4ONGH

Fab fragment of 3d6 in complex with amyloid beta 1-40
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
210
Chain Sequence
EVKLVESGGGLVKPGASLKLSCAASGFTFSNYGMSWVRQNSDKRLEWVASIRSGGGRTYYSDNVKGRFTISRENAKNTLYLQMSSLKSEDTALYYCVRYDSGSSDYWGQGTTVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 3D6 FAB ANTIBODY HEAVY CHAIN
publication title Crystal structure reveals conservation of amyloid-beta conformation recognized by 3D6 following humanization to bapineuzumab.
pubmed doi rcsb
source organism Mus musculus
total genus 45
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2014-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ongH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ongH01
1WZ1L 3FOMA 1I8MB 1H3UA 4ETQB 1DLHB 5F7YC 2AXGB 4JQXC 4XPBH 1YMMA 5EZJB 4YXHH 4KZDH 1KC5H 1MCNA 1A3RL 3V4UH 5IB4A 4NNPH 4ZFFA 3PL6D 1I8IA 4TVPL 4JFFA 2G60H 1JUFA 3BQUB 4NZUH 5EU3B 1HHKB 4YR6A 2FJHA 2XN9B 3VXUA 1HI6B 4D0BB 2IMNA 3G6JB 2ZOLA 4KJWC 5FHAL 3UBXG 3VGFA 5I76A 3S3PA 5F7WC 1FYHB 2IPUG 2NY3C 5JDSB 5JOPD 4RAVB 1PKQB 5LG1A 1CGSL 3QDMD 1WWBX 3FCTA 1J8KA 1N2RB 3Q1SL 5FGCE 2ZUQC 4QXUH 4EN3A 5L2KE 2J8OA 4GSDL 1OWWA 1SHMA 1CFBA 3KJ6L 5I1DB 3C09B 1NGYA 3GIVA 2HKFH 3LN4A 1WZLA 2DIAA 4UAOB 1MFEL 4ODSL 2NLJA 5DFVC 5D1XB 5IHBA 4OLUL 3MGAA 3S96B 4J6RL 2EYRB 2JCCA 2DI8A 1W72B 4JDVA 4DZBA 3GSOB 1ADQH 5C07D 1E4XL 3GBML 2EDYA 4E41E 4F7CB 2D7QA 4LSUL 5IT2L 2FD6L 1VGKB 5EBMA 5FA3A 5C09E 5LCVL 4OTXL 1U8OB 5SWQA 4G8IB 5D1QB 3D39D 1F90L 5AWNH 2J6EA 5C2UB 3ULUL 1CXKA 4E9LA 2P8LA 4I3SH 5EZJA 5K93A 4GXUM 4LP5A 3LSOA 4HWUA 4OCYH 4UNVA 1OARL 3OB8A 3TBSA 1K4DA 1NAMH 4ONGH 1A1OB 4XP6L 5CJBA 2Y07L 3C60A 4J3SA 5HYJE 4HUVA 1MREH 5EU3A 3RY4A 5J1TC 4HLZG 2VLRB 3VW3H 1N6UA 3G6JA 5HHXL 4G9FD 4NT6A 1A47A 1KF9B 1MJ8L 2Y9RT 1CU4L 3U0PB 5JDSA 5F97E 4RAVA 2J8UF 5IVZA 4K8RD 3WD5H 4AJ0A 1R5IA 1EO8H 2DQJL 3L7EB 3AREC 3AGVA 1N2RA 1AGCA 5T3XH 4YHLL 1T22A 3BKCL 4G80B 1BQUA 3MV9B 2HKHL 3BAEH 2VXQL 3X11A 2H32A 3F58H 1Z2KA 2FJGB 3BGFC 4LMQE 1YY8A 4X80H 2IQ9L 2EDTA 4MWFB 4Y16B 5EA0L 4XC3H 3G5ZB 3IDGB 4L8BB 4Z0XB 3L3IB 1Q9KB 3X14A 4XCNB 3QDHA 1W72A 4NKOB 5HVWA 5GJTH 4H0HB 3GSOA 1FP5A 2PYEE 2UZIL 1ZHLB 4Z5RA 5HI4D 4RRPA 1ORQA 2FJFA 5J12B 3I6KB 2F5BL 2XFXB 2DI9A 4F7CA 2I07B 4FQXD 2FECI 3BD3A 3QYCA 4TNWK 1UZ6F 1Y6MR 3W2DL 2FO1A 4P23D 4S1SL 2NCMA 3D9AH 4PG2C 1EHLL 4EDWH 4D3CH 4GXVL 3MBED 2P42B 2C3HA 5LAXA 2GHWB 1ZS8B 4UV7L 1NUGA 1FV1B 2ZUTA 2C5DC 3K74B 2ZKHL 4JHWL 2OTWA 3AB0B 4X98B 3C8KA 2VLRA 1U93B 1UQSA 3P40A 4HUNB 5GS2D 4L8DB 4Z78A 4NKDB 4RMSA 4M6NH 3MGOA 4UT9L 3TYFB 5EWIL 4K8RC 1VDGA 3O9WB 5CSGA 3D3VB 1D6EB 2CDEB 1U8KA 4F33A 3G6AA 3DX6B 3VWKD 4P9HH 1QACA 4LBEB 5DVMA 4ZO7A 5LBSH 4G80A 3GI8H 3GSQB 3MV9A 3PUCA 4UIKL 1H9VA 5GS1C 3CPLB 2Z4QB 4PJIF 1OPGH 4WI5A 4WU7B 2FJGA 5JOPE 4BQ9A 4MWFA 1DSFH 3SDYL 3QDME 1N59B 4F8QA 2AJXL 1UKSA 3LKNB 3IDGA 5T33H 4CW1B 4PGBB 4X7CC 1KCSL 4QOKD 1I3RB 1Q9KA 1PEWA 5INCB 3U6RB 4RMUA 3N1FC 3D25B 2GK0B 4LPUA 2WUBH 1ZHLA 4FTVD 3C5ZB 5F1IA 3IVKB 3O4OB 2XFXA 5IMKB 4FQXC 4G3YH 1DCLA 5EORL 3D0VA 3U4BL 5C0IB 1WIPA 4P23C 5FM5O 2DLTA 4PRIB 3KYOA 1FFOB 4L4VA 5C07E 3MBEC 3F6LA 4N90E 4TQEL 1AD0B 1ZS8A 3UBXI 3OKKA 3VFNA 4KU1A 5HHOD 4MX7B 2BMKA 3LMJH 3GSRB 4ZDHB 2BY0A 3D39E 1U93A 1NFDB 1T6WA 5H2BB 2FIRT 3SJVA 1KNOA 2V7NB 4NKDA 4ODVH 3M1BA 1Z3GH 2R69L 3BKML 3O9WA 3U7WH 1QFWL 5HHVH 4WFHD 1D6EA 4HULB 2CDEA 4RA0C 3DX6A 3FQRB 4S11A 4PRBB 2NY4B 2OX5A 1X6LA 4IHOA 1EBPA 4PJ7F 5GRJL 4HWZA 4TUOA 2AQ1A 3S88L 4G9FE 4MB3A 4XVTH 5IROC 2JELH 3BZFB 4WU7A 4XP9L 2W0LA 3HI1A 1KTLA 3L5WA 5GGTA 2P24A 1N59A 5I30H 5AEAA 1HZHH 1FNFA 3MRDA 1GGYA 4MNGB 4PGBA 2FO4B 4HIHB 5FYJU 1T04B 3CFCH 3U6RA 5D6DC 4PFEA 4XNUL 3OXSB 3O4LD 4R2GD 4J3XA 5ADPH 5DK2A 3MC0A 3NZHL 3O6KH 3ZTNL 1KPVB 3IVKA 1ZHBA 3IDXL 3EDKA 2CD0A 2ENYA 5C0IA 2N7AA 4L9LC 1A9EB 4U6VH 3E1F1 3G9AB 3LPGA 4LVOC 4Y4KB 5C0FB 5GJSH 3C6LA 3GSUB 2AEWA 1V05A 5EU7C 3W39A 1GGUA 5EC1B 3QIUD 5DJ8B 4KDTA 2DLHA 3FQXA 2GY5A 4NDMA 4X6DB 5HHNB 4XAWL 1KEML 1QO3A 5EO1B 5D4QA 3BDXA 3TBWB 2DQDH 3GSRA 3IGAB 2A6KA 2BSED 5D7JA 4ZTOH 1SMAA 1UCTA 4XNQA 4G7YL 4HK3J 5F9WC 4QO1A 4PP2A 1RZJL 4DEPB 4U1NB 2AXJA 3ZDXF 2E7LC 1G6VK 3ARFB 1A6WL 3VI4E 1WK0A 4PRBA 4G6FB 5EZOH 1QBAA 4U1HA 1FL3A 4Q0XL 2AEIT 1H3PL 4HKBB 3K81A 1A4JA 2YRPA 4HD9A 4MA7H 3LKRB 3J8F7 1J0IA 1KB5L 4KVNL 3BZFA 3DIFA 4WEMB 2IG2H 4OCRH 1SMOA 2AI0H 4RMWA 1BHGA 4G8GB 5LWYH 5E24E 1NEZB 1QSFD 3PQYA 1W8OA 4MNGA 4TSCL 1DFBL 1XCQB 4OZIE 4R2GC 1YN6B 3OPZL 3CVIH 3ZE2E 5JHLH 1AFVL 3PIQB 2BZDA 1IGTA 1KN2L 5B38B 4WO4C 1A22B 4YHML 4HHAB 4PR5A 3T3PE 2AS5M 1I9JH 5DRZB 3KLAA 1A9EA 3IFLL 4QOKE 4Y4KA 3MRFB 5JIKA 2ICWA 1LK2B 1MCCA 3GSUA 3QIUC 4XMLH 1OTSD 3IS1X 4WEUD 2R0WH 5I8OH 3HS0A 5DJ8A 4FTVE 3EYUH 3DV6A 3NA9L 3Q5OA 5LVEA 3O3BB 2IJ0C 3OZ9L 1UXSB 5EO1A 3HRZB 4Q9QL 3EDEA 4R9HA 4JFOB 4ZO9A 3MUJA 5IFHL 4OT1H 2C4XA 1FYTA 4OLYL 2VTFA 2A6JA 3CDGB 4JG1L 4HBCL 5CJXA 3KHQA 2R0ZH 3LVEA 5C0EB 2UWEF 1KYOK 4NRYB 3QXWA 2VAAB 2ZCHH 5FYLH 5HHOE 5HY9A 1VGEH 3ARFA 2HJKA 4XCEB 1U95A 3P0YH 1BF8A 3LKRA 2DJUA 1G9NL 1JPST 1E4KC 1KEGH 1MI5D 4WFHE 2MCG1 3IFPB 4JJHA 