1UCBH

Structure of uncomplexed fab compared to complex (1cly, 1clz)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
219
structure length
219
Chain Sequence
EVNLVESGGGLVQPGGSLKVSCVTSGFTFSDYYMYWVRQTPEKRLEWVAYISQGGDITDYPDTVKGRFTISRDNAKNSLYLQMSRLKSEDTAMYYCARGLDDGAWFAYWGQGTLVTVSVASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords CHIMERIC HUMAN/MOUSE IGG FAB FRAGMENT BR96
publication title X-ray structure of the uncomplexed anti-tumor antibody BR96 and comparison with its antigen-bound form.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1996-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ucbH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ucbH01
5FYJD 4ZD3H 4U7KA 2F58L 3KR3L 4GAGL 5ALBH 4G6MH 1LVEA 4ELMB 3EJZD 3LHPH 5L8LB 1R3IL 3UC0H 2LTQB 1D9KC 3TA3A 1WBXB 4J3VA 5HVGB 1FGNL 2B8OT 3JVGC 1IGCH 5DURB 1A7OH 1UVQA 5K9OA 3B43A 3QUZA 1KFAH 2R2EA 1S7VB 4OBRA 3ET9F 3RKPA 3S88H 2P8LB 3ULSB 1FLTX 2FB4L 3OKNA 4L29B 4F9PA 1L4IA 1MCKA 2A77L 2BNQD 3RWFB 4ZUWB 4LOUD 5ADOH 4P23C 3UPAA 1ZLWK 5MHSD 5A2IH 5ESVA 3VRIA 3BGMB 2GJ6D 4KRLB 1FSKC 3CFCL 4N8CL 3DIFB 1ND0A 2ITCA 2WIIB 3GRWA 4P57B 2J7LA 2CIKB 1HHJB 3O0RL 3CFBB 1BF2A 4KHXL 3GJEB 4RFEA 4UDTB 4X7TA 3EYUH 5C0IA 1NBZB 5ICXA 3O45A 4WGWB 1HDMA 3ORJA 4P2YA 1SM3H 3IDXL 1J1OL 1GSMA 1AQDB 4OUOA 1OSPH 4Q9BA 1RPQA 4QRUA 4RWYL 2EDNA 3V52H 5DZLA 4EN3D 2XYCA 3MBXL 3EOAA 5LKNA 5DC9B 3RL2B 3G5VA 5GGQH 1BFOB 1I9JH 3D69B 2J2ZA 4FA8A 2DIJA 1CFQA 3CH8A 3G6AA 4YHOH 1CL7I 2JB6A 2P1YA 4MLSA 5EBMB 5C0AA 2VH5H 5TDNA 2W0PA 5C0JA 1FC1A 3ZT5A 1NUGA 5EZLB 3VU2A 4X4ME 3B6SB 4TUOA 3P0VL 2DMKA 4YE4L 2OI9C 4PB9L 2BVUA 1GC1L 1E27A 3QUKB 4NO2B 3QIBD 4N0FB 5ALCL 4MDIB 2R2BB 4M48H 1L6XA 1YEHL 3UTQB 1Z0MA 3D25B 5CP3A 3ROLA 3WKMH 4EQ3A 5CIPH 2NY6B 5HVWA 4BJLA 3TBVA 4UTAL 4N0RA 5DK0B 3MRCA 12E8H 1T66D 2R1YB 2XWBB 3GSQA 4I18A 4M6OL 3MBEA 4KKNA 3CDGA 1CFVL 3VGDA 1TZIB 1BJ1H 3RDTA 4PS4H 3H3PH 3GMPB 1KC5H 1L7TH 4U7MA 2RJMA 5J6HB 3D3VA 4JM2A 1KNOA 1KT2B 5CJXA 3RL1B 2BJMH 3D9AH 2APTA 1RURL 8CGTA 3O81A 1QSFA 3HC3H 3MREA 1T03L 3FRPA 3QG6A 4PLJC 3FQWA 2Y7QA 2YXFA 3S96A 1NSNH 5DJXB 4GFTB 1G6VK 4QRTA 4L3CA 1NJ9B 1NL0H 4JFEA 3HR5B 4QT5B 4RZCB 1NCAH 4XH2B 3GMQA 1R0AL 4XB7A 2IPTL 3LCYA 4XPHH 2BMKB 3LRSB 3O6FB 3DYPA 1UB6B 1MRFL 1TZGH 4KHTL 1AI1H 4PY8I 1A7QL 1RK0A 4GOSA 1T89A 3QO1B 3I6GA 3CC5B 5IG7B 1I1CA 1VEPA 1MWAB 2FSEB 1U9KA 4J1UB 1I8IA 2J12B 1CDBA 3NCJL 1KCUL 5IV2A 2WBKA 4WEMB 1TJIH 4WUUE 1U8OA 4K3JH 2ATPA 1CK0L 2VISA 1MI5A 2BVOB 2EIDA 3LAFA 3VWKC 3IJSB 4NHCL 4WEBL 3RWHA 3W9DB 1U8IB 2BSTB 5EZIL 1U8QA 3L95A 4EI5B 3T0EA 5HSFA 1ZS8A 5INDB 4TQEH 4IMLB 1JGUL 2ESVE 3B9KD 4HWEL 4UTBL 3O9WC 1NCCH 3MRFB 1ZHNB 4OZFH 5T1KB 4OCWL 3N0PB 1G9EA 3ZDXF 1XIWB 2DYPD 2O5ZH 3UJJH 1LDPH 4X98A 3OV6A 2R56H 3SKOA 4ODVH 4MCYA 1GXEA 3LN9A 4GW1B 4YHZH 2R2CA 5C0RL 5DJCB 5JORB 3C2AH 4L3EE 3WJJC 1S9YA 4HIJA 3P77B 4PJCB 4WW2B 1C16B 3WNNA 4P3DA 1FL5B 4JO3H 5EO9A 2WUCL 4L1DA 5GGVY 1S78C 5AAMA 5IB3A 1MFAL 3GSVA 3SDXB 5E95B 3F58L 4FNLL 3GIZL 3WLBB 4CU6A 3KXFB 4L4VD 2HJKA 3CK0H 3QQ4B 4L8DA 4CMMB 5LVEA 4MNGA 1P4IH 3UXFA 3BP7A 1Z9OA 3KPOB 2FEEI 4LPTA 3U7WL 3V6OE 5GIRA 2DQCL 1EEZB 3MA9L 5DQ9A 4WO4A 1QACA 3H9SA 2NY0C 2PR4L 2A6DA 1VERA 3TN0D 5GHWH 5I8KL 3OJDB 5I73C 4TSCL 1F97A 8FABB 4RMTA 5LCVL 2GUOB 3EOBA 4LQFH 2ZUWA 5JQHC 2OR9L 4Q9RL 4N8PA 1P6FA 1CVSC 3ARFC 2J8UA 3T3MF 1DVFB 1I8KB 1S7QA 2DBJA 3L5IA 1XF5B 2Q87A 4HAFA 3ROOA 2HMID 5KSUA 3UPRA 4OCXH 2ZCKH 4HIEA 5F9AC 3TBYA 1G6RH 3KPSD 3RGHA 1UCTA 1CDUA 3SOBH 1JZ3A 5C2BH 1FVDA 3DROA 4OIBA 4XMPL 5TGBA 5FYLE 4IRSC 2DM7A 4NQCE 4NIKB 2A73B 4PGEA 3W0WB 4GT7A 4XNZB 1QQDB 3GRWL 3X12B 4ZOAA 1J8HA 3MV8A 3QUYD 4G9FE 1WT5A 4NQDD 2H2PC 3V5HA 2FDBP 4EOWL 3DSFL 3QA3A 1Q9WB 3FT3A 3L3JA 3QDJE 1D6VH 1I3GL 1T22A 4YK4C 5HHQB 1EXUB 2FZ3B 4N0CD 1WFTA 1CFNA 3JV5A 3OKDA 5K9QG 2IANA 4ONOA 2E9IA 2YBRA 5IVOA 4Q9QH 1FNHA 4G80A 1U95B 1WJ3A 4TULH 4YXKL 2DQIH 3C5ZA 1OAQL 2VLRB 3BEVB 3UZQA 4P4KD 4F7TA 5F97E 3H42L 2VIRA 1KLGA 3AXLB 3GJFA 4M8QB 4XCYA 4C83B 3LEYH 1DN0B 1IGYA 3L5WA 4FZEL 4CGTA 5GQBA 2VZTA 1HN1A 4MAYB 3TFKD 4QF1A 5L6YL 1VADB 2R2HA 5CIPA 2HFEA 4GG8B 2W0FB 3L3DB 3JUZA 1Q8MA 3A67H 1M6OA 3FQXA 5F6HJ 3P9MA 1XZ0A 3F65A 3F6IA 1W72H 2EIEA 3OGOE 4QYOA 5D5MF 3WJLA 4UINH 5E6ID 5E8NB 2OQJB 4LVNB 1FYTA 3TO4C 1A7NH 2PXYA 4XNYL 5GXBB 3GHBH 2K9UA 3PL6B 1CICD 2LABA 3LEVH 3ECBA 3E3QE 4WFFE 1MCIA 4XAWH 3LIZL 1E4XH 3GSUA 1OCWH 1LNUB 1AXTH 2BOBB 3UJIH 3OF6D 4TUKH 3MV11 4YDVA 1IEBA 5JOFB 4WEUD 3V4VH 1I1YA 3D39A 5BRZB 4QHLA 3EO0B 3QJFB 5CZVL 4R90L 1EV2E 1PSKH 2Z4QA 2PN5A 2ZSVA 1BD2E 4TVPL 4FOMA 3WUWG 3N1MC 1A6AA 5HJ3B 4NQXB 3CVHH 2EYTB 1M05A 1FFNB 1F90L 3W82A 5DK3A 4GW5B 1CXKA 4MAUL 3KAAA 4ZTPH 2BVYA 4WW1A 3GGWB 1HILB 2ADIB 4Q6YA 5FGRA 3UO1H 2CXKA 2NY3B 4I1NB 5KJRL 2FJGB 1BQHB 1UJ3B 4HBQA 2UZYB 4OTXH 3MLZL 1YY8B 2Z93B 3FAXA 1KPUB 4PGBA 2VL5B 1AC0A 1JGLL 2J8OA 3SPVA 1A21A 2XN9A 5J11C 3UTTA 3W9EA 5K9JL 4FQCH 2H9GA 3O3BA 5TH2B 2FATH 4AJ0A 4K3DH 4FFWD 3HNVH 5MENA 5I6XC 3GUTA 2DQHL 1CZ8L 1AQKL 1N3NA 3A6BH 4JREC 5T5NF 4ZFOA 1LE9B 3RI5F 4BQBA 1EFQA 5F9WC 1ES0B 2CRYA 1AD9B 