1AZCA

Structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
b'AQCEATIESNDAMQYNLKEMVVDKSCKQFTVHLKHVGKMAKVAMGHNWVLTKEADKQGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMMKGTLKLSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
molecule tags Electron transport(copper)
source organism Achromobacter xylosoxidans
publication title Structure of apo-azurin from Alcaligenes denitrificans at 1.8 A resolution.
pubmed doi rcsb
total genus 33
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1azcA00
2FQFA 4MFHA 4M4RB 4ENZA 1AIZA 4N8UA 3OMNB 3X1NA 4AZUA 2JKWA 4W1TA 3S3DB 1AQ8A 1AG0A 3TBCA 1NZRA 1SFDA 2BHFA 5TK4A 2IDTA 1MZYA 2FT7A 2HX7A 2HZHA 1J5CA 1CYXA 3AG2B 2HRGA 1IC0A 1ET5A 4TXVB 2ZOOA 4GXFA 1E67A 1IKOP 4E9RA 5F7BA 2JFCA 3SQRA 3FPYA 1SF5A 2GB2A 3T71A 1AZNA 2GHZA 2BW4A 1CURA 3V9EA 2FWLB 3FU7A 4FAAB 3NT0A 1SFHA 3U25A 4E9SA 1SDDA 5F7AA 2FQEA 1L9PA 1WS8A 2CBPA 2CCWA 1BXUA 3MX0B 2BZCA 4DP7X 4GYBA 2HX9A 1A8ZA 3OMIB 5B1BB 1BQKA 1A3ZA 4G7RB 4GP8B 5FC9A 1A4AA 3EF4A 2VSMB 4NB7A 1KBWA 2VM4A 5B1AB 5B7EA 1SJMA 4JHVA 1GY1A 2PPFA 3OM3B 2BP0B 2GC4C 3NJKA 3PAZA 4YSQA 4UF7C 3H4HA 1HAWA 1FA4A 3NJMA 4A66A 3TASA 3PAVA 1GR7A 3G5WA 1T5KA 4K9JA 2IWEA 2XWZA 4PAZA 1F56A 1M56B 2DWTA 3IEAA 2HLEB 4E9QA 1OOWA 2AZAA 3NJFA 4YVNA 2PPDA 3NJHA 3ABLB 3H4FA 1WA2X 2R7EA 3WNJA 2IAAC 3FU8A 4YSUA 2A3TA 4JHUA 2EINB 3NJJA 5I6LA 4AI7A 2UXVA 5A7EA 2AZUA 4AKPA 4KNTA 3WG7B 3PAUA 4GP5B 3QPKA 1JXGA 3C75A 1PZAA 4UAHA 5I6PA 3IN2A 1HFUA 3FQ2A 4FA7B 4RH4A 2Q5BA 4KOCA 2BWDA 4DPCX 2BP0A 4A68A 1ILUA 2BWIA 2GIMA 1VLXA 5LDUA 1ZIBA 4HZ1A 1BAWA 5B1JC 4ZK8A 4BWTA 2Y1AA 1ASOA 1JZGA 4L0PB 1PLBA 2I85A 1TEFA 2UX6A 3GDCA 4NAJA 3CDZB 3DIVA 4BXVA 1SF3A 2OJ1A 3NJLA 3WNIA 5B7MA 2GI0A 2VSKB 1NIDA 2DY2A 2WO2B 5IY5B 1BYOA 4Q89A 1V54B 2OCCB 3SBRA 2AANA 1XB8A 1NIFA 2IH8A 1NIBA 2R7EB 1NWOA 2UX7A 1KDJA 1IBZA 3OMAB 3PXLA 2PP8A 3BQVA 3FU7B 3T6VA 5I28A 1KCWA 3NJNA 1GS8A 1A4BA 3X1FA 4AKQA 1JVLA 1OCCB 1AS6A 1I53A 4A2HA 9PCYA 3WI9A 2BP8A 2J55A 3CZUB 4P5RA 3TA4D 4EF3A 3ASNB 1AZUA 2PPEA 4UANA 1GY2A 1NICA 3EHBB 1CC3A 1AOZA 3SBPA 4DP1X 1KV7A 2XU9A 3QJRB 4A2FA 4HCIA 2P80A 4E9XA 2FNWA 3ZX1A 3FQYA 3S3BB 1M9WA 1PZBA 1JZIA 1NPJA 2N0MA 2W8CA 1ET7A 2W88A 4E9YA 4KO6A 1PF3A 3X1EA 3T9WA 2YARA 3T6XA 1E30A 2XXGA 3NJGA 4CSZA 1KCBA 1JXDA 2VMJA 3S8FB 4KNUA 2J57A 1E5YA 3IN0A 3NJIA 4HALA 4KO5A 1W6WA 1AZRA 1DYZA 5D4JA 2X88A 2ZWNA 4YVUA 3NYKA 2ZONA 1MG3C 2XV3A 3SBQA 3UAEA 2OV0A 3FS9A 1TU2A 3UABA 3QQXA 1NINA 1KDIA 2PCYA 5AFAA 4DP4X 5PCYA 3CVDA 1ILSA 2QDVA 1L9OA 1W8EA 3IE9A 2PPAA 2XX1A 4JKNA 2MTAA 4DP0X 1AACA 1QHQA 2XUWA 4DP2X 1SHXA 4BK5C 5AZUA 4KOBA 3D12B 1J9RA 1ID2A 5I6OA 4G71B 4E9TA 5I6MA 1OE2A 1A4CA 3CVBA 3NP4A 1AG6A 3NP3A 1NIEA 2YAHA 1AS7A 1ASPA 5I26A 4A2DA 1BXAA 1QLEB 2XV0A 3UGEA 2PCFA 1AZBA 1JOIA 2DYRB 1WAEA 4KO9A 1KYAA 2BZ7A 2EIKB 2IDQA 4HCGA 4BDVA 3X1BA 5I5IA 3H56A 4NERA 1MG2C 3HEIB 4P5SA 3ZBMA 2ZXWB 1MDAA 1A65A 1NDTA 1SHWA 2MRYA 2B3IA 1NTDA 5B1JA 3WKQA 3FYEB 1V55B 2PLTA 4E9WA 4YSEA 4W9ZA 2XXFA 4CSPA 1JVOA 4WTQA 3MBWB 4QLWA 5PAZA 1J9TA 1ET8A 3ABGA 2QT6A 4DPBX 1UATA 1PMYA 2H47C 2QDWA 1IBYA 4AX3A 2BW5A 2LLNA 1X9RA 3AW5A 4DP5X 2YAEA 1JXFA 3AZUA 4DPAX 3N2JA 2NRDA 1KBVA 3PLYA 1AS8A 2TSBA 4A67A 1N70A 3CVCA 3CDZA 3FYIB 1JZEA 1X9UA 3QJTB 1NWPA 1PZCA 1N68A 2EIMB 1XB3A 3ZDWA 3PCYA 1W6LA 2PPCA 3S3CB 1ASQA 2H3XC 4G72B 3UADA 2YAFA 3EH3B 1M57B 3HB3B 1NIAA 3T6WA 4BWWA 2FT6A 3ABKB 4DP8X 2IDSA 2GSMB 2E86A 2UXGA 4Q8BA 4WKXA 1L9SA 2CUAA 5B3SB 1PAZA 2B08A 4N4YB 1AAJA 1PY0A 3NSCA 2IH9A 2WSDA 5I6NA 1PLCA 2CJ3A 2IWFA 3WIAA 2CAKA 4E9VA 4M3HA 3UAAA 1B3IA 2VW7A 3ERXA 3QJSB 3S8GB 1E65A 1BQRA 8PAZA 3T6ZA 1GYCA 2YQBA 4KNSA 1R1CA 3DKHA 2XLLA 1ZIAA 2J5WA 2Y69B 3JTBA 2XV2A 2DYSB 1JZJA 1OCRB 1BXVA 1PCSA 2Q9OA 3NSYA 2UXFA 1BEXA 2VN3A 3PPSA 4BXSV 4HHGA 4YSRA 2HX8A 1PLAA 3WKPA 1RCYA 4GY4A 2UXTA 2GC7C 1OCOB 1GSKA 2YAQA 1GS6X 3FSAA 3FPXA 2AFNA 3FSWA 1FWXA 1IUZA 1FFTB 1OCZB 1SDDB 1XB6A 4HHWA 4HIPA 3TU6A 1ZDQA 4A2EA 1L9QA 2YAPA 4G70B 2FQDA 2FQGA 2PP7A 2BP8B 