1UCBH

Structure of uncomplexed fab compared to complex (1cly, 1clz)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
219
Chain Sequence
EVNLVESGGGLVQPGGSLKVSCVTSGFTFSDYYMYWVRQTPEKRLEWVAYISQGGDITDYPDTVKGRFTISRDNAKNSLYLQMSRLKSEDTAMYYCARGLDDGAWFAYWGQGTLVTVSVASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of the uncomplexed anti-tumor antibody BR96 and comparison with its antigen-bound form.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
molecule keywords CHIMERIC HUMAN/MOUSE IGG FAB FRAGMENT BR96
total genus 43
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1996-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ucbH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ucbH01
3O4LB 1I9RL 4ZO6A 4JRWA 5I76B 1YECH 3RTQC 5D1XA 2XKNA 1CQKA 5BZDA 1GVIA 1JUFA 3L3KB 1HYRC 3MZGB 4MDJB 4UILL 2EC9T 2YK1L 1U8QA 3GBML 4OBRA 1UEMA 4LDOB 3FQRA 4R7DA 3BZ4A 3ZMRA 2R0LL 3P11H 3G6JE 4ODSH 2J5LB 4CVZB 3RUGB 5JZ7D 1DBKH 1C5CH 1U3ZA 4I48B 2EDRA 2WK2A 2X89D 4N0FB 4YR6A 4AM0A 4NN6C 1H3XA 4WGWB 4QXWA 3ARSA 4N5UA 1AD0B 4LARH 1XF5A 4Y2DD 4YNYB 1CE1H 3A0OA 4YDKL 2KL6A 5TF1H 2K7PA 3JVGC 3L95B 3NFNB 3D87B 5F7DA 3WUZA 4ZUUB 3HI1A 5DJ6B 1CICA 2X4NB 4S1DC 4YNYA 2KZWA 4NM4L 2W65B 3W9DB 1F2QA 1UVQA 2F54E 3FFCD 5HHVL 5TE7L 4FFWD 3TYFB 4UB0H 2JB6A 4IRZL 4CVZA 1YPZE 4JM4H 3VI3E 3MRCA 4RWYH 1QRKA 3EIFA 3CNKA 5B3JE 2R39A 5IB4B 3QT2A 3IRPX 2C3XA 3E8UL 4WNQB 1I1YB 2WP3T 3S88L 2VLKE 4U6HA 3RZCC 2R15A 5C0JA 1WT5A 1OP3H 3KPOB 1CGSL 4JAMB 2FGWH 5B22A 4H0HB 5LCVL 1S9WA 3LEXA 5AG9A 4KK6D 5D1XB 1KB5L 4HCRH 3T2OA 4P2QB 3T0EA 3TH4T 3TH2T 3IAGC 4QEGA 2LFGA 3QH3B 3U46B 1ND0B 3C5JB 3MA7A 1KCUH 1WITA 3NPSB 5M94B 3SDXE 3ZO0A 3GBNL 4F15B 3C60A 4UTBH 3CFCH 4Z7UF 3QEQA 4Y4FB 4V1DD 3V4UL 1CF8H 3VDCA 3UAJC 1MQKL 4HCRA 4TQEL 1Z9MA 5F1KC 4WI8A 4QHMB 4DKDC 2AK4A 3SGKC 4YHML 1NGXB 5CEYA 1QYGH 4HK0A 1AKJA 3FB5A 2Q87A 4YFEA 4JM2B 2DL2A 1FFOB 1A6TA 3VGGA 1AP2B 5D7LB 2VDKL 4U2YA 4KJYB 4I0PA 3MUHL 1W0WA 3DGCR 2X4TA 4U2ZA 4BUGA 1UWGL 2NY4B 3ULUC 2BOCB 1OAZL 4PG9B 4KJYA 1WF5A 4YQXH 2IAMB 5FO7B 3VFTA 1JUFB 3U9UB 4DW2L 4OI7A 1HYSD 3V9FA 3ESVF 4HLJA 4MJID 3SDAC 5CKGA 1DQLH 2AK4B 5GS1B 1JV5B 2OJZL 1PY9A 5H8DA 4NQEB 1IE5A 5EOCH 1CXKA 3QUXB 3H0TB 2V9QA 5KTEH 3D48R 2ED8A 4ENED 1K8DB 3RVTD 2NZ9D 1T20A 2ZCHH 5HYIA 2P8LB 5KZCB 1KUMA 3STZB 1J1OH 2XY2A 4NO0A 2BSRA 5DXWA 2F53E 4A6YA 4MJ5B 4PJ7E 5TE6H 2PYED 1EH9A 3MUGA 3BKYH 1KPUB 4FQIL 3DVNA 5FFLA 2YUXA 4F9LC 4MJIB 2VDQL 4G6AC 4HJGA 2AK4D 4H25B 5FOJA 2GJ6E 4NZTL 4Z5RB 4RMRA 2IPKA 3WN5B 3BFOA 4GRLD 4XAWH 3RAJL 5EBLA 4IIQA 3PNWA 2Y36L 4M7LL 1CR9H 3V5KA 2VKWA 4L3EB 2AI0L 2XICA 5DJDA 4P5KB 1U8NB 2H8PB 4P23B 4G8IA 4IIQC 5HYJD 4WEBL 2DM2A 1M1SA 1H9VA 4OIBA 3DVGB 3SGEI 1KV3A 3TFKC 3VXPB 1JGDB 4WUKL 2DQJL 5EUOF 5HHOD 3W39B 2Z4QA 3OXSA 5DVMA 5I1CL 1T2XA 1GZPA 3RY6A 1IGCH 4LSVL 5IW1A 2HN7A 2V2WB 4MDIB 1IQDA 1R6VA 4MAYD 3WJLA 2C3VA 2Z8VC 4D3CH 2HFEA 3O2WH 2NZ9C 3RUGA 5IVXE 3QFDB 2XA3A 3OGOE 4K3EH 5GISL 1DQML 2NY2D 1AIFB 1WZ1L 5DJ0B 3U1SL 5L2KB 2GK2A 2JCCA 4PJEE 1QSEE 1NFDB 4K9EC 4J4PD 4G6KH 1RJZA 3QFDA 3NCFB 5D96B 2VISA 1OHQA 5C0BE 5F88A 3MRNB 3T2PA 1DL7H 1D9KD 1MFBH 4LLYA 2YPLB 1VENA 2VDLL 3B9VA 4FMKA 1KELL 1PFCA 3FQWA 5GRUL 4AEEA 3R0MA 3PDOB 4GT7A 2WAHA 3OAZH 4I2XB 2JE8A 2XN9D 2MWCA 3QHFL 5IB1A 3OF6A 4X7DC 1GSMA 2AP2A 2WM0A 4FP8H 1ZGLA 5IHUL 3GSNA 5T1DL 3ZE1E 2OQJB 1JPFA 5ID0B 4G6AD 3VXQA 1ZTXH 4QY8B 3IETA 4JPWH 2X09A 1QKZH 4PJAB 1C5DB 4MJ6A 4OGXH 4PPTA 4X7TB 5DJDB 4WFGD 1I4FA 5GGRB 3TT3L 1F11A 3OJ2C 5EIQA 1IBGL 1A5FH 5TE4H 3W0WB 3AMLA 3VFOA 3U0TB 4PJ8B 4AT6B 3B2UC 1T1XB 4EDWL 3CH1B 4OTXL 4HJJL 4JFQB 3W0WA 4TSAL 3HAEA 4MVBC 3BOVA 3EYFB 3RVVC 1JZ8A 3L1OH 4NO2A 5CMAB 4D9LH 4LASL 1F3DH 1EEZB 2UZXB 1WWBX 5DJZB 1JHTB 2ADIA 2ATPA 2R23A 1G7JA 1QBML 2E27H 4CW1B 5IHBA 5T3ZD 2Q7YA 4P46D 4Y1AA 2ZUVA 4ZUSA 5IHZA 4XX1G 3QFJE 5TGBA 4N0CC 1P4BH 2VN4A 4G8IB 1FL6A 4L9LC 3QG7H 1Q9KA 1JYNA 4UMGA 3STBA 5C0CD 5EIVA 1JFQL 1DUYB 1JZ7A 5SWSD 3CJJA 3L3HA 4YX2H 3H42H 4JFXA 2A74A 5D7SL 1TPXC 2JCCB 1AGFB 4PJHB 2MPAL 2CMRH 3MGTA 5F8QC 1CK0H 3WUWG 2ERJC 2F53B 2ARJB 1UZ6F 1CXHA 3TA3D 2FJGA 1VFMA 3QUZC 3S37X 4X9FA 2YN3A 2MCPL 1IFHH 3SJVB 5KN5A 1JHKH 4R8WH 2IQ9L 1YNKH 2FO4A 3E2HC 3ULUH 1FL6B 2VJXA 4RFEA 2VABA 3MLZL 4PG2A 5FYKH 4Y16B 2XPGA 4OUUA 5D5ME 5ICXB 3WJJA 4I4WA 1GCFA 4P23C 5CGMA 5JA8B 2DIAA 2VAAA 2I07A 4JY6B 2B4CC 1VGEH 4BFEA 1RUPH 3BJLA 4NUGH 2I9TB 1DEEA 2GT9A 3D0LB 1UXSB 3MACL 2EDKA 4RRPA 1ZWIA 3C6LB 3UYRL 3FRPA 4XNXL 3HRPA 4HKJA 2FZ3B 4O5LL 4U1KB 4XNYH 2W92A 5DFTA 4F2MA 1X4ZA 5FYLD 3TN0D 4RA0C 5F9JA 3OKOB 5DRXA 5EZIH 4GUPA 1U8JB 5MEQB 1A3QA 2IBGA 5CKAA 5AZ2H 4UIKH 3UTTA 5DEZA 5DVKA 5TDNB 3H6JA 1KBGL 2L4OA 4GSDL 1MRDH 1DBJL 1H3VA 2RB8A 5DJ2B 1Q1JH 5IT2L 1BFSA 3L3IA 1OSZB 4N9GB 5KSAD 1QSFB 4F9PA 1QSFE 2CDFB 1B2WL 3S35X 3D85A 4JRXB 2GTWA 4PJBB 5ALCL 2BDNL 2D03L 4LOUC 4OZFA 4PJEA 1QSEA 3CX2A 4Z78B 1FVEA 1A9BA 5JHDB 1M6OB 3DUSA 3QQ4A 4FQPA 3KDMA 4U6VL 3ZKXB 1L6XA 1F3RB 1FAIL 3DX7B 1GZQB 4NQDD 1JNHA 1TJGH 3GSOA 3PDOA 5D5MF 3RWDA 4YDLB 1FDLL 3BP7B 2XY1A 5E94B 4PJ9B 5HYQB 1DE4B 4PJXE 5IEHB 3CUPA 