2XTJC 5DGQA 4RGNB 1IM9B 4M5ZH 4OM1H 3FN9A 1RULL 2QKIA 2MHAA 3EDDA 4AEHL 1PG7X 4TVSa 3MGOB 2Z91A 3OR7B 2NW3B 2Y6SC 3ZTJH 2AEQL 2B7DT 4B5EA 5KG9B 2C1PB 3FQTA 1FP5A 1FNSH 2BVEA 4PJHE 4JZNA 4XCCH 5EBWB 2P48B 2Y06L 4WTXA 3F8UB 5DMKB 5HD8C 2IADA 4DAGH 2SEBB 4GRMA 4QOKB 1ZHLB 4M6NH 3I50L 1J0KA 2R0KL 2GSIA 5JLZA 5CUSL 5I66A 2ZUQC 3ES6B 1BLNB 3I3BA 4KKBC 1WZ1H 5E8OB 1XCTB 3UROR 2EH7H 2P5EA 1VPOH 2NNAA 1IT9L 4DKFH 3VG9C 2D0FA 5FV1L 3WIFA 4IJ3C 3TVMC 3CU1A 2G9HB 4UIKL 2D03L 1JI2A 5C07A 5K9KA 2VN7A 1EFXB 2KDGA 1PLGL 4F57L 3T0WA 3S34H 4PJ5A 1IAOA 3SBWC 1L0XA 4PJEA 1MHPH 2R8SH 4DVBA 1KPVB 3FN3A 1RUKH 1BEYL 4OZHA 4X99B 4JFFA 4Q0XH 3SCMB 3BWAA 4E41D 4ONFH 4PJ8B 2XOTA 1K9TA 3KPNB 4H1LG 3ARGA 3FFCB 4HWBH 3NABH 2B1AH 4KVCL 3UC0L 2BSED 1BVLA 1BQLH 2PO6B 5I16A 2CDGA 4KWUA 1UKQA 4KUZL 4WRLA 1K6QL 3NCFB 3VFSA 1T6WA 3PNWB 2F8OA 4PG9B 5CJ8A 1KFAL 4P46C 4PV9A 2WUBL 3V4UL 2VJXA 4XVUD 3S88L 4PRDB 4M7LH 3MOBL 4F2MA 4OCLC 3LH2H 3GEWB 4LSTH 3UEZA 5F1OB 2AXGA 5J57B 3CCHB 4ZMAT 3TJHD 5ADOL 5HYIA 5D71H 2MMXA 4L8SC 2ZP0T 3HPLB 5C2UB 1FDLH 3IF1A 3VGAB 4IOFD 1MSPA 3HLAB 1HINH 1GAFL 1NC4B 1WCBA 4KJPC 5EUKA 1BHGA 2IH1B 1UA6L 4NO0B 1HI6B 3OJ2C 3PWPB 5D1ZA 3VFUB 4B53A 2QTEA 3OXSA 3JV6A 1AXSA 3QIWB 3FO1B 4FHBD 4OCNC 5JXED 3RVWD 4OI7A 4I0PD 1M7IA 3SE3A 2O5XL 1WEJL 2BHZA 1K8DA 2YPLA 3RJQB 3ZKQD 1LEKB 4HBCL 2E7CA 1OSPL 3OAZK 1QLEL 1GOGA 1CS6A 2ZCHL 4K71B 2F15A 4WHYH 2E9WA 3CFKA 2EDOA 2HN7A 2FHFA 3LS5H 4FS0A 4PGDA 1I9JL 4ETYA 2V5SA 3MLXH 4KK8D 1OGAB 4N0UA 1Z0NA 2ITDA 2F54B 3F7VA 3TBSB 1SJXA 2X4PB 2HT4C 5CJBA 5D72L 5KSBA 4M61A 4X6FA 4FZ8L 1X5GA 1S7SB 1DZBA 1UENA 2GCYB 5CHNA 3OB0H 5C3LD 2GJJA 2VDQH 4F58L 1B0RB 4EIGB 1C7TA 1N64L 4JGMA 1UC6A 3AU1A 3VXPA 1EDQA 3QG7H 1I4FB 4FQ1H 3PGCB 3VMOA 1RHFA 1UGNA 1BBJB 2EZ0C 4NO5B 4KPHH 3TNNB 1NEZB 1S5HA 4JFDD 5FV2A 1F02I 4LHJB 1MRDH 1U8LB 1G9ML 1SJHB 4IRJA 5DZNA 5FOBA 1WGOA 3AB0B 3VXUE 1A6VL 3MLWL 4TSAL 3HAEB 3PHSA 5DEZA 3ZKSD 1C1EH 2B39A 3CVIH 1JTPA 5IVXE 1U93B 2FR4B 3PQYA 1JGVH 4HQQH 4LGPB 2Q8AH 2JKXA 1GGCH 2CDFA 2MKLC 5IKCB 3U2SB 4HEPG 4YDIL 4U6XA 3VFVA 4NKMB 5J1AA 3QDHA 2B2XL 4LMQI 5FYLH 3K8MA 4H25B 5D1QD 3QO0B 5C6TH 1NL0L 5IP4A 3CMOL 1UH2A 5GS2H 1RAMA 3FOLB 1JBJA 2EDEA 1CU4L 3H6JA 1NCAL 4PRNA 4JN1H 4XP1L 4XPHL 5HHNA 3QRFM 3ESVF 3GSRB 3ARWA 4NQSB 4EZMA 2X1WL 1T3FA 1INEL 5I18L 3UMTA 3KS0H 4F7MB 4R4ND 1MPAL 3ILQD 4QHNB 1NLBH 2QADD 4LCCA 4D9QD 1T5WA 1OD7A 4Z7VA 2LQRA 2A6KA 2BSSA 4NHUA 4K3JL 3BH8A 2D4FA 1MCBA 4TPRL 3VGBA 1CGVA 4PGJA 1OM3L 4ZSOE 3T04D 4QNPE 5J0BA 4LPYA 3UYRH 1XGUB 4ZFOL 3BP6A 1BX2B 2P24B 3TO2A 2FYYB 5CLWA 3T77B 3GMNA 3VXNA 4O02H 4NN7C 3RQ3A 1NCCL 2CK2A 4P2OD 3GI9L 3T4AB 1Z2KA 1KV3A 4MNQE 2YA0A 4FQ2H 4FXKB 2DQFB 4HV8A 2ADFL 3PHOB 3WLWD 1PX4A 1R3JA 2R0WH 5KVFH 4ODVL 2EKSA 1AHWA 2VTFA 2A74A 4ETQA 3VXSD 5EO1B 3ZT6A 4LHUG 1ZLSL 3RVVD 4ORGA 3I2CH 3UTPD 4JR9H 5HHMD 3C2AL 3CH1A 2I25N 3BQUC 2QJDA 2AKRA 5B39G 3QPXL 4P2RE 5IIEA 4K3EH 1VCAA 4NNYB 4NKDB 3V4PH 2IBGA 5D7LD 3S7GA 3KG5A 4S11A 5C7XH 3MLSH 3TJEL 2Y4SA 1DBJH 4Y0GA 4EBQH 5DA0B 3X11B 5I1CL 2OLDA 4ZAKB 3B9DA 3M8OH 4FFZL 4O2CB 1D9KA 3Q6GH 4ZS7H 3TA3D 3RHWK 1B6UA 5HHOA 4QTHA 3JVGA 4YC2B 1KB5H 3O6KH 4NZUL 1LO2L 1JUFB 3OTTA 3IVKA 1XGPB 3TT3H 2X4SA 1IVLA 1CLOL 1KN2H 3L5HA 4OI8A 1R3HB 1YJDH 1MOEA 2FH8A 1MJ7H 4KK5C 1F58H 3MLUL 4P23A 3BFOA 5DJAB 5C8JB 2FGZA 3EOTL 1U6AH 5F89A 1F6AA 4RIRA 2W65B 1YN6A 4U1LB 3TCLA 4PGCA 1GIGH 1Q1JL 2VXSL 5C2BL 2VZ3A 3HS0B 4ONHB 3SJVE 3H0TB 4KRPC 2QQNL 3DVFA 4OIIH 1KTLB 1Z5LA 3RTQB 3MO1A 1M71A 2OL3L 2MTPA 5LGJB 4JY5H 3UX9B 4HHAA 1V5JA 3EAKA 1W8NA 1D5BA 3EOAB 3G5VB 1I7ZB 3BW9B 5I1EH 3FTGB 1OAXH 1A4KB 1WFOA 1U2HA 3G6AB 1HHHA 4MCZA 1KYOK 3OHXA 5C0AB 3PGFH 1CVRA 4JG1H 5DC4B 5TDNB 1YEFH 1Y18A 4P4RB 5E4EC 3P4MB 1UWXK 4JJHA 5DD3H 4G5ZH 2CLRA 3NA9H 1MAJA 3E0GA 4ODSH 4YHIB 3DXAD 4PJHF 4TULL 4LLAA 4BZ2H 4LLWA 3ROLB 4HS8L 3MRPA 5HYQB 3OKEB 2Y5TA 5ISZE 3FT2A 2P5WE 3HNSL 3ZE2E 1F3JA 3IGAA 2GK0A 4XMLL 1DQDL 1QUNA 3IFLL 5SX5K 4FQJL 4AMKH 2EEBA 3MBED 3MRRA 4LIQE 4PRIA 3IT8D 3RDTD 2H1PH 2PW2B 1YN7B 3BO8A 1KB9J 1U3HD 2D9QB 3GMMA 3V0VA 1DQLH 3T2PA 3D3VD 4JM2D 3JTSA 3U7YL 1NFDB 5TE7H 3CXHK 1GZQB 3DHMA 3DUUB 3MCLH 2I26N 3MREB 4ODTH 5MERB 4XBGA 1QSFD 3PHQB 1A7NL 1V3MA 4GUPA 3VFRB 1A3QA 4V1DA 5D4QA 2HH0L 4L3CB 1JMZA 3T0VA 4QHMB 4Y19E 1FZKB 4XAWL 1E4XL 3S35L 3U4BH 3CPLB 3R8QA 2L4OA 5C0FA 1LEIB 1UZ8A 3UJIL 1WLHA 1QLRA 3FONB 2F53B 2VUOA 3VXTB 3BRDA 1Y6NR 3QXVA 4NQCA 3M45A 4UT6L 4I13B 3MRGA 3W81A 2YD6A 4XP6H 5IK3B 3QUXB 4RAVA 4HMCA 4EJ1C 2FX8L 5J1TC 4YWGH 3TBTA 2UWEB 4XC1H 1ZT7B 25C8L 4ZTPL 4JFXA 5FB8A 1JPSH 3VXQA 1D5XB 3VXMD 5JW4M 5JPNA 1F2XK 3D85A 4MVBD 2RQ8A 1NCDH 4GMTL 5ELIA 1MI5D 4PJXB 5GRVL 3ZSSA 3VWKA 5J13C 3U4EB 1A6ZA 2EDRA 5FXCH 3T0ED 2IPUG 4FQCL 2Z9TA 3G6JB 3NACH 2GITB 2H32H 1PVHA 3LSOB 2A83A 3FB6A 3NCMA 4NP4H 1CCZA 1F6LL 2HVJB 1LD9A 1OARH 3O9WA 3S8WA 3BDXA 4O00A 1EEYB 3A6BL 5ECJE 2V2WA 2IAMB 3QCTH 1MVUB 2AQ1A 3OG4B 1R3LA 4U1NA 5SWSB 1QBMH 1O7SA 3HC0B 3HCVA 3T4YA 1CIDA 1QBLH 2OM5A 5KN5B 2UZXB 5D93B 4S1DC 2F19H 5DJYB 2DICA 1HEZB 4LHUA 3VWJC 1H9VA 3BDYL 3WJJA 2ZCLL 4NC2B 3IFPA 3IU4L 2ZOKB 