4ONGH

Fab fragment of 3d6 in complex with amyloid beta 1-40
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
210
Chain Sequence
b'EVKLVESGGGLVKPGASLKLSCAASGFTFSNYGMSWVRQNSDKRLEWVASIRSGGGRTYYSDNVKGRFTISRENAKNTLYLQMSSLKSEDTALYYCVRYDSGSSDYWGQGTTVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3D6 FAB ANTIBODY HEAVY CHAIN
molecule tags Immune system
source organism Mus musculus
publication title Crystal structure reveals conservation of amyloid-beta conformation recognized by 3D6 following humanization to bapineuzumab.
pubmed doi rcsb
total genus 45
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2014-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ongH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ongH01
1J05B 1TFHA 2VDKL 5BZDB 4BH8A 4RZCB 3LIZH 2BY1A 1DVFC 2Y7QB 3MACL 3QI9D 1EHXA 1ZLVH 2DWEA 3DBXA 4L8SC 2D9QB 1UVQA 4LSVL 1FG2A 2A6JA 5GS0D 4Z8FL 3PQYD 5BS0A 1U3JA 1TETH 1O0VA 1VGKB 3QUXB 4GOSA 1NDMA 4HK3N 4HAGA 2CRMA 4R8WH 1HH9B 2VZVA 5IVXA 4DGIL 1NH6A 1NCNA 4HUXB 2FX7L 1MF2H 3QG6B 4LVNC 1LWRA 5DMIH 2SEBB 3WFBL 5C0GB 4L3ED 5GGUB 2A6KB 1JTTA 1QFHA 2ICWI 2R56H 4KRPD 3UYPA 5I9QC 3LKRB 4LQFL 5CZVL 3MQIA 4PJHB 2V2WA 1QRND 5F1NA 3EYQC 3QNZA 4UOW0 4MNGE 3JWOH 4JFED 4WU5A 3ARFC 1XEDA 1BLNB 2R1WA 4YUEL 5CJOH 1HYSD 2EDXA 4N90E 5FYKU 4KKAC 2F5BH 3NAAH 3GSNB 5SWZE 5MERA 4F37K 4ZXBB 1L4IA 3BD3A 4MAYC 2CDFA 3AU1B 1CFQA 4AEEA 4RDQF 4D94A 2NX5A 3TZVA 3FO0L 1FHGA 2VAAB 3MC0A 5CWSA 1A6UL 3Q5YA 3O3AB 5EO0B 2W91A 2GY5A 2GTZA 3BE1H 3LKOB 5EIIA 2HLFD 1DBML 1W0VB 5L9DH 5KOVC 1E4JA 3MLXL 3SDAD 4F33B 4XNUL 5CCKH 1BZ7B 1IC4H 2QQLH 2UYLA 3RJDA 5ERWA 1B0GB 3PXHA 4HS8L 3F62A 1VFMA 4KVCH 3UTPD 5BV7H 5I66B 1WISA 2A2QT 1BJ1J 4CVZA 1X7QB 9CGTA 5JW5A 1CBVH 4S1RH 3MLSL 1R3LA 4FQJL 1GIGL 4Y2DB 4ZFGH 4K9EL 1FIEA 3WL9A 3VGAC 5BJTB 5HXMA 2R69L 1BWMA 4JFYA 4YHLH 3GIZL 4ZOCA 1KEGL 1YEJL 1I4FB 1GIGH 3OKMB 4XVUD 4LPXA 2A73B 3G5XB 5F7EL 3VXTB 4ZSOB 1QRNB 5DJ6B 4Z7UF 4GKNB 1FO0B 1NEZB 2HFFA 4PJ5B 1TJIL 5CSZA 4XHJC 3U6RA 3JVGA 1CT8A 4QHLB 4HWEL 2D03H 3QSKB 1JZ4A 2AJUL 1LEGB 1KCKA 2L7UA 4ZXBD 1JRHH 4XVJL 4JKMA 1M6OA 4YXLH 4PRBA 3VFRA 1BFOA 3V0AC 1OT1A 1C12B 3G5VB 5L2KD 2CLVA 4P4KD 3RWJA 4P2RD 4HW6A 1H3UA 2O5ZL 1IKNC 4RA3A 4YDKL 4TTGA 2YWYA 3QB7C 4IRSC 2I9TA 1HYRC 1T21A 3SDXF 4EUPB 4ELKB 5IHUL 2J8UB 3WIHA 1UB5A 3EBAA 4NRYA 4LLVB 4LVEA 4MSWA 2AP2A 3OJVC 3BAEL 4R0LC 1LDPH 2VZOA 3VXUE 4C83B 1I1YB 2ARJB 5EZJA 5I30L 3G6DH 1CDCA 3SDCC 1U95B 5HYJE 4ELMF 1QEWB 5D1QB 2WAHA 5IESL 1ZSDB 3CH8A 1OAQL 3DO7A 1GCFA 4H8WH 4P5TA 1A3LH 2GKIA 3RWCA 1OHQA 4O02H 1ZANL 1G7LA 2WWMD 1OVZA 3MXVH 4MB3A 1T03H 2VNCA 4OCLC 1A7OH 3U48A 2VQ1B 1XGRA 3BKYH 3QDJA 3E3QC 5JW4R 4V1DB 1NJ9A 2D3VA 2H9GB 1JP5A 3RTQC 1F13A 5DD0H 4MQSB 4KQ3L 3RBSA 4HWEH 1HHJA 1M7XA 5FDYA 2NTSP 5DRZA 7FABL 5GGTA 5KSAB 4QRPA 5GRJL 3N06B 2AXGA 2HT4D 2DM7A 2QSCH 4F2MB 4P46B 3DV4B 1PJ9A 4LRNH 3RWGA 3MV7B 3QIBC 2CDGB 1QYGL 1ZT4B 3BD4A 4FQIL 3T1FA 2BY3A 5C09B 3QPQD 5JNYA 1JWMA 1YEDA 5HYJA 2A6DA 1MRCL 2EIDA 1PY4A 1UC6A 4G42A 2FEEL 1ZLUK 1GZQA 1TETL 1FZOB 3H6JA 4JZNB 3ZDZF 4MS8C 5I6XC 1FV1A 3H9SA 5ILTL 4APQB 3S4SG 2ILLA 4G6KL 5FM4A 1J1XH 3LY6A 5BVJA 4PP2A 1MHPL 5H35A 2V5RA 3X11B 3B4NA 4HIEA 4P2OB 4G9FE 5CJXA 5GRVL 1T20B 4LCWA 3ZKMD 2KQNA 3WFCL 4OZIB 3FQWB 5D7LB 4HGKC 1X5ZA 4QRPE 1VA9A 5T3XL 5HHOD 5FYJU 4BKLA 3FO2B 1FL5B 5E9DE 4DZBA 3UO1L 4RMUA 5CEZD 3MLXH 1RY7B 3SKJH 4O2FB 4X5XB 5BVPL 5EOCJ 1KJMB 1YMHB 4JFPB 1QSEE 3VDBA 4JHZA 3QZWB 1AKJA 4DTGL 5HJ3B 3O9WD 2E7HA 3LH2L 5FYLD 5E2TL 4YPJA 4K71C 1GGIL 4U1KB 1S7VB 3HNSH 1D5BB 5K9JL 3IVKB 4FZ8L 2Z8RA 3QI9A 2PCPA 3ARED 1KCRL 2CRIA 1GL4B 4LCYA 2NW2B 5JHDD 4JRYD 5I1CH 4NZRH 3STZA 4NNXB 1X5JA 2CUIA 2OXGA 1AP2A 2VXVH 3LEXB 3TLRA 4M7KL 4D0CA 3WXVL 4XAWL 3D0VB 5BJTA 1PKOA 4GG6B 3KPNB 3DTXB 3U7YH 4MDIB 5F9AC 3OKKB 4X7TA 3QNZB 1U8HA 4P46D 2WZPD 5HYSG 5E2VL 4YHPA 3MLWL 1ZTXL 3AS2A 3IU3A 1OTTD 2JK5B 1A14H 1FPTH 5C0JA 5FK9B 5C0AB 4GG6E 2R0ZL 2CJUH 1KCVH 3KNBB 2UVEA 3NPZB 5FO8B 5DQJA 1FC2D 2EE2A 5I15H 4PJHF 5LQBH 2UY7A 3OTTA 4RIRA 3MBED 1U8QB 4M7LL 3LS4H 1U8MB 3BKCL 5IESH 4ODHH 4LARH 4RDQG 3LQMA 4XGZB 1XGPB 2NY2C 4NGHH 4JDVB 4QRSB 1Y18B 2KPNA 4GW4A 4U1HA 3JVGC 3RQ3A 1A7QL 1DANT 3BWAA 3A6BH 1NDGA 2OK0H 4GAGH 1P9MA 5EUKB 3S37L 4Y5VC 5TDNB 3UTZB 3ECBA 4Z7QE 3OAZK 3RZCD 3L6FB 2X9YA 1MCLA 2DTML 5EC2A 1ZHKA 3NIDE 5DRNB 2FJGB 3LRSA 1JTOA 4HGMA 4BH8B 4LLUA 4AEHL 2V2XB 5DD5L 2VDMH 4AG4H 4I9WE 3HUJE 4OF0A 1A7RH 3OB8A 5JHLL 4HDIA 3IJSB 3EOYG 1MWAB 2ICCA 4EI5C 2W9EH 4XP5L 4BH7B 5J11B 1QP1A 2AI0H 4NJ9H 5DEGB 1DQDL 5IR1A 2I9LA 2CXKA 5F7EH 4GRWH 1U36A 4IJ3B 4WI2A 3CNKA 3C9NB 4C58B 1PEZA 1FDLH 1A5FH 1JNNH 2C1PB 4P2QE 4K94L 2Z91B 1I7ZA 4Y1AD 4CDGC 5GRWA 1UJTA 4KHTH 4B53A 4G7VL 3T1FB 5FO7B 3N85H 3BP6B 2CIIA 1T2XA 3LS5L 1G7PB 2PF6A 5F7NC 2VOTA 4P59L 4X6EA 4HWZA 4JFOB 4X4XB 3NOIA 4XNQB 2Z0BA 1UGNA 3FOMB 2AVGA 3NCYP 1N8ZA 1RJYB 4Y7MA 5D7IA 4YWGH 4XHJD 3RBGA 2IFFH 4HJ0D 3K2MC 1SJHA 3GHEH 4F7PA 1FNLA 4ZSOA 2WWMC 1D3CA 1UEYA 1SEBA 1I1YA 5J6HA 1QKZH 4OFIA 5J1SC 3B9KC 4U1LA 5GS1A 3QNXB 4KK8C 5DR5L 1FL5A 3H9ZA 4ZNEA 3CDCA 3S97C 1U41A 3PGCA 