5D72L 5T1MB 2JIXB 3DVFA 2YUVA 3H3BC 3O6LL 5GS0L 3C09C 3MRNA 4XBEL 3VD9A 1EEQA 4NHUA 4I18C 3MV7B 3BP5A 5GGVH 3QUZA 2FH8A 3LQAL 2Y25A 2C1OB 1I9IL 3T04D 3MLUL 3J8F7 3DV6A 2XI9A 3RUGF 5DFWH 4OCWL 5H2BB 5HD8D 3QEHA 1CGSH 5DDHB 2CJUH 2ZUTA 5I1EL 4PG2C 4ZOEA 5LCVH 5CZXD 3UTSB 3DLQR 2R4SL 2WUCL 2Y6SD 1YEJL 3VWJB 3TYFA 5J12C 3WFBL 1JYXA 3KPNB 4YE4L 2X6MA 3VXSB 4CKVX 1FNSL 5FUOH 4HMDA 5JW3H 1FVCB 3NPSC 3BZEA 1MCFA 1G6RL 1U91A 5DK2A 3CDGB 3HZVA 1OCWL 4X6DF 1NSNL 3MV7D 1I85A 4YAQB 4LEOA 2PETA 2GITA 1HINH 3O45B 1NANH 3SHSA 3KLHD 3ZT5A 5IV2A 4RRPG 1N5AB 4LMQI 3FJTA 3MRIA 5F6IB 4AM0B 1WAAE 1QPPA 2CGRL 5DQ9A 2MFNA 3V5DB 1UACL 1NBVL 3INUL 3PL6D 3VXRE 1I9JL 4HUUA 3MO1A 2N56A 2YA2A 5EH1A 1RZKL 1OSPH 2DQTH 4N8VG 1MRFL 3QQ9D 2NR6D 5F70A 3EZJB 2AJUH 4KKLD 1AGEA 1QFPA 4JDVB 4QRPE 4NKOB 1X4XA 3MROB 4HIHA 4M61A 3ARTA 1KJMB 2PF6A 1BBDL 5DUBA 2NY0C 3SOBL 4Q2ZA 2J2ZA 1I1CA 3HRZB 2EDXA 4XNUH 1N5AA 3FT4B 1T7XA 3BIKA 1OGTA 2WINB 5IMLB 4XB8A 2LV4A 1NGPL 3GJEA 2H2PD 4MJ2A 3CDGA 3HZVB 1A2YB 2Y7QA 5DRZA 2FECI 1Q72L 3MJ9A 1OF2B 2F9BT 5AAMA 1FCGA 4F7EB 1MCEA 2QTEA 1ZVHA 1E4XL 3ROOB 4PJXA 3UAJD 3SKJH 2O61A 1TZHB 4GRMA 1P5UA 4LBEB 3P4LA 1NH6A 3UZQA 4LLAA 1Q8MA 4M00A 4YHOL 4DKAA 3Q1SL 1MAJA 5D2LA 4MA8L 4L4VE 4ZD3H 3GBMH 3L7EB 5HPOA 4K2UH 4WHYH 1RD6A 3ZDZF 2H32A 2P48B 3X13B 2QKIB 4Z7WA 5F89A 3MMEA 1HXYB 3OG4B 3T1WA 4J3VA 5CJOH 5CIPH 4RNRA 5GJSL 5DQ9B 1V05A 3FO2A 3MV9A 4WI6A 4U1GB 5D7IB 4HUKB 5T5FH 1KCLA 2Q7NA 5C9JA 3NA9L 2VXSL 3OKLB 4TUOA 2AK1H 3BGMA 3OB0K 4Q6IB 4AL8L 3O0RL 1BREA 2O5ZH 3NIFF 5DJAB 5C0AE 1FYHB 1YECL 3JUZA 4P2QE 3ZT7A 5JQ6H 1F4HA 1BLNA 1DZBA 1KLUA 4Z18A 2DB8A 3FQXB 2YD8A 5CEZH 2WANA 3DMMB 3VXMB 3HAEB 4QOKA 1WAAA 2YZ1A 4Q2ZB 4EUPB 4E0RB 3QFJB 4KKNA 3P4OB 1IILE 4ODHH 5ACLA 4IRSD 4QNPF 1LE9A 1CT8B 1R5IB 4AQ1B 1E4WH 2E6QA 3RVUD 3DV6B 3NTCH 3LSOA 3OAYH 4ODSL 4QXUL 2E7HA 3KG5A 3QP3A 1IZJA 1VFAB 1X5AA 5EWIH 1KC5L 5C0BA 2AV7A 1T5XB 3FQRB 2ZNWA 1S7TB 2XFXB 1LD9A 1MFAH 4JLRB 4HK3N 2DMCA 1R5WB 2NY4D 4U1LA 3NIDF 3LEVH 1FPTL 3LH2L 1XGRB 1JE6A 2BVPA 1XH3A 1JGEB 3T1FA 1JPFB 3D2UB 2XZZA 5JHLL 2BMKB 4NO5B 1NCAH 5EIIB 3RWEB 4PJIF 4UB0L 3TO4C 4P3CH 4LNRA 3SGDI 1J9CT 4E41A 1JGLL 5B39G 4JM4L 1N0LA 4NO2B 5HHMB 5KW9H 3BZEB 3RGVA 1KCRH 1YMHA 4IOFC 1MRCH 4NDMB 5AD0A 1UWXH 2W59A 3W5MA 4K7PL 2BNRA 1FL5A 1CFNA 4G42B 4PJBF 4C56D 2A6JB 4I2XE 3QZWG 2YSSB 2EXYD 3HUJB 2H1PL 3MYZA 5IVOA 1A14L 1LGVA 1NCCH 3RX7A 3RVWC 2DBLL 5CJBA 3RWGA 2VDMH 3A67L 3KYAA 4HUXA 3O4LE 3CFJA 1ED3A 4YQXL 2VXTL 5ETUB 1AHWA 4K7PY 5HHQB 2DF3A 3FB7B 3Q48A 3MODH 4R4FH 5I66B 2ZCKH 4U0QB 3GMRA 3QISA 4RX4D 2NY6B 4L3EE 2C26A 1X5IA 5EU6A 4MGXA 4U0RB 5AAWA 3QXUA 3BP6A 1IGML 4FQJL 2H26B 4C59B 3RWEA 3WJLC 1T4KB 1QYGL 1KULA 3U2SB 1PEWA 2ZCHL 2X4UA 4ELKA 5JW4Q 4EOWL 4GKSB 4TPRH 1Z5LA 3SE8H 4FQ1H 5C0GA 3KYNA 4ODBD 1Y6NR 4Z7OF 3S3SA 4NRXB 3RUGE 1J8HB 3L9RB 5KVFL 5DC4B 1AXTH 4JO2H 5E5MA 3PNWB 12E8H 1I8KB 2E7CA 5EBMB 1KPRB 1BBJA 2EEAA 4PRIE 4G3YL 1BQHA 1KJ2H 3UTTB 5T1KD 1D5BB 1CDHA 3LDBC 4DW2H 5ISZB 3FB8B 3Q5OA 5AUMA 3RVTC 5EOTA 4RMQA 4JFXB 3RHWK 1FO0L 1SEQL 2DD8L 1KB9J 3M8OL 2GK0B 1WBZA 3EFDL 3OAZK 1IFHL 1T0MA 4P4KA 4HWZB 5C1MB 1MWAB 3VE0A 3VWJC 1YNKL 5ACMA 4UOW1 3V0WH 4MQSB 1ZHNB 5ICZB 5F97E 4XCEB 4BQ8A 5IOPA 1T21A 1UXSA 3P4MA 3V8OA 1J88A 5D1QB 1KENL 1QQDB 4KQ3H 2VLKB 4IMKC 3U30B 4X98B 3WKMH 4N8PA 3H7BA 1ZA3A 4QGTA 3GMNA 5IB3B 1PVHA 3UYRH 5KN5B 3X13A 1U8OB 3TN0B 4P46C 4XAWL 1RU9H 4HWEL 4RFNC 4PJDA 5C0DA 2CPCA 3RAJH 3N0PB 2ITDA 4QHNB 3MNWB 4K3EL 4X6FB 3ILQC 1WFNA 4JFQA 4WW2B 1A6AA 4GKNA 2P5WB 3G6AB 5E8PB 3VFSB 1HI6B 3VXUE 3BMVA 4X6CE 2I60H 2APVA 1NKOA 4G6KL 5GQBA 5E8NB 1MHEA 2NY1C 3V4VL 1MHHB 3CVIL 3DXAD 3JWDL 1HSBB 4AMKH 1LDPH 2HTKC 1FL5B 4WFGE 1JGVH 1WIUA 4YFDB 1TNNA 1G6RA 1FCCA 4RMVA 3GKWL 2FX8H 6CGTA 4I5BA 5J11C 1U36A 4NBYB 3NA4A 3PWVA 4UINL 5I71C 1N6VA 4U1IB 4XP6H 5FA3B 5JORA 3K8MA 4ISVB 4ELME 1QFOA 2ICCA 3I85A 5IK3A 2VXUL 1P2CB 3BKCL 5L7XH 2R0WH 2W60B 2X10A 4W6YB 1F02I 2EE6A 2X9XA 5D7KE 3KPSD 5GISH 4OLEA 4WO4D 1U8NA 5DD3L 3EOAA 2C9AA 5EOQL 1UQSB 3BHBB 4YHPB 5DMGD 2EE3A 4Y2OA 1T7YA 1G7MA 2ZG1A 2BVQA 1A5FL 2D31B 4I0PC 1GPOH 4XMPH 5C0CB 3TV3H 5D1ZA 3ECBA 4MNGB 2CLZB 3O3EB 5FM5M 1PLGL 1BMGA 3U0TA 1YJDC 4JHAH 4OCWH 3SDCC 3BEVB 5GRUH 2BNRE 3OKKB 4PRDB 4OGAD 3CK0L 1Q9WB 4PJXB 2FWOB 2V2WA 4MDIA 1YEJH 4GAFB 1JN6B 4KAQL 2A2QT 4DKEL 1AFVL 2MNUA 5DMIH 4J4PC 4Q6IC 4U49A 5FUOL 5IHUH 3LRHA 3BPNB 1XR8B 1I3RA 2OZ4A 1WBYA 1F4XH 4CBPA 1URLA 5HGDB 2Y06H 2PR4L 1T6WA 4JPWL 2FB4L 3T8XA 4LPTA 1NANI 1X4YA 4OLUH 3CDYA 3OX8A 5IB1B 1HOCA 4X7CC 3BIBX 3U4EA 1NDGA 4MAYC 3VWKC 5F1SA 5C0AB 3BQUA 1PG7W 3ETBF 3ZHDA 1FHGA 4NHCL 1H0DA 3C08H 4BSWB 4PJEF 1SEBB 3FQNB 3L3JB 4I0KA 4FQXD 4WW1B 5A3IC 3ARZA 3QNXA 3MROA 4HIHB 5C3TA 1ZT1B 3SO3B 1CE6B 1G7PB 4MA3B 3BZ4B 1RZKH 4YX2L 1MRFH 4R3SA 4WNQA 4S2SA 3F7YA 4KZDL 5B8CC 5EU6E 3MBED 2Q3AA 3KPRB 1UB6B 1RK1A 3PDDA 4W6XB 1LEIA 1CK0L 4R4NC 1EHNA 1YQVH 3MOAH 4GRWE 4J12A 1VPOL 3DROA 1A22B 1KYOK 5BS0E 2SEBB 4LLUB 5CWSA 3MJGX 1AQDA 1ADQA 3TEUA 2KZ1B 3UJIH 5IVXB 1TVDA 3DUUB 4ZUUA 1I1FA 3DMMA 4OFIA 4MNHB 4JRXD 4PV8A 2JJVA 1WC7B 4EVNA 1D9KB 5D7JC 