5B39A 1XGYH 3MRLB 1B3JA 1OP5H 3TM6A 4L4TE 4P5MB 2XA8L 3L1OL 2MNUA 2VDOH 2ENYA 5CZKA 1TNNA 4L4JA 3GSVB 5F7FA 3IAGC 4N5UA 1FQ9C 3HPJA 3EDFA 3TPUA 2NXYD 2IQ9L 1JGEA 4MNGB 2RCSH 2EDHA 4PRPA 4Y5VC 4JGUA 5DD6B 3UBXI 2Z8SA 4DKFL 1N0XL 4WO4B 4JVUA 2VKWA 2FO1A 1ZMYA 2J6EH 4XNMA 1NBYA 1LP9B 2EXWC 2HKHH 1EJOL 3H9SD 4ZPVA 5C6PB 4JFQA 3EOBB 1YDPB 2CRZA 4R96A 5IVXF 5EOCL 4XMKL 3ARFA 3DURB 2MKWA 3HG1A 4AK1A 3RGVC 4OCYH 1H8OA 4WWKB 1FV1A 4J3TA 5IJVA 1D5IL 2DQTL 1IL1B 4LLQA 1U3YA 4NJAH 3UPRB 4ONFL 3BHBB 1JZ2A 2DQGH 4OQTL 2B1AL 2XWJA 4LLYA 5FM4A 3MQIA 1BQLL 2XQBL 2FL5B 5FFLA 3TZVB 2QL1A 3DROB 4N8VG 2VLJE 1HCFX 3LQMA 4GMSL 2VDPH 2Q7YB 4IRSA 4X6DF 1BM3L 4MWFA 1RZFH 2AV1B 3LH2L 4LSTL 3CNKA 4G8GA 4QY8A 1J8HD 1NCTA 2A0LD 2RB8A 3MV8D 4LKCA 4UIMA 1G7JB 5DRXB 1S7XA 4M5YH 3BZEB 4NBZB 2C1OA 1FDLL 2VXVL 4Y4HD 3STLB 5JIIA 4HUWA 3SGDI 1B4JH 1KCSH 4IOIA 1I9RL 2UZIL 4ODWB 3WXWH 3NCCB 3DX8A 4Y89A 3QDME 4NQEA 5F96L 1EO7A 1BIIA 3T0BA 5L0QB 4O2EA 4QNPF 4AIZB 3NCBB 3WXVH 1P4BL 1ZVSA 2IAND 1F2QA 2LTQC 1KIPA 4PR5B 4FQHA 3VGFA 5FECA 1FJ1A 1K2DA 4QTIH 3WE6B 5I75B 5IHBA 5IUSA 3QEQE 3MNVB 5DHVB 5SX4H 2IJ0C 2XXMB 2CO6B 3MLXL 3LV3B 2D31B 4I9WD 1EHNA 4O2FB 2FHBA 1OP3K 4AENB 4PJAB 2YUVA 1CD1A 1ZGLB 1VA9A 2FECI 2ED8A 1ZTXH 3VD5A 4D9LL 1OLLA 5DD5L 4PJ7A 4LSRH 4QYOB 3MRQA 3JWOH 3TO4A 1NANH 4RGMB 1FYTD 4XZUB 5DJ8B 1JRHL 2PXYD 5E00A 4FQ1L 1VB9A 4XPAL 4UB0H 4KI5C 1WK0A 4NKOB 1MRCH 5GGRB 3VXOB 3QI9D 4YGVA 1HH9B 1AJ7H 5IF0A 4HEME 4XPFL 2OS7A 3O4LA 1QRNE 3D39D 4XNQB 3PDGA 5EC2A 4WI4A 2AK1H 4MQXD 5JO5B 4K23H 1G0YR 5C08A 3THML 1JIBA 1OAYH 2DQDH 5KVDL 1OVZA 5T1DH 3RWDB 3FCTB 1YC8A 2V7NB 2YC1A 2BNRE 1GGCL 5DEGA 1HH6B 2VAJA 4H8WH 4AEIH 4AT6A 5MEOA 3QHZH 3UTSE 1B0GA 4FFVD 1F42A 2DF3A 1C5CH 1KENL 2XZQH 3LPWA 2VDNH 2W9DL 3MNZA 2OK0H 1IILE 4S1RH 2ED9A 4OZIE 1KIQB 3L5XH 2FWOB 1FZJA 4P5TB 2NY6C 1R5VA 1KJ3H 4PGBB 3WFBL 5I8EA 5CSZB 4NC1E 3T2QA 2XN9D 4NM8H 3OKKB 3UTTD 4X6CB 1A22B 1JHLL 4JCMA 5L88H 1BFVH 3GUTB 1G1YA 5IWLC 5MEND 5EU6A 3CIQA 1IC1A 3DYMA 5D1XB 2PYEA 2MQCA 4NQUA 4DN3H 2DQJL 5HY9B 2P46B 3LQZA 4PJBA 4YHLL 1NUDA 5AD0A 1BQSA 2MHAB 1JNLH 2VLLB 3O8XB 4I2XA 4XTRD 1D6EB 2EO9A 5T3XE 4GG6B 5AWNH 1U8PA 4LIQH 5HBBA 3UYRL 5K59E 5I8OL 5F21B 1BP3B 2YWYA 2QHRL 3EZ8A 3TT1H 4APQB 3I9GL 3VJ6A 3I02B 1X5LA 4LSPH 3EO1B 2DWEB 2IADB 2BCKB 3PE9A 4URTB 1FZMB 3U9UA 2JE8A 2DD8L 1SY6H 1IGMH 3MV7B 3O6FC 1HIML 2P47B 3ZE2F 5DFVC 3V6FB 1RQ5A 3UDWC 2XFXA 3Q1SH 2AJZB 3U0PB 3OL2A 5IFHL 1EPFA 3P9WB 3WIFB 4JKPH 2R0WL 1O7VA 2P5ED 4K7PX 5D7SL 3MRDA 4H0GA 3W39A 1BZ9B 2BNQE 1JZ4A 3TVMA 5DS8A 3W11D 5FO9B 3CXDH 3OKOB 4Z7WA 1ZVHA 4X6BB 5HTSA 1X5HA 3RNKB 3T0AA 1XCQA 1JK8B 4LCUB 1UWEL 3DO3A 4GLRH 2HLFC 4JO2H 4ZUVA 1UQSB 3OAYK 4KZDH 2GJ6E 35C8L 3VGEA 3SBWA 4HKZA 5CINH 1CXLA 4L4VB 1H3VA 4PJ5D 5I30H 4X7CC 5TQ2L 3MACH 4OZHB 4G43B 4KMQA 5EWIH 5B8CB 4HJ0C 5E8DH 3BWAB 4EI5C 1KTDA 3BZ4A 5BCAA 1N6VA 1Q0YL 4O51B 2BY0A 2AJVL 1JFQL 1VFMA 2VXUH 4O58H 1YA5A 5E0QA 4PJDE 3ARGD 5I16B 4UI2A 4NZDA 4OF8A 2KPNA 1OQXA 4PTUA 4Z78A 3O6KL 3HI1A 4N8VA 4H88L 3IXAA 3E8UH 4LDOB 1XIWC 4P46A 3RKDD 3L3HA 5DC0A 4NRYA 2B4CC 1MHEA 4F2MB 1KN2L 4O9HL 5IBUB 4Q74A 3NPSB 2GW5A 3QDGB 4D8PB 1F58L 3OKMB 3QFDB 4KJQD 3KPSB 3BPOB 4CJ1A 4L8SA 3IDJA 4YNYB 1DQJB 2DWDA 3QNYA 1YY9C 4C56A 3MROA 1MCCA 2OL3B 4WW2C 1QR4A 2V7HA 3NZHL 4RWHA 5CZXD 5E5RB 2VQ1B 4DCQB 1LE5A 1NAMH 1LO5B 2ADGB 3WFCH 1SEBA 4HC1H 1HQ4B 1AO7A 2A9NL 1N8ZB 5C0CB 5H37G 5D2LA 3DVNA 5ID1A 5C3TA 1N5YH 4S2SA 4OIIL 1PEWA 2YPLD 5IROC 2IBZX 1X5KA 3BIKA 1EHLH 4JY5L 4BUHA 4HZLA 1DBKH 5D7IB 5DT1H 4JN2A 1TNMA 4RNRA 4OZ4B 1NGWA 2J8HA 4YXLL 4PTTB 1S7TA 4N0UB 3QULA 1ADQL 4YDLB 3SDAD 5E2UH 3RZCD 1DVFC 1GGYA 4UOJA 4YH6A 1KOAA 4NN6B 4R2GD 4Z0BH 3BH9A 5LBSH 5FM8A 4HGWB 3S4SB 1ORSB 3QPQD 3AROA 1T0PB 1RZ8B 5DD3L 5BV7C 4M00A 4G6KH 1SBBA 1W8OA 3VFWB 3PWNB 4G9DB 4ZXBD 5D2NC 3AS1A 1OAZH 4XVSH 4BZ2L 3UP1A 5D6DC 5H94A 2WMPA 2KUTA 4JVPA 4XP4H 4W6XB 4P59H 2RHEA 5JPMB 4FABL 4LQ1A 2DS4A 2V2XA 4XPTL 3RAJL 4AQ1B 1QFWH 5F9JA 4LCYB 4HIXL 3PP4H 4HK3J 3RVUD 4WI3A 2NY2D 4DQOL 5KVEH 3HUJA 3WUWB 5F9OH 5GGVH 3PQYD 2C4FT 2ZUVA 4U6XB 2IPKA 3MCLL 1NGQL 5EBLB 4IIQB 4LSVL 1UM6H 3BP5B 3N9GL 4KMTL 4KZEH 2DBLL 1KULA 2MWCA 4L1HA 5CBEA 3RBGA 4PP2A 5I2IA 2N4IA 3B9AA 1G9NC 5GJTH 5AYUH 1XAUA 1C08A 2NR6C 3L9RA 1NDGB 4I77H 4UV7L 2RIKA 2UYLB 2JELH 2Q6WA 3PWJA 3VFOA 4JQXC 4MZ3A 5ESAA 3T2NH 1BZ7A 5ENWB 4M7ZB 4MAYC 4XP6L 4Y2DB 1J86A 3S36X 2AJ3A 1U3JA 1D7FA 3CDCA 3L7EA 3D0LA 4TOYL 3SE8H 4YBQD 5I1LB 2DLFH 4JHWL 1VFAB 4OLVH 3DBXA 3CZFB 2EEAA 2BVPB 2GTWA 3PV6A 4HKBA 4HMEA 3MZGB 2A6KB 5F1NB 3OKLA 3BH8B 4J3SA 3WV0A 2VDMH 5IOPA 4Y4KD 4P3CH 3DWTA 1KUMA 3PL6C 2BSRA 4U2YA 1FLRL 1MHHB 3HZVA 2H2SD 3DRQA 4FQLH 2NYYC 1NMAH 3ARSA 2E7LC 3CFDA 1XGTA 3RPIA 4DGVH 4R7DB 2HTKD 4Y4FB 1FAKT 3MXWH 3QQ3A 3AREB 3HI5H 3NIFE 1MCFA 1P7QB 2M2DA 4HV8B 2ZNWA 3LN5B 5FA4A 1HSAA 2VWEC 1R3JB 4HFWB 4JM4H 4KQ3H 3CFEB 3U83A 2EKSB 5AAWA 3DVGB 3FB5A 1A14L 4HWUA 4M1CD 2EDJA 2W92A 1J5OL 1QBLL 3BT2L 4Y8DC 1I1FA 1SY6A 2ATKB 3MUGB 3RA7H 5L8KB 2F19L 1ORQB 3EYQC 4ONGL 4QXTA 1V7NL 4FG6D 2W1NA 4U1GB 4X5WA 1OP9A 3BQUA 4DN4H 3ULUC 1AP2A 1S8DA 