3HZMB 1DBAL 1FYTA 2LVCA 3G08B 2V5TA 5D2NB 1JYVA 3KLHC 3VI4F 3SQOH 4H0IA 4IOIA 1I7TA 3RI5K 1Z5LA 2FO4A 5IJVA 4OFYD 4PREB 3U4AA 5J12B 3MUGB 4LSSL 3F7PC 3GMRA 3MRLB 3QUYB 5E08L 4E5XA 3CUPB 4OLVL 3D3VD 4N8VA 4D3CH 2B8OT 2A0LC 1W0VA 5JHLH 4G8FB 3TO4D 6CGTA 1LILA 2F54B 4G9DA 3W11C 1C08B 1EEZA 3UEZA 3WLWD 5GGSY 3VFOA 5I19H 3PQYB 3ARPA 3VXRA 4F2MA 3ZE1F 3HN3A 2FIRT 3FJTA 2F8XC 5HVFB 5CHNB 4P5TD 1HH6A 2BMKB 2ADIB 3ARGA 3L3OA 4U6HB 5CGMA 5FCSH 4PJFE 1CGSH 1AFVH 2BRRL 4BZ2L 1GC1C 3QQ9C 1IGCL 3FB7A 3S37H 4H1LH 3VFMB 1QSEB 1BZQK 1QZ1A 1JF5A 4IHOB 5EIVA 2F19H 1A64A 1HZHL 5IW1A 2WMPA 3QWOA 4ODWA 5EIQA 1JGVH 5FOBB 4Y4KA 5FK9A 5CJQL 2V5MA 4ZTPL 5E5RB 2DRUA 1E0OB 3AM8C 5HVHB 1A02N 1EZVX 5F9WB 2YA1A 2EYTA 2X7LA 3B6SA 3C6LD 2D4FA 4QXGH 3M17B 1NFIA 2C26A 1YMMA 3SDDA 1KULA 2HMID 3DV4A 1PKQE 4DVBB 3NA9L 5DC4B 1KPUA 4LOUC 1U93A 3I9GH 1MCFA 4JM2B 4JHWL 2A6KA 4ZO8A 2EYRB 1ADQH 2PO6A 2IPUK 3LZFH 3UTPE 3KPRD 4K3DH 5B3NA 2DD8H 5ETUA 4PGCB 4OLUH 3RTQA 3VWKB 3MX0A 4NKOA 1FRGH 2YC1B 4L3CA 4X83A 3ZTJG 1FL6A 3T0EA 4MD5B 4M61B 4G8GA 1HQ4A 5L2JB 2ITDA 4GRLD 2Y5EA 3ULVL 2RAMA 2GSIA 4AJ0A 1VACA 3CSYA 2XNAA 3TO4B 2JCCF 3CXDL 1YEHL 4R0LA 3GSNH 3SGDI 4JHBA 1J8HE 2HTLC 1AKJD 1PKQA 2NX5B 3D1MC 4GLRI 5HI5D 4CMMB 1HI6A 2VLJD 3QUZD 5DJ8A 1B6UA 4JFEB 4MNGB 1SBSH 1NBQA 3MGTA 4BA8A 4JFPA 3RWHB 3SDDC 4HUVA 5E7BA 3T0XA 3TN0B 5IR1B 3HG1B 4WJ5B 4UI2A 5IB1A 4OB5H 2FWOA 2XKSA 4QTIH 4NQCB 5ICXB 2EKSB 5B39G 3M1BB 4QTIL 1KNOB 3MTRA 1DQTA 4G8IB 4TULL 4PUBH 4FTVB 4KMTH 3VMPA 3MO1A 3K2UL 3FQNA 4JFZL 5J11C 2IH1A 3C8KA 1CU4L 4OZGA 4EXKA 5L0QC 4KHXH 1F97A 1A7NH 1AGDA 2C7UA 3CFCH 5C9JB 4MD4B 4HWBH 1IAIL 4L8SB 1JF1A 3T8XB 5DWUL 1ZEAH 2YK1L 3MLVL 3D2UB 1EBPA 1PX4A 3K1KC 3BWAB 4PTTA 4J4PC 2AXFA 4QRRA 1BQHG 4HMEA 3NMEA 4K7FB 1L7TH 5MI0B 1FG2B 4WFED 3BEVB 1UM4L 4U1JA 1RK1B 5BOPA 5KVGH 3QPXH 4X98B 4ODHL 1S9YB 1U58A 4M1CD 3IKKA 1VADA 2PETA 2XQBL 4NUJB 2FEDD 5J0BA 4Z7VF 5DLML 3Q1SH 4Y5VB 3TBYA 2XWBA 4BFEA 1KLUB 4TUJB 5F8QC 3DI3B 1OCWL 1LHZA 5FYKE 4QTHA 1MLCA 4C54A 1I8MB 3TYGH 3PL6C 2CLRB 4KH2A 1JF6A 1MHHA 1KLFA 2BHUA 3BDBA 5EOQH 4HUKB 4PJEB 3CPLA 2QR0A 5C08E 3QUXC 5GS2H 2X4RA 3S8WA 3W0WE 2J4WH 3UJTL 2WP3T 2NY0C 2NY5H 3IU4H 2DI7A 1LO3H 3VXUA 3RU8L 2VLJB 3QUZB 4P57B 4U3XA 1T89A 4AMKH 3T0EC 5KANI 3X14A 3QUMA 2DM2A 4PGBB 1WGOA 2EEBA 2XRAH 1ZHNB 2D0FA 2J8UA 3L3OB 1JPFB 1T5XB 1MCPH 4WHTA 3T3PF 2A6IB 4MNQE 1U3HA 3Q6FB 1GVIA 5I1JL 4FTVD 1IAMA 2VSDA 3WNPA 5LBSH 1DN0B 3TVMD 4UNUA 3DROA 4X9HA 1J5OL 3EYFA 2F53B 2YRLA 3K8KA 3PDOB 5DTFA 3HR6A 2VQ1A 1ND0A 3WFDL 4YHZH 2O5XL 1RZIA 3QUXA 5GSVB 2E27L 4PB9L 5HYSA 3LQAH 4GLRH 3CFBB 1CGVA 2DQDH 4D8PA 3D6GA 4Y8DC 5A1AA 2C3XA 4NO3B 5D93C 4HK0B 4KDTA 3P73B 3VJ6B 4LSSH 5E08H 2VL5B 3SOBL 4PJ9D 2AEWA 4KDWA 5FUCC 1TMCB 5IBLC 1OAYL 1X5HA 4GS7B 2LTQB 1RQ5A 2JF1A 5J1AA 3A6OA 4HZAA 4ZO7A 4WW1A 3SQOL 4M02A 3L5XH 5IW6B 2BSTB 4V1DD 3NZHL 3HE6B 4Y2DC 3CK0L 4M43H 2DAVA 4HJJH 3TBVA 1NUFA 3EYVB 3SDCD 1KTRL 4S2SB 3FO1B 5I75B 3H3KA 1E4WH 4KJWD 5F21B 3LSOA 3IJYA 4WENB 4MD0A 3MV7D 1SYSB 4KTEH 3X11A 4GH7B 5LKNA 3CH1B 5IUSA 2D7QA 4MQXD 2F74A 3BYYA 2NY5C 2N1KA 3JV0A 5F89B 1YEEL 1EPFA 1G7JA 5BQ7A 2CDFB 2EH8L 3RUGE 1KTKE 1TJGH 3VXOA 5IBUB 4O9HL 3ARDD 3RP1A 4ISVB 3VWJD 1QLFA 1BD2A 1T1YA 2ADFL 1U3ZA 3MXVL 1T03L 2JJVA 3NGBC 3S37X 3QFJD 1UB6A 1Q9KB 3E8UL 4QHUB 4JRXD 3S34L 3MA9L 3D3VE 4H26A 2C5DC 3EGSA 4QXGL 4XAKD 3DVGA 5FIEA 3UTSA 3RGVB 5LGJA 4TRPH 4F57H 2C4FT 5C0CA 1Z2KA 4GBXB 1ZT1A 2EICA 5SWQB 5ADOH 3G6JB 3PHQB 1A1OB 2YR3A 2R23A 5F6HI 2VDLH 4NM8L 1XF5B 4HLJA 4MJID 3DUUB 3MGAA 3DTXA 1MCNA 4GG6A 2OTUA 2HVJA 1QEWA 2DDQH 5HD8D 1AR2A 4QXUH 5I8KL 3RL1B 4N0FA 4U05A 3ZYOA 1OSPH 3QEHA 3FT4A 4X6DF 4XVJH 4PJCB 4P9MH 4NHUA 1RPQA 3OQ3B 3O4LA 5D1ZA 1YNLH 4ENED 1P6AB 1QSFB 2VIRB 2HH0H 4JB9L 3VXMB 1QFWL 1FNFA 4OUUB 5DQJB 2KL6A 3P9MA 5TE7L 2CO6B 4TUKH 4D3CL 2DI9A 1QLRB 3RTQD 5MEQB 1U8QA 1P5UA 3RFZC 2J8HA 1JGLL 3UXFA 4HG4K 1U8MA 4GRLA 2WIIB 5E5MA 4MAUH 4PB0L 3U4BL 3MRQB 1DLHA 3BESR 4U7SA 4MD5A 3MRKB 2H2SD 3QPQC 4K9EH 3VWJB 1J86A 4PJHA 3INUL 4FQLL 5I1DA 5C0ND 5GZNC 4NCDA 1N59A 3AAZB 4JRXB 3MLZL 2QHRL 5CBEA 1OGTA 1RIUL 3D0LB 5DUPH 2FX9L 1YPZB 3UTTE 5DFVD 1X5GA 2NCMA 1I3VA 1BQLH 3RGVD 1NKOA 1S7TA 4LLUB 1FNAA 4X4ME 4OLWL 2OL3A 3EHBC 1A6TA 1HXYA 2BP3A 4XPFL 3I84A 3VXNB 4FTVE 4YHYC 1MLBA 2GJ6A 2CIKB 1RK1A 2RB8A 1RZIB 3IT8D 5C86A 2AK4E 5EN2A 5KTEL 1Q94B 1J9CT 4JFHD 3RVWD 5HHMD 5D70H 3WLBA 1UKQA 4KJQC 1FNEB 4PRID 5GRVK 3FQUB 2H32H 2OS7A 1RUAH 5FV1L 2P8PB 1UJ3C 2DLTA 4QWWC 5C0IA 2M1KA 4LVOC 1FSKC 2VMFA 3ZTNL 4XC1H 3D2UA 3LN5B 1RZGB 1BAFL 3WFZA 3FN3A 3MNVB 4EOWH 3P0YH 4PGCA 3RTQB 4NRZA 5ID0A 3ARTA 5ITFB 4QCIB 1VGEL 3K0WA 2DQCH 2XV6B 2XFXA 3QUMB 5I1KH 1XMWA 2V2TB 4FOMA 2GFBB 2BXZA 3JWOC 2AK4A 1NBZB 3L9RA 2YXMA 3O6MH 4R9HA 3LB6D 1Z9LA 4RFOH 3ROOB 1UFUA 2GT9A 1KJ2B 4NQXB 3W39A 5CEXA 4LPWA 5B8CA 3EOBA 4ZPVA 2NPLX 2AV1B 5C07B 4OGAD 5C0JB 3K81A 2VXSH 3QDGB 1KLUA 4NDMA 4TUJA 3WO4B 2VWEC 4TN9A 3IFOA 5D93B 3D85B 5B22A 5CD3A 5IB4B 4YFLI 1KG0A 3JV6B 4E42A 4OTXH 5EZOH 1NBVL 3GNML 1EGJL 1D9KA 2DB8A 5I18L 3HR5A 4GO6B 1EO8L 2YEZA 4FRWA 4JG1H 2QSCL 1S3KH 2YSSB 