4ONGH

Fab fragment of 3d6 in complex with amyloid beta 1-40
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
210
Chain Sequence
EVKLVESGGGLVKPGASLKLSCAASGFTFSNYGMSWVRQNSDKRLEWVASIRSGGGRTYYSDNVKGRFTISRENAKNTLYLQMSSLKSEDTALYYCVRYDSGSSDYWGQGTTVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure reveals conservation of amyloid-beta conformation recognized by 3D6 following humanization to bapineuzumab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords 3D6 FAB ANTIBODY HEAVY CHAIN
total genus 45
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2014-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ongH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ongH01
1ZHKB 5AUMA 5KSVA 1JNHB 1HQ4A 1XCQB 4OLXL 5CZVL 4X4XA 4Y4HD 3MREA 5MEPB 4PJXB 3IDNA 5I30H 3RA7H 1L7IH 5GZOD 4HZLA 4QTIL 5C09D 2HT3D 5JW4Q 3VRJB 1A1MA 1JUFB 1V7MH 1PEZA 1NBZA 2DDQL 4C54A 5C7XL 1MFDH 1EJOH 2BXYA 1LP9A 4JVPA 4PJAB 3RX7A 5IB4B 8FABA 4YHIB 5EWIL 1QLFA 2MKLC 3DV6A 3H9HB 3KLAB 2OX5A 4X80L 4HBQA 1A6UH 1L6ZA 4P2OD 5EZJA 3CVHB 4EOWH 1YMMA 5CFHA 1T04B 3V6ZA 3MJ7B 1OB1A 3JTSA 3H3PL 3G6JE 2Q7YA 4PJFF 5TF1L 5L88L 1PX3A 3OGCB 5F7WC 5IG7A 1A7PL 1OAZL 2CJUL 3K2MC 3C60A 4HKBA 1X4XA 4OGXL 5FK9A 2APXA 5I66A 5SWZA 3CXHJ 3I3BA 1E4KC 4LOUC 1NUDA 2EDQA 2HTLC 3CFCH 3QQ9D 4U1LB 1XZ0A 1HCVA 1IM9A 5CZVH 3GMMA 2NW2B 3C09C 5ICZA 4XC3H 4NBZB 5FYLE 5F9OH 4ODUB 1EEZB 1UQSB 1H3UA 4XPGH 5IROA 4BKLA 1KELL 2Z4QA 4KQ4H 3MV8E 5DVLA 1K6QH 2XICA 1NL0L 3Q2CA 1MJ8L 5A16A 3OR7B 2C3VB 4JDVB 2F54E 2WP3T 5BZDA 3V7MA 3TP4A 1NC4D 2Q87A 3D85B 4MQ7A 1ZLSH 4IOSD 1GAFH 3O3UN 3SGJA 2CLZB 3FONB 4U6VH 1ZLVH 5JPNA 3L5HA 5I16A 2Y06H 3DLQR 4XP9L 4K2UH 3DYOA 4DGIH 3MROA 3TH2T 3VD9A 4WUUB 3FAWA 15C8L 3VXPB 3BYYA 1PZ5A 2EZ0D 4WNQB 3OF6D 4NRXA 4MZ2A 5BO1L 3IU3A 4Q0XH 4ACPA 4MSWB 5EU6A 2YUXA 1F5WA 4H8WL 2A1WH 2L0DA 3V4PL 1RZ7L 5CJQH 4JFQA 1A2YB 1JGUL 1PLGH 3GMMB 4H25B 5BMFL 4FS0A 2YD7A 3LH2H 2IG2L 5E8PB 5IFAH 3L3JB 5DA4A 1D5XB 3GIZL 2BNQE 3QDJA 3U7WH 4MNHB 5DC9B 4KDVA 1HHIA 2J88L 3BWUC 3SE8L 1FG2B 2WBJD 4PRPD 3HAEB 4LOUD 5FYKD 1J0KA 5J11C 4HIHB 5HHME 3VW3L 3FCTA 5GZND 5GS1B 3CX5J 2XWBA 5FUCE 4JY5L 1E27B 4N0UE 5E2TL 4R0LB 2P49B 4IRSD 3BI9X 4YFLF 3OB8A 1P7QB 1MCBA 3MNVA 2R2BB 3C2AH 3MCKB 3OG6B 4UT7L 4R4FL 1LWRA 4Y4KA 2HT4C 2Y7QB 5DT1L 5B4MD 1WAAF 1S3KL 3T4AA 3C5ZC 1T1XB 3GHBL 4BUGA 2E6QA 2G5RA 1UZ6F 3HRZA 4F33B 2X09A 3N9GH 4WUKL 1QFWM 1OWWA 15C8H 1JV5A 3E6HB 4JJHA 4N0CD 3T8XA 5J6GA 1IGFL 1ZTXH 4NJAL 3IDGB 5D8JL 1W72H 3STLA 5ERWB 4PBXA 3TZVA 3ZKND 2X7LA 1AJ7H 1L9MA 2RIKA 4OLZL 1E0OB 3IJHA 4WDIA 3DWTA 4O5LL 2F19L 1AGBB 1T89A 3ZZ1A 4CN1A 5IT2H 3D0VA 5E8DH 3KHOA 1MHHA 4Y4FB 4M6MH 2EO1A 3O4OB 3OX8A 5JOPE 5GIRB 1FH5L 4DKEH 1DQTA 4Y19B 1KSRA 3UTZA 4OCYL 1MRFL 3GSNB 4FQHA 3OKLA 1HSBB 3Q6FB 4AIZA 5E4EB 3D85A 4R96B 1F3DH 3OAUH 5FO8A 5K59E 4KY1L 4P3CL 2QHRH 1U8MB 4D9QE 4F3FB 3EW3B 4JPVL 1H5BC 1SYSA 4HS3B 5DTFB 3UTTB 3MRPB 4NHCL 2JLLA 4YX2L 2Z93B 1MCEA 4ZPTB 2XZZA 4CJ1A 4PJHE 3QDME 2CDFB 2NQCA 1XGUA 5ESAB 4WWKC 3GBMH 3DVGA 3NFNA 5GS1C 4MDJB 2VNCA 2X4NA 3HZKA 3EOBB 3RWEB 2DWDA 2AEQH 3P4OB 4NZUH 4X80H 4PFEA 3RY6A 3IJYB 2R0LL 3KS0H 1KCUH 3CSPA 5IQ7H 3SKOB 2MJWA 5JHDD 1TZGL 1QSEE 4XVUC 3ROLA 4D8PB 3KPSB 4NZTL 1MEXL 1T5XA 3TZVD 4P9ML 4GMTH 1C5CL 1PW3A 5I30L 2EE9A 2AJ3A 1FIGL 4YUEH 4IOIA 4Y2DB 1LE5A 4GKSA 4WWKB 3ULSB 2J3SA 3X14A 1YPZB 3G04A 3FB6B 1U8KA 5F44A 1MI5D 1S7XB 1JRHL 1SJVA 4Q6IA 4JPWH 5AEAA 2B5IB 3TBVB 1P5VA 3ETBF 4LGRB 4JO4L 2VDQL 4GG8A 4ZPTA 3DIFA 2YMXL 3T0EB 5F89B 4D9LL 5JPNB 5C08A 3ARSA 1QBLL 1J0HA 2XY2A 3LKQB 2O5YL 1AY1H 3VXNB 9CGTA 4RFEB 2DLFH 5IJVB 4Z7VB 4LMQE 4YR6A 4L8BA 1RUQH 5DD1L 4HPYH 4P49A 2EH8L 4JPKL 2VLRD 4LFHD 4GAYB 1Z9OA 1RZJL 1SEQH 5GRUL 4S1QL 1SVCP 3N1GC 4X9BA 4PTTB 4MXQC 3ZE1E 3BKCH 1F97A 1NH6A 3STLB 3ZKNC 4K7PH 1MH5B 1S9YA 3WV0A 4H20L 4JM2D 2Q8BL 4RGOH 1INDH 2GK0A 4ELMF 4DUXA 4YDVB 3D9AL 4O02L 4YDKL 3UCRA 4MJIE 4DN3L 2OQJB 4OFYD 2H41A 1PY4A 5FGSA 1XCTB 5EBWB 4XWGL 2J2ZA 2SEBB 3OKLB 3TBYA 3G9AB 2ZZUT 4L8SB 4I2XB 2VLJB 5KZCB 4PJEA 1IJ9A 3BIAX 3RVVC 3GJFA 4Z7VA 5FB8B 4PREB 4R9HA 4EBQH 5EBMA 3JV6A 3ELAT 4LSVH 1F4YH 2VLJE 4DUWA 4IDJL 4DGVL 5E2WH 5J12C 1CFQA 2H2PC 3BD4A 3FN0H 4HUWB 3NFPB 1CGYA 2WZPD 2NTSP 1IGFH 2WBJC 4LCCA 4LGPB 3PWUA 3H9HA 3KLAA 4XNQB 3QZWA 3I2CH 4M93B 4G9FD 4POZC 1H15A 1J0YA 3QIBA 1CLZH 4FFYH 1BOYA 4RGMC 4U1IB 1DR9A 3QO1A 1OTUD 3UTQB 1LO5B 4RFOH 3DHJA 1G6VK 5JA8B 4DW2H 4XNZB 4ETYA 3HAEG 4F9LA 4EDWH 1UH3A 2ZNXA 5EU7C 5F9JA 1RUMH 2YD2A 5DUPH 5JIHA 3WKML 1U58A 5C09A 4WV1A 1SJHB 4V1DE 3HE7D 4Z7WB 2VXQL 4I2XA 3BDBA 2BOBB 4KMLB 4NQDE 3G5YA 5TPWH 4XP5H 3ZSSA 2OZ4H 1OGAA 2P47B 3P4LA 4JHAH 3JV6B 1SM3H 1JVKA 4W81A 4DN3H 5GS0D 3D18A 1DQDL 5E9DE 1VADB 4JJ5B 4JVUA 1VACB 3MV9E 1C5DB 1EIBA 2MCG1 4AH2B 3B43A 1C5BH 1PKQA 4L1DA 1QR1B 2X4TB 4K3HA 2E9BA 3QIBB 4N0YL 3P77B 1N4XL 1BIIA 1CE6A 1S9XA 3MNZB 3WEXA 1HQRB 4AG4L 4C56E 1LO5A 3PHSA 5C9JA 1FBIH 3QIBD 3H0TB 2D7OA 1RJLB 1KEGL 1YJDC 2HLFC 3NCFB 2CRMA 5F6HI 1HWGB 1M7IB 4WFFE 4JFHD 3ARPA 4P5TA 4Z8FH 3RVWD 3HPLB 3WIHH 1JBJA 2AAVA 1DVFA 5C6TH 5GGQL 5HGHB 4NN5C 4O2EA 