2NY3C 1KJ2B 5DK2A 4X6EA 3WD5L 1UJ3C 1XGYL 3BUYA 1IEHA 3Q6FB 2CGRL 2LU3A 2CIIB 2QBWA 5GRUL 1JZ7A 1CDHA 4EDXB 2ICWB 3N1QC 3DI3B 2F5AH 4Y19A 5KS9B 4J2XA 1JN6A 4Z18A 3NH7L 4KKCD 3IDMB 1U8HA 4H1LB 1R5WA 2RFXB 1AGBB 2E6JA 3WFEH 5B3NA 5E99L 2BOCA 3GBML 1D9KD 1T83C 3W0WE 2HFFA 4BFEA 3OJMB 2EDKA 3ZL4L 5J3HC 3NOIA 1JE6A 2EE6A 4YHNA 4NQDE 3IVKB 1ZSDB 4RGNC 4DZBB 4E41B 1QA9A 2J88H 2LAAA 3HFMH 3HRZA 2PYFB 1RD6A 1FG9C 3BIBX 3VFPA 3F5WA 4WJ5B 1TIUA 5C86A 4Y5XB 4OCYL 4JFPA 4HX1A 4S1QH 4P2QA 3SQOL 4P23D 4FFYL 1Q9LB 5EU5A 5DQJA 2VERN 2AK4A 3LKPB 2PETA 1NAKH 5JZ7D 3LKSA 5ITFA 3K3QA 2A2QT 5DVKA 2UVFA 1A3RH 1W2KT 4JQIH 5IB5A 4OZIF 1AGFB 4J8RA 2X70A 4QLRA 5GGRY 2X1PA 1IBGL 3V5KB 3VXRA 1J1PH 3OX8A 5B38B 4R26H 5T1MA 2DIBA 5DO2C 4RAHA 5DZOA 4HC1A 5JHDB 2NLJA 5EUOE 1S7WA 5T3XH 3ZO0A 1U8NA 1EK3A 3GIVB 5JXAH 2BXZA 3FO9A 3ULVC 5J06A 2LE9A 3MGTB 3MJ6A 3ZZ1A 5F7NC 1J12A 1DDHB 4YDKH 1KCSL 2NX5E 3OHXB 4Z77A 3SDDD 1EA9C 3FN0L 3U46A 1MFBL 3EYFA 3ILPA 2MCPL 3SCMC 4J6RL 1WZLA 5ERWA 3QIUD 5IHZB 2J1KA 3EO9H 5K59F 3INUH 3OAZH 4KJYA 4FQQB 2PO6C 3LDBB 2OXHA 4GKSA 4N1HB 5DDHB 1WV7T 4M03A 5LXGH 4HAGA 4ZNEE 2Q8BL 1MUJA 5BRZE 5IESH 4U6TA 2R1WB 4N5EC 4P5KA 4PRIB 4Z0XA 3MV9A 4Z95H 4X9GA 5DLMH 1HQRB 4HKXB 4LLMA 3MJ9A 4XPGH 1DANT 3ME0A 2J4WH 3UAJD 4N9GB 2VOTA 1T1ZB 3FQNB 3GI8H 1A2YB 4QGTA 1GYAA 1P4LB 3DVIA 5HI4D 1U8KA 4ZS6C 5FDYA 4BSJA 1NCWL 2O61A 3QIWC 4KJWC 4M7JH 1T04A 3CSGA 3C6LB 3X13A 3GMLA 1XF1A 4LDEB 4XNXL 5FYKL 4PJDF 4Q58C 5E8EA 4K71C 3B2VH 3MRMA 2XWTA 5DJDA 1FL6A 5FYLD 3HZYB 3RVXC 3GB7B 2YSSA 4NQCD 5EPMB 4HKJB 2R4RH 3MSPA 2VE6A 1ACYL 1A7RH 5D1QB 3BSZL 1JNHB 3G6DL 4OD3L 5GS2D 5BMFH 4XP9H 3TBTB 1CF8H 4OJFH 3ZHDA 1MIMH 2VDLL 5C9JA 3CJJA 4PP1D 1EO8H 4AEIL 3CX2A 4JEGB 3CZJA 4OFPA 4JFXB 3QDJD 5FHAL 3HNTL 1C5CL 2C3HA 3NFSL 2DI8A 5J12C 3D85B 4HUVB 4S1RL 2OJZH 5FO8B 1P53A 3MYZA 4OI9A 2XTLA 4MA3A 5FUZL 4EUPH 1FO0B 1ZE3C 5FUOL 2QADB 2EDQA 2V17L 5DWUH 1F4XH 1HCVA 2CR6A 4MD5A 3MXVH 5L2KA 1BFVL 2IALB 3AB0C 1Q9KA 2V2WB 4PRBB 2OCFD 4DN3L 3JTTA 4LCWE 1SJEA 5KAQF 1IC7L 5KANG 1HXYB 1FVEA 1P84K 1YEGH 5CJQH 5ITBH 4XBPA 4U1JA 1QG3A 1YMHA 1MIEL 5AEAA 5E1AB 3VWJA 4LHUD 3IS1X 3LKQA 3E6FB 5AWNL 4DVRL 3P11H 4QRPA 5B39B 1RU9H 4OFYA 2DKSA 3LN4B 1VKXA 4J3UA 4QCIB 4Q9CA 1LILA 3O11A 2XKUA 1SY6L 4Z7UB 3TPUB 4EKXA 3BGFB 5HHMB 2EECA 4LSSL 3Q1SL 4Y5VA 5E5UB 1RHHB 2Z31B 4PRPD 2JJUA 2X4OB 3GKWH 5BO1L 3WN5B 3DUSB 1ERNA 2JCCE 4XP5H 2GFBB 3G08B 4PFEA 4Y16B 3F12B 5D7LB 5LWYL 5E94A 4X83A 2BNRA 2NY0D 3BZFB 4NZTH 5TDOA 3RPKA 4JFQB 5I73B 4S0TD 3DTXA 5TQ0L 3FRUA 4OD1H 3MLRH 5C09A 3H8NA 1TJHL 3ALXA 4F3FB 5I30L 2OTWA 3ARFD 3RGVA 3HG1D 3KYNA 3GMOA 3ZKMC 3RWIA 1IGJB 1EBAA 1MAML 4LEOA 2F9BT 1T0MA 3BD5A 4I4WA 5DVLA 3AM8C 3TYFA 2VXUL 3MNWA 4O58L 1N2RA 4GW4B 3QCVL 2XWJB 5HPMB 5IMKA 1I9IH 1RJLB 1CE6A 2EDBA 3I6KA 1CN4A 2VLMD 3QT2A 5TDPA 3U0TA 4ERSL 2ZKHH 3E8UL 5DMYA 5GGUA 2UUDK 3CFIC 4XCEB 2FJFB 1U91B 4M43L 2AJUH 1FORL 2DLGA 5EIVA 2YD9A 3VCLB 1T0NB 4QHUB 2HYMA 5DRWB 5CEXA 2B20A 3C5SA 3S3JA 1NC2D 4MDJB 4HIHA 1YEJH 4MJIA 5IEHB 4NT6A 4DKEH 4OZGE 4L8BB 2D7PA 4KTEH 5EOCJ 1MJ8L 4YK4B 4BQ6A 4MA8H 4HC1L 4JB9H 3STBA 1RSFA 1U0QA 2DJSA 4ZAKC 4RA3A 2QLVB 4ELMA 5BS0B 1AIFB 2C5DC 4DOHB 3RNQB 4JFDE 1OTUC 1YYLH 4YC2C 1KELH 2X41A 5EU7C 4YX2H 3NGBB 4PJIB 1DBKL 2APXA 1S7VA 4FTVB 3MRKB 5HDOA 1ZOXA 3NTCH 1RI8A 3U30B 1TENA 2D7QA 2P8LA 5HHVL 3ULSA 4L29A 1K4DB 3RWFA 5FHBH 4CUCA 4ZUWA 2BVTA 3DXAB 4OLXL 3LMJH 3C5JB 5INCB 4M9PA 1N6QL 3CGTA 5TF1L 4QKXB 3BGMA 4I8DA 4K7PH 3U48A 4PJ7B 2WIIA 4P57A 2HFTA 1JHKH 1DBMH 1FH5H 1KLFA 1CTNA 2CIKA 1HHJA 4E42B 1JHTB 1UM5L 3CFBA 3ZSTA 3GJEA 3VH8B 4UDTA 2BP3A 3MJ9L 1MJUL 3TO4D 5CD5C 3W2DH 3D2UA 2IMMA 4JE4B 1CBVH 4R6UA 3RTQC 2IBBA 1AQDA 4YBLC 5C0ND 2IG2L 1HZHL 2AABH 5ADPL 1EX0A 1NCNA 1QFWL 2E9BA 2AEIT 3O4LB 5I1DA 5KOMC 3WSQL 3RL2A 1V8HA 2Q1EA 4EI6B 1BFOA 3D69A 2Y25A 5C08D 5E5MB 1AGCA 4LCIH 5KVEL 3QCUH 5D6CB 5GGVL 4JG0L 5GISL 1YEIH 4LSUL 5EBMA 3D48R 4X7EC 4XWGL 2NY1D 5EZLA 3S3SA 1QLFB 1UM6L 3B6SA 4H26A 4KZEL 4U7SA 2OR7A 3PWVB 2ORBH 3MMEB 3QUKA 1JNNL 4NO2A 2VZSA 2GKIA 4N0FA 3U1SL 1F00I 2R2BA 4MDIA 3UTQA 1NEUA 3D25A 1A9EB 3ARPA 5AYUL 5FA3B 2GY5A 3H7LA 1LO3H 1CGWA 2R1YA 4DGIH 2XWBA 1NDMB 2R9HC 4MNHB 1YC7A 2HKFH 2YR3A 1TZIA 1R5IB 1KJMB 1MFDL 3M07A 3GMPA 5F1IB 2H26B 5IWLA 4HPYL 1EZVX 4ELKB 4N0YL 4TRPH 5EUOF 2Y5EA 3VXSE 3RRQA 4PJ9D 5J6HA 2R0LH 2PYED 4CN4A 1KT2A 1IMHC 4R8WH 3QZWB 3UTPE 2IFGA 4GH7B 5AZEH 3RL1A 4K9EL 2AI0H 5I76B 4DW2L 2XTJD 5AD0B 4W6WB 2N7AA 1I8LC 4P3CL 3IJHB 3NAAH 2KL6A 2Y6SD 4YFEA 2COQA 4OSUL 1NJ9A 3PG2A 3HR5A 4JRXB 1CGTA 3QJHB 3P30H 4NDMB 2P8MB 4RZCA 4XH2A 1UACL 4C58B 2N56A 5HD8D 2AXFB 4WV1B 2BMKA 3LRSA 3VRLE 2ARJQ 3O6FA 2YRLA 1UB6A 3L7FB 1E6OH 1N7ML 1FCCA 3QUXC 3QO1A 2VNCA 3UDWA 3KPMB 4PUBL 4RFOH 2M26A 3CC5A 3O4OC 5IG7A 4P9HH 5D96C 3W39B 1AC6A 1MWAA 2FSEA 4NYLB 4J1UA 1TJGH 4UILH 5ID0B 1NLDH 2I9TB 4AEEA 2E7MA 3B5HA 4JRYB 4M62L 1ZT4B 4NKIL 1K8IB 2NXYB 4KH2A 1SMOA 1KTRL 5F3BB 2BVOA 3P4NB 3IJSA 1KJVB 2BERA 4MX7B 2JIXD 1U8IA 2BSTA 1WBYB 2F5AL 4I3RH 3W9DA 4EI5A 4WU7B 5DRNB 3V95A 1HE7A 4H5SB 4OQ1A 2EDLA 4JHAH 5INDA 2VAAB 4YBHA 