3F7PC 2GJZA 1CD1B 1UH4A 1OGAB 4RGMC 3MV7B 5E7FA 3LQAL 1NEZA 5ALBH 5JQ6H 1YEGH 5DT1H 2J88L 1NCDL 4ZOEA 2X41A 1NCBH 1YN6A 5D7IF 1C08B 4WV1C 3QQNA 4ONOA 1N5YL 2L7UA 1T7ZA 1KJ3L 1PDKA 4KKNA 1EVUA 3I75B 2AK1H 3LH2L 3OR6A 1IT9H 4HHAA 3WEXA 3DJ9A 1INDH 5I1CL 4Z0BH 5I16B 3JUYA 3R1GH 1A5FL 1OTSC 3HMXH 5I19H 1LK2A 4DTGH 1IL1B 3O4LE 4OM1L 4DWHA 4R7NB 4JFQB 2XZAH 5C2BL 5L0QB 1E4XI 4FQHB 3O3BA 5KJRL 1FNSH 2NW3B 1Z9LA 3BD4A 4WDIA 1GC1L 1IGFH 3C5JA 5D2NE 1SYVB 2CKNA 4HMDA 1N8ZB 1DQMH 4BELD 4CVWA 2R4SH 1YPZB 2NX5D 3QHFL 1JJUA 3CDGA 4QYOA 4KUCF 3KPSB 2MQCA 4H0GA 2GJ6A 5TE7H 3RDTB 3PWLB 1G6RL 1UM5H 5E03A 4R4FL 1Z0MA 3V5DA 4F9LC 4OD1H 2J8UE 1T0NA 3KYAA 4PRPA 1DUZA 4XCEA 2HJLA 3MFFA 4AMKH 1OAKH 3BPNC 1WJ3A 3ZKXC 4P48A 3JWNC 5TPWL 2EDEA 2JIXD 1F4HA 3IFPA 4NNYB 3A6CH 1S7TA 3P4MB 1ONQB 4OZHF 1D9KA 1U3ZA 3QEHB 3UP1A 3H6JA 4JY5L 5GSVB 1SYSB 4MB5A 3ARRA 3VFPA 1T7WA 1N0XL 3VG9B 4YHKH 1C08A 1JF6A 1NGQH 4GKSA 1CIUA 3I75A 4JO3L 4EI6A 1FNEA 5DK0B 1WC7B 5K9OB 2CKBL 5DDHA 1PX3A 5MEND 2XZCH 5ID0B 5I16A 1QSFE 1WF5A 1KTDB 3L1OL 2BY3A 4LAQH 3ARSA 1UZ6E 5CAYB 3U82B 2NQCA 1OAYL 4FZ8L 3SKJH 4WUUD 4FQHA 3NZ8B 3X13A 1K8IB 3QCTL 2WBJA 5CEZL 2IADB 1W0WB 4KQ4H 4NQEA 3KPRD 1P6FA 4G6KL 5DEGA 4KTDH 4HFWB 3OJDB 4RIRA 1T7VA 2Y4SA 3KPSA 3WLBA 3DWTA 3TO2B 2N56A 4O58L 3PWLA 4OCSH 4KK6D 3UTQB 2XQBL 2OTPA 3KPLB 1JPGA 4HWBA 3EO9L 2P8PB 2VLKA 4OUUA 5IBTH 1CZ8L 1ZWIA 2Q76B 3ULVF 4AEEA 2D03L 4U0QB 2Q3AA 1J18A 4X4MA 3T0XA 3W0WB 2IQAA 2P1YA 4PJIE 4NNYA 1J1OL 4MVBC 1PG7W 4YHPA 4JY4A 5KSBF 5GSVA 4GQ9L 2HFTA 4YDIL 1PSKH 4U49A 5ACZB 4J3TA 1AE6L 3TH3T 1MI5E 3UDWC 5DK0A 3ZE1F 2NNAB 1WC7A 1UFUA 2E27H 2N7BA 4K7PL 4JREB 4YDVA 5ID0A 3IDUA 1HDMB 4ZAKA 3RL1B 5BMFL 1N64L 1P4IH 3GO1L 3KPPA 3TVMA 1D5XB 1VEPA 4N9GA 3CFKA 1JN6B 3VRIB 1QP1A 4ZD3L 2VWEC 1YEDA 2IADA 1W0WA 1J88A 2BC4A 2VQUA 4ZUUB 1NC4B 3BOVA 43C9B 4F57H 3RX5A 1A8JH 4ALAH 2IMMA 5EG6C 4NQCB 1EFQA 2YKLL 4Y5XB 5D93C 5LQBH 3WN5A 3GJFK 5EFIB 1XAUA 4Y1AB 1YDPB 3VH8G 2P8PA 2QSCH 2Q76A 2NX5E 3IJSA 43CAB 2Y5TB 4U1GB 2OQJA 4GRWH 2FB4L 2KQNA 4PJ7E 4MD4A 1EEYA 1MRFH 1K3ZA 2DKUA 4J3VA 4ODXA 4R7DA 4YDLB 4M7ZB 4FXKB 4EDXA 1QFWI 3S4SG 1CFTA 2AJZA 3T8XB 3O11B 5HGAB 4WFGE 3HA0A 2H1PH 5TF1H 1EFXD 5F7FA 3V6ZB 5IIEB 1QLEH 1U3HC 1V7MH 5F1OB 1EBAA 1C7TA 1S7SB 1ZLSH 1DBKL 1T3FB 4L8SB 3MUGB 1OT2A 2AJ3B 4GS7C 4JZOB 3MLUH 2MKWA 5CINL 3I6LD 4S1RH 1CLCA 1D5XA 5EZLB 4ZXBD 4U1JB 1JN6A 5AYUH 1FE8L 2VN7A 4LLUB 1A7BA 2HJFB 4IRJA 4MZ3A 5F1NB 1DANT 1Q1JL 3CZFB 4EOWH 4JZNB 2HT3D 5IJKA 2I25N 5L88L 4X6BB 1NAMA 3CFEA 4ZUUA 5CEYB 1IAIL 4K23L 4N1EA 5EIIB 4NQCA 3SO5A 2WANA 3HB3D 4WUUE 4OV6F 3FO2B 1T03L 1P7QB 2VWEE 3GMOB 3QRGL 3KPRE 1S9XB 3ZDXE 3GKWL 2CMRH 43CAA 3MREB 1R24B 5KAQF 4NWTH 4LU5H 1MCLA 4JRXD 3D18A 1RK0A 3A6BL 2QR0B 4P2OB 1X5IA 3VFRB 2FX8H 3OWEA 1D5MA 2IH1B 1ZK9A 3QFDB 5BQ7A 1QSEA 4OKVB 1RZ8A 1FNAA 3H9YA 4FN0A 5BOZG 1GVIA 1QR4A 5HGAA 3TZVB 3VMPA 1AGBB 1CLZL 1GGCL 4E42B 5TGBA 3V6ZA 2DLEA 4MJIB 2ICEB 4WI7A 3HI6L 1I7RB 2E8ZA 5FGSA 1JTOA 5C9JB 2MQ0A 2IGFL 4N0UA 4WJ5B 5D5MB 3MUGA 2V5MA 4LMQI 3ARTA 2I5YH 3D85D 3SKMB 1CLOH 3BDBA 4UTBL 5E9DB 4BQCA 4MNHB 5FYKH 3QG6B 4E0RB 2AQ2A 4QXTB 3GBNL 2RJMA 1SM3L 5EZLA 3TWCH 3ESVF 4GG6A 4CVZA 1B2WH 3QQ3B 3V4VH 5AG9A 4MXWL 4RQQB 1OB1B 2HJFA 5I1LA 2HT3C 5F1NA 4WY7H 1K5NA 1YQ2A 4X6BA 5E2UH 2YUVA 1A6TB 2Y06L 5CEYA 5EPMB 3HB3C 4Z7OF 4ODHH 5GISH 3ULVD 1AKJD 4QRRD 5J1AA 1CF8H 3H7BB 1FSKC 1S7VA 3GMOA 3V7AG 1S9XA 3ARDD 5JA9A 4JHZA 4TPRL 1MFNA 3LDBB 1R24A 2ESVD 1E6OH 1UACH 1SJHB 2C1OB 4HH9A 3WL9B 2QR0A 4P2OA 1FRGH 4Y7MA 4CMMB 4GLRI 3L3JA 2X4QB 4KTYA 4NWUL 4Y19B 1P84K 4GAJH 3L6FB 2EDFA 4S2SA 2VC2H 2CR3A 4IDLA 4MAUL 1RJCA 4E42A 4NO0D 4EUPG 1RJYB 3P3YA 1TETL 2LAAA 2GTWB 1QEWA 5CSZB 3ZDYE 1Q0XL 5D7IE 5C9JA 1XGYL 5D5MA 4WJ5A 4NQUA 1BM3H 4R4ND 1HSBB 4TYUA 3NFNB 3T04D 3PWNB 4MNHA 2HLAB 2YA0A 2PTTB 5FGCB 4GXUN 1S7WB 3L3KB 4K3DL 3DSNA 2WW8A 4KKAD 3I6GB 2WLYA 2C9AA 3T65B 3MJ9H 4I0PB 1EV2E 2VXSL 3QQ3A 1HQ4B 3FRUB 4YBLB 2UZXB 2IFFH 3IDMB 4RQQA 4AQOA 1ES0B 4TTDD 3CC5B 1CGUA 4WEBH 2GSIA 3C2AH 3V6OC 3I6LE 4UIMB 2IANB 3TBYB 5T3ZE 1A6TA 5BV7C 1UB6A 3ULVC 3L3HA 1CFSB 3AMLA 3JZ7A 2GK2A 1QVOA 1HH6A 4E41B 5SX5H 2OI9C 4LHUG 3WFCL 3H7BA 5IW3A 4W4OA 1MELA 4JFDB 4ZNCD 4XP1L 2ED8A 3ARDC 2DLGA 3AXLB 4MNQB 5C09B 2F8OA 3GSWB 4LLVB 3DMMC 2X4PB 3VXOB 1BREA 3JTTB 2WBWB 2C1OA 3WL9A 4NN7B 3WXVL 4CMMA 4ISVA 4UDUB 3U4AA 1ZSDB 3V5HB 1S78D 3B2VH 3SQBA 4Y19A 3MRLB 3QG7H 3IFNH 5LJYH 4DCQB 3SBWA 3QCVH 2UYLB 4OZHE 4V1DA 4NM8L 4XP5H 5KSAB 1ZA6B 4JRXE 1J0KA 1MF2H 2CDGB 1BOGA 4M9PA 5CSZA 4XGZB 3BZEA 2AGJL 3HI5L 4R4NC 4NQDD 4H5SA 4D2NA 1RHHB 3NFNA 5DJ0B 3PWNA 1QSZA 4MDIB 5ERWA 1JNNL 2PTTA 3NIDF 1QFOA 2ZG3A 3V2AR 1S7WA 3L3KA 1N5AA 4KKAC 5SWZD 1F2QA 3QUMB 3AU1B 5EC2A 2Q7NA 1XF5A 4M5ZH 4MQ7A 2ZUYA 4OQTL 4TTDC 1CDHA 5GGSB 5J13C 4YHZH 3IDMA 4XNXL 3CC5A 4JPVL 5J89A 5HYQA 4YIQA 2IANA 3GJEA 5DC4B 5DR5H 4ERSL 4IIQC 4Y5YC 4PTUB 5DRWB 4EVNB 4ELMB 3AXLA 4MNQA 5B39B 3BRFA 1UG9A 3CXDH 3MLZL 4HUUB 4HUWB 3V6OE 3VXOA 4Z7WF 2WK2A 2NXYB 4NQSA 4QHUB 3ULVE 2BNUB 1K8DB 3GM0A 4ELKB 1S78C 1ZSDA 3HPLB 4ZTPL 1QA9B 1NMBH 4BFIB 2CRMA 5B22A 3LD8B 