1NCUA 3HC3L 4NSKB 2CH8A 1FO0L 2P24B 2VDNH 3KNBB 4O00A 3BE1L 4C57C 4U6HA 3P0YL 3S5LA 1TJHH 5TF0A 1S7SA 4PJ9C 2OL3H 3TEUA 3RIFF 1L9NA 2VE6B 1I3GL 1OP3H 5E95B 1MIML 3HPJA 3T77B 1YEDB 4DCQB 2NY4B 1CQKA 1WAAA 5AYUH 1RSFA 2VLKD 1MSPA 5GS3A 1S8DB 1WZ1H 2IAMA 4KY1H 1CIUA 1JF1A 1GGCH 1GGBL 1E4WL 3LSOA 1FNGB 4KFZC 3EZJB 1CL7L 4X6DF 5M95B 4OZGF 1IKNA 3NFSL 4U1IA 3OKKB 2DKUA 2GSIB 3H9SE 4D94A 4JRXD 3PL6B 3STBA 4LVHB 4YXHL 3TO4A 4Z7UA 5CEZE 1JPST 3AC0A 1J9CT 5IP4A 1V3MA 2FSEB 5GZNC 1UB6B 4WCYH 4PPTA 3FO2B 4HIXH 1GZPB 1MCIA 4LU5H 1KCLA 4LF3B 4F37K 5HHOB 5DRWA 5J1AA 1F8TL 1C1EH 2XZCH 4NNPL 2Q76A 2XI9A 4MZ3A 4OCSH 5EBWA 3OXSA 2HFFA 2AJUL 5EZLA 2AI0L 2I9TB 3UPRA 1EGJL 5CZXD 5DJ6B 1NMBL 3CXDL 4OZ4A 3V4UL 5GJSL 4NQEB 5F72S 1UH2A 4MQTB 4JM2B 4Z76B 5JHLH 2XNAA 3K80A 3EO1A 1D5IL 3WIHL 2APVA 2RJMA 3QWRD 1ACZA 3B6SB 1A3LH 5ADOL 4PRHA 1R3IH 5F96L 2F54B 5IW3A 4QRQB 2X9XA 1CD1A 3FL7A 4NP4H 1AD9B 2OI9B 4LEOA 3DUUB 5I1EH 1DBJL 5IVXB 4KVCH 3QI9D 2X4UA 5D1ZA 5B3JF 3AY4A 1JNNH 4N8PA 4XXCC 1R3JB 2MPAL 4NHUA 3U0WL 1VEOA 1A6ZB 4PJDA 2W0KA 3GHBH 3FB8B 5D6DC 3S36X 4OLUH 4QNPE 3NCEB 3TESA 1OAKL 3VXUB 3WFHA 3V6FA 4XCEA 2EIBA 5KS9B 1TZIA 3EOAB 1G7IB 3GI8H 4HFUL 4KRNA 5E5MA 4EI6B 2D03L 5KSAA 3VFOA 3LH2L 1IT9H 1QA9A 1NEZG 2IH1B 3CUPB 1UJ3C 2D31B 4UB0H 3I6LD 3PHOB 3O8XB 1U93A 5TPWL 4NQCB 5TDNA 3U0TB 1K5NA 2UWEE 1IGIH 3VGAB 3CZJA 4ZO8A 3HMXA 3PWLB 2HG5B 4HWZA 5GGUB 3WFCH 5HHMB 1FL6B 1D9KC 1DBBH 3DTXB 2PYED 1RD6A 3MOBL 5DK0A 4BZ2L 5GZOC 1EV2E 1YEEL 3IFPB 4M1DL 1PQZA 2GT9A 1ROWA 2R0ZL 3VXOA 3BPOC 5EH1A 5TDPB 1HILB 4H5SA 4JDZA 3VXMB 3I6KA 1CFSB 5E8OB 1DBMH 4WFHE 4X4ME 3WIFB 5I1LB 4M1GL 4Z7OE 1DL7L 3U9PL 1F3RB 5F7EH 1MCOL 2VABB 3P2TA 2G60L 5L6YH 3WS3A 4HIJB 5SWSA 2YEZB 4I9WE 4HLJA 4KRPB 4Z0XA 5IVXF 4I0KA 5GRXG 1ZOXA 1FFOA 3CUPA 4XNMB 3FO2A 3B5HA 4ZUVA 5IVZA 4JDTH 3IFOB 1NGWA 4LASL 1B0GA 3PWJA 3VFSA 4PJGE 5D7JB 1NL0H 2DLGA 1U3YA 1WAAE 5JMOC 3WFZA 1RVFL 3M45A 5CJ8A 1Y6NR 3QCVL 4JRXB 1TMCB 1XF5A 3K0WA 2IPUK 4JZNB 4PUBL 1U2CA 4YJZL 4L3EB 4X98B 3WSQL 4FZ8L 4XNYL 1FVDA 4PJFE 1QFWH 5T1LD 5GPRA 4L29B 2OJZH 4MMXC 4PJGA 4OZIE 4LCUB 3LRSB 3DUUA 2XZQL 1JHLH 4LCYA 3BUYA 3VH8G 3HZVB 1NCAH 1NJ9B 1IZJA 1OHQA 2BVEA 3DYPA 4JN2B 3HC0B 3HI5H 3F7RA 5EORH 2AV1A 2F8VA 3AAZB 4K71B 4LIQL 3HNTL 4LVNC 1A1OA 3L6FA 5ITFA 3UBXI 2ICWI 1KJ3L 1FO0H 3FQWB 2ZCLL 3BSZL 4L5FH 5JXED 2FJHA 4JANA 3WS6A 1II4E 1RJCA 2YN3A 1FAKT 2BP3A 4EXPX 2BY0A 2VDKH 3KVQA 4CDHA 1QO3B 2R4RH 1MF2L 1U6AL 1NGXB 4LSPH 5DRWB 1U58B 5DRXB 5DRZB 4C58B 2R1WB 4J3SA 4UDTB 2H6PA 3LKSB 4NUJA 1U8PB 5A1AA 1SMAA 3FRPG 4HUXA 3ARTA 5FM4A 1IBGL 1YNTA 3RVTC 5FFLA 1E6JL 4U6XA 1FVEA 5CHNB 5I19L 5ALBL 5EU5A 5CSZA 3Q5OA 3T04D 5HDQL 4WI9A 3RI5K 2HH0H 3PUCA 2Y9RT 4MHHI 5D7SL 1A3RH 3NGBC 4MD4A 1PZUB 2ENSA 2WV3A 3EO0A 4UDUB 4DOHE 2F8OA 1U95B 2V7NA 3SE3A 1H3VA 3B2VH 3WIHA 2EO9A 4WNQA 1KEMH 2X5PA 1GRWA 1I8IA 3RL2B 4DAGH 4MSWA 3LKOB 2VDOL 3T4YB 2WBKA 3U2SA 3BH9A 2B5IC 2XRAH 3ULVD 5FDYA 4HIJA 2D4DA 5HDLA 2ICWJ 2LAAA 4YHOH 3BQUD 1OGAD 4ZODA 2VL4A 1FFQA 1BQLH 5JXEA 4JFFE 4XBPA 1T2JA 3GBNH 3QDJE 1C08B 1QFWL 4NM8H 4F7TA 1WZKA 2FBJL 4GAJL 4X7CC 2AK4D 4IHOB 5J4MA 4G43B 3QDJB 5DDHA 4YIQA 4WW2C 1J0JA 4NQXB 4O2FA 5HYJD 3KS0J 2V17H 5FO9B 3LEYL 2Y6SD 1CLZL 3O2DL 1ZGLA 3C09B 4K23L 1YMHA 4HKZB 3CH1B 3DRQA 1QRKA 4FXGA 4WEUD 1FVDB 5I1CL 2GFBA 5T5FL 2HTLD 2C9AA 3QQ9C 1GH7A 1FHGA 5JIPA 2XTJD 5E2JA 3H9YA 5E2WL 3QRFM 5DMKA 5F7MC 3GGWB 5C0ND 3ESVF 4ALAH 4U33A 1HXYA 3WNNA 2J8HA 3QFDA 4J2XA 1ZHBB 4IJ3B 4K9EC 1FNHA 3S35X 4LCWE 3RTQB 1NCBL 1OB1B 5CD5D 2OZ4A 3HA0A 1RZIA 4JO2H 3HI1A 1LQSR 2OR9L 4UILH 4I0CC 1UWXH 1VKXB 1GL4B 1FO0B 2E7CA 3PWVA 1QD0A 3BQUC 1VGEH 2YPLD 3H0TA 3G6JA 2LU3A 5JW4R 1U8IB 2VIRA 4Y5XA 5CBAB 2VLKA 1K9TA 4JRYD 2AK4A 4X8XA 1BQLL 1J8HB 4M93C 2OCFD 3UTSE 3BKCL 1GJIA 4J3XA 3KPOA 4KROC 4MQXC 1KPVA 3VFNA 4TYUA 1VFUA 5ID0B 1RK0A 1DLHB 2V2XB 2H26B 1SY6L 1E4XH 3GSRA 3GZKA 4PJCF 4V2BA 4Y5YC 2IG2H 1FNFA 1ZGLM 3SGKA 5TE4L 3PIQB 3MRBB 4DEPB 4OGAC 5AWNH 3BPCA 4X6CB 4E42A 4HPOH 4QYOB 4UT6H 4YHZL 3KYNB 1WBXA 3X17A 3W2DL 4PRAB 3SKJL 2APBA 1NGYB 4PGCA 4PJBB 2PW2A 2EC9U 4ERSL 2GUOB 2ZOLA 1AGEB 3BT2L 4XBEH 1QLFB 4HS8L 1AP2A 2Q8AL 4XAKD 1DBJH 3MRRA 2CGRL 3EAKA 1DFBH 2ICCA 4YUEL 1I7RA 3MRFA 1S78C 3QQ4A 3QXAA 5HVFB 4M6AA 1IAIM 2BSTA 2VDKL 2YPLA 1RZFH 1G7JA 3EBAA 3QUXA 4XP4H 3NZHH 4RAUA 2A74A 2ESVA 3TO4B 2VAAB 3HUJE 5EDXA 3NPZB 1FNEA 5E6ZA 4GW1A 4UV4H 5F3HA 4HUXB 2ATKA 5DFVD 4OD1L 3GSUB 5INCA 3PWPB 3HNTH 4R6UA 3NBNA 1OT2A 5D7KD 3GBML 3DRQB 4HKZA 2HN7A 4KTDL 3S37L 1PBYA 2ZJSH 5D96B 5EC2A 4YDJB 4LAQL 4RAVB 1I8KA 3FMGH 4OSUL 1NCTA 4LP5A 4PY7B 2IFFH 4HQQL 4HT1H 4K8RD 4Y4KB 5CEZD 4MLIA 3EOTH 3BZ4B 3BHBB 3NFSH 1MRFH 1KNOB 3DUHA 4PY8I 3KJ6H 4NJ9L 3BH9B 5HPOA 3SDXB 2R29L 2EDBA 5T1MB 1BFVH 1MVUB 4DEPC 5GS0H 4G6KH 5FV1L 4G6MH 4K71C 3SKMB 3WN5A 3LDBC 4UAOC 3CZFA 2P5WA 3QBTB 3RGVB 5JDJA 5EU6D 5T1KA 1CD9B 1OF2B 5JUEL 3CK0L 4LCIH 1LO3L 3R8BB 3QUYB 3QUXD 4OF6A 3ARUA 1UXSA 4OZHA 4ZDHB 2CXKA 2FX8L 5C3LD 1YMME 4QXTB 4PR5B 5I8KL 1AKJB 4G8FB 4M1GH 4AYFA 1UC6A 1O7VA 1YDPA 3M17A 1DLHA 1XIWB 3MGOB 3U36A 2X70B 1U8NB 1T5WA 5JR1H 5T3XL 