4ONGH

Fab fragment of 3d6 in complex with amyloid beta 1-40
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
210
Chain Sequence
EVKLVESGGGLVKPGASLKLSCAASGFTFSNYGMSWVRQNSDKRLEWVASIRSGGGRTYYSDNVKGRFTISRENAKNTLYLQMSSLKSEDTALYYCVRYDSGSSDYWGQGTTVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3D6 FAB ANTIBODY HEAVY CHAIN
publication title Crystal structure reveals conservation of amyloid-beta conformation recognized by 3D6 following humanization to bapineuzumab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 45
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2014-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ongH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ongH01
4RX4D 1IEBB 3IFLH 5DFTA 3EO0A 3WXVH 4OLEA 4DJMA 4HCRH 2APWA 3JV0A 4TSBH 3WBDA 3NFNB 1CGUA 4DUVA 2JK5B 4X6DF 1P5VA 3IU4L 5IFHL 4PGEA 2EEAA 4JJ5A 1Q1JH 4KKBD 1GZQB 4PV9A 5EOCH 5T1MA 1BWMA 1RZGA 1XR8A 4L5FL 4O4YH 3M17B 4AEEA 3NOIA 3KJ4B 1FJ1B 4MA1C 4Z7QE 4JCMA 2DWEB 3W0WE 5TFSL 5ICZB 5HVWA 2JCCA 3VCLA 3GHEL 2XPGB 3OXRB 4OQTA 5D6DA 3O4OB 1BQHG 3EO9H 3QDMA 1I1YB 4O51B 3UYRH 3AVEA 5FYKU 1S7VB 2IQAB 3SBWC 2BOCA 3Q5OA 5DD5H 1YEDA 5EUKA 1VHPA 5AAMA 1PAMA 4C83B 3UTTD 5IV2B 1QPPA 2XQYK 5EU5B 5L2KD 1G7QA 1RUPL 2FR4A 4ZXBC 5DD6A 1MFDH 2NXYB 5DMGC 3B2UC 4FRWA 3DHMA 2X1WL 4OZ4A 1BD2B 2W9DL 4YZFE 1J9CT 5I71C 5DEFB 5C6WH 4OM0L 1T5WB 4ODUA 1L7TL 1F2QA 1FVDA 5EOQH 4W4OC 1Q9KA 2FSEA 2NZIA 5AZ2L 3SCMB 2V9RA 1P4IL 2AJXH 4IMLB 4MQ7B 4KK9C 3UTZA 2I9LB 4MS8C 3SGDI 3BUTA 1MHCA 2EDFA 5DJYA 3NCYS 4PTTB 1MIML 1GIGL 4PJ5E 2QQLL 3ARWA 5D1XB 5FCUL 3QQ3B 4LU5L 2ESVB 2P7TA 2YS4A 3MLXH 4ZQKB 2QR0B 3FMGL 5FHBH 3QIBB 4PG2A 4YQXL 1SBBA 4ZFOA 2R4RL 3ARFA 2VOTA 1K8IB 5C0BE 1AQDA 3H9SB 2MCPH 3NTCH 4K55A 4PJFE 2Y72A 3BH9B 3ARRA 1YEJH 1J0ZA 3RWFA 4GW5A 3L3GA 1DUZB 1X9QA 4NJ9L 1C1EL 1W72A 4KHTH 2ICWB 4N8PA 3GI8L 5SWSB 1U3ZA 1VFUA 4QHLB 4OLUL 1X5HA 2R56L 5DMJB 4Q0XH 3OZ9H 2A0LC 4U3CA 3ZDZF 2Z8VC 3JWOH 4KUCF 5HJ3A 1AXIB 4ZXBD 1CXKA 4ODVH 3GSXA 5FGCE 5B4MC 4YGAB 1CD8A 3BMWA 5DMGD 1FAKT 3B2UD 4GKSA 4LVEA 2ZG1A 1ZANL 3EOTH 4LPWA 1LO4H 2G60H 4N8VG 1YC8A 2FBOJ 25C8L 1CLOL 2ZG3A 1D5MB 4O2EB 5LQBL 2IFFH 2DN7A 1CICA 3PWPB 4HZAA 4IS6A 3P0YH 5I1EH 3EOAA 5HGDA 2HH0H 3IYLW 5DRWB 5KAQG 1VEMA 3HE6B 1BM3L 4GW1A 4KK9D 1VACA 3MRMB 2YPLD 3RWIA 4MS8D 1CR9H 3C8DA 4K9EH 4OLVL 1E4WH 3H3KA 4MNHB 5IFAL 5EO0A 4DTGL 1OW0C 2HJLA 4K71B 1LEKA 2Q1EA 3LZFL 4QTIH 2Y25A 4DWHA 4G43A 3SDCC 2MQ0A 4X6CF 3M45A 4PGCB 5HHPB 4EOWL 2DQFA 1S9YA 2F5AH 4LQFL 4EN3B 2BVOA 3GI9L 3RVTC 1G84A 4HPYL 2C1OA 4XNZB 2R2EA 1BVLA 3AS3A 4NWTL 1U8IB 3WJLC 2L7JA 1MCFA 5BOZG 5I1IL 3GRWL 3MRNA 4FQJL 1JIBA 3IAPA 2BMKA 3G6JF 3G5ZB 2AGJL 3DLQR 5C6PB 3T3PE 3QDHA 3OKOA 4RNRA 5IVOA 2D9QB 4WJ5B 3PXJA 2VDPL 5EU3A 5T5FL 4N90E 1U8PA 4ZOCA 3I50H 4OFYA 1KIPB 5T1LD 4F3FA 2A0LD 1JNNH 4IDJL 1EBAA 5DYOA 5C9JA 3O0RL 5F1NB 4YHZL 2QJDA 3O2VL 4Z7WA 4LLAA 2AEIT 3S3SA 5C86A 4HXAL 5B4MD 1IGCH 4G8EB 4H20H 1YY9C 4L4VD 3N1QC 3I9GL 1NGXB 3KLAA 2PYFB 4GQPH 3V6ZA 1U8LA 5A3IC 2D0HA 1HZHL 4JHWL 1MAJA 4Y8DC 5I76B 2ED8A 1R0AH 3PP3H 1YJDL 5CJQL 1KCUH 5I30L 2IAMC 4TVPH 5C0AD 1AKJD 4MD5A 4HXBL 1I3UA 5FKPA 2OL3L 1EGJH 3C6LC 3VXRE 3Q5YA 1N7MH 5D1ZC 4QXGL 4NQVB 3ZDXF 1FZMA 2L4OA 3KPRD 5IOPB 2A6JB 4YDIH 4DQOH 1HHJB 3OJMB 5ADPL 3SDCD 2C9AA 1IJ9A 3BPLB 1ZS8B 2QSCL 4NGHL 4M43H 3ZT7A 5IEKA 2HFGL 4LLDB 1YMHA 2W0FB 4FS0A 5EU4B 1PD6A 3RVTD 4X7SH 1FFPA 1ZLSL 1MJ8L 5E95B 4DFIA 4ONFH 1WBZA 4Y2DB 4R8WH 1QLRA 2AJSL 3VXMD 1P7KA 1MCWW 2ILLA 5H37G 3WFZA 5D7LB 3IU3B 2YSSA 4JO2H 3RAJH 3FRPA 3IXAA 3VWKC 1IBGL 1RY7B 3WO4B 3N85L 1F11B 1RJZB 4JO3L 5GGSB 3UX9B 2EECA 3UJJH 3OGCA 3VXOA 1FBIH 2XACC 4YXLL 1MELA 1I8MA 5MERB 3EBAA 3WS3A 4HPOH 3BYTA 2XKSA 5JPMA 5FYJU 1MFBH 3L7EA 1ADQL 4D3CL 4GAGH 2HFTA 4XCCL 1YY9D 4X0KA 2IALA 3MXVL 1EJOL 3KJ6L 1KCVL 4MA3B 5A3ID 1JZ6A 5JDJA 5E8PA 1HHKB 2XTJC 4PLNC 1JGEB 4L8SB 1C08B 2YZ8A 3B8SA 3DMMB 3IFOB 5J3HC 1N5YH 2OZ4A 1DQDL 2IAMD 4IM8A 4JFEA 4BSJA 3N1GC 3W9DB 4ZAKC 3FQWB 3C6LD 3O4LA 5IVXF 3KPPA 1GOGA 5D1ZD 4TVPE 3O11B 1NQBA 3BP6A 4S1DC 3S36L 1V05A 1X7QA 3ZYJA 4XAWL 5FAAA 2HAZA 2P8MB 4QWWC 4GKNA 1MWAB 2DJ4A 4XVTL 3LQAH 2PTVA 5JO5A 4XP5H 1IAIM 1MPAH 3ARDC 1IGIH 3OKKB 4U6HB 5H94B 1A6AB 2XXMB 1XGYL 4RGNB 2EIZB 1R3IH 3ZHDA 3PABB 2IC2A 4OCSL 4C58B 1BD2E 3TBVA 4XXDB 2RQ8A 3DRQB 3BESR 1KPUB 3DI2B 3RFZC 3L3IA 1NMAH 3VWKD 1TJIH 4Y5XA 2QQQA 3MO1A 1TCRB 1AHWC 4K3JH 4OM1L 4JDZB 4NKQB 4LNVA 1CD0A 2VXSH 1FZOB 5DRZB 5DVOA 3VW3L 3LH2L 3S8WA 2NY1C 2Z91A 4P2QA 1AFVH 5I74C 4KXZH 4HK0B 3T3MF 3FO2A 3RUGA 3DI3B 2ESVE 2MQCA 3NIFE 2XTJD 3NA9H 4JE4B 3V4UH 3NCEB 1R3KA 1JN6B 4GBXA 4NZUL 5J3HD 1IC5L 3H9SE 2YUZA 1FN4A 5B3JF 2GTWA 2Z35B 3G5YA 1IAKA 1XF1A 4ZAKD 1MJJA 1H3WM 4F7CB 3ARBA 3QHFL 3V6OC 4G9DB 3UP1A 4J6RH 4U0QB 3WFDL 4S1DD 5IMKA 5SWSE 1PQZB 4ODSL 1JTPA 2XWJA 4LCWE 5CEYA 4QWWD 4HIEB 2B1AL 4P5TC 3FHQA 3REVB 2VLKB 1L7IH 3MPCA 4N9GA 3ARDD 5B38B 1MRFH 1KIQA 3D87B 1UXSA 2VLJD 4X6BA 4TNVK 5C0GB 1E0OB 1D5BB 1XR9B 2VL5A 4WCYL 3H3PL 1U91A 4Z7UF 3ALPA 2O5XH 2ZUTA 1CGVA 5AYQA 1INDL 1BIHA 1KT2B 1FLRH 2P44B 1KJ2B 4HZLA 4LASH 2AK4B 