3FU9A 3GXUB 6PAZA 1RZQA 1JZHA 3V9CA 2H5UA 1OV8A 1OE3A 4F2EA 4BWUA 1ETJA 3ZIYA 1BQ5A 3JT2A 1AZCA 3N55A 4YL4A 1WS7A 2QPDB 5D4HA 1CUOA 4F2FA 3AG4B 1GS7A 2XX0A 2YAOA 1V10A 3AG1B 2VM3A 5ANHA 1QNIA 3TBBA 1TEGA 1L9TA 2P80D 2I7OA 2WO3B 3NSFA 4GP4B 1EZLA 4YSDA 4YSSA 3FSVA 1E5ZA 1EHKB 2FJSA 3OD3A 1ZDSA 5EHFA 1AR1B 2RACA 1WA1X 7PAZA 1ADWA 2YXWA 2X87A 2FT8A 4F7KA 1BYPA 4PCYA 1RZPA 4A2GA 2VW6A 3X1GA 3AY2A 2HXAA 5E9NA 1J5DA 4BDVB 1DZ0A 2XVBA 1XMEB 3X2QB 3CG8A 3QJUB 3EH5B 3FQ1A 2TSAA 1ZPUA 3EH4B 6PCYA 3NSDA 1L9RA 1JERA 4HAKA 5AKRA 2CALA 2IDFA 5B1KA 2XYBA 4YSAA 2DV6A 2PP9A 2FTAA 3ASOB 4G7SB 3BVDB 2J56A 2JXMA 2IDUA 3L45A 1J9SA 3FT0A 2GBAA 1RKRA 3FSZA 1PNDA 1HAUA 2YAMA 2YXVA 2EILB 1MZZA 2IWKA 1JZFA 3DTUB 5I6KA 5B7FA 3UACA 3IBOA 4X4KA 4DP9X 4QKTA 3KW7A 1PNCA 1NPNA 2I7SA 1WA0X 1YLBB 4AKOA 4YSPA 3QJVB 3AG3B 3GYRA 1URIA 3KW8A 1GW0A 5I5MA 1J9QA 5I5JA 2VW4A 3RYMA 5TK2A 4DP6X 2QPEB 1ZV2A 4YSCA 4HCFA 1KGYE 2AVFA 4YSTA 2BO0A 2HRHA 3QJQB 1CYWA 1TKWA 3ABMB 1OF0A 4G7QB 4YSOA 1AANA 2EIJB 5D4IA 7PCYA 1SNRA 1OE1A 3OQRA 4KO7A 2DWSA
chains in the Genus database with same CATH superfamily
3IJYB 5FCSH 1SVBA 4DO6A 2NMSA 3ULVF 1BIIB 1HQ4B 5I30H 1MHPL 1LJMA 1T6WA 2ZKHL 3VB8A 1A7BA 2WTPA 1AQ8A 1T03L 3GZKA 3TBCA 5TK4A 5JW5A 2HZHA 1EGJH 1AP2B 1EZSA 3KYMB 4IKNA 4NHCH 2BNRB 4LLUA 1BFTA 1C12B 1OTTD 3QIWD 4R4NC 5F7LB 3RDTC 2I25N 4K3DH 3V0EA 3MV01 3BVTA 3WHXA 2GJJA 3DI3B 4R7LA 4WGKA 2IV9A 3MRQA 4BRJA 2VR9A 4MB1A 1K4CA 1MWAL 4JHZA 5E1HB 4W9EC 4AGPA 3HVNA 1AVAA 5C2BL 2DKMA 2GHZA 3HI5L 1BQLH 1X5ZA 3NT0A 5LXVA 4CJ1A 2ICWI 1E2WA 4LHUA 2B3RA 4DOHE 3U1SL 4CMHC 2F5AL 1NMCB 1FE8L 1NJ9A 2HVKB 4FQXC 5DQ9A 5KVDL 1Z3GL 3CLWA 2QV4A 5AAMA 1TLMA 3B7UX 1TYJA 3CMOH 2XBTA 2IAMB 3T8VA 5F9OL 5E03A 3WNKA 5DZNA 4HLZH 3ESNA 3PWJB 3BIAX 5E9DE 3A4FA 5B7EA 4Z7WB 3THMH 4FG6D 3Q6FA 2Q7YB 3PREA 4P3WA 2BP0B 4U6TA 3NK4A 3PP4L 2NY5C 2FYVA 3L4ZA 1SY6H 4CJ0A 3ARFC 1L7IH 4W9HC 4K3DL 5C0BD 2HCZX 5F2FA 2DRUA 4UOZA 1TDQA 2ZD0A 3C6LA 1J1XL 4PJBF 1XGUB 4FN0A 3O6KH 4OKVB 3ZGHA 3K71A 3K8MA 1ADQL 5KJRH 3QNYA 4OLXH 2P5ED 3CDYA 3NACL 3UMNA 2D3NA 2OCFD 1BBJB 4MNQE 1EMTL 4PFEA 3OF6D 2KH2B 2GIXA 2XG5A 3B6SB 3O6LH 4UQIM 4JHUA 4U1NB 1MCOH 4KMTL 4XNXL 4I2XB 3X3GH 5ID0A 5FOBB 5F0LB 1E4WH 3HN5A 2DW5A 2MQ0A 2UXVA 4W9KC 4P9ML 4ZX6A 2J5LB 3PAUA 2G5UA 4PG2A 3HC4L 3QXAA 5KOVC 5AVQB 4GP5B 4KTYA 5EU6B 2GSGB 1E2VA 1N67A 5C7ZA 4AWJC 1EBAA 1RURH 3B3BA 5IGXL 3NZHH 4RWYH 4WO4A 4Z1PA 1JGEA 2ARJB 2WVUA 3NTCL 1FI8C 1UOKA 2D3VA 5CR1A 5DMJB 4B3EA 4L5FE 3V95A 3VRIB 4LNRA 3FU5A 3U1SH 2X4UA 4DKEH 1I1AC 2E9WA 4FFZL 1ZE3C 1G7PB 4XMXA 3VWKC 3H53A 2W0FB 4D7PA 5JR1L 1KGJA 3WJLC 1QI5A 5DA0B 2OJ1A 4P3CH 2EUZA 3BUPA 3AUWB 3ZQ9A 1AGDB 1X5XA 4EE2A 4UM9B 1F8TH 3TTSA 3ARZA 5KYWB 3PWPD 3EBHA 4R4FL 5D2NC 4PRHE 1HYSD 1EO8H 3QORC 3CAFA 5L2JA 3MV9A 1NWOA 3MACL 3OAZH 4FQPA 4PJFA 4ZXBB 1H15A 3K0WA 4ZRGA 1UA7A 5AL0A 1SM3H 4GB9A 2ARWA 3VXUD 4PGBA 4BZYA 3RWGA 3I9AA 2D31B 3TT1L 4M43H 1QABA 4L3AA 3IDXL 4ZUUA 1E0OB 2ROXA 3C2AL 4Z78A 3RY5A 2AJYL 5D93C 1YN6B 2CLRA 2HAZA 1EAPB 4C83A 4UANA 5E1QA 1CF8L 5I1HL 1P1ZA 3UJJL 4G5AA 2AKRB 3NBNA 4H40A 2ZPKH 4ZO6A 5IESH 5AENA 5EIIA 3D0LB 4H2CA 4FFZH 3U7AA 1Q9KA 4Y4FA 3HMXH 4HBQA 4KO6A 2OSWA 3GRWA 4Y16B 3SQOH 3H9SA 2WLLB 1E9OA 1JNHB 4W9IC 5FUZL 5A2LH 4W4OA 1FNGA 3HG1D 1JXDA 4Z7WA 2VMJA 3DK2A 3L4VA 5CSGA 5JW4N 4YBQD 3WO3B 1KB5L 4M9OA 5KSAA 3HS0C 3KWVA 3DK0A 2JKLA 1CI3M 3HHSB 1AH1A 1PL3A 2PCPA 4NCDA 1HNYA 2DWDA 4WY7H 4YDNA 5DGRA 2X88A 4H8WH 3V0AC 3EBGA 4NDMB 2ZNXA 4EEEA 5C08D 3SE3A 2BCKB 3JVGC 2JB5L 4AEIH 5MEPA 4HA1A 2GTWA 3JUZA 4HKXA 4GQRA 1WV7T 8FABA 3MBWA 1F6AA 4O51A 3H7LA 4G8GD 4M1CC 3ZXAC 1XCQB 1IFRA 2BIMA 3NGBB 1MCDA 4YDMA 2MPAH 3X3FL 1BVKB 1TZGH 1KFAL 4OIBA 5ISZD 5HHMD 2WQSA 3DO7B 4BFKA 5EN2B 1VKXA 2YWYA 3BKJL 3L1OL 4G43A 4JK0D 1NEZB 5AVVB 3HZKA 1PX8A 2DLTA 1T03H 5JHLA 4HCGA 3S4SG 4K9EL 4AC4A 4RETB 5DUJA 2R0KH 5BS0B 5F1IA 5FEBA 4EZKA 4GQ9L 2WQVA 5DCCA 2Q86B 2VLKD 3BPCA 2Y7MA 2QQNH 5INCA 1CBVL 1JHLL 3DHPA 3MCYA 3LZPA 4FADA 4J3TA 