5CJ5A 1OGTB 1MFNA 3DUUA 3K81A 1XF5B 4HKBB 3QXVA 2KBGA 4P2OC 4POYA 3LD8B 4LSPL 1EGJA 4G5ZL 4HWBL 5HDLA 5H94B 1R3IL 4DUXA 2VZVA 3BGFC 4LGPB 2MPAH 5FUZL 1CGWA 4UU9B 1FG2A 1PZ5A 2XN9B 4JQIH 4MWFA 2EYSA 3GNMH 4U1SB 1TJIL 4HKZB 1JWMA 3MRFA 1XF4A 2X40A 3MLSH 1U8LB 3HPJB 3R4DA 1DANU 4QRRE 1BQUA 5AZ2L 3PWPD 3RWFB 2OXGA 4ZS7H 3MLZH 5FYKL 4HZAA 3QI9A 3BVNB 2VITA 1AKJB 3ZKSD 5IT2H 3D25A 4JFHD 5C6PB 2VWEE 3WUWA 4LHJB 1I8MA 2W65A 2IFFL 3VWKA 1JK8A 3PQYB 2YPVH 1HHJA 4KQ4H 4HKXA 4V2CB 3LQAC 4I4WB 1P9MC 1XMWA 4MNHA 4LHQB 2CKBB 2JLLA 3P9MA 1JK8B 4LLVA 5DI8B 3VXSA 3MRRA 2VLJA 5B8CB 2BX5A 1NCBH 3KPSA 3LKQA 3NOIA 4G8GD 4X4MA 3RA7L 5I75C 4LLWA 3WHE1 4MMZC 5C2UB 5A2FA 1T04B 2EC9U 3AREB 3IFNH 1YEDA 1CDJA 5T5NG 1YEIH 1YEGL 2L0DA 4KH2A 4QHUA 3AXLB 3BRDA 3CXDH 2X41A 4AJ0A 5DF0A 4IOSD 3MLUH 4Z77B 2E7LC 2MSPA 1CVRA 3S7GA 4JFPA 2ORBH 4M7JL 1U92A 2VDOH 4FABL 3LEVL 4BZ1H 5FHBH 1A1MB 5IVZA 5FDWB 4R90L 5T33L 4NM8H 3UTQB 2J3SA 3G5VB 1S7UB 2HT4D 4G8GB 1DVFD 4P3WA 2BSED 4OD3L 1OAXH 1T80A 2AV1A 3B43A 5J1SC 3P4NB 4GLRI 1NCAL 1P1ZB 2F53D 4MD5B 3O41B 4JY6A 1FJ1B 1QQDA 4RX4A 3S5LB 3PXJA 1A9BB 2XZCH 4HAFA 2ICES 4M4RA 5FIEA 3P9WB 1U8KB 3BDXA 3P30L 3EYOA 3VG9C 1M7DB 3I2CL 4L4TA 1PD6A 4F7TB 2OK0L 5D6CA 3KYOA 4Z76A 5HGHA 2HJKA 3IDNA 4PRHB 4XP9H 2XOTA 3VXNA 3OKKA 3ZTNH 4D2NA 3TVMB 4LVNC 1K4DB 2APWA 3IGAA 4XT1C 2DDQL 2BRRL 3PGCA 5BVJB 1FNEB 2XNAB 1OQOA 4Y2DB 2BVEA 4WRLA 2V2XA 4PJGF 3G5XB 1WAAF 4KJWC 2ICEA 3MUY1 1IAIH 3WFBH 4YHYB 1PGRB 4MA3A 3H2WA 4MNQB 3A6BL 3BDYH 4HGWB 4U1KA 4HW6A 5FK9B 1JPGB 1IKNC 4CJ1A 4ORZC 1C5DA 4MJ6B 1T1YA 4C54A 1OCWH 3UBXA 1S9YB 5DC0A 3TJHD 4XNUL 3Q6FA 3LIZL 2EIEA 4O51B 4Y4HA 3QQ9C 1KEGH 5EDXA 2R2CA 4DJMA 1A4KB 1IGMH 4JCMA 2EYTB 4PJ5E 2KH2B 2R23B 3WIIL 3QWQB 3NIGF 1RK0A 1C12B 1JPSL 2EKSB 4YXKH 3INUH 1KNOB 3NIGE 3GJFH 3KS0J 5I8CB 4M93B 3HZKB 3KPQA 4QKXB 5SV4A 3ME0A 4N1EA 2YD1A 2AEWA 2OJEA 4HZLA 4ODWA 5F6IC 4L4JA 1GAFL 3SKOB 3ZDXF 2IBBA 1OD7A 3AAZB 1CGTA 3LPFA 3ULSA 5C0BD 3NBNA 4G3YH 5E8OA 3DX8B 1M4KA 4HJ0D 1TNMA 3VU2A 1S9VA 4QWWC 4ZD3L 4EBQL 1NAKL 3TIEA 2APBA 4IHOB 4MQ7B 3C9NA 1XF1A 4F37K 3TCXA 4OFYD 5GRJH 4HC1A 1BQHB 4M43L 3MUJA 3O9WC 4F2MB 1J05B 4GW5A 2A83B 5BJTA 2EE9A 3S97C 1OAYL 3NACL 3CLEL 3LY6A 3OZ9H 2EZ0C 4PJIB 1LP9E 5I8CA 1QSZA 1G1CA 1IC1A 1TCRA 3HPLB 5D5MA 5E2UH 4UAOC 4LNRB 2IPUK 4NZJA 1XFPA 1LILA 1F4AA 4M1CD 3MJ8A 5MEPB 1MCLA 1OW0A 5ILTL 4ZFGL 3HC3H 3LN5B 3MLTB 4XNMB 5JQHC 1MIMH 3D85D 3ZDYE 1JWSB 4P4KB 3OKEB 4S0SD 1IEBA 1DSFH 1R5WA 2DJ4A 1TTFA 5I2IA 1XIWA 4M6OL 2NX5E 3SCMA 3LRSB 4XAKD 5MHSD 1IKNA 4L29A 2CK0H 4N1HB 4IJ3B 5IEKB 1Z6JT 1CT8A 5GRVL 2XQBH 4NCC2 2VUYA 1VACB 2AK1L 1XIWC 3O0RH 2YD5A 4JANA 4R2GB 3MOBH 5T3ZE 4OGAC 4WW2F 4PRID 4JQXA 3O3UN 2WW8A 4ZTPL 3OSKA 2MMXA 3GSQB 4JE4B 5DHVH 4UINH 2AEIT 5BMFL 5JHLH 3IFLL 3OV6A 1A0QH 5FYJL 3R06A 4XBGA 1U3JA 2Z35B 2CKBH 1IC5L 2V9TA 5I9QC 5FGCE 4PJ5A 1DN0B 3QUKB 4WDIB 4YK4B 3RRQA 2X70B 2NXYD 1JGLH 1HNFA 3E0GA 5I1HH 3WN5C 1S9YA 2Z9TA 4NT6A 2ZCLL 1N0XL 4QRSA 2O5XH 5DWUL 4M6NH 3QEGL 1UXWB 3UTZB 4L3ED 4LFHD 3MFGB 2XKSA 5DSCB 2DLHA 1CLZH 1J8HD 3CH8A 2IALB 4JPKH 1UB5B 2FO1A 3BE1H 5EOTB 3HMWH 2IQAA 2HT2D 3FMGH 5DVOA 1VFAA 3OAUL 2R56H 1NCCL 2VSCA 1X6NA 1LVEA 2DBLH 2RIKA 1C8PA 4OIAA 4M8VA 3VFPA 3A67H 3A6CL 4OFDA 3CSYB 2BSTB 4PRHE 2BHUA 3DARA 1MEXH 1OPGH 3MODL 1AC6A 1PEZA 3CFEB 2DL9A 1NCTA 3WMSA 1NC4A 3HNVH 1PSKL 4OM0L 3HE6D 3VD3A 5K9OA 5JW5B 1NMAH 3IJSA 1NAMH 2Y06L 3RKDC 4BK4A 1JNLL 1X6LA 5F3BA 2R9HC 2J8UF 1JYWA 1L7TH 1S7QB 7FABL 3F6IA 4QHLB 1SJHB 1LEGA 4EOWH 3BP4B 4H1LH 1FL3B 4ERSL 1NAMA 3IB4A 3BW9B 1XH3B 3RZCA 3U9UA 3Q5YA 4CRPA 5AZEH 3V5KB 1AXTL 2RCSH 3MRKB 3X11A 5LKNA 5KVEL 5L9DL 1DFBL 1XGQB 3QCUH 3TGXA 1K5NB 1CVSC 1P69B 5D2LB 3RVVD 5DRWA 2EYSB 4GBXB 4IBLT 3DMMC 5DFVC 4O4YL 3ZE1F 5DJXB 5DJYA 5E4IA 4DK6A 2DQIL 4WCYL 3BGAA 5HHXL 4JRXE 4A6YB 1MVUB 1ETZB 3SDAA 3D3VB 2Z92A 4PJFB 2JJWA 1MIEH 4LCYA 3GSNH 3DETD 1T66C 4P3DA 1V7NL 1DN2A 1Y18B 4JFEA 1LO0H 1LWRA 3DHJA 3DWTA 2XTJE 3V79C 4OLYL 1Q94A 2EH7L 1ULVA 3O3DA 1NGWB 4OLXH 1KJ2L 5BXFB 4YHIB 2Q20A 2YEZB 4G80A 1HK6A 4MB3A 1RJYB 5D1ZD 1TETL 1G9MC 4JFOA 3VFMA 4HG4K 4YK4C 4LPXA 3BPCB 3CC5A 5FO9B 4HXAH 4I9WD 2V2XB 5JW4M 4ONGH 3PGDA 5IFAL 4L8BB 4OLVH 3NCJL 3MC0A 1CZ8L 1RJYA 3ZYZA 5IB2B 1R5IA 2X89A 3V4VH 2Y07L 1G7IA 4PJGB 1HH9B 4F8QA 2X4OB 1KENH 5HYJB 3F7VA 2LQRA 1U3HD 5E2WL 4H8WH 1EXUA 1JNHB 4JFFD 3BRGC 2W9EH 4QOKD 4AIXA 2HLFD 2B5IB 3OX8B 1K8DA 3LB6D 4KFZC 1XAUA 3L95A 3KHQA 3ARRA 3NFNA 3QRFM 4GOSA 4R26L 1MJ8L 3ARVA 3KPLA 4FQ2H 3CXHJ 4H0GA 3QG6B 1BZ9A 1CD1B 2OR9L 1BM3L 5DJ2A 5GGUB 5I8KL 4R4BA 4XXDB 3BSZL 3RTQD 4F57L 3KPMB 5I6XC 5C07B 2Q8BH 4KZEL 1UB6A 3ZTJG 2F8XC 1GGIL 2XRAL 4Y5YC 1JGVL 3C5ZD 4NKDA 3TBTB 3O6KH 2G60L 4U0RC 3BP5B 4OZIA 4IDJL 2LU4A 1N7ML 4G8EB 4GJTB 3QIBC 2IGFL 3L3KA 3S35H 1NFDE 3QDJB 4RBPK 4XP6L 5CBAA 2X4SA 5BRZB 1BD2B 1BVZA 2A9ML 3LKQB 4HIJA 4AG4H 2H32H 1OAXL 2PNDA 4F3FB 4NOFA 4DN3L 2GFBB 2R0WL 4QHLA 2PTTA 3FZUD 4U1NA 1ZLWK 3FT2B 3WJJC 1F4XL 3F8UB 5JHDA 1N4XH 4HJ0C 4UDTA 1AQKH 4PRBA 3RVWD 2DIBA 3RKPA 4Y0GA 2BXZA 4OLUL 2FDBP 1S8DB 5CLTA 4S10A 4U1NB 4QYOB 1R0AL 1XGPA 2K1MA 4NHCH 