1LE5B 2YD1A 5CIPH 2ESVE 2Q7YB 1CGYA 2UYLA 4IRSA 5JIPA 5LGKA 3TCLB 1XF4B 1FG2B 1EPFA 4UBDD 4HEPG 3SN6N 1BFTA 3GRWH 4XGZA 3PL6B 1U92B 2PTUA 4MMXC 4TSBH 1HHJA 2A38A 3VXTB 1RHHA 5DJ0A 1JPFB 1UYWL 3ZE1E 3FQUB 4X99B 4F80A 1LILA 3AY4C 1LO0H 1BGXH 3OL2A 4U6TA 3QAZC 2O5XH 3E6HB 3UO1L 4HF5L 1BECA 3DUHA 1WWAX 1YEEL 2B39A 4QWWC 3RI5K 3V79C 3P73B 4OD3H 2OL3L 5E8DL 2RQ8A 4JG0L 5T1LD 3UJIH 4YHYB 5E2JA 4LLDA 5ILTL 3MRRA 1S7QB 1DEEA 4XCFL 3RY6C 4G6AD 5E5RB 3TCXA 5F3HB 4M61B 4X9GA 1TFHA 5T5NF 1BJ1J 1CXEA 4OV5B 4JDZA 2R23B 2DWDA 1NUDA 4DFIA 4ELMA 3SKOB 1QLFB 5BVPL 1UJ3A 4M1DH 3FRPA 3G04B 4WI9A 3JSSA 4HUUA 2F53D 4DFHA 2EYSB 5J6HB 1Q9WB 1SJXA 1TJIL 3LEVL 1CDJA 3HPLA 3MLXH 4LPWA 4Y4HD 1LNUB 2XACC 4BFIA 1A0QH 4GRMA 1DE4A 4K7FA 4UBDC 1YEFH 3OSKA 3TCLA 1IC5L 1XF4A 2VIRB 5H35B 2VERN 3UTTD 1ZGLA 2VKWA 1U92A 4PRHD 1DN0A 3ALXA 2QADC 1MIML 4BFGA 1BP3B 4WWID 1KG0B 1RY7B 2EEAA 5E8NA 2EIBA 4NUGL 5LGJB 3QI9B 4KQ3H 3LKOB 4G9FB 3OXRB 1DZBA 1IKNC 4JO1H 4JJ5B 4QHMA 5EO0B 1NBVH 4XNMB 3VGBA 1GZPA 4MYWB 2IPKA 4LKCA 4YPJA 3IFOA 1FDLH 2M8XA 4NQDE 3P73A 3BUYA 3CFDA 3N1MC 5HGBA 3MO1B 4XWGL 3SCMB 4L5FH 1HEZA 1V3LA 4KDWA 4U6XB 5SWZE 3WHE1 2ZUVA 3P0GB 4G6AC 3LN9A 4WUKL 5FAAA 4MA1B 4PJ5A 4U1MB 2YPLA 4TVPH 4LLWB 5F3HA 5DJ6B 2D0HA 3SGJA 3S5LB 2V2TA 4OV5A 5B8CC 1X5XA 2R23A 1QTYT 3QWRD 3SKOA 4WNQB 4UOJA 1QLFA 3WDHA 3ZE0F 5I2IB 2V17L 3BP7A 1G9MH 1QKZL 3RBSA 4OJFH 2EYSA 3O8XC 1Q9WA 5J6HA 2OK0L 3EFDL 1CGSH 1IAII 2NY2D 2PW2A 2VZTA 3SKNB 4GT7A 4U3XA 4QF1B 3LN5B 3K1DA 3Q1SH 2CLRA 4KMTH 1W0VB 4L3AA 4TUKL 3FFCA 2CXGA 3ILPA 3LKPB 4P23B 4GSDH 8FABB 3RHWF 5TE6L 1MCFA 5DJYA 3MBEB 1R0AL 3T2NH 2VIRA 4PGDB 1MFEH 4ODSH 2DIJA 2CO7B 2C3VB 2HH0H 1F4WH 3I02B 3BP5B 1E4XH 5FV1L 1RZKC 4YQXH 3VG0L 4MCZA 1IKFL 3QI9A 4JJ5A 4RGOL 4F3FB 1QNZH 1UM4L 2QQNH 2FD6H 3BSZH 4F37F 3HC0B 4ZS7L 1QZ1A 5LCVH 2ZP0T 4LSVH 3VWKB 1U8IB 1WFUA 3MZGB 3KLHD 3VFVB 3U46B 3ZT7A 3QDJA 3BIKB 4HG4K 4U1MA 4B41A 4XP6H 2Y07H 2EDQA 4BZ1L 5HDQL 5A3ID 1EZVX 1WCQA 4Z7OE 1MWAL 4JM2F 1MNUL 2JJTC 4U7MA 4XI5D 3KXFD 4D8PA 4AIZB 4MD5B 4U2ZA 5CGMA 5INDA 5C0BA 2NY2C 5BV7L 3EGSB 3TA3D 4WIQA 5E95B 2WAHA 3H9SA 2AXFB 2F5AH 4YHLH 1B0RB 4FXLA 3BKCH 5KG9A 4LOUD 5DJZB 2XXCB 2HKHH 2VXQH 3UJTH 1WWCA 3L7FA 5BZWA 1A1NB 1JTPA 2Q1EA 2F53E 1KPRB 3PGCB 4JO4H 1N3NA 4NHUA 1LD9B 4PGDA 1T1ZB 1OGTB 4KY1H 2MTPA 4JY6B 4Z7VA 2C3VA 4PY7B 2ZSWB 3C5SA 5HJ3B 5HHPA 3I02A 3BP5A 2UZIH 4NCC2 1HXYA 2GTZB 1DEDA 1UA6L 2X7LA 1OT1A 4DKFL 4GFTB 2F5BH 2O5YL 4MQXD 1F97A 3U1SL 4BUHA 1J0JA 3OKOB 1FL6B 4JM4L 3W2DH 3KLHC 4PRHE 1F11B 1RZIB 2WMPA 2VMFA 3PGDB 6FABH 4GXVH 2A2QT 4NZJA 4DJMA 5GHWL 3FB7B 2XWTA 4UV7H 3U46A 1GL4B 4M9OA 4F58L 1YY9D 5IFAL 3BIKA 1DR9A 2LFGA 1T1YB 4X5WA 5A3IC 4UNUA 1LO5B 2OYPA 1MOEA 2ARJB 3O2WL 4M1CD 1D6VL 2AJSL 3SDAD 1BLNB 1HIML 4P9MH 3WJLC 3RWGB 4AYFA 5EWIH 1T5XA 2COQA 1ZVSA 2BP3A 2OR8A 4JFPA 5C70A 4LIQE 5DQ9A 3F8UB 3KPOA 2QSTA 4XNYL 4HK3N 2AXFA 1B0RA 3W81A 5D2NB 2MOVA 5DJZA 1EGJH 2FBJL 4YK4B 4UIKH 1A1NA 4HX1B 3KPMB 5D7KD 1X5HA 4NSKB 1KPRA 3L5HA 3PGCA 3GSXA 2LU7A 2NMSA 2FH8A 4XB7A 2AJXH 1T1ZA 5KS9A 5L7XH 1YNLL 3BPLC 1N7ML 4JY6A 3EFFA 1IARB 3CSPA 4BH8A 2P5WD 5BO1L 2ZSWA 2DBLL 4OIIH 1BJMA 1HYRC 5TDOB 2DL9A 3PWPA 2QV2A 2DQUL 4PTTB 2B5IC 4Q9RL 4RWHA 4QT5B 1S3KL 5FGBA 3C9NA 5EULV 4RRPG 2VXTL 4FMKA 4GRLD 1NBYA 5DD6A 5EORH 3NIDE 5FUZL 3O0RL 3QUZD 5CEXA 2XNAA 3W9DB 2VDRH 4B53A 2X40A 4DKAA 3VXMA 4IRZH 2KZWA 4XPHH 3FB8B 5MP6L 5FHBL 1RZIA 4HWNA 3X3FL 2E9JA 3PGDA 3UZVB 4KUZL 3JV4A 2PR4L 3E2HB 2HFEB 2AK4B 5CCKL 5CJOL 5I9QB 4JFEB 4D9LH 3IETB 4JPIB 3UPCA 5DS8A 1T66C 1LO5A 4M48H 4M1CC 1GZQB 2YXFA 3SDAC 1YECH 1QSFB 3BHBA 4R90L 1BLNA 3BN9D 5IGXL 3RWGA 3GMPB 2QJDA 4OZ4B 4UTAL 3BKMH 2P44B 3TF7C 4ZNEA 1BX2B 1QFWH 5J8OA 3K4DA 2FX9H 1MCRA 2FX7H 2R0LL 4Z7WE 4PPTA 3JV5A 2HA1A 4LASL 3VGHA 5CBEB 1RZFH 3IXTB 5GRJH 3S88H 5J6GB 4I2XE 3GHEH 2AEPH 3NCEB 3KXFE 4LNVA 4EI5B 1EEQA 2P46B 4ZPTB 4HX1A 4KKBD 3KPMA 3R06A 2D3VA 4RGNC 3O3EA 1DDHB 1A7QH 1UKQA 3IDIB 4HKJA 1NFIB 3IKCB 4OD2B 2E9WA 4P2QD 5I1KL 5ICYA 3U4EB 4PTTA 4TOYH 1WFOA 1WCBB 4LRIC 3WUWA 1NGZB 1BD2A 3BW9B 3QUZC 3HZKB 4MA3B 4QRTB 2EE9A 1WV7T 3FB8A 4PJIB 1JF1A 5IMOB 1QPXA 4P46B 3NFSL 2OJZH 2HRPL 1X5YA 2RGSA 3K8KA 3MLSL 5E2TH 5DO2D 4JM2D 2I27N 2QHRL 4BJLA 4F7EB 4FQJL 2HFEA 2AK4A 4XAWH 4HS6A 1ITCA 4XPAL 1MI5B 3ZKXB 3GBLA 4Q6IA 2E7HA 4JPIA 1E0OB 1YEIL 4LGPB 2VITA 1PYWA 1QLRA 2O5ZL 1VADB 4QY8B 5D9SA 3BN9C 4RISL 1T89C 3GSNB 3O6LL 3QISA 4GKNA 5C0ND 2BNRA 3MNVB 5A1AA 3HG1A 1TPXC 3LV3A 1QFPA 1RZJH 4OZ4A 1AGDB 4OGXL 3JBG7 2BX5A 4IMLB 1KJVB 3QBTB 4G43B 4DN4L 4PJ9B 4PB0L 1LO3H 2OSLA 1FZOB 5CBEA 4LCCB 3U48A 1IGYB 1FFNB 1H5BC 3D69A 4NNXB 2E8YA 1KB5H 3EJYD 1T83C 4EI5A 5GRVK 4PJDA 4LCWD 5TJWK 5CBAA 2BDNL 3HE6C 3VCLB 1DDHA 4NUJB 3RJQB 4P5MB 3S36X 1TITA 1VEOA 2DOCA 1OD9A 3IKCA 4LFHG 3MFGB 3OPZH 3NN8B 4NJAL 4NZDA 1FFPA 2O93L 5C7XL 5D7KE 3EOTL 4X4XA 1VPOL 1KN2H 3AS1A 3HZKA 4PJ7B 4MA3A 1Q38A 3STZB 4QRTA 4M8QA 4Z7NF 4RGNE 1WT5C 2JCCF 4NBXB 2VZ3A 5IMOA 1RU9L 4UUJB 4XPFL 3KLSA 4P46A 1MH5A 5L8JB 4L4JA 1NFKA 5DO2C 1ZT1A 3U0WL 1FAIH 3NA9H 4LSDA 1INQB 2HVJB 4MAYC 3BEWA 1NMCC 2HG5B 4Q9QH 3ARYA 