5I8KL 4HBCL 3RTQB 4PIRF 4GXVH 4G8FA 2AVGA 4YHYC 4JRXB 3MFFA 1JYWA 1FGVH 1YNKH 4L8DA 5HYJD 5KSBA 3DX7A 5DT1H 2N1KA 4IRSB 4WHYG 2MJWA 3P3YA 1QR1A 3MRCB 3HAEB 2NY1D 5I19H 1XIWC 1X5XA 4CKVX 4PJBA 3BIBX 1DBAH 1YYLL 4GW4B 2H9GA 4PRPA 1CWVA 2VXVH 1J8KA 4EUPB 1OAUL 4NRZA 4Y5VB 4LGSB 4G7YL 5CIPB 4YR6A 2C1PB 1JL8A 3BDXA 1OWWA 1SJXA 4Z7VE 3DXAB 4JFZL 4E41E 3KWWA 1SY6H 1AD0A 3TBTB 2PO6A 1IEAB 1YEGL 4NUJA 5IHUL 1OGTB 4YAQB 1QFUH 1CZ8H 2MPAH 3RI5F 5J7CC 1G0YR 1XT5A 4AEIH 2EDKA 3KXFA 5BS0D 5CJ8A 4P5TD 2B4CC 4G7VL 1OP5K 1JFQL 2NZ9C 1TIUA 2FX9H 1QFOA 3V2AR 3BGMA 2LAAA 1G7MB 2FNBA 1MJUL 1LGVA 5E8DH 2J7LA 2VJXA 4N0FB 4D9RD 3JUZA 3IFPA 1F58L 4PBVC 5I1KL 1JF1B 2ZWLT 1QPXA 5C0CB 1QLFA 2CLRB 3HHRB 1F3DJ 3MUGB 2I9TB 1VESA 3NGBB 5IB4A 4JQVA 4LGRB 5CGMA 2B5IC 5F88A 1MWAH 2H6PA 1XIWD 3QEQD 4U6XA 4D0DA 2IBZY 2GY5A 5I15L 2X9YA 1IKFL 2FX7L 4G3YH 1IAMA 1CLYH 2XWBB 3KDMB 5IQ7L 3EZJB 4PJHF 2VMFA 3MJ7B 4UU9B 3Q1SH 4G42A 3LV3B 4M8QA 1BBJA 5DMIH 1UADC 5F93C 3WE6A 3OKLB 5DK2A 3HZVB 4M1DH 2G5RA 1MCLA 3D9AL 1KJMA 1S7WA 4P59H 2B20A 5JXAH 3UTQA 4YDVA 3ZSTA 3WL9B 3SO5A 5D7LE 5HHXL 1G9MC 1EVTC 4KDTC 4F58H 1I9EA 1OAKL 1A6VL 1GZPB 1RHFA 4PJCE 4XC3H 4M1CC 1J1PL 3EGSA 1X5LA 2R2BB 2VKXA 4R97C 3GDBA 2B0SH 3B5GA 3I75A 5C0BD 2NZ9D 5DRXA 1BQSA 1V7MH 3GJFH 1MLCB 2GJJA 4EBQH 5DJCB 2LVCA 3GSUA 4BQCA 3MJ6A 4M7ZB 5B3NA 4CRPA 3G9VA 1UB6B 4JG0H 5INCA 5ACLA 4HIHA 4P3CH 5JOFB 5K9KB 4Q9BA 4I0PB 5T3ZL 2FHCA 2WW8A 1LK3L 1REIA 2VLMD 3GSNL 4OT1H 3V7AE 1JGLL 3IDYC 4NO0A 5EC2A 2ADJB 3EFFB 3NPZB 4KQ4H 2IEPA 3DX6A 1UQSB 1SYSA 4ZD3H 4H1LA 1A1NA 3UDWC 3TN0B 2V2WA 2DIAA 3GSWA 1MF2H 1VEOA 1P84J 4U1SA 3LKQB 1TFHA 3AC0A 2H3NB 3AMLA 4HV8B 3OAZK 4FQHB 1PY9A 2X41A 3U0PA 1KJVA 3SOBL 4X4ME 4OV5A 3ZE0E 3O6FA 3PNWA 4RGNE 3T0XA 5FXCH 1HHIB 5DGQA 5HGAA 2DQEL 4JFOA 2Q86A 2VN4A 1MH5A 1Z0MA 4O00A 4PR5B 1Z5LB 4WTZA 4YFLF 4X98B 5ENWA 5CUSH 1FVEB 3SE9H 4FXGB 3Q0HA 4M1CD 4RFNC 5IESL 2CSPA 4HS8H 3RJQB 4BQ9A 2X1PA 1WT5C 1NGPH 1VPOL 3WJJC 3MRBA 3TIDB 4PY7A 1IC4H 3QUKB 1PBYA 4N0UB 3G04B 1WEJH 2DD8L 5J1AA 3QG7L 4DOHB 3VI3F 3HZMB 1RK1A 4XPBL 1IRAY 1EEYB 5DLMH 1WC7B 1N0XH 4FQXB 4J3XA 4HKBB 1FO0L 3U7WH 2XY2A 4UB0L 1J5OH 2QHRH 2RBLA 2EYRB 1XCTB 5IHZB 2JKXA 3ZE2F 1MSPA 1NC4B 3QH3B 4XNMA 1UWEH 1A3RH 4CU6A 2GUOA 4QHMA 1VKXA 1YN7B 1R6VA 2VDMH 1J12A 1BGXH 5JIIA 5TE4H 1MEXH 5IJKA 3OAYK 4CU7A 1L0YA 2VLKE 3MROA 5TDNA 1EEUA 1TZGL 3B83A 1I9RH 3KJ4C 3KYKH 5DJ0A 4BKLB 2EE2A 5E5MA 2G2RB 5DA0B 2R0ZL 3JVGA 4CGTA 3GGWB 3VXRD 4PY8I 3JTSB 3O4OC 4GKZB 5A16B 3WUZA 1KSRA 1TVDA 2CKBL 3MRHA 3GMOB 1DBBH 1BVZA 4PB0H 4TRPH 5E8OB 2JTDA 4I9WE 2AK4E 3L6FA 2PF6A 4M7LL 4JRXE 4NO2A 2DYPD 4XC1L 2YD4A 1RZ8A 3CMOL 2C4FT 4K94L 1EMTL 5FGBA 4P0DA 3LS4H 2YK1H 5FUCE 1KN2H 2F8XC 1IAIH 2ATPA 2WBJB 3RWDA 3QA3A 2FL5A 4ALAH 2VQUA 4PGEB 3GJEB 1UC6A 4PV9B 3SCMC 3H9YA 3DXAE 1RZGB 3TBSA 1MI5A 3IDMA 2Q76A 4OCWH 2EYTA 3S6CA 1FLTX 1FYTA 5I1JH 3FTGB 2PW1B 4FQ2L 4K8RH 3QB7C 2JCCB 3VCLB 3BE1L 3E3QE 4BFBD 5D1XC 3W5MA 3QDMB 3MMEA 3QIBC 5LWYH 4YE4H 2IWGA 3DYPA 1QHPA 4D9LH 5KZCB 1ZT7A 1YEDB 5EUKB 3F65A 1JPSL 2R0LL 2AERT 4Z8FH 1G7QB 1X3DA 2P48B 3WFHA 2FR4B 1Z9MA 5DD6B 3DECA 3JTTA 4AL8H 1RURH 4MWFA 4RA3A 4OZ4B 1UM5L 5F1IA 1EAJA 3TLRA 3TT3H 5C0CE 1ND0B 3QFDA 1S7XA 4ODUB 4E9LA 4M7KH 3T3PF 3QWRD 5HDQL 4R4NC 4Q2ZA 1CTNA 3R8BB 1Q9KB 2FSEB 1DBML 3L3JB 4L5FH 2VITA 3UTZB 3KGRA 3QUYA 2NQCA 3HG1E 1MHCB 5TFSH 1ZLUH 3BEVA 3GHEH 2DBJA 3QCUH 5T3XL 2P7TB 3DX8B 1F6LL 3CU1A 4ZFOB 4NO5A 4XCYA 3SCMD 3ARFB 3HE6C 1FCGA 2R8SH 1T89A 4ZSOB 2BERA 3BQUA 1AQDB 1EX0A 4MJ2A 5HYQA 1RUPH 3QI9A 3C60A 4K71C 3QWQB 5D1XD 4Q6YA 3RWFB 2Q7NA 4GW5B 5DZOA 2ESVD 3L3GB 4N8VA 4JAMA 3QIBD 1W72B 3ZYOA 3OF6A 4EN3C 1ZOXA 2HFEA 2KUTA 3BZFA 3CH1A 3RL2A 4XNZC 3H9SD 1QQDB 4U7SA 5HJ3B 1FNAA 4PJIB 1FV1B 4HKXA 3H42H 3MJ9L 4CDHA 1IZKA 5GGTH 2J4WL 4JQXC 5GGVL 3CPLA 5SWSD 3C8HA 3F7YA 4P46A 1J10A 4UT6L 1NUFA 1A3LH 4KQ3L 3FN0L 1CICB 2BSRB 2ICCA 4IS6B 3PP4H 3FMGH 4R4ND 3EOAB 5HGDB 4YQXH 4HFWA 2BK8A 2F74A 2Y5TA 2R4RH 3PUCA 2P42B 4GW1B 4JO4L 5DQJB 4TSAL 3OKYA 4LLUB 3UCRA 5EO0B 2ED9A 2HJLB 1LEKB 2AXGA 3LPGA 3PWPD 4G43B 5MEPA 2NLJB 3QEGL 6CGTA 1C1EH 5KANI 5FCSH 3GI8H 5ILTH 5LAXA 2IG2H 3HE6D 2CMRL 4OLUH 2BVOB 2ZUXA 2C1OB 5DS8A 3KS0J 1BVLB 3WS6C 2R0KL 4M4PA 1AO7A 4V1DA 4HSQA 5FDWB 4KMLB 3MRNB 4KKAC 3IRPX 3BPOB 1X5KA 4JDTL 1UJTA 2GK0A 1FVCA 1ZANH 1AJ7L 3OKOB 4RNRB 3DSNA 5IIEB 2LABA 2V7HA 3IDJB 5EU3B 5EC1A 5FYLD 1H9VA 3ALWA 1CLOH 1I9IL 5GS0L 1U8PB 4EN3D 4I2XB 3K81A 3QXDA 3MRRA 2J8UA 2Z0BA 4RRPG 3ZHKA 4F3FB 4X7TA 5C3LD 5DYOB 2AEQL 5SX5K 5C9JB 4N0UE 2XICA 4Y2DC 4MAUL 1FQ9C 5FYKE 5D1QB 4DOHE 4Z7WB 1S5IH 2K3TA 3KG5A 1M7IA 3DROA 3PQYA 3QO0B 1BM3H 5F96H 2VSDA 3GFUA 3KLAB 3FQTA 3V6ZB 1U8LB 4UINL 4L3AA 3WO4C 3PHSA 4YIQA 2B2XH 5C92A 3LZFH 1YECH 4HGKC 1CLCA 1F90L 2VWEC 1S9WA 3HZKA 3IGAA 2D9CA 4OQTH 1QEWA 4NC0B 3PWNA 4LQFH 5FKPB 4L9DA 2H32A 4HPYH 1UWGH 2AEWA 3MRLA 3QIUA 3S3JA 4PB9L 4NWTH 4S0TD 3UJTH 5I1IH 3EYQC 4DW2L 1FZMB 2V17H 5F7HA 2ICES 2JJSA 4YXHH 5I2IA 2AGJH 1HI6A 4L8SC 5KBNC 3DMMC 1EFXA 2Y5EA 2VDPH 5C71A 4PGZA 5T5FH 5IEKB 3PG2A 4MX7A 4PBXA 5TF1L 1NDGB 1FFPB 1C12A 2LTQB 3QUML 