4IMLA 4U1SB 4YO0B 5I8CB 3CU7A 3MRFA 1ZHNA 4JY4A 2OZ4A 2H41A 3FT4B 4Z78B 2IAMC 4JPIB 5T1KA 1RUPL 2UVEA 2QQKH 5I71C 1KG0B 1XIWA 4RBPK 4BZ1H 4FQPA 4XGZB 1MHEB 4P46D 2JK5B 1LDSA 3HFML 4ZUSB 1NCUA 4LARH 4NJ9L 2V2TB 5D93C 4NWUH 1DJSA 1UZ6E 1QFWM 1Q94B 1KN4L 4GW1A 5DJCA 5JORA 5C0AE 1TETH 4UBDD 3Q5YA 5I74B 3P77A 1T2QL 4PJCA 4WW2A 4C56D 1C16A 2V7HB 5F71A 2GQHA 2E6QA 1FL5A 4UU9B 1NAKL 4HGMA 4CMHC 5C9KA 4KJPD 4QRRB 1E0OB 4GAYB 2F58H 3KR3H 3QWRA 4GAGH 5BZDB 4F7PA 3VMPA 1B4RA 3DVNB 3SDXA 3UYPA 3V7AG 1X4ZA 1R3IH 4A6YA 3KXFA 3B9VA 4AY0A 2DIAA 1I7RA 4CMMA 4LAQH 4Y4HB 1FGNH 1S9WB 5IROA 1ED3B 2IQAB 3KPOA 3MLVH 3PDOB 1EEZA 1A6WL 4GQPH 2HLAB 3OJDA 4LSQL 8FABA 1NGWB 3KLAB 2FB4H 1ZANL 3D3VE 1WQVT 3HRPA 4NPYA 4PPTA 2HJFB 1QBBA 3LD8C 1DVFA 5JHLL 1I8KA 4WWKC 4F8TA 1XF5A 2VABB 4G6FD 1T1XB 4YQXL 5DUPL 3DX6A 1BWMA 3CFCH 4N8CH 2VLKB 3M1BB 1A3LL 3QFJB 3O0RH 4TVPE 4KHXH 5D2NA 3INUL 1HYSD 4JFEE 2P8PB 5DUBB 5LG1A 1WAAA 1G0XA 1PBYA 3DJ9A 3TZVC 4LOUC 1L6ZA 5D6DA 4OGXL 3IDXH 1J1OH 3K2MC 4HLZG 2EZ0D 2A73A 4KRNA 4I5BB 4RWYH 3STZB 3ARQA 2R1XB 4JFHD 1F11B 4LF3B 1QQDA 3OPZL 3X12A 5I0DA 5DLML 4LLDB 4MB4A 1DE4B 3OKYA 4JDZB 3QWOB 2JCCF 2RGSA 4WHCA 3M17B 4WY7L 4Y1AB 1B0WA 1MCSA 1Q9WA 1CTOA 5TF0A 3CLEL 2F5BH 5MI0B 1EXUA 2FZ3A 3QI9B 5AZ2H 3P0VH 1MI5E 3ARZA 2ARJB 5EZJB 5L0QC 1H5BB 4PB9H 1GC1H 4XHQA 4U0QB 1PYWB 3BPCB 1U95A 2WAHA 5ALCH 4G42B 4HUMB 2YRPA 2VR4A 1YEHH 3T0EE 3U6RB 1O5DT 2IFFL 5A3ID 5I75C 3SJVD 4FXGB 3G6JE 4LU5L 4UTAH 2VLRA 3BEVA 4M8QA 1WISA 5I1KL 1CFVH 1DN0A 2ERJB 4JQXA 4KDWA 3SGEH 4MAYA 2AQ2A 4LNRB 1VADA 1ZAGA 3QIBC 1CF8L 4GG8A 2W0FA 1PKQA 3L3DA 5F70A 2BY3A 3I85A 1QP1A 3RWCB 5H8DA 1T66C 1RURH 4XBEL 3JWDC 4ZUTB 2LAGB 1T03H 4OZGF 3JV4B 5E8NA 2OQJA 5IOPB 1INQB 4RGMC 2R15A 3PL6A 1YMMB 4G8FB 1OPGL 3HI6L 1N5AB 1FNEB 3G5ZB 1LNUA 2BOBA 3ZE1E 4LPXA 3MGAA 2IMNA 3MXVL 4D0DA 5ISZD 1R0AH 2E7LA 1XGTB 2IPTH 3EO0A 3QJFA 4MNGE 3O2WL 4NWTL 3HAEG 1MRFH 4KHTH 2NZ9D 1A7QH 2PUQT 4OZFB 3H9SE 4ZYKA 4MJ6B 5HJ3A 1HSAB 1QO3B 4NQXA 1YEGL 3RFZC 1RJYA 2EYTA 3BUTA 1FFNA 3D1MC 4ISVB 3NCJH 2J8UE 4GW5A 1KCUH 2QHLA 2WBJB 3GGWA 1HILA 4X4ZA 3SKJL 3SO3B 3DV4B 2EXYD 3QEGH 1HHGB 1I3RB 1CK0H 3MRIB 3KYKL 3P11L 5DK2B 4E0RB 4UQ2B 1UJ3A 4WI5A 4P5TC 3SKUD 4WI7A 1YY8A 3MODL 2Z93A 4NHCH 4PLNC 1KPUA 2BDNL 5EZIH 1MWAL 2VL5A 1OOAA 4Y19D 5HI5C 2CMRH 4WU5B 1XR9B 5K33A 5TH2A 1JGUH 1GJIA 4HWEH 5DSCB 4UTBH 4JZOB 4LGSB 2BRRH 1T83A 1Z9LA 5CWSB 5D1XC 4CAGA 3BPNB 1X6LA 4OCWH 1J8HE 1XGRB 5F6IB 1LE9A 2EYSB 3L3OB 4NZTL 4PD4J 1ES0A 1AD9A 1FG2B 1IM9A 1S9XB 5D7JD 3F5WB 3D5OF 3O8XC 3MGOA 4HX1B 2P7TA 3OR7A 5C0RH 1P7KB 4P2QB 1YYML 2CLVA 2OZ4L 4DGYL 1JWUB 5KG9A 1A4JB 2C1PA 1EO5A 3ALWA 5ILTL 5I15L 4APQC 2AK4D 3K1DA 5J56B 2EEDA 4ZTOL 2IANE 5EBWA 4BKLB 2B4CL 1F4HA 5DMKA 5DD1L 2CK0L 2SEBA 4P9MH 4QOKA 1MFAH 4X9IA 1ZHLA 4YEEA 1G6RB 1DLFL 3F58H 4FNLH 3GIZH 2V6HA 4HF5L 3VA6A 4KQ4H 2ZKHL 3ES6A 1BLNA 4KRPD 4PY8J 3VXRD 5E8OA 1XCTA 2FIKB 4UDUB 6CGTA 2AJUL 2YD5A 3U7WH 5FM5O 4NKQB 2DQCH 3VA2C 2X4UA 1HK6A 15C8L 3QHFH 2PR4H 2CRIA 4I3SL 2G9HA 3MCKB 2XIDA 2CJUH 1CD0A 5I8KH 4TSCH 1EFXA 5LCVH 3I6LE 4LDLB 5BZWB 2OR9H 1YEJL 4PY7B 3UTOA 1E4JA 4A6YL 3LS4L 1KPVA 1MH5B 3S35X 4XVJL 5B8CC 4JB9L 4X99A 5IW3A 4P0DA 4TTDC 3SCMA 2HAZA 1FN4B 4YHKL 3KPNA 1N26A 3TN0C 3IRZA 3FFCA 4OCSL 4ODBD 1CGXA 2P43B 4GKSB 2PO6A 3KHOA 1NH6A 4KTDL 5GS3A 1QTYT 4XMPH 4X7FC 3PNWA 4KK9C 4PG9A 3D39E 2VO5A 4KKLD 3VRLF 4WHTB 5D5MB 4PRDA 3D0VB 3GRWH 5BV7L 5CILL 3CCHA 4ZXBB 1Y6MR 2X4TA 5EFIB 3KJ6L 3BPOC 2GI7A 1CLYH 3FB8B 5IMMB 3HPLA 4EOWH 2EIBA 4NM4H 4MJ2A 3HLAA 1NC4A 1I3GH 4R3SB 3TIEA 1W72B 4NO0A 3PWPA 3UJTH 3VFUA 4F7EB 4FXLA 3QIWA 3FO1A 2O93L 2WBWB 5DTFB 3X13B 4YXKH 2DMBA 4CADB 2XN9E 1LEKA 3UTTE 1OAQH 1XR8B 4BK4A 3IJYB 2VLJD 1IQWL 2GAZA 3H42H 4GS7B 3E2HB 5MENE 1FFRA 2CDEB 2EDTA 1YNTA 5JW3H 1WFNA 4FZEH 1RZGB 3UYOD 4MMXC 5GRXG 2YPKB 1JPFB 5L6YH 1OGAA 1S3KL 4LCIL 4YDLC 2NY4D 2F54A 5IEKB 3TBSA 1GHFL 5C9JB 4NN6C 5CP3H 2X4PA 4M1GL 1G9NL 4G7YL 3WIIL 2B1HL 4PLKD 4YHPA 1UZ6F 1ZA6A 3CVHB 1S7SA 5HGDB 2AP2A 2GCYA 4H0HB 1KLUB 2VZVA 2YKLL 4AL8L 1A64A 1B0RA 2APFA 4PBWD 2ORBL 2ZG2A 3CSYB 1L0YA 3QDMD 3TFKC 5C0GB 5E2WL 4XNYH 1UFUA 1I4FA 3VFTA 3PGCA 3L3KB 1LO3L 2YEZB 3U4AA 4CVZB 2X4RA 1BBJA 4NO5A 3LIZH 3TNNA 3R4DA 1T1YB 5HGAB 3EBAA 3WL9B 5HXMA 1EUTA 4RGOL 4BYHA 1U8LA 1SJHA 4U3CA 5CZVH 5E6IC 5L2KD 4R90H 4JO1L 4QGYA 2NY5C 4Y4KB 3HAEA 1WF5A 5LGHL 4TVPH 4W4OC 1U93A 1CICC 1QR1B 2FR4A 5C07E 1HHKB 1A7BA 1FVEB 5IKCA 1MAKA 3U2SA 4JM2F 4WVRA 3B83A 1N59B 5IHLB 1F90H 3HB3C 4NKMA 4PJ5E 4MAUH 2H6PB 4IIQC 4PJEE 4BZYA 2BC4B 4S1DD 1MHCB 4KAQL 3VWJD 4OZHE 4JFFE 3QO0A 3NN8B 1T80A 5KBNC 4KVNH 5KJRH 2DN7A 4QRPD 3FOLA 3MLZH 1SVZA 4NCC2 4OFYD 4BFBD 5F88B 5J9PB 5K9JH 5F1KC 1YEDA 1UXSB 3O3AB 3GSRA 2AJXL 4RDQF 4Y2DC 1DBBH 4NQSA 2DQHH 3CAFA 1LK2B 3ULUL 1CZ8H 5H2BB 4ZUUB 4F7MA 1AQKH 3L3GB 4QHNA 1Q9OB 3ELAT 3QXDB 4HUXB 4KMLB 2X10A 4GRWE 2Q76B 2EXWD 4OF6A 2BNRD 4QRQA 3WBDA 5C09B 4HULB 2R23B 1DUYB 3EKCA 4XI5C 4BQ8A 3UTSD 5J4MA 1RUML 2AEQH 2A38A 4U1KA 1XGUA 4I3RL 1KEML 1CDYA 1BX2A 2P24A 3AM8A 1FBIH 4JHAL 1G7PB 4AG4L 3MJ8B 2AJSL 2Y06H 5F7HA 3T77A 2ZG3A 4Z9KB 