1MVUA 5IMKA 4NGHL 2NY5H 5EFIA 2BCKA 1A6VH 4PY7B 5CAYB 3O3BB 2BSTA 1GIGL 4LVHC 2P49B 5EC2A 1QLEL 3JXAA 3ARBB 2EDJA 4P2RB 2XXCB 1RZ8B 1JGUH 1CLOH 2J4WL 4HF5L 1KCVL 4RZCA 1YPZB 5DJCB 4WWKB 4KAQH 5FM5O 1UCBL 1CFVL 3V6ZB 2P8PA 4ZODA 5FKAA 3KHOA 3PJSA 4WUUA 4TNWK 2XZAL 1ACZA 3IS1X 4LKXA 2K3TA 2DQDH 4IRSB 1MH5A 5IW3A 3LZFH 4S1QL 3GO1H 4PJ5D 4IRJA 4NFCA 3GJFB 5JO5A 4PP1D 5A16B 1I3GL 1U58B 1QOKA 1HE7A 2WV3A 3SDDC 4JCLA 2W9LA 4H26B 4F33B 1UWEL 5F9AC 4P2RD 1T21B 1VFBB 2AJXH 4ZNEE 4DK3A 2FATL 3W9EA 4JRXA 4HMEA 5C09B 1K4CB 5E99L 4DN4H 4Y5YA 2NCMA 1FP5A 1WBZB 4LLDB 2FJHA 5IBTH 4U7SA 3MCKA 4NCC1 2V9RA 5ESVB 5L88H 3BT2H 3WLWC 1YQVL 3BD3A 3ARDD 4PR5B 2UUDK 3GKZA 4HUVA 2E9WA 1AGFA 1ONQB 4KRMB 5F93C 3MCLH 1CTNA 4YDLC 3WIFA 4OCMC 2GJ6A 1NCUA 3C2AH 4O58L 5JLZA 1RZFH 5GJTL 2VDRL 4RSVA 5B38B 3NAAH 3ZL4H 2X1QA 1UG9A 3DIFB 3FHQA 4JGMA 4PGBA 4XC1H 5ADOL 4JDZB 4MVBD 3GSOB 1KCKA 1YMMD 4XMKH 2X70A 3MRQA 4Y1AB 2XA8H 1MHCA 2H26A 1BQHG 1HOCB 2GY7B 2YRZA 1YEKL 3TPUA 3QNZB 1R3IH 4C55A 3HPLA 5D5MB 4ZNCD 5INCB 3BD4A 3PUCA 5EN2B 3AREC 4HHAB 2DQCL 3QO0A 1LK2B 3HI6L 1D5ZA 3QIWB 1NCBL 3UCRA 1OD9A 4NUJA 5CSZB 5ID1A 4O02H 5F88B 2C7UB 2XV6B 4OCSH 1ZSDB 5B4MC 1RURL 3B9KA 1EAJA 1FVDB 3WFCL 3MLXL 4K3JH 3CXDL 3OGCB 4DTGL 4OZFH 3FZUC 1JZ4A 4FTVB 1IL1A 2EH8H 5C08D 1ZHKB 4JFDE 4N0UA 2C4XA 1EVTC 3UTOA 3VFOB 5KVMC 1UM4L 4LEXL 1CLYL 2VL5B 3L5HA 5HHOE 5C0EA 4WUUE 1YNTA 4YFLI 4JFZH 5FUCC 4U1GC 4ELMA 4HKJB 5J0BA 5I30L 4ZUVB 3QIBD 2YZ8A 1RHHB 2EIZA 2R2EB 1FNAA 3WYRA 3F12B 1RSFA 3GMMA 3B8YA 4OZ4A 3X3GL 4NM4H 1A0QL 1GOHA 4FQCH 1ACYL 3QRGL 1QR1A 4C58B 3IXAB 1FZOA 2H3NA 2AXGB 5SWQA 1BF8A 1QFWM 2MCG1 2XTLA 4RFEB 2J8UB 3CCHA 4K23L 2GCYB 1RFDH 2XTJC 1A1OB 5EUKA 1S7WB 3WL9B 5LQBH 3E8UH 5IHLB 1KG0A 1WEJH 2BZDA 3U79A 2FEDD 2FJGB 2ESVE 2VDOL 3N06B 4TSCH 3BEWA 3NN8A 4F7MA 1ONQA 4BZ1L 4KI1A 4Z0XA 5FHBL 1V3MA 5MENA 1INEH 1ES0B 4OF8A 2OL3A 1M7IA 1ZANH 2IALA 3ULVE 1LO4H 2AAVA 2HT3D 5FECA 2AABH 4Y89A 1I8KA 3I02B 3N50A 1J10A 4JZOB 3G08B 4GO6B 1YZZA 3TYGH 4APQD 2Z31D 3AUVA 2Z31C 2VRAA 5JPNB 2DQFB 5GGVY 1CU4L 1A64A 2A77H 3T0EC 4N8VB 1BD2E 1GGCL 3CVHH 1F90H 4GKSA 2FEEL 2UUDH 3OXSB 4LSTH 5BVPL 1A7RL 5DMJB 5SV3A 4F37F 1DQJA 1KB5A 4APQA 4Z8FL 4NN5B 1KEGL 1ADQH 3IT8D 2GUOA 3WIIH 4OCNC 3VRLF 4JQVC 1JPSH 1EHLL 5HVFB 5C9JB 3EO9L 1H3UA 2VIRA 4WFHE 1UKTA 3DIFA 4M7KH 2B39A 2X1WL 5GGTL 4M4PA 5IVZB 4LCIH 3WEXA 5ETUA 5MP6L 1A02N 3KLAA 1E0OB 4JQVA 5FKAB 1Q38A 4KDTA 5T1LD 4J7RA 4E9LA 1CXEA 4XCFH 4X4XB 5HGAA 4TTGA 3K2UL 5CFHA 4OKVB 2RQ8A 4JB9H 3A6BH 3VRJA 3RPKA 4U1HB 1RUQL 5BS0A 5BVJA 2Q6WA 1OTTD 3VA6A 4D9RE 1FLTX 1KOAA 3M17A 4PUBL 3MCKB 5KSBB 2YC1A 1OARH 2I5YH 4UQ3B 5IJKC 3OZ9L 4Z7UB 1WUNT 5IR1B 4P5TA 1GZPB 4JN2B 3C5SA 5C9KA 2DTML 2DI9A 2OQJA 4MXVE 1C08A 1MNUL 2HMID 2X4PB 2ZPKH 1MELA 3CSBA 3MRBA 1QFUL 4FNLH 3DX9B 1NUDA 1A4KA 1PX4A 4NNXA 3MR9B 1ND0A 3BX7C 3C5JA 2E9JA 3MA7B 4CU6A 2EIZB 3MXWH 5CS7A 4XWOD 5HYSA 4U05A 3RDTA 3QDGD 4P5KA 4HT1H 3QWRD 5JUEH 3MRGB 2OP4H 4KRLB 4TVPL 3C5ZA 3C8HA 4QRPB 4CADB 4MD0B 1YYLL 3STLA 3HG1E 3MZTA 5FF6B 1IGTB 4MAYB 3UEZA 1BFTA 2P5ED 1T2QL 3NACH 4ODTL 2NXZC 1AIFA 1MAKA 5JTWA 5FA4B 5ENWB 3WFDL 3FT3B 4EUPG 2DI7A 2J88H 1IM3B 1IGYB 4PJHE 2BCKB 2XWBA 4LQFH 3ROOA 4WWKC 4NQDA 5H94A 2LAAA 3QUXC 2A6KA 1AO7D 4YDJB 1LE5B 4QOKB 4K55A 3MRRB 5CHNB 3LEYL 3QO0B 3MREA 1QTYT 4HUNB 1T20B 5A1AA 3PWUA 1CYGA 3DMMD 2NY1D 1HHKA 5FYJH 4KTDL 3X17A 1KLGA 5HHOA 2NXZD 4L8DA 1H5BC 5EIIA 4HAGA 2QQQA 1U3HA 2ENSA 5IUSA 4F3FA 4N0UE 1CXFA 4XGZB 2HKHL 4NO3B 3FRUA 3K4DA 1MH5B 2APTA 2NW2B 4TUKH 2QSQA 4ONFL 4KVNH 5F7EH 3IKKA 4PJGA 5HYJA 4M6NL 3U1SH 5E4EC 4L1DA 5F1IA 35C8H 3PHQB 3HR6A 3WNLA 4NKOA 1IAKA 1LEIB 3EHBD 3MA9H 4LRNH 3G6DL 4BH8A 2X44D 4Y4KB 2D7NA 3MLYL 5FDYA 4M7ZB 1A7QH 3WS3B 3FMGL 4NN7C 4FQXA 3KPMA 1SBSH 3HNTH 2XACC 2BNUA 5AYQA 5EC2B 4TTDC 4HIIB 1NGYA 1N2RA 4TNVF 4M9OA 1AGDB 2A9MH 4XGZA 5J1AA 2EECA 4I9WE 4F7TA 1QNZH 2MKWA 5I73B 4NO0D 2VLRA 4M1GH 4YGVB 1M6OA 3FQXA 5ESAB 1Q0YH 4JKWA 4QT5B 5FKPB 2EKJA 1N3NA 3T2QA 1L7IL 3SDYL 1OAUH 1R3JB 2G2RA 7FABH 4C4KT 2VO5A 3KXFA 3ARFC 2ZUXA 5FV2A 1IEAB 5TE4L 3WUWB 4QGYA 1SY6H 1ZGLM 3BE1L 1A6VL 3FO9A 3BO8A 4MS8D 4YIQA 4ZPTA 5DUPL 2EC8A 2E6PA 4QTHA 3RNQB 1ZA6B 1ZEAH 5MI0B 4ZSOE 3SGJA 1OB1B 4NP4L 1AGBA 4OZFG 3L6FB 3NMEA 4YPGB 4LHUA 4HQQL 4OGZA 3V95A 4JZJC 3QCUL 1YYML 3MV7E 4YHIA 1MY7A 5DD0L 1MPAH 4YC2B 3M1BA 2VYRE 1YDPA 4LARL 3I6LE 5DK0B 2IWGA 3T2NH 5HHNB 3H7LA 3TBYA 32C2B 1CFSB 4GRLC 1NJ9A 3DBXB 1I3GH 1YUHB 1MIEL 4ERSH 1NGQL 4M03A 4LIQE 3HZYB 2AJXL 2PO6B 3DURB 3C5SB 3V0AC 4GW4A 3V2AR 3MNVA 4OLYH 1WISA 3GIVB 4IRZH 2IANB 3FN9A 1YEFL 1W0YT 3MRPA 1MHEB 1JNNH 4UT6L 3PWJA 1S7VB 1N59B 1VEOA 3GMPA 5JIIA 2VH5H 3IKCB 5HHXH 5IFAH 2EYRA 3MCLL 1XGUB 1J0YA 3ULVF 4RAVA 4L3CB 4KKBD 2EDTA 2HFFA 2P47B 2EIDA 4M1DH 3RJQB 1SEBA 1T1WA 3FQNA 3L3JA 1F97A 4NZUH 4ORGB 4NWUL 3ZL4L 5E2WH 3TWCL 1NBYA 4HDIA 3DX6A 3F7PC 3RWDB 1VGEL 4Y4KC 1RUPL 1DTUA 4ZFOA 3MOQA 5IG7B 3UZEA 1UJTA 3I6KB 3FFCA 4NC2B 3MV9E 4TVPE 3V4UH 4NKIL 25C8L 2VAAB 1MJ7H 4PTTB 1FAKT 3TCLB 2ITCA 4YBQD 4Z78A 4WI4A 4HEME 5BQ7A 3QIWD 5CMAA 3MREB 5JHDD 2VR9A 4K7FA 2FO4B 1D5MB 