1WBZB 3O9WB 1QLRB 4KKAD 2ZPKL 4M4RA 1CCZA 2B1HL 2YSSB 4YX2L 3BOVA 3IXAB 4WDIA 1ZA3A 4KKNA 4MNGA 5DHXB 4HJJL 1S7TB 4NP4H 3U48A 4RGNC 3VXOB 3OGCB 1I8MB 3NZ8A 4FQIL 3L5JA 3WS3B 3L7EB 4PJGA 4Y2DD 1QA9B 2ADIB 5FKAA 3CDFA 5A2FA 4HXBH 4Z76A 1FORL 2IALB 1NKRA 4O9HL 4QXGH 2OR8A 4YHMH 4XHQA 3KYAA 3D39B 1CBVH 5E8PB 4X5LA 1CXIA 1C5BL 5ADPH 3TO2A 3A6OA 1UYWL 1PZUB 2QQNL 1QBAA 3BD3A 2QSCH 3PDDA 1CDUA 1SVZA 4NGHH 4JFEB 9CGTA 2QLVB 2DLEA 1W72H 3L3HA 4WU7B 2JCCE 1ZLSH 5J1TC 3KPPB 3QDME 3SGEI 1J88A 3HFMH 1F97A 3BP6B 3EYQD 1YDPA 3P4NA 4M62L 4YEEA 1X7QB 4GKNB 3DMMD 3K7UA 2E7HA 4XMPL 1KGCD 3GMPA 5JO5B 3H3BC 1IBGH 3N85H 4JO3H 3SKNA 5LG1A 1CGYA 4M00A 4U1MA 4TOYL 4UV4L 1ADQH 1OD7A 1UH3A 3TBVB 4JM4L 3QJHA 3FB7A 4GG8A 5EA0L 4OIIL 1B0RA 2EDQA 1CGSL 3F7RA 3MXVH 2CLVA 4X4ZA 5E2WL 1N59A 3MREB 2FB4L 1KCVH 4W4NA 4OZIA 2FJFA 4XNQA 1NCUA 4Y5XB 3FB5A 3MO1B 4UNVA 3IKKA 4RGND 1U58A 1W8NA 4Y5YA 4QRSB 1DQDH 4MQSB 2Z91B 4P2QB 2NXZB 3FO2B 4X4XB 3RUGB 5C07D 3K1KC 3RTQC 1KOAA 3B2VL 4NWUH 1R3KB 3CCHA 4PRNA 2WUBH 4XVTH 1HCVA 4L4JA 3X11B 1FN4B 2GTWB 3G5YB 5FUCC 1NAKL 3RDTA 3ZMRA 3PE9A 1JCKA 1IAOA 3TFKC 3ARBB 1DQJA 4OCSH 3DUUA 5IMKB 4JGUA 2ICWJ 4XBEH 3K2MC 2XWJB 1FPTH 1IL1A 4X6DA 1PKOA 1MHPH 2ADFL 2PR4L 3ARGA 3QUZA 1JGUH 4N9GB 1KIQB 12E8L 1YNLH 3BIKA 4GT7A 3TM6A 4X6BB 4KGLA 4CMMA 3SDXF 2VL5B 3VW3H 2VDRL 3LH2H 1JHLH 1CFBA 1U91B 2KL6A 2J3SA 2CRZA 1P6FA 4BH7A 4HZLB 3VXQA 2CR6A 3SE4A 3DV4A 3P40A 4WWKA 5DJXA 3U4EA 4G8FB 2A38A 4PUBL 1ODAA 3MFFB 5BQ7A 3PL6A 4U05A 5KSBB 1CDBA 2EKJA 3DARA 5B21A 1QR1B 2IBBA 1Q0YL 5EZOL 4AM0A 2H9GB 2D03L 4H26A 4PRPB 5E2VL 2C26A 1JPGB 4JB9L 2Y06H 3QG6A 2OJEA 4I9WD 4NRZB 3RTQD 4P5MA 4ODSH 4JRXD 4YR6B 2GY7B 3P11L 5GGRA 3NGBC 1DQMH 2B1AH 1B3JA 1WUNT 1MLBA 4XCEA 3KWWB 5CJOH 5KVDL 4AQOA 2PO6B 3TFKD 4JKPL 1DFBL 1QNZL 4NUJB 4WCYH 2MCG1 4CBPA 1H3PH 4HIIB 3BISA 1IVLA 2E6PA 5ALCL 1DCLA 5IKCB 4AENA 4KU1A 3KXFB 3CUPA 3ARQA 5F72S 5F7DB 4Q74A 1HKLL 3DXAD 4R0LA 3QQNA 5I8KH 3LRGA 5LVEA 3MV7A 3DGGB 3FO9A 1FZKB 5EG6C 4Z7WE 3IRZA 3ULUL 1H5BC 1A6UH 3CXDL 3BGMB 4X8JB 3PDOB 2CUHA 3LS5L 3BDYL 2FEEI 4GO6B 3U9PL 2AV1A 4HWNA 3VFUB 1HHGA 2X4TA 2JJTC 3IJYB 1UZ6E 4OGYL 1RIUL 2OZ4H 2NY4C 3KYMA 3OMZA 2EDXA 4HHAA 5GSRA 4Y7MA 1N5AA 1OAUH 2WIIA 3CDYA 3U0TA 3V4VL 1QLFB 5SX4I 4WNQA 4M1GL 5IB4B 3TT1H 5C2BL 2F5BL 4M7ZC 5F88B 3SE8L 4U6XB 2H6PB 1MY7A 2D7OA 2Z8RA 4NPYA 4D0DB 4JPWL 4YNYA 4EEEA 4XB8A 3CK0H 1EAPA 4RX4A 4U33A 2IH1A 2VSCA 2XZQH 4P9HH 4G42B 2COQA 4M8QB 1BBJB 1K3IA 4U6TA 3WE6B 1T2XA 4X6FA 5DK2B 1BZ9A 3FJTA 4JVPA 1JFQH 2EDTA 1KJMB 2NY3B 1S7WB 3GB7A 4RFOL 1OQOA 1MJUH 4CADA 4YDVB 4HMCA 4QTHA 3TYFA 4OD2B 3NIGF 5D7SL 4K3HA 1J0IA 1F58H 2WQRA 2DL9A 3CJJA 5I1KH 3EGSB 4GFTB 1DBJL 5D9SA 4U7KA 4KGJA 3S35L 4F7TA 1INEH 1IC7H 4X6CA 5JHDA 2IF7A 1N64L 2C7UB 1NBZA 1GC1H 5JR1L 4B0MM 3RGVC 3WXWL 1NLBL 2VABB 5BMFH 3GSUB 1U8JA 5K93A 4UDUA 2WBKA 5INCB 1Q9LA 4HIHB 4DN3L 2DDQL 2NY4D 5BW7A 4J12A 1IKFH 2FX7H 3LHPH 1PG7L 5LGHL 5IQ7H 1DQTA 1JZ3A 1TVHB 4NO0B 5EC2B 4JFEE 2F19L 3A6BL 4PRBA 4MXQC 2C3VA 5DHVA 1CF8L 3C87A 1ORSA 1MCPL 3DX6B 1RZKH 5J9PA 3KHOA 1I1AC 1SYSB 3O4LE 5CSBA 1A1NB 3HS0A 4KMTL 3D9AH 3V0WL 2V2WB 1LQSR 1HKFA 4R4BA 3GSWB 4OBSA 4U1SB 3IKCA 1CG9A 5HHXH 1OTUC 5I1DA 2CDEB 4MA7L 1CD1B 1OAKH 2BC4A 1KJVB 1HIML 2OCFD 1NEZG 3O6FB 5ANMA 3PNWB 2AXFA 2X4NA 2CUIA 3FO0L 6FABH 2Q86B 1MH5B 1U42A 1B9ZA 3OBAA 4LSQH 2A6KA 1FNLA 4K7PX 4KJWC 4NUGH 5KVFL 1LK3H 3RI5K 3UROR 3BZEA 1EZVX 1JGLH 3CFJA 3U79A 1MY5A 2VDLH 3MRBB 1RUML 4ONGL 4PY7B 3AROA 4P2QE 4M6ML 2X70A 3SBWA 3RGVD 3UXFA 5J1AB 3TWCL 2ZCKH 4U1GB 3RUGE 1ZHNA 2AXJA 3ZE1F 3JWDC 4Y1AD 1DDHB 5ESQB 2ZCLH 3VFMB 4Q97A 4OLYL 2ORBH 4MXQD 1RVFL 2VXUL 1OSPL 4PV8B 5FYKD 1I1AD 2XFXA 4PJ9B 5I9QB 4XNMB 2YZ1A 4JHBA 1C7SA 1UB5A 1JI2A 1QP1A 2GUOB 2WBJC 2ZUWA 2FEEL 1VKXB 2YWZA 5D7JB 3AU1A 1OTUD 1DVFC 4R90L 5HVFB 2Y4SA 3MNVA 2PN5A 2YPLA 3MROB 4LOUC 3NN8A 5EZLA 5TDNB 3JZ7A 5E70A 1INQA 1G7HA 5DJ0B 5E5MB 1NC4D 2DLGA 2YXMA 3R1GH 1VPOH 2Y7QA 5D6DC 3K80A 2YBRA 2R1YA 5IVXA 2ZKHL 4M03A 5E8EA 4XPBH 4AYFA 1B90A 4J4PC 1Z3GL 3NCCB 4NO2B 3MLRH 4KJWD 3DVNB 4P9ML 1RZ8B 2CLZB 1F4XH 5HHNA 5KSBE 5IVZA 3MXWL 4I0KA 2R1WA 5K9QI 5I17A 4RAHA 4DVBA 1HSAA 1GSMA 4PJBE 4K7PH 4PRPE 2F53A 3ULVH 3QZWG 3C5SB 1J0YA 1DN0B 2ATPB 5T1LA 4FQ1L 2YRPA 4OI8A 5K9OA 1BQHB 3OKNA 1IQDA 3RWDB 3QA3B 32C2B 4U49A 2FL5B 4HUUB 3WYRA 1FDLL 1KTLB 3M8OL 2K9UA 4OI7A 4I5BB 4L4VA 3PWLA 3TBSB 4FQLL 1MI5B 4UOW0 3IDMB 2Q76B 2QQKH 3HNTL 1TZGH 2EYTB 1K5NA 4KDVA 3NH7H 3E2HB 1XZ0A 2WBJD 3PGDB 4NCC1 2VAJA 5C0AA 1AKJA 4WU5A 3MRQA 3MMEB 1DVFD 4PG2C 3KXFE 3F58L 5L8KB 1OB1A 1SYVA 5EO9A 4LOUD 1NGYA 1ZT7B 1BREA 2X4UA 3VFVB 5L8JB 3H8NA 2DLHA 2HT2C 5LJYH 1MNUL 5C6TL 3QHZL 4OFDA 4K94H 3WFHB 3SDCA 2NNAA 2LFGA 2V2TA 1IQWH 3KPLA 4MWFB 2YC1A 2XRAL 4NN6C 1QFHA 4QXTB 5DEGA 1DEDA 1NCCL 5F1IB 4Y4FC 3QFDB 4HF5L 3VRLE 4D0BA 1QSVA 1EERB 3TESA 1S7XB 4H1LH 3RHWF 3WJLA 3QHTC 3V8OA 5FHAH 4JM2A 4J4PD 3L3KB 2VB5A 1WBXA 2Z31B 3QRFM 3VXMA 4Q2ZB 2BNRA 3BKCL 3DETC 1QD0A 4N0CC 4U2YA 3SJVB 2XA8L 4LSUH 3QUYB 3AS2A 3S34L 3K4DA 5A2IH 4XAKE 3D85A 4FQ2H 3SE3C 1Y6MR 3BEVB 3BJ91 3BE1H 4Z7UA 1CICC 