3RX5A 3S98A 4BFGA 3K2UL 2YPLE 2ICES 4GKZB 3I50H 2R0KH 4Y4FC 5CUSH 3AREC 4LK4A 3T4AA 1TTGA 5C0DB 3C87A 4WUUB 4FXKA 2DQFA 5EIQA 1OF2B 3PHOA 1IT9H 3TNMB 3N85H 2LU7A 4ZFZB 1YECL 5KTEL 1EEQA 5EO1A 2D03H 3FQRB 4N0UE 4NWUL 4F57H 1JPGA 1LGVA 2JF1A 5AUMB 2WQ8A 4U1GC 4HT1L 1TETL 5KSBE 4MJIB 1JYVA 4BFIB 3NCYS 2W91A 4MD4B 4NT6B 1SYSB 3GM8A 1FFPB 2ESVB 4NNYA 4NKDA 1BEYH 5B4MD 3BKCL 5T3XD 3V6BR 3LKNB 5C0BB 1OT1A 5CJOH 5DF0A 3X11A 5BJTB 4ZAKA 3ZE0E 4UQ3B 4KVCH 3ULVL 4O2CA 4K94L 4LAQL 3FQUB 4DZ8A 4KUZH 3ZE1F 1K6QH 3MLVL 3MLTA 4HPOL 4EQ2A 4Y8AA 2G60L 5HYFA 5DURD 1NMBL 4NUJB 4YPGA 4L3EB 2HFGL 2WUBH 4G8EB 3FOMB 1J7VR 1JUFA 5LJYH 3V4UH 2EYRA 1XGPA 3MOBH 3QIUB 2JJSC 1NPUA 1R3HA 4LL9A 4JAMB 1P7HL 1UEYA 3FHAA 4WNQA 3RIAK 4Y5XC 1VGKB 3PQYE 5GS1B 1PG7L 5H35A 5DJAA 3QDAA 1RMFL 2J8UF 5C8JA 4OAWB 1GAFH 2FX7L 3KDMB 4M3JA 4HW6A 1BIHA 2W65A 3KLHC 3H9ZA 4LLUB 1UA6H 5ICZB 4U1LA 2BX5A 3C60B 1ZHBB 3C9NB 3TJHC 3HS0A 4ONHA 3H0TA 2O5XH 1WEJH 3D2UB 4Y7MA 4CW1B 5DGRA 1KTLA 4HBCH 1UB5B 4IOFC 3RTQA 1L0QA 1QLEH 2ZCHH 4HJGB 4KI5D 5IJKC 5LGJA 1C5DB 3RIAF 1R24B 1JF6A 2QEJA 3KPQB 5I1DB 5IR1B 1FZOB 2G75B 1BZQK 3K0WA 1I7ZA 3BW9A 4PLOB 1DBAH 2NTFB 3FTGA 5JXEC 1A4KA 1AGCB 4NOFA 5JW4N 2F5BL 4Z7VE 5D72H 4P4RA 1UWGL 3EGSB 4FZ8H 3OAUL 1QEWB 3DX9B 5AZ2L 4H26B 3P4MA 3FB7B 2X1QA 3GJFH 4F58H 5EG6C 3LY6A 3QR2A 1N64H 2YZ1A 1FCGA 3FMGH 1WTLA 4YHIA 4J3XA 4NZJA 3LDBC 3BMWA 2DI7A 4MA1B 1HHIB 2DJUA 5HYQA 4G9FB 3OKEA 1YQ2A 2A6IB 1QHOA 3ARUA 3PXHA 1UADC 5E8PA 5SWZB 5KZCD 4MHHG 5IMOB 3BP4B 1G9MH 3L6FB 2PW2A 3JWDH 4NNXB 1YN7A 5FK9B 1A6VH 3MLWH 3DNKA 4TSAH 1L9MA 4YDJB 5JMRA 3MFFB 4LVOB 1YUHB 1GRWA 1NFDA 2K1MA 1GZQA 4YDIH 4GBXB 3DUUA 5IW1B 3OXRB 3BD3A 1FVCB 3OGCB 1AGDB 5MERA 2B2XH 5DD0L 2I60L 2DQUL 1I8LA 3PHQA 3AUVA 3QXAB 5EOQH 3F7YB 3VFRA 3G9VA 3C6LC 4QHMA 6FABL 3CMOH 1FZKA 2YK1L 5EN2B 4NFDA 3CPLA 5JUEL 1CU4H 1LEIA 3MA7B 3FONA 2CKBA 2F53A 3OG6B 1E6JL 3VXTA 2O26U 3QNXB 1JGDB 4XP1H 2C3WA 4CU7A 5HHOE 3D18B 3O6FD 2Y1VA 3FFDB 3BAEL 2V5YA 5D1QC 5IK3A 3QUXA 1XFPA 5IVZB 1INEH 1WCQA 1FGVL 5DFVD 5I18H 1MPAH 2UWEA 3RUGB 2GY7B 3KNBB 1CE1L 4GSDL 1ZT7A 3I75B 2P49B 5E9DB 4HJJL 3VI4F 2FEDD 3ZYOA 3VRJB 4FQXB 2HLFD 4KROD 1D5XA 2P44B 3QEGL 4TPRH 5A16B 2GIYA 5TFSH 3QP3A 4GKNB 3BEWA 4OCRL 1VENA 1OM3H 4PJXA 2ZSWA 3B3IA 3ILQC 3O3UN 5IQ9B 2QADC 3U4EA 4HUUB 4EI5D 1BD2B 2CMRL 2AGJH 5CD3B 3G6JA 3PP3H 2GITA 3LSOA 1P5VA 2Z0BA 2HVJA 3P9LB 2H8PB 4JY4B 4LRNL 3VW3L 1DQQB 2BRRL 3GI9H 1EEYA 5ACLA 1CT8B 2Z8WC 2IAMA 1MVUA 5T1KD 1TLKA 1KB5B 5C71A 1BJ8A 5D8JL 3TEUA 2ADFH 1T7ZA 1ZLUH 5SWSA 2XRAL 1VEMA 3HC0A 5FAAA 2AV7B 4LKXA 3A6CH 5KN5A 1ZLSH 2XKSA 4OBSA 5DJYA 3PJSB 1HEZA 1T1WB 5HGGS 3QPXH 2DTML 3BI9X 4NRZA 2ZOKA 2PW1B 4MJ4A 3MRLA 2XKNB 4OKVB 3WLWC 4P5MA 3TJEH 4F7PB 4P9ML 2BFVL 5I1CH 3QWRD 3RVVC 2E27L 1NC2B 2VN4A 3BGFC 4FFZH 4A6YB 4KQ4L 3AVEA 3RIFF 1I7RB 2N7BA 5FOJA 3KXFD 3LZFL 1D5ZB 1QFUL 2Z31C 5DD6A 3WN5C 4CN6A 1FFOB 1KGCD 4RX4D 4NZUH 3QHFL 4PRIE 4Y16C 2A6JB 2OTPA 1LO2H 1LP9A 2CJUL 3R0NA 4G6AD 4KDVA 1LQSR 3UBXB 1KBGL 1YDPA 1CLOH 3ZDZE 4NPYB 1TZHB 3P4OB 2ZJSL 1QSZA 3DURA 3B8YA 3NVQA 3MLUH 3BJ91 3RZWA 4WWKA 1IKFH 1DVFD 3DX6B 4PJEF 3EOTH 1I7TB 3QQ9D 1IL1A 4M1DL 2VZUA 5D70L 5I1GH 2AJYL 3BHBA 4JKMA 5BV7B 1Y6KR 1AY1L 4OZHF 4V1DE 5D2NB 3WO4B 3HE7B 2VXSH 1Q1JH 1G7QB 3U9PL 2FL5A 4GRWH 1LWRA 5BQ7A 2XNAA 3TZVA 2QQNH 1RJZA 1PZUB 2Q7YA 2YWZA 3PWUB 2OL3H 3KYAA 4QO1A 2AEPH 5IBUG 1JNJA 1XF3B 5DHXB 4MQ7B 3W0WD 2AV1A 1MCWW 4PG2C 3EHBD 2YD2A 5T1LD 5HYJB 5DRXA 1G7JA 2F8XC 3Q5OA 1CLYL 1WVZA 3BZEA 2FGWL 1ZK9A 4NM4L 3STLA 4GRWF 4KK6D 4ODWA 2ZPKL 3HC4L 1UCBL 3IDIB 3C2SA 5T3ZL 3JWNC 4L5FL 3UJTL 4AIZA 4TNVF 1JF1A 3HKFA 1I85C 4PR5A 1S7RB 1OAUL 1X5ZA 4HS8H 2CUHA 1SYVB 3WE6A 2G5BB 1VESA 2VR9A 1MQ8A 1WZKA 3NGBC 2NR6D 3HNSH 4JFOB 2XZAH 3MNVA 5DHVA 2J3SA 2QR0B 4XMLH 3U30C 1DQDH 5JW3L 3IFLH 4FQJH 1XEDA 1XF2B 1BBDH 1L9NA 3LV3A 2D31A 3ARTA 3QIBA 4O2FA 1PKQB 4GAJL 4OUUB 4AENA 4PJAA 3S4SG 1ZGLA 3U7YH 5F7KC 1EGJL 2NY7L 2NX5D 2HJLB 3IXTB 2JB5H 1MCJA 5KSBF 4QHKI 4QWWC 1OTTC 3AS3A 2L7JA 5ANMB 5F44A 4G6JL 4NFBA 5DR5L 4XZUA 5DJ8A 2Z35A 1U3HC 5KSAB 2HH0H 5KSVB 2R69L 1C8PA 2NY5H 3WNMA 3S35H 1CLCA 2B5IB 3ZE0F 3OJVC 4NKOA 4JPWL 5GGRA 3T8XA 3VXOA 1HH9A 4D0DB 4IRZL 2H32B 3BKML 2Q3AA 4PRPE 4XAKD 5BRZD 5FCSH 4UT6H 4XNQA 4LFHD 4OM0L 5JO5A 3MV01 1FAIH 3MOAL 4NCDA 1TXKA 3RWDA 4ZYKB 3FCTA 4JFYB 2FX8H 2KZ1B 3RWEB 2V7NA 1IKNC 1FNAA 1QFPA 2AAVA 4XCFL 1P1ZB 1EH9A 1RJYB 1HH6A 1UKSA 3OR6B 4L9DA 1G84A 1J0YA 4DTGL 25C8H 2CKBL 3HG1E 3GMRB 2NCMA 3RI5K 2EDDA 2X6MA 4R0LB 3EYQD 2C9AA 4Y5YB 3R06A 4L9LB 4KVNL 5EORL 2YXMA 1XGQB 4GMTH 5KW9L 1KIQA 1V05A 2FWOA 2NY3D 4P5TA 5GRJH 2FD6L 3PUCA 4N68A 3VXUB 1Z3GL 2VLME 5CSZA 2YN5A 5IVXB 4F33B 1K4CB 1ZHKB 3OKKA 2W07A 3KWWB 4X6CA 3QXWA 1X5FA 1DBBL 1YEEL 3EJYD 1WZMA 3V9FA 2HWZL 1BOGB 2GSGA 5CBAB 5D1XA 4Z7OE 1F3DJ 3BESR 5HY9A 4G8GE 5EZOL 2ZWLT 5J3HD 2JIXB 1X7QB 1I1AD 2BXYA 1A6TB 4HGKC 4RGND 1QYGL 1IM9D 1QSEB 3F62A 1YZZA 2PTVA 1AFVL 2VLLA 2M8XA 2P7TB 3O8XA 5DUML 4Z7VF 3BDYH 3VE0A 1ETZB 4JGJA 1D6EA 2CLVB 4GG6A 1MEXL 2ZCLH 4PB0L 3MJ7A 4NQEE 4X6DB 3IU4H 4POZD 4APQA 3W5NA 1FBIL 1JZ5A 