3OKLA 4NFBA 3D39E 3ARBA 1PBYA 2R9HC 1MVUB 2VE6A 4JB9H 4ODXB 4YDLC 1KTDB 3VFTA 3KGRA 3VFGL 3TA3A 5KZCB 4PJGF 1BVKB 1MH5B 4LEXH 4MAYB 3MJ8A 1KFAH 5I1HL 3RL2B 5FKAB 4D0BB 4X5WB 5D7LE 2GK0A 2K9UA 3IDXL 4GXVH 4G6JL 1URLA 3UC0L 3FT3B 1ZAGA 2G75B 3MRDB 1FGVL 1KB9J 5E8DL 3GSOA 4C4KT 1S7WB 1HHGB 4PYHA 1UACH 4LHUB 5GXBB 2R0LL 1MFEL 4KVNH 1L7TL 4WW2A 1F2QA 1KB5H 1ZHBB 5GRZA 4ZS7H 4R7DA 3NH7H 4RFNC 1GC1L 3IRPX 3FRUB 3IDMB 4PLJC 1BREA 4GG6F 4IOFD 1K8DB 2EYTB 1NGPL 2JB5H 5EU5A 1KSRA 5DD3L 5DVNA 4OF8A 5CP7B 4UIMA 2ZOLA 1NCAL 5J3HC 4M4RA 4N0YH 4TTDD 1CR9L 5CZXD 4I48B 4XPFH 5DYOB 2CK0H 3P4NA 4JVPA 5DFTA 4FMFA 1KGCE 2O5YL 4S1QL 1D5MA 5JIPA 3HI6L 3MV7A 2AJZB 5KN5A 3OGCB 3L7EA 1T0PB 1S78C 3FRPA 1NAML 2IH3A 2VKXA 3K80A 4XMPH 3IJYB 1ZHNA 3CJJA 2NXZD 3WKMH 4DWHA 4JANA 8FABA 4NQUA 3IDIA 3VI4E 3IGAB 2I25N 4Z76B 1CLYL 5DJCB 1J1XL 4HPOH 1ORQB 3BPNC 4R7NA 3BSZL 2Q8BL 2FL5A 3EFDL 3HFMH 1B2WH 3WUWG 2QADB 4HKXA 1UEMA 4PGEB 1QFUL 4AH2A 3QFJA 3PL6A 4MAYD 4OZIA 3H9YA 4GMSH 4GAJH 3X12B 4K3HA 4X6BB 1CBVL 5IFJB 5LVEA 3O3DA 1YN7B 3MLTB 1T1YB 4AYFA 2XWJB 2CK2A 1MCWW 4DGVL 3DJ9A 3RPIA 3GB7B 1RHHA 4TUKL 1XGUA 5F6HJ 3BPLB 4LHUD 1KCUL 5F7YC 4NN5C 4OV5B 4C56E 1PG7X 1B0WA 1Y0LB 2R29L 3QWRA 2HYMA 1YNLL 1JMXA 2QSQA 5IROA 3ULSB 4KUCF 3QG6A 2BVQB 1WFOA 3PQYA 1V7MH 1JHTB 3VMNA 2Y23A 5HYQB 1JNJA 3BGMB 3CZFB 1OARL 2BNQD 4EUPH 3DUUA 3FFCA 4PRPE 2MMXA 1E28A 3FQTA 3C08L 3VXQB 3O4LD 5D1ZD 3RIAK 2AJSL 5F88A 4Q9QH 4PTTB 2BOBB 1VPOL 2AXFB 3T0DA 2AJSH 4WU5B 1J8KA 4N0UB 4JRWA 5BW7C 3GHBH 3BISA 1NGXA 3EOBB 1OM3L 5BOZG 4R96A 4M1GH 1M4KA 1NEUA 1SY6H 4Q9QL 5L6YH 1PQZA 2R0WH 5TE4H 5C08A 4NHCL 1KLGA 2P45B 2JK5A 1FLTX 4Y16B 3UBXB 4KI5C 3QUKA 3CX2A 5J6HB 1A1NA 4L29B 3VG0L 4L4TE 3VXSD 35C8L 1I8MA 2GJZA 3ZHDA 2P5WB 3MRPB 2YHGA 3VI3F 4PY7B 5GGQL 3WDIA 1RI8A 3FFCE 5DMIL 3QEUB 2Q7NA 3ULUD 4P23A 4JLRB 5CS7A 5AD0B 1IKFL 4PLOB 4JDZA 4JPWL 2AJVL 5BRZB 1EZVY 4GAJL 4R8WL 2EDHA 2VLRD 1CCZA 2V17H 1MIML 2I5YL 3T77A 3PHOA 4V2CB 4XCCL 2QEJA 5DGRA 4M61A 1ED3A 2ED8A 2XTJD 3E6FA 4LLWB 2YPLD 1JPFA 1YEJH 3P0GB 2GJ6D 3DRQB 1QKZL 3C60D 2MQCA 1HHKA 2VDQL 2ZPKH 4WU7B 2PYEA 4Y8AA 3WJJC 4HF5L 1IMHC 5IGXL 2GITA 4ORGA 1FIGL 1DL7H 4KI5D 1J1PH 3IJSA 3FHQA 5HHOE 5BW7A 3IXAB 2WUBH 5C07A 1TQCC 2ZCKL 5CEZE 2J5LC 5L88L 5HYSB 4A2MA 1CGWA 4OZHB 3X3FL 4WFGD 3PABA 2O61B 5DD6A 2AEQH 3F7VA 3L3JB 3WIHH 2QADC 3GMMA 1U8LB 4OAWB 2R4RH 3CFEB 1CVSC 3QWQB 4PRBB 5M94B 3BPCA 1DSFL 5TF1L 3SGJA 1V8HA 1LK2A 1N0LA 5GRYA 2C9AA 1KB5L 3VFTB 2YRPA 2OJZH 5IFHH 1QACA 3V4UH 1UACL 2HT3D 5E8PA 3VWKA 1FVDB 4JO4L 4J8RA 1FZKA 1WC7A 1G6RL 4J1UA 2YOCA 2EH7H 5HSFA 1Z3GL 4JDTH 3CH1A 3QFJB 4FNLH 5KSBF 1HQRA 3MRHA 2QKIA 3BKJL 4S11A 1DBBL 4DN4L 5T1KD 4OQ1A 2ZUYA 3PP3H 5IFJA 5HI4D 4YE4H 1W0WB 3VXRE 1A6TB 1HXYB 1CQKA 2DI8A 1IBGH 2VZUA 3QRFM 1ZHBA 2VLKD 3TH4T 5EPMB 5F3HB 3UP1A 4PY8I 3O2VH 3WJLC 3CFJB 4PP1C 2X4RB 2AQ1A 4MNGA 4XPGH 4RRPG 2FBJL 3GGWA 2BSSB 1UB6B 4JM2C 4BQ9A 4QHUA 4HLZH 4EDWH 4U0RB 4L3EE 3ZHLA 3BUYA 4OTXL 2RCSH 1UM6L 1RIVL 4J3UA 3GSWA 5B3JF 5I18H 1B90A 1QA9B 3S5LB 3HPLB 2EXWC 3OR6A 3ILPA 3NZ8A 4LPYA 5MP6L 3CX5K 3V5KA 3GMPB 3SY0A 2F19L 3AB0C 5F9DC 4RFOL 1EBAA 1J1OL 1ES0A 1P6FA 4MWFA 1R5IB 5ACLA 4ZAKA 1OY3B 2VDKH 1ZTXH 3J7HA 3DROB 4HLZG 5IHZA 1MHCB 4JJ5A 4UV4H 5D8JL 3JTTB 4TULH 4TYUA 3FL7A 1MUJB 3VXTA 1RVFL 2X1PA 1S9WB 1R3KA 4Q9RH 4MCZA 4MJIB 3KLAA 1RUKH 1J7VR 2DQUL 5D96B 4U0RC 1VFBA 2VQUA 3HZVA 4G8GE 1JPTH 5IOPA 4X6BA 3P73A 3VJ6A 3BH9B 5D1QC 4L8DA 4WDIB 1MCCA 3ARGC 1IGIL 4LPVA 4ZYKA 5AYUL 5HHXL 2A9NH 2F9BT 2XN9E 1YN6A 1ZE3C 2CR3A 3O3UN 5F7LB 3U46A 1I8KA 4OD3L 2X1OA 1F4AA 4H88H 4CVXA 4PD4K 4GQPH 1D6VL 2APTA 2DQTL 2X44D 3VXMD 5EFIB 4R4FH 1LE9A 1YECH 2PTTA 5IMMB 5MENE 4GW5A 3ZKXC 1DZBA 4BZ1H 1A6VH 1MQ8A 3B9KB 4JFFA 4OJFH 2MTPA 1KTLB 5DJCA 4KKLC 3HRZA 4HS6B 4TVPL 4HPYL 3ZKNC 4EQ3A 4LAJH 3EDFA 1K6QL 4WVRA 1UH4A 4F9LA 1JPST 5JPNA 2W07A 4XPTL 2XNAB 1OAZL 3TO4A 2BXYA 3FN9A 5FECA 3DBXB 4YXHH 4AENB 3J8F7 1BOGA 3U1SL 2YUVA 2OTWA 4C56D 1YPZE 5KSAC 1U2HA 3BQUA 3QH3A 2NNAB 3KNBA 3L3GB 4S0TD 3BGFC 3BXNA 1P7HL 3MBEC 5D2LB 5F3BB 1D5ZA 1OQOA 4PRHD 2AABL 3OHXB 2DS4A 5CJQH 4Y4HA 3P30H 4EJ1C 3CFEA 1IKFH 1CLZL 4PLKC 1KNOA 1EUTA 2CGRH 2P8PA 5I8EB 4OGYL 4GBXA 3FB8A 1XF2A 1YEDB 5HYJB 4OI8A 2R1XA 1DFBL 2EO9A 5DD5H 5C0GA 2HFTA 4RMSA 5LGHH 2Y06H 4Z0BL 2V7HB 4TSCL 3MNVA 4KAQL 1IGJA 5EUKA 5T3ZE 3MBXH 5HI3C 2Z4QB 4ZPTB 3JV5A 4F7EA 4M48H 2Z93A 4HXBH 5D7JC 3OAUL 2DLFL 3QEHB 4PRDB 2AJYH 5F96H 3IFPA 1H3XA 4PJCF 2ZUQB 4ZPVB 1A0QH 5HGDB 3QCTH 1Q72H 3CSGA 3M8OH 4P4KC 1VPOH 4PG9B 5CFHA 3AY4C 4JN2A 4QF1A 3I50L 1VHPA 3RZCB 4MLSA 1LGVA 2VUOA 1VKXA 1I1FB 2AABH 3I75A 1ZSDA 4M7ZC 5AUMA 3WJLA 2UWEE 5DJXA 1G9EA 4GKZB 5DJZB 2K7QA 1HOCA 2GEEA 3QG7H 2Q86A 4YXLL 1RURL 1FE8L 3WEXB 3B8SA 4LQ1A 3UDWC 4YXHL 3R1GH 3IFLL 2E8ZA 2O93L 4XH2A 3BPOC 5E1AB 2EDYA 2HKFL 2UYLB 3MSPA 1TJIH 3DRQA 4PTUA 3WUWA 1ZLSH 1R5VA 1LDSA 3OKEB 3KPNA 2H1PL 3BP4B 4GMSL 3WMSA 5FKPB 3DNKA 4F3FB 1HHIA 2BSRA 4DZ8B 4JZNA 3AXLB 3REWA 4BZ1L 4YHLL 5SWSA 5I74C 3DYPA 5IVZB 3WSQH 4ZUUA 2XXCB 1U42A 4LP5A 1BGXL 3DVNB 1R0AL 4RISL 1JI1A 3EO1A 3TT3H 1HE7A 3O81A 2DQJH 3T1WA 3RHWK 