2ENQA 5D70H 4NI3A 4PRNB 5DJ2B 5F7DA 3WSQL 3KS0J 4LLWB 5IVOA 4PJAE 4X98B 5CJBA 4HAGA 4JZJC 4KXZH 4XXDA 5L2KB 4R96A 2XICA 5DJXB 2VXSH 2YMXH 4P57B 4PBVC 4GKSA 5AQ0A 4X9HA 4UTBL 3MLRH 2D31A 1EZVX 1I75A 3VFVA 1ETB1 3F7LA 2WNWA 2OL3L 1KBVA 3RL1B 4XMZA 5FXCH 4JRFA 4P4RA 4N8VA 3U4AA 1CLYH 3I9PA 4CDHA 1KPRB 1JGIA 3GMRB 1ZWIB 3V7AE 2VERA 4FZ8L 4LOUD 5GJTH 1IL1A 5B1CA 4LOVA 2ED8A 4Z78B 3Q3GA 4WRLA 5HHNA 2H3XC 1K6QL 1LDPL 3FUEA 1U91B 2XN1A 3ECQA 4EZJA 4AH2A 5F7MC 4C83B 3ETBF 2FEJA 5FFOA 4JQVC 1ZLWH 2K4WA 1IM9A 2X0UA 2OTUB 4FLQA 4FNRA 5ITFA 3A24A 2Q76B 3Q8EA 2ZUTA 2CJ3A 1GGUA 3AFLA 2KT6A 5DFWH 2F58L 1EPFA 4AQ1C 1KBPA 1ULVA 4ZS6C 4XB3A 1UM5L 1FVCB 2JH2A 1X7TA 3DGGB 4DN3H 2BOBB 3M6DA 4F27A 1ZLDA 3IFPB 1A64A 4PJ8B 4ZW6A 1KENH 3BT2L 2ZZUT 4JJOA 4JQXA 1NKRA 4GG8B 1PVHA 2MJWA 2GUOA 2UXFA 3QRGH 4MCZA 4DJMA 1Z0MA 1Q0EA 5LAXA 1UZGA 4FJZA 4ZXBD 5FUOH 2UY6B 5C0FB 3EOBA 3O6ML 5DC2A 2EUVA 2XACC 3RNKB 4KTGA 3PWNB 5DJ6B 3K2UH 3Q8CA 4G9FE 5DS1A 1ZDQA 5K9JH 2DBJA 3HS8A 3NIFB 1XFPA 2DWYA 1FNSH 4XO4A 4NM4L 4OD3H 2R0ZH 3VI4E 2R56L 3BRGC 1U33A 2PP7A 4I89A 5E00A 1OF2B 2JSFA 3EUUA 4YZFE 1H3VA 4APQC 3KM1A 1KV3A 5AB0A 1ZSDA 4Z7IA 5LNEA 3IDGA 2C5DC 2VXQL 3GJEB 2R2CA 5GRVL 3CZSA 1AZCA 2GJ6B 4N1EA 5D4HA 1Y0LA 4JFFA 4HLJA 3NPSB 2XX0A 4QHUA 2X5PA 2PCFB 1JJUA 3BP6A 1FFPA 2IFGA 1X44A 3OKMA 1NCWH 5F1OB 4ABVA 1WC7B 5F89B 4JZJB 3KVPA 3UP1A 3WJMA 4I1RA 4NZRH 1ACZA 3SE4C 3KBHE 2XTJD 4Z9KB 2KMWA 3EJYD 2W95A 3EYSL 4EOWL 3ZTCC 4GNKB 4CVXA 1OAKL 3G08B 4OTXL 5DYOA 3AY2A 3DARA 4UDTA 3N43B 4XCEA 3B43A 1UCTA 3KD4A 2CD0A 1JPSH 4RFOL 1KTLA 2V9UA 3N6YA 2UWEE 1J5DA 3MFFA 4LDEB 4BDVB 2VAAB 2YEZA 1DZ0A 3CQPA 3STBA 3GLZA 2HTLD 1I8IB 3CVHA 3X2QB 3SPGA 1R5WA 4YWGH 3KL5A 2EH8L 3N5AA 2IAMD 5IW1B 5IP4A 3OZ9H 2C8NA 3MOAH 1OGAD 3RPKA 1N4XH 1RHHB 3SY6A 4KMLB 3VDBA 1I9IL 2K6ZA 1UWEH 2J56A 5I1CH 1BVZA 4OGXH 1E27A 1UB5A 5CD3A 3WTWA 1PYWA 3LQMA 3L45A 4DGWC 1WZKA 1AMYA 3BUYA 1KY6A 1QBBA 5FPIA 1AYOA 3QQ4A 4TM9A 3BKML 4ODTL 1UWXH 4P59H 4HS6B 1SEQH 3KYAA 4U1HA 4W6XB 5I8CA 1T2QL 2GEEA 1OP5H 4LZKA 3T0BA 2VDOH 3SBWC 4JZOB 1A6TB 1QSVA 3IMVA 3SCMC 1T2JA 4R26H 1RU9L 3ATAA 4AKOA 4B9ZA 5CMAA 1FUNA 1WZ1L 4PUBL 5AW5B 3FONA 3RDJA 4HXBL 5EZIH 3VWKD 1OK8A 1QSEE 1OP9A 3O9WD 1UXMA 3L2NA 1VJSA 3ZDZB 3E1F1 4HCFA 3AY4C 2BO0A 3DDGA 3QJQB 1SXAA 5EOQH 1P2CA 4LPTA 4TSAH 3RJDA 4ZMNA 3SDAA 3ZZ1A 4NQDE 3OXSB 4LCIL 2A9NH 2DBLL 2WWMC 4OLEA 2J71A 1SJEB 4XN5A 3K81A 3CD4A 5AOKA 3ZTJH 1MRFH 1DQLL 3IU4L 2Z0UA 5EDXA 4AZUA 4MXVF 4Y7OC 3L1OH 1JZ4A 1RZGA 1CGTA 2QSCL 2NQDA 3BGFB 1IAOB 2ZXEB 1M42A 5C09B 2FT7A 2HX7A 4NO3B 2XPGB 1FORL 1G7IB 4G8GA 1N12A 4NWTH 5HGAB 2UV3A 4DZBB 1Z5YD 4WENB 5AVWB 2CA4A 3L3IB 4GAFB 1FG2B 4R4ND 2NY0C 2F53E 4YL9A 3JSSA 1JHTA 2BC4A 4J4PC 5SWSB 4U2ZA 1U3HD 3RNQB 5FWQA 1QSFA 4JDZA 4AITA 1NUNB 2WBJD 4IBLT 5FFLA 2FWLB 2C3GA 5GJSL 2JI2A 4LL4A 1N7MH 3KXFB 5IIEA 2FJHB 2X6BA 2PYFB 5EUOE 2FQEA 3IFOB 1ACYL 3O6FC 5F44A 3TJHC 3KYNA 1PCXA 2V9TA 2VERN 3REVB 3QXAB 1GGCH 3TH3T 1H8SA 4PBXA 1LE5A 3DX3A 4ZSOB 5FDWA 5H4ZA 1G6RB 1UH3A 4P49A 3FAWA 1A3ZA 1IJNA 5DFVC 4GP8B 3VXQB 2Y7SA 5LLIC 3IGFA 4GT7A 3FT2A 3FT9A 4WHCA 2OW7A 1QWHA 3NABL 4L8CB 1A6VL 3OG6B 2WXIA 4PI0A 3VXOB 1B0GB 2H26B 2J8UF 1UWXK 4HCRH 5BUPA 1WH0A 4X4MA 2VL5A 4Z95L 2DJMA 4IEFB 5HHPA 4HJJH 5TGBA 1I8IA 1RIUH 3CVHB 1F3JB 4N2LA 3C60D 5AAPA 3EKCA 2ZOLB 1D7CA 4R5XA 2YBGA 3BZFA 3CXHJ 3MRGA 5K1VA 3LY6A 1AC6A 4MD5B 3VDCA 1QUNA 1KZQA 2PXYC 2JELH 1YNLH 4Q9QH 3C5XA 2XPZA 1L3WA 4HCRA 3U4BH 3S4SB 1JGDB 1MFCH 4Y5XC 3SOTA 2VRAA 2ADJA 5FUZH 1S9WB 3WUWB 3AAZB 3WENA 4HPYH 2OS7A 4XRCB 1T20A 4LVHB 3VFSA 1ZGLM 4HDIA 4ONFH 5F3BA 4AKPA 3GXIA 3K4DA 2XWXA 2H2SD 1H5BB 3KPPA 1EVUA 1YDPB 4ZNEE 4KVCH 1I9JL 3GRWL 2XZCL 4GI9A 3VH8B 1LO3L 3HRZB 3G9AB 3MA7A 4BEIA 2EDHA 5T5FH 1YN6A 3KL3A 2WKGA 2EABA 4NZJA 5DC9B 1P4BL 5IG7B 4FS0A 4HJIA 5TD4A 5JQIB 3F5WA 1Q9WA 3WLBA 4BWTA 3O3AA 5I71B 3KR3H 4XX5A 1DVXA 3ATDA 1CXKA 1TEFA 2CH8A 2DLEA 4DQOL 2P7TA 4DETA 1TQTA 2JELL 2DWDB 1A7QL 4NC0B 2EC9T 4NDMA 5KVEE 1VGEH 5TDPB 3AMLA 5J4MA 