2FO4B 2DYPA 2D0GA 3I02A 2CD0A 2XA8H 3EO1A 3L1OH 2AERT 2DWEA 2K7QA 3TLRA 2BCKA 1FZMA 1AH1A 4GRLB 5CKGA 4WV1C 2BHYA 3MV7A 1GZPA 2A1WL 1M1SA 3KPRB 3K46A 4QOKD 2IQ9H 5F7EL 5CFHA 3V6FA 2ADJA 4HS3B 2AJZA 3U0PA 1GGIL 3N85L 3VFMB 2X4UB 3C8HA 1N0XH 1BZ9A 1A1MB 1WWWX 5FO9A 1EJOH 4LCWD 3OKOA 4X6BA 4M93B 3DI2B 3ESUF 5I1HL 3TP4A 3RNKA 4LCUA 1JK8A 1EFXD 4JANB 1RIVH 1UQSA 5EOCH 3V6ZB 3LOWA 4KI1A 1DCLA 4H1LH 2NXYC 4XMKH 4GXVL 4X8XA 4HH9B 4L4VA 3ZKND 5I9QB 2XPGB 4XB8A 3O2DH 4PV8A 4PJ7E 4U6YB 4XNUH 4G43A 1D5IH 5B8CA 2DQTH 3DRTB 4DUXA 1DUZB 1BGXL 5JW5B 4O51A 3MR9A 5CJOL 3SCMD 4OQTH 4MNQB 3IB4A 4PJ8D 4I48B 3B8SA 3CMGA 5FYJL 4YIQB 3FFCD 2DTSA 3BRGC 2CH8A 4WFHE 5T5FH 5CEZL 2XQBH 3J7HA 2APVA 2CQVA 4YGAB 4ZQKB 2GK2A 2PO6D 1B6DA 1ZT1B 4GMSH 3QEUB 1QVOB 2WP3T 4BM7A 4M4RA 4XVTH 4F37F 5SV4A 3O4LE 3EFFB 1X5IA 4Z6AT 1BM3H 5C6WH 2FBJL 5C08E 4P2RB 2C4XA 4U4BA 5DQDL 2X4TB 3GHEL 3QDGA 2X9WA 4U1MA 4D8PA 4TNWF 4HDIB 1II4E 3OKMA 3QFDA 4JY6B 4R9HA 3KPSA 4ALAL 2VXVH 4M6ML 4YNYA 5GSRB 1DQJA 5I74C 2OL3A 1DLHB 1I9RH 2UZIH 3HE6B 1H3TA 1MLBB 4UMGA 4P49A 5KVGL 3TIEB 2VQ1A 4DCQA 1NC4D 1LO5A 1P2CB 4K3GA 2ADGA 3WIHA 1HQ4A 5F96H 1N8ZA 4NO0D 5BVJB 5C0CA 1E4XI 1U58B 1P4BH 2A0LC 4HG4K 3QIWD 1J10A 5B38G 3VG0L 5IB2B 4R4FL 4Y4HC 3BX7C 2GAZB 1G7LB 1PQZB 1YNTB 5D7IA 1GVIA 4WFEE 3GBNH 1DBAL 5EU6E 4OZ4A 3RVXD 4X5LA 4YHML 2PYEE 5EA0L 1AD0A 2EH8H 3O2VL 2D0HA 4PTTA 5F7WC 5IQ7L 2CSPA 4PJBE 1GGBL 1EAPB 3WO3B 3OB0K 3P0YL 2XTJE 1A6UL 1KYOJ 1FNLA 1J0IA 4HGWA 4YHPB 1ZA6B 3S4SA 1ORSA 3A0OA 4D9LH 1ZWIB 2AS5M 4I2XE 1RZ8A 3KJ4B 5DD5H 1I7UB 4Q2ZB 1TVBA 3VFWA 5J12B 3PWNA 5IT2L 4G9DA 3FMGL 2IH3B 4RQQB 1X3DA 5EU3B 1OWWA 3OSKA 1JRHH 3VFTB 1VGEL 3MRHA 2X4RB 4F9LC 4XPAH 5JPMA 1F4WL 3WNOA 3S37L 2Y72A 5BVPL 5GZND 1QZ1A 4XPFH 3WFHB 4LCYA 3JWDL 4NQTA 4PJFB 5E6IA 1Z9SA 2VZOA 1JF5A 2QQQA 5L9DL 3Q0HA 3THMH 5KVDH 3DX7B 4W4OA 2LVCA 4Z7WE 1CICA 3WUWA 2VSCA 3ARDD 3ZDZF 3BXNB 5DHYB 2VZ1A 1AKJD 5MI0C 4UV4L 3CXHJ 4OLUL 5EBLA 2EIZB 3QI9C 3OF6A 1FRGL 1RUAL 4IIQA 3WFDL 5ISZB 2EE3A 3BP5A 1KENH 2P5WB 1H5BC 5EOQL 4G8IB 3H7BB 1F8TL 5DXWA 3QSKB 2W9DH 4MQXC 4QRSB 4NNPL 3EIFA 1D5MA 4RMVA 1NDGA 3SKNB 3WFBH 5CKAA 3RJDA 2UYLA 2FLRT 1YEDB 2HT3D 2ERJC 1TDQA 3AC0A 1JHLH 4D3CL 4JHZA 5ENWA 4Y2DA 1J18A 2DQJH 5I1LA 3IYLW 3B2UC 1VFAA 4C59B 3REWA 2YHGA 2BVPA 3CZFA 4YHLH 4HCRA 5D9SB 4QRQB 5F1NA 2WP3O 3SGJC 4JZJB 4C56E 1CGSL 4NSKB 4HXBL 5TFSL 4U1KB 1MHHA 5I8OH 1M7DB 1AO7E 3CD4A 2QHRH 1YPZA 3I9GH 5D2LE 4BH7B 2AGJL 4ODXB 5F72S 2A9ML 3QXTA 1W0VB 4JPKH 4XWOC 2DD8H 3MRNB 4R7DA 5BOZG 3H9HB 5DYOB 1HIMH 4Y4FA 3EDEA 1T21B 3AREA 1ODAA 1P7QA 1CGYA 3TYGL 3SEPA 5IFHH 4WENB 3LN5A 1ZLVK 1IAIL 4HFWA 1MCEA 3CFEA 5D7SH 3DVGA 5FO7A 2BHUA 3DMMB 3A6CL 2ATKA 3MUGA 1JPGB 1ORQA 2WBJC 1NUNB 1UWEH 2GTZB 3SE4C 3SO3C 2YD8A 2EDWA 35C8H 3U82B 2OTUB 4UOW1 1KJ2A 3IS0X 1WBZB 2VLKE 3Q6FA 5TQ2H 1CFSB 2KZWA 2CIIA 4J23A 5JR1H 3K80A 4EDXA 2ICWA 5HDQL 1OD9A 5KS9A 3W11C 1Q0YH 4J4PD 2AJVH 1JFQH 4EVNB 3IDMA 1U8JB 4H1LA 2RFXA 1AGBA 1A0QH 3U79A 1MNUL 4ZAKD 1KIRB 3SHSA 1H0DB 1PJ9A 1VSCA 2JLLA 3O2DA 4DZ8B 4V2CB 3MLTB 4JFHE 2H3NB 3BPNC 2XZCL 3AS0A 1OTUD 4B41A 3SDCB 3D6GA 1Q72L 4H88H 4JPVL 4YPGB 5F6IC 3BKYH 4OQTA 3QUZD 3BMVA 2EYRB 1ZGLM 1ZSDA 3HZMB 4DZBA 4E41A 2ARWA 2VRAA 4O9HH 3HZKB 5MEQB 2PYFA 2JJSA 2EKJA 4WNQB 4WJ5A 1J8KA 1W0WB 4L4TB 3HUJE 4Y5XA 5FYKE 5M7QA 3NZ8B 5L8JB 2WQRA 4XX1G 1URLA 4EIZC 5H35B 3C6SB 1IKFL 1PAMA 4XXDB 1Q9LA 1QPPA 4DKDC 3LKPA 3NZHH 4HWNA 5I1GL 3RKDC 3BN9C 1MFEH 3WCYA 2A9NH 4KC3B 1AGFA 4PREB 4XC3L 3WS6C 3V5KA 1K5NB 4NBYB 5CD5D 3SE9L 5B38A 3ZYIA 4U3HA 4YBLB 1MCQA 2AEPL 2UY7A 5JHDA 5IJKA 3EYSL 3GNML 5T3ZD 3WIHL 3GIVA 2FJHB 1H3PL 2R0ZL 3NBNA 4Z7OF 4YXLH 3MGTA 3LB6C 5JXEA 1NGPL 1U42A 1ADQH 1DDHA 3E6HB 3IAQA 4OF3A 3EYVA 1AE6L 4PRHB 5C0AD 1J1XL 3SY0B 2VL4A 2C4FU 2VLJB 4KTYA 1QFHA 5IHZA 1FL3A 1S7UA 4HXAL 5GS0C 1S9VB 1YMME 1PZ5B 4FQQA 2GT9B 5DDHA 5I1JL 5CCKL 3SDAC 3RZCC 4RISL 1DTUA 4R2GC 3Q2CA 2OSLB 4FABH 5IVNA 2XZAL 5E8PB 5F93C 4AZ8A 3PF2A 1GGUA 4OF7A 2R1WA 4XPTH 3RAJH 1IJ9A 1BBDL 2R9HD 2C7UB 3NFPB 1HQRA 4ZXBC 4HIXH 4HKXA 3QDMB 1RZJC 4NZRL 2FRGP 4W6YB 4N9GA 4DQOH 3FQNA 1T1ZA 3V5DB 3PGDB 1UXWA 1V7ML 3P73B 2JB5L 1A2YA 4WIQA 1NGQH 4OF0A 1P4LA 1IAIM 2WNGA 4OLYL 2QSCL 4YUEL 3VH8G 4LSVH 3N9GH 4KMTH 4ZO6A 2DBLH 4PJ7F 1I8MA 3QEQB 4FQIL 1U92B 3C6LA 3SKMB 1R6VA 4TVPD 2NY5L 5J6GA 4JFED 1EBPA 2XG5A 1IGTB 1NGYB 5SWQB 4G7VL 2CKBB 5JNYB 4GS7C 3E2HC 4UV7H 4XCNB 3T09A 3HZYA 3GB7A 2YMXL 5EPMA 4HKJA 5IGXH 1FAIL 3FRPG 1DQML 4I0CC 4MZ2A 4MJ5B 2CXGA 3TIDB 2X44D 1IM3B 2X5PA 5D1QA 4WFGD 1JNHA 4RMRA 3O4OB 5M94B 4TOYH 4HWZB 5D96B 4C57C 4JHWH 2MSPA 3IRPX 4OKDA 4CNIB 4C4KT 5GZOC 2JTDA 4FN0A 3WKNA 1G0DA 2D7TL 4P2QE 1MLCB 2IGFL 1SEQH 1FHGA 4HUVA 2AK4E 2APWA 3TWCL 3U36B 3BEWB 5FO8A 1FO0A 2ZSWB 3B3IB 1QRNB 5GRJL 1FLRH 4K9EC 1OTSD 1MCPL 3O3EB 1E4KC 3S6CA 5ESQB 3V0WL 2VYRE 4HCRL 4YHYB 4KFZC 3VXRE 2IALA 3G5YB 3JSSA 1WTGT 4Y4KC 4PRBA 3UTSB 1QKZL 5I71B 3FZUC 1QD0A 2IAMD 3QZWG 1XH3B 3PXJA 1HXYA 3V7MA 3QAZC 4V2BA 1A14H 2APBA 1KIUA 1J5OH 4LKXB 3BT2H 3T3PE 5EO0B 4LGRB 4PJBF 4R4BA 2ED7A 4ONGH 7CGTA 5E1AA 4ODUB 3FO2B 1OP5K 1V7NH 