3ULVE 3MA9H 4M8VA 4LCCC 5C0EB 4XPTL 4XCYB 1M1SA 1N26A 5F3HB 4UI2A 3BQUB 2FO4A 4XPFL 2R0LH 3L3OB 4OCMC 1HK6A 2IGFL 4AT6A 2DQCH 2XKNA 4I4WA 3QI9B 3RX5A 4PJ8A 2XNAA 1D5ZA 3RY4A 2IAMA 2E9JA 4N8VB 4JAMB 1C5CL 2KQMA 1UM5H 4MJ4A 4TYUA 5DK0A 4DKAA 3C6LA 4HQQL 1KCRL 2W38A 4OSUL 2AJYL 1OAQH 5D1ZA 1OARL 4Z0BL 1M05A 2HFEB 2DBLL 3CH1B 2HT2D 2X1QA 3KYOA 4WHTA 1KIUA 5I73B 2V5MA 5GJSL 2XXCB 3BPOC 4XX1G 1DBMH 2LE9A 1QSFD 4NC2B 5AG9A 4HJ0C 3MV01 4QNPF 5DMKB 4I3RL 4MLIA 3CPLB 3U83A 3P30L 1YPZB 3F7YB 4JPKL 4P46B 4Y4FD 1T80A 5MEQA 2A6DA 1UJ3B 1KLFA 5T3XH 1TITA 1JGVL 5D1QC 4E42A 2IJ0C 1CU4L 4HFWB 3WUWA 1KV3A 2F74B 1E28A 2Y5TB 3DETD 3R8QA 2GSIA 4N0CD 2A74A 5IQ9A 3RJDA 1HOCA 3VWKA 5I16A 4HS3A 4LCUB 1AC6A 1WIPA 4LLWA 1BHGA 3WIIL 3LVEA 4PRAA 1I8IA 1T1YB 1A0QH 1U8QA 2AXGB 1A7OL 1CICD 1JYVA 3SGJA 2E3VA 3VGFA 3AM8A 5LAXB 4RRPA 1QTYT 4LHUD 3X3GL 3VD5A 8FABA 5GQBA 4GH7B 1AO7B 1I85C 4V1DB 5EPMA 3LD8B 4NIKB 3K3QA 3MOBH 4KROC 4ZUWA 1OP5H 2P49B 1KB5A 3T09A 5EIQA 5EO1B 3MJ9H 1QR4A 2GK0B 2AV7B 5E1HB 5FYJD 1FVCB 5GGVH 3EAKA 4UOW1 2Y36L 4PJHA 5BV7L 4UT6H 2J8UB 4X7TB 5HY9A 1AI1H 1RUAL 2LTQC 3O9WC 3G6DL 4XH2A 3FT2A 3DROB 3PQYB 3CVIL 1DQQA 4HJ0D 4JO4H 4TSAH 1RIHH 3ARDA 3WDIA 4ACPA 1TDQA 3FQTB 4JR9L 4GG6F 4MQTB 1G1CA 1GH7A 4MAYA 2VLJA 1EEQA 3BEWA 4YIQB 3MRPA 2V7NA 1RZJH 1S9WB 3HZKB 3IGAB 3QEGH 5HPMA 2EC9U 5D1QD 3PWNB 4GRWF 4LMQE 2B39A 2CMRH 1HILB 2H32B 5FO7A 4NNPL 2GKIA 3MRLB 3QIUB 1VFBA 3IETA 2XN9A 1AHWA 4XP4H 2VC2L 4NKIL 5HYJA 4F80A 5F6IB 1HI6B 1EFXB 3MCLL 1BAFL 3N9GL 4JFQA 5F7UA 5GS0H 1T04A 4MX7B 3WFCH 3UBXA 1VFAA 2E8YA 3IDIA 1KG0B 1DJSA 3SDYL 2I5YL 4NQEB 1C12B 3T4YA 2HVKB 4J1UB 3DX9A 1NANI 1U3HA 1WFUA 4KROD 4PTUB 2GFBA 2HFFA 5I1CL 1OWRM 2EDHA 4WDIB 1ZA3B 4MNGB 3KR3L 4UINH 3O2WL 4BYHA 4Q9RH 3V6OA 4QHKJ 3T77A 4UILL 1F90H 3BO8A 3NZ8B 5FFLA 4QRQB 3O9WD 4X99B 1M6OA 5FKAB 4PJIF 5BS0A 4Z76B 1J11A 5D5MF 2MQ3A 3GZKA 3BUYA 4PB9H 3IB4A 4WRLA 1Y18B 4R9HA 2XKUA 4Y5XC 4DW2H 3L5XH 4MQXC 4ZPVA 1LNUA 2WAHA 3LOWA 4AEFA 3TO2B 1MI5E 1FG9C 2XZZA 1EXUA 1FYTE 4H0IA 5I1LA 3OAZH 3L3HB 1I7UA 5TF1H 2AW2A 2BCKB 3EJJX 1TETL 1BPVA 2HWZL 3QUMH 5FUOH 5J11B 4LSTL 1JJUA 1YDPB 1A5FL 3D39D 3GKWL 1JMXA 5GRZA 1NGWA 3MLUL 2FO1A 4JVUA 2FZ3B 4XPHH 5CILL 2B1HH 2NY5C 3QEQA 1XIWA 3TPUA 1IGJA 3CLEL 4YX2H 1FL6A 3QPXH 3DVFA 4JFED 1RI8A 4JZJC 3TZVC 1IGTB 3SKNB 4NN5B 1BFVL 1DUYA 4U1MB 2R4SH 1UACL 3FB7B 4GG8B 1I9JH 4AH2A 1B0RB 4JPIA 4CVUA 1FORH 2BJMH 1T22A 4O9HH 5JLZA 1N59B 2AQ1A 4OZIB 4OAWA 4XNQB 3FB5B 1H8OA 5JNYB 1FNSL 3LEYL 4FFZH 4Y5YB 35C8L 5HGHA 4MMXC 2HLAB 1A6TB 1NC2D 5TPWH 4UIKL 4OGXL 1AXTH 2UZIH 4N9OB 2J1KA 4Z18A 3QEHA 4RMTA 4MQXD 3ZTJH 3C09B 4M62H 4PLJC 7FABL 4MJ6B 3U46B 2ZNXA 4PRNB 4XMPH 5E5UB 4KH2A 3MNWA 3CFEA 2DAVA 3RDTB 4P2QD 4LDLB 4LSRH 5EUOF 4PBWD 1IAOB 1RULL 5FV2A 1XCQB 2I07A 1OQXA 3SDDC 3C2SA 3DUUB 4UV4H 1ZMYA 5EA0H 1JHKH 1L6ZA 4OIIH 1AQKH 1OF2A 3B5HA 1U93A 1UEYA 3EYOB 3AS0A 2XT1B 3ARGB 3D25B 3QUZB 4W6YB 1YEIL 3TBWB 3TZVD 3S9DB 1DLHB 4RMQA 1Y0LA 1PLGL 1X6NA 3ELAT 3CLFL 4MHHI 4XXCA 5E6YA 4BH7B 2VIRA 3VXQB 4LCIL 2H32H 2N4IA 3GK8H 3DV4B 3U4EB 3GM8A 5TH2A 1ACYL 3F7PC 4KDTA 5BQ7B 3PL6B 5IMMB 5E9DA 2OTWB 2RCSH 3TBYA 3TIEA 5GRVK 2V5RA 4UT9H 1Z2KA 1QKZH 1W0WA 1BJ1J 4GRLA 4KVCL 3OB8A 3HNSL 1S78C 3QG6B 1IC1A 4JFHE 4NZTH 4PLJD 5IW6B 1MIEH 1IILE 5GGRB 4HW6A 4AMKH 2H2PC 1J0JA 3CC5B 5HVGB 5CD3B 4RIRA 2ADFH 3HMXA 1AO7E 4NC1E 4V1DE 5HHOD 2E7CA 3GBNH 4FQQA 12E8H 1VFMA 3U30C 5GS1B 4XCEB 4NBZB 1EHLL 1G9NC 2ICEA 1CXHA 5L8LB 4R2GB 3SDDD 4M93C 5I75C 4KK5C 3UEZA 2Z9TA 3MLWL 1MCNA 2J8UE 3CUPB 5DUPH 4WEUD 2NY3C 4ODTL 4LAJH 4NCDA 4TQEL 3PQYE 4TULL 1ZLWK 1U0QA 1C8PA 1FSKB 3IFLL 2AV1B 4K2UH 4DN4H 1Q0YH 1HHGB 2X4TB 5EZOH 1OTTC 5GRUH 3AB0B 2D03H 4TSBL 4Y89A 2WANA 4HHAB 3NPSC 4CUCA 5GIRA 1N5AB 2B4CL 4KRNA 2WIIB 3U0TB 4QGYA 2NW2A 1RD6A 1Q1JL 3P11H 1G6RA 3CZFB 4P5KA 4MJIB 4UT7H 3KPSD 4PPTA 1TENA 2VH5H 4OLZH 4NPYB 1JNLH 5DJDA 1OM3H 4DZBA 4U1KA 4YNYB 1WT5A 2C3HA 4PREA 3IDXH 4JKPH 1DFBH 3WJJA 1A3QA 1QNZH 1S78D 1EAPB 2R9HC 4LKXA 4RGMB 5F1KC 4ISVA 4EXPX 2IH1B 5DDHA 5TDOA 1D5XA 3RY5A 1LP9F 4LVNB 1MCBA 5ALCH 3CSBA 4M7JL 4ZFFA 1N6QH 2H2PD 4G6KL 2VISA 1BZ9B 1WWBX 2VYRE 1QACA 3GB7B 3ULUH 1V3JA 3CXDH 5EIIB 5DC4B 4CADB 3TYFB 4QTHB 3NMEA 3BDYH 1IEBA 2HMIC 1FC2D 1XGQA 1RUQL 4MNGE 1K6QH 3PV6B 4KK5D 4OGYH 3O6FC 3SGEH 4XPAH 5SV3A 1JTTA 5K9JH 3THMH 1K8DA 2E7LA 2E7BA 1S9XA 4QHUB 4F7TB 1NH6A 2JK5A 4X6CB 5JHDB 2Z8SA 4WI2A 3V4VH 2NY3D 4GQ9H 4PJGE 3U1SH 1OAZL 5EOQL 1NBZB 1GZQA 2DMBA 4KWUA 4EIZC 2F5BH 3W11C 2AJXL 1G9ML 4XT1C 3M17A 1U8JB 3SE8H 4UDUB 1Q9LB 2IQ9L 3AGVA 1OTTD 3MLYL 4JPWH 4POYA 2QTEA 2G75A 3MTRA 2KKQA 3BKML 3GIVB 4ZNEA 5DTFB 3LAFA 2ERJB 1NEZA 1T0MB 4PRBB 5DHVB 1S7VA 3H7BA 4G8GA 1ORSB 2VZOA 1UT9A 5EBLB 1A4JA 3HS0B 4C83A 2RB8A 3KPOA 3SDAA 3VU2A 4R4BB 2YKLL 4ZUTB 5HHMD 3W9EA 3HMXL 1KC5H 4OF0A 4DAGL 2BY3A 3VFGH 3IKCB 1CG9B 3VWJA 1TLKA 4FTVD 4NJAL 5HGGS 2R9HD 1IGYB 5I1DB 3V95A 2HJFA 5D7SH 1KPRA 2BC4B 3MC0A 1CFQA 3OSKA 5ANMB 5JZ7C 2V5TA 4PJ9C 1T5WA 4IOFC 3S35H 5I9QC 4Q0XL 3OZ9L 1KULA 2A83A 3H7LA 2ICWI 3FQRA 3L7FA 1RUKH 1MFEH 5JR1H 4NQXB 4ODVL 5D7JC 4MQ7A 1NLBH 5IJKC 