5E8NB 1E27B 2YZ1A 4UU9B 1NMCC 2HKHL 4X80L 4Z7OF 4P2RB 4S0SD 1T7ZA 4WEUD 5E03A 1EFXA 3HI6H 2ARWA 1CI5A 3HI1B 1MEXL 3PWPE 3BPCB 1ZMYA 3HRPA 3MV9B 4XBEH 2GQHA 3VGFA 5KS9B 1RJLA 3SCMD 1NUDA 4U2YA 2X4QA 2P44B 4FQ1L 5FGBA 4NKMB 2OYPA 4QGTA 2BSTA 3ZE1E 3MUY1 4M6MH 5E5UB 4MJIE 4ZS6C 4MZ3A 4NQSB 1F4WH 1I8IA 3QFJE 1QBAA 5T1KA 3KPQB 2VR9A 1T21B 3H42L 3L9RB 5E99H 5JTWA 3EYOB 2FX8L 5I0ZA 3BN9C 2D7MA 4NOFA 3L5WA 3IGAA 3MLYL 3QXAA 3FB7B 1V3LA 4FS0A 5T3ZL 5DK2B 3DVIA 4HKXB 2XRAL 2FBOJ 5EU3A 2AJXH 5HY9B 1QYGH 3QIWA 1JPGA 1FGVH 2BNRA 4H5SA 5GRXG 1LD9A 1FAIH 4ZDHA 4S10A 4G5ZH 3PV6A 1DP0A 2OI9B 5GS0L 3KS0H 3GB7A 1V3KA 4XT1C 3N1QC 1T83A 3ARGD 3KPPB 2NY2D 1VGKA 3QCUL 5TE6H 3S36H 3GMLA 5JW4Q 2QADD 1II4E 1Y0LA 4P9HL 4H1LA 1NCBL 4N8PA 3OHXA 1MQKH 3QCUH 4IS6B 4RGNB 1JNHA 1G0DA 3VWKC 2WINA 3W9EA 3QQ3B 4QHMB 1F4YH 2F8VA 5E8EA 5TE6L 3TYGL 1HCFX 3MLWH 3WD5L 1CLOL 4PRAB 1EO8H 1WBXB 2GCYA 3CDGB 3R0NA 4P2OD 2EH7L 3GIVB 2SEBA 1DVFD 2YA2A 5C0AE 4D9LL 1A1OA 1EVTC 1NCDL 5F6IC 2W1NA 4M62L 3MJ7A 1GZQB 4LASH 1RZGA 1K4DA 1EDQA 1C5BH 5IFHL 5ESVB 2GSGB 5IB5A 5IHZB 1AC6A 4MA8L 4IRZL 4LCIL 4F7MB 4PJ9A 1AGBB 4GKOA 1KCRH 4JM2D 5H2BB 3BHBA 3PNWA 1F8TH 4LMQI 2R0KH 3WS3B 3EOAA 2BNQB 4MCZB 1DTUA 2E9IA 2VB5A 2CUMA 5IK3A 3VRLF 1FZJA 1KJ3H 1VGEH 1M05A 3KPSB 3O4LB 5D1ZB 4OGXH 3ZDYE 4FQ1H 3MRPA 2P5WA 1T04A 4PUBL 4NZTH 4HKBB 3AREB 4MXVE 5MEQA 4X5XA 5T3XH 4O2FA 3G5ZB 3O3AA 3MV11 4LLYA 3U9UB 3SE8H 4MA3B 5EBWA 4ZSOE 5EOCH 4L4TB 3RWFA 2YD6A 3G9AB 4KY1H 3TT3L 1FL3B 3QUYC 4O51B 4LDEB 3VW3L 1IAKB 3P9WB 4JHAL 1GGUA 3DX7A 5EZIH 4ZTOL 3ARVA 2ZPKL 4GRWE 3GIZH 3C8KB 1JV5A 3LOWA 1KEGH 1MCQA 1ZLWK 3MV8E 3H8NA 4WHYG 2DKMA 1HEZB 4D0DB 1EXUB 1R5VB 1QSVA 3E1F1 2EDKA 5TH2A 4X5WA 1A6ZA 5IW3A 3LMJH 4OSUH 5IT2H 4O4YH 3S35L 1F4HA 4LVHC 1ORSB 2J5LB 4QT5B 1ODAA 3EZ8A 2XA8H 1U8HB 3MGOB 5C0CD 2BJML 1AH1A 2RGSA 1FRGL 3KYAA 5D6CA 1GPOH 5LWYH 1UJ3B 8CGTA 1MJ7H 3HAEB 1OAXH 1SEBB 1DBMH 5L9DL 1NAMA 3RY5A 2NZ9D 1P84K 1U8KB 3MRNA 3MXWH 5JQHC 2OJEA 3I9GL 3KVQA 4XVTL 5L2KE 3FB5B 3FO9B 3BE1L 3BYTA 3KPOA 4UBDD 2QV2A 4LIQH 1NEZA 1FO0A 4RIRB 1HH9A 3Q6GL 4NO5B 3MLUL 2OR7A 5IV2B 4H8WL 2F5AH 4KJPD 3MZTA 4I48A 4FQXC 3ARDC 3MUGA 4JFHE 1XZ0B 4IMLA 1VB9A 4ZODA 2XA3A 4G8FA 2EIEA 5GGUA 4ZFZA 1N6QH 1OOAA 2A77H 1NC4A 4M6NL 4NRZB 5IMLA 4MQXC 1A4JB 5IROC 1MIEH 1SEQH 4TVPE 3V4PL 4BZ2H 4DN3H 2VC2H 5IFAL 5T1MB 3D39A 3MRCA 4NQEA 4Y4FA 2XICA 5C70A 3WNLA 2HRPL 4Z78A 3LD8C 3VWJC 3IDIB 3GSQA 5C08B 5DMKB 4G3YH 1KIQA 3MBXL 1ORQA 1TNNA 4Z0BH 3UJIL 4U6XA 2CKBH 3DURA 4CVUA 1DFBH 3VXUD 1OD7A 4WTZG 3TGXA 3VH8A 15C8L 1N6UA 2VXQL 3MOQA 3L1OL 2XWTA 5E2WL 5F9WC 3MGTB 4OKDA 2P4AB 5ADOL 3KPPA 5CGYC 5I9QB 4EI6A 2CKBB 3QDAA 5GJTL 2PXYA 3JWNC 4X6FB 1FNGA 4JPVH 5D7JD 4CW1A 3LQZA 1I7UB 2COQA 4YK4C 3TBSA 3WXWL 4LF3A 4P5KB 4FTVA 1GXEA 2F53D 1QA9A 2BNUA 5KANG 3E8UH 3ULSA 4OFPA 2VDRH 1EJOL 4XNYH 1U0QA 3ZDYF 2DBLL 1AGFA 3LIZL 3G5YB 3OAYH 4FFVC 4GRWF 5K9KB 4WRLA 1TJHH 3VD5A 1M7IA 4CVZB 3TPUB 1T66D 1JWSA 1NAMH 4WHDA 1AGBA 5GZOC 1S9XB 2RFXA 3MLPA 2N7BA 5GRUL 1HHGA 4UT7L 5D5ME 4WV1B 2IFFL 3W0WB 2CMRH 2BOBA 4Q6IA 4PS4H 4APQA 4POYA 1GH7A 1AR1C 1YQVH 1IEAB 4U1SA 5D7KE 1G7LB 4ALAH 5A3ID 1BFVH 1T7YA 3G6JE 5HDBE 4LK4A 5C6TH 1A6VL 4FQPA 1DQJB 5IEHA 2EDTA 1EFXB 4AY0A 4Y5XA 3S96B 2CLRA 1ZT7B 2YUWA 3B2UC 4L4VE 1ZVSA 4Z77A 3RDTA 4FQQB 2JB5L 5IWLA 1I9JH 4QOKE 4HIJB 3VW3H 4P3CH 3RX8A 4QHLA 1D5XB 4BUGA 2ICES 2HJKB 1PLGH 2VDOL 5BS0E 3OJDA 4DVRH 3Q48A 4JPVL 1IGTA 4M93C 1UH3A 4X4ZA 2R2BB 1J0ZA 4N8VB 4X7FC 2ATKA 4JDZB 1DANU 1MREL 3X3GL 4XCFL 5CJOL 4Z7WB 4J23A 1C08A 4NZTL 2P24A 2W60B 4K9EC 1D9KD 3TO4C 1OWWA 5IVXE 2WQ8A 4UQ3B 5D7IF 5CJ8A 4KKBC 2X4SB 4LP4A 4AEHH 1JGEA 1HWGB 5J6GB 2XT1B 3GRWH 3LB6C 5J57B 4U6VL 2DQIL 3A67H 4LPCA 2WV3A 4Z76A 1L0XA 4FABH 3ME0A 5A2LH 3VGGA 4NO0A 4ETQB 1G7HB 2EZ0D 2IANA 1A6AB 4JM4H 4QOKA 1T2QL 4PGEA 1KT2A 1MIEL 1J1OH 4C59B 2KBGA 3QISA 2OK0L 1MF2L 3F12A 5EBLA 1OTTC 5J13C 1CZ8H 2ZUTA 2GY7B 4QWWD 3B43A 1H0DA 1E27A 2OR9L 4X6DB 4PJIB 4NQDB 5HDOA 2BZDA 1J0IA 1XIWD 3QQ3A 4HK0A 3BKCH 5I15L 5JOEA 1RZJC 2X2YA 4J4PD 2JELL 2F5AL 3DX8B 5DRWB 2VLRE 5EORH 3I6GA 5FYKH 2A74B 4JN1H 2DQFB 1KCLA 4GRLB 4HEPG 4JJHA 3GJFK 4OCXL 3GBMH 1KCVL 1A3RL 3SY0B 5FF6A 4UT9H 5KSBB 1AO7B 3RWGB 4BQ6A 1F6FB 2PO6B 3C2AH 5MEPA 5D2LE 5E4IA 3TZVD 3WXVH 3NABL 4JEGB 5DFVC 1CFSA 2ITDB 2J1KA 1OGTB 4RFEA 3MR9A 4Z7NE 5HYJD 2DJ4A 3U0TA 3PV7A 1NGQH 5T3ZH 1H9VA 3HG1D 1Q1JH 3O41B 4IRSA 3UBXA 3SE9L 1PLGL 2XXMB 3WN5B 5JIHA 3F58H 5DMYA 5JXAH 1XGYH 5K59F 3C09B 3DVFA 5BVPH 1R5WA 2HLFC 2R4RL 4IOIB 4L4VD 5DJZA 5K93A 5EOCL 2Y72A 4PJAF 3V4VH 3V8CA 4PJXB 1TVHA 4GW4B 4URTB 5D1ZC 5FHBL 3UTSB 1MHEA 3UTTA 5C6TL 1H5BC 1YJDH 2VAJA 4PRIE 2PW2B 4OB5L 4GXUM 5C0DA 5D7SL 4CU7A 4HIIA 4NO5A 3C9NA 1MFCL 3IVKA 4UT7H 1SBSL 3ILPB 4X80H 3TBWB 5HHMB 4HS6A 4MNHB 3OKEA 1I85C 3QWRD 3HMXA 4U1IB 1JF1B 3T8XA 5JA9A 3INUH 3QIUD 5HVWA 3FMGH 3GMNA 2Y6SD 2BSRB 4DZ8A 1O7VA 4XPBL 3W2DH 1KIUA 4N0FB 3OJMB 3P3YA 4M8QB 3QIBA 1CDBA 1M7DB 5ILTH 1DN2A 5CIPA 5B8CB 3F7YA 4M8VA 5CKGA 3ULVH 5A2JH 5B3JE 1IT9L 1L6XA 3BZFA 1DEEB 1W8NA 2ZOKA 2D7TH 4OT1L 5HVHC 4CMHB 5GRJH 3TESA 4P2RA 4NKQB 