3UMTA 1T7YA 4QY8A 4JG1H 3N1PC 1IM3B 5C0NC 3EJZD 1A1MB 4GLRH 3ZE0E 5DD5L 2ZG1A 2DI7A 4IMLA 3ROLB 1KJVA 1QBLH 4G43A 3QO0B 5TQ2L 5KVDL 3DVGB 4PJ9A 5HGHB 3G6JF 5MENB 1FZOA 1BQHB 3EJYC 3RIAK 5F9AC 3QQ4A 5E8EB 3VFMA 4M7JL 3QO1A 2H26B 4TTGA 1HQRB 2D4DA 2YEZB 3DUUB 1FAKT 3HKFA 2CJUL 4R26H 3N1QC 3VCLA 4IOFD 4OFYA 1R3LA 5IWLA 3V95A 9CGTA 5I8CB 3NN8A 5GGRA 5E2VH 1N5YH 2HTKC 1FL5B 3QXAB 1KJ3H 3LRSB 3LH2H 4KKLC 3CLEH 1ZT4A 2HTLC 2X4UB 3CSYB 2H8PA 2H2PD 4P4KC 2FBOJ 4HPOH 3UBXA 3STZA 1H3GA 1KJ2B 4MDJB 3MOBL 1SVCP 1J12A 1A5FH 3MRMB 5IVXB 4P2QE 4C83B 4NGHL 2DKSA 2AJVL 2I60L 4EIGB 2QL1A 3VGAB 1XGTB 1RUPL 4OI8A 1IC7L 1OQXA 1INQA 2A6DA 4IJ3C 4CVXB 2HVJA 1JRHL 2HG5A 3W5NA 5A2FA 1OF2B 2I9TB 4G7VL 5DTFA 4NO3A 3EJZC 1IM3A 4AM0B 2IALB 1ZLWH 5SX5K 1QBML 1GOGA 3DNKA 4NKQB 4OLZH 3ROLA 2JJUA 3H0TB 5EBGA 3LCYA 4X7SH 5HGHA 4D9RD 1Z0NA 4GW4A 4YE4L 5IM7B 5E8EA 3WS6A 2Q8BL 5GZOD 2YEZA 3DUUA 1M05B 4IOFC 4CBPA 2EDDA 4XPBL 3BH9A 4H0IA 4YXHL 2KZ1B 3QJHB 1DQJA 4XHJC 5D1ZD 1KC5L 4U1KA 3V4UL 1U8PB 2DMKA 1N0XH 4TRPL 4NNPL 2ZOKB 4O51B 1CN4A 1A6AB 3HAEB 3CK0L 2C4FT 2UY7A 4LCWE 3V6FB 4NZUL 2BVYA 2XKNA 1L6ZA 3N9GL 5CMAB 2H2PC 2LTQC 4NN6C 5DMIL 2X4UA 3MRGB 4LPXA 3K2UL 4FABL 4MQSB 3BWAA 5EU6A 4MDJA 3AM8A 4B5EA 5IVXA 2L7JA 2EC8A 4QXWA 3SEPA 2W0FA 1B6UA 3RIFK 3QR2A 4YXKH 1YMMD 4QXUL 4NQXA 3HC3H 3QCTH 2GW5A 5CEZH 3ECBA 1DUYB 1UWXH 1OF2A 1O7SA 1TDQA 4G6KH 5JW5B 1JWSB 2HKFL 3S34H 4AZ8A 1ED3B 4LP4A 3VXUD 3FQTB 1FHGA 1EFXB 1Q94B 2P4AB 2A74B 1ADQL 3B5TA 3H0TA 2IPTL 3VGGA 1YEHL 3TNMB 4EN3D 2J5LC 5TH2B 5GZOC 1QRKA 5JIIA 1CE6A 1LP9B 1MJJB 1BQLL 3T4YB 3T1FB 4D0CA 5AWNL 4ZXBB 1M05A 2Q6WB 5D1ZC 4I3SL 2NYYD 3HNSL 3QEQA 5KTEL 3QZWG 2GQHA 1XH3A 1CDIA 1YNTB 4NQTA 5EOTA 2OXHA 5CHNB 4O51A 5ADOL 1A6AA 4PY8I 1AE6H 2W0PA 1BOYA 5C1MB 4GUPA 4QNPF 4OLVH 3VW3L 2ED9A 3FOLB 4K7PH 5EIVA 4CVUA 5BMFH 5IESH 3WD5L 1OAQH 3SPVA 3PXHA 1B88A 4OF3A 2ZZUT 4LVHC 4OZHB 4P4RB 4U1LA 4ZD3H 4JRXB 4MJ6A 3BAEL 1KLUB 4LLYB 1DUYA 4BK5A 1S7UB 3NH7H 2XZZA 4ZPVB 3C60D 3BQUD 1BVKA 2AV1B 3P0VL 2XN9D 2YKLH 1HNGA 1AGEA 4EUPH 5KBNC 1FIEA 3QWOB 1Q94A 1AQKH 2Y1VA 4KJPD 35C8H 4RCAA 1JNLH 5H37G 3QUYC 1MHHA 1NFDF 2VDPL 3D85B 1LDPL 4EN3C 3TPUA 4LSRH 1S5HA 2FB4H 3OJ2C 2BOCA 5TH2A 1LP9A 5FK9A 4LKXB 1MJJA 4LLAA 5JOFB 4LLQB 3T4YA 3T1FA 4QRUA 3MCG1 1NDGA 4EDWL 4NO5B 2UZYB 4OUOA 4HKXA 5D1XD 5EOCH 1JGEA 1CK0H 2Z0BA 3OGCB 3T0BA 4F8TA 1MFBH 3O45B 1S9VB 4F2MB 1DQDH 4FFZL 3QPXH 4XZUB 5GRUL 4KROB 4GW1B 1WBXB 5DQDH 2R1XB 4QRRB 3FOLA 1ZT7A 1ORSA 2W9EL 5HVFB 3S97C 5FO8B 1VA9A 4JKPL 2APXA 3UZEA 1PKOA 1D5ZB 5I18H 4P3DB 1MY5A 2GAZB 4OGAC 5DC0A 2ESVB 4OI7A 3T2QA 3EIFA 1JK8A 4P4RA 2VQ1A 4MJ2A 5HPMB 5IQ7L 3G5YB 1JZ6A 3F5WB 1OPGL 1Q1JH 2CSPA 4X6CA 3C60C 3BQUC 5FF6B 2JJVA 4Z7UB 1DSFL 5E6IB 2EDKA 5M95B 1IAIH 2VLRD 1RJLA 5T33L 2DMCA 4NZRL 4X6DF 1YMME 3DGGB 4NO0B 1HH9B 5BW7A 2B1AH 3QRGH 4UDTA 1AQDB 1BJ8A 3X17A 2Y36L 5CUSL 4MXQD 3VXUE 4OM0H 1OQOA 2K1MA 5FUOL 3MV9D 3WIIH 2AJUL 4LKXA 5JOFA 2CIKA 4LLQA 3C09C 1KENH 3CVHL 3D2UB 4Y16D 2UVEA 3HPJB 3LS5H 4UAOC 4WU5A 5EU5A 4OGYL 2VZOA 1I9RL 5D1XC 1JP5A 4LCUB 2AVGA 4M6ML 2YD2A 3BEVA 5C0JA 3OGCA 5DEFB 1AIFB 5HYSB 4N0CD 5C08A 2QSVA 3MXWH 3HI6H 3O45A 4XBPA 5D8JL 3DGCR 2IGFH 1WBXA 4XH2A 4ODVL 1Z3GL 5FO8A 3BPCA 3E3QC 4IIQB 3U7WL 5HHVL 1RIHL 5D1QC 5GS0C 2JCCE 3GBNH 5IBLD 1SM3H 4L4VD 1X5GA 4QXGH 4CU8A 1ZGLM 1IGMH 4LSSL 2WP3O 3JVGA 1MCBA 1IM9A 4MXWH 3G5YA 4PJ8A 5I17A 2C3XA 2JELL 3VXPA 1F45A 4HJGB 1A7RL 2K7QA 4Z7UA 5E6IA 2YZ8A 4NZTH 2Y06H 4I0CC 2APBA 2R9HD 3RVUD 1IAMA 2X44D 3QT2A 3SJVD 5DSCB 3H3PL 1F4XH 3CFCL 2FLRT 2PXYA 3NCYP 3IDNB 3OKLA 4Y4FB 3O9WD 1R5VB 5ADPL 1AQDA 3ARZA 1MLCB 4NQDB 4LEOB 2O61A 5KVGL 4MXQC 3DROB 3GDBA 3JTSA 1JVKA 5CKGA 3ZMRA 2XN9E 4B7LA 3G6JE 4JQVA 2VSDA 1G7QA 5SWZB 5GJSL 2E6QA 2GITA 3LIZL 4Y16C 1TIUA 2VRAA 3NCMA 4LCUA 3AS2A 5IFJB 1X3DA 2DQCL 2Y6SD 4N0CC 4OZFG 2DQDL 4XVUD 1U91B 1C16B 1Q0XH 3ARBB 3NACL 4XVJH 5J12C 2B2XH 2HAZA 4ZTOL 2RFXB 3QHZH 2VO5A 3MXVH 4YLQT 4FQ1L 4G6MH 4GAGH 4HJ0C 5IBLC 1TZHA 4GMSH 1RMFL 3C6LD 3MMEB 5EOCJ 3CXHJ 5HGDA 1EXUA 4YZFF 1CXLA 5EZOL 3UZQA 1XIWA 1MJ7L 3DUSB 2XY2A 1BZQK 3CCHA 4MA7L 1B9ZA 4CNIA 2G75B 3PWJA 3DI3B 3DO3A 4OCRL 4U1SB 3AB0C 2VLLA 3QNXA 2R9HC 3RVUC 3VD9A 4XPTH 4L3CB 4AIOA 5D7JD 4JLRB 5LWYL 2F19L 3BO8B 3DURB 3BESR 3CX5J 4JKLA 1G84A 2D31A 3O9WC 1W8NA 3WFCH 5IVNA 5E70A 4Y4FA 3CVIL 2MHAA 1MLCA 4YDJB 1B6DA 1EK3A 3GIZL 2VLRE 2KQMA 1J0ZA 4F7TB 4NO2A 4XC1H 3N0PB 1D7FA 3DHMA 2HVKB 3MRHB 4XMLL 1OD7A 4MB4A 2R0WL 1ZLUK 4OI9A 1GAFL 3FB6A 4PS4H 4ZSOA 4X0KB 4HK0B 1FBIL 3RTQB 1J86A 1YEKL 2NY5C 2Y6SC 3QJFA 1F3RB 5FO9B 3PQYD 3CU1A 1Y6KR 4NM8H 1EUUA 3MV9E 5JMOC 4XVUC 5FECA 2M26A 4JVUA 1JI1A 4OT1L 4PRAA 3ARBA 2W60A 5DD0L 3O4OC 2RFXA 4XCYA 4H25A 2B0SL 3NGBB 4HW6A 5DYOB 5D96B 4IEFB 1KFAH 3QIBA 4P3WA 1JZ7A 1JNNH 1I7TB 4OF7A 3T08A 1G0YR 1TQCB 1AC6A 1EHNA 2ZCHL 1FPTL 4Y4KD 5FYLL 1DJSA 4H20L 1L0QA 5D7LB 5BRZB 3VXNB 2PKDA 3SDXB 3CUPA 3R4DA 5CSBA 1CWVA 2DQIL 3P0YL 3VFOB 1RULH 3EYSL 1CGWA 3CLFH 1KACB 4HIEA 5ESAB 5HHQB 4M03A 2G75A 2BXZA 4JPVH 1KEGL 4ZFOL 4X9HA 3ARPA 4U1SA 4Y4HB 2DYPB 4NQVB 4OFKA 3QQ9C 5D7JC 4L3CA 2X9WA 1FYTD 