2BNQD 2X9WA 4M02A 5DFVC 3TPUB 3WXVL 2FIRT 4PRPA 5EBMB 1Z9LA 3MV8B 1JGLH 4ZUSB 3PABA 5DTFA 2DL2A 5SX5K 1NEZB 3CDCA 5AG9A 2Z93A 4RMTA 4V1DB 5GRJH 1ZHBA 1CWVA 1NCWL 4HWEL 3D1MC 4BFGA 1XF3B 5F8QC 4R7NB 2QQLH 1I3UA 2GCYA 4GAFB 4YQXL 2QSVA 3UTQA 4YE4H 2F74A 5DQDL 1T0NB 1U41A 1F6AB 3DURA 4HJJH 5C2UB 1U3HD 5F9JB 2P5WD 4YO0A 4O2CA 3HNSL 5IMOA 3F7VB 3THML 1DQDH 5DHXB 1CICD 5K9JH 4HUUB 4YE4L 5E00A 5FA3A 4JHAL 4PG9A 2ZUXA 3IJHB 4OLUL 1MJJA 1NAMH 3GK8H 4CBPA 1G7MB 4J3OC 1AFVL 5HYSB 3H7BB 4OJFH 4G5ZL 4KVCL 1EX0A 4MB3A 4HLZG 5DHYB 1VADA 3HNVH 4MNQD 3V0VA 1H3TA 4QRPD 1R6VA 3GHEL 4PJ9A 4K3EL 1CCZA 5D7LD 4QHKJ 3LD8B 1OAUH 4MJ6A 4F57L 4R7NA 3VXNA 5I1KL 4AEFA 3DI3B 3KWWB 4L29A 3CXDH 3TN0A 2ZUQC 1F58H 1TPXC 4FQJH 1JE6A 2AI0H 3GSOA 3KG5A 2ZSVA 3AS1A 1LO0H 4WFHD 2DBLH 5DJXA 1TDQA 2YRZA 4RGMB 3SGEI 4HCRH 1CGXA 4UV7H 2JK5B 3TYFA 5E00B 5D2LF 4QHNA 5F9DC 4F7MB 5BJTA 3K1KC 5CIPA 4QOKD 4HUVB 3MRQB 4FFVD 3RY6C 5DMIH 2W1NA 4UQ2A 2A9MH 1JGVL 4IHOA 1T2QL 5D7IB 5IW1A 1AH1A 1EVUA 5D93C 5HXMA 1TPXB 2BDNH 5E94A 4WU7A 4X7FC 4G8GA 3KPQA 4NO5B 5AAWA 1IGYA 3MV7D 2V9RA 5I2IA 4P4RB 2Z8WC 1BFOA 2VDOH 3OAYK 3C5SB 4M3JA 1SEQL 5GRUH 4E5XA 2HFGH 2NY2B 5IMKA 1IAIH 4KAQH 4MJ5B 4XVTH 2XN9E 2EH8H 4ISVB 4ONFH 4EUPH 1Q0YL 1RUQL 1GGBH 3GIVB 1N59A 3I6LE 3OKOB 4OFKA 3UPAA 3HUJA 3BJ91 4P57A 1A6VH 2ITCB 3I9GH 3MLSL 3FT4B 5HHXL 1XGTB 4TVPH 4JO4H 4Z7NE 3FB5B 4MA3B 3L9RA 4QRTB 4ORGA 3ARZA 2Z31C 1SVZA 3EYVA 1X5XA 4PLJD 3BN3B 3VXRB 5DD1H 4KDTC 2BFVL 4N5UA 4UV4L 4ZSOB 4XX1E 5EU3B 3IU4L 3QEQD 1VPOL 1QRNB 1MREH 2PN5A 4GOSA 1M4KA 4OIAA 1LDSA 2VXUL 1A9EA 1UFUA 3RGVD 2BVQA 2NY5C 3CFJA 4RGNC 3ZE0F 1TJIH 4PJEF 4ZTOL 2IALB 35C8H 1LVEA 2R0LH 1S7UB 3B9KA 3ET9F 1XF4B 4NKIL 2DLIA 2ZG1A 3AVEA 3I02A 5I1IH 3UC0H 5FV2A 3G9VA 2VXVL 4GKOA 1OGAB 5BCAA 4KXZH 2N4IA 3V0VB 3QDMB 1UCBH 3SDCB 1U92B 1YMMD 4PJ9B 1KYOJ 2E8ZA 4DGYL 5D93B 4NRZB 5ANMA 3OKEA 3ZLQC 4RWYH 5T33H 3O9WC 1KCUL 3QZWG 5DUML 2FEDD 3Q3GA 1QP1A 4YBHA 2BK8A 4TNVK 4Y89A 2RQ8A 1NGYA 3TJEH 2M26A 4QF1B 5IR1B 4DKEL 4C83B 3P4MA 1ZHKA 3H9SD 1CGVA 4X4XB 3CH8A 4YDLC 4Z78A 5C71A 1WF5A 1D6EB 2R56H 3BWAB 3CFBB 2JB5L 2F54D 4KUCD 3NVQA 2CK0H 3F7VA 3R8QA 4NNXA 4I77H 3QULA 1WVZA 2A74B 4F58L 1BZ9B 1MFBL 3DRTB 3U4AA 3GMNA 3QSKB 1BM3H 2XA8L 4HS6A 3IXTB 3T0DA 3PWNA 3CVHA 4Z7QF 4R97C 3SDXF 1LEGB 4ZQKA 4JKKA 1AO7E 5BV7L 2FR4B 2P46B 4N8CL 3DX6B 3P11H 4QHUB 1SYVB 4QT5B 4YHPA 2EDRA 1RUPL 4Z7NF 2EDJA 4FZEL 1FPTL 1RQ5A 2K7PA 2H26A 3FQTA 1VGKB 3S36H 4MA1B 1ZE3C 1FV1B 1LEIA 4KJPD 1YQVL 4WUKH 4WU5A 4LMQI 4JLRB 2C3XA 4K07A 4J4PC 2HKHL 1DJSA 4S0SD 5HYEA 1R5VA 1HEZA 3MUGB 5I74C 1DQMH 4XWGH 4UOJA 3ARDB 4KPHL 3KYOB 3MRKB 4Z77B 3DOSA 4XH2B 1IC5H 2ZP0T 2Z8VC 3NZ8B 5GQBA 3BW9A 2XN9B 1RJZA 4PRDA 5TH2B 2X7LB 2XFXB 4Q58C 4F15B 1QHPA 2FGWL 3IF1B 4QY8A 1F45A 5F6IB 1DTUA 2Q8BH 1XR9B 4PIRF 3MLXL 2H1PH 2MCPL 5LXGL 3MROB 4P5TD 2XWJA 1D9KD 3QXAB 4QHUA 2DQUL 2LTQB 4IRSA 5I71B 4GLRH 2A83A 1BWMA 5C07B 2JTDA 4CJ0A 3G5VB 4U0QB 1NBVH 2AERT 2D0FA 4NRXB 4DAGL 3I84A 3CD4A 1CDGA 5JW3H 4NSKA 4IMKA 4ISVA 5CSBA 2ARJA 5IFAL 3GIVA 3FRPA 4JG1L 1H3WM 3MA9L 3WMSA 3C6LA 2QTEA 2GITB 4X6FA 2VL5B 2MFNA 1PVHA 2VLLA 3C5JA 5SV3A 3W9EA 2DLTA 4IRJC 4BSWA 4D9LH 5HD8D 4NCC1 4MAUH 43C9A 5E8PA 3QCUH 2H2SD 4HG4K 5ENWA 1MJ8H 1HHHB 3BO8B 3ZDZE 3ISWA 3HZMB 4N90D 32C2A 4ZS7H 1O5DT 2WLYA 3VRLE 1U8HA 4N90E 3RZCC 3MZGB 3ULUF 4HH8A 5EU3A 2V2WB 1NANH 2R23B 4Y5YB 3QI9C 4LK4A 2OBGA 5C0BE 4ODXB 2FD6L 2J8UA 4D8PA 4LSPL 1FE8L 2AV7A 3JTSB 5GSRA 1OD7A 4KK5D 1QO3A 3NMEA 1IFHH 1N7MH 4PJ8C 3DBXB 3KXFE 5E5UB 3VE0B 1QUNA 5LVEA 3DX8A 4K3DH 3CZFB 4U1SA 4G9DA 3NIDF 1K6QL 1N6QL 4KGLA 3HC4H 3ZKQD 1G0YR 1CR9L 3CVIH 3N85L 1IC7H 1ZT4A 2HLAA 3G5ZA 3I02B 4LHUG 3SDDB 3VXSE 5KVFH 2F53B 5C0JA 1FG2A 2GITA 1U8JA 1AR1C 4HJ0D 3O3DB 5J1AB 4F15C 1CF8H 2CMRH 2GKIA 4KK6C 5ADPH 1YPZF 5C6WH 1S7RB 5MEQB 3MLZL 2O5ZL 3BGMA 1L4IA 4JQVA 4OGXH 3AM8C 2GJZB 2X4SA 3ARGA 4TSCL 4L8CB 4IS6B 5EUOB 4G3YH 3RA7L 4LCWD 3DV4A 1WITA 1I3GH 4M61B 1A7RL 4NBYB 4PJIE 1FRGH 2HFGL 1WBYB 3SGDI 1JFQH 5HD8C 1EO8H 2OSLB 1GIGH 5D1QA 3N85H 1AO7B 2DIAA 4NQED 1LDPL 2EC9T 5D1ZD 3O3EA 4LPTA 1TJGH 2R4SL 2VXTH 4X9IA 3RBGA 3RVTD 1AQKH 5E6IC 5EU6B 5D7LE 1TVHA 3PDOA 2Q7YB 4RISH 4XXDA 4MNQA 5ILTH 4Y4KC 1PG7L 1DDHB 5C09E 1QKZL 1X7QB 1ORSA 2WBWB 2EDEA 1U8JB 4B5EA 2ZSWB 4RQQB 4RGNB 5B3NA 1EDQA 3S88H 4NO0A 2BXZA 4F7EB 1OCWL 3BT2H 3AREB 5IGXH 1DBML 3VXSD 4FQLL 1AC0A 1KCSH 4JFOB 1Z2KA 4WWKD 4E5XB 4ZG1A 4G8IA 1G84A 1UQSA 4QHMA 4IS6A 3SE4A 1UEYA 5DT1H 1TCMA 1TETH 3QPQD 5J89A 5GS1A 3CMOH 2N7AA 4WIQA 4UMGA 4LCUA 2DQCL 3BRGC 3RZCD 3P0VL 1QLRB 1WC7A 3Q1SH 2VZ3A 2DM4A 4EXKA 3IDMB 1ETZA 4KMQA 1X5AA 2LAGB 4XP5L 3V95A 2X4NB 1Z9SA 2J88H 5DLML 4U7KA 1RUKH 2VKWA 3T2OA 4Q6IB 2VLRB 2CDGA 2VXQH 3K8MA 4RGND 4IDLA 2AJXL 4U1NB 2E6PA 3QDMD 2ZSVB 2NY2C 1WEJL 4LCCB 3JV0A 3TT3L 2W9LA 1SJHA 2K1MA 4OD2B 5BXFB 3V4PH 4GKZB 3A67L 2ZOKA 5BV7C 3ULUH 4M00A 3BP5B 3OJDB 2ERJC 3U0WH 1JNLL 3JBG7 4KJWC 2VN7A 1EAJA 5DYOB 2Z31D 1X6NA 2H3NB 1JHKH 4U49A 1X5GA 2W65A 3FN0L 4TQEL 2HT4D 3NCJL 5IB1B 4Z7WE 4LBEA 3B83A 2GK0B 4MD4B 3QAZB 4OZFB 2Z0BA 1S9XB 1JMXA 3QDGB 4NQDB 1CL7I 