4JFYA 1CIUA 2HMID 4OZIE 2I9LA 5SX5H 2AJ3A 5DXWA 3P73A 4XNUL 1LO4L 1S7QA 2G60L 3O6FD 2A6KB 1RHHA 3K1DA 3RBSA 3BZEB 2X4RB 4OGAC 2IFFL 3TPKA 2NY6B 1T7YA 3JVGC 4POUB 3P0YL 2F19H 3O2DA 4ZQKA 1O0VA 4BM7A 1CF8H 1MCPH 2HH0L 1KTDA 3W11D 1EA9C 4B7IA 4KI1A 3FONA 4KMTH 1ZHNB 3NBNA 1EV2E 1CR9L 2LQRA 3ZKQD 3BN9C 3BH9A 2HN7A 4JHAH 4QTIL 1NJ9A 4MA7H 2BNQB 3DJ9A 3FQNB 4D9QD 2X7LA 2I24N 1HIMH 4WWID 4JEGB 3NZHL 4QHLA 5I71B 5CBEB 3DGCR 1UB5B 2FBJL 5ICYA 4KXZI 1A21A 4K3EL 1Q94A 4X6DE 2BXZA 2PYEB 1J1XL 3MNVB 5EZLB 3NABH 3NN8B 1D9KA 1ZHBA 3EZ8A 5JZ7D 5KVFH 1CXLA 4Y4HA 4PJ9D 4X83A 5ISZD 1G7HB 1IM9D 4IOFD 3PWPA 4CVXA 2Y7QB 1GGIH 1RUMH 4HT1L 3QWOB 4ONGH 2YBRB 2R1YB 5D7JD 5IVXB 4H20L 1R5IA 1P2CA 1QG3A 4YDKH 1D3CA 2P5ED 2CKNA 3CX2A 2IPUG 5HHNB 4OGAD 1XGPA 4CL7A 5IVZB 1I1CA 2R1WB 5I17B 1G7PA 1HXYA 4DVBB 4OLYH 1HSAB 1KCUL 2VXUH 4O58H 2BHUA 4TVPL 5ABDE 1OSPH 3HPJA 5FO9B 2F53B 5CZXC 1EGJL 1NGQH 1GPOH 5T1LB 1T20A 5K9OB 3OKNB 3QO1A 1IQDB 2Z31C 5DD3L 5C08D 3OTTA 3MOAH 4I3SH 3BN9D 3UPAA 4YDIL 1S7RA 4R90H 2BVQA 3RX7A 2YRZA 3G5ZA 4L4VB 3PWLB 3WFEL 1NCNA 1T66C 1CFVH 5E4EB 2CIIA 3T0AA 4JQXA 4WJ5A 3DURA 4JFDA 1VENA 4W68A 1K5NB 3HMWL 4OUOA 5K59F 1I7TA 2Y9RT 3SKOB 2FHFA 1XZ0B 2XIDA 2V5SA 4F33A 5C0AB 4G8EA 5HTSA 2ZKHH 4YH6A 1SYVB 1NGXA 5EO9B 2PYFA 1NGYB 1QYGL 4OFIA 1MI5D 1T89C 2X4UB 3MV7E 4JO2L 4UIMA 2WP3T 2YR3A 3MV11 3I3EA 1LO0L 1JV5A 4OZFH 5EH1A 4E5XB 1FBIL 3QUXA 3MXWH 5EORH 3SDCB 2NNAB 2V2TB 4HPOL 3KPLB 4U0RB 3V4PL 4J3VA 1MRDL 2YC1B 4GAGL 1R3LB 2NTFA 5DEGB 1RIVH 3P0GB 2KH2B 5IBUG 4FQ1H 3K8LA 3AS1A 4OF6A 4D0BB 3C08H 3MUZ1 4TPRH 5ECJE 3RVWC 4WO4A 3V9FA 4WFFD 1NFDF 3WS6A 4JM2B 1WBXB 5I73C 3O3AB 5IOPA 2A6JA 3M8OH 3GSNB 2BNRB 3VDCA 1N5YL 3HNTH 5D2LB 3O45A 2H8PB 5CZXD 5I0ZA 5EU4A 2R2HB 1AIFA 4P46C 5IHLB 3D85B 3SDXA 1UJ3C 2DQHH 4KV5F 1FAIH 1F8TL 2Z31D 3G6AA 3QXUA 1UVQA 1MCHA 2FATH 1CLZH 3ULSA 1YEHH 1T66D 3LQAL 3SJVD 2EE3A 4JQIL 4Z77A 1IGIL 2AJZA 1MNUH 5IW1A 1MCIA 4J8RA 2ZUVA 3QHZH 1R3IL 4PJ8B 2XNAB 1D5ZB 4ERSL 3QQ9C 4DKEH 1NCCH 5DK0B 5T1DH 4HF5H 1BQLL 3DWTA 4MHHG 4X6CE 5JHDE 5D1ZB 2J6EA 1M05B 1NMAL 1TJIL 5ITFB 1TJHH 3KYOB 2GHWB 4K3JL 4JFPA 5GRXG 5HD8C 4WHTB 4XWOC 3FT3A 1QLEH 1LEIA 2VXSL 4L8SA 1C08A 3DMMA 4MB4A 2XV6B 1NGZA 1NMBL 2XA8H 1KTRL 4M5YH 3RWEA 1AFVL 5IWLA 1ES0A 2EE6A 1A1OA 2A6DB 3NIDF 5MEQB 3RVWD 4C4KT 5IEHA 4LDOB 1FO0B 3GSOA 3LEVH 4KI5C 2LVEA 3V4UL 4XPTH 2FH6A 5IF0A 1N6UA 3FT4A 2GSIB 1LE9A 3MRDB 1KB9J 4XVJL 1HOCB 5I16B 3GBMH 4NFDA 3PGFH 4LLWB 3LIZL 2EIZA 4P46D 1F4WH 4PRAB 1I8IB 2ZZUT 3FB8A 5TQ0L 1U8QB 2OK0H 3GMLB 2LU7A 5ANME 4C59B 1C5CH 3SKJL 1AR2A 3S3PA 3E6FA 4HQQH 5I6XC 4KHXL 1LWRA 3BT2H 1X5GA 5BZWA 1XGRA 2YWYA 2P5WD 3SHSA 8FABB 5C07A 4DCQA 1YNTB 1L7IL 2DBLH 1MHHA 3QIUC 2EC9T 5GJSH 5EPMB 3MBXL 2ZCHH 4ZUWB 1KB5B 3JXAA 2CKBB 3I84A 5F6IC 2ATKA 4B53A 4C56A 4JFHD 3QQ9D 1KTKE 4L8BA 2R29H 1ZWIA 2ZUQC 1X5ZA 1FLRL 1M7XA 3K46A 1OT1A 1QBLL 4GXVL 5HY9B 2R0WL 5HD8D 1AO7D 4V1DD 4XWOD 1JGVH 5C0DA 5MEOA 2PXYB 1JN6A 4XH2B 1YNKL 2FRGP 3FT2B 5DT1L 3QEUB 4OKDA 3TNNB 1DQQB 3VGDA 5I19L 3T0BA 5FM8A 4WI9A 2NMSA 2JJVA 4MAYB 2VXVL 2YUVA 3BEWB 2W92A 5D7IF 1F6FB 1KNOA 4ZO8A 3MRPB 1A7OH 3RHWK 3WKNA 1PQZA 2EDEA 4HKJA 4RWHA 2EYSA 5HPMB 4KI5D 2FEDC 3DNKA 4HIEA 2RAMA 3BX7C 4JG1H 5DRNB 1A7RL 2NYYC 2UZXB 1WV7T 5FO7B 1E4KC 1VFBB 3IETB 2XN9B 1AHWB 1F02I 4POZC 5KJRH 2Z93A 2YD9A 5HYJB 4R7NB 1D5BA 2YPLE 5DA4A 5C70A 5F8QC 3T8XA 1CZ8L 3MRIA 2MPAL 1F3DH 2CRMA 5I74B 3VXTA 4AEIL 2H41A 7CGTA 1T04B 2Y36H 5BCAA 2A73B 3RTQA 3IDIB 3B9KA 3QIUD 3T4YB 1RUAH 1Q38A 2FX9L 3DX9B 5IVXE 2Q7YA 3AXLA 1U3HB 4ELKB 2Z8WC 4A2MA 2CK0H 2GFBB 2HFFB 1UCBH 4M7LT 3CVIH 5HPOA 3HAEA 5HHQB 1EFXD 4JR9H 3QT2A 1FIEA 2EDOA 4BSVA 5HVHC 1GHFH 3UC0L 4EUPA 2YUXA 4WI3A 4NN5C 4NKMA 5E99L 3T77B 5A2KH 5TJWK 3BO8B 3QXVA 4NQED 2QADB 1BJ8A 4DGYL 1OP3K 1M6OB 3QR2A 2F53E 4QRTB 4UQ2A 1I8KA 5KAQF 3CFDA 5CZKA 2A77L 4NNPH 2DQJL 1MWAL 2BVEA 5B8CC 1FNFA 1HDMA 1XF2B 4L4VE 1YPZF 4ZPVB 4G3YL 1CLYL 1LNUB 1MCRA 3WDHA 1OGTA 1KCSL 2FEDD 1BAFH 4ZS7H 5I1LB 1I7UB 2NYYD 1OLZA 2JIXD 1IAII 4C54A 2I5YH 4P59L 2P8LA 5C0AE 3T3ME 2E27L 4POZD 4H8WL 5JXAL 1AD9A 3C09C 1NGWB 5I1CH 3TPUB 5B22A 1IGJB 3WCYA 1I3RA 4K7PY 3RDTC 4ELMF 2FD6H 1GOFA 5B3JE 4ZNCD 1BBDH 1DUYB 4AH2B 5T5NG 1NUDA 2QL1A 1I4FA 1LK2A 1NAMA 1T22B 4JG0L 2JELH 5JLZB 4P3CL 2ZUUA 4RCAA 3VXME 4OAWB 2BNRE 5GRWA 3QAZB 5CJXA 4OT1L 2ZSVA 2EDWA 5HGHB 4JKKA 3AMKA 3VFPB 1DE4A 1XGTA 2IH3B 4KI5F 4FMKA 4Y0GA 4R4FH 4Z7UE 1MF2L 3QEHB 1DEEA 2JJWA 3UZVB 4LSTH 1H5BA 1NL0H 1A5FH 4X9HA 1YJDC 4Z0XB 3MLUH 3VI4F 4X9FA 1TQCB 2R39A 3PL6C 5CILH 3GHBH 2JJTA 5D7KD 1KB5H 3ROOA 3CFEB 2DTMH 2CIKB 1OPGL 2R2BA 3ME0A 3MQIA 1JZ4A 3O6LL 3VRIA 4F9PC 2J12B 1BFVH 1KJ2L 2VZVA 4J3SA 2BSSB 1WTLA 4L9LA 1JWMA 4NQSA 1MLCA 4HS6A 1JUFB 1O7VA 1OF2B 2B5IB 4DVRH 5F6HJ 4QOKA 1K4DA 4HS8L 4WUKL 3RDTD 1FNSH 5GS1C 3LEYH 5F44A 1NGPL 1F3RB 1NUNB 5FOBA 4YWGH 2ZP0T 5D2NA 4OGXH 1IC4L 3K4AA 2ZUSA 3T2NL 2QSTA 1ZVHA 3CU7A 4KK8C 2VIRB 1LO3L 4M6NH 1I1FA 3IDNA 5DHYA 1ZLVH 3HC4L 1GL4B 1J5OL 2QHRL 4FQHA 1EIBA 5E9DB 1T21A 4HWZA 2J88H 4PJ7B 1EUUA 1FSKC 3TBYB 3TIEB 3ESUF 3GSVB 3AB0C 3VXNB 4R97B 1RULH 1UWEL 