3UTTE 3FQUB 3N1MC 5CIPB 2XKUA 5DO2C 4ONGL 4YXHH 3BWUC 5J9PB 4YHKL 4NQDE 3BPLC 4IOIB 2P5WD 4LLQB 1ORSB 3NCJH 4PB9H 5K9QI 1G7QA 1A6ZB 4ODVL 4RAUB 4C4KO 3BSZH 2BNUB 1NCDH 1GGBH 1MRDL 4F80A 3D0VB 3QI9D 3K74B 9CGTA 1XIWB 4ENEC 4OCRL 4X8XA 5I15H 1P7KB 1A3RH 2QADB 1DUYA 4WWKD 4IJ3C 1ZT1A 1ZGLP 5DD1L 1DQDL 5JIPA 1AH1A 4HFWB 3IETB 3SDAD 4GXVH 2PTVA 2Y5TB 1UYWL 3WSQH 5SWQB 4NO3A 5F3HB 5HGGS 2O26U 2FHCA 2YBRA 3BWAB 4ZXBC 2VLLB 5KTEL 1YJDH 1CGXA 1YA5A 4FQCL 2J8HA 4GBXD 5CLWA 5D7IE 5DA4A 3UBXI 1T1ZB 5CGYC 3HE7D 3RP1A 4WHDA 4DZ8B 2DQUL 2IEPA 4Z7UA 4QTIL 1FZMB 3TJEL 2GYSA 2VDQH 1I9IH 1X5KA 1UENA 1KPVA 4GRLA 1CTOA 3I02A 4JZOA 3D39E 4KK8D 2ICWB 2NQCA 4G6FB 3RY6C 4LCCB 1G0DA 1N7MH 1YN7B 4JO1H 3MLPA 4LSDA 2CXKA 3KXFE 4QXTA 1AD9A 3WFEL 4XPFH 3JV6A 4JFEE 4DAGH 3ECBB 4FFVC 1ZANL 1KPRA 2AI0H 2R1WB 4PRPB 3EBAA 1LDSA 3MRKA 4P9HH 2ID5A 4LDLB 3SDCA 4PREB 3TN0A 3CD4A 4LSQL 4X0KB 5ITBL 1N6UA 4WEBH 5EO0A 43C9B 3IFOA 5IJKA 1AQKL 2FJFB 4DZ8A 4EI6B 5BOPA 4XC3H 3ULVC 1A7RH 3D39D 3VA2C 1S3KH 3HMXH 4OI9A 2R8SL 4PTTA 3TCLA 1BIIA 4HPOL 1AI1L 1F4WL 3QUYC 3JTSA 5DURB 4QRTA 4PJ7F 4JFED 4XI5D 3OKYA 2B20A 3RPIB 5MI0C 5E5RB 4C57C 1D6EB 3W2DH 4N8CH 5JW4N 3RL2B 1OSPL 2FYYB 4S0TD 4ZOAA 1EIBA 2A0LD 4L3EA 5JPNA 3QPQC 1OTUC 4PREA 4P2OB 3SE4C 3KLHC 3U9PH 3W11C 2AJUL 2QJDA 1LD9B 1WZ1H 4W4NA 2DLFH 1NUNB 1AXIB 1ZLSH 3I3EA 3H9HA 2XNAA 2D9CA 3O3AA 4NQXB 5IF0A 3NH7H 1D5BA 2CH8A 1FH5L 4XVJH 5ESVA 3ZKMD 5B21A 4TNWF 1OARL 5F72S 1CFNB 4ZO9A 3UTZA 3TBSA 3T4AB 4BH7B 2J8UE 4MX7B 1BEYH 3W81A 5C0FB 4V1DA 4LSSL 5F1NA 4XVSH 5IBLD 1QO3B 2W38A 5AWNL 2A6DB 1RIVH 1MJUH 3DI2B 5DHVB 1BIIB 1CDYA 2HAZA 1BGXL 3C5ZC 4E42A 1H5BA 1NLBL 1TFHA 5ITFA 1BD2D 4X9GA 1A7OH 4OIIL 1ODAA 2Y5TA 5TQ0H 4Z7UE 1FG9C 1D5XB 1Q0XL 1MQ8A 3M1BB 4HFUL 2JB5H 4MA7H 4NQCA 2DMBA 4O02L 4XZUA 2IH3A 4PG9A 4GKZA 1RJLB 1ZS8B 1J5OH 2YD9A 1Z9LA 2Q8AL 2AEQH 2XN9E 3S36L 2P7TA 3REVA 5F7HA 1A6TB 4KVCH 4PJ8A 5C0ND 5I0ZA 5H35B 1K8IA 2HWZH 5CBEA 1ZAGA 1HQ4A 2G9HA 1KG0B 4XMKL 4PJ7B 4UTAH 1T83C 1I1AB 1SY6A 5I30H 2GJZA 5J3HD 2ZJSL 1QBMH 4KHTL 2P8LA 1S8DA 2R2HB 3O6FA 4N0YL 4CJ0A 8FABA 5DRZB 1N3NB 5I18H 3OJDB 2MKLC 5DUMH 1MCWM 3GSWB 1XF3B 3DOSA 4JY4A 4EIGB 4G9DB 4XPTH 1OAKL 4R0LC 4ZQKA 3RIAK 2D7QA 2Y72A 5D8JL 5GGTA 3OB8A 4P5MA 3FT4A 3TN0C 5GSVA 4AENA 3Q6FB 3L5XL 4DVRL 1RURH 1EHAA 1Z9SA 3P0VH 1SQ2N 1C7SA 2XWTA 2ADGB 1FLRL 4YHZL 1DUZA 2BVPB 1T1WB 3DGGA 4WHTB 1BHGA 2W9DH 3QEUA 4JEGB 4NKMA 35C8L 2AVGA 3GMOB 4NIKB 1WEJL 4X6CF 5E2VL 3TNNA 5TF0A 2Z91A 1NFDA 1X5LA 4JFZL 2X4TB 1IAOB 2Q86A 3GIZL 2YSSA 1RZ7L 3O2VH 4FQLL 3HNTL 3NFPA 2R1XA 4RDQG 1JHKL 5HVHB 4LLDA 4WV1C 3SDXB 1DVFB 3P4OA 1ITCA 3D39A 3OKNA 3S37H 2NNAA 3FQUA 2NX5D 4NCDA 5D6CB 4Z76B 3RJDA 4NO0B 1XGPB 5MHSE 2DQGH 5KANI 3KXFB 2HTLC 1A1NA 1OT2A 3HI1B 5DJ6A 4UV4L 4X6EB 4GAGH 3TA3C 3SDCD 3K46A 3QEQE 1CL7L 5GRVK 3GMLB 2WINA 3K1KC 3V6OE 2HFGL 1HWGB 3DVGA 3EJYD 5E2JA 3OKDA 3RQ3A 4TUOB 2R69L 5D6DA 5IFHH 3PWNA 4JDZA 3SE3A 3VDBA 1JGEA 3L3OA 2HKFL 2DM4A 3QDME 1YMMB 4OFPA 3MX0A 1KJMA 4HFWA 1A14H 4AIZB 3PJSB 5DUPH 1XCTB 4Z7WB 4XRCB 1B0RA 3WIFB 4AK1A 3K2UH 1XGUA 2HLAA 2B4CL 3HE7A 4QRUA 4R3SB 4UQ2B 4P2RA 4PRNA 1T6VN 4OV6F 1H8OA 4P59H 3QSKB 1F90L 3H9ZA 4G80B 3I6LD 2YK1H 4LIQL 3WO4C 5EC1A 1T89A 5CP7A 2V17H 5EFIB 1T2JA 2D03H 3QDMD 2X2YA 2VR5A 3PGFH 4JRYE 4OM1H 1JTPA 3C6SA 3L7FB 5E1AA 3AB0C 5CD3B 3E3QC 1XGYL 2FSEB 3EO9H 4LEOB 3LHPH 2ERJB 3SE8L 1S7RA 4JFYB 4PRBB 2NW3B 2VZ3A 4NRYB 5D1XC 4CVXB 3UO1H 4LCIL 5IESL 2BC4A 3FTGA 1MFEH 3CMOL 2F5AL 5E1AB 5CEZE 5CHNA 12E8L 4N5EC 4RMUA 5I8EA 3OKNB 4XTRD 2EO9A 5FYJU 5DJYB 4HT1L 3ZSTA 3BVNA 4TSBL 4JAMA 3L3GB 4KK5D 2BNQA 5LGHL 3L3DA 1AGEB 5HY9A 5E5UB 1YPZA 3DV4B 4JJ5B 5F9JB 2VH5L 5E0QA 4PRAA 5C6TH 3VMOA 3GFUA 4G7YH 1KTDA 3EJZC 3HHRB 2PKDA 1AP2A 4HUUB 1ZHBA 1JL8A 1FNSH 2X1XR 4K94H 1G6RH 2RHEA 2AJVH 2IANA 3NFSL 3R0NA 5ITFB 2F5BL 5B8CA 2H9GA 2DQEL 5DYOB 4KMTL 3FO1A 5EU4A 4XWGL 5FO8B 3CFBA 4PJIE 1DLHB 1MCIA 25C8H 1AR2A 1HINL 4U6TA 5F7DB 2QQLL 2F54D 4PJCA 1JWUB 3GK8L 3KR3L 3JTTB 2DOCA 2FH6A 5HDBE 2OP4L 3V6OA 2V2TB 3V7AG 4DOHB 4KUZL 1NC4B 1OTSC 3QUMH 3SKMB 2ADFH 3DRTA 3O11A 3FFDB 3ZKXC 1I9JH 1KXTB 1KEML 2PW1A 1E6OL 1B0WA 4MQXC 3UTSA 4YHKH 3TO2A 4JFDA 1ZHBB 3JUYA 4WHYG 2VLKD 2FECL 1GGBL 1KIUA 1B0GB 5I1LA 1MCNA 5MEQA 1I1AC 5DVNA 1F5WA 2FLRT 4UQ2A 3HLAB 1I7ZB 1I1YA 4MNGE 3WDHA 1A7QL 5M95B 3VXSE 2WBJA 4YUEH 3WO4B 1EO7A 4OZHA 4Z95L 5MERB 4H88L 2D7PA 4K3DH 3ZE0E 1DQDH 3RNQA 5IWLA 1K3IA 1PZ5B 4MWFB 3LS5H 2DKSA 1DE4A 4GMSL 5FHAL 4UBDD 5IEHA 3VXTA 3FCTB 1FYTA 5JXAH 4OZHF 2EZ0D 1DQQA 1K9TA 3LS4H 5CSBA 1LO3H 1DEEB 1YJDL 4GG8A 1QNZL 1CICB 1OGAB 3ARWA 4M1GL 4A6YH 4PJAE 3TZVB 2FIRT 1OGAE 3CMGA 5D1ZC 4ZFFA 1Q0YL 1Q72H 1HIMH 3QXTA 1BVLA 5HGDA 4JY4B 5K9OB 1J1PH 1O0VA 5LAXA 4Y16A 1A1NB 2B2XL 3HC4L 2DQUH 2CDFA 4P5TB 1EA9C 1OOAA 2OYPA 5EOCL 5CEXA 1S7SB 2LVEA 4XMPL 3TV3L 3UPRA 2FBOJ 4HH8A 2J6EA 3I75B 1S5HB 1WCQA 1SBSL 1QEWA 1ZEAL 1J1OL 3GI8H 1AGCA 5CD5D 3AS0A 3PP3H 2P24A 4NWTL 1VB9A 5IFJA 3HC0B 3SDDB 3AC0A 4FQIH 3X11B 4FXKB 4HQQH 1X5XA 4WV1B 5HGAB 2IF7A 5DMIL 5CJOL 4P9HL 5E9DE 2V5YA 5BZWA 2DKUA 4DGIL 4NQCB 3B8SA 5JXEA 3C8KB 3U4AA 