3WD5H 3NPSC 4NM4L 4IDJH 3HI1A 3FT2B 2PXYC 5DVLA 1BD2B 2Q8AL 5KS9A 3NCMA 3VG0H 2FH8A 5JPMB 4JFEE 4U1GB 3ZTJH 2JJUA 3L95B 2YD7A 1LO0H 4HSQA 1QNZL 4HIHB 5TDOB 1OAQH 3VCLB 4L4VB 3HCVA 1QFWI 2QQQA 4I18C 3ULVD 5BCAA 4B7IA 5HI3D 3SCMB 3GHBL 1UQSB 4LSQL 4PJ8B 1GYAA 2NY6C 1ZK9A 5DI8A 4ETYA 4LLAA 3WFHA 2E7MA 1I9RH 3WHE1 2VLRA 1XGTB 2O5ZH 1OARH 2XWTB 1LK3H 5ALCH 1OT2A 3STLA 1ROWA 1Z0NA 3ALXA 1YY9D 2YPLA 4P3DA 3DRTB 3GEWB 2Q8AH 3QIUB 3T0BA 4JG0H 3R06B 1UWXK 4IMKA 1LEIB 2Q86B 3BQUB 4WV1C 2MCG1 5E2UL 2V9QA 4KKCC 5HYFA 2BSSA 3FQUA 4NM4H 4PJDE 5EUOA 4D8PB 2X4PA 3SDCB 3MOAL 3I02B 4HC1A 5EWIH 12E8H 1E6JL 1X5KA 5CJ5A 5FHAL 4OIBA 1RUPL 2FJFB 2AJZA 5KBNC 3MRBB 4XXCA 1LP9A 1RJZB 3RVXC 1P4BH 4AM0A 1E4WL 1HKFA 3HZKA 1CLYH 4IHOA 4YDIH 4BSVB 2H41A 3O6FD 5K59E 1FCCA 2ENSA 3BD5A 2KDGA 3IKCA 3MCKB 2IEPA 1F58L 2Q76A 5GGVL 5GHWL 1S5HA 3GSNA 5MERB 3SDYL 4AT6A 3CMOL 4K7PL 1UXSA 1U95A 1DVFB 2F74B 3CXHJ 3KPSA 4NYLB 5EWIL 2C3GA 5TGBB 4YDJA 1G9MC 4O2EB 5SX5H 2EC9U 3CVIL 4PRHE 1XCQB 2FRGP 4NP4L 5EU6D 3VD3A 5FUOH 3SDAA 5CCKL 1FYTB 3G08A 2ITCA 4KI1A 5EA0H 1AD9A 4JG0L 1U3HC 4X0KB 2NY3B 2VXTL 3MREA 4OGXL 4ZYKB 1MRFL 5DD3H 1ADQA 3QRGH 3U30C 1YC8A 5I1EL 2EDNA 5HYIA 4LSUH 2AGJH 3RWFB 3EGSB 4DJMA 3B83A 3WEXA 2ZNXA 1TIUA 1JV5B 1B0GA 4Q6YA 3RKDD 3OJ2C 1FFRA 1P7QD 2NY7H 3NACH 3I50H 1MFEH 1S5IL 3FKUS 2XOTA 2V5SA 3NAAL 3QCTL 4OD2A 4MD4A 4BQCA 5C2UB 1C16A 1FV1B 3H9SB 1PGRB 5FM5O 4WW2C 2OTUB 1ACYH 5E8DH 4MZ2A 1VFOA 4TQEL 3SKOB 4RAHA 2DQHL 1TLKA 2J8OA 5HGHB 3NN8B 2E8YA 2IC2A 1IEAA 4U1SB 4MA1B 3EYFB 4EBQH 5GS0C 1V7NH 5D7LA 4NQDA 4ZXBA 4M1DH 3DGCR 4LFHG 4PRPA 1T1XB 5CSGA 1ULVA 4E42B 3EYSL 3QFDA 1H3TA 3BP7A 1TZHB 1LEKB 2VISB 3IDYC 2OR9H 3OKDB 3QHFL 3Q1SL 3K74B 4LKXB 1RIVH 5TJWK 4LLDB 2E3VA 2WUCL 3BIKA 3TWCH 32C2A 4OT1H 5FCUL 5J1AB 4MA1C 2IQAA 5MEOA 2GCYB 1O7SA 5C08D 1T80A 3OGCA 2KKQA 3QUMH 5HGBB 3WIIH 1LMKA 4WWKD 1IAII 4LEOB 3TA3B 5F9OL 5IMLB 4YZFF 4DCQB 1VFUA 2NW2A 4HH8A 2N7AA 1QHPA 5ALBL 1KEMH 3VI3E 4PJ8A 1J87A 4WUUA 4P2QA 4HC1H 4P23D 4O5LH 4PJDA 2GTWA 5CMAB 5C0BA 1U58B 3L3DB 3P0YL 3P77A 1T5XA 4OLEA 5I1KL 1WBZA 2I07A 3CAFA 4MS8D 3T0ED 1KACB 1P7QB 2K1MA 3G9VA 2YPVH 5FA3A 3QDMA 1WK0A 5EO9B 3VFPB 4JZOA 3QDJB 4MJ2A 3ARSA 1YECL 2VABA 3F8UB 2P49B 1I8LC 3HE7A 2HT2D 3G5XA 3K3QA 4B41A 2Y4SA 3TVMC 4CW1B 3ILQC 5EU6E 4IRJA 5E2JA 5SWSE 3FQXA 3V6FB 3F7VB 3L3JA 4JQIH 5ANMB 3VXUB 1QVOA 4Z0XB 1N3NA 3EKCA 2GHWB 1IAKA 1CD8A 5LCVL 4YAQB 5ISZA 2ESVD 5C7XL 4OZIE 4HWBA 3FTGB 2DL2A 5C0BE 2NTFA 1HEZA 2AERT 4HV8A 2VL5A 4KROC 2VN7A 1I1AB 4G9FB 5CP3A 4W4OA 3N9GL 1T7WA 1DUZA 4NP4H 1U8PB 3MUJA 5C07D 1CFTB 4KQ4L 4S1SL 4PS4L 3RPKA 1XF1A 1WFUA 1M7IB 3D85D 4PRHA 2CRYA 5GRUH 1G7MB 2RFXB 2YBRB 1N7ML 4HKJB 5ID1A 4QRRB 1NFKA 1MJJA 2VZSA 3M45A 3UJJL 4NC1C 4Q97A 4BSJA 4KKLD 1B6DA 5LGKA 3SJVE 3PQYE 5DURB 3JV4B 1FFOB 1EEQA 4ZQKB 4PGZA 2YD9A 3IFOB 3U6RB 2I27N 4XHQA 2NYYC 4K3EH 4HD9A 1LNUB 3RDTB 3U4BH 3DIFA 5FUCE 4NN5B 1VFAB 1G7JB 4PJAA 1RUQH 4CDHA 5AD0A 1Q0XL 3ZLQC 5EO1B 2QR0B 4DGYL 4HWUA 5JPMA 3FONB 1P53A 1Q38A 1LEIA 1OD9A 3GBNL 1JK8B 5GZND 1RJLB 3WE6A 5HBBA 2BNRE 1A0QL 3AMKA 4MA3A 5EBWB 4XC3L 4HGWB 4MB4A 1YUHA 1EO7A 5JORA 4LLVA 1IGCH 1AE6H 3T65A 4TPRH 5I8KH 5B8CC 4JVWA 4NNXA 4OLYH 1JGEB 2X4SA 4WIQA 4L1HA 3TIDA 5FUZL 1EO5A 5FDWB 4DW2H 3MRDA 2YMXH 4TQEH 1LK3L 3GO1L 3HMWH 2D31A 3DMMB 1SY6L 2CLZA 1F02I 4CADB 1N6QL 2AEPL 4JJ5B 4RMWA 5I8CA 1LDPL 1DN0A 1FORH 3EDEA 1S5IH 2LAGB 2L0DA 2W65B 1CF8L 4Z7VE 5IHUH 3SPVA 3DI2B 1N0XL 2ZG2A 4F57L 1UJ3A 1QHOA 3H3PL 5DTFB 2HJLB 2Q6WA 3Q6GH 2PO6D 1OLZA 2HJFB 2VIRA 3VFWA 5GGRB 3V95A 1F42A 4WUUE 4M7LT 2Z31D 4FN0A 4NO2A 4UQ2B 4LLMA 2D03L 4PR5A 1CXIA 2R29H 2EDJA 2XIDA 1JTPA 2X40A 1GPOL 1CQYA 1ETZB 4GW5B 3HUJA 3PJSA 3BPOB 2D7PA 3SEPA 4DCQA 2V2WB 3QDME 1FIGH 4EUPA 4LLQA 4GW1B 2ZWLT 2AK4B 3QA3A 4LSRL 5M7QA 3H2WA 4OI9A 5EU6A 3N85L 3JWDH 1QBLH 3BRFA 3ARFD 3EFDH 3HFML 4A6YL 3ZYZA 3JWDL 2OL3H 4M7ZB 4EZMA 4K94H 4WU7A 1YYLH 3VXMA 4MDIA 5CUSL 3B9KD 4JFDA 3JV6A 1BZ9B 3CK0H 4M43L 3TZVB 1X4YA 3NZHH 43C9B 4C4KO 3RJQB 3HMXL 1FZMB 1KENL 3MUHL 5CWSB 2A6JB 4HS8H 3EIFA 5DT1L 4ZXBC 3TNNB 2J6EL 3EJJX 3RPIB 3VGDA 4LNRB 3V5DB 5JOFA 2DQGH 2ZKHL 4X6FA 2CPCA 4NKIL 1P9MC 1FVEA 5E70A 3AFLA 2YUXA 1CFNA 4HG4J 3GMMB 1KPUB 5FO7A 5HHQB 3BP5A 4FP8H 4NNYA 4U2ZA 1Q9WB 1WBYA 3C6LB 2R0KL 2ZJSH 1X4XA 3K4AA 3T4YB 5I1JH 3HC0B 3FT3A 3H7LA 1NANH 2A83A 1J18A 1HDMA 5DHYB 3UTSD 4JY5L 3LN5A 4ETQA 2Z31B 3TIEB 3WL9B 3AVEA 3A6BL 5KSUA 4PJAE 2HG5A 5ID0B 2X42A 3PWNB 2X6MA 3SE4C 3CC5A 5A43C 4U7MA 4Q9BA 4QRQA 1NBYB 3RWIA 1UZ8B 5ACZB 4JKPL 1KB5A 2WIMA 1T22B 3IYLW 3TCLA 4N8VG 5DC9B 2B5IC 3RU8H 3TM6A 3ZT7A 5CSZB 4JFEA 1ZA6A 3NFPA 4EVNA 2R0ZH 4XC3H 1UA6L 1IFHH 4C57C 3QEUA 3VXRD 4JZJC 1MI5E 1T7XA 4PJ8D 1AKJB 1DLFL 4U33A 4WUUD 4RAVB 5E6ZA 1U3HD 1JWUA 4MJ5B 4LKCA 4QRUB 2RR3A 3VMOA 1YEGL 1DLHB 2XZZA 3HPLA 2C1PA 4HFUH 4B5EA 2AS5M 3TN0D 5C3TA 4LOUD 4W68A 3VFVA 1OW0A 4NN6C 3KLSA 4JKKA 3ELAT 3GKZA 4NZRL 2FD6H 5CP3H 3RZWA 4P48A 3I2CH 4R7NB 2VXSL 3MLVH 3C8DA 5DI8B 2J2ZA 3GM8A 4XWGH 2JCCA 5K9OA 5F7HA 3KYNB 1IAIH 3FOMA 1XR8A 4NWTH 4KUCD 3V6ZB 2RJMA 4IRJD 4NO0B 3O6FC 2ZSVB 4GRMA 1UCBL 5EO9A 