3VFUB 2YC1A 4L4VE 4JLRA 4RAUA 1NLBL 3DVNB 3F62A 1BZ9A 5ALBL 3DURA 3ULSB 2NW2A 2EDNA 1NCBL 4EIZC 4JQXA 4JVWA 5DJAA 2NY4C 3Q3GA 3CX2A 3UTTB 3ZKND 3ARFD 3MLZH 1INDL 1II4E 3IU3B 3TBTB 4TNVK 4UILL 5DHYA 3HMXL 2WINB 5I19L 4JANB 5HDLA 1KB5A 4XX1G 1EMTH 3D3VE 5EUOB 2KL6A 3RTQA 2JTDA 5EU4A 1FNSL 3D87B 3VXSA 2B4CL 1SEQL 1C5DA 4OLEA 1CD9B 2R4SL 5C0DA 1VENA 5HDBF 3A67L 5ANMB 4FFWD 4PJGA 2JB6A 1X7QA 4WI2A 4QNPE 1UYWH 5TE7L 1JYVA 3I3DA 4Y4KC 1JF5A 4X7FC 3VJ6B 1BBDH 1UM5L 1RSFA 3QRFM 4D0DB 2ZSVB 4FP8H 5D7LA 5BRZA 4QRQA 3UO1H 1D5IH 3SY0A 3SDXA 1JL8A 3AMKA 3STLA 2BVOB 4X5XA 3VFOA 3RJDA 3LQZA 4AMKL 2NY2B 5HVHB 3H9HB 3O3DB 3TC9A 2OL3H 5HD8D 5E8DH 5HHQA 2EDXA 1V3JA 3A6CL 1REIA 2DYPA 4MJ5A 4NQVA 4P5KB 3S4SB 4GAYA 3P4OA 3VFUA 5CJXC 3UC0L 1A9BB 4JGUA 1FO0H 2GJ6D 1T7XA 3M07A 1NGQL 3ZKNC 3ARFC 4JFXB 1G6RB 1VEMA 4PRPD 4BFBD 2NTSP 3IU3A 1NFDE 1BWMA 3NPSB 5I6XB 3IKKA 1A4KA 1R3HB 1RPQA 2WINA 1WAAF 4LAQL 4M6AA 3WFBH 5EUOA 1Z9SA 3SKJL 2ZNWA 3KPNB 3MV7D 5HYFA 5ITBL 1D9KD 2QQKL 3X12B 2XA8H 3EYOB 5E94B 3UYRL 1IAKB 1DVFB 4ZUVB 3AREA 3EOAB 5JDJA 3B3IB 4FFWC 5ANMA 4AT6B 4O4YH 4JCLA 3KPTA 2YBRB 3KGRA 2XY1A 2CKBB 3VJ6A 4RFNB 3PQYE 4MNGE 4DN3H 2ZSVA 5E1AA 3VH8A 2A0LC 1LO4H 3MRPB 5IBTL 1UWEH 3FQWA 3OKDA 4YFEA 3TA3B 5HD8C 5DFWH 1IGIH 3DARA 4F7PB 2WBJD 4HAFA 3QXUA 5I73B 1PEZA 5T3ZH 1BBJB 4WUKH 3S4SA 4GG6F 4KWUA 5GS0L 1MUJB 4H1LH 5ICZA 4YGAB 4Q6YA 4PG2A 1A9BA 3KPSD 1KB9K 1UGNA 3RRQA 4OKDA 3U0TB 2W92A 5IB2A 3MUY1 3SE8L 2V17H 1RK1B 4I4WB 2VLKD 2EIDA 1FYTE 3BE1H 2OK0H 2YR3A 32C2A 3EFDH 1Y18A 5J7CC 3ZYZA 1MHPH 1P4IL 1Q0YH 1R3HA 3FZUC 1OOAA 2ITDB 3OX8A 3GZKA 1D9KC 5JPMA 3MRKB 5E94A 1IAKA 1ZHNA 4NFDA 4OFIA 1DVFA 2EEBA 4ZUVA 5GGQL 5IW6B 3I50L 1LK3L 4NRXB 5DFTA 5I1EL 3KDMA 4F57L 1KIQA 5GS1A 4AT6A 5LQBL 4DAGH 1T5WB 1KPUA 1YC7A 3SDAB 1IEBA 5DLMH 1I7ZA 1UM4H 1X6NA 4JR9L 3MRPA 5D5MF 5MERB 3TVMD 2QSQA 4ZS7H 1SBSL 5L0QC 5C0CB 5JMRA 1XF3A 2WBJC 3NPZB 4P0DA 4U1IB 1YYLH 5J0BA 1CBVH 1MRFL 1WZKA 2R2HB 2VL5A 4M3KB 4P59H 4BSJA 1FLTX 4LDEB 1BBJA 1JGDB 2BNQB 3TT3H 4TVSa 1G7JA 4QGYA 4OF0A 5GRZA 4N8VG 3FT4A 1OLZA 4CKVX 5TF1L 1UXWB 4HGWA 3RDTC 1MWAH 1OTTD 1QLEL 1MNUH 2EECA 4EQ3A 3KYNB 2DLFL 2XWBB 1ZLSL 4N5EC 1CE1H 2P5WB 1ND0B 1RK1A 4I4WA 1ZLWK 5E0QA 3RVVD 2ADJB 3ROOB 4XXCA 5BV7H 3P4NB 5I66B 3PDOB 2HP4A 4YH6A 1U2CA 4GRLB 4OCXH 3LKQB 4S1RL 4CMHC 1JNHB 4F15C 5AYUL 4PRPE 3RVTD 2SEBA 4MZ2A 5DRNB 3VG9C 1FN4B 3CFJA 1BIIA 3DSFL 5J11B 4OZIA 1GHFH 1OGAE 3EYFA 2CLVA 3AFLA 5T5FH 2C3GA 3MV7E 5I1AA 1U8NB 1UA6H 4DKFH 15C8H 4LHQB 2ATPB 1MIEH 3TVMC 4QOKA 3KAAA 4CJ0A 4CGTA 1AH1A 2CMRL 2QQQA 5D6DA 5C0CA 5MEOA 4YZFE 1I1FA 4NWTL 1A6ZA 4U7SA 3S3JA 1CCZA 4U1IA 1P2CB 4IRJD 1FGNL 5IMMB 1YZZA 3VXRA 2FX8L 5GHWH 3I84A 1EEZB 2D7PA 4ZQKB 4F58H 5IFAH 4L9LA 2BNQA 4K3EL 4I9WD 1VCAA 4NQCD 1UWXK 5FO7B 1OTTC 4EUPA 1NMAH 5DURD 4XWOD 1AY1H 3O2WH 1LGVA 5E8PA 1D6VH 1MLBB 5E5UB 4L3EB 1HIMH 5FB8A 4P2QB 1CFNB 5HHOA 4Y5VA 1CLOL 3PDOA 4K07A 2BY1A 5T3XD 1QBBA 3KPSE 4CUCA 2XICA 4YFLF 1X5AA 4JRWA 4AEFA 1Q72H 1LHZA 3TWCL 1QSED 5IF0B 1PGRB 3RVTC 4U31A 3RGVB 4KH2A 1LDSA 2VLKE 1FVDA 2DQTL 2E7LA 5DRNA 4AL8H 1XEDA 5FYKU 4X4ME 4JM2B 5C0AA 3SO3B 1YNLH 5E2UL 3GMNB 5H94B 5IJVB 3EO1B 4ODHL 5HHMD 3SHSA 4JREC 5GISL 4Q9RH 3VI3F 1KCLA 4KPHH 1S3KH 4LHUA 3T0EA 3G5VA 2ATPA 3G08B 2VXTH 4A6YH 5JLZB 4R96A 1L7TL 4J3UA 3MQIA 1QFUL 3O0RH 4K7PY 4X7DC 2A83A 3RWDB 4Z76A 2AABL 4RDQF 1P53A 5FHBH 1E6OL 1UACL 4QHLB 5F3BB 2PTVA 3MJGX 4KUZH 1FRGL 5MI0B 4WO4A 5IJKC 1RZ7L 1EUTA 5FYJH 4PLNC 4Z8FL 3P9WB 4LCWB 3OAYH 4GAJL 5C6TL 3PNWB 2VC2L 5FO7A 3WBDA 2FECL 1LEIB 3KS0H 2MPAL 3B6SB 3VA6A 4ZG1A 1P7QD 2V9RA 2RHEA 4L3EA 1P4LA 2VR4A 4R0LB 4PV9A 1BM3L 3TIDA 3G5XA 5DJ2B 1YUHA 1NBZA 1TCRA 4ELMF 5TDNB 4P2OD 1LEKB 3OHXB 3KPQB 4YDLC 4M7ZC 4LLMA 2VOTA 1NPUA 3HR5B 3MJ9L 2VLJB 2OZ4L 2EDHA 1R5WB 3GMLA 3RGVA 2DQFB 2IFFL 1H15A 2B7DT 3MCKA 1I4FB 3Q5TA 4WEBL 1WIUA 2XTJB 3FO1B 3FT3B 4OLWH 3FL7A 4RWYH 3LRGA 2XZQL 3W0WE 4L8SC 3GMNA 2LQRA 3CXHK 2DBJA 2IAMB 2NTFA 2ERJB 4HFUH 3T77A 4PYGA 3D0LB 2PW1A 1TVBB 2XPGB 3JV6A 5FCUH 1Z5LA 4KJYB 1UKTA 3RWDA 1G1YA 4UT6H 2FCBA 3DRQB 4PB9H 4WV1A 4QHLA 5F3BA 3MRQA 2DQHH 4XBGA 1FVEB 4U7KA 3L3DB 2QHRH 1EAPA 3B2VL 4FQJH 1FZMA 4TN9A 2EYTB 3QG7L 1J87A 2W65B 3PNWA 1E27A 1YEIH 3F7VA 3LS4H 1MF2L 4HKZB 5MEPB 1AR1D 3W9EB 1SY6L 1U8LA 3P4LA 3B9DA 1MHEB 4P9HC 5JXEA 1HK6A 2Z8VC 1KTRL 1U58B 1T20B 4I9WE 4NQCE 5DJ2A 4HIIA 2CUIA 4P2OC 5TDNA 4NN6B 1LEKA 3KPQA 4IDJL 4G6JH 1BF2A 2VLJA 1WAAE 2OBGA 3TZVC 4MHHI 4Y19D 1T0PB 1MHCB 3RU8H 4OLXH 2DQFA 4YHZL 3MJ7B 4JDTH 3GHBH 4V1DD 3FO0H 3FO1A 3FT3A 5T3XE 5FOBB 2ZUWA 1T21B 3WHE0 1UZ8B 1JWMA 2IAMA 5ESVA 1S5IH 1QSEE 1ZV5A 2QQLL 1F8TH 2FHFA 4NJAH 1G0DA 2YOCA 3D0LA 1MCPH 4C56B 5C7XH 5F96H 1CT8A 5B21A 4I5BA 1I8KA 2RR3A 3QHTC 5I8EB 4Z77A 1T2QH 1I8LA 2PYFB 4PGEB 4WW1B 1AP2B 2HN7B 1G7PB 4ACPA 4G42A 7CGTA 2NY7L 3VFTB 3CXDL 1RU9H 4N0UE 5HHME 4GKZA 3HZVB 5KANG 4R3SB 3UTSA 1NJ9B 1RZKH 4J4PA 3L3DA 3B43A 2IAND 3P2TA 1A14H 1BEYL 1U8JB 2W65A 2WP3T 4GG6E 4GMTL 1R3KB 1U41A 4JFDD 4LCYA 3GRWL 4QRPB 3U36A 1D5BA 3W9EA 2AERT 3V7MA 4MNQD 4OB5H 3EO0A 1UB5A 3LDBC 4BA8A 4X5LA 5DD5H 5E4IA 3MA7A 