3EAKA 2ENYA 5E8DH 1E27A 4N0RA 4WVRA 2IG2H 1SMOA 4DUVA 1HN1A 3QDMA 2P43B 5HI5C 5F1OB 1OAUL 4ZO7A 4MHHG 3GSNB 3MR9A 1P2CA 3OG6B 3LKSB 4LKCA 1INQA 3SE9L 4G9DA 4KTEH 3VRIA 4LRIC 5H37G 4D0CA 4LCYB 1QSEB 2VZTA 3ARGA 4NSKB 4B7LA 3GSQA 2E6JA 1RHHA 2VC2L 3U30C 4BM7A 4KK8C 4JZNB 5C08E 2A83A 1KGCE 3MBXL 5BO1H 5IGXH 2BOBA 4QXUH 5DTFB 4HMCA 3GGWB 5E95B 3FT3A 2PYFB 5CUSH 3RWGB 1R3HB 5D2NB 1QBLH 3GMQA 4YBLC 1IGCL 4A2LA 5MENB 4PJXF 4NYLA 2J7LA 4DCQB 4R97B 5L2KD 3EFFA 5D2LF 4G9FD 4D3CL 3VXOB 5D6DC 2IH3B 4HS3B 1HZHH 4KK6C 4PJGE 3N9GH 4LF3B 5HYJE 1FZMA 4HK3J 4F7PA 2HT4C 1T83A 4K8RD 3VGDA 4ZAKB 43CAA 5EN2A 4JKMA 2YA1A 5D9SA 3ZHLA 3KPRD 3MBEB 1JIBA 5GIRB 4X6DE 4P3CL 3WNNA 5BV7H 1KYOJ 1PKQB 4NNPL 2BK8A 4LSPH 1NC2B 1YEFH 1B88A 1WCBA 2BMKA 4I13B 1LNUB 4R0LA 4PB0L 4GRWB 4TUJA 2E7MA 1CLCA 4K7PH 5F9DC 3TO4B 2H8PA 5T3XL 3WLWD 3DO7A 4K3GA 43C9A 1RIUH 1QVOA 4LCWA 3TBSB 3L5WA 1PAMA 4NN5C 5FGSA 4HUXB 1HHGA 2G9HB 4Y5VA 2WBJB 2ZKHH 1BJ1J 4P57B 4OBSA 2AEQL 3G9VA 3WE6A 4M1DL 1QKZL 3RWIB 1HI6A 4OGYL 3LRSA 5EZLB 1P7QD 3VH8G 2VXTH 3I50L 3L3HB 4A2MA 4P4RA 2FNBA 4Y1AE 5JOPE 1HSAA 4G6JH 1G9MH 3F6LA 1C5BL 5IROA 3QIWA 2J6EH 4Y7MA 2AK4E 1Z3GH 3TO4A 4Y4HC 3G6JA 3KYMA 2HYMA 4F9LA 5HYFA 5I18L 2V7HB 3WLBA 2AXFA 3H9SD 3KGRA 4ZSOB 4EI5D 2MTPA 2PTTB 4OF5A 3MRJB 3JWNC 4K94C 1UKQA 3BWAA 3GSRB 3L1OL 1MWAH 3MNZA 1T5WA 4LASH 5DK0A 3RFZC 4FFZH 1V8HA 3P0VL 4X5XB 1M05A 2A9NH 3CZFB 3QWOB 4GXUN 3PL6C 4AH2B 4U4BA 5LG1A 3TJEH 4ZUWA 4MCZB 1CWVA 1HSAB 2ORBL 4GG6B 1TQBB 2XIDA 6FABH 4KGJA 4PGCB 3NVQA 5IEKA 3CH1A 5C7XL 3ROLB 2OLDA 2WWKO 1B0GA 4WFEE 2F19H 5GHWL 4MXWL 5I1DB 4Y5XC 3QR2A 2VLRE 5CEYB 3V0WL 3EDEA 3S37L 5IB5A 4LSQH 1OY3B 1LHZA 3KYNB 2X4RA 1CG9B 2MQ3A 2HH0L 4KHXH 1UM5H 3CGTA 2JJTA 1HHIA 4LDEB 5INCA 3OR7A 1A6UH 1LP9F 1I7UB 1TPXB 4QHKJ 4XP1H 4J1UA 4MXVF 3BP6B 3THML 1N8ZA 2D0FA 2R69H 2FL5B 1VESA 4KUCF 4HIEA 4X6BA 5HHPA 3G5VA 1MCPH 3P2TA 4P48A 2QQNH 3LKNA 2YD3A 3X12A 5GS2H 2Z8WC 1UZ6E 3ARPA 4R96A 2KKQA 3B6SA 4U3XA 2VQ1B 3QUYD 3EFFB 2RJMA 2NY0B 2BNQD 2IH1A 5ITBH 3HCVA 5GXBB 1II4E 3CVIH 3L7EA 3ZKND 1B6DA 1B0RB 1AGCB 5J13C 1UH2A 3GRWL 1QUNA 1T04A 1AJ7H 4I3SH 4UUJA 3WV0A 3RBSA 1J0JA 2FX8L 2VOTA 1AE6H 5ALBL 4HPOH 1AI1H 2VR4A 3LCYA 3PV6B 3PWNB 1S7SA 4RIRB 4WI7A 2CQVA 1OL0A 4JG1H 1EUUA 1ZVSA 4ALAH 4HHAA 1V3LA 4YXKL 1RZGA 3IU3A 3QA3B 4NZDA 5J6HA 4JPIA 4WGVB 2VXUH 1Q1JL 3FAWA 4H26A 3FOMB 3WNMA 1IC4L 2CIKA 3JV0A 3JWDC 1INQB 5B38G 3P77B 3IVKA 2AV1B 4G6ML 5GS1A 2GW5A 5SX4I 5HI4C 2DLFL 3FCTA 5TQ0L 4N0FA 4IRSA 3K2MC 5KG9A 4FMFA 1F58H 3TIDB 3QEHB 2WZPD 4XVJL 4JVWA 3GUTB 3TNMB 2JIXD 5LGHH 1RK1B 4RBPH 1J0ZA 1BJMA 2HP4A 2P24B 4UV7L 3IRZA 3IS0X 1WWWX 3DO3A 5GS0H 3PHQA 3DETC 1KIRB 4LQ1A 3R8BB 3QEUB 4NKMB 2HWZL 1U9KA 1HILA 1YMMA 3ZTJH 4XCCL 2OMBA 4Y5YB 3TESA 4WEUD 5LWYH 3U7WH 2DQEH 4K7FB 4J6RL 1BGXH 1BP3B 3BQUB 3I3BA 3CZJA 4KHTH 2Y1VA 4NC0B 3Q3GB 5ILTH 1UJ3B 3BH8B 2BHYA 3RGVD 4PJ9C 5T1LB 2DIJA 1S78D 2NW3A 2DTSA 2CIIA 1NC4D 3GSXB 3QA3A 3IU3B 3QIUC 1OAKH 2R2HA 3O41A 3O6FB 8FABB 3GRWA 5KSAA 3QUML 2A73B 4NRZA 2Q8AH 1KEMH 4M9PA 1W72H 4NQED 4YHZH 1KCSL 3ARXA 3JWOH 2VN7A 4YWGL 3VGAC 4LPWA 4XWOC 4KVCL 2AJSH 4KZDH 4XXCC 1LO2L 4LGRB 3HCVB 4NQSA 3U0WL 3IKCA 2R1YA 3DV4A 3FN0H 3ET9F 2O5YH 3B9AA 3WIHL 4YC2C 5I1LB 3E3QE 4K3DL 4MZ2A 4U1SA 5IJVB 5KS9F 3CUPB 4MB5A 5T1MA 1EBPA 1D5XA 4HK0B 2NW2A 1WICA 2WQRA 3VW3L 5IMKB 2A73A 1NL0L 1OGAD 4NRZB 5D93B 4DGYL 5L6YH 3K8LA 5KS9A 4ZS6C 2I26N 3ISWA 4UV4H 1PQZA 2UWEF 2CKBA 2QEJA 3FOMA 1D6VL 4GAGL 5EULV 4EJ1C 3O4OB 1I9RH 4OUUB 5ICXA 2VLRB 4YGVA 4FZ8H 3B2UD 2P5EB 1LK3L 2YWYA 3WXWL 4W6WB 3FL7A 4RGNC 4POZC 2HJLA 2Z0BA 4ETYA 3KS0H 2A6KB 3HNSL 4U1JA 1QLFA 3GNML 5F7NC 4AZ8A 2DMKA 2AW2A 2H45A 1N2RB 3PWLA 4KJQD 5EU7E 4RFOH 4X80L 1OM3L 2ADJB 3DECA 1ZVYA 5C0JB 1IGJA 3Q0HA 2P7TB 1FE8L 4HLZH 4PJHA 1P6FA 4NWTH 4S2SB 1UA6H 4NQSB 4OKVA 1H15A 2E7BA 3OPZH 3B6SB 4IMLB 2FR4A 4D0DA 2VLME 4R4BB 4K2UL 2ADGA 5F21B 1NAMB 2W07A 4OQTH 5LBSL 4ONHA 2AJYH 1NCWH 4KQ4L 1C16B 1K6QL 4H0IA 5CILL 2FL5A 5FYLL 3V6OC 8CGTA 5TF1L 4CNIB 4O2FB 5KSVB 4E42B 2R2BA 1G1YA 4P49A 4ZOBA 3LHPL 5E4EB 1FN4A 2AXJA 5TE7H 1I1AD 4C83B 2JELL 1A47A 2UVFA 3RWJA 4CMHC 3AU1A 2VLMD 4NC1E 2R0ZL 1AGDA 3ARGD 4X0KA 5D7KD 4YR6B 5IB5B 4BFIB 3DYOA 5L9DH 4RWYL 1SJVA 2XTJD 1IAMA 4OB5H 3U0PA 1CFTA 5DDHA 4P59L 5MEND 3Q6GH 4WTWA 4OF6A 1WIPA 3JV6B 5I8OH 2CRMA 4DVBB 5DRXB 3OR6A 4WW2A 3HE7B 1TXKA 2JJUA 5FO9A 2KQMA 3GHBH 2A6IA 3STLB 4BUHA 3PGFL 3TFKD 1EAPB 2OM5A 3GUTA 4R90H 2DBJA 5TH2B 4NM8L 3QNXB 4QXGL 3BKJL 1L9MA 1HYSC 1A6WH 3UDWA 4X6DA 3B3IB 2ZG2A 5TDPA 3VXQB 2A1WL 3IDIA 1AR1D 4Q6YA 2YUWA 3TBVB 4OLZL 3O4OC 3MGOA 3WKNA 2NY4C 3CFDB 1CD0A 1LEKB 3D2UD 3EHBC 4J1UB 4MD4B 5T3ZL 4I2XA 3MRBB 3SDXF 1ZMYA 2QQLH 1F4YH 4DGVH 4UNUA 5ESQB 3G6JB 3KYMB 4KK5C 3RVUC 3V0VB 1NFDF 3RVXD 5B4MD 4Y8AA 4NKQB 3HFMH 1G84A 4J4PA 4QF1B 4K7PX 4G7YL 2R1XB 2R0KH 1BVKB 5MEOB 2DLTA 2BY3A 2OL3L 2LE9A 4K94L 3VI4E 3EUUA 3I75A 4Z95H 2V7NA 2ZNXA 2XYCA 4HS8H 1ORQB 3GSUB 5DHYA 3DO7B 5K59E 2YA0A 4XMLH 4R26H 3ILPA 5HDQH 1FNFA 3ILQD 4NNXB 3DXAA 3VG0L 4KJWD 2G75A 3NZHL 3UYOD 5KANG 1HXMB 4J3UA 3UXFA 1J0KA 4M02A 4WU7A 3LQZA 5I8KH 