4GRLB 1G0XA 1KLUA 3LPFA 4WW1A 1ULVA 4Q6IA 1MCOL 4NHUA 2VDML 4XMKH 3RGVA 1BGXL 2HRPH 1MEXL 3D3VB 3PL6D 2IPUK 4FA8A 3D2UD 4R96A 3U4AA 4RIRB 4ZOEA 2EDNA 1I9RL 4Y1AA 3KYKL 1QRND 3VA2C 4HJGA 1IGML 3EOBA 1WVZA 4DGVL 3T4AA 2ICEB 3BXNA 3MV9D 3FB6B 3NCFB 4RGMC 1PLGH 3TIDA 3OV6A 3QUKA 2F9BT 4LVNC 3D5OF 1I1AA 4TRPL 2GCYA 4KZEH 3HZMA 1BWWA 4PJHE 5DI8A 4HWBA 5E6ZA 4RZCA 3RZCA 2AI0L 3V6BR 4HKBA 1YUHB 5JOEA 1ACYH 1WZMA 1MFCH 4X6EA 3TC9A 3LS4L 1T7VA 2ZG2A 2YK1L 1XCTA 1KN2L 5IHZA 1IAIL 2X4SB 2VLJE 4NT6A 4ZFZA 3SGKC 3QH3A 3RU8H 1NANH 4QHKI 4KVCH 4KK8D 5GIRB 1CK0L 3V7AG 2VUYA 3TH4T 2ARJB 3AREB 2NW2B 1SMOA 5DC9B 3GNMH 4ZG1A 4HC1L 1QRKA 2XYCA 4P5KB 4YFEA 1ZVYA 4YDJA 2VDOH 4JRWA 2XN9E 4RFNB 5GISH 4DZBB 2BRQA 5I1JL 2G2RA 4U1KB 5GGVY 5BW7C 5HYJE 1EHLH 1HCFX 4RQQA 3GGWA 5DZNA 4K8RL 4NFCA 5JW4Q 4F2MB 3JTSA 4GKZA 3LRHA 3MUY1 5A16A 4QKXB 3BKJH 4S10A 5DDHB 5TDOB 1D5XB 3AY4C 2F15A 5KVEL 4YE4L 4D9LL 4ZFFB 4WV1A 3ZT5A 2VISB 4MJID 3HTLX 4LPUA 4ODTH 3MR9B 4Z8FL 5IHBA 1MCJA 4TULH 3C2AH 3PWJA 4YHLL 2B7DT 4AL8L 1RURL 1H0DA 1Z9LA 4IRJC 4MCYA 1XGQB 1KIRA 3TT3L 3V6OE 1K8DB 2OBGA 2WBJA 1S9XB 2B4CH 1TTGA 5CGTA 3DUHA 5LBSL 3U6RA 3M1BA 4M7KL 2FH8A 2A9MH 3GJEA 4JFFD 1DVFA 5BS0E 2ADGB 2DLTA 3BH8A 4UDTA 5CLWA 3RY6A 2CUMA 3FTGA 2PW1A 1PKQA 2G75B 2AXHA 3VE0B 2C3WA 2EC8A 3EDFA 4D9RE 3KPTA 4QYOA 2NY6C 2F58H 3L5WA 5F1SA 3QCUL 5JHDD 1NEZB 4LPTA 4G5ZH 2C4FU 3H7BB 3BSZH 4M7JH 4G8GB 4G6KH 2R8SL 3ARVA 1A4JB 4J4PA 3KPOB 4M6AA 1ZT4B 3BFOA 1J8HD 3SDAB 3VI3E 4LPYA 3W9EB 3OKEA 1J0HA 2Z92A 1F4YH 3VWJB 4ODBD 3QEQE 4GG6A 1QSZA 2HJFB 1KPRB 3MRGA 1G0DA 1RUQH 5F9OL 1CFQB 5JW4M 1ND0A 1XMWA 5JPNA 4WTXA 5FYKL 3I6GA 4LLYA 5GSVA 3ZE2E 8CGTA 1OAZH 2A83B 3FQRB 3L7FB 2Q8BH 5BXFB 2EKSA 2APFA 1G9MH 3L3JA 2XG5A 5IT2H 3H42L 4JFYB 4IRJD 5GGTL 1UKSA 2PTUA 2AJ3B 2IQ9H 4MGXA 3P73B 3WNPA 1S7QB 2YHGA 3MLYH 1AR1C 1RHHB 4KKCC 3WNMA 4UV7L 1A64A 2DJSA 3BKMH 3PHOB 1A3LL 3IVKB 3PP4L 3DX8A 1ZTXL 3KS0H 2RGSA 2BDNL 1KTDB 3OAUH 3FONB 4ZSOA 3DSFL 1IGFL 2YKLH 3IDGB 2RHEA 3HMXH 4DAGH 3B9AA 2MWCA 2HN7B 4NJAH 2NY6D 1NJ9B 1QSFA 2WNGA 2X7LB 1F3JB 1W0YT 4HH9A 2NX5B 3RZWA 5ILTL 2VLME 4Y4FA 5JDSB 2IG2L 2EDJA 2F54B 4LIQE 1QQDA 3CSGA 3KPQB 5ICYB 1P9MA 1FV1A 4PJIA 4HG4K 3JWDL 3OJVC 5D5MA 1Q94B 2BNQD 1NLDL 5E4EC 4P3WA 4OJFH 4WFGD 4XNUH 5IW3A 1D9KB 4A6YA 1ZHBB 4P99A 3SE3A 4Y4HB 4KTEH 2VZUA 3L9RA 2BSRA 5F89A 4CVXB 3SY0B 1A02N 1O7SA 4LCCA 2P24A 1MCSA 1S5IL 4HIJA 4CVZA 5F96L 4LHUA 1QSED 2IFGA 1BEYL 2PYED 1R5IB 5CP3A 5DQJA 1P2CB 1G6RH 2YD6A 3QXWA 1T2QH 3LB6C 4HCRA 4LLUA 1AR1D 2D7NA 1CQKA 1Q9OA 4KKCD 3D69B 5E4IA 2B2XL 5E9DE 1YECL 4XP9L 1XGPB 3EYUL 4JN2A 2NLJA 1G7PB 3WFBH 1HXYB 4U0RC 4OQTL 4KVNH 3NZHH 2FHBA 4PS4L 3HPJB 2BRRL 3WIHA 2AP2A 3PWUA 1T20B 1UWGL 4LHJB 2FBJH 2EE9A 3QO1B 4JM2C 3UJTL 5FDWA 4ZDHA 2V17L 3ARUA 4K3EH 1S7RB 3P9LA 2BVQB 4YXHL 1J1XH 3DVGA 1KXQE 4JLRA 2CIIB 5IIEA 3DURB 3IDJA 4JFDB 3FO1A 4J23A 3VD3A 1SBSH 2F53D 5EU7C 1TXKA 4I2XA 4ZS6C 3CZJA 3BIAX 1I7TB 1G7JB 4YDLB 4HT1H 5D1QA 4F33B 3AUVA 3QO0A 4S2SA 1B6UA 1SEQL 1BMGA 1A4KB 2YPKA 1RZ7L 4UIMB 3DV6B 3BPCA 4HGWB 1S9KC 1JV5B 2C3GA 4NP4L 5IJVA 3QUXB 2YEZB 3WD5H 3IF1B 4PJ8C 4LF3A 4OD1H 5CZVL 5EUOA 3LN4A 2NTFB 1ZEAL 3QIWB 4ZFOL 3QPQC 5CBAA 3LB6D 3MBEA 1JWUB 4WO4B 4YHML 5KSAB 1I85A 4WEBH 5DD3H 1CBVL 3L3DB 4APQB 1ZA6A 3BD5A 4WENB 5L2JB 3R0NA 3UJIL 3RPIA 3WFEH 2QSVA 3STLB 4ZFGH 3O45B 5C0RH 3HMWH 3EYSL 1W72L 2RIKA 5FECA 1AIFB 1NDGA 2BSTA 3ZO0A 3SDXB 3TCXA 3IS0X 3HFML 4JM2D 4OZGF 3O9WA 4OIBA 5T3ZD 5JA9A 3G6AB 4G6JH 4GUPA 1UVQB 1E27A 2VLLA 5ID1A 3O3EA 5ID0B 2BNRD 2AKRA 3ULSB 1ZE3C 4LSSL 3Q6GH 1QYGH 4XB7A 1H15A 4EVNB 4Z77B 1S7TA 1T2JA 1LO0H 2AJZB 5IW1B 4ZS6D 4J8RB 3RIFF 3D85D 5J6HA 3ILPA 1AP2B 2AQ2A 4YHKL 2CGRL 3V4PH 1QA9A 2UY7A 1MRDH 2ADIA 2PKDA 3SGJC 4BQBA 2X89D 3TH2T 3O2DH 2BHYA 1JP5A 3NA4A 4RDQG 3AM8C 1NCDL 4FP8L 5ESAB 3HRZA 1U8NA 3F5WA 3D39A 2MHAA 4JFPB 4P2RD 3FT3B 4P2OA 5ELIA 5BO1H 1LEIB 1BF8A 3HCVA 3BW9A 4PJ8D 2VLRB 1U8KA 1HYSC 1NGZB 2X05A 3IFNH 2W07A 4TUJA 1R5VA 1F42A 4WU7A 3RWEB 3QFJD 5HYSA 1ES0B 4ZNEE 3QPQD 3BDBA 1A1OB 5IEHB 2AABL 5DUBB 4NRYA 1F8TH 5E7FA 5B39G 4DEPC 3GSOB 4NWUL 4G8GE 1YYMH 2PXYC 3UYPA 4KKLC 4P57A 1O5DT 4O2FB 3FFCD 2WUBL 5IF0B 3FT4B 1LE9B 4JQIH 3S4SG 1X4XA 3BWUC 4PRHB 4MAYC 4AZ8A 3UZQA 3FB8B 1SJEA 1NC2A 4ERSH 2HKHL 4XBEL 3MGAA 3E1F1 3ZHLA 1FL3B 4JJHA 3E6FB 4M9OA 1FPTL 1BQLH 1WTGT 5BZWB 1XGRB 3MREA 1B0WA 1MHPL 4FNLH 3CSPA 5C07B 1OSZA 4DCQB 1UXWA 1JGUL 1MHHB 1YNLL 1F00I 4KUZL 2AAVA 4Z78A 3JV6A 3BYYA 1IFHH 4QRSA 1NMBH 2ATKB 1OGAD 3R0MA 4L1HA 1JHLL 4C56B 1OL0A 4HUVA 4P23C 1KB9K 4L8BB 1ZWIB 3B9EA 1UG9A 1ZLWH 5FYLH 5AG8A 4Z7OE 4X4XA 3GMMA 1GGUA 5A40E 1LP9A 4XVSL 5E94B 2R15A 1XEDA 4RISH 5TQ2L 5C0DB 1U3HC 5D70L 5MEOB 4U7MA 3X11A 2HKFL 1HYSD 4XVJH 3CDGA 5KSUA 1A47A 4BH8A 1DLFH 4JZJA 3TZVA 4PJDF 4NZRL 3LIZH 5F7LB 3VGHA 1VCAA 5C1MB 5TQ0H 2Y06L 1KNOB 2NX5E 2QADC 3V5HB 4HKJB 4JM2F 5IUSA 2EYSB 3SKJH 4NQCD 2PXYD 4KKLD 4KHXH 1SJVA 1DQML 3PF2A 4U1JA 5D2LF 3RKDC 5J4MA 4MAYD 5CJOL 3MBXH 4HK3N 2Z93B 4X7CC 2BSED 3QJFB 1X5JA 3IJHA 3NFSH 1H3PL 1L0QA 4OQ1A 3T8XB 1LO2L 2EEBA 1FC1A 2X5PA 3MRIB 2F8OA 1JWSA 5SWZD 