3HZMA 4HXAL 2EDKA 1A6PA 1EK3A 4MXQD 1UACL 2UWEA 2QR0A 4YBLB 5TDOA 3ZL4H 1OCWH 3LEYH 3GKZA 1YC7A 2FHBA 2J12B 4OCSL 1G9EA 4P46A 2NR6C 2A6DA 4BUHA 3MX0A 1UGNA 2EIEA 4EUPA 2YPKB 3S96A 2DQJH 2MNUA 5BXFA 1YJDH 5E2UH 2YPLB 1DSFH 1H3GA 2KQNA 2OL3B 1HI6A 1JI2A 1A1NA 2HVJB 1YEJH 4BQCA 3REVA 3ARBC 3CU1A 1QSFA 4RRPA 2JF1A 1ERNA 1OPGH 1QPPA 4YHLH 4G42A 5C86A 4HS6B 2WUBL 1H9VA 3D87B 1BFVL 3R0MA 4QRPB 2WBJB 4CGTA 4Y1AE 3MBEB 1AO7D 4GW5A 2J5LC 3D39E 2FJFA 5FGBC 1AD0B 3C6SA 1YC8A 4FQ1H 3JTTB 4IMLB 1XF4A 4JPKH 5KOMC 3X14B 2W38A 4XPBL 4HQQH 1ZHNB 2IFFL 3BUTA 5CMAB 5D2NB 1AY1L 2NNAB 1KB5A 2UZYB 1MIEL 4WFED 4U1JA 1ZA6B 1Y0LA 3B9AA 1ZLWK 5I8EA 4YHMH 3FO9A 3J8F7 1UZ8B 4ZOEA 4JPIA 4JFHE 2ZCHH 1FAIL 5DEFA 4W6WB 1IILE 3FN3A 4LNRA 2DQGL 2IPKA 4N68A 2A77H 3V6ZB 2F15A 1EO7A 1CIDA 4Z0BL 2EDWA 1P1ZA 3MRLA 1BMGA 2VWEC 4OD1H 2WIIB 5T3ZL 3RWJB 3ZKXB 5C8JA 1QFOA 4FQQA 4QWWC 1MPAL 1RZIB 5DRNA 3G6DH 3NFNB 3SO5A 5FKAB 5TQ2L 2YR3A 3QDHA 3GI9H 5F7KC 1DBKL 1KJ2H 1T83A 4M43H 4ZSOE 3B8SA 3RWDB 4GG6B 1GXEA 2VAJA 3DX7B 1IGJA 1X5JA 1EO5A 2X44D 3QHZH 2NY0C 3OQ3B 3O6ML 2VITA 5D5MF 2CKBB 3N1MC 5C07A 2Z4QB 1DE4A 5T3ZE 4U1HA 4JO3L 3TBTB 3U9UA 3P73A 1NCAL 5MHSD 3VWKD 1OSZB 2W65B 3DSFH 2EH7L 5E7BA 4NHCH 4X9GA 1S7TA 3TVMC 3SJVB 4ODTH 1M71A 3DSNA 2VL5A 4F9PC 3O11A 4OUUB 3RGHA 2RHEA 1P4LB 4DTGL 4ZXBC 1GPOH 4AT6A 5FEBA 4XCCH 5F1IB 4XNYH 3TWCH 4OTXL 1R3HA 2G5BB 4KRMB 3KNBA 1I1AD 2EDDA 4X4MA 5D71L 5CJOH 1HH9A 2UZXB 4CMHB 2ZOLB 4L8BB 3RWIB 1P7QD 5BZDB 4MAYC 3KPNB 4YHLL 3W5MA 3WHE0 3EYFA 4C55A 4N0UB 5T3XE 3EDKA 5GJTH 1A6AB 4WHDA 1H3PH 1INQB 2YK1L 3BH8B 3M8OL 2PXYD 3AROA 3SDAA 4P5MB 4CVZB 2BY2A 1XIWD 2DBLL 2AJSL 2JCCA 4Y4HB 3IAGC 2XN9D 4L3AA 5FXCH 3CDYA 2NLJA 3QWRA 1NDGB 4XPTH 5DJ8A 2G2RB 2XACC 3GSQA 1JF5A 4JEGB 5DMGD 3BEWB 4PRNB 5DJ0A 1S7TB 4NYLB 3LQZB 3FOLB 3K7UA 1AI1H 3I75A 1ZHNA 4OIIL 5D2NA 3NAAL 4WI8A 1XIWC 1MCJA 3PL6C 1ZGLP 1RK0B 4L4TD 5LWYH 4NFCA 2P8LA 2WWMD 4URTB 4BFEA 4Y16A 4R4ND 4GMSL 2JIXB 1L0QA 1FC2D 1W0WA 3DETC 2DWEA 4GAGH 3EYFB 4RWHA 4E42B 2NZ9C 3DVNB 2V17L 4MD5A 4NDMB 5C8JB 4M5YH 2AEWA 3FFDA 3TVMB 2VDLL 5B21A 3R1GL 1JPFA 3QG7H 4K9EL 5FKAA 2GUOA 4EUPB 1AHWB 3EFFB 2C3VA 3LHPH 2I5YH 5DVMA 2ID5A 2VERN 3MODL 4I77L 3UJIL 1VDGA 3L3OB 5CIPB 4PJ7E 1KIQB 2I60L 3TCLB 3U46B 1X7QA 2W9DH 1RZ7H 5CJQL 5GRZA 4DWHA 3IAPA 1RFDH 2DF3A 2P7TA 1T1WA 4BH7B 3O2WL 2FWOB 4GW5B 1OT1A 4LCWA 4HHAB 2QQLL 1A6ZA 3GRWA 3QHTC 4ZNEE 2NXZB 3O0RL 5I8CA 1I3RA 2GY5A 1HN1A 1F11B 3QIWB 3JV4A 4KDWA 1N2RA 3ZYJA 4K3JH 4DN4L 3KPRD 1IEHA 5ADOH 1J86A 5JQ6H 1GOHA 3B6SA 3ULVF 1QSED 3SCMD 4KUZH 3QUKA 1MFEL 1GOFA 3TT1L 4EN3C 3WLBA 3QAZC 3EFFA 1Q9LB 5DI8B 5F88A 3VFWA 5E1AA 1JGEB 2AJYL 3L3OA 4HGKC 4NQVB 3TCLA 4OIBA 2NZ9D 2GTZA 4OZGE 5AZ2H 5J11B 2CDGB 4GRWH 4LU5L 3VGAC 1QKZH 2X4OA 3ES6A 4G6JL 5ALCL 1FN4A 3VRLF 3RWCB 4Z7QE 3INUH 3RVXC 4LHUD 1HK6A 1PDKA 3DROB 2I9LB 5IB2A 3C60C 5JDSB 5DJ0B 4WI7A 1T6VN 1FL5A 3C5ZB 1Q0XH 3P30L 2DTMH 4OCRL 1ND0B 2IJ0C 3T0EA 1IRAY 1S7SB 4HV8A 2VZSA 2R1WA 2FDBP 4LAQH 4YR6B 5FOBB 1Q9LA 4TOYH 1FZKA 1PYWA 3Q3GB 4R3SB 4XAWH 2X1XR 3QFJA 4HK3N 5CCKL 1QSEA 3SCMA 2P4AB 4ONFL 4XHQA 3U6RB 3L1OH 2VB5A 2NXYB 3UPCA 3PABB 4PUBH 4KXZI 3T0BA 2CR3A 3DVNA 3ILQC 4WW2F 5DD5L 2PYFA 5H2BB 1CD8A 4PJIB 3O4OC 3LS4L 5DJYB 4F2MB 1W8NA 4EN3A 1A6AA 3INUL 5BQ7B 2YEZA 4MXWL 3Q6GL 1QLEL 1ZANH 4YEFA 4MMZC 2IPTL 3KPSD 3LIZL 3CVHH 4OT1H 3T09A 4BSVB 2VLKE 3Q5TA 3D69B 1G7IA 3EZ8A 1KFAH 3L3IA 4PJ5E 5A2KH 3BUYB 3S7GA 4XBGB 4UNUA 4UQ3B 1CT8B 4E0RA 1WT5C 5ISZE 4Y5VA 2YRPA 5HVWA 2AQ3A 5ICXA 2AJVL 4YHYC 3ILPA 1NGQL 2FGZA 3P4OA 5TE6H 5ICZB 1VA9A 1BBJB 4PREA 5I1KH 4CKVX 5CGYC 1K2DB 3EJYC 3QXDA 5IBTH 4XVSL 3TBWB 1HOCB 3AXLB 4X6BB 3NFPA 1NUGA 5F1OB 1NLDL 3PP4L 3RWGB 1RJYB 1X5HA 1KJ2A 2ATPB 2OMBA 2X4PB 4JHWH 5DJYA 1AGDA 2XIDA 3O9WB 1BZ7A 2P42B 3QFJE 4GBXD 4MJ6B 3H8NA 3A6BH 4NKDB 2J6EA 4PJFA 4I8DA 4OF3A 4H0IA 3QDGA 1U8KB 3VDCA 3QJFA 4NHUB 5GGVH 2R9HD 3VGGA 4J3WA 4MAYB 1J5OL 1KB9J 4YHKL 3BXNA 4E0RB 2D7TH 5C0FB 1PLGL 1TTUA 3X13B 4XVSH 3EYOB 3B3IB 1ZA3B 2B0SL 5ELIA 1RIHL 3VWKB 1IE5A 4LCWB 3O6FC 4J8RA 5JXEC 3LKSA 5HI4C 3F62A 3SOBL 1EMTH 2CKBA 4Y4HC 5BO1H 5CILL 1P7KB 4WEMB 3WE6A 2R0KH 3MGAA 4V1DD 1IEAB 2DIBA 4NP4L 5F7FA 2V5SA 4XBPB 1DEDA 2J8UF 4HDIB 5FOBA 4F7TB 1JGLL 3FFCD 4LSQL 3RKDC 2MQ0A 4JFFA 2BNRD 1WBXB 5EBGA 2V2TA 2QQNH 1N59B 7CGTA 1RUPH 4PV8B 3O6FB 4MXWH 4GKNB 2PW2B 5GJSH 4S0TD 2NW3B 3CLFH 3O2DH 4M4RA 1NGQH 3MRCA 2GT9B 5KTEL 2SEBA 2YC1B 4XC3L 5EA0L 2VDMH 3QDGD 5CKGA 4FFWC 5IBLD 1SMOA 1F8TH 3K4ZA 4YXKH 3ARQA 4S11A 4I0PB 5IK3B 3HG1A 1E28A 2WIMA 1J18A 3VWKA 4W4NA 2GYSA 2YK1H 3O6LL 2YN5A 3L5WA 4ZSOA 4S10A 4ZNEA 1HQRA 4H20H 1IQWL 5L2KB 4RMSA 5JORB 4J4PA 1A7NH 4FQIH 3KJ6L 4DUVA 2HYMA 4U7MA 4MWFA 2B4CC 5D7IF 2AEIT 5BRZE 3U4BL 3O8XD 4DTGH 4GKNA 1QFWI 1V7ML 5C7XH 2BSRB 4XGZA 3MBXH 4OFPA 3RWGA 2BVYA 1INEL 3LCYA 4UTAH 2F8XC 1C8PA 4KJYA 4EDXB 2CKBL 4QXUH 2YUVA 5HHOE 2DOCA 1UWEH 3D25B 4RGNE 4FXKA 1JNHA 4OF8A 5DZOA 3W81A 3IFNL 4NKOB 3CCHA 3ARFC 2KL6A 1MCPL 3MRKA 3NOIA 2EE3A 5D2NC 5L2KE 1W0VA 2YOCA 4JKWA 5BOPA 4P23A 5HDBF 3QI9B 5EC1A 3MLTA 4R4BA 2B1HH 2EKJA 4OZHB 3H42L 4TRPH 4ZDHA 