3P4MB 4JG0H 4ONHB 1GRWA 3BKYL 5FDWA 1AHWB 1TZGH 2EDOA 4UAOB 4OJFH 5C8JA 4ETQB 3RDTD 2FRGP 4WFED 1VA9A 5E8NA 2ZOKB 3VMPA 4DCQA 3GI8L 3REVB 4GMSH 5FHAH 4OZGF 3UTTD 2E8YA 3WD5H 4R2GC 5E8OB 2HG5B 1OAYH 3GM8A 1RUKH 4DN3H 4XZUB 3S3PA 1EUTA 2Q1EA 4KPHH 5BW7C 5HXMA 2O93L 4U3HA 5C07D 1MI5A 5EU5A 3HZKA 1M05B 2D7MA 3BYTA 4POUB 3P9MB 1J1PL 4GQ9H 4JPVL 4MAUL 1WCBB 4K9EL 4NJAL 1MJJB 4U6YA 5HDOA 4BQ9A 1F3JA 1FIGL 3VD7A 1CQYA 2X4SB 5BRZA 3RNKB 2IANE 4MCYB 1OAQL 1ORQA 3GSUA 5DJ8A 2R0LH 3NGBC 3IAPA 4G8GE 4D0DB 4TOYL 4U1LB 4RAVB 5DO2D 3LN9A 1CFVH 1VACA 1WQVT 4LP5A 2A6IB 1J18A 4OF0A 4X99A 5C3LD 1X7QB 3RHWF 2JCCE 5E8DL 3LSOB 4QHKI 4BA8A 2PYFA 2ESVB 4XXDA 1INDL 2EDYA 2FX9H 5GSRB 1NMCB 2VDLH 3DVNB 1V5JA 1WVZA 4NRXA 2DM3A 4ODWB 3LKOB 1WBXA 2HT3C 1IGIL 2NLJB 4XNMA 5BMFH 2EDHA 4PYGA 2V2TA 5HHVH 5JZ7C 1IC5H 5FKPA 3U2SA 3QO1B 4AMKL 5KVDH 3O4LD 5I1HL 4CDHA 4DN4L 4I3RL 4P46A 4Y1AD 3S8WA 2ED9A 3CAFA 4NQEA 4PB0H 1MLBB 5J1AB 3KPTA 5F3HA 4WHCA 3BT2L 3QQNA 1G0XA 1S9WB 1G7IB 5B38A 2GI7A 1XGRA 2UY7A 4D8PB 2C4FU 1MY5A 3WFHA 5EBLB 1CD9B 4YPGA 5IFJB 2YN5A 3MV8B 4UV7H 5BW7A 1W0WB 3NABL 1IAKB 1KCUL 2WIIB 2YXFA 1PG7H 1CGYA 1OPGL 3AAZA 3PQYE 4DUWA 3CFCL 2C3VB 4FRWA 1ZHLA 4XCCH 4EUPA 3BQUD 1NGXA 5I6XB 1YEKH 3QQ3A 2GIYA 4X7SL 3UBXG 2J6EL 5CCKH 1O7SA 2N7AA 1FFNB 1JNLH 2R29H 1UZ8B 4O2EA 3D9AH 5I1GL 1NGZB 5I75B 1NFIB 3QEQB 4TRPH 1ZLUK 1I1RA 4JFFA 3CFDA 2ZP0T 1UZ8A 4O2EB 3UJTH 1ETZA 4IRJB 5F9WB 1FV1A 4YEFA 3QG7L 3QDMB 5SX5H 4P2QA 2ZKHL 4RGND 2XG4A 5AZEL 4HUMB 4PY8I 3WXVL 3MLXH 3QDJA 1HILB 1KCSH 2RCSL 4OGYH 1HH6B 5EA0L 5FK9A 2DS4A 4ESKA 2AJSL 4PRIB 3ZE2E 4TYUA 1H15B 1LO2H 2EYRB 1PW3A 6FABL 3SPVA 1KJ3L 2LAGB 1ITBB 4BSVB 1EO8H 1KN2H 4JDTL 4MA1C 4O4YH 3VFWA 4GXUM 1NQBA 1RZJC 3CPLA 1IC7L 2YEZA 4R96B 5D1XD 4MXWH 5F6HI 1DANT 1YNLH 1EV2E 4Y4HD 2ILLA 3BP4A 3QDHA 5ACZB 3V6FA 1N8ZB 5C09A 4Q9RH 2OR8A 4FTVD 5D7IF 1B9ZA 2OCFD 5IK3B 2I9LA 1V7NH 4M5YL 1T7ZA 3ARDC 1VPOH 3T8XB 4NUGL 5T1LA 2K9UA 4X6EA 1PQZB 1TTUA 4PJDF 3VWKB 5DD6B 1NMBL 3TM6A 4CNIA 3WNOA 1D5IL 1XEDA 3S4SB 4Z7NE 1MCPL 5D4QA 5C7XH 5I1DA 3UTSD 2Y36H 3IJHA 4WO4C 1INEL 4EDXB 5DS8A 3KJ6L 5ENWA 5GS2D 4L3CA 4Y8DC 1FE8H 4NQVA 4KROC 4D0BB 3UTPE 2R1YB 3EGSA 4LCUA 3MNWA 4OD2B 3MJ7B 4G43A 3UC0L 4KHXL 4DFIA 4ZXBD 2D4DA 1AJ7L 4OV5B 4GMTL 5JNYB 3QULB 5BZDB 2VDPH 2W9EL 1SM3H 3DTXB 3O3DB 2BDNH 1K6QH 5FYLH 4JY5L 3QUXD 5FB8A 4JM2F 3THMH 4PD4K 4KK9D 2VAJA 3EJJX 1EBAA 1JJUA 4P9HC 2Y7QB 1MJ8H 2ZUSA 3IF1A 3BGFB 1T7WA 4NPYA 5GGTH 2X4PA 1TJGL 3O2WL 4HKXB 4S1RH 4FN0A 4LFHG 2CO6B 3TT1L 1FDLH 2LTQC 5FO8A 3CFEA 4P4KD 3UMTA 1BOGA 3OXRB 1GGYA 3PG2A 5K9JH 2R0ZH 4UQ3A 1MCCA 5KAQF 2QR0A 1F58L 1HH9A 4F57H 5DR5L 3BEVA 5H35A 1ES0A 1UM6H 1KJVB 4R97C 3BPOC 1I85C 1FORH 5D7LD 1MLCA 4Y2DC 4YBQC 2R4RH 5HHMD 1IGTA 4L8CB 1RJLA 1ZS8A 5FCUH 5K9QG 5DSCA 1HHGB 4Y5VB 5C07A 5I1JH 3L9RA 5ADPL 2BVOB 4ZUWB 5GS0D 3T3PF 1DP0A 3MRLA 5HYSB 3VFVB 1B90A 1P7QA 3QG6A 1M71A 1JPST 3WNKA 5F44A 2I27N 3SY0B 5EU6D 3SO3C 4Z7VE 1NSNH 2P46B 1QLRA 1BFVH 3DUSB 3QQ4B 3QCTL 4CVXA 1CGUA 3PWPA 5L8KB 1CICC 1FFQA 1HHKB 1R0AH 4LGSB 1I3RB 4PS4L 2C3WA 3EO0B 3ARFA 1BZ7B 2NY2C 4JRYD 1OP5K 4PJIA 2AJZB 2BFVL 1UACH 3PV6A 1ED3B 3MUZ1 3QUMB 4OSUH 4L4TE 2XZCL 2R1WA 3SGJC 3ES6B 1VCAA 2WLZA 4JFFE 5TDNA 1KCVH 2DM7A 1F45A 2XG5A 1RIHL 4HUWA 4DEPB 2OK0H 1UCBH 1RY7B 3OGCA 4X99B 3MYJA 5LGJA 3WHXA 2O5YL 4NJ9L 5C8JB 3LEYH 4P2OA 4QNPE 5GGRA 4HS8L 4S1QH 4DQOL 2OTUB 5FYLE 3RWHB 4KTDH 4MLIA 1FL3A 2ZOLB 3B5TA 4NZRH 5DT1L 5ISZD 2RGSA 3AROA 5DLMH 5C0RH 4GLRH 2Q7YB 1JI1A 1LEKA 5DMYA 5EBWA 4GFTB 1T3FB 3BUTA 3WLBB 2ZZUT 1DQJB 5F7EL 4FQXC 5KOMC 1DQLL 4PJFA 4FQHB 1MFDL 4OZFB 3H42L 5EUOE 3S34L 4JG0L 4I5BB 5D7SH 5C0FA 1GJIA 4OZIE 4QO1A 4L4VD 4KKAC 3B3IA 3S6CA 4HG4J 2FEDC 3EOTL 1JPGA 1BJ1H 3WBDA 1FBIH 3D5OF 3TP4A 4E5XB 1J05A 4YXLH 5DJXA 5LXGL 3QDJD 3WIHH 4JLRA 1MHHA 3FRPG 2UYLA 3KWWA 3CDFA 5ISZE 4R8WL 3LV3A 5K33A 3GI9L 1MUJA 1W8OA 1GAFH 3G5ZB 2YMXL 4UI2A 4X6FA 3VW3H 2H2SC 4P99A 5C0IB 2XQYG 4HIXL 1I3UA 3IDNB 4PRHA 4IEFB 3MLVL 4ZTOH 4XP5L 5ADOH 5DA0B 3H3PH 4OQTL 4N9OB 2O5ZL 4M43H 3MACH 1U41A 1FFRA 1H5BB 1N64L 3I3DA 4TTDD 1LNUA 1CR9L 1IQWL 2BY0A 4PBWD 5E00B 1F6FB 1FZOB 5IHZB 4P46B 1S9XB 1JHLH 2EYTA 5GGRY 5HDBF 3TA3A 4KI5F 4NFBA 3RY5A 4Q9QL 1VSCA 1E4KA 2DYPB 4JZJA 4M8QA 3BI9X 5CZKA 4L9DA 4ODHL 2NZIA 5EZIL 1F6AB 1QFWL 5I9QB 5JLZB 3V7AE 1KBGH 4BELD 5EOCJ 2DQJH 4PIRF 3WFCH 4Q58C 1P7KA 4DTGH 15C8H 2JTDA 1JPTH 4OZHE 3RBGA 4RZCB 2ARJA 2OL3B 5DJCA 1MCJA 2ZSWB 1J86A 3ARDA 3VFRA 2OSLA 3BH9B 2YHGA 1MPAL 1CLYH 1MIML 3H9HB 2HFTA 1R3HA 1GXEA 3FO0H 5CILH 1CDIA 1JZ3A 2K7QA 2O61B 3H9SE 3TF7C 1KLFA 4WIQA 1DQMH 1C1EH 3KLAB 5JXEC 3RIFK 4PJAA 4ZFOL 1S7XA 2XQBL 5TGBB 1TDQA 3EO0A 4HV8A 5KSUA 1VGKA 1RK0B 3GSRA 2Z31A 2VLKA 2DN7A 4CUCA 1RVFL 3VH8A 3I6KA 5KW9L 1PKQA 4I3RH 5T1KB 4OZ4B 1KCRL 4H8WC 3UPCA 2X4QB 3RI5K 4HBQA 3RWHA 4ZFZA 4EN3B 3SQOL 3T4AA 1YY8B 2IAMA 2WWKT 3HN3A 2BVOA 1CD8A 3QXAA 4FFWC 4PRPA 2VLRD 4FG6D 2J1KA 4UOJA 3BKJH 3LV3B 4JQXC 3TLRA 4DVBA 1TQBC 1KJVA 4PTUA 3TYGL 1NBQA 5EO1B 4KDTC 1DJSA 4ZPTB 3VD5A 1KGCD 1FG2B 2XN9A 4BFBD 1IBGH 4LVEA 3LRGA 4RMTA 1GGCH 2ZCKL 3MFFA 1BWMA 3HMWL 