 1ZEAH 3MUY1 2MFNA 4HQQH 1J88A 1U93A 2IWGA 4JFQA 5DURD 5BZDB 4NRZA 3T65B 2ZSWA 4K9EC 4KKBC 4M93C 4CADB 1H8OA 4PJ5B 5CJ8A 3O4LD 4FXGB 4JLRA 4HV8A 5IOPA 1X5AA 2AK4A 3KPRE 3DX8A 2CLZB 3D9AH 4Q6YA 4K23L 2YUXA 1A6ZB 3D85A 4WJ5A 5F9WC 4XNMA 3PDOB 2Z0BA 5I19H 5J6HA 4L4TE 1M1SA 4NZJA 5JO5B 1UCBL 1FYTB 1Q9WB 4NQDD 1HYSC 1JK8B 4WDIA 4ZO7A 3MGAA 1WTLA 2AQ2A 1TZHB 4BUHA 1CWVA 5DMIL 4XVUC 3FQXA 3I3EA 2ITCA 1FNLA 2ED7A 3O11B 5ESAA 1UCBH 5FYLD 5C0FA 3HNSL 1UA6L 4FFZL 4WNQB 3P0YL 4HWUA 2M8XA 3FZUC 4R7NA 1EJOH 4AM0A 4JQXA 3T77A 4LSTH 2D4FA 5IMLB 5MEPA 4UBDC 3T04D 4M93B 2EO1A 1HCFX 1F6AB 1FL5A 4DZBB 3HNSH 5F1KC 3S4SA 1JE6A 3HFML 1M6OB 2GT9B 4NGHL 1H3UA 4P5KB 5MERB 4WW1B 1BF8A 2FX9L 1AGEA 2AK1L 3FCTA 4PRDA 3L5XL 4YNYA 4DGIH 4HFUL 1P7HL 4YFLF 2PTVA 1CICC 1NEZG 2A9NH 3MRJB 3HFMH 1QO3B 4NGHH 2XACC 3WNMA 4PP1D 2AK1H 2VDPL 3L5XH 3Q5TA 5B3JF 4OZIA 4M1CD 2MPAH 1P5UA 4HS3B 2R8SL 3VWKC 3VD5A 4M8QA 4XWOD 5AYUL 3CUPB 2ENYA 3QDMA 1FFPB 2R15A 1YEFL 1U58A 3VXSE 5D1XD 5ID1B 1SBBA 1VFOA 3Q3GA 1WC7B 3GSOA 4PREB 4GBXA 3I02B 2X41A 1NKOA 1S9KC 2R8SH 3TO4D 3FO9A 5AYUH 2YK1L 1YEFH 2E7LC 3PJSB 5CLWA 4ZTPH 5E2UH 2Z8VC 4X80L 4Z7UE 5EU4A 2FWOB 4JO4L 1M7DB 1QLEL 1HHHB 2VXVL 1CICB 4CVZB 2HLAA 5GIRB 5E6ID 3N1MC 4C56E 3GM0A 3LCYA 4X7DC 5HHOA 2OMBA 4KHTL 4XWGL 3OKEB 3RVVC 1FL6A 3HI5L 1MJ7L 2FH6A 1NC2A 4PP2B 3TNNA 2HJLA 3VWKB 3S3SA 1KG0B 2BP3A 1INDL 4U1SA 2IPKB 5B4MD 2NY5L 4DK6A 3FFDA 1A4KA 4QRUA 3MO1A 4MVBC 5JPNB 4BQ9A 4KHTH 4XWGH 3TBTB 1KB9J 3HI5H 1FVEB 2CIIB 4HGWA 2VOTA 5CSZB 4RAHA 3L7EA 3MJ8A 3DVIA 4QRRB 5FOBA 4Z18A 5DR5L 2NY5H 4OZIF 2VDLH 1KB5A 4CJ0A 2WWKT 1KPVB 3K74B 5C07D 4CN4A 1KLUA 2BHUA 1IGML 5DJXB 1JGEA 2CRZA 3PL6C 1A7RH 3D2UA 3QUZD 3TVMD 5DR5H 2OL3A 1IGFL 3RZCC 1A1NB 4YHPB 1AKJB 1BOGA 2XWTA 2R4SH 4P2RD 1HXYB 1HHIB 3QJFB 3T09A 4KKBD 2BVPA 5ICZA 5JHDA 1IGMH 5HYJE 3M1BA 3KPPB 4PRNA 2XQBL 1VADA 5IMOA 1I1AC 1WLHA 2I07B 4HWBH 1IGFH 5D7IE 5FO8B 3QQ9C 1CGWA 1DBAL 1MIML 4MCYA 3K2UH 2NY2C 3MRNB 1A6WL 