5CBAA 3HS0A 2EKSA 2OTPA 3SDXA 2CGRH 3MNZA 4NT6B 2AEQL 4Y16D 3F6LA 2Z92A 2P8PB 4YPJA 2ZG2A 4G43A 1PJ9A 2J4WL 1I85A 4MXVF 4JFOA 4APQD 4J7RA 2CIKA 4KI5C 4UDTA 4U05A 4WRLA 3RJDA 5E7FA 4L8DB 1IEAA 4YHZH 2FX7L 1JWSA 3VG9C 1I1YB 4PJ5D 3HPLA 1NC2A 4Y2DC 5D9SB 1ZWIB 3ARGC 4Y4FC 4S1SH 3S3JA 3C08H 4EQ3A 3MA9H 5IMLB 5KVEL 3RPIB 4JFXA 3EIFA 3KYNA 4U0RB 3UJTL 4GUPB 4XPHH 1T5WB 5JZ7D 1CICC 3ARWA 3BKJH 5E4EC 3L3HB 3UZVB 3UYOD 3MLTB 1BD2A 4R4BB 5E8DL 3RP1A 1NGPL 4RCAA 1ZEAH 3DURB 3IETB 2NXZC 3W0WB 1MFAH 2ED8A 4ONHB 3AY4C 1RY7B 3AGVA 5EOTA 3PJSA 2J8UE 1KJVA 4OLYH 2VUOA 3W11D 3BKYL 4GXVL 2BVOA 2PTUA 1ZS8A 4Y5XB 2DMCA 1DN2A 3VWJD 3V0WH 4YIQB 5DURD 5HVGB 4QRUB 3IKCA 3IXAB 1JGDA 3MUJA 1WFUA 4YHYB 3BKYH 4RNRB 1XAUA 1IMHC 1EBAA 3RRQA 2EDTA 4K8RC 4W70A 3T3PF 4LLUA 3TA3C 4MB4A 4Y5VC 1FPTH 4PG2C 4K3GA 4PLKD 4DVBB 5I1CH 4OV5A 3PIQA 4Y5XC 1M05B 1FZMB 5KOVC 1DQJB 1BD2B 5BVPH 2UWEB 4M61A 5TDOB 4Z7UF 4FOMA 3VW3H 5K33A 1N3NB 4Y4FD 1WBYA 4ODBD 2YC1A 3AB0C 2FEDC 3QWOB 32C2B 3K46A 1FNSL 1FP5A 5SWQB 5HHVL 3NGBB 3V5HA 1D5MB 1BFSA 1T3FA 1PQZB 4KMTL 4OTXH 2JK5A 1UADC 4ZOCA 4BQBA 3ZKMD 1YEFL 2A73B 3ARDD 2IH3B 5ACZB 5E6ID 4HJJL 1VKXA 4HAGA 3K4DA 2YRLA 4UINH 2H45A 5MHSE 5KANI 3RY4A 4JY6A 1T7WA 4EI5D 1RK1A 3OG4B 3LRHA 2NY0D 3C6SB 2IANE 3F65A 4E9LA 2MHAB 3P0VH 3VXUA 5JXAL 1VFBB 1G0DA 1FYHB 2NX5D 4ZNCD 4KKNA 3TNNA 4EI6A 5KSAB 3QJHA 2O5YH 5J6HB 5F96H 2I26N 5K9QG 4B7IA 2PR4H 2MQ3A 5I8EB 2XKSA 2CSPA 1CDBA 4XPFL 4JZOB 5FECB 3VFUB 5T1LB 5GIRA 2K9UA 2VR4A 5EZOH 1R3KB 4HUUA 3GSNA 4FQHB 3QPQC 4Y19E 1NMBH 1MVFA 2AJVH 4PJ7B 5D1XA 1IBGH 3LPWA 4QOKA 1MCPH 2PTTB 1ES0B 5L0QB 2IQAA 4MQXD 3VGBA 5D70H 1LNUA 4LLYA 5FF6A 5AAMA 4IOFC 1HHKB 3F12A 4G7YL 2AJZA 3K8KA 4WFEE 4Z7VF 4XCNB 4TUKL 1LO4L 4F2MA 1QLEH 1ZANL 3BVNA 4GG6F 3IGAA 3MACH 3QHFL 3NPSC 2XQYK 3GSNH 3BOVA 3BSZH 1TVHB 1T1YA 1WIPA 1I8LA 4PB0H 2YA2A 3BESR 3BPOB 2W60B 1PY9A 1QFHA 1FRGL 1CXHA 1D5BA 2ZCHL 4XAWL 1I4FB 1OL0A 4PB9L 5GSVB 3U0PA 5F9WC 2A0LD 4KKCC 4LBEB 4DVRL 4XVJH 4POUB 1R0AH 4AMKL 3OAZH 4KROD 3ZTNH 4FTVB 2DI9A 3V5KB 5ADPL 3D0VB 4H0GA 4FQ1L 2B2XH 2FHFA 2NY1D 5EO9A 3QCTH 2BOCB 1GZQA 1T7XA 3QO0A 2A6IA 3OGOE 3GSOB 1XGYH 1ONQA 4D0CB 1OPGL 3PXJA 2NY6C 2F58L 1PFCA 1XF3A 1T4KB 4W68A 5F9WB 1SBSL 5CS7A 1J0IA 4NUGL 2PNDA 4JG0L 2PYEE 1HHGB 4A6YH 3CU7A 3OXRA 5ISZB 4I3SH 1F4WH 3K4AA 2AXGB 4NKQB 1JHKL 3FQNB 1IQDA 1RU9L 2AJYH 5FYLL 2EDHA 1FBIL 4MS8C 3GMLA 3UTSA 3KYMA 5BS0D 1C7TA 1A1OB 1DN0A 4ESKA 3MZTA 3LEXB 5EUOE 3FQWA 4W6YB 3ZT5A 1RHHB 4LVNB 1YZZA 1HXMA 3FN9A 1VFAB 4BZ2H 3TT3H 1CLCA 5DEGA 4ZFGL 2NMSA 2A0LC 2AEPL 1M05A 5I74B 3ARDC 5E70A 1R5IB 4OJFL 5MERA 4H26A 1V3JA 3NACH 1OP5K 1MLBA 2NY4C 1DZBA 1FSKB 4M1CD 4CADA 2KBGA 1LD9B 3TYGH 1HH6B 1G7LA 4JKPH 3HR6A 3BZEA 3VFGH 1I9IL 2C1PB 1IEBA 3DGGB 5BS0B 3RWDA 2QL1A 1TZIB 3BZFB 3FO0H 1FGNH 3BIBX 5I16B 2IMNA 3AU1B 4JFYB 4NOBA 2OR9H 4Z5RB 1S7UA 2DQEL 3B9KB 1A1MB 1JUFA 1MFCH 1BVLA 5TGBA 3NZ8A 4JFEA 3MRIB 3WDJA 4WHCA 3OV6A 2LU4A 2FLRT 1DUZA 1X5YA 3BP7A 3SKUD 5FGCB 1MJJB 1BJMA 1LO2H 1YYLH 4JY4A 4QOKE 4L4TB 1KENH 1A3LL 2Z91A 1WK0A 2DM3A 4OUUA 5IM7A 1A0QL 3VG0L 3VWKC 3PDDA 1HHHA 3BO8A 1MY7A 3B9KC 4NGHL 2F9BT 2CKNA 1DBAL 1FFPB 3P11L 2QBWA 5FYKL 5DSCB 3OR6A 4OM1L 4XCFH 1XGTA 1URLA 4WI6A 1MCKA 1TZHA 3F7YA 2DS4A 1D9KA 2VR9A 2FX8H 3WDHA 1DVFD 4APQA 1OSPH 2XWBB 43C9B 3VXQB 4TSCH 4TOYL 2WIIA 5J7CC 1JK8A 3LKPB 3OKNA 4Z5RA 1Q1JL 3BH8A 4JAMB 3B2UC 1K3IA 5SWSB 1AHWC 3GBNL 5DJAA 3BKMH 2FJGB 4U1SB 3IDIB 4FFZL 4Z0XB 1B2WH 2FYYB 4LSUH 1A6TA 3I6GA 4HK0B 5I76B 5I8OH 3V6OE 3GSWB 1KN4L 2ZUVA 4MB5A 5I1AB 1JFQL 5D7IA 4WI3A 3L3DA 3CLEL 4PRNA 3C9NB 3X11A 1VERA 2IAMD 4I0PC 4KRPC 4ZD3H 4PV9A 3WO3B 1TFHA 3RU8L 1J1PH 3TWCL 5K9OA 4BH8B 4H88L 4JQVC 4Y19A 2NY5L 1EJOL 2GIYA 2J1KA 3QPXL 5FYJH 4HXBH 3TH3T 2R15A 4QTIH 1NFKA 2YMXH 3QUMA 3ZKSD 5CBEA 4QHLB 2VLKB 4X5WB 2WWKO 4G7YH 3ORJA 1U8QA 3GJFH 3LQAC 3VXSB 4JPWL 1A2YA 1YN6A 3F58H 3SQOH 4DJMA 1KNOA 4XAKE 4L9LA 3UTTA 4ZMAT 1E6JH 3E8UL 5I1DA 2NY7L 3MJ8A 4PJXE 5HPMA 1L0YA 3ZYIA 3QHZL 3BGMB 3HC3H 4RZCB 3SDAC 1NCNA 1Q8MA 1MJUL 2LVCA 4AIZB 4YNYB 4PJAA 3WL9B 4BJLA 3HFMH 3HR5A 4YAQB 1K8DB 3DI2B 2NX5B 3S3PA 2D3VA 5SWZE 1IKFL 5I76A 1NMCC 4P9MH 3MBXL 4EJ1C 3MV9D 1FC1A 1U8MA 4AJ0A 1SEBB 5GGSA 4TSBH 4JFDE 5FIEA 3U4BH 4CUCA 4H88H 1Z3GH 3WJLC 2R2BA 3OZ9H 1T1ZB 3DVFA 2IAND 1XIWA 3MGOA 4HCRA 2IADB 3L5XH 4JN1L 1QQDB 1FQ9C 3MA7B 3VCLB 5CEXB 1BLNA 3O2WH 3N1QC 3WKNA 1CFNA 4UTAL 2UY6A 3SKOA 3MLXH 1MIEH 5LJYH 1KPRA 5CD3B 1Q1JH 2FO4B 5D1QD 1OW0C 5DD0L 5TE4H 1NFIB 5GISL 2AK1H 4MJ4A 1YN7A 2VAAA 5E6IA 2DD8H 1TQBC 3O3BA 3GBLA 3F7PC 1SM3L 2CLVB 2PO6D 2AABH 5DURB 2MSPA 1KV3A 4JRXE 2UUDK 3T0WA 5E1AB 1YY8B 5DEZA 1LP9F 3MRJA 4RMWA 4ZUSA 1CGSH 4POZD 5DFTA 5KJRL 2MCPH 5ETUA 4NGHH 5LXGH 3LKPA 2FL5B 2UZIH 3DV6B 4KVNL 3O6LH 2NY6B 2AXFA 2DQJL 3BZFA 2Q7NA 1R5WA 4L4JA 1D5MA 3CFEA 1ETZB 5C0EA 4PG9B 4ZFFA 1JNJA 1IC5L 2G60H 3DROA 5EFIB 5JQHC 3U9PH 1HHJB 4PRIB 5KSBB 4H1LH 3W39B 2ADJA 3OKKA 3BGAA 2IANA 4M8VA 1PKOA 3DXAD 3ULVH 1AIFB 5D1XD 2DLHA 1N0XH 3NA9L 2ZUUA 4HHAA 4NC0B 1UVQB 1ITBB 3W5NA 4R4FH 4MDJA 2Z91B 1OM3L 1UKQA 4FXGB 3QUMB 2D7TL 5K93A 4KJQC 