2MKLC 4NENB 1QO3A 3T0EC 5H37H 3C6EA 5C0CA 2YQ3A 3F12A 2XSKA 4Y5VC 2LQRA 3GS7A 3TO4A 3OMAB 4PSRA 1QW8A 3GXPA 4QOKE 2QMKA 3HB3D 3EXJA 5L8JB 2D9QB 4HUXB 3X12A 1W0YT 1NMAL 2W9LA 1XAKA 2V17L 4TSCH 2H8PA 2AK4A 2ZIDA 4XNQB 3QHZL 3RI5K 2CPCA 1A6AB 4EN3A 2KC0A 4QRAA 4U4BA 5D8JH 3U30C 4F8TA 2VDRL 1QBAA 2R2HA 1H6TA 1UD3A 3L3GB 3MCKB 5EZJB 4JRYB 2NT1A 3JTSB 2O6CA 3P4OB 3SE9H 2VLJE 1YUHB 1EUUA 1MHEB 4QUOA 3RZWA 2HN7B 4FJ6A 3D25A 4O2FB 4PG9B 5TE4H 4DQOH 3RFZB 3CSYB 4G2AA 4NQCB 4H88H 3NJGA 4CSZA 3MLRL 5IJVA 3V5HB 4DEPC 3VM7A 1SJXA 3KL0A 3VFGL 3NDZE 5DUPH 3OVUB 1E5YA 1F02I 2N7BA 4MGXA 4ZTOL 1AO7B 2R1WA 1BAFL 1BIIA 1HQ4A 1NAKL 2HH0L 1ZLEA 1XH3A 3PWPE 3QEGH 4XO5A 3RPBA 3WE6B 1TJHH 4ODTH 1HHKA 3QK0A 2EZ0C 5T5FL 4G6JL 2YGQA 4WU7B 3BFOA 1EDHA 2W91A 2ITEA 3PV6B 2BSCA 2HG0A 3VGEA 1LD9B 1OOAA 2NNFA 2XIDA 4Q74A 2W9EH 3WFBL 4CL7A 3QQXA 1NINA 3OTTA 1IIKA 1KCRH 5DJXA 3ZQXA 5L4JA 1AC0A 4LNVA 3GMMA 2YGNA 1G0YR 4J4PA 2QDVA 2VE6A 3F7KA 1INQA 5CWSB 5BVJB 5DURD 2E6PA 1JK9B 1HN1A 4RMRA 2WXRA 3QXTA 1BJ1H 4TSAL 2D7PA 5CZRA 2WBJA 3L7FA 32C2A 3LKPA 4YLQT 4R0LC 3BWUC 4PJGF 1HHJA 2V7NA 4AVJA 4W9LC 3SKNB 4R2GC 4F3FB 5DD0L 3BN9D 5DFTA 1J1PL 3QUZA 4KO9A 1UFGA 1NMAH 5BV7H 3ULUD 2N59A 3QYNA 2IEPA 4CN1A 3BW9B 4QGTA 4ES8A 3MUZ1 2Q76A 3DROB 4X0NA 4J3OG 2BSTB 2R29H 4JN1H 3MPCA 3LMJL 1IM9B 2CNYA 1T5XA 2BOLA 1EJOH 1J5HA 3FOMA 4ZFOL 5K5YA 3ZRSA 2D73A 1ZPLA 4NJAH 5E4OA 5BJTA 4W4OC 2KQMA 2NTFA 2YGOA 3NCEB 2Q0ZX 2Z92B 4JFDA 4OM0L 3C6LB 5IEKB 3MJ9H 2NW2A 3NFSH 1E3ZA 1K5WA 5HHOA 3VMPA 4EDXB 4U1IB 3C6LD 2YRLA 1W2KT 2IGLA 2J25A 1Z3GH 4J3SA 2RMNA 3WEBA 1Q8MA 2AEOA 5EU5B 2YUVA 5D1QA 3N2JA 4UAOC 1MWOA 1IAKB 3ZDYF 1ZGLB 5IQ9A 2XT1B 2C3VA 3HHRB 4GXUM 3QA3A 3NIFE 4AYFA 3TV8A 2ZKWA 4P4KC 4CMMA 2FO1A 5IFJB 3UTTA 2PPCA 3BEVA 4Z0BL 5JPNA 5D7IA 1M57B 4HUWA 4JDEB 1XTLA 5CZXC 4JRYA 3BYYA 3NIGB 5DVLA 2B7DT 3MSPA 3ET9F 4E5XA 2UXGA 4WKXA 3TO4D 4K7PL 2WINA 3ZE1B 3LN9A 3DO4A 4P5MB 5BVPH 2HJFB 3RTQA 4OFPA 2ALWA 5JUEL 4KUCD 4FQIL 2R0LL 1RZJL 2VO8A 4WU7A 1D2PA 4BH8A 1W9XA 2YQBA 2FBJL 4JQIH 1BEYH 3DOHA 5D7LD 1RUPH 4XHQA 3C5JA 2E46A 5C07E 1OCRB 2Q9OA 3PDGA 3KPSD 1EXUB 3OX8B 4X9GA 3J07A 5T1KD 3ARFB 1A6PA 2GC7C 5B22A 1GSKA 2GY5A 4FZEL 1VFBA 4NRYB 2P26A 1OCZB 4HHWA 1MRCH 1HKLL 3PG2A 3L3DB 2GUYA 5HGDB 4EUPA 4U0QB 5CEYA 4J3WA 1WWCA 3U1QA 4X5XB 5F96H 1IB5A 3BPLC 2APSA 3DV4B 3F05A 4J6RH 1W0VB 2VN7A 3MJ9L 3GQFA 2DZEA 1EHLL 2XFXB 2V4LA 3EJZC 5HVFB 3LKOB 4F3FA 3O2WL 3R06A 3J7HA 1GCFA 2XWRA 3STZB 3V9CA 1AMXA 4F7CA 2HPOA 4B9IA 4GXVH 1MPAH 2A9ML 4CW1A 1NBVH 3VMNA 1OGPA 1CUOA 1EANA 3P2BA 4MXVE 3WFEH 5IVXA 2F53B 3L4WA 5E23A 2O6PA 1JNHA 3ESPA 4HWBA 3NSFA 2MCPH 2BWQA 4YSDA 2YPKA 5C9KA 2FJSA 2WLJA 4O9HL 1ZDSA 3UAJD 3A4EA 2N7AA 3IGKA 1I7TA 2AQ2A 1OHZA 3C08L 3H9YA 2A77H 3ME0A 3ZE0E 1GJWA 4BE6A 5GSRA 1VCAA 3KWWA 5T3ZE 1K72A 4KDTA 2G60H 5C2BH 4G59C 5EIVA 1KLGB 3UTQA 1FDLL 1NCAL 3Q8AA 1XBDA 4D9QE 5KJ7E 4X4ZA 1S7VA 3W81A 1HZHL 3MHZA 3MNWA 4O02B 3P4MA 2YPVH 5JDJA 5AKRA 2CALA 3MLUL 2YPLD 3QFJD 4Y2DD 4G7SB 3Q3GB 3CXHK 4RBPK 4KITB 1O75A 1MFBH 2BSDA 4A2MA 4WSKA 4F5CA 1S7SA 4RQQB 1RQ5A 2A6JA 2OMZA 5D7IE 2X4QA 4Z7OB 1F4YH 4ZS7L 2WZPA 2YGVA 1VZHA 2I7SA 3HC3L 1WEJL 2I5YH 5EEYA 5HI5C 2NX5E 2W07A 4P23C 3GYRA 3T4YA 1T2XA 2WUBL 4JFOA 4DZ8A 5JPMC 2K4AA 2R4SH 3DMMC 1VCBC 1TPXB 1SLVA 5AVTB 5TK2A 2XJLA 4OIAA 3VJ6A 3TN0D 5HSFA 5ICUA 1VPOH 5JNYB 1KIUB 4X80L 3PS6A 2A74C 4PGCB 2AJ3A 3ZMRA 2C9XA 2HRHA 4HHAB 4I13B 1UH4A 2Q3ZA 4HJ0C 5ALCH 3SPVA 1LMIA 4UQCA 4MCNA 3SE4A 1Y07A 3FB8A 3G6JF 2A4CA 3T2NL 5SWSE 1QTSA 3GO1L 4ODXA 5DFAA 1IBGL 3E6HA 1LM8V 1TVBB 4PLKD 5D2LE 5E6UB 5HGHB 4MFHA 4F15B 5D71H 1JDDA 5H8DA 4BFEA 5IM7A 2W0PA 3Q43A 4JLRA 4W1TA 3VI3A 3VXPB 4HEMA 3BSHA 1LO0L 1SN0A 2IDTA 4D9LH 4N3TA 5B38G 2VKWA 4H44C 4TXVB 2IQAB 2VDOB 5DS8B 4DKTA 2VISA 4XP4H 1U3HC 1JI2A 1RD6A 4M5ZL 4PJ5A 5ELIA 5IHZB 1PG7X 1FAKT 1EIBA 4U3SB 5HGGS 3T3MF 3TO2B 4G8FB 1SF5A 3GSOA 4KK6D 4XCNA 3KM2A 1FG9C 1JZ8A 3ZKNC 3V9EA 4U6VL 2FVNA 1XZ0A 4PJXE 4UNVA 4OM0H 1F4XH 1R3IL 1WAAA 1A6ZB 3NFPB 