3HZVA 4LLMA 3IDJA 4TSCL 2NY7H 5J6GA 1IZJA 2WBJA 3Q5YA 1UXSB 2P46B 4KHXH 3MLWL 2R2EA 4L3CA 1HYSD 1MQKH 1NFDA 1DBAH 2NR6C 4NN6C 2HT4C 4OF7A 4NNYA 1OF2B 3EOAB 3MRDA 4HAFA 1CDYA 4NQSA 4XVUD 2FLRT 1BM3L 4KROC 4PRBA 1A6WH 2V5RA 4WEMB 2AV7A 1CGVA 3PL6B 3MLWH 2D03L 4LPYA 3RZCB 1QNZH 3FZUD 2EZ0D 1NCTA 3O3UN 4QTHA 3B9AA 1LD9A 3QEGH 4JFOA 4GOSA 3FOMB 5HYQB 3HS0B 1BM3H 5AZEL 3D0VA 4Y4FC 1T6VN 3MCG1 4X7CC 5FGBC 1A7PH 3D25B 4I2XE 2APVA 1I1AB 3Q6FB 1RMFL 2PXYB 4HHAB 3U6RB 4Y2DD 2W60A 3VGBA 3ORJA 1UYWL 1QPXA 2NY2B 3FFCB 2CIKA 4LVOC 4LK4A 1CICD 1QLRB 4QXWA 3VXPA 4AIOA 4N0UA 1RMFH 2MTPA 3DX9B 1S7RA 3ISWA 1OARL 4ETQA 2Q7YA 3KPRB 4NN6B 5EA0H 3IT8D 3S35L 1T2XA 2ZG3A 4OZGA 5EU6E 1UYWH 1SYVA 1JNLL 1FZKB 1ETZB 4Q9CA 6FABL 4KROB 1JYWA 5BVJA 2VO5A 3GZKA 1IAIL 3EHBD 5CSBA 3VRLF 3O2VL 4L4TB 3TWCH 5EB9A 1NAMB 1OARH 2XFXA 3KPNB 3QDJD 1S5HA 3S35H 3RWIB 1F90H 4XCEA 1NFDF 2Q86B 2A6DA 1JNLH 5C7XH 6FABH 4QRRD 1KLGB 2YD6A 1O7SA 1IAIH 5CKGA 2XQYG 3CDCA 4AL8L 3C8KB 4F8QA 3GJFB 4R4FL 3VFUA 5D5MA 4EBQL 4PJCA 4PJGE 3V5HA 4ZAKA 2P8MB 1YY9C 5ICXB 1D6EB 4R7DA 3QG7L 2YR3A 4R4ND 4LVOB 3TCXA 4HFWB 4YZFE 4AL8H 4R4FH 3FB5A 2D3VA 2FB4L 1JN6A 2BCKB 5CEZE 4OTXL 1ZA3A 3ILQC 1OAYH 4MNGE 4U6XB 2HVKA 4CVXA 1JWMA 1J8HA 3QG7H 3MLUL 3GMMB 3TZVC 1G6RA 3EYOB 2JB5L 4ZNCD 3F12B 2FB4H 4KDTA 4YHOL 4OTXH 5I1EH 4PJIB 1I1RA 4PGJA 2GTZA 2FATL 4ZFFB 5JMOC 1HZHH 3JVGA 3QFJE 3VI4F 1KYOK 3S35X 3QO1B 1AO7E 3ZSSA 5DUBB 4X99A 3DVNA 4OZGF 4KK5D 1BFSA 3F8UB 4LEOB 1YQVL 2UYLA 2W0FA 8FABB 5F3HA 3BEWB 2FATH 4BYHA 2IAMC 2EYTA 2QTEA 3VXSB 1WTGT 3GBML 5KAQG 2GCYA 5DJ0B 5EOQL 1OGAE 4KGLA 1SJHA 1BVKA 1B2WL 3E0GA 3GSQB 2X4QB 2XWJA 4Z78A 2XA8L 1A6VL 1JPGA 4JFPB 1CL7I 4P2OC 5J1TC 1YQVH 2ARJQ 3NZHH 1G0DA 3WFCL 4MAYA 1CE6B 4PRPB 3SQOL 2P44B 5D5MF 1IBGL 4PJCF 5SWQB 3GBMH 4HJJH 5IHLB 5EOQH 4YBHA 2PYFB 3D18A 3TZVB 5HHQA 3TIEA 1JMXA 1RK0B 5DMKB 4QHMB 4DKEL 3VG0L 5JHLL 3GHEH 5F6HJ 1A6VH 3GSUA 3DXAE 2AAVA 5J1SC 1NC4B 4OCLC 4JG1L 3H7LA 3SQOH 3VJ6A 1IBGH