3PIQA 4KGLA 4JPIA 3WIHL 3F5WA 5JR1H 2AKRB 3L3GA 3MODH 1IGFH 2X7LB 1KJ2H 4JFQB 5E94A 1G0XA 4HUNB 4XBEL 4XP6L 4R3SA 5KVFL 2HJFA 5DHVB 3TNMB 1PZ5B 4GSDL 5D2LF 1QSZA 5FGRA 2X4UA 1KBGH 2CK0L 5F93C 2IAMD 2JJSA 5E8OA 1I7UA 1DQQB 4HH9B 5C7XH 1CR9H 4K8RL 4MXWH 4TSBH 1RUAL 2KQMA 4HIIB 5DRZB 2B4CC 1JN6B 3UROR 1KJ3L 4N8CH 1N5AA 4LVHB 4OAWA 4MYWB 4ORZC 1BBJA 3GSVA 5DJ0B 1LK2B 3JXAA 1Q0YL 2Y5TA 4DUWA 2OL3L 1CLCA 3F6IA 3MRRB 3ZT6A 3SE9H 5J1TC 1XAUA 5T1KB 3QXVA 3TO2A 5K33A 4AEIH 2VLKB 2H1PH 5T1LA 2ZG3A 3RAJH 1N2RB 3SO3C 1CFSB 3HB3D 3C2SA 1UB5B 2NY6D 2V17L 3BZFB 5C0CE 1EERB 1L6ZA 4X9IA 3UC0H 1ADQL 2ZUUA 2WW8A 1QO3A 3FQWA 3O3BB 1NLBH 4J3WA 5DMGC 3OMZA 1NC4D 3O41A 4IRSB 5KW9L 4RGMC 3C2AL 4U1NB 4KQ3H 1TPXB 1XCQA 4CGTA 3ULUH 4KK6C 4OCXH 1P84J 1W72B 2IBZX 2BNQE 1OB1A 1YMHA 3BXNB 1R3JB 4Q0XH 4HXAH 4G7YH 5JOPD 1FLRH 3GSWB 4YBLB 5HHPB 2WANA 3KJ6L 4JGMA 3TP4A 3BQUC 2UY6A 5I2IB 1Q72L 4H8WC 2XG5A 4N9GA 1LQSR 3U79A 1I85A 4G43A 2LE9A 5GSRA 3DOSA 5F1IB 3C08H 1IE5A 5C0AD 1YEFH 3FCTA 2HG5B 4FZEH 2GAZA 3TJHC 4PJ9B 1PFCA 4QRPD 1F4WL 1S7WA 2CQVA 1OGAE 2Z35B 3DGGA 4GW1A 4CN4A 1KT2B 1WEJL 2X9WA 4ZO6A 2WLYA 3JTTA 3EDKA 3EJZD 1GZPA 3HE6D 5CILH 4JR9L 1HXMB 1RK0B 3IDJB 2C3WA 4P5MB 4HHAB 2YRZA 3BW9B 3KS0J 1RSFA 3ETBF 3PHSA 4ZQKA 4HIEB 4JN2B 3DSFH 4DQOH 1I1RA 1FN4A 1UXWA 2MJWA 3H9SD 3P30L 5ESAB 5JXEC 3O2WL 3AS3A 3LN4A 2LVEA 1YEIL 2X70A 2BFVH 4L8DB 4UTBH 4XI5C 1JHTA 5TQ0L 1KN2H 4UDUA 3FQRA 3CVHB 4G8EB 1FCGA 1YA5A 3MA9H 1KGCD 3S88H 4JDVA 3HLAA 1JZ5A 4L8CA 3QNYB 4NN6B 4Y5YC 1J10A 4OCMC 1A21A 3WLWC 3C6SB 1EEZB 4Z7UB 4LSRH 2PW1B 3B9KA 2X1XR 4AZ8A 2XZQH 2R23B 2FSEA 3OGOE 5IIEA 3LPGA 4CL7A 2MCPH 4P2QB 3C60C 2JCCB 5K9OB 1MCBA 2P43B 4K7PH 4OJFL 4DKEH 4JAMB 1FFPA 1KYOK 4JGUA 1TZGL 1J8HD 2VXUH 5DD1H 3T04D 2CLZB 2V9RA 5SWSB 1KPVB 5EB9A 5C3LD 5ANME 3GI8L 4X9GA 5FV2A 1NGZA 3L3HA 5BZWA 1JGDA 2R2HB 5FOBA 3STLB 1T5WB 5T5FL 3IFNH 1QR4A 1JZ3A 3HE7B 3HC4H 5HHXH 4V2BA 2AK1L 2HJLA 5I1AA 1FDLL 1CTOA 2XWBB 4NJ9L 2WINB 2P8MA 5ICZA 4XP5H 4OBSA 1KIPA 2P5ED 1N4XH 3B9AA 1DBKH 4JFXB 4OGZA 3DSFL 2W9EL 1FORL 1WBYB 4YHML 3GK8H 4L8SA 2IQ9H 1BZ7A 5IHLB 3CVHH 3BP6A 1CXHA 5F7WC 1HILB 5DURD 1NGWB 1QSFE 2FJFA 5JZ7C 4J3SA 1Q8MA 4ODBD 5BV7B 1XIWA 1NUGA 1EGJA 4PJFF 3MBEA 4K7FA 1WFTA 2G60L 2YC1A 3UJIH 2FO1A 5H2BA 4PGBA 2ESVB 4ZFOL 1TQBC 5ID1B 1HQ4B 1GHFH 2BNQA 5LGHL 5LAXA 1UYWL 5D4QA 4N90D 4LCCA 3JZ7A 2E9JA 5FB8A 5E6YA 4YHIB 3U4EB 3U83A 5D2NC 2EC9T 3RKPA 4R2GD 4F8QA 1C5BL 2H2SC 5F9JB 3PABB 4YQXH 4Y16A 2O61A 1OTSC 4DGYH 2OMNA 1UM6H 4UAOB 4WO4A 4QYOA 5D5MB 1PX3A 5FGCE 5JW4N 4W6YB 2ZUQC 3KR3L 4MMZC 3U7WH 1LO3L 4GKZA 3VG9B 4UNTA 1PG7H 3KYOB 1C5CL 4OLZH 4P9HC 4GMTL 3DVGB 4O51A 4RWHA 5HHPA 1OGAA 3ZE0E 4LGPB 5AAWA 4LSVH 4PJCE 5IB3A 4PV8A 1NCBH 5DEFB 3MXWL 3ALWA 4PV9B 4XX1G 4L3AA 3NIFE 5I71B 3OKOB 5E2VH 3L6FA 3OR6B 2P1YA 4IOSD 4DAGL 3GSXB 3NCYS 1I75A 4Z5RA 3PDGA 5JMRA 4I2XB 1MELA 2JIXA 3HHRB 4HWNA 4KQ4H 4S1SH 1U8JB 3LV3B 2UV3A 3RAJL 4L9DA 3N9GH 1XIWC 1DE4B 1S9KC 2BC4B 5CBAB 5ADPH 1PG7W 4GAYB 2MWCA 4RCAA 3KJ4B 4X8XA 4Y5XC 3U36A 2AKRA 3TV3L 4KMLB 3PNWB 4EI5B 4X7EC 3CGTA 3TT1L 5IK3B 3BVNA 5EBMB 3RGHA 1ZLVK 4XCNA 3DUSB 3ZSSA 1WSST 4OCNC 4TSBL 3KPRB 5E2TH 5CJBA 2APVA 4UIKL 5DQDL 3KYMB 2Y07L 4LHUG 5I8OL 5EUOB 1A7PH 1XCTB 4WW1B 2YD3A 1YJDL 5L88H 1QBML 5F7KC 4Q9RL 2EEAA 4ISVA 4IIQC 4E0RA 1AJ7H 2IFGA 3Q0HA 3FAWA 3HLAB 4AIZA 5JMOC 4OLWH 5T1LD 4LLDA 1MEXH 3VGHA 5KVFH 1EUUA 2R15A 3ARZA 4MGXA 2DJUA 1G9ML 1TPXC 1IQDB 3U2SA 1RIUH 5DUPL 1TNMA 1CXFA 1PAMA 3WFCH 2FATH 3E6HB 5CLTA 4WI7A 2ZUVA 1C7TA 1RUMH 1AQKL 4Z7QF 4K23L 3V79C 5CJXC 1T6VN 3D3VA 3RA7H 2CDEB 3TFKD 5CHNA 2NY2B 3O9WA 1HSBA 4PB0H 2DWEB 3RDTC 3VXNA 1GRWA 2Z35A 1WVZA 2IPTH 4WI8A 2BNRB 4H5SB 1IM9D 3BX7C 2HVKB 4JGJA 3VXSE 1TVBB 3O4OC 3RWHA 3VE0A 4OZGE 4XX1E 3BW9A 4FQXD 5F7DB 5ICZB 1P4IH 4Z7NF 1IBGL 1SM3H 3NA9H 4HK3J 5AWNH 4P9HH 4EI5D 5C6WH 3BUYB 3GJFH 5FXCH 4KRPC 4NFDA 1Z9SA 1YMMB 3BP5B 4NNYB 3SBWC 2QQNL 2J8UF 1NGWA 3QEQA 3EJZC 3FTGA 4LGRB 2WIIA 3QNYA 4KDTC 3DMMC 2H6PA 4U1MA 2P7TA 4PGDA 2HRLA 1UM4H 1OWRM 1C16B 2OJZL 3VXSA 3WIFB 1SQ2N 2X4OB 4ONHB 3BAEH 1FL6B 4HX1A 4L3EB 4YDVA 5E9DB 2NY4C 3CC5B 3PWJA 3EOAB 4EDXA 4UTAL 5J13B 1B0RA 5B38B 2DQIH 1FN4B 5ESAA 1FBIL 3CMGA 3KJ4C 4Y5XB 2IADB 5IF0B 3DURB 1J12A 3I6LD 3VGAB 5AG8A 1JRHL 2EYSB 2VAAA 5HPOA 2XWJA 3QEQE 3VRJA 4YFEA 4WEMB 4Y88A 3HC3L 4M7JH 3RVTD 3U7AA 2DLHA 1CS6A 1CLZH 2LTQC 2PTUA 4PJ7E 3ULVC 1IEBB 2VDOH 5I6XB 1UWGH 2FWOB 2HKHH 4IEFB 4HF5H 5J4MA 2XI9A 1J8HA 4Y89A 3MOBH 3OF6A 4HEME 5B38G 3OX8B 5GGRY 5TDNA 3UTZA 4ONOA 4PGJA 4HKZB 4LNVA 3DWTA 4JFFB 5DVMA 5GSRB 4LSTL 1O5DT 3LV3A 4K3GA 5T33L 3FOLA 4DUVA 2VZ3A 2DL9A 4O2CB 1P4BL 4UUJB 5ICYA 5EU4B 4U3HA 4NC0B 3L5XL 3C5JA 4J3XA 4Q9CA 3BRGC 2MPAH 4CMMA 1OAYH 4WFEE 2E6QA 5CGYD 4WY7L 1A2YA 3RWDB 5J8OA 1DDHB 3IDJA 3C09C 3S5LG 4R3SB 4XZUB 5F1OB 3QEGL 3LEVL 1TQBB 2HAZA 4GFTB 1JZ6A 4YHZL 3R1GL 3UTOA 5GZOD 1CICD 1MFDL 1XCTA 3F7QA 1RURH 1A6UH 4QRRE 1LVEA 3CFIC 4U31A 1EV2E 5TQ0H 4AQOA 1T0NB 1IGIH 2VH5H 3RIFK 3ZE0F 4LHQB 4Q6IC 1BMGA 4E41B 2DQEL 2Y5TB 5ITFA 4ZTPH 4UNVA 4N5ED 3MRFA 4BK5A 1NGQL 4LSQH 3V0VB 1JGVL 1NC4B 4PJIE 3QXTA 