1OW0C 2DQHL 5FYJL 4HD9A 1IVLA 2UVEA 1RLWA 2FZ3B 3KAAA 1P7KA 4L8BB 1YMMA 5AW9B 1CS6A 3LEYL 4TNVF 2VXUL 4GS7B 3RB7A 1H5BA 4JB9H 3I6GA 1A4AA 4Q0XL 4JG1H 3P3TA 3H9ZA 5GS3A 1OIOA 3KPRE 3LYRA 1I7UA 1P6FA 3VGDA 4RDQG 3DX6B 4G1MB 3ZDXB 3SE6A 3DMMD 1QR1A 1GOFA 4XPAH 1D9KB 2VR4A 1G94A 5SX4I 4HVBA 1UURA 3ZTNH 4AQAA 2DJUA 4JX0A 4YLCA 5C0ND 4KRPD 1X5YA 4KROB 4NKQB 3L5HA 1KLUB 2J1XA 3GI9L 3HC0B 2OXGB 4LESA 1EDYA 1WUZA 3FCSB 3HUJF 1ZT1B 4L8DA 1K4DB 4J23A 2ZXGA 2WLIA 3TCLB 4WIQA 4P48A 3BUQA 1OF2A 1TZHA 3P4LA 1DBAL 2E0PA 4UQBA 5FYJH 1P1VA 2PR9A 4FA6A 3HMXL 1BLIA 3VFVB 3FT4A 4WI0B 3X13B 1SEBA 4BSWA 2PNDA 3TZVB 2DIBA 4XGZA 2VMDA 2VUYA 3L3JA 5A7EA 2YBRB 4K3GA 4NUMA 4MDJB 4XAWH 4XN7A 5JOFB 5BV7B 2AAVA 1IC5L 4G6ML 1HC1A 2Z0BA 3BE1H 3U46B 4PTTA 2XWDA 2M1KA 3D8MA 3LSOB 5JNYA 3VSQA 4KX7A 3TLRA 4IGBB 3BSZL 1IE4A 1OZTG 1YPZE 4MMYA 3VA2C 4F5CE 4RH4A 5ADOH 1N5YL 3JTSA 1CIDA 1RJZA 4NZ8A 2ZXBA 4ANWA 5ENWA 1JWMB 4GRWH 5DK0A 5TDNA 4YXHH 2M8XA 4M7KL 5IMLA 5IR1B 2V9RA 1EO7A 1F8TL 3NCMA 4WO4C 4AVKA 2DM3A 4NO3A 3CVHL 5F97E 1JGUH 4OGAC 4M4RA 3NJLA 4A38A 3NACH 3T6QC 3P2DA 2JF1A 1XF4B 4UU9B 3O9WA 4NO0B 3V0GA 2KHAA 1ZVSB 3SBRA 2WVVB 4NNXA 4ORGA 4QYOA 1GHFH 4JL1A 2ZCKL 4X8GA 1A1NA 2D4FA 3PXLA 1F6LL 3G5XB 4KKQA 1T0NB 5D6DA 3RURA 2WTOA 1KLFB 3MOBL 1AHKA 4EOWH 1I53A 3HC4H 3GSWA 3MGTB 2X6AA 3IDNB 4JFEA 4XVTH 3KLAB 5B38B 1MAJA 5I16A 5H35A 1F4AA 4GT0A 4OCYL 2JCWA 4JO3H 3CZUB 3LDBC 3BZEA 3DO3A 2FNBA 3EYOB 1ZT7A 2R8SH 3LCYA 3V6OA 2WP3T 5C0EA 4AM0B 4XBEL 2P42B 2D8KA 1CFTB 3HBPA 3RVTC 2DJ4A 1DBMH 4U4IA 4H1LH 1X7QA 3BAWA 4OB5H 4K2UH 1PD0A 3QDMA 4KPHH 1LNUB 4UZSA 4AQ1B 1HWHB 1S9VB 2W8CA 2W88A 1QR1B 4P5KA 4X7SL 2X53A 4QXTB 4S1QH 3IAGC 3MLUH 3T9WA 1B0GA 2XA8L 3BAEL 4M6OH 3F3HA 5CIPH 2H6OA 4H26A 4HUMB 4AUYA 1NGZA 3CCHB 1NCCH 4FI7A 3KCPB 1L9MA 4HIHB 3FCGA 1K8DA 5I66A 4R84A 1HEJC 2CUIA 3VX0A 2ENJA 3HZMA 4LEXL 4PG2C 3LPPA 1IGYA 3WDHA 3H9SB 4LO9A 1RURL 1H0DA 2G2PA 4YGVB 2LTQB 5AW0B 2WC7A 4FL4B 1LK2B 1S7QA 5A2CA 4U1IA 2H2PD 4KI5C 1MXGA 5CIPB 3MXWH 3SDXE 3D2TA 2AI0H 5FW6A 1BA9A 1DJHA 3NSXA 5AVYB 1KBGH 2XX1A 3II1A 2HLAB 3EJZD 4W68A 1JBJA 1ZA3A 4P2RB 1WT5C 3ULVL 5ICYB 1LEKB 5LBSH 2VDRB 2Z6FA 4X8XA 4Z7OE 4L48A 1U8LA 1J9RA 1EQWA 1SDYA 3GD1C 3V4LA 1KTCA 2AS5M 5FGBA 1IE5A 2VLJB 2FGWH 4M02A 4ETYA 35C8L 1KYOJ 4WSJA 4D9RD 3C12A 4HIIA 1TZAA 4XP9H 1MREL 2XV0A 3UGEA 1Z0NA 4XODA 1LGVA 2F1BA 4CC4C 2XIBA 1UKQA 2XTJB 4QRRD 4APQB 5FO2A 4F9PA 4NERA 4IDJL 4YHNB 3ZBMA 25C8H 2D0HA 3APNA 5FF6A 1DQDL 2QADD 4KJWC 4ICXA 1WO2A 3A21A 3KBFA 4JANA 4LAJH 4LSVL 1RUQL 3MCG1 5D1QE 4FNLH 2X28A 3TT3L 4HOWA 3HHMA 3MLSH 3ZGIA 5GS0D 3QP3A 1ITCA 1U2CA 2ITFA 1B6UA 1XCTA 3F12B 3L95A 3O4OB 5BRZA 1G9MC 2DQHH 4KKLD 1AO7E 5BXFB 4EI5A 4PS4L 3AW5A 3Q9PA 2JI1A 3T0EA 1RZGB 4U1NA 2KDYA 4KC3B 3UYRH 2IGTA 3MBEC 2ILLA 3D50A 3ZDWA 1URZA 3MRJA 4MAYA 3WTTA 4HIXH 5G4OA 5KSBE 2A77L 4MNHA 5DRZA 2DLFH 4O2CA 4OJEH 3R4RA 4GSUA 3UADA 3EDJA 1PLGH 1WUNT 3FMGL 2R9HC 4NUPA 4PJ8D 1E28B 3ESVF 4WI6A 3GSXB 2VDKB 4N8CL 2FJHA 1MFNA 1L9SA 3CN4A 4FDWA 5AYTA 3CH1A 5HYIA 1S7RA 4P2QE 2J88L 5I82A 1GZHA 4URTB 1KPUB 1EMTH 5IHUH 2YK1H 2GQHA 2VWEC 4MB4A 2XZAL 2YKKA 2VW7A 1TZGL 1GJIA 1F4WH 5IQLA 1IGYB 4A6YA 4S1DD 3C5ZA 3FOLB 4KNSA 1R1CA 5B39B 5JOEA 4E41B 1RZKH 2DL9A 1K8DB 5I66B 1S9KC 3MJ8B 1OGTB 2DTMH 3BVWA 1UT1A 5F1NA 1NGWB 3LNIA 1WBZB 4UM9A 3S3SA 4ZAKB 1Z9OA 4NENA 4WHDA 1FYTD 5DHEA 5AVSB 3ISWA 4JO8A 4BQ6A 1F90H 2L3BA 3PNRB 2H3NB 2OKMA 2OSLA 3BWUF 1T89C 4PWIA 3IETB 3DVGA 1VF5C 2YMTA 2AF2A 4PCSA 4F8NA 4WWKD 2Y72A 5FLUA 4NQQA 5D4QA 2RAMA 4O2EB 4DQAA 2FQDA 2MCMA 3FU9A 5K59F 3KYMA 3VXUE 1R3HA 4NM8L 3DXAA 2CWRA 4QXUL 4F7MB 4WJ5A 4QLRA 1CVSC 4TNEA 4F2EA 5KW9H 3QFGA 1ETJA 3BW9A 4UT6L 4J3BA 2L7QA 1JD7A 4HKBA 2BPBA 1Q0XL 4WW2F 1H6FA 1BZQK 4K07A 5KBPA 5DI8B 5KSUB 4KKBC 1CLOL 1MRFL 2Z34A 5DJAB 3ZT5A 2FJFA 3HLKA 3L3OC 2FDBP 2WXGA 1G5GA 1N64H 1MW2A 3QH3B 3QUMB 5GRUL 3D30A 2ORBH 3OD3A 4H25A 4NZUH 5E99H 2FATL 1YPZA 4L37A 2H9GA 2E7LC 1BFVH 4UV4H 1P5UB 4WFEE 1NFIA 1MY7A 5DR5L 2WJ5A 1S5HB 