5I19L 4IOSD 1F4YL 1NCBL 2HTKC 3E6FA 1BAFH 4JDVA 3TC9A 4NRZB 3TV3H 5JIHA 3WD5H 4F7CB 2CGRH 1QSVA 3G04B 5GRUH 3ARBB 3LN4A 4CMHB 2EC9T 4PJGA 5JW4R 4QCIA 3FO0L 2HRPL 4WI6A 3NH7H 2DL9A 1ONQB 4Z7UA 4JLRB 1X4YA 3V2AR 5E99H 1QFOA 4FG6C 5BXFA 5IFAL 4Z7QE 3MRBA 3GBMH 4KDTC 3GSNA 2VC2L 3S36L 5HGBB 1RHHA 2Z31A 3WN5A 2X4OA 1KJ2L 3DUSA 3MFGB 1LEGB 3DECA 3ZL4H 2GFBA 3G08A 3MV9E 4WO4D 4Y16A 3F12A 4O4YL 1MREL 2NXZD 1PG7W 5D7LA 5KVMC 3BZFA 5CGMA 1IFHL 1RIVL 1QNZL 4Z7WF 4Q6IB 2DOCA 4F3FA 5CEZD 3LD8B 4D0BB 2YA1A 1AR2A 3GK8H 3O2DL 3SQOH 3X3GL 1RUQL 4FFYH 4XNUL 3K7UA 3QH3B 4O5LL 4WWKD 1T5XB 1IGJA 4WUKH 43CAB 4LSDA 3CX5K 4M02A 3QUMA 3V0AC 2E7BA 1RZKC 4GW4A 5HPMA 3X14B 3QNZB 1U8MB 1RJLA 5T5FL 2BNQB 4RFNC 5BQ7B 2XNAB 1IBGH 4PBVC 1RJZB 2W0KA 3TZVD 4XCEA 4XVTL 1MFCH 2FJFA 4UAOB 2GJ6B 1U91A 2VXTH 3VFNB 3R1GL 5JZ7C 5CSBA 1L7IH 3VCLA 1T0NA 4LVHB 4QHUA 5DRWA 2W38A 4PG2A 1KCRL 1ZLWH 2X9YA 5GSVB 1JYXA 4MDJA 4WI8A 1KPRB 5E6ZA 3REVB 3PWLA 5IEHA 3BZDA 1DANU 4PJDB 5FIEA 4L8BA 3P40A 3FN0H 5DMIL 1MFBH 5HI3C 2MCPH 5LAXB 2AXJA 4J6RH 2VXQH 4EN3B 1BJMA 5IBTH 1IAKB 2BY2A 1JF1B 5GRZA 4C4KO 2P42B 5BS0A 1I85A 1ADQA 1AIFA 1CG9B 3RNQA 5D2LF 5CGYC 3LKRB 1HKLL 4JJ5B 3SDDC 3C5ZD 4JO4L 2Q8BH 4PJIA 1RIUL 5L2KE 4FTVA 3MRKA 3GBNL 3QIUC 2EH8L 5E08L 1K4DA 1A5FL 4BK5A 2F8VA 3ISWA 5GS1C 3QIBB 3DXAA 1U36A 5HHXH 3C5JA 5INCA 3EFDL 3I6LD 2QV2A 1VACB 5IHUH 1G7IB 1JJUA 2DM3A 3K4AA 4YR6B 4E42A 1JHTA 5KZCB 3DLQR 3V6OC 3GO1L 1ZA3B 3C60C 4QRPE 1NCWH 4XT1C 3VH8A 1CWVA 4LMQE 2Z35B 5FDWB 3ZYJA 1U3HA 1DL7L 4EUPB 3UAJC 4G3YL 4XNXH 5FYKH 3T8XB 2VR5A 2MPAL 2WIMA 3BYYA 5HI4C 3RU8L 3FL7A 2I27N 4EI6A 1ACYH 5T33L 1TPXB 5E5MA 3L3IB 3BSZH 4OD3H 3G6DH 4OB5L 5D6CA 1IKNA 2VDLH 4KKAD 5TPWL 5SV3A 4DFIA 2D7MA 5C09E 3HUJF 3QB7C 1QLFA 2ID5A 5FHAH 3HNTH 4WHDA 2XT1B 2GJZB 5HGHB 3NFSH 3PWVA 1UM4H 2HG5B 3R06B 1P69B 3MMEA 4MXVE 1T2XA 1I1RA 1A9EA 5FUZH 4MA1C 5FA3A 4P5TD 5FUOH 4DUVA 4PP1C 3ZHLA 2V17H 1NDMA 4MNHA 1EJ6A 3IKCA 1R5IA 1AGEB 1KJMA 4X7SL 5HI5D 2HTLD 4IM8A 5F1IA 2DJ4A 4KROB 2H26A 3VXMA 1F5WA 4ELKA 2GSGB 3IU3B 1FO0L 4CRPA 1BECA 4LVOC 1IC7H 5D1XD 4HIIB 3QZWA 3WNLA 3HMXA 5I76A 4GBXC 2W60B 1OB1B 1MIEH 2OMNA 4MJIE 1WIOA 4CDHA 4Z8FH 3B9KB 3KYOB 3VE0B 2I5YL 3O8XD 3IJHA 3N1GC 3PABA 4LLVB 4ZDHB 3F7QA 1H3UA 3MJ7B 4DVRH 2E8YA 2XY2A 4FP8L 2DMCA 4JRXA 2MOVA 3QJHA 2ICCA 5TE4H 5C0BE 2DYPB 4NDMA 2P8MA 4APQD 3MRJB 4ELME 4JPKL 3S9DB 4AM0B 1GZPB 2AXFA 4WV1A 2DM4A 3L7FA 5IFJA 3MV7D 4DJMA 1FPTL 4LSSH 4OZFG 3P4LA 3KPPA 4U6HB 2ADJB 3WMSA 3KPMA 5BO1H 4HFUL 4H20L 4UT7L 2B0SH 4NYLA 5LWYH 3GDBA 5ID0A 1DQTA 1FE8L 3C08H 2I9TA 1BVZA 3VGHA 5C07D 3TESA 3E3QC 5TQ0H 4JRYA 3NIGE 1ZT4A 4FQXC 1K8IA 1TJHH 1DN2A 5IM7B 2NW2B 5CAYB 4PV8B 3GSNL 5F3BA 2HT2D 3C8KB 3LPGA 3P4NA 1JV5B 5JR1L 1KJVA 5EU4A 4MX7A 1MAMH 4JFFD 1KCVH 1WBYA 4BSWA 4WU7A 5DRNA 3MR9B 3RVTC 3BVNB 4H5SA 5JA9A 4TTDD 3TN0B 1RIHL 3P3YA 2YD7A 5DMGD 5EB9A 2VAAA 1NGXB 2YOCA 1ZEAL 3QCVH 4NGHL 1A0QL 4QXWA 2E5EA 4U1SA 2ZOLA 2FBOJ 3EZJB 4YO0A 5I8CA 4ZFFB 4KI5E 5SX4I 4NFCA 1IAMA 3T1FB 1WICA 3FT4A 3AAZB 4JPIA 1PD6A 4ERSH 1KG0A 3BKYL 4KK9D 4M43H 1FORH 4XGZA 2JK5A 4BH8B 1JCKA 3QUML 4ZUSA 2MQ0A 1IE5A 1YJDC 3C8DA 2V2TA 4U1MB 2NPLX 1Q94A 3QDGD 4OLWL 5GGSB 5H37H 1KXVC 2KQNA 3NMEA 32C2B 2VQTA 1IEAB 4WI2A 4UU9A 1MJ8H 1NANI 4CL7A 2PCPB 4XHJD 4U31A 1MFEL 4QRRA 2BRQA 2J5LB 4GAYA 2Y36L 3RWJB 4GQ9L 1H15B 4CBPA 5BZDA 5D1ZD 3QUYB 5C0CD 2KH2B 5T1LB 4NQDB 4MXWL 5DEFB 4JFZL 4WTWA 4Y4HA 4MB5A 1JWMB 1S9WA 1ED3A 2IQAA 4S1SL 3PDOA 5SWZE 1LO0H 5MP6L 3GSOA 4RAUB 4GXUN 2EICA 1AR1C 4F8QA 2ENSA 1CQYA 1FNGB 1MVFA 2E9JA 3S5LB 4ZNCD 2HLAA 5HHVH 3KLAA 1AD0B 3LQAL 4K7FB 4QXUL 3DV6B 2HJFA 4LBEB 5I1AB 5GS0H 4OLXH 2G2RB 2PF6A 4WDIA 1N6QH 3T3PF 2VABA 5TF1H 3SO5A 1T1XA 1TVDA 5ETUB 2VDRL 4LAJH 2VLKA 4P4KB 1LK3L 4ACPA 3M1BA 1TVBB 3QFJA 1UM5H 4OLZL 5JQ6L 5L7XL 3WO4C 3HE7C 2P8PA 1NBVH 5DUBA 5EUOB 4WCYL 2VDKL 3MJ9H 1MJUH 1DFBL 3MRHB 1RZJH 4F9LA 2ICEB 1CLZL 5IB4B 2QQLL 1GPOH 4LPUA 4CVXA 1C12B 2IG2H 4I5BA 3QEHB 1C5BL 1HZHH 3STZA 5DRZB 2R1XA 2NX5B 1F11A 4LF3A 4Z7QF 5ADPH 4UT9H 3WSQH 5E6IB 4LLDA 1DE4A 4JDZA 4IRJD 3QWOA 3M17A 4Y1AA 3RUGE 1N4XL 1IC4L 4RMQA 4X8JB 3KLSA 1E4WL 1CICB 4X5XB 3MTRA 4JG0H 5GISH 4LSUH 5E9DE 4XWGH 5C0NC 4MA7L 3RWGB 3QI9A 3HB3D 43C9A 2ARJA 5EZJA 1H5BA 1TCRB 1MF2L 1U2CA 1YNLH 4R7NA 1JNNH 1PYWA 3BPCA 3T65B 1D5MB 3U1SH 4G42A 3U6RA 1CXHA 3OZ9L 3B5GA 3IKKA 4FXGA 1TVHA 4D94A 2YD3A 4NUGL 2NY1C 1NGZB 4K2UH 4HS6B 5IGXL 1Q0XL 2X05A 2I9LA 1CL7L 1MFDH 2D2OA 4LPCA 4M7KL 1CR9H 4LNRA 4Y2DD 4D0CA 1V3KA 4HPYH 5C0EB 4N0YH 4E5XB 3UZVB 4GLRI 1KXQE 3UTZB 3ZLQC 2FNBA 3REWB 1DSFH 3RWCA 4K9EH 1RZ7L 1T20B 4Y88A 3NA4A 5DJ2B 3T0XA 4DW2H 4W81A 3SGJA 4ZUTA 4RCAA 1SEQL 1QHPA 3JV4A 4PJCE 5T5NG 1JMXA 1INQA 1HSBB 4XI5D 5IBLD 5ACZB 5KSAC 2HVKB 3UPCA 3MX0A 3VFGL 1YMMA 1MCOL 4OSUH 4PJ9C 5IW6B 4G8FA 1OAKH 3K4ZA 4X4XB 4EDWL 1YPZB 2B5IC 1N5AA 3DETD 4XPBL 1FNEA 1N0LA 1SHMA 3G5ZA 3SDXE 4RSVA 3HMXL 1I1AB 3KXFE 1DEEB 1QOKA 1UACH 1B2WL 4DFHA 1ZV5A 2CUIA 1HOCB 1KGCE 1ZXQA 2W9EL 1N7MH 1YNKL 4Y4FD 3IETB 4OZFA 3ARED 3IFNL 3B9EA 4PUBH 1P7QD 4ESKA 4MJ6A 1T7VA 1IGFL 1QO3A 5FO7B 2X4QA 5JOEA 1ACZA