4QHNA 5TQ2H 2WLZA 5KVDH 1LO0L 1BGXL 4HUXB 5HI3D 2O5XL 3OKMA 3OB0H 5JZ7D 4ONFH 3KS0J 3OG6B 1MHCA 3SBWC 4JZJB 4OD3L 1JV5B 2XV6B 4ZFZB 2GFBB 4IRSD 3VRLF 2KH2B 3UJIL 3E8UL 1LWRA 1RURH 1IQWH 1T21A 1UZ8A 3OF6A 4FFYH 4H8WL 4YPGB 5M7QA 4ZFFB 3RX8A 4WHTB 4C56A 1CLYH 1P9MA 4JFFB 1JUFB 4OCWH 4YR6B 1P4BL 5I8EA 2DTSA 2ZOLB 5GSRA 1AP2A 4MJIE 4Z7VF 2Y7QB 4M1DL 4XMKH 1G7PA 5IOPB 5H37H 3VFTA 4XAKD 5JW3H 4YBLC 5D5ME 1PQZB 5E08H 2D0GA 2I60H 5I75B 4FNLH 4X6EA 3FCTB 1NJ9A 1TMCB 4PLKD 4S10A 1RUPH 4MD0B 3MLXL 1KTKE 4WFED 1A0QL 1U8JA 4PJHB 5D6CA 4OCMC 1NGYB 5DHVH 5F89A 1YEFL 4WUUA 4HGKC 3IDJA 4QRPA 5FV2A 2YK1L 4KHTL 4K3HA 3U9UA 2VQTA 5FYLD 1QBMH 4JDVB 1EVTC 4DZBB 4JN2A 3TNNB 2JB5H 4S1QH 5SWSA 4FXGA 3DX8B 5B38G 4GQPH 1TTFA 5JZ7C 4JFZL 4HUXA 5CP7A 1QQDA 4X8JA 5EBMB 3MZTA 5FA3B 4I1NB 4LL9A 2Q8BH 5SWQB 1FFRA 1BIHA 5GZND 1FDLL 4JZJA 5KW9H 1FH5L 3ZYIA 1JV5A 2DWEA 3VA2C 3B8YA 1K4CA 4ZFZA 2GFBA 2P8LB 5KSAC 4L5FL 1K3IA 3U30B 3LSOB 4YPGA 4OFPA 2ZNXA 4TRPH 3TBSB 1K4DB 2FR4A 3CK0H 4I0KA 1CD0A 4WHTA 4Y19E 3C60B 4HUVB 3N9GH 5DMIH 3DETD 5KS9F 5AAMA 4V1DE 4NT6B 1WBYB 4HGMA 3K2UH 4P5TB 2Y7QA 4FABH 4NOFA 5IOPA 1G9ML 5IVZB 1F00I 4JHBA 4OJFL 1U3HA 1R5IB 1PQZA 1JTTA 3V6BR 3QUXB 1AGCB 3FN0H 2OL3A 4HJJL 3OKEB 1T22B 4KMTL 3DYOA 4MD0A 3TO4B 3X11B 2R1WB 2H32B 3Q5YA 4PJ5D 4PJHA 1YY8B 2YPLD 2X4TA 3VGEA 3KLDA 3O6ML 3T2NL 4LAJH 4PJXB 4YNYA 1NGPL 4OSUH 3VD7A 2BHUA 4Z6AT 3NCCB 5JHDA 3X14B 2HH0L 3GMRA 2UWEA 2UV3A 2IANE 1FIGH 2NXYC 1F4WL 3TNNA 4YQXL 4Z5RB 3DX8A 4MLIA 1ORQB 2FJFB 2L0DA 2IPTH 1U8MA 2VISA 4JFDE 1QNZL 1YEHH 2QQNL 3BSZL 3FFCD 4QTHA 5F6IB 4MNQE 3LD8C 1BQLH 4LSVL 4PBXA 1TTGA 3HNSH 1ZLVH 4XMPH 1TJGH 5KTEH 5LAXB 1G1CA 5A2JH 1UEMA 4POZD 3PL6C 3QIWB 1SJVA 5ADOH 4FRWA 2YWZA 1C5CL 5KANI 2OTWB 3DETC 3C8KB 4DUVA 1UQSB 3VI3E 3QI9D 4Z78B 4M62L 1WBYA 4P5TA 3MGOB 3PHOB 2EEDA 1U8KB 4F33B 3G6AB 1KELH 5EBLB 1IBGL 2PO6B 1NDMB 3ARWA 3QUXA 2F5AL 4YHYC 3OKEA 3SCMD 2Z35A 2VL4A 3TO4A 4V2CB 3UJTL 2R1WA 2ITCA 3QDJD 2ICCA 4XAKE 1OAXH 2DIBA 4JO4L 3DX9A 3SGJC 3E6FA 1MCKA 3P0VH 2DF3A 4UU9B 4OZFH 4PJXA 4KY1L 5JORB 3U83A 2Y25A 5I1GL 4BUGA 3NIFE 5FM4A 1WTGT 1UEYA 1J8HA 4N1HB 5C0BD 1DBJL 4G9DB 5F1IB 4ODTH 2VDPH 1LDPH 4E5XA 3H9SD 3D0VB 2EIZA 3DV4A 1NCCL 4ELME 2F8XC 3IXAB 4OZGA 5MEQA 1G7MA 2ED7A 4WWKB 5FYLE 3UJJH 3KYOB 4POYA 4L4VB 6FABL 2ADGB 2P49B 4POZC 2WIIB 3I9GH 5F7EH 4B7IA 2HFFA 3C8DA 5F7MC 3OKKB 3VFNB 2XI9A 4OBRA 3QIWA 3TFKD 4FQIL 3RPIA 2BMKB 4FFZH 4B0MM 3QI9C 5GRUH 1E6JH 2E9IA 4GG8A 3SJVB 1KNOB 4P9ML 3WHXA 2W9EH 3M1BB 5EBWA 3PHOA 4UOW1 1F5WA 4LQFH 4JKPH 1M6OB 4MMZC 5EBLA 3LHPH 2PO6A 1NDMA 2GJJA 3PF2A 4IHOB 3SCMC 1UADC 4HWZB 4TUOB 1A3LL 1EGJL 5IQ7H 1IQDA 1AO7B 4MA1C 4CN1A 5L8KB 3OJMB 2A77H 3HI1B 1KTLB 5HTSA 1RUMH 3O6FB 3L5WB 3EZ8A 2P24B 3EHBD 2V2XB 1P7HL 1XGRA 5GRWA 4UU9A 2FZ3A 5F7HA 4PG9A 5L7XL 3GB7A 3MRDB 1MWAA 4NZRH 5JORA 3FT2A 4YX2L 4OIIL 4HS8H 1RD6A 5HI4C 1GRWA 3WFEL 2YPLE 4G9DA 5DK2B 4FQCH 2Y36H 1ZHBB 4Q2ZA 5CUSH 2BERA 3JWOL 1NCAL 2VDRL 5FUOH 1DN2A 2VKXA 4IRZL 4XPHL 3IXAA 4F7MA 2AJUH 3REWA 3C6LB 4WWKA 2ENSA 4NC2B 4I3RH 3W39B 3CVHH 2ADGA 3FQXB 5KSBA 4OGYH 3KR3L 2WIIA 1I9RH 3DMMA 5E4EB 2YUZA 4NDMB 3TFKC 4M6MH 1S9YA 1QO3B 3HUJB 4YO0B 3FFCE 4D9LL 1QD0A 3PWPD 2JF1A 4M48L 4N0FA 5D8JH 2A6KB 4RMQA 3K4ZA 1RUAL 5D7JB 1K6QH 5IBUG 1YECL 2UUDK 4XNQB 4PP2B 4P2RB 4Y8DC 3O3AB 1R6VA 4XCCH 3Q2CA 3VXMD 1RIHH 3VWKC 1J5OH 1M6OA 2FX9L 2WQ8A 1HXMB 2FX7L 4ORZC 4PJBA 4U1HB 1FL3B 1VFAA 4LSSH 1RZFL 1J1PL 1A4JB 1AO7A 3GHEL 2AEPL 3RA7L 1X5LA 3DIFB 5BVJB 2I26N 4XXDA 1A7RH 3IF1A 3EHBC 3ES6A 3O6FA 5FOJA 4I3GA 2V2XA 2ATKB 1A7QL 3PQYB 4TULL 3H3PH 2A6IA 1CD8A 2QHLA 1XT5A 3QDJE 3AS0A 2NR6D 1U6AL 1TVHA 4K2UL 4TOYL 5TDPA 3KYMA 2BRQA 4QRSA 1IGTB 4PRDA 5DD3L 2EO9A 5KVGH 4PR5B 3CH8A 3P11H 5ISZB 3KLAB 4LPYA 2EDRA 3T0DA 4Y5YA 1M1SA 2PF6A 2DL2A 3SKUD 2ICWB 3K8LA 2VXVL 3LIZH 1OSZB 4PJCB 4HLJA 4NPYA 2OJZL 4WHCA 2OTUB 5C0BE 3HS0B 3DRTA 3DV6B 4YJZL 2NZIA 1I1YA 2MCPL 1CFVL 5E2TL 3WS3B 2P7TA 4TSAH 4RFOL 3H9SE 4NBZB 1BQSA 1MPAH 3VRLE 2XYCA 2DQCH 3HUJA 4YO0A 3VFGH 4QGTA 1T2JA 3FQNB 3WO3B 1YA5A 1HHGB 3RWFA 2PNDA 3MPCA 3HHRB 5FGBC 3NACH 1FYTB 1CICB 2A6JB 3RUGB 1BD2D 1IZKA 1HWGB 4NM4H 4D94A 5IG7A 5FYKD 4P2RA 4A6YA 1TENA 3O3AA 4FQ1H 4APQB 2YWYA 4F9PA 4Z7VE 2BXYA 1RMFH 5HY9B 1HXMA 4FQLL 1TZGL 2HJKB 2BK8A 1MJ7H 1LO3L 1U95B 3DI2B 4GAFB 1OAZH 2AK4D 5C71A 5IVXF 5BVJA 3AY4A 3DLQR 4JFED 4EEEA 2GJZB 2ZUUA 2DLIA 2ATKA 5IR1A 2F19H 4UV4L 3DXAA 5DF0A 2N4IA 2BNRD 3QEUA 3HG1D 3FHQA 2NR6C 1EO7A 3OR6B 1IZJA 3RY5A 3ARUA 3RY6A 3WEXB 5D2NC 3GIZH 4YK4C 5ISZA 3BP6A 1KIUA 1IJ9A 4PJEB 4EI5D 1S7XB 2XWJA 3F7YA 4XPGH 4PJCA 1OSZA 4WW2B 2Z8RA 3MCLH 3ZKQD 1GAFH 2OTUA 2NPLX 3L5XH 1FAIL 3WS3A 1FBIH 5AD0A 2K9UA 4P2CG 1YEKH 4WDIB 3MRBB 3C5JB 2R2EB 3FQNA 3MTRA 1HHGA 4O00A 4K94C 5DD0H 1RUKH 1CICA 3NAAL 3RUGA 2B0SH 4LNRA 4QYOB 4BKLA 2R8SH 5B3NA 2GJ6B 2BVEA 5F7NC 5KS9E 5ALCL 4APQA 5LGHL 4M93B 4Z7QF 4RNRA 2G5BA 3Q6FA 1FPTH 2BFVH 3WJJC 2CH8A 4H20H 3V5DB 1QBLL 4YC2B 3PWPE 4P46D 1T0NB 4PRPB 1DUZB 2Z91A 2HJLB 3V0WH 4OFVA 2DQIH 3MFFB 2MKLC 3SDDB 3E2HC 3EYSH 2NY6D 5I9QC 1W0YT 1IKNA 3VXME 3AROA 1YNKL 4R26L 1GH7A 