1LEIA 2WXKA 1CE1L 3ARBD 3M07A 4HHAA 1CF1A 1UM4H 4RZCA 4HU8A 2OMTA 4OUOA 4ZW5A 2OJEB 2JB6A 2K7PA 3MOAL 3COOA 1AXIB 1KIUA 4PJXF 3B1TA 3I3EA 4EQ3A 1DDTA 1JZ7A 1A6UH 2FEEI 2N7SA 2EVGA 1YCSA 3GMQA 3MJGX 1DVYA 2EC9U 3S35H 3UL4A 2R56H 2AEQH 3TNMB 3WGUB 4MLSA 3NMEA 4CMMB 4ISVA 5B1KA 2CJTA 4A7UA 5HDQH 3IDMB 3FDWA 2P48B 3BCDA 4KX8A 4N24A 1MCEA 2CDFA 2Y7NA 4YDJA 3UPRA 4ECNA 2AJUL 4LLYA 4I2XA 2WBJB 2F19L 1J9SA 2B5IC 4PP1D 4E0RB 2ZSVB 2MPVA 4NFCA 1HAUA 3VXNA 5H37A 1GZQA 3BKJH 1NCCL 2WP3O 3L4XA 1BBJA 3ZIMA 2ITDA 4QHLB 4I9WD 2YD3A 3ROOB 2W65B 4LLMB 1HIMH 2QEJA 3PP3K 5JPNC 4XMPH 4AG4L 3V0HA 2A7BA 4FX5A 4GW1A 4LSSL 4MQSB 3T0ED 5F71A 1YLBB 4HJTA 4ZUWA 3LQAL 1M2VA 4N9OB 2ZAIA 4JZNB 3QFDB 1UOWA 3FCBA 4NM8H 2X3AA 3AGWA 5F7YC 3WHE0 3RYMA 4Q97A 1NFDB 4FA8A 1HE8A 1KGYE 2XKUA 5E1AB 2DS4A 4UBDC 4V2CB 4O02H 2G2RA 1SJHA 2CXKA 3BIBX 4GKOA 3KWXA 2ZOKB 2X10A 1MFMA 3KPRD 2EH7L 2WXPA 3VXUA 3MV7D 3ARXA 2HRLA 3V0WH 3EJTA 4XMKH 1WCQA 1I7UB 4JFDD 2EC8A 3R7RA 1AIZA 1V3KA 2D9CA 3EFFA 4K23H 4OGQC 1LO5B 4CVWA 4HOZA 2X2IA 2WYIA 2D2CC 1B4JL 4R6UA 4WI2A 2VABB 4TNWF 1DDHA 5IW3A 5F7UA 4PB0L 5F8QC 4Z7WF 4GXFA 3IJHA 1ZA6A 2EYSA 4LSUL 1T2QH 4Y5YA 4ONHA 5I1JL 4GQPH 4CU7A 2AJSH 1M1XA 5HPMA 4Z7QB 3BH9B 3VI3E 1OAQH 1SN2A 3SPCA 1D6EB 2X0WA 1WQVT 4HZAA 4CC4A 4FAAB 4WJ5B 2EDWA 4LHJB 4LDLB 1YSOA 3WFHB 1QACA 3V6OE 1OPGL 5AOJA 4HAFA 3MRPA 1AR1C 3CFKB 3FB6B 3KGTA 4Y5XA 1MNUL 5J56B 3LD8B 2ZOWA 3BWSA 4AXWA 5T3XE 4GO9A 5ESVA 3QORA 4QRSA 5SWSD 4QHKJ 1FZKB 4M1GH 3RX5A 5AUMB 4IIQB 2FWUA 2QGDA 5F9JA 1CFBA 4PJHF 3VWJB 5IB2A 4Z95H 3O6FA 3ZHNA 4M93B 3DIFA 5AAWC 4HSAC 3RIAK 3D6GA 2APBA 3ILDA 4HGKC 1X4XA 5EIQA 3I9GL 3MLTA 2GYSA 5HJ3B 4ISVB 4OZGF 4N68A 3WY2A 5HYSB 2A83B 3PFQA 5DJ6A 5LAPA 4WEEA 4I3SL 2VXVL 2AJSL 5IMLB 1IQWL 4N6RB 5IR1A 5E8DH 1U8QB 5DZ9A 2ODIA 5GIRA 4NQXB 4B5ZA 3OBAA 2JKRM 4NUJB 4LU5L 1FPTL 2ESVB 3QWOB 3LH2H 3NJFA 5E95B 5JDSA 5G5DB 5MP6H 5JW4R 1X5JA 3MV8D 4LEEA 5HI4D 2XY2A 1MIMH 1KIRA 4PI2A 4I18B 2AQRA 4FQLH 4D94A 4QRQB 3VM5A 3ZQWA 4YJZL 1JL8A 2DQDL 2IALA 4YUEL 2Y1VA 1ZLUH 3DJSA 3G5YB 1QSEA 4AYGA 5JHAA 1DEEB 4AI7A 1MNUH 5KANI 3QUGA 4JM4L 4PREA 2C3VB 4YR6B 5C0GB 3MRCB 5IROD 5AW4B 5BRQA 3I50H 2XC8A 1PKQB 4MMZB 1XWVA 2CRYA 3GI8H 3WG7B 4YDKH 2F7OA 4WO0A 1U3YA 4QT5A 4RLDA 3SQBB 2FJGB 3STLA 1WC7A 2PW1B 5F89A 4FMFA 1MCLA 1UWYA 3ZUNC 1D9KD 4UAHA 5I6PA 1U8NB 3K2UL 2HFFB 2OYPA 4CVZB 1U8CA 5KS9B 1U8OB 3S36L 3ZL2A 3QIWB 5F8RC 2PR4L 3EDFA 4MNGA 4Y2OB 1Z9MA 3ZDXE 5IFHL 3DURB 3HI6L 4P9HC 4A68A 5EUKB 1EUTA 1CXHA 1ZIBA 1A1MB 4DGUA 2Y1AA 2JQAA 1MRDH 4I88A 1C9SA 1TO4A 1SMDA 1B2WH 3QZBA 2OMWA 3ZE0F 1YC7A 5A6LA 1BD2B 3FQRB 3QZMA 4QXGH 2NT0A 3DIVA 4Z7NF 1PZ5B 1U8MA 2DI9A 2NQCA 1FGNL 3ARRA 2IQAA 4NP9A 3MRFA 4PRHD 3VO0A 3WNIA 1AGFB 1QEXA 1NIDA 3LKRA 3EOAB 1Q0XH 1ZA6B 3L16A 4Y5YB 4XI5C 4W70A 3SCMD 2F1AA 3KYKL 2H1LM 4LVOC 1UJTA 4LLWA 2WCSA 4XNUH 3MRHA 3VFMA 3BP7B 3HTLX 3QHZH 4HJ1A 3VGGA 1X9QA 5MENE 1DLHB 3P73A 4JFPB 3LKSA 1C5CH 4U1SB 1E90A 4N2DA 4IMLB 1NKGA 2GHWB 5LN4A 4EZLA 4TUJA 3OC8A 1S7XB 5IK3A 4P23A 5C7XL 3QIBD 1KIPA 2XZCH 2XFXA 4RIRB 3MCLH 1SMOA 2FYYA 1E4KC 5I73C 4PWFA 5HD8D 2Z8SA 2X4PB 3CUPA 4OZHA 3EOYG 4FYTA 4TQIA 3M1BA 4NUQA 1FDLH 2DQFB 3DHMA 3MNMA 3POCA 4GUPA 4M8QB 1GH7A 4R5TA 2DQIH 2EDFA 4HISA 2HTLC 4X6CF 4N87A 1PZBA 3RIAF 3U4BL 1FH5L 3A6BH 1KNOB 1Z6JT 4ZOBA 5I1LB 4UOW0 4X4XB 3N3EA 3OXSA 1AR2A 2A9NL 2WQRA 5I15L 4HZLB 1SJEA 3HS9A 1KB9J 3OR6B 3UAJC 2GAZA 1CE6B 5HI3C 2CDGB 5AD0B 2XCMC 1EFXA 1FRGL 2QKIB 1XBRA 4CGUB 5EC2B 4RGND 3MYJB 1GAFL 4NQCA 5GZOC 1OP4A 4OCRH 5DUBB 2HJLA 2IAMA 3IB4A 3V0JA 1FORH 3KBEA 1WZ1H 4TVUA 3AWFA 1FGVL 2VISB 4BJLA 5BRZB 1QFWI 3MUHL 2PCYA 4DP4X 5FCUH 4QDGA 4D0CA 5GRYA 3HKFA 5IEHA 4Y16D 4E41D 1H3PL 4PGJA 3EOBB 3GHBH 1PIFA 2C9RA 4QT5B 4PJGA 2CUHA 5I1EL 5T33H 3OKOB 3ALXA 1QHQA 3ENEA 5LGKA 1TZ8A 4OI7A 1I1FA 3RVTD 1SHXA 3MJ6A 4QNPF 3IPFA 1HH6B 1T3FB 3N1PC 4GBXD 3WY3A 1P7KB 1EAOA 4QRPE 3C2SA 5J12B 5MHSE 4RAUB 1ZSHA 3JYBA 2A6DB 5L0QB 4I0PD 3HBGA 5LO7A 1I3RB 4P99A 2OYLA 1B9ZA 4ZXBC 3AREC 