5CSZA 5ID1B 5IP4A 2DJSA 3KYOB 3DRTB 5BVPH 2BSRB 4EDWH 3V0VA 1X5JA 4XPAH 5C0GB 2D4FA 2MOVA 4PV9A 3PP3K 5CD5C 5I1GH 3OAYK 4FQJH 4X7FC 4D0CB 4ELMF 1MCSA 1OTTC 3GBNH 3VG0H 1UJ3A 3BH8A 4RGNE 5C08A 4GG8B 3R1GH 5A16A 4FQ1L 2VKXA 3GSVA 1TCRB 1TLKA 3FQWB 5AG8A 4KKAD 2V5RA 3VWJA 4ODVH 3UTQA 5SX4H 4IS6B 4PLOB 3FHAA 4XCFL 3ARBD 3C6LD 3O6ML 1SJXA 4YEEA 4M3JA 3F5WA 5TDOB 4PRAB 2P1YA 4FQQA 5T3XD 4NKDB 1ZHKA 1V3JA 3B2VH 2H6PB 4Z9KB 2VDKH 1KJ3H 2ICWI 2GHWB 2D9QB 3IXTB 1QZ1A 1EO8L 1FO0H 1KN2L 4JDTH 1CFQA 3ZYOA 3WD5L 2CLVB 4UBDC 1UYWH 3WSQL 2DAVA 3FB5B 4WFHD 2XTJB 4OT1L 4G42A 5JIHA 2PW1B 4ODUB 3K8KA 1K4CA 4L8SC 2FLBT 5DD6A 2Y6SC 4RA3A 5E24E 3QPXL 5BOZG 4JM2C 1QR4A 4U6XB 3D69A 1NKRA 2MCPH 4JPVH 3SCMC 3HR5B 5IQ9A 3GJEB 1WZMA 1NFIA 3E1F1 3MTRA 1KXQE 2DLEA 3VXPA 5F8RC 4YHOH 4PJEB 1XR9A 2HVJB 1YUHA 5DJAA 2WUBH 5FGBC 4LCWE 3PQYA 3LKSA 1KXVC 4LKCB 5JR1H 4OJFL 2R2BB 4MA8H 2H9GB 1FZKA 1YC7A 1P7QB 3GSNL 3VXTB 4UDUA 3IDXH 4LKXB 2YPLE 5FGBA 3GB7B 2VITB 3C8KA 4F15C 1VEPA 1EFXD 1W2KT 2WWMC 1DBAL 4XI5C 3Q5TA 1EAPA 1RUKL 3WHXB 4OZGE 4FQQB 4HUVB 4NZTH 4MD0A 2AGJH 4Q0XH 3NPZB 1LO5B 3S4SG 5JPMA 3LPGA 5D7LA 1T22A 1G7QB 2BERA 1INDH 4WW1A 4WHTA 5HGBB 1BF2A 1QRNB 3RZCB 5F6HJ 4CL7A 5A2IH 1TZHA 3QUMA 5DEFB 1S3KL 3GKWH 3HMXL 2X5PA 4M93C 1J12A 1UJ3C 1G7LA 4R2GD 4UIKL 3PABA 3EYOB 4X6CB 1NBZA 4J3SA 3W2DL 3SGDH 4PRPD 3QUYA 1BLNB 2OI9B 4U1IA 1RZGB 3LD8C 2IAMD 1JF5A 3EOBA 4JVUA 4MD5A 5FUCE 4X6CA 1E4WL 3BD5A 4XTRC 2GFBA 4TOYH 4QLRA 2CR6A 1X9QA 5E7BA 5D7IA 4WI2A 5CP7B 4ODUA 4K8RH 2YKLH 2QBWA 3QULA 3BPNC 1HQ4B 4LSVH 5HGBA 1FH5H 1FSKC 1GH7A 1FAIH 4JJHA 5GS3A 1UM6L 3MV01 3V6ZA 1H3PH 1FORL 4H1LB 4HH9A 2DI8A 4XP4L 5T5NF 5C0CA 5J56B 2XT1B 2YUZA 3WCYA 4KY1H 5AEAA 3LPWA 5D2NE 3GDBA 4LP4A 5GGVL 3TJHC 4PLKC 4LLWB 3CVHB 1MJUL 2BNQE 4CN6A 4X7SH 3MNZB 2ICWJ 2HTKD 2FB4H 2X4NA 2JKXA 3D9AL 5I1EH 2IFGA 1JZ2A 3TZVC 1L7IH 3B5GA 3SDYH 5F7UA 3JV4B 3R06B 4XBGB 4N68A 3HS0B 3IF1B 4JRYB 1NEZA 3W0WE 3GSWA 4FFVD 2B7DT 3QUYB 5JW5A 2V7HA 2P5EE 3QHFH 4LHUD 3VXMD 1SY6L 4NBZB 1RZJL 4UOW0 5KSBE 3QXDA 32C2A 5A2JH 1I8MB 4RIRA 2HJFA 3DTXA 3RGHA 5BV7C 2EDQA 2VDML 1IM9A 3WXVH 1NGYB 4OSUL 2EICA 5I71B 1FGVH 3BRFA 2H2PC 2VDNH 4BK5A 3RWFA 4K71B 1PG7L 3BISA 1X7QA 4OD2A 5F9OH 2CLZA 3PP4L 2IQAB 1MCKA 2NY5L 2PXYB 3BEWB 1SMAA 5JMOC 4H1LA 4GQPH 1RUML 1SBBA 2NY1B 4X4XA 1NBVH 4PJDB 2GY5A 3MRCB 4HJJH 4I1NB 1VFUA 2R29L 5KOVC 3N1PC 3MRMA 4XCNB 3TIDA 5I16B 3CCHB 3V5DA 3X14B 3V7MA 4EN3A 3QZWB 2FBJL 4TPRL 4Q9RL 5DLML 2H41A 1BOYA 4L8DB 3IDYB 4YH6A 5F3BB 3LOWA 1RUAL 4XVUD 5GRXG 2QQKH 4FFYH 3GO1L 1L6ZA 1XGTA 1AC0A 2HT2C 1MFDH 2I9LB 3PWVB 4Z7VF 1YEHH 5F1NB 4ZAKA 1ZVSB 3E6HB 3QDAA 3FB7A 1FYTE 2GJZB 4HWZA 2SEBA 2NNAB 5BJTB 4I48A 3HZMB 4Z7VA 2HVKA 1SEQH 2DD8H 5C0IA 1TQCB 4FZEH 5H2BA 4HWUA 3QFJD 1IC7H 1EMTL 3SCMD 4F58L 2F58H 2HRPL 5ISZA 4QXTB 3KPRA 2WSKA 5I1AB 1S9VB 4WI9A 3HMXA 4X9IA 2YMXH 1ZXQA 2CMRL 4I3GA 1G7MB 4JN1L 4NWUH 1SVCP 2YD6A 2XWJA 3EYSL 5TFSH 1T7VA 4HGMA 3H3PL 1HKLL 4M5YH 2VERN 3RL2A 2VDPL 4IS6A 5GZND 1H8NA 3O2DA 4O2CA 4NKIH 3QYCA 4KC3B 2H3NB 1U3HB 1IARB 2CXGA 2HFGH 3C2AL 5C0AA 1CIUA 4LAQH 1S7QA 3TVMD 4JFFB 3JTSB 5D71L 2DYPD 4P3DB 3T77A 3C6LC 2PCPB 3D69B 3MBEA 3ORJA 3QDGB 3RU8H 1S7XB 4QRRA 5EZJA 2OTUA 4LLYB 4QRPD 1QSFA 3ARFD 5KJRL 5JQ6L 1ZT7A 3WS6C 3U6RB 4D9QE 1R24A 3JWDH 4OAWA 4I18A 1LDPL 3DHMA 5EO1A 3C9NB 3R8QA 2Q6WB 3AS3A 4C56A 2IH1B 1CDGA 1A9EB 5I17A 4NBXB 2OBGA 4RAUA 1SM3L 1K4DA 2DRUA 3ALXA 2NYYD 3QXAB 5I1JL 3SKOA 3N85L 4GXVL 3QDJE 1XGYH 3LDBB 3WO3B 3RDTB 1NUGA 4M8QB 4NT6B 5I74B 5IESH 3ARFB 2X4QA 4OKDA 3X3FH 3W39A 2GT9B 1HXMA 1ZT4B 5BRZD 5K9JL 1BFVL 1RJCA 3TA3B 3QCTH 2P8MA 1VADA 1KSRA 3KLDA 5BS0D 2I24N 5DR5H 4YHLH 3BDBA 2RFXA 4MX7A 4F7PB 5FV1L 3LKOA 1DR9A 4Y16D 4KTYA 4L4VB 4MYWB 5BCAA 4PY8J 5D72H 5DD5L 1P4LB 1R3KA 4FXKA 3KJ4B 4XPFL 3VWKD 1MFCL 1HHHA 4Z0BH 4HJGB 3NN8B 2HRLA 4K8RC 3B9DA 2I25N 3VGHA 4OZGB 5HPMA 1IEBB 4XWGH 5MENE 1IAII 4YO0B 3MXVH 4MJ5A 4Q7DA 5ECJE 3OMZA 1FNGB 2WUCH 2Y9RT 2YRLA 3W9EB 4HS6A 3PHOA 4FQHA 4Q97A 3C08L 3P9LA 1IKFL 2W1NA 4NPYB 5JW3L 3T77B 2ADFL 3IXAA 4MD4A 1TTGA 4Y19D 2CD0A 4XHQA 5INDA 5DZLA 2NTSP 3R1GL 1NJ9B 3DBXA 3CVHL 3BN9D 4TNVK 2QHRL 5L0QC 3T1FB 5C92A 2X42A 1OQXA 4GRWH 3JBG7 43CAB 1RIHH 2WBKA 3EDKA 4G7VH 4GS7C 5HI4D 5E6ID 3ULVL 1FBIL 2CGRH 1MHPL 3F58H 2VISB 4YXLL 5LXGH 3ESUF 2V5SA 4WI3A 1UGNA 3FQTB 4HH9B 4M7KL 3BXNA 3LN4B 2MQ0A 2WBWB 1AD9B 1ZE3C 2X05A 2RAMA 4PR5A 5DS8B 1CS6A 3GGWA 3JWOC 4JM2A 3U0PB 2JK5A 3H9SA 1WTLA 4OT1H 2QLVB 1KF9B 3SDDD 1KPUA 4AEFA 1BAFL 4G8FB 5C0RL 4XP5H 1RUQH 2AJ3B 4ZOCA 3MLTA 1NCNA 2GITB 3QPXH 4HWBH 2G5BA 4Q74A 3KPPA 1J11A 1JGDA 1NLDH 1OLLA 4QRTB 1A7OL 3KJ4C 4OIIH 3HC3L 4NO5A 4KGLA 2W0LA 5E00A 3FO1B 3MLSL 1JV5A 4U31A 1FYTB 4O9HH 3DRQA 3BKMH 3QHZH 4P23A 4PBXA 1K3ZA 3IFOB 4U3CA 2AKRA 4KI5D 3SJVD 1GOFA 1T22B 1DBAH 3GI9H 1EZVX 3FOLB 1HDMA 5BV7B 1ZLVH 3BPCA 3CC5B 1BECA 3VMNA 3PL6A 5JUEL 3AXLA 1QRND 3G6JF 2AGJL 4EXKA 4RGNB 4UTAL 2IG2L 3MPCA 1CFBA 4HBCL 3QNYA 2D0GA 1PZUB 3IYLW 3GHEL 3MLWH 1JHLL 3SE9H 4ODTH 4ZUTB 2ZWLT 3LMJH 3ZE2F 3O8XD 5E6ZA 1M7DA 4L4TB 5GJSH 4Q9QH 1F3DJ 1R3JA 2VXQH 1BZ7A 2CKBL 1EGJH