1S7TB 2W1NA 3FB5A 3ZTJG 5DMYA 1HHIB 1L7IH 3PWVB 1D9KB 3OAYK 3QZWB 4ODWA 1NLBH 3BT2L 5BS0B 1CGTA 4Q9CA 2FWOB 2W59A 3VFPB 1J0YA 3OGOE 2FEDD 3ZDYF 5IHUH 5D72L 3EYVA 4POUB 5E2VL 3CDYA 4GKSB 2DQGL 2VDLH 4EI6B 1FNEB 3CLEL 1IC1A 5HYEA 2CO6B 5JUEH 3K3QA 4HWEL 4PJ9D 5DDHB 4HPOL 1Y0LA 3VE0A 3KG5A 4JB9L 3PGFL 4UILH 4EI5C 4PJEA 3RWIB 1S7XA 5B8CA 1G9EA 4WW2A 1V3MA 2V5SA 4ZNEE 1XR8A 3QXVA 2E5EA 1P5UA 4NCC1 2GUOB 3MLVL 4OFYD 3K2MC 3B9AA 3X13B 3O8XA 4NKIH 1OAUH 2WBJB 1LP9F 1UM6L 1SEQH 2B4CH 3MRBA 2R2EA 3PJSA 5IEHB 4NQEB 1OVZA 4BZYA 2AJYH 5DEGB 1QRNB 1CVRA 3A67H 4IOIA 4RIRB 4EJ1C 3GJFB 4WTXA 3WLBB 4DQOL 4N9OB 4OLZL 4P46C 1JPGB 4S1DD 3RWJB 2P8MA 2VLKB 4X7SL 4XBEL 1XR9A 4OUUB 1ZWIB 3SDDA 4P57B 1BD2E 8CGTA 3PP4L 5FYKE 3KWWB 2IQAB 2AV7A 4K8RL 1B4JH 4CMHB 1A7NH 2QTEA 2VDKL 3LB6D 2JJSA 4YHPB 4JY4B 4F15B 3ULUF 1HHIA 4R97C 3PWVA 3QZWA 3UC0H 5FA4A 5BS0A 3C08L 1PFCA 2FEDC 2FWOA 4XTRD 2J7LA 4X6CF 3PABA 2EXYD 2AK4E 3TIEA 5CLTA 3A0OA 1H8NA 4JFEE 4BM7A 4PJ9C 5CD3A 4LCCC 2LVEA 4AQ1B 4YDVB 1IAIM 3CMGA 2XRAL 4ZAKB 3JWDC 3HG1E 3RWIA 3IYLW 3KPPB 3TVMB 4N9GB 3CFKB 3MV8B 2GUOA 4YXKL 3MLRH 4URTB 5ITBH 5DWUL 3MR9A 2QQKH 3HC3L 1S9KC 4PJAA 2H6PA 3UYRH 1YEDB 5LKNA 3QULA 3GNMH 5IEHA 2BC4B 5JPNA 4PJDE 3QDGB 1QRNA 3ARXA 3S34L 2EH8H 3RKPA 5IB3A 2FEEL 3GJFA 3EZJB 3WN5B 1NC2B 5EU6D 4O2EB 4QCIB 1DTUA 3SGDI 3RWJA 1NQBA 1E28B 5F93C 5IEKB 3IJSB 5B39G 2JLLA 1IRAY 4P57A 2RB8A 2OQJB 4U6YB 4DVBB 3GGWA 3KWWA 4LPVA 4G8EA 4MD4B 1EEYB 2Q86B 3WFHA 4LHJB 1FNGA 1AR2A 3OKNA 3LB6C 4ZOAA 3LQMA 4ODXB 4R7DB 1YMHA 4W68A 4EDXB 4PD4J 5GS0H 1BFSA 3ZYOA 2IBZY 1CFTB 2AJZB 5DHVA 3MOAL 3QNYB 4N8PA 2YUXA 4HDIA 4KK5D 4XRCB 1MCQA 4Z7UF 2RAMA 3B8SA 4KGJA 4OLVL 3SE8H 1XGQA 2DDQH 4WHYG 5F1SA 2H2SD 1CYGA 3CH1B 4R6UA 5JXAH 3WS6C 3BKJH 3MROB 5IESL 1OAQL 3OB0K 5JNYA 1PLGH 4M02A 2ORBH 3MV8A 2BVQB 3QEQD 3U9PL 5TE4H 4IRJB 3BUTA 4J1UA 5GGQH 5HVGB 3I50H 1LK3H 4P99A 1KIRA 5I1EH 3M17A 3NH7L 2ICES 1NAMB 3CFEB 3QDGA 5GIRA 3O2DL 2JK5B 1P1ZA 3H3KA 4KRPD 4KK6C 1AQKL 5DURB 3CMOL 1NC2A 4KFZC 1GYAA 1IGJA 35C8L 4H26A 1JNLL 4O2EA 4QCIA 1AHWB 3RKDD 1M7IB 1SEBA 4JR9H 1E28A 3VGAC 5ENWB 1DLFL 1SBSH 5IEKA 3REVA 4LSRL 4U6YA 3VXQA 4DVBA 3D18B 1RK0B 4FOMA 3CDFA 4KTEH 2Q86A 1UWGH 4JKWA 1D5MB 1Z9MA 4CRPA 5BQ7B 1QSEB 1RZ8B 4YHOH 5KZCD 4L9DA 4TVPD 1ACZA 1M7XA 4DW2H 3QNYA 5EOCL 1CK0L 4KK5C 1AXSA 5TGBB 3RWCA 3CNKA 3HNTL 4XRCA 1MFBL 2DLFH 4PGJA 1DQDL 5IK3A 3QPXL 2H2SC 4N0UB 1ADQA 4FG6D 5HHMB 5DQDL 3CH1A 3TPKA 4HXBL 4WI6A 3TGXA 3HE7A 3MROA 3K4AA 5I18L 3MLPA 1G0XA 5IW1A 1U3JA 1Z9OA 4GG6B 4CVZB 5DMGD 2BVQA 3O41A 2EC9T 2YD7A 5MENE 5I1LB 3BKYL 5HI5D 3BGMA 3DSFH 1K5NB 4YFLI 4KK8D 1ERNA 2JK5A 1DANU 2APTA 3UEZA 4DVRH 1TZIA 4X4YA 5J1AB 2Z31B 1BMGA 3S5LG 2VZVA 2NY5H 4JVPA 2A9ML 2B1AL 3RKDC 3MGTB 1S7VB 3BDYH 1AHWA 1M7IA 5ENWA 4JFHD 3VWJA 4UQ2A 3ULUD 2R29H 1QHOA 2CK0H 1I1AA 4OM0L 4HH9B 3WIIL 1FGNH 1L9NA 2FLBT 3WDJA 5DJDA 2VJXA 3L3JB 1KENL 5IVXE 3LS5L 2J4WH 2R1YA 4MCYB 4CDGC 4K3EH 4S2SB 5CZKA 5FM5M 4OZFA 5JW4N 1B4RA 1FJ1B 3MXWL 3MLWL 2GT9B 1QEWB 4FG6C 3MRIA 1HHHA 1KBGL 3V4PH 3RZWA 4J7RA 1TQBC 4ZXBC 1T89A 1OTUD 4BQ6A 2DTMH 5DMGC 4HUMB 4QXGL 1VKXB 1IGML 5F7DB 1I9IH 2DQTH 2YD4A 4C55A 1UJTA 3HC4L 5HI5C 1ZLVK 2GSIB 4KK8C 4CN6A 4X9IA 2GKIA 3FFDA 5C08D 4NZTL 1X5ZA 1UVQB 1UB6B 1T83A 1YYMH 1MEXH 4KROD 3AC0A 3L3HB 5CILH 3V52H 3QEQE 1QVOB 1F4XL 1HH6B 3HE6A 1DQQB 1TTUA 2Z31A 3VGDA 1EEUA 1JGVH 4Z95L 3WLWD 3MGTA 1JGLL 2QLVB 1L7TH 1VSCA 1QFUH 4Z7QE 4GW5A 5CJQL 3BH8B 4PJGF 3WIFA 3ULUC 2AABH 2PCPA 3EYQD 3F65A 5AZ2H 2UVFA 1IM9D 4PJ8D 3ORJA 4ISVB 2WIMA 4M00A 1RZ7H 4Z8FH 4DK3A 3SDXF 3ZT5A 4ZO6A 5E6ID 4MCYA 2D2OA 5C6TH 5C0RH 3GUTA 4XT1C 4V1DB 3V0VB 5BW7C 2MPAH 4JRYA 1M7DA 2PXYD 2OLDA 1FJ1A 2Q87A 1BOGB 2GT9A 3MNZB 1RJZB 4XVJL 3BZEB 2B2XL 4MAYA 3QHZL 4H5SB 5E2WL 5EUKA 4TVPE 2RIKA 3MXVL 5ERWB 3GSNL 2Z8WC 5JTWA 4G6ML 4GAGL 1OTUC 1N5AB 2IH3A 4FQQA 4GMSL 4U33A 4YHIA 4HV8A 1E4JA 5EC2B 5FFLA 2OZ4H 1XF5B 1VKXA 3D2UD 2EDOA 1BJ1H 3EDFA 5F7DA 4MQ7B 1J05B 1RHFA 3CVHA 1CFQA 1I3VA 2VABA 3T0WA 1NCTA 1A2YA 5GGUB 5HYQB 4YIQB 3BZ4A 3DVIA 1LP9E 2XZQH 5EUOF 5IQ9B 4KROC 3GJEB 3GK8L 1UVQA 4XPTL 2V2WB 1MCOH 3WLWC 3R8BB 1DQQA 1MVUA 2F58H 1DQLH 2X70A 1JI2A 2NZ9D 3J7HA 4NJ9L 3BH8A 3EYQC 3CFBA 3JVGC 1KOAA 1XIWD 4LVNB 4NQSB 4F37K 1JMXA 4XC1L 4QTIH 3LY6A 5I1JH 4P4KA 5E6IC 1VESA 4LVEA 5I8KL 4PS4L 4OF6A 4JFHE 3ULUE 2HT4D 4IRSB 3V0VA 5C8JA 5E8OB 4Y4FD 3MNZA 4AEHL 7FABH 1SY6H 4X6CE 3S37H 1RJZA 4NN5C 1NGWA 4QLRA 3IS0X 1CL7L 1HHJB 1KFAL 1N6VA 2DJSA 2NXZD 1IEHA 1NL0H 2P5EB 2WWKO 4IDJH 4LF3B 1F42A 4KZEL 5F6HJ 4OIAA 1J05A 1RULL 4HIJB 4LSPL 4ONHB 1XGUB 1RVFH 3CLFL 4UB0H 5GGUA 2EXWD 5IQ9A 4LLDB 1MRCH 3MRRB 1ZHKB 3ILQD 1DEEB 3ARBD 2QQLH 2V2WA 5IHLB 3WNLA 2NZ9C 3QIBD 4L29B 4ZUTB 1JHTA 4JDZB 2DWDB 2YSSA 5CWSB 3TN0B 1UJ3B 5C08E 2NY7H 1MCDA 3GMQA 3NFPA 4CL7A 2P43B 4NFCA 4TUJA 4QRRE 4KHXH 3MODH 2FEEI 1N26A 1MRDH 1U2HA 3RWHB 1IGCL 1KJ2L 2HT2D 5ICXB 2IBBA 1EMTL 4U6HA 2GSGA 1BEYH 3O81A 3LKSB 1OWRM 4NHCH 4GRMB 1DE4B 4GMTH 4K7FB 2F54A 4Y4FC 3GEWB 5AAWA 5E8OA 1KT2B 5JIHA 5I1IH 1ZGLB 3E0GA 1DN0B 4Z7UE 2NXZC 1Y6NR 5E8NB 1BBDL 2VDOH 2BSRA 4K7PX 5KVFL 