4P48A 2ZUQB 1K8IA 4L3CA 2UZIL 4KVNH 4PV8A 5E9DA 1G7QB 5C0DB 2WNGA 1S5HA 3BD5A 4JKPL 3T65A 1CQYA 1J05B 5GJTL 4RQQA 3HKFA 2R1YB 2KDGA 3RHWK 5K59F 1K4DA 1FV1A 1LEIB 3SOBH 3IDYB 4NQSA 1YEGL 4JQXC 5KVDL 2CLZA 2E7HA 3WLBB 3AREC 1IGTA 3BGFC 4Q2ZA 1YQ2A 3VI4F 1N5AA 1T4KA 2XXMB 1JZ2A 4R2GC 4S2SB 3WIIL 1NLDH 1RURH 1JPTH 2VQTA 4JM2F 2ZUSA 4X6CF 1QHOA 2FIKB 2R1XB 4G9FA 1U91B 1N0LA 4JR9H 4OGAD 5I1LA 1IGYB 3QUZB 1RI8A 5F7DA 4MA8L 3HCVA 1MNUL 4D0DA 1NANI 1R3JA 3EHBC 4S1QH 3GMQA 3EYSL 5L8KB 1D7FA 1KEML 3LVEA 1KJMA 2BVUA 2VR5A 2YD8A 4PP2A 4CNIA 1OP3K 1NUNB 3B8YA 5DUMH 4RDQG 1CXKA 5B38G 3O2VL 2ZWLT 5B38B 3BAEH 3IVKB 2B1HL 4MYWB 4A6YL 5SWZB 2ICES 4LEXH 2WANA 3D18B 2Z31B 3VU2A 4MCYA 3CFDB 4JJ5A 1UCBL 1BGXL 5AZEH 3LB6D 2P1YA 4JRWA 3U0PB 3LPFA 2EDOA 1SJEA 3UTPD 1KJ2B 3QEUB 2ATPA 4JCMA 4M4PA 4OLWL 5IGXL 1AXIB 4X6DB 4JHZA 4Q2ZB 3T3PE 4NWTH 1BOGB 5HBBA 3AMLA 5HPMB 2NY7H 3QFJD 4FQQB 1P4IH 3QNYA 2XQYG 5I15H 2HJLB 4HKJB 5C07E 3GMRB 4P3DB 2P48B 1NKOA 5KAQF 1K8DA 2HFTA 2CKBH 3KDMB 1P4BL 4PJ8D 4AENA 5EC1B 3RNQA 4YHML 5JUEH 3O3AA 5HHQA 1AGCB 1T7YA 1UWGH 2VXUH 4U7SA 5DVNA 3V6OC 1W8OA 4OZFA 3IDUA 2NY5H 2XY1A 3I3DA 5TF1H 3RUGB 3FHQA 3RWEA 2UVEA 3MJ9L 4WJ5B 1MAML 2QR0B 1EO8L 4PJ7F 2N7BA 4HG4J 4M3KB 4O58H 2C1OA 5L8JB 3H9ZA 1UVQA 4G3YL 4WDIB 4LLVA 4TVPE 4LPWA 1QOKA 3EFDL 2CRIA 4H1LG 4KKLD 3SDCD 2C3WA 1S7RA 1RHHA 2Z9TA 2W91A 5HY9A 1CGTA 3T77A 4CRPA 1K2DA 1FYTE 4HMEA 2DQFA 2YBRB 4PJDF 4G6FD 5JO5A 2XWTA 3BEVA 3FB7A 4GW4A 4TNWK 3IB4A 4FQXD 4P3DA 1OGAE 5CP7B 3P0YH 4ZYKB 4FTVE 3QISA 2VZTA 1QNZL 2GAZB 1VEMA 3LN5A 1NBQA 4JGUA 4WV1B 1YY8A 3TFKD 3Q5YA 5FO8B 3CAFA 5BOZG 2DQDL 3TT1H 5ETUB 5HDOA 2AS5M 2VDRL 4N1CA 1BQHB 3T2NL 4ONHA 2OTWB 2CR6A 3NZHL 3RUGA 3PL6A 3ALPA 4J12A 3UO1H 2VZOA 3HMXH 4XNXL 3CFKB 3QEQB 4R97B 4AM0A 5MEOA 3BP4B 4QRSA 4I48B 2R0WH 5DEFB 1NMCB 2BSSA 3UYRL 3VWJC 1SY6A 1DL7H 4EIGB 2GJ6E 1W0YT 5IW6A 4XRCB 1VSCA 5HGBB 5GHWH 2XPGA 4MNGE 1F58L 4KDTA 1NFDF 1WWBX 2P45B 2ZCKH 1T04A 5HHPB 3X3FL 4ERSH 2CLRA 3P9LA 3VXRA 3JTTA 1FYTB 4LSRL 1EHLL 4QXTA 5EPMA 5EZLB 4BFBD 4RNRA 2G9HB 5JW5A 1QSFE 3GKWL 3AREA 3EJZD 4P0DA 4RDQF 5EIIA 3QNXB 1KIPB 3FO0L 4FQXB 4W4OC 4NPYB 4QHKI 3MRDA 3ARYA 3PGCB 1SJXA 5BRZA 4MCYB 1WSST 4HK3J 3NTCH 4XGZB 5KW9H 1P2CB 3HNVL 5DJDB 1ZLVK 2CUIA 1ZLWH 3KHQA 4L4VD 4KTYA 4LNRB 4KC3B 4X6DA 5CWSB 1FNSH 3V2AR 5JW3L 1S7XA 1A9BA 4MDIA 4MD5B 3TJHC 5KSBF 1P6FA 2FH6A 3D2UA 1P1ZB 3MRLB 5HGAB 2DQUH 2UVFA 2H9GB 2JE8A 3Q1SL 4FQXC 1R3LB 5CJXA 3HLAB 4I48A 3WKMH 2RR3A 2I60H 1A7BA 5AUMB 3V6FB 3KPRE 3QI9A 4XNQA 3ULUC 3H9SB 2XKNB 4G9FB 5D5ME 2ZG3A 5HGBA 1Q72L 3GI8L 4HFUH 4RIRB 5J8OA 4GAYA 3HCVB 1KCSL 3X12A 2HFEB 5DO2C 4Q0XL 1MH5A 3HZKB 2FECL 2CIIB 1Z6JT 1BAFL 4GAGL 4N5EC 4X5XB 3LMJL 5GGTA 3OKMA 1S9VA 2NCMA 1U8IA 3ZSTA 2NY4D 1T80A 1B6UA 1YMMB 2AJSH 1KOAA 4I3SL 5AD0A 1S9KC 4DGVH 4ZFZA 3UO1L 1UZ6E 3F8UB 1B4RA 2A6KB 5GRYA 3E3QE 2ORBH 2C7UA 3QEUA 4HSQA 2VXTL 4HULB 4AEHH 3OPZH 3OF6A 5HGDB 5IWLA 3PWNB 3EO9H 4HEME 3DPBA 4X5WA 3GMOA 5JZ7C 1BJ1J 5I8KH 4IOFD 2XA8H 1F6FB 3SPVA 3UJTH 1A7RH 3AB0B 2BNRE 5B39G 3CFCL 2WP3O 1NBYA 2VN4A 1XFPA 1P53A 3LB6C 4M7LL 5GISH 3M8OH 4B53A 1G7PA 1CD0A 1I9RH 3B5GA 4ZUUB 1VGKA 3BGFB 3SDDC 3WUWB 2Y36L 1TNNA 4MNQE 5ERWA 2R9HC 1G7HB 4XX1G 5D2LE 4ZAKA 4P23D 3K2UL 2DTML 1EGJA 2D2OA 2XRAL 3MRQA 4PJDE 2VQ1A 4LLMA 4GRWF 4NJ9H 4GQPH 4F7PB 2VOTA 4EOWL 4PJIF 1CL7H 3VFTB 2PO6A 2H32A 1A64A 3SE9L 3B2VL 4TTGA 3CVIL 4Z18A 1IAKB 4DFHA 1BJ1H 5EIIB 2FJFB 1GPOL 3HI6L 4OQTL 3NIFF 3JWDL 2ITDA 4QRRE 3BRFA 1LHZA 4K7FA 4XI5C 1UWGL 2GHWB 1P2CA 2QLVB 5HDQH 5C09B 5ALCH 2N1KA 3U6RA 2VKXA 3EOAA 3BEVB 1S5HB 2XQBH 3QIWD 5EZIL 2QJDA 3C5ZA 3G6DL 4JO3H 5EO9B 4V2CB 1Y0LB 3UC0L 3Q48A 4X6EA 1A14L 2V7HB 3OKDA 3BE1H 4YXLH 5E6IB 5T1KD 3C2SA 3IFNH 4LHUA 4U3HA 4MNHA 4Z7UE 4R0LC 2ED7A 3N06B 4TUOA 2OTWA 1FIGH 3LKNA 4QXUL 5DQ9B 2PCPA 3W2DH 1KLUA 2ZUWA 5C0GA 3RUGF 4LSTH 4UUJA 2EDXA 1NPUA 4U3CA 3JWDH 4HUWA 3QXWA 3L3IB 1F90L 5IHUH 2R1XA 3WS6C 1P9MA 3MLWH 1FZJA 5E03A 1A6WH 1F2QA 1WCQA 3ECBB 1KLFA 3T2PA 1EFXA 4M7KL 3WHE1 2BHZA 4XBEL 4PLNC 1JPSH 1NKRA 3EYSH 2IQ9H 4FQIL 5LCVL 1OAYL 4U1MB 1NBVL 3LKRB 5MENA 3GSXA 3CMGA 3S4SB 3SO3C 1B2WL 3QXDB 3UBXA 1J12A 4FFZH 3MRDB 1I9RL 5C0AB 2D7MA 3TBVA 4GRLD 2FGWH 1YEFH 2BNUB 3F5WB 2WUCL 3EYUL 3MBEC 4TSAH 4EN3D 4HW6A 1XR8B 4G9DB 1O7SA 4K9EH 3H7LA 1YEGH 2NY1B 5MEPA 2GJJA 4OF5A 3MV7B 1G7QA 5C0DA 1EH9A 2FECI 5C0GB 5CAYB 5C6PB 1FL5B 3CSGA 3SO3B 1ZHLB 4N9GB 5BVPL 3S4SG 2VH5L 4C83A 1PX4A 3ARFD 1C12B 2V6HA 2QQNL 1WFOA 3VG0H 2OJEA 3DIFB 1WC7B 3REWA 3B3IA 3HE6A 3FRUA 4GKZA 3QFJB 1I8MA 3NA9H 4YPGB 1LE9B 2B7DT 2VSCA 4PJHA 5C1MB 3ULVL 4HC1L 1KACB 3S4SA 3MRPA 2KUTA 1UM4L 2UYLB 3U7YH 3CPLA 3BPNC 5D7LA 4A2MA 4HJGA 1IARB 4WO4A 2BNUA 3F5WA 5M7QA 5MEND 2F5AL 5C08D 2W0FA 5AD0B 1KC5L 3MRGB 2FBJH 4GAJH 2YWYA 4PJ8A 4PJCA 2BZDA 3L5IA 1CDJA 2B20A 5E4IA 3DETD 1GCFA 3MFGB 5E56A 3CC5B 4FRWA 4CW1B 3ULVE 5C3TA 2P8LB 4N9OB 2OQJA 2BJMH 1MWAL 3ROOA 2HLFD 2QHLA 5ECJE 3NH7H 4H1LA 3PWUB 3BKJL 3UTPE 3QUYD 2A6IB 3NCCB 5D72H 4WY7H 1HKFA 1HEZB 4PJ7A 4JM2A 4PJBF 4P4KA 3HZYB 4GRMB 3ZHLA 1KBGH 5F88B 3VFWB 1HI6B 5FB8A 2RFXB 2X10A 2DRUA 