4XNQA 1AXTL 5JUEH 4PJGB 5LAXB 4RFEB 4MAYA 3RL2A 2VLKA 1RVFH 2CDEA 1UQSA 2W59A 5D5MF 3GSUB 5FUZH 2VDML 3O0RH 3ORJA 5IIEB 1HSBB 1R3HA 4GXUN 4UV7L 4Z5RB 2QQNH 2VLRB 2YS4A 1AIFB 3IFPB 2R56L 3CD4A 5TPWH 2HRPH 5C1MB 3KPTA 4HMDA 3HNTH 2VC2L 1FO0H 3MROB 2Y06L 3NFPB 4DK3A 3QIWB 3F12B 2OM5A 4FXKB 3WDJA 2PR4L 1AD0A 5FYLH 3KYKL 2UZXB 2NY0B 1TVHB 2VZTA 4Q2ZB 4PJIA 4KTYA 4FFZH 2R2EB 2JLLA 2PW2A 4OI7A 3BIBX 1X5AA 5SWZA 3ULUE 2V6HA 1VSCA 1MI5D 4ACPA 1WUNT 1P2CA 3RUGF 4XXDA 2PNDA 4JO2H 1CFVH 5JNYB 3EYOA 4XVTH 4GJTB 5F7MC 4YX2L 4QRTA 2CJUL 1WT5C 4F9PA 1G7IA 3C6LA 4R26H 3LKRA 1GSMA 3MACH 4NNPH 5FYJH 3QQNA 4HUWA 4ODUB 5LWYL 2FATL 1E4XL 4ONHA 1S9XA 4JQVC 4W81A 1MFAL 2Q3AA 1J0KA 1WCBA 3K8MA 5MENB 4JQXA 3ZKSD 4NZUL 1UADC 3B5TA 2FB4L 2X89D 1T83C 4LCCB 2K3TA 3MV7E 1DR9A 1U8NB 4WHYH 4M7KH 1T0MA 5IM7B 2W0FA 5FHBH 3LS5H 4PPTA 1DQJA 5IEHB 2GK2A 3D85A 4WUKL 4QRQB 3V8OA 4UIMB 4F8TA 4DVRL 3IJHA 4ZOBA 4M3KB 3MJ6A 2YZ8A 1ZVSB 4Z77B 3RWEB 4WO4B 4G8GD 3HNSL 5K9JH 3TF7C 2A9MH 3O6FA 2EZ0C 1CVRA 2I24N 1OPGH 1G6RB 1H15A 4YC2B 4NBZB 3R8BB 1DQDH 1IL1A 4K94C 3P2TA 3WN5C 2HLAB 4I4WB 4XBGA 1KELL 2APXA 3BFOA 2AEQL 1K8IB 3D69A 1KBGL 3MRKA 4UT6L 3HTLX 3P11L 1L7IL 1YY8B 2GSGA 4PY8J 1NCTA 3OKNB 4NJAH 2WUBL 2BVTA 3NABH 2VLLB 5JHDE 3MRJB 1EMTH 1JRHI 3BN9D 5JIKA 1HSAA 1E4KC 3CDFA 3O9WB 3IDXH 4Z78B 5CBEB 4RGMB 3QA3B 3WFHB 3D0VA 1NLDH 3FB6B 5FYJL 4BFIA 1GGBH 1KFAL 5KS9E 4R26L 3D9AH 4LEXL 5F88B 1RAMA 2PUQT 5EOTA 1KXTB 5HGHA 1C5DB 2VLME 5CBAA 4ZOEA 4JRYB 1EJOH 1PKQB 1A2YB 2EDOA 4MAUL 4KK9D 5CGTA 4EI5A 1C5CH 4OLZL 4IIQB 4KROD 4YZFE 2PN5A 3U82B 3LPWA 2XYCA 1JGLH 3KWWA 1RIHL 1K8DA 4ONFL 3TJEL 1NCCL 1QSFA 1CE1L 3T2NL 5FYLL 3FT2A 4LMQE 2LAAA 1OAUL 3L1OH 2NW3B 5E2WH 5J12C 4E0RB 1B4JH 1MFBL 1MQKL 4U1HB 2VQTA 2B1AL 3H9HB 2BY0A 2IANE 3MCLL 5AG9A 3JUZA 4IDLA 1X5FA 4R2GB 1XZ0A 4IMLB 2XKNB 1MWAL 5D72H 5J3HD 1DBBH 4MCYB 2G60H 2HVJB 4RGNE 4ZFZB 2I9TB 5GGTH 4UZGA 2NY1C 3SDXB 3FO1A 5MHSE 3MR9B 4KK5D 4AL8L 4P2OA 1GZPB 2QKIB 4RMQA 3W39B 1QRKA 2NY7L 5C2BH 4U1JB 2FDBP 4CN6A 2ARJA 4E41E 3T09A 1IARB 4KTDL 5TDPA 1EA9C 1LO5B 1BOGB 1CFQB 2CKNA 1P69B 2GITB 1KN4H 2BDNL 2DICA 5KZCD 3BH8A 2X70B 1AD0B 1MCKA 3MLUH 4OM1H 1FH5H 4EVNB 3TCXA 4M6ML 1NGYA 4FP8L 1DDHA 3F65A 3S36X 2YSSA 3OKLB 5T5FH 1MAMH 2H9GA 3IF1A 1Q94A 4XWOD 5DD6B 1YJDC 1YEEH 2EDDA 1QTYT 4XVUC 3ET9F 4OIAA 3K8LA 1YQVL 1E6OL 5F72S 2CMRL 4FFVD 4DOHB 1H3VA 5E4EB 3QDMD 4NQEB 4X4YA 3MLRH 1KENH 1SMOA 4KTEL 5HDLA 3PWPB 4FFWC 4APQC 4MX7B 1JFQH 4K2UL 1ZT1B 5SWQA 5JW5B 1P7KB 1ZWIB 5A16A 4O4YL 5DMKA 4LCCC 4KWUA 3JUYA 2NY1D 4NQVB 4LSTH 2BX5A 2RBLA 4ORGB 5KOMC 3TPUA 2AV7B 4WW2B 1SJXA 3T3MF 5DF0A 4KXZH 5I74B 1NQBA 3RHWF 4JHAH 3SDAC 4QF1B 12E8L 1E6JH 1T1XA 1H5BB 3NPSB 2NXYB 4I0PB 3EYUL 1RUPH 3DIFB 5GSVA 3QP3A 4JO1H 2D7OA 3NCFB 1FNEA 4OUUA 5INCB 3OZ9H 3BO8A 4JFXA 1BEYL 3KPMB 3I6GB 2O5YH 3OR7A 2NXZB 3FFDB 4PRNA 4ELMA 1WIUA 3ZZ1A 2MKLC 3B9EA 5E00B 4CKVX 3HR5B 1HN1A 1MRDL 3QO0B 4AG4L 1FE8H 3QZWA 1OSPL 2DIAA 2HJKA 4ZS6D 1WEJH 35C8H 5C0EB 2YN3A 3HAEG 5KVDL 4HS3A 3T0AA 4OM1L 3S5LA 1F8TL 3FO0H 3KHQA 4DN3L 1CYGA 1SJEA 5DZLA 4UTAH 5JW3L 3MJ9H 4X6CA 2BERA 3VWJA 3V5KB 4ZUTB 3PWLB 4QHNA 4M1GL 2F58L 4ZD3H 3D39B 3MRCB 4X7DC 3AAZA 4JRXA 3GJFB 3QDGA 4NDMB 5GJSH 2R0LH 3HMWL 4JAMA 4M00A 3S3SA 3SKOA 3QDMB 4NQED 4R2GC 4E9LA 4HXAL 4KRLB 5D72L 1MUJA 4KAQH 2DF3A 4UINH 5HHVL 1LO4L 4UU9A 3QCVH 3KLAB 3ARBB 5EIIB 3RVVD 1WZKA 4JVUA 4BZYA 5AWNL 3ISWA 1FGNL 2B1HH 3LQZB 5CD5C 1RZKL 4KKCD 4WHCA 2NQCA 4PV9A 1MCIA 4LHJB 5DGQA 4JO1L 1RU9H 3LEYH 3QDGE 1CFTA 2IBZY 3QPXL 4ZFFB 1QPPA 4ZNCD 3MRBA 4GUPB 2X89A 4YFLF 1PVHA 5EFIA 4Z7VB 4NKOB 4U1MB 3EW3B 2ADGB 1RZJL 4GQ9H 2GIYA 1OTUC 4XB8A 1QFUH 3CCHA 2DBJA 3OKNA 1U6AL 5TFSL 1JVKA 3BSZH 3BKML 5SV3A 2C1OB 1KPRA 3MV9E 1SMAA 5EZIL 4ZTOH 4JANB 3HZYB 4AT6B 1QQDB 2CD0A 4KZDL 2EXWD 1V3JA 2HA1A 3QNXA 2AJ3A 3PG2A 5HI4C 4OCRL 3SE3A 4EN3B 1LE5B 4PJAB 1BHGA 4KXZI 1G7QA 4S1QH 5HHME 3MNZB 4XNUH 5E9DD 1HOCB 3BDYH 4I5BB 2A1WL 4OCRH 4AEFA 1DUYA 1R24A 2HT2C 3ARFA 3C60B 1XGYL 1FVCB 3TEUA 3WNKA 2O26U 1BECA 2AQ2A 4XAKE 1CK0L 2A9NL 1BQUA 3RUGA 1JHLH 4U1KA 3PHOB 1D5BA 1S7VA 5GGSB 3U0PA 3TV3H 1HH6B 1C7SA 2BMKA 3ARGB 1WZLA 3TIDB 1NAKH 4KTDH 4LCWE 1JNLH 4Z7OE 2QLVB 3BGMA 3F6LA 4I0KA 1HHIB 1AI1L 3ESVF 4KPHH 2FL5B 3EO0A 1A3QA 4NC2B 5INDA 1JGUL 4FQIH 4MVBD 1CD0A 3JWOL 1RULL 4RZCA 2DMKA 4U4BA 4QOKB 2FX9H 4XXCC 4PP1D 4ERSL 4HC1L 2HKFH 2ORBH 4F7PB 3UX9B 2I60L 3OB0H 4OCYL 5EBLB 3N1PC 1S9WA 3D2UD 3DX9A 4D9QE 2X05A 4I3RL 4PG9A 3VFGH 4WWKB 3QUKB 4KRPB 1SYVB 3H0TB 3CPLB 3GUTB 3KR3H 4GKSA 3U7WL 4G5ZL 5IHBA 4NPYA 4WTXA 4XMLH 3TYFA 1NGYB 4DGIH 5IBUG 2VUYA 1XGPA 4QRSA 1CGXA 1MCDA 1WAAF 2FECI 1ZT4A 4N9OB 1CZ8L 2JJWA 3PF2A 5C09A 25C8H 3DARA 5I30H 5EZOL 4EN3D 4U6YA 1AO7A 1C1EH 1E28B 3FQTB 2PR4H 3T0EB 4OZFH 1NDGB 1UYWH 4LBEB 5EC1A 3QIWD 5A40E 4I0CC 2EDBA 3QXAB 1X44A 2MKWA 4WUUB 4L5FH 3BKJH 4L4TD 1A7NL 3EZJB 4KHXL 4E41D 4KU1A 1CIDA 2DDQL 3V6ZA 5FOJA 2BOCA 4W4NA 4YFDB 5KVMC 1YYMH 3AREC 3ROLA 3AXLA 2IGFL 3ARWA 4M9OA 4YDJB 5E56A 3WV0A 2M8XA 1L9MA 2DQGL 3SDAB 2OZ4A 4M1CC 3TN0A 3P9LB 5D5MA 2VABB 1YN7A 3MLTA 4Z7WE 3QH3B 2NLJA 2VRAA 