3ZHDA 4FP8L 4QHMB 2P5EA 3KYKH 1A7OL 4LF3A 1D5IL 1LEGB 1GZPB 2OM5A 4HWBH 4JAMA 1JYNA 2IPKB 2YPKB 4HIJA 5EIQA 2C1PA 4LKCB 3IFOB 4ONHA 4W4NA 1XGUA 3BUYB 3CFDB 2DM2A 3RTQD 5HGBB 3VXSD 1HEZB 3E8UH 3ILQC 1FCCA 3ARBC 4N8CH 4H8WH 1ZHKA 3UX9B 3S35H 1O7VA 4PJ5B 5F7LB 3RVWD 1VFMA 2YPLB 1PAMA 2JJWA 4L29A 4ZUTA 1FO0L 4PJFA 2V2TB 1P4BH 5CWSA 3RZCB 3TN0A 3MACH 5D7LD 4IS6A 5BRZD 3BP7B 2GEEA 1H0DA 3C2SA 1L6XA 2PW2B 2IWGA 2AKRA 2HT2C 3RWHA 1HILB 2CLRB 3WFBL 1WGOA 5ICXA 3FFCB 3ILPB 3DBXA 4ZFOA 1BAFH 2DYPD 3LKSA 5DA4A 5B4MD 2XA8L 1X5KA 5DJYB 1BZ7A 3TEUA 1RZJC 5KN5B 2HFGH 2YK1H 1KT2A 4KHTH 3WKNA 4O4YL 1V5JA 1FZKA 1H3XA 1RFDL 4MCZB 3MJ8B 3PV6B 4YDKH 4DN3L 1TJHL 4JFZH 4Y2DA 3VDAA 1G7LA 5C3TA 1LEGA 1LO4L 3HMXA 1UWEL 3OR7B 2CUMA 2YPKA 3OQ3B 1VACA 3RTQC 4KJQD 3ZL4H 1IGIL 4DUXA 3IT8D 1FH5H 1MCIA 4U0RB 3QUYA 3QA3B 1T1XA 2YRLA 2HRLA 5FKAA 3ARED 4I48A 5T3ZL 4ZODA 2A9NL 3RVWC 3QDJB 3VD4A 2G9HB 5F72S 4LSTL 1U9KA 3GSVA 3NGBC 1B3JA 5D96C 3ZLQC 4N8VA 5BXFB 5LXGH 4ORGA 4ZSOE 5EN2A 3QDAA 2HYMA 3PE9A 1TQCC 1J1XL 1HYSD 1Q9LA 3H3BC 3RZCA 4D8PB 2EZ0D 2LABA 5INDB 4PD4K 3BE1L 5C0BB 5CZXD 4C57C 1MAML 1MHPL 4N90D 1Q0YL 1HILA 3H9SB 3QXDA 1CTOA 3N50A 4HJJH 4NYLB 4U4BA 5IB5A 4Y4HC 3OKYA 1BQHG 5KG9B 2QKIA 5BZDB 5B4MC 1I8MA 3L7FB 5BZWB 3W11D 4ETQA 1DLHA 3TJEH 1N3NB 2AXGA 3FONB 4PP1D 2V6HA 3O6MH 4NHUB 4ZUSB 1NGPH 5KN5A 4Z7VB 3IJYB 4RZCB 4YEEA 3FN9A 3C5SB 2MMXA 5HHPB 3QUKB 4DAGL 1IC4L 3BQUA 1HXYB 1ZKAA 1HHKA 2X7LB 1MFAL 4I13B 3ARGB 3MJ8A 2XN9A 3PV6A 1CR9H 1HI6A 1MJUH 4D0BA 5DLML 1C8PA 1G9NC 1AXTH 4KJQC 1JBJA 2FNBA 3OR7A 1KV3A 1NAKL 1PKQA 3LQAC 1YYLL 3QA3A 1CBVL 1DVFD 4O9HH 4P59L 2XWTB 5DRXB 1C12B 3L5JA 1AI1H 2G9HA 3TT3L 5GGVH 4X5WB 2OMBA 5BXFA 3PHSA 3MA9L 1C5CH 5I1DA 2EDJA 2PUQT 2YMXL 3DYMA 1HYSC 1ZAGA 4L4TB 3VXSE 5F7UA 4M62H 5D1XA 2EZ0C 5D71H 1CE1L 3S96A 2EYRA 1T5XB 2YN5A 1ZVSB 4JFPB 5CZXC 4JO2L 5HVHC 5JW4Q 3G6DL 3ULVL 4PJGE 5DQ9B 1IBGH 4XNZB 3V5KB 2IBGA 3KPOB 4OCXL 4GRWB 4KK9D 4NYLA 4HZAA 1GC1C 1KCVH 1FC1A 3NTCH 1VGKA 3W11C 5BZDA 5DUMH 5CEZD 5D7LE 5BRZE 5D2LB 1U8OA 4G8IA 3SDXE 5D1QA 4PP1C 3M8OH 3GSXB 3FONA 3W82A 3U2SB 5JOEA 1I85C 4ZUSA 5KS9B 2DICA 3EFFB 2R2CA 1OW0C 4BH8B 3IJYA 4RZCA 5I1GH 4YBQD 2BY2A 3SE4A 1A1OA 3HAEG 3PWPB 1GHFL 5T5FL 3QUKA 5EO9B 1DBJH 3NPSC 1G7HB 5I6XC 15C8L 3ARGA 3C9NB 1F4AA 1MIEL 5JR1H 3F12B 5DVOA 1XFPA 1NBYB 5DD6B 5CEXB 1NCCH 2XNAB 3U0PA 3VXMB 3UTTE 1WITA 1DVFC 3L7EA 3JV4B 5DRXA 1E4WL 1FZJB 3WDIA 1C12A 3SGDH 2X9YA 3FN3A 2H41A 5A43C 4FQIH 2X10A 5EUOE 3TT1H 4WRLA 5DS8B 4Y16A 5FIEA 1NSNL 4RFNC 4ZFGL 2R0KL 1NMAL 4L4TA 1MFDL 4XI5C 3TH4T 1AY1L 3G5ZA 4L8BA 3BHBB 4Z0XA 3L3IA 3TLRA 3QEGH 4XCNA 1OP3H 1T1WB 4HH8A 1GGIL 4NKOA 3TA3C 4Y2OA 5C0CD 2YD9A 5ANME 3V5KA 4KK9C 2E6PA 3I6KA 4LOUC 2XQYG 5IKCB 3VXRD 5I73C 1Q72L 1A3LH 1ZLUH 2I07A 5D7SL 3RGHA 5D2LA 2BNQD 4AL8L 1M4KA 1AGFB 3R06B 4H1LG 3U2SA 3O3EB 5E1HB 4YBQC 4HKJB 2CIIB 2J1KA 4YX2H 2FATH 5ICYB 1FV1A 4M43H 4XXCC 3SE3C 3BJLA 4KPHL 5EO9A 3WFEH 2BHYA 3WUWB 1G7HA 4MQXC 4X98A 1BD2B 4A6YL 3F12A 5CZVL 4L8DA 2I9LB 1CDUA 3JWOH 1NCAH 3TYFA 1JF1B 3D3VA 5EB9A 1YQVL 4C58B 4LBEA 3QFJB 1CL7I 4DGVL 3KR3H 4O5LH 3MNWB 5I74B 5FYJL 1YY9C 1FZJA 5C0AD 3GSQA 12E8L 2M1KA 3K0WA 3CPLA 1P6AB 4HS6B 2Z4QA 2AEQL 4FS0A 4Q6IB 1ROWA 3ZTJH 3FJTA 2Q3ZA 2R4RL 4YBHA 2VITB 1PYWB 1RUAH 4LHUD 1QLRB 3LKNA 3T0ED 5D9SB 2VNCA 1BVZA 4GKNB 4JE4B 4CW1A 2BNRB 3HG1B 1I3RA 3LV3B 1I75A 1T1WA 5INCA 1X4XA 1T4KB 3D25A 1CXFA 1GXEA 2GK0A 3P30L 5FEBA 2VE6B 3C5ZA 1P84J 5CGYD 5GPRA 2OSLB 5IKCA 5IMKA 4WO4D 1J1PH 2F9BT 3D69B 1GCFA 3RA7H 3WUZA 1XGPB 4PJDB 5BJTB 1RZGB 3B9KB 4PRIA 5CBAB 1FFOA 2W07A 4K3JH 1AGFA 1D3CA 4W81A 5DD1L 4OLWL 1AD0A 5DA0B 5BCAA 4RWYL 4JKKA 1MFCL 3SGKC 4TULH 2CIIA 4L3ED 4M7LH 5TQ0H 4Y5VC 4HFUL 2Z8SA 3IU4H 3RNKB 5CEZE 4MX7A 2V9TA 1FFPB 1U6AH 4K2UH 3O2VH 4HC1L 4X4XB 2AW2A 4ZDHA 4GRLC 4OIBA 1NFDA 5DD3H 5FCUL 1NCUA 5H2BA 2WZPD 1JZ3A 2V7NA 2XG5A 2I9LA 4M8QB 4I8DA 4UT6L 4HQQH 5AG8A 2Y72A 3HZYB 2UY6A 4PB9L 2XT1B 3RGVD 2VXVH 3RAJH 3RQ3A 1MH5B 3K80A 3FQRA 4KV5F 2DQHL 3EKCA 4ODUB 3QFJA 2EE3A 4QKXB 1ZT1B 5J11C 2MCPH 4IMKA 1RIVL 1CFVH 3MNWA 5SV3A 2PETA 4P3CL 4RFOH 2NY6B 3S6CA 3BEWB 3CSGA 4NIKB 1EERB 3T0EC 3LS4L 3R0MA 4ODBD 4R97B 3BMVA 2W9DL 2FO4A 4HIHA 1T04A 1T4KA 1B0GB 2X89A 3OXSA 2VE6A 5CGYC 2RBLA 4FQLH 1HKLL 1TZGH 1KPVA 3LPWA 1J9CT 3U79A 1L9MA 4G6JL 1SJEB 3QQ4B 3V7AE 4KKBC 2CGRH 1HINH 2G5RA 3VFMB 3QO1B 1XGPA 3QUMH 5BJTA 5C0FA 1RZGA 1CDCA 3B9KA 3RU8L 4OLXL 3TESA 4LEXH 5C0CE 5EC1A 3LZFL 4JDTL 5T1MB 3GHBL 3FO0L 1QPPA 4YGVB 1R3LB 3PP3H 5DZOA 4UV4H 5DJCB 4X6DA 5HHNA 3VXRE 2HMID 3C87A 1J0HA 1S5IL 3RNKA 1F8TL 5GGRB 4PJHF 1MCPL 3TBWA 5HYSG 2H3NB 5JXED 2BNQE 5A40E 5F96L 1FGVL 3IGAA 1ZT4B 4ZYKB 1T2QL 5EU7E 3MRCB 2H8PB 3UBXB 2EKSB 4JEGB 3BP4B 3PG2A 3RGVC 2VLJD 4U1NA 3HZYA 2P5WE 3MJ9A 2OZ4A 4N5UA 2FH6A 3S8WA 1WISA 1JPSL 2IF7A 4ODUA 4MXVF 4TNWF 2V9QA 1MQ8A 4JM2C 3SO3C 1RZKL 2XTJD 4HKBA 2ZCLL 3BN3B 2A6DB 3BYYA 1C5BL 4R8WH 2ADIB 1A14L 2IAMD 3I2CH 5FKPB 3D5OF 1A7PH 1AXIB 2R56H 5DTFB 4NO3B 2B1HH 3NAAH 4G8GA 5ID1B 5C0AE 4OB5L 1IEAB 5LGHH 1XCQA 5ALCH 1B0GA 3IRPX 3IAPA 4WHYH 4LIQL 6CGTA 2ZJSH 3PIQA 5E6YA