3HI1B 4PRID 4QCIB 2BCKB 4DGYH 1TETL 4HK0A 1IAMA 1XGQB 2HT2C 1KXVC 3RHWF 3WD5L 2VUYA 4U2ZA 4G42B 3DSFL 5FDWB 2A1WL 4GG8B 2AXGA 1B9ZA 2GSGB 3VFVB 4HWBA 5EU4A 5JLZB 2IAMC 4KRPD 4XCEB 3FFCA 2R2EB 4N1HB 2GCYB 4UIKL 5IJVA 2BNRA 5GGRY 2R8SL 5GRJL 4ZUVB 5IVZB 3LV3B 3O6MH 1Z3GL 4NQTA 4JRYE 1BREA 1HYRC 4YH6A 5FA4B 3LY6A 3H42H 2VZ1A 1MHEA 4U6VL 2GY7B 2R4RL 3MXVL 4G8GB 1I3RB 2C1OB 4JPIB 1OD9A 4PBVC 4JG0H 5J56B 3JV4B 1F3JA 4HC1A 1JIBA 3A0OA 3HTLX 3VGFA 2JJTC 5IFJB 3MYJB 2OMNA 1E4XI 4M6OL 4XPGL 5CINH 1OTUC 5D1ZC 4F7CA 1GIGL 3QCTL 5ENWB 5BV7B 4XMLL 4NRYB 1KPVB 5EUKB 4J4PD 5FM5O 5E1HB 3V6BR 1ZSDA 2ERJB 5C0BA 4U1JB 5JIKA 3U30C 4GT7A 5CCKH 4J1UA 5L9DH 2AXHA 1SHMA 2GAZA 3LN5B 3QUZD 4MAYA 3B9KD 4HIXL 4RISL 5F6HJ 5ILTL 3MUZ1 4ETQA 3QPXH 1VACA 5FYJL 4X8JB 3KXFA 3EJZC 5GGSB 5MENE 1P9MC 4POYA 1WTLA 3QQ4B 3X3GL 5GS0L 1I3VA 3FQRA 3RKDD 3MLYH 3MYZA 3VE0A 1U8LB 4OI7A 5DF0A 4TPRL 5E08H 2UYLA 3RIFK 1QRNE 3CSBA 4R2GD 5DVOA 5KVFL 5DD3L 2OP4L 1G9ML 3V5DB 2B4CL 5FOJA 1W72B 4BQ6A 1Q38A 2XZQH 4ZXBB 2MKWA 4S1RL 1OTTD 5CEYA 3CNKA 2FEEL 4K55A 1RIVH 4DKAA 5HHPA 5FYJE 1SBBA 1X5KA 3QA3B 5T1DL 3QEHB 3T3MF 4OCNC 2AK4E 4TTDD 4M7LH 2DM2A 1ND0A 1YJDL 5E2UL 2Y1VA 3MRNA 4YDJA 1HSAB 5I0DA 5E94B 4YXKL 1TCRB 4D9RE 3P40A 1KCRL 1AE6L 5DEGB 1MCOH 3UDWC 2WBJA 1J87A 4GW1B 3STZA 1CXFA 4YC2B 2OXGA 1OSZA 3W9DA 2VO5A 4HIEA 1U0QA 2YSSB 3AS0A 5FYKH 5IT2L 3RVWC 4AEHL 5KVGH 2ICEB 1SYSB 4HS3A 4FQ2H 4HWZB 1EVTC 4LASH 2R0ZH 2AXFB 1YA5A 3SDAB 4JFXB 2DJUA 1YEEH 5CJ5A 2ZKHH 4EN3B 1EUUA 3ZDYF 1E6OL 2D9CA 1R3LA 5FUOH 4KJYB 2X2YA 3S5LG 3N1FC 4DK3A 1P84J 5DMGC 5EN2A 4PJHB 1GZPA 4MA7L 3BHBA 2R69L 4PRPE 5HHOA 3QH3A 4MJID 3IKCB 4TVSa 4QYOA 1ED3B 2OS7A 2Q76B 2XXCB 1MQ8A 4YHNA 3NIDE 3ARFB 4Y5VB 1N4XH 5IESL 4B0MM 2B0SH 5DQJA 2V5RA 2GQHA 3QUYC 1KN2H 3R06A 2BVQB 3CFJB 3MOBH 5DJZA 5AWNL 1JZ8A 4DOHB 1N64L 2YZ8A 1K8IB 3C60B 4HKBB 3QIUC 3C60D 3WE6B 1BIHA 4U1KA 3PNWB 4YHKH 4PRBA 5EU7E 4O2FB 1YPZA 4QXGL 4KV5E 3DX7A 1DQJA 2YD5A 1I7RB 1WJ3A 3MRFB 5L2KD 5HHVH 3H3BC 3OJMB 4OUOA 2VITB 4X99B 2D7PA 3VJ6A 3VMNA 5GGRB 3CCHB 3M1BA 3O6FA 4L4VE 2I9TA 1OP5H 4UB0L 2D0GA 5EO1A 3TO4D 1MCHA 1G6RB 1KTDB 3O9WA 4JHWL 5CHNA 5A3IC 2VZVA 3FJTA 3HMWH 5E24E 3TVMD 1MQKL 3MUHL 3S5LB 4MXVE 3T0VA 4QRRD 2JIXA 4MJIB 1JZ5A 2HMID 3IDNB 2F5AH 1PD6A 3FQRB 4FG6C 1NSNL 1OAKH 1S9WA 2ADIA 3WUWA 1NBZB 3CDFA 4FFYL 4FQLH 2P8PA 4RAHA 1RZGA 1KJMB 4PP2B 3QIWC 1CXEA 1RJZB 3LEVH 4LVHC 1D6VH 3UAJC 4U1KB 5IFHL 4NNPH 3O45B 4OLYL 2DM7A 4JQIH 1CFNB 3KAAA 4XP6H 2Q6WB 4L9LC 1F6AA 2CK0L 1PEWA 2FO4A 3QNZA 3CVHL 4NUGH 2FWOA 4ODVL 3EDJA 3SKMA 1I9JH 3WN5B 5DDHB 3ULUD 1KB9K 4J6RH 1YECH 1OTSD 3QIUA 1RZJC 2D31A 1LDPH 4N0CC 1QNZH 2Q1EA 3FOMB 4JGMA 1EFXD 1QFUL 1KXQE 4LQFH 3TNNB 4DQOH 5D71H 3O6FD 2PKDA 1QACA 5HJ3B 2XZAH 5I6XB 3IDYC 4L8SC 5I17A 3ZTNL 3O3AB 2P5EE 4LVOB 1WFNA 2ADFH 3BP6B 4XHJC 4M7LT 4PGCB 1XGPA 4G80B 4PJBA 1T7ZA 3ZMRA 3LKQA 1QEWA 1RZKL 1CK0L 3FZUD 2NX5A 1FFOB 4XNMA 3KPMA 2I25N 1MIMH 4LRIC 3TA3B 1U8LA 1NGWB 4O58L 4MD0B 2IQAB 5J57B 3H3PH 3ZDXF 5IF0B 4A2LA 4QRQA 1H8OA 2ADJB 3IAQA 2QQQA 5DJ2A 5KAQG 1IL1A 3GSVA 4XH2A 5SWQA 3HC4L 3BZDA 2VABA 1F4AA 1U3HC 1J10A 35C8L 1ZT1B 5TQ0H 5KSUB 2XTJB 3QA3A 5B8CC 5C6TL 1G9NL 4QNPF 4GSDL 4G8GD 3FTGB 4XP4L 4L3EA 3O6KL 4P5KA 4FTVA 1DBKH 4YGVA 5CGYD 3HFML 4Z8FL 1IC4H 2J7LA 1EFQA 1FLRH 1U8OB 4NBXB 1CE1H 3RIAK 4ZYKA 2P5EB 4AZ8A 4YWGH 5I9QC 4OI8A 4ELKB 5SWSE 4DKFH 1AXSA 3NABH 2CUMA 5SWSD 1Z9MA 1UWXK 1C5DA 1UWEL 5IMKB 1MF2H 1K4CA 1U6AH 1I7TB 2HMIC 3MRHA 2O61B 3BZ4A 3D85D 3MRJB 3BPCB 3MLSH 3FCTB 2FJHB 1YNLH 3HUJB 5KSAC 2WQRA 4RSVA 1E27A 5LQBH 4LPCA 4JG1H 4X4YB 3MV8D 5IW6B 2CD0A 2D0HA 3O0RH 4OZGA 4LIQH 3RJQB 4UIKH 2OZ4L 3MNWB 2VC2L 3GNMH 3HS0B 3I50L 5C2BH 1KT2B 3GFUA 2P5WB 3RGVA 3EHBD 3MR9A 3ZE2F 5IVNA 3EOBA 4NUJB 4HGMA 5HI3D 1QZ1A 2VTFA 3QUYA 4NIKB 3W39A 3G08B 1CU4H 3D69A 4M1CC 4G7VH 2H1PL 4TN9A 5L8LB 4Q97A 1MHCA 3DO7B 2W0PA 2MQCA 4ELMA 3MFFA 4UBDC 5ESQA 4L3ED 2X6MA 3HE7A 3VFUA 12E8H 4KMTH 1FNEB 1F3JB 4XVTL 1RZ8B 1MOEA 1WISA 3SDXE 5BW7C 5EOCJ 2H2PD 2OTUB 5IMLA 3UYPA 1IM3A 1PG7X 1KB5H 3VFMA 2DQTL 4XMPL 3PWJB 2BJML 4DZBB 2YD1A 2BDNL 1HOCA 1HH6A 3CLFL 3QXUA 1I9JL 5DD6B 3BZEB 4R90L 8FABB 5FGCE 4ALAL 4L4TE 5BS0A 4DW2L 1KENL 1F4YL 3OJ2C 3BVNB 1T3FB 3ZTJH 1V3KA 3BWAA 5L6YL 4CMHC 4K8RH 3N9GL 3L5JA 5D4QA 2VLRA 4DKDC 1XEDA 1HWHB 4M03A 1IGML 3DRTA 1Z5LA 3L95B 3P4MB 3FB5A 2V5TA 4D0DB 4P3WA 1RIHH 4LDEB 5GGTL 1ZGLB 1YEIL 3S3SA 4IDJH 4Z78B 3DX9B 1IAOB 3DUSA 4P5KB 2ZOKB 2V2TB 1GOGA 4RAUB 5JOFA 3TO2B 4ODWA 1UXSB 2AJXH 5FA4A 3W0WE 1WT5A 1IGIL 4NC1C 3FB7B 1WV7T 3PGFH 4U6HB 4OFYA 5IV2A 2DYPD 3BQUA 4P2OA 1GC1C 3GEWB 1BEYL 4GRLC 1I7TA 4RAVA 5KW9L 4XCCL 3VXMD 3VRJA 3QWOA 4QRRB 3OAZK 4U6YB 3FQUB 2DMKA 2EYTA 2HRLA 1KTLB 2BC4B 1GYAA 4QRSB 1VCAA 4Z7VE 2A73A 4I4WA 4H26B 2FNBA 2OI9C 2R2HA 3FQXA 5JR1L 1WZLA 1E4JA 4M7JH 3D48R 4RA3A 1ORQB 4LSDA 3OZ9L 3MUGA 1MCWM 1ED3A 2X4RB 4R26L 5IHLB 1A6WL 1CFVL 5CJXC 5IG7B 4NZJA 1CE1L 3U48A 4KKLC 2UWEF 3RAJH 1RIUL 2WSKA 4Z6AT 4ZOBA 1QBLH 5AG8A 1WBZB 2WMPA 4LRNL 5IQ9B 3CK0H 3CDGA 5E6YA 1IKFH 4OT1L 4EDXA 4NZTH 5IUSA 1TXKA 3VXME 4KHTH 5L7XL 2VDRH 3TN0C 