3OF6A 3QZNA 1LO0H 4Y1AA 3GXNA 5C08B 1QI3A 1S7RB 4PYHA 1Y0LB 4JFFB 4U6XA 4H8WL 5FR3A 3FU0A 3IJ9A 3FQRA 1INEH 4OFKA 1A6VH 3V52L 4OLYL 5A1AA 3WELA 3G08A 5LWYH 2H26A 4Y5VB 5CGYC 2ZXAA 4X6CA 4OZFG 2H0FA 3MFGB 2XXFA 4IRSB 4K5MA 4A37A 3GBML 1NGYB 3KGUA 4UINL 3L8QA 1RK0A 1H3PH 2YUZA 3RAJH 2BSTA 4WO4D 3SBWA 4UT6H 3GDBA 1BDYA 3QPQC 4QJ5B 1WYJA 2P43B 1AD0A 3LOWA 2YS4A 1SHMA 3LAFA 3LS4L 4N86A 5DFVD 1U41A 1MCKA 2XZQL 1IFHL 3TGXA 2ADJB 4QXWA 5CD3B 3HS0B 4M8VA 3LB6C 5HDOA 1BAFH 1JPTL 3FYIB 2WGXA 4LOUC 3P0GB 2W0FA 3VWKA 3TEYA 1M6OA 4WUUB 4FTVA 1XB3A 2HWZL 2QFRA 3N44B 2DQFA 1AD9B 4JFHE 1W6LA 3HPJB 3JT0A 2BVTA 3BQUD 4FNTA 4MMZC 5DHXB 4LHUD 5TF1H 3VFNB 1RJYB 4GI8A 1S9VA 3KPRA 4RDQF 4HIEA 3Q06A 4BWWA 1EEYA 3KPSB 5KOMC 3UG4A 4DP8X 2ZSWA 5H37G 2Y23A 4RSYA 4KK8D 4Z7UB 4XMLL 3D7PA 4PY7A 3FONB 4A7VA 2PF6A 2BMKA 4JRWA 1EJOL 3MRKA 2WSDA 1JV2A 2RH0A 1N26A 3GBMH 4UINH 2DDQL 1IQDB 1PGRB 3QWRD 2K9UA 4XVSL 2I60H 3W37A 4PGEB 4GG6F 5KSBB 4QEGA 8CGTA 2PN5A 1WFOA 2VDNL 5JHLH 4JPSA 3FCTB 3L5IA 5HXMA 1IKFH 2BHUA 5IBLC 4Y1TA 2VDKL 4BBWA 2VN3A 1UWGL 3KWTA 5CEXA 4ZFOA 3NA9L 1PKOA 4LKXA 5DT1H 1XGRB 2YAQA 4L4VB 4OQTH 4PS7A 3P0YL 1T0MA 3H9SD 2A74B 2AFNA 3TU6A 5JHMA 3FRUA 3ARGC 3HC0A 1QASA 4KZCA 4ZMOA 1MHCB 3INUL 1K4DA 1MKFA 2BIHA 1KCSH 4E41E 2LU5A 1MPAL 2A9MH 4PP2B 4X2UA 4JM2B 2D3LA 3D5OF 1JHTB 3IJ7A 3QORD 5D8JL 5SWSA 1B0RA 1MAML 2R2HB 1OTUC 5HGAA 3T77A 5AW6B 4XN2A 1U36A 3OR7B 4J8RB 2RBLA 1ONQA 1JZHA 3VTMA 4XCYB 4RBPH 1B4RA 3EFOB 1TJIH 4JY4B 5FYLL 4EI0A 3T0WA 2NY3C 4LLYB 5DEGA 2RD0A 4W4NA 3FN0H 4B9GA 4NCC1 5DJYA 3GHEH 2G5BB 2HVKA 2YAOA 3D2UB 1MCQA 3NPZB 2DBLH 2UZXB 1OY3B 4XMVA 3C08H 1YC8A 2EDRA 1CDHA 3QZWB 4YSSA 3OKDB 1N9PA 4BZ1L 2ZKHH 5C8JA 3W1ZA 4Y8DC 4ZQTA 2COQA 1P5VA 2AVGA 4HK3J 4KK5D 2BRRH 1X5LA 4M5ZH 1MIEH 4MQ7B 4F7KA 1LO4H 1P84J 3GZPA 4N0RA 4A2GA 2VW6A 4E42B 4OAWA 4M7LT 2BM3A 5TE7L 2F7IA 4JPKH 4KROC 5CU5A 2I9TB 3FU6A 3G04A 3P3UA 2DYPB 5C3TA 2YQGA 4KWUA 1UENA 3U9PH 2E27H 3QEUB 3H55A 3W39A 1I3GL 2FGZA 3ILQC 2YUXA 4OLZL 3EXLA 2WQXA 3IPEA 3O9WB 5AZ2H 2DI8A 2YD9A 4PJIA 2E9IA 32C2B 3LKPB 2HH0H 1O9VA 2WBXA 2YMOA 3QEGL 4HWBH 2X4TA 15C8L 4PLOB 4XRCA 2YXVA 1NMBL 2EILB 1LP9E 1MZZA 4WLCA 4YPJA 2WSKA 4N5EC 2CR0A 4Q4IA 2QHRL 3P0VL 3QUXC 5GRJL 5BV7L 1AQDB 1EXHA 4FTVE 5CCJA 1IM3B 4EN3C 2Q87A 4H2AA 4LSTH 1DBJH 3EFDH 4ODHH 3TVMC 1EJ6A 3LXBA 5KUMA 2VQTA 4KQ0A 2CLVA 3VA6A 3IT8D 5TQ0H 3L3KB 4IK6A 1CFTA 3MRKB 4K5OA 5F9WC 2IANA 1BXXA 2NNRA 3MTRA 3RGVD 1RZ7H 2ITCB 4LLDA 4FABL 1IBGH 3FTWA 4FNSA 4Z3FA 3MKKA 3L3HB 4MAUL 3GHBL 3GIVB 3MREA 5E08H 4BFFA 5LNGA 4GKNB 1AANA 4HGWB 1XVSA 4RAVA 5DD5H 4H26B 5FECA 1EBPA 1SOQA 1EFQA 4WUKL 1BOGA 3GKWL 3P69A 4KZ0A 4YHPB 2J2ZA 5D7EA 4X6DE 3X1NA 3DIFB 5B8CB 3SSGA 2J72A 3U7YL 5DRXA 1NZRA 2OJZH 4DEPB 3ARBB 5DMGC 1CDGA 4J3OH 2VB5A 3GC3A 3RZCB 2VZ3A 1KJMA 2KYIA 2R83A 4LKCA 1GPOH 4LCYB 2YJLA 3HNVL 1F2QA 3NIGF 4H20L 4P2AA 2UWEB 5DUMH 4OZIE 1SUJA 2CIKB 5KYXA 4NPYA 4X6EB 5CIPA 1N5YH 5IQ7L 2JLPA 4BZ1A 4O2CB 3CQQA 1RUAH 1USQA 3IDIB 4XN4A 3V0DA 4ANVA 2APXA 1U8KA 5F72S 2BW4A 4KY2A 3C6SA 5J6GB 2ZAHA 3CC5A 3LRHA 4N0FA 4F7PA 5KJ4A 3TBWB 5EEVA 3X12B 1R5VA 4Q0XH 4AV4A 3FH7A 1E6OH 1A6WH 3WOVA 4R0LA 5JHDE 2IQ9H 5F3HB 5EU6A 4YR6A 5C0GA 5CZVL 1M05B 1YNKL 3IM1A 2HX9A 2WQAA 3OMIB 4J3UA 2EQDA 3QUYD 3Q13A 4OLWH 4CNIB 2UZIH 4R5VA 5HD8C 5AKTA 5J12C 1CD1B 3FU3A 3DXAD 4MJ5B 3LQAC 4NC1E 2PWHA 1CICA 1E40A 5E0FA 4B60A 2OK0L 2NYYC 3Q44A 4LNRB 4D3CH 3W5NA 5L6YL 3AXLA 4NCC2 2LU4A 4TLKA 1O6VA 3NJKA 4NN7B 3RZCC 1XH1A 4JANB 5TQ0L 1SM3L 3VRIA 2OMWB 3WJLA 1QMUA 5E9DA 1BD2A 5EO9A 3TASA 1GGIL 2VITB 2Z64C 5K33A 1PLGL 3T0AA 3W0WE 1AXTL 3TYFA 4K9JA 2A73A 3U0TA 5FO7A 4GAAA 3GS0A 4XI5D 2ADFH 3B56A 2O5NA 1MCIA 1HHKB 1RUKL 4WCYL 4X0KA 5LG1A 3VI4F 1BGXL 3C8KB 1FIGL 1WGVA 3GJFB 4UNTA 2J88H 3II3A 5CD5D 4B41A 4EI6B 3G9VA 4RDBA 1WA2X 2QSVA 1CJYA 3ATBA 43CAB 5BMFL 2F5AH 3ROOA 4JN2A 2V5YA 1H15B 1YEIL 3CHSA 4A7SA 1BZOA 4FE9A 1NEUA 4Y2LA 3QRBA 3DUUA 3AM8C 2YD0A 2WB1A 4MLIA 3TV3H 3E1ZA 2H41A 2IMMA 4QHNA 1G7HA 3BGFC 