3VXTB 1PX3A 3EYFB 3PWPE 4YPJA 1HQRB 1QBLH 1Q72L 3B9KB 2XN9D 2R0WH 3SEPA 2PCPB 4OF8A 1MRCH 3UAJC 3INUH 4LBEA 1A6UL 4MYWB 5E6IA 3AXLB 4MZ3A 2Y07H 1MUJB 2Q7YB 2HVJA 3ESVF 4IOIB 5HHOA 3S5LG 2KQNA 4G9FB 4P23D 5F7MC 5EN2A 2OZ4L 4BSVB 5IB5A 1F6AA 1JPGA 3PWVA 3SDDA 3QCTL 4NKMB 2CH8A 5C0FA 5MEND 2IBZX 5FYLE 2MTPA 4L29B 1U3HD 1HINL 2DF3A 4UQ2B 1I8KB 3TT1L 5HDOA 3CFDB 1A7RH 1YN6B 3TEUA 2IBGA 4MCZA 1HDMB 5EU6A 4PP2B 3MZGB 3CK0L 3QAZC 4GXUM 4RGOL 2QADD 4JFDE 4HIIA 2XZQL 4P9HL 4GKOA 5IKCA 3BVNA 3VD4A 3KPNB 5F7DA 1A8JH 1BZQK 3DGGA 1TNNA 1FZKA 2P8LB 2J6EH 4YGVA 3RKDD 2DMKA 3GJFK 3ZYZA 4X8JA 3PDOA 5SWQB 1AD9B 3FOMA 1TPXB 1J05A 5AUMA 1TQCC 2BY0A 4JO1H 4A2LA 3KPSA 3VFUA 3IJYA 4GRMA 2MKWA 1I3RB 2DWDB 3UC0H 5DGRA 1INEL 1IC7L 5E99H 5JMOC 1KBGL 4DGYH 3UAJD 5C2UB 2K7PA 4XPGH 3LCYA 1GC1L 1E6JL 1LILA 5IVNA 5JQ6H 1CT8B 4Y88A 3VH8G 1I4FB 5BMFL 1LK2B 1NAMB 2A77H 1U92A 2DQJH 4PGJA 2NY5L 1EVUA 1CL7I 4X9BA 5F9AC 3LHPL 5E2JA 3ARPA 5J12B 4UTBH 2ZSVB 1KCSH 1WCBA 1WFOA 4MNQA 4Q9QH 2WK2A 1DE4B 1XGTB 1KN4H 1RZKL 2IANA 2GYSA 3SDXE 1P7QB 4XXCC 4WW2F 1DEEB 1H5BB 2E27H 3H0TB 4H8WH 3J8F7 4OGZA 4OD2A 3LKNA 4YLQT 4OCNC 3MCKA 4HWUA 3ROOB 4X5XA 2GW5A 3Q5TA 2NY4B 2ID5A 4XX1E 3CVHA 3VRIB 4PJAF 2VWEE 4ETQA 5L7XL 4GRLC 2PUQT 6FABL 3T0DA 4G8IA 2C7UA 4ZUSA 1BLNA 3LDBB 2OX5A 4L9LB 1JWMB 4NQSB 1IMHC 4HS6B 2VABA 1ZHKA 4QOKB 1EUTA 4LSQL 5JW4N 3MNZA 2ZNWA 1K4DB 43C9A 1JHTB 3T1FA 1C16A 2CDGA 4NUGL 5BV7B 3X3FL 4FTVA 1KGCE 1TVHA 4KPHL 2VDLL 2X6MA 4WHDA 5FOBB 3JV4A 5D2NB 4RAUA 1TZHA 4Z7NE 2ZCKL 3MA7A 4J7RA 2X42A 5CEZE 1WITA 4NZJA 5GS2D 1I1FB 3GMRA 2GIYA 3VD9A 5IK3A 3IDNB 4MD4A 4GS7C 5DHYB 2CDEA 2ZCLL 1CD1A 1T21B 4HWZB 2ORBL 1CGWA 4YPGA 5DVLA 1OPGH 4L3CB 3O6LH 1M7DA 4TUKL 1KJ2H 1SY6A 1KLUB 4WW1B 4YBLB 3AREC 3HPLA 1HEZA 4Q6IB 3RGVB 4NHUB 2X4PA 4RMRA 4LMQI 3HR5B 1NFDA 2BP3A 5E9DD 4V2BA 5C07E 5JORA 1RJCA 4HFUH 4R96B 1T5XA 1EEZA 3HAEH 4Y1AB 5DVMA 4WUKH 3I3BA 4HJGB 3EOBB 3BD4A 3R1GL 4GRLD 4UNUA 3T4AB 3BXNB 5FIEA 2DL2A 3C5ZA 4C56E 4EUPH 4X7EC 1XF3B 5EZIH 3IDUA 5CIPH 5LGKA 1I1AB 2VUOA 4ORGB 2GCYB 3D3VD 1VGEL 3NACL 4OCRH 5DI8B 3T2NH 1PGRB 2BY2A 1B4JH 5EBMB 5DJZA 3ABZA 4RZCB 1LO3H 3RZCB 2L7UA 3MLRL 1DDHA 5ESQA 4L4TD 1F4XL 3C8KA 3HC4H 3VFMA 4X6EB 5DEZA 1DP0A 2PETA 4D0CA 2ZSWA 4M48L 4K7PL 4PV8A 4PJ9A 3ULVL 5ISZA 4NT6B 4ZFZB 1IM9A 1A7NH 5HI5C 3NIGE 4IJ3B 5ADOL 3RWJA 2E7LC 1QBBA 3WN5C 5KTEH 3W2DH 4RWYL 1PFCA 2AK1L 5D7JA 1MCOH 1MVUB 1ZKAA 3O6ML 4OF7A 5DVNA 3T0EC 4NBYB 4YDJB 3T2OA 4PFEA 3MLVH 2QQKL 2P5EA 2OTPA 3QXAA 3NH7L 1IGMH 5JQHC 4Q7DA 4RQQB 4DGVH 4LP5A 4LRNH 1HNFA 4DKFL 3BN3B 2J8HA 1BVKA 3ARED 5A2JH 1S5HA 2XQBH 5ETUA 1CL7L 3FQXA 1MCWM 4HLZH 3ROLA 4WV1B 3K4ZA 3ARYA 2AI0H 1A6WH 3K0WA 5C08A 3DVNA 3SDAC 2CLZA 1A2YA 4LNRB 2BNUB 3PWJB 3VWJC 1L0XA 2UY6A 4TTDC 1IQWL 1H0DB 3GJFA 4XVUC 4LEOA 3TCLA 4MCYB 3GMNA 3LKRA 3C5SA 1DN0A 1M4KA 1KIRB 1JPTH 3X12B 1BQHA 2DQUL 4X9GA 3OX8A 3ARXA 5FHAL 32C2A 4JANA 1CK0H 4Z5RB 4HUUA 3U6RB 4NDMB 3M1BB 3RVXC 1KTLA 1DVFB 4HC1H 4I5BA 1B2WL 5AEAA 1H3XA 3BH8B 4UDTB 4UUJB 4LSUL 1G7IB 3LSOB 1A7QH 2DLIA 5HDBE 1PKQB 5HI5D 2DLFH 4UTAL 5JXEC 2A1WL 3PGDA 4ODXB 1P6AB 4QYOB 4BQ8A 3L5WB 2ARWA 1E6OH 3OR7A 2WUCL 3MA9L 5KVEH 1RZIA 4D8PA 5F7EL 4TN9A 4LK4A 3LKPA 3T0ED 3VFVA 4B7LA 5GHWL 4PJ7F 4L3ED 1GAFH 2KBGA 3U36A 3OKEB 5M94B 1TZIA 2DQCL 2Z92B 4F15B 3QISA 4YHLH 4WI6A 4ZTPL 4FABL 3ZE1E 2GI7A 2X1XR 4GG6B 4QXTA 3MRGB 2H1PH 4G8GD 4N1HB 5D7IA 5JPNB 5TF0A 1PY4A 1OAQL 3I6GB 3L3KA 2Z31A 4LLYB 4OUUA 1FFOA 5GSVB 5LBSH 3SDAD 3GO1H 4GRWB 4LRIC 4OF3A 1JVKA 2EKSB 3VWJD 4QT5A 4TTDD 3ORJA 3SJVA 1CD9B 2AEPL 3DTXB 15C8L 4XVUD 5LXGH 1D9KC 2OI9C 5F9JB 4Y4HC 1FIGH 4KRLB 3OB0K 2EIBA 1KFAH 3RVXD 4KRPB 4UAOC 1NCWH 5C0EA 3W0WB 1NPUA 5F3HA 1YY8A 2VXTL 3MGTB 4HMDA 3L3OA 4I8DA 4JY5H 1EHNA 2UWEF 3ZYIA 5C0NC 5JXED 4DK6A 5DVKA 1A0QL 1QSFB 4NN6B 4HH9B 5F9OH 5DFVC 3UO1L 1T03H 3FL7A 3D18A 4Y4FB 3V6FA 5FYKH 2ZOLA 1NBQA 5LGJA 4HWBH 3BAEH 3MOBL 4YUEH 3U7YH 1EHAA 4Y19A 5D5MB 2Q3AA 4QOKE 5DMKA 2NX5D 3SKUD 1V8HA 3JUYA 1VFOA 4A6YB 1YPZA 4KY1H 1UWXK 4TTGA 1NFIB 4UV7H 2C5DC 1UJ3A 3QNXA 1Y6KR 3L9RB 1ACZA 4YDLC 2F54D 5F89B 5D2NE 5DO2C 4N68A 1AI1L 1ZTXH 1X4YA 3O6KH 2BDNH 3KLSA 2P24B 4LCCB 43CAA 2O61B 4HGMA 2DJUA 3I6KB 4HIJB 3H6JA 2P5WA 4CVZB 4LHUB 4RFEA 4OZHF 3RRQA 1RIHL 4LCUA 3DSFH 4AQ1B 5HYFA 1IGFH 4HBQA 1D9KD 2P45B 5FF6A 1Q9OB 2NY7H 4FXLA 4Y4HD 4BSWB 1T1YA 4M5ZH 5TE7H 4H25A 2GAZA 3QUXC 4JN2B 1N6VA 5HHVL 1RZJL 4MXVE 1ZGLA 4ELMA 1WBYA 2PW2A 4PJFB 3QRGL 2Y1VA 3QIWC 3PWUB 4WO4C 1WAAF 2EDBA 5KSAC 1MOEA 1S8DA 4XP4L 3SKMA 5C0ND 1K4CB 3RWCA 3JWDH 4ZDHB 4APQC 1GGBH 1ITCA 2CQVA 5E0QA 2W65A 3P9LB 1NLDH 5EO1A 2AV7A 3DVGB 4JLRB 4I18B 4Y1AE 1RZFL 1H8NA 3FO1B 5DFVD 4X7FC 5LCVH 1XH3A 4KMQA 2KDGA 3WFCL 2HJKB 1IKNC 3LQZA 3ZDYE 2XG4A 1XFPA 5IBUB 4S2SB 2HLFC 2HG5A 1BEYH 1DANU 5C7XL 2YPKB 1SHMA 4JFDD 4QRPD 4MDJA 3BPCB 3WHE0 3F62A 1TJGH 4Q9RL 4TNWF 3WO3B 4J3WA 3EYUH 4XP9H 1TMCB 5IJVB 4FQCL 2J8OA 5DO2D 3DUSA 4LF3B 3RIAF 4W81A 3VFWA 4PS4H 4S1QL 5EUOB 4JZNA 3LN4B 2BRRH 4CJ1A 3AAZA 1HILA 4FZ8H 4MLSA 5CBAB 3DRTB 3MBEB 2X1OA 3MV8D 3J7HA 3L5XL 1TCMA 3HC3H 4KROB 1ZA6B 4H1LG 1GGCH 5DWUH 