4P3CL 4XI5D 1F3JB 3CX5J 4KK5C 4IRJB 4X7SL 3SGDH 5TF1H 3VRIB 3MV01 5CZXC 3AGVA 5DVKA 3O8XA 1CG9A 1J88A 4WI5A 1BVZA 2ICEA 4RX4A 2JJSC 3VXME 4IBLT 5I1EH 3ARXA 3GSNL 4Y2DD 3HC4L 5CKAA 4JFDE 4L4VA 1MFDH 1WBXA 2PCPB 4ODVH 3CSBA 5DJAA 2CIIB 3S3PA 1IVLA 4ZFGL 5FKPA 3V6OC 1GOHA 5ITBL 1U91B 3EJYC 4PBWD 1FAKT 4JFOA 4X6EB 3HNVL 3FFCB 3NCJL 5GPRA 2Q87A 4JCMA 4WFHD 4L3CB 3C5JB 2EKJA 4XP4L 3AY4A 4HKJA 4OQTL 1QLEL 1IC4L 2QQLL 3KLDA 5GISL 4LRIA 4PRDA 1QQDA 4NNPL 3UZVB 1PSKH 5FYJE 3OV6A 3QIUA 4FQLH 2XN9A 3B9VA 3SGEH 2DQTH 1KLGB 3IAQA 5DK3A 5D6DC 2H8PB 3PGCB 1FP5A 1BF2A 1VFAA 2F8OA 5BV7C 3B3IB 4XCEB 1FH5L 4LKXA 4OZHF 4XNZC 4CN1A 1DBJL 3MMEA 5FHAH 5DJXB 5EO1A 4MNQB 1MPAL 1T0NA 2AJVH 1AD9B 3C5ZC 4LNRA 4RNRA 3V2AR 5KVEH 3DYMA 2HFEA 3RUGB 1MJ8H 1S7UA 1H8SA 4NQSA 4KC3B 5TE7H 5GJTH 2AJYL 5GGQH 4U6TA 5I2IA 1IQDA 4WO4D 3U2SB 1K4CA 5JDSA 4WWID 3SJVA 2NR6C 4DW2L 1GOFA 2H32A 1LO2L 4OD1L 1S7RA 5CINL 3VCLA 1OL0A 4C56B 4KROB 3GM0A 2D0GA 1FBIH 5T3ZD 1R3HB 2GTWB 3SE4A 2BVEA 5DXWA 1NUNB 5I19L 5L6YL 2A77L 3AM8A 3D5OF 4FZEL 4M6NH 4JO3H 3PIQB 3Q5OA 2WBJC 1CXEA 4NM8H 3O2DA 2B7DT 1C1EL 3D48R 3BRDA 3OWEA 4DEPC 4EQ2A 5DA4A 2CGRL 3HAEA 4NHUB 3VA2C 4P5MA 1TDQA 3GMQB 1WZMA 1V3MA 5IG7B 3QULB 1KOAA 1ZA3B 1MPAH 1PZ5A 1OF2A 3FFCD 4U49A 3TH2T 1MY7A 2X09A 3RVUD 4XMLL 4Z7WF 4NKDA 4ONFH 2JE8A 1FLRL 1KV3A 3EOTL 5DK0B 3JTSA 4XPGL 5CEZL 5LJYH 4NQEE 4XNMB 3D18A 2ZCHL 3MNZA 2A38A 4LLMB 1I9IH 4R6UA 3HE6A 4UOJA 4OV6F 4ZUWB 2BHZA 4YIQB 2L4OA 2X4NB 4CUCA 3PXJA 3ZSTA 1K6QH 4FXLA 1OCWH 4TNVF 2XA8L 1ZLWH 1IC5H 1WZ1H 3U7YL 2P7TB 2C1OA 5SX4H 4WTZA 4M5ZL 4AIXA 2D7TL 1SYSA 1XGQB 4NJAL 3X17A 2IWGA 3KXFD 4KI5F 4UT6H 1KTLA 5I16A 1NAKL 2G2RB 1ZVYA 4OSUL 2W38A 4UMGA 5DZOA 1KCSL 3V7AG 4PJDB 4I8DA 4YC2C 4QT5A 1AQKH 5D7KD 1T1ZB 3HS0A 4HJJL 1RUML 5HHNA 3UTTD 4H25A 5IMKA 2X4TA 4YNYB 4U7KA 5AYUH 4MQTB 2VZ1A 2AI0L 4BKLB 5A3IC 4KY1L 4JFQA 2BCKA 5E94B 1KXVC 3S6CA 4JFFE 4O58H 1MWAA 4H26B 3VRIA 2WBJD 3QHZH 3FONA 1RFDL 5IB1B 3MREB 2BSED 2B4CH 3GKWL 4GS7C 4XNZB 5TQ2L 2DQDL 3B2UD 5F7FA 1FYHB 1KJ2L 1IEBA 5TQ2H 4MXQD 4PJBE 1CFNB 2V7NB 1DQMH 2OQJA 1RFDH 4I77L 2FB4H 5IV2A 4OGAC 4PRAA 2B2XL 4OFKA 1HILA 1N6VA 5IGXH 4ZFFA 2DLEA 5I8EA 1BBJB 2Y1VA 1E4XH 3GSVB 4KKAD 5DJ0A 3QXDB 1OSZB 1BD2E 3MRRA 1H3WM 3B5GA 1FYTE 5LBSL 3VFNB 4OF6A 5AZ2H 3DMMA 5DQ9B 4ZAKC 2DWDA 1AY1L 2P5EA 1A9EA 3CXDH 1P7QA 1ONQB 4WFFE 4PLJD 3FT4B 3U30B 2CO7B 4TUOA 2X9XA 4QXWA 5H37H 4F7EB 1P4LB 2RCSL 3EO1B 1I7RA 5IB4A 3KPOB 1WZ1L 1CGUA 1FSKB 4OCSH 4EDWL 3EHBD 7FABH 4FQQA 1RZKH 2FBJH 4EN3A 1LE5A 1MSPA 4Y4HB 1BJ8A 3RX5A 3KPMA 1T89C 1TTGA 1MCRA 3V7MA 1E4KA 2J4WL 4PJFA 2NTFB 1V7NL 4H0HB 2ZCLL 1U93B 1A7OL 2NLJB 1A14L 2XZCH 3WHXB 1U8LA 3N1MC 4XPAL 1MHEB 5D6DA 3UTTB 1U8PA 3U46B 5JO5B 4L4TA 4JKPH 4M5YH 1CD1B 4KV5F 1S3KL 2R1YB 1G9NC 5HGGS 1EAJA 4UAOC 3EJYD 4QRUA 1KJVA 3C5ZB 4NO0D 4OF7A 3O0RL 2VITB 1OM3H 3V52L 2FSEB 3VXPA 1INQA 2IPTL 5JLZB 1VEOA 2OZ4L 3KPRE 5AZEH 1WLHA 2F58H 1AGFB 3MLYH 1BVLB 3EO0B 4MXVF 4I9WD 1IAIM 4KKBD 2BC4A 4K23H 3WO4C 5AZ2L 5SX4I 3PWUB 3O6LH 4KK8D 3VFMA 5IWLC 1HKLL 4NQTA 3LH2H 4J4PA 4XTRC 2G9HA 4W6XB 1TCRB 5F6IB 1FNGB 1GGYA 2D0HA 1NAMB 5EU5B 5DUBA 1T6WA 2PYEE 2UVFA 2WNGA 5DRWA 3P4MB 4NQCA 1XF3A 5ICXA 1CT8B 1QR1B 1SYVA 5E1AA 3EYUH 1ZHLA 2YUZA 1T7VA 4MNQA 2XPGA 5JQ6H 2ZG1A 2JCCE 4X4YB 1VCAA 2VDNH 2VDQH 2PYFB 3MRQA 1F11B 3L5IA 4YJZL 1HDMB 5DHYA 3EO9H 3TO2B 1YYLL 4HWZB 4X4XA 1H3PH 4G6MH 3IAGC 3IS0X 2OMBA 1JCKA 5T1LB 4MLIA 5D7IB 1E4XI 1EJ6A 2VXUL 5J6GA 1CXKA 2V9TA 4P5TC 4KKNA 1QLEH 1S9VA 2Z8WC 1JUFB 3W9DA 4LU5L 3N1GC 2ZP0T 2D4DA 3P0VL 5BZDA 1T22A 2RQ8A 1WWCA 4ENEC 2LQRA 3SO3B 5DDHA 1WQVT 4Z95H 3MPCA 2F54D 3QO1A 1RHHB 4BQ8A 2DBLH 3BKYL 5JA8B 3LKOA 5C71A 1SY6A 3GMOB 1BQHB 4UINL 1N5YL 3SGEI 4HUUB 2ATKB 2BVOB 5JOPE 2ZZUT 4X6DA 5IB3B 5C92A 2BNRD 5DK0A 1OTUD 1IM9B 3DLQR 4NHCH 2OQJB 1UM5L 5HDQH 1K4CB 1R6VA 2NYYD 3NH7L 4FXGB 4L9LB 5I1LB 4N5EC 5FKAA 4D0BA 3W9EB 3G6DL 1R3IL 5C0CB 1FNSL 1YY9C 5KJRL 3QIBD 3BQUD 1TVDA 3ZDZE 4G42B 2MQ0A 1DQLH 1G7HA 4FFYL 5KAQF 1WIOA 4FQXA 4I3SH 2CXGA 2ED9A 3P40A 3FB6A 4BFIB 1S7SA 2HWZH 5INDB 4NIKB 1JE6A 4QCIA 4PRPD 1TTUA 1CICC 1QNZH 3RNQA 3MJ7B 5C9KA 4R96B 3V6OE 4Q6IB 5IW1B 4JQVA 3QULA 3BEWB 3LKSA 1FZMA 2FNBA 1LO2H 1AHWB 4DOHE 2XN9B 3VA6A 4X98A 3O4OB 3QJHA 4LL9A 2VDPH 4ODSL 1KCUH 3CFKA 5C8JA 4HUXA 5F70A 2X4TB 2A74A 1DQQA 4HH9A 4N1HB 1M71B 4HIJA 1NC2D 5F7UA 1T04B 1R5WB 1EVUA 3CVHA 3ZE2E 1IT9H 3N1FC 4P2QD 1NPUA 4RNRB 5E00A 4HCRA 5C0BD 1DBAH 3UPCA 1KJVB 3C5ZA 4KV5E 4X8JB 3IFNL 5DR5H 1J8HB 1ETZA 5KSVA 5IEKB 2Z31A 3TIEA 2V7NA 5ESVA 5IB5B 4F80A 2EH8H 3UJJH 2EE9A 1P1ZA 3PGDB 2KZWA 3LKQA 3SCMC 5KW9H 5I66A 2HT3C 1WIPA 1HHKB 1HIMH 3HE7D 4LDLB 5EUOE 4AH2B 5C0RH 5L7XL 5I17B 5HHNB 3O11A 4NBXB 4OKVB 2MCPL 4X7TB 5FYJD 5HGDA 3EDJA 4PG2A 3S35H 3W5MA 3K4DA 3G04A 3A0OA 2OCFD 1MLBB 2GJ6B 3IAPA 2BCKB 1BBDL 1LP9E 2ADJA 1LD9B 4ZDHB 4NCC2 4OM0H 2E6JA 1D6VH 3BZEB 3QAZC 4J6RL 1EHNA 2ZUXA 2IBBA 1TCMA 2FGWH 4J6RH 3V5DA 5JOFB 3MNWA 2X4UB 4N8CL 4HBCH 2H2PC 1HWHB 1UCTA 1RUKL 4N0UE 3TBWA 4MA7H 1JMZA 2R39A 3VFSA 2PYFA 2OI9C 3UO1H 1IAOA 3KPSE 4MHHI 1CD1A 4R90H 2R1YA 3SQBA 3VDCA 2ZUSA 3LQAC