5TQ0L 4FXKB 4K94C 1LEKB 3D39B 4QEGA 3OXSB 1U2HA 5CD5C 5I0ZA 3SE3C 4HF5L 4IRSB 4MDIB 1JZ7A 2R29H 3RL1A 4YDVA 3GRWH 2E9JA 3QUKB 3UJJH 3M07A 2GEEA 5HHOD 3B4NA 3IXTA 2DQGH 1K4CB 2XG4A 4P46C 1BD2E 1CZ8H 4QHLA 1GZQB 3QO0B 4MQ7B 1LO3H 1ES0A 1K85A 3IDXL 5BZWA 3U4EB 4HXBL 4Y5YA 2OJZL 2HJFB 3VXMA 3I9GL 1LNUB 2AW2A 1AXTH 3EFDH 1EAPA 5L88H 4G6KL 4NT6A 4NM4L 1FFRA 4XXCA 4NZUL 2X4UB 5D1ZB 1ZVSB 2DN7A 2IADA 3QT2A 5DSCA 4M7ZB 5TFSL 3BP4A 4LRIA 2EYSB 3SBWC 3K2UH 2C4FT 5EWIH 2O93L 5KSAD 4I0PA 3KYMB 4GBXB 3O9WD 4QLRA 3MACL 5DMIL 1Q94B 4JPVH 4OZIB 1JK8B 3OKNB 2DL9A 1TNMA 2HTKC 5IJKA 2IH1A 2ICWB 3O3BB 4G6FB 4HV8B 3WBDA 4G6AD 2YD3A 3ABZA 1OAXH 1IM3B 1U93B 2P24A 4LIQE 2HKFL 4L8DA 3DMMB 3OR6B 2QSCL 3FOMA 3EO9L 4L4VA 5FYJU 3SKNA 1ADQA 4XC1H 2F19H 4RMVA 1GSMA 4BSJA 3D2UD 1YYML 4HPOL 1A0QH 3FT2A 4HEPG 3TLRA 4LEXL 4M1DH 4LRNH 5DK0B 3ZT6A 3HC0A 4DN4H 3BAEL 1RIUH 4WWID 5DJCB 1IVLA 1U3ZA 3WNMA 3BPLB 3VFRA 2X4QB 4BZYA 1E4XL 3OB0K 2Q8AH 1XF2B 1D6VL 4PP1C 1NAML 3GK8L 3IETA 1MNUH 2VZUA 3L3DB 3O2DA 1VESA 3PXHA 5SX4I 1CT8A 5ACMA 5DJ2B 1INQA 1I75A 2W0FB 4X4ZA 4X9FA 1DUYB 3PQYB 1JN6A 2W9DL 3OGCA 3THMH 2F53E 4Z9KB 4KJWD 3OJVC 4WHTB 4YK4C 2PETA 3BPLC 2BRRH 1J05A 1H5BA 1DDHA 5D7JA 4P5TB 1SY6H 3VXSA 4L4VB 3SKNB 1MHHB 4PGBA 3B5TA 3UMTA 4LPXA 5I18L 4JFDA 4IIQC 2GTWB 3VMPA 5K9QI 3UBXG 1HSBA 3Q6FA 1AXSB 1JL8A 3M17B 3U36B 1WCBA 2VLMD 1XCQA 4MQSB 3GUTA 4EIZC 3PP4H 2RFXA 2PCPB 3OR7A 4FFVC 3TBSA 4Y16B 4PRPB 1R3IL 2NXYC 4UUJB 1EERB 5KSVB 5BW7A 3QUZC 1U3HB 4G8GE 4LDOB 2Q20A 4FN0A 3MMEA 3OHXA 1YN7B 1NBYB 5IESH 2JB6A 3LS5H 3O81A 3FQXB 1S8DA 4GUPA 3X13A 2EYSA 2Z8RA 4U0RC 5GHWL 2C3HA 4I5BB 2AJUH 2BNQA 4ZAKD 1ZLUK 5ABDE 1CVSC 1S7VA 1RMFH 4UAOB 2ADGB 5J6HA 1GVIA 3TPKA 4PLOB 4P5MA 1V3LA 4CVZA 5KG9A 1CFBA 2ICWA 3I3EA 3G5VA 2CDFA 1DLFL 4ONGL 2VH5H 4OBRA 4Z7OF 4JO1H 1H0DB 2CQVA 1CI5A 5FM5M 3RL1B 1G9MH 3GB7B 2GFBB 5D5MB 4NCC2 1N2RB 1UYWL 3ULUE 4AIOA 1VFMA 3C5ZD 1ZSDB 4JGJA 4QTHA 4JM2C 1I9EA 1G7MA 1AQDB 1KXTB 4O02H 4DZ8A 4JQXA 2HT3C 3HG1E 4JFZH 4NFDA 2DDQH 3LQAH 3TH4T 5DJCA 2HH0L 2PYEA 1N26A 2EH7H 1XH3B 1L7IL 2M8XA 4I18C 4JLRA 2ZJSL 1G6RL 2PTTA 1JYVA 2B4CH 2BSED 1FCGA 1QRND 4CU8A 5DD3H 4KV5F 5IR1A 3GMRA 4MNGA 1N8ZB 2J4WH 3PV6A 1JPSL 5F1SA 2FYYA 1RZJH 1UJTA 4KU1A 4OI9A 2DYPB 5KG9B 1AGCA 5FCUL 3MBEA 1T0PB 4LVOC 2I27N 2QV2A 1PZ5B 5EOCH 2EEAA 4WHTA 2DJ4A 2IPUG 4MJ5A 1BECA 1IFHL 1N7ML 3AS3A 4AQOA 1KJ2L 3GSXB 4OM0H 3QYCA 5JO5B 3RY5A 1B0GB 3SDYL 1GHFL 1YEKH 2OK0H 3NCBB 1AGBA 5DC4B 3IU4H 4BM7A 5FCUH 1KGCD 5F7UA 5IHZB 5B3JE 2EDFA 4GRLA 2DTSA 4JKLA 4DKFL 1HHIB 4Z0BH 4D0CA 2FR4A 4NQCE 2ENYA 4M7JL 1TVDA 3EYQD 3F58L 2DBJA 4XNUH 1AR1D 1X5ZA 1G9NC 3SKJH 4PJHF 1BGXH 4UZGA 5AZEL 3P77A 1XH3A 4LLWA 4TVPL 1BVKB 4GRMA 4HIHA 4Q9CA 1HINL 4OCXL 1BIIB 4NO3B 5KS9E 4ZO7A 2JB6B 2EYTB 1T89C 1C12A 2AP2A 5FYKE 2HA1A 4HBCH 2A9NH 3DTXA 4M9OA 3QH3B 3HE6D 3CJJA 1MCWW 2HT2D 1RZKC 3JXAA 4F33A 1A5FL 4JFEE 4IEFB 1G6RH 2HJLA 2W9EH 4EI5C 3WD5H 4LSUL 4FQXA 1ORSB 1RZKH 4RMQA 5GSRB 3PWVB 4JANB 2UY7A 4PJAE 3IVKA 2ZSWA 1XR9A 4PTUA 4WO4D 4JRYA 3V4VL 1TIUA 3PE9A 4F8TA 1IAOA 3DUSB 2CLRB 3TYFB 1LO0L 1FZOA 2WINB 4GG6E 3TO2A 4E41E 4LLWB 4NWUH 1UXWB 3NCYP 4E41D 4FQJL 5J0BA 3VG9B 1DBAH 1OGTA 2EZ0C 3WFDL 4BELD 5H37G 5GSVA 3QG6A 4PJAF 1M7DB 1R5IA 1X5LA 4JZNA 4J3UA 1IGTB 1X44A 1BFTA 3MXWH 4F3FA 1YYLL 4X98A 1M1SA 5EBLA 4FZEH 2PXYB 1CTNA 2FL5A 2WLZA 3UXFA 4OIIH 3WFDH 4GW4B 4K7PX 5C0AE 3WLWC 1G7LB 2QQKL 1H3XA 4UIMA 2DQEH 4W6XB 1S3KH 25C8H 3PDOB 5I18H 3LS5L 4WW2A 2CXGA 5IJKC 4ORGB 4PJGF 1B88A 2FZ3B 1F4HA 1MFBH 1Q9WA 3TIDB 3S37X 2W0LA 2DAVA 2FATL 3C2AL 3D0LB 1BQSA 2HJKB 4ODUA 3V7AE 1X5IA 5B38A 4BKLB 5E99L 1MCDA 1FCCA 1WLHA 1DEEB 1ZXQA 1T5XB 2ATKB 5INCB 2BRQA 1KCVL 1T20B 1A5FH 2H3NA 4MJ2A 2LV4A 4NQXA 5ICXB 1NDGA 3I50H 5DJ8B 5IFJA 1DQQA 4E41A 2OXHA 4NYLA 4PJXA 3TNMB 4M7ZC 4AK1A 1YMHB 5A40E 3I75B 1CD1B 2N56A 4S1SL 2C4FU 3GM8A 4X7TA 4WGVB 4HKJA 3TBTA 4ODTL 5IBTL 3WNPA 3NIFE 4KKBC 1CFQB 5A2FA 1C7SA 3BD3A 4XT1C 3ZE2E 5ALBH 3ZHKA 2W92A 4HKXA 1OAYH 3SPVB 3JVGC 5C92A 4NKDA 4YEEA 5EIQA 3TIDA 2PO6B 1PSKH 2YPKA 4I3GA 4YXLL 3VXQA 1WTGT 3P9LB 4HZLB 1R3HB 2G5BA 5GRWA 3HB3D 1D5ZA 2HRPL 1F90H 4U1GC 1S5IL 4XNXH 3T4YA 3U2SB 1EEQA 4JREC 4EZMA 1PG7H 4CU7A 1QSVA 4KK9D 4BQ9A 3D3VD 4F9LC 3T0EE 5FGRA 4GQ9L 4Y8DC 3T2NH 1ZA3A 1IM9B 1A4JB 5FUZH 5KVGL 1RV6X 4WEBH 2XWJB 3L3KB 3CFBA 5EIVA 5T3ZH 1MAJA 3WN5C 1LK2A 3KYAA 4HX1B 2CIIA 3C6LC 1OQXA 3KPOB 4CU6A 2C4XA 5D2NE 1OGTB 5JNYA 1LILA 1J7VR 3L7FB 2BVTA 3SBWA 5FK9B 3ZO0A 5F7YC 4HUNB 1GGCL 1T21B 4NZDA 4XVJL 4CDGC 1AXTL 4X6FB 3TN0B 2EICA 2QHRL 4PJEB 2XV6B 4YXHH 1CFTA 2X4OB 3ES6B 2HFFB 4IJ3C 4GRWE 4OCRH 3WNOA 3RWJA 1XGRB 5D7JD 2FX9H 5DMKB 3MRCB 1D5ZB 5GS0C 5JOPD 4P5TC 4PJ5A 5DUBB 2PF6A 4JFPA 1BZQK 3F7YB 1FH5H 1TZHB 3BDXA 4P46B 1AP2B 3QFDB 2HLAB 3SDDA 4XHJD 1RVFH 4ONOA 1UM5H 3VDAA 2NTFB 3G08A 5KS9A 2EIZB 5B8CA 4WTZG 5FUZL 4K3DL 3QHFH 3DO7A 2P5ED 4PTTA 1QFPA 3B9VA 1NFIA 3L3KA 4TUKH 3PWPD 3E1F1 3FAXA 1D5XA 4JQIL 2HP4A 4N0FA 1HE7A 1BD2D 3IJSB 2XFXA 3S98A 3O4LA 2E3VA 5IFHH 2WINA 1UT9A 5INDA 1DP0A 4YDIL 1U3JA 5IB2B 1UXWA 1FJ1B 1BBDH 2APTA 5CINL 4U1GB 4PJEE 1KG0B