3QUXD 2FCBA 3QNZB 3RPIB 4KTDH 4Z7OF 3VDAA 2A6IA 4K3DH 5IROA 4YJZL 3VXPA 5IWLC 3QIWD 5FECB 4QNPE 2BSTB 1KG0A 4W70A 5GJTH 4NQEA 4WO4D 5KSAD 2HVKA 2NCMA 4J1UA 5FUOL 2FGWH 3VG0L 4GUPB 4GXUN 5KN5A 4APQD 4I3GA 1E27B 4PTUA 4ORZC 2VLLB 5ID1B 3O3EB 4AEHH 2AKRB 4GRWH 4XPHL 1SEQH 5HDLA 3UTPE 4BK4A 1RZ7H 3W39B 5IGXL 3QPXL 1H15B 4CW1A 3EDDA 5FO8B 4WTZG 1B4RA 1VDGA 2O93L 2XI9A 4GAYA 5C0IA 5KG9B 5J6HB 3ILPB 4QRQA 4X99A 4ZOAA 3MYZA 2R4SL 3OHXA 5CZVH 1FP5A 4HMEA 4NNYA 1I9JL 1ZEAH 2HLFD 5IMLB 2BJML 2JIXA 5FGRA 5B39A 1E4KA 5BRZA 3HRZB 4CMHC 1Y18A 1U8NB 1D5IH 1GXEA 3OPZH 3F5WB 2MHAB 3WNNA 2X4OA 3MYJB 4LEXL 4WIQA 4P2OB 4FFZL 3UJIH 3V0AC 3HCVB 3BW9B 1OCWH 1U8KB 5TPWL 4M9PA 1MREH 1PKQE 1AXTL 4TUJB 3EYSH 1R5VB 3TA3B 2UZIL 5CSGA 5HYSB 1YMMA 4BFEA 2BCKA 1T4KA 5H8DA 1ORQA 4NRYB 4NRXA 4MVBC 2OLDA 1M71A 2IPTL 2FZ3A 4LSSH 4P57B 4N1CA 2VLRD 2UZYB 3TJEL 5KW9H 5EBWA 3ET9F 1IGTA 3EO1A 4LSRL 4X4YA 1CE6A 4GG6E 5CEZD 4YHKH 2CGRH 1SJEB 4H5SA 1NC2B 4JRYD 1BOYA 5ERWB 2E9BA 4M3JA 4WUUD 1JHKL 1L4IA 1AQKL 1NCDH 5B8CA 4FP8H 3GSRA 3KNBA 1KLGA 5CP3H 2OQJA 1OSZB 4WFED 1UXWB 4WI7A 4GRWE 5JNYA 4M6OH 4PRHD 5L88L 3AFLA 3MGOB 3MODH 1FCCA 4LCYA 4RMSA 4Z78B 1BJ1H 2HLAA 3JV6B 3ZT6A 1A6TA 2CXGA 2ITCA 1UM6L 5FYJH 5ACZA 3HUJF 4HUVB 1EHXA 5AWNH 3MCG1 3WIHH 3GMMB 1NCAH 3MLTA 2AABH 3GK8L 3B9KC 1LP9B 4IIQC 1GCFA 2BFVH 1QVOA 4PRID 4MJ6A 3U46A 4ZSOE 4HK3J 3C5JA 3OR6A 2RCSL 5CINL 4C56D 3CDGB 2C4XA 5KSUB 4UT9L 3B9VA 4BH8B 2WM0A 4JZJB 1QKZL 3TZVB 2P1YA 1P4BH 1QSFE 1XCQA 3Q48A 1VADA 3GRWA 2EXWC 4OTXH 3WHE1 2HKHH 4MVBD 3CFBB 3F6LA 4NZTL 1ZV5A 1MIEL 1XF5B 4AMKL 3EYOA 3WMSA 3N0PB 3BRDA 3TYGL 3D25A 4U1JB 4NQUA 2R1XA 3GBNL 3N50A 1QUNA 3TBWA 4PJIE 1S3KH 1DLHA 2I60H 2FWOB 5D5ME 4XBGA 4KUZH 5ICXB 2O5YH 3S5LA 3GSQA 3IJHB 2P8PB 3WIFA 1JWSB 1YEFH 5DUPL 5GGUA 3V52H 2NY2B 1KEMH 4OCXH 4XVSH 4LBEB 5TQ2H 4EKXA 5E6IB 2E6JA 5D70H 1NCBL 1J87A 1TPXC 5IMMA 2OTWA 1RJLB 3RIFK 1U95B 3D2UA 2HKFH 2HVJB 4K2UL 4DN4L 1P53A 2OL3A 5HHOB 1QRNA 2VTFA 3LPWA 5EN2B 4NZRH 5GRUL 1OHQA 4RAVA 3UZEA 4F9PA 4XWGH 5IB5B 1AGEA 3MV9A 1F6AB 3PWVB 1LD9A 5FYJE 3SDDB 5C0FB 1BX2A 3B9KD 3CXHJ 4HIXH 2PNDA 4LLQB 2N7AA 5IW6A 1JK8A 3CC5A 5CD3A 4CDGC 4UT7L 4XZUB 2VH5L 4OLZL 4G9FD 2VR4A 3HI6H 4MCZB 1JNLL 4IRZL 2GQHA 1OM3L 5GS1A 3EFDL 5INDA 5IBTL 4LCWB 5EU6B 3IDXL 4F9LA 5CJXC 4Z7NF 5J12C 5I66A 2EXWD 4BZ2H 3HA0A 1LO2H 2O26U 3REWA 3STZB 1A9BA 4I2XE 3BVNB 1N6QL 4PLKC 1CDJA 1Q72H 5JHLL 2VL4A 2RR3A 4YGVB 4XCFH 3VH8A 5JMRA 3FOMB 1J05B 1ADQA 5AUMB 3S37X 3KPSB 4GRMB 1K6QL 1UGNA 4XPAL 1OAXH 5K9JL 1QHOA 3THML 4N5UA 3JSSA 3MFGB 2YD3A 3QCTH 2GTZB 4GLRI 2EDYA 4GQ9L 3U1SL 1E4JA 5EUOE 5KSVA 3LDBC 1HINH 1CFSA 4L9LC 3CZFA 1AC0A 4HEPG 4LARH 5I1AA 4MJIA 1PZ5A 1U92B 3N1PC 3ILQC 1JTOA 1A7PL 3SQBA 3VGAB 3RA7L 3U30B 4S1RL 5BV7C 5GRYA 4Z7VB 4RGOH 2J5LB 4LL9A 4M3KB 4Y2OA 4M93B 3R06B 5I75B 5D2NC 1WCBB 4EDXA 4MNQB 4E41B 3BP7B 2UUDK 2IANB 3U9UA 4NHCH 5CCKL 1IEHA 3RL1B 3O81A 4JFFA 5EIIA 1KC5L 3VFGL 1JE6A 3LKNB 5J57B 3MCKB 1YC7A 3PV6A 3ZTJG 4X5XB 3SGKA 4JY4B 5M7QA 3RGHA 3CVHB 3NPSB 4QHUA 4PLKD 4ETQB 1P7QD 4OFVA 4Y4KA 3QULB 4JDVB 1KBGH 3BKYL 4G8IB 3ZKMC 4KRMB 4ZUSB 1BLNB 1RUKL 1N4XH 4YBLC 1E6JH 2BVPA 1MFEL 2OSLA 4Q6IC 2MOVA 4P48A 4ZUVA 2X10A 4YXKH 1ERNA 3RWGA 1ZHKB 2NY5H 4I77H 1J8HA 3D39E 3MNZB 1YEKH 5HHMB 43C9B 3T1FB 1C16B 1FRGL 2CDGB 4JGMA 4F7EA 4KAQH 4HKZA 2OMBA 3GIVA 1FGNH 4FTVB 3S37H 1BZ7A 5DTFA 1T0MA 1U3YA 5HXMA 4S0SD 5MHSD 3AY4A 5KANG 3JV4B 4RAUB 1FH5H 1TZHB 5CEXA 2VDKH 2MSPA 5EBLA 3MA7B 4QOKD 1E4XH 3ILQD 4ZUTA 3RZCC 1UZ8A 3BP5A 3GMRB 5IK3B 4N1EA 4MD4B 4IDLA 1CTOA 4JHAL 1IGYA 3ECBA 5I8CA 4IRJA 3UTSA 4QRRD 4G6FB 2BVTA 1CYGA 1QFWM 4O02L 3DO3A 4YPGB 4XMLH 3NCJL 5L7XH 4IJ3C 2WBWB 1B0GA 4JKLA 1M7DB 3TNMB 1MQKH 1UA6H 4PJCB 5DD1L 1FNEA 3HI1B 3I6LE 4NQXA 3RKPA 3HPLB 1HEZB 2WZPD 4GMTH 3U0WH 5HDBF 1WWWX 2X4PB 1NFDB 5IFJA 3NABL 5JORB 1T5XB 1EEZB 3QDGA 4XRCA 4WI8A 1ONQA 2ITDA 3X3FH 2GJ6A 2X4RA 4CAGA 3UYOD 3WLWC 3VFOA 1ZGLP 1U3JA 2WWKT 3C5ZB 4KPHH 4NO3A 3ZKMD 1GGIL 4CNIA 3CFCH 1JGDA 4LPVA 4NYLA 4WI4A 4EDWH 4OZGA 4YDKL 1U2CA 4WV1C 1LP9E 5DJZB 1KJ3L 2OJZH 1QFPA 4HUKB 1ZHLB 2IMMA 3LKOA 3C8KB 3K74B 2BNQA 2YA2A 2VZSA 3FQNA 2DQIH 4HD9A 4WI5A 1X6LA 3VXUD 4D0CB 4O58L 4M61A 3MLPA 2ZSWB 1DTUA 4D94A 5CBEA 5ISZB 1IM9B 1NGQL 1GPOL 4MA8L 3RWJB 4TUKH 3D0VA 5KS9F 2FJHA 3CGTA 3LN9A 5CJ5A 3RZCD 3MOAL 3IXTB 4I3SL 4ONHB 3LKSA 3T0VA 5AYUH 1KCKA 1QSEA 2PYEA 1CFVL 5D72L 2P5EB 2V9QA 3QDAA 3QXAB 2DICA 5F7KC 3RY6C 3T1WA 1ZGLM 2Z4QB 3CMGA 1I7RA 4M02A 1PEZA 3QWOA 1BVKB 5KVGH 1S5HB 5ETUB 4ETYA 3KPMB 2V9TA 1VGEH 3NACH 3FQXB 3ROLB 4JZOB 3RVUC 1AE6H 3M07A 5F7YC 5C08B 3KLDA 5F97E 2FX8H 4I48A 1A2YB 3WLWD 4F15C 4NKDA 4BUGA 1H8SA 3VGEA 1G9NH 5EORL 5C8JB 5HHOE 2P47B 3GJFB 3GMQB 4LEOB 4M48H 2RFXB 5FO9A 3TCLB 3GMNB 1RIVL 3LKRB 4XGZA 1TVBA 1NMCB 1DL7L 5ADOH 2OP4L 3O3UN 3C08L 4TPRL 3OX8B 4GMSH 4JANB 3UTPD 2W60B 4RWYH 1U8OA 3U2SA 4LSPL 2AK1H 2BOBA 3O6MH 2MNUA 3SN6N 1AGFA 2P4AB 5A2LH 3X14B 4BFIA 3BI9X 4PJXF 5EU6E 1T0NB 3SKOA 1B88A 2DQHL 3CVHH 4DKFH 2EO1A 1FAIL 4OB5H 3OR7B 1VEPA 4KRPC 3IS1X 4LSVH 4O2CA 2FATL 4RSVA 1CL7H 1CLZL 1RZIB 3HI5L 1IT9H 4D8PB