5ALBH 5E2UH 5DUPL 2V37A 3UEZA 1RLBA 1XEDA 2G4GA 4EAEA 3ARYA 1S3RA 4UQAA 1AFVL 4JG0H 3UBXI 1MRCL 4YEFA 4GW4A 3L3HA 2J6EA 4NN5B 3QR1A 5D6DC 3TBTB 2EE0A 4MJ6A 4LSDA 4NN7C 4JUTA 3M86A 2F8OA 3L1EA 3QDAA 4Q9CA 4A7GA 2WUCL 4H7VA 3MXWL 1BAWA 1G9HA 4EIBA 2OJEA 5I8EB 3UJIL 5SX5K 3ZE2B 1PKQE 3QUXA 5L88L 2RB8A 2QQKL 4Z3TA 3JXAA 4GIAA 1SYVA 4P4KA 3K2KA 5FYKH 4S1RL 5AW7B 3N0AA 1U95B 1T7WA 3GT6A 3CDZB 4WV1C 5FWRA 5J5EA 3MO1B 5FYKD 3ZY7A 5D2NE 2ZCKH 1TJXA 5CP7B 1N0XL 1CE6A 2ICWJ 4JM2F 5AD0A 5I1AB 1BYOA 3MAWA 5E0QA 3SD2A 1WE5A 1KJ2H 4R8WH 1RVFL 1T22A 2NW2B 3O0LA 3BI9X 3SDDD 3SJVD 1X4YA 3KE0A 4UTAA 3BVNA 3QO0A 3IGAA 2FWOB 3OKNB 4GRLC 2WANA 4LHUB 2UZYB 4R4BB 2FECI 3BQUB 3WNMA 2BVOB 5JLZB 1DO5A 4HJGB 1FV1A 5I19L 4EVNB 1QHOA 3ZTNL 1UEMA 3NZHL 1C5BH 3PABB 1ORSA 5DHVB 3UEQA 3WI9A 4F24A 3BN3B 4Y4HA 3QIBC 5MEQB 3LEXB 3ASNB 2PPEA 3QNFA 1MCSA 2IIJA 4RFEA 1CC3A 3D4ZA 5AUMA 1IBDA 4XC3L 5BZXA 3VXTB 3SGKA 1UZ6E 1CICB 3CN3A 3H3BC 3VJ6B 5I1IL 4H0LC 4L9LC 5AW8B 1BX2B 3S88H 3TP4A 2VNCA 3AXLB 4KHXL 1DP0A 3V4UH 1PF3A 1HYSC 4HC1L 5FM4A 3P30H 1DVFC 3QULA 4R7NA 4PHZA 2JKXA 4MJ5A 3R8QA 4UQ2B 3TF4A 1IFHH 4L23A 3E8UH 3T2PA 3IN0A 1IGCH 1T66C 4HALA 2AK4E 4UB0L 2CHWA 2Z7YA 1L3NA 4BH7A 4Q6YA 4HQQL 4QXTA 3B8YA 2BNQD 5GRXG 1B88A 4QRBA 2NY4C 4J27A 4HUVB 1NCTA 1VFOA 1TU2A 3DX2A 2VLRE 5CD5C 4XP4L 1X5FA 3ZTEA 2VZSA 1R3LB 2B1AL 3TBSA 1KDIA 3NJXA 5C07B 5HGDA 3PU7A 2BVEA 3QGVA 2AW2A 4G8FA 4WFHD 4HD5A 4TLUA 2Y5TB 1ILSA 4PU2A 4JRXD 3WFDH 1JZ3A 2IXQA 1ORQB 3UBGA 2E76C 1A7RH 4NQSA 3RVUD 2GSIB 2OX5A 4DWHA 3BDYH 5T1LD 4G9FD 2YXFA 3KPLA 4BK5C 2WN3A 3CWGA 4XVUD 1DVFA 2ZSVA 5I6MA 3TL5A 3OZKA 2EE2A 4H88L 3BDBA 1ZWIA 2VDNH 5FO9A 5IROC 5JHLL 2RCSL 2XTSA 2YAHA 3BHBB 3PL6C 4TMPA 3I2CL 1BEYL 1N8OE 1X7SA 3NCBB 2ZCLL 4F92B 1BXAA 3UTPE 1QLEB 2PCFA 1S2EA 5J3HC 1DSYA 1ZA3B 2P9RA 1N0LB 4FOMA 5EEWA 1HINL 2O5ZH 1SLWA 1CL7H 2YIHA 1GC1C 4ALAH 4YHZH 4FQ2H 3D34A 3EBIA 5ITBH 2Z91B 3DUHA 4Y19E 4JRLA 4FQCH 4Z7UA 1T1YA 3UZEA 1IAIM 3FQWA 1KJ2B 4JGJA 2R2BB 4LSUH 4QRUA 2VLKE 5I0WA 3VXRD 1JV2B 2JCCF 2PLTA 4XC3H 1S7UA 2RIKA 5J3HD 4RESB 1RZFL 4XBEH 5G4NA 2AQ1A 4ZDHA 3QUKA 4CGTA 3GM8A 1MAMH 2FSEB 4XH2A 5GS2D 5PAZA 3BP7A 4N0YL 1KG0A 1ESOA 2FIKA 1QKZH 5BPPA 1OSZA 2HYMA 5IHWA 4H1LB 3NCWA 3OHMB 2WZPD 5KN5A 5D96B 2PYEE 5FHBL 4EVNA 5LAXB 3SO3B 2EIBA 2VT0A 5E70A 3B2UC 4JREC 4Y9FA 5FLVA 3OKNA 4HPOL 4PW9A 5IHBA 2ZICA 4XGZB 5E4AA 3LEXA 2ZUVA 4HWNA 1DCEA 3MNWB 4NNYA 4O02A 3ARBC 1DLFL 2F54E 5GGTL 4F33B 4GQZA 4OM1L 2XI9A 4DO4A 1RZIA 4NC1C 3US9A 3HI1A 3SCMA 4FXKB 4P04A 1NSNH 4YN3A 4G7VH 1O7SA 1JPGA 3D0VA 5SX4H 4DZ8B 3HMWL 5GISH 2G60L 4XN1A 3MV7B 1RUQH 2NXZB 3DOSA 3RWHB 2XWEA 4M3HA 3VI4A 1GGTA 3MQIA 1KYDA 4N25A 3S8GB 1A7OL 3W56A 5C8JB 4MA1B 3T6ZA 4ZMAT 3OJ2C 4IIQC 5HVWA 1GYCA 4Y4HC 2I07A 3CN2A 1BWWA 3A5VA 2DQDH 4YUEH 4PV8A 1T1XA 2AEIT 1IEHA 2WY3B 5C1MB 1COBA 3PP3H 1EO5A 3BE1L 1OT1A 3L4YA 4PS3A 5F6HJ 1T4WA 4GRLA 2UXTA 2VLRA 4M8UA 1P7QB 3GMPB 3QPXH 2J8UE 1DLFH 5DVMA 3CZLA 3F6LA 4LLVB 3OWEA 2D3JA 1XB6A 4ZMXA 5IT2H 3O2VL 4N6RA 4TN9A 4WK2B 5BO1H 3KGRA 5EB9A 3MV9E 4HH9B 2E9GA 4BFIB 4NUJA 1V3LA 2PXYB 4WGWB 1OGSA 1OP5K 1T1ZB 2BFVH 3G6DL 4G70B 1F11A 1YHPA 5K9OB 2FQGA 3W38A 4A2LA 3GSOB 4FYRA 1GRWA 3ECWA 1DQJA 5HVGB 5L88H 5CFAA 1OE3A 1UCBL 1IC1A 4U1GC 3U4EB 5E08L 3MRNB 2EEBA 2WCPA 4X4YA 1MCWM 4OCWL 3MLZH 5FO9B 2FBRA 5K59E 1B0IA 3P9MA 4L4TD 3F8UB 1PKQA 4MMZA 4G80B 3D08A 5F1KC 4YEEA 3CSPA 4J4PD 4WUUE 5EBMB 2W92A 1G6RA 5I1LA 1QUPA 4WDIB 5I23A 2P80D 5KYWA 3VXQA 3NRPA 4PJ8C 4PW4A 2AITA 1QLEH 1Q94A 3WU1A 2BDNL 1KB3A 3GPSA 2F5BH 3RL2A 3WIIL 1YEGL 3L3KA 1RV6X 4Z7UE 5E7FA 1G7JB 1HHJB 3QJXA 1YEKH 2CM6A 5I1JH 1KOAA 2X6MA 1V7NH 4H1LA 5DZLA 3O2VH 1MJ7L 2VR3A 4LIQE 5D2NB 5HDRA 3E9UA 4U2YA 3K4ZA 5F96L 3VXMD 3ZO0A 4ANKA 3QUZD 1XR8B 2EVHA 2DM7A 1LQBC 2YSSB 5FKPB 2OPCA 5KG9A 4JREB 3HLAB 3B9EA 3I6SA 5CJXC 2WIIA 4IMKA 1KCUH 1WVZA 4PRPD 4LMQE 3UC0H 1AD9A 4I77H 1ACYH 4LDOB 3VFPB 3P3SA 2PETA 3MLZL 4P2QA 3A6BL 1KB5B 12E8L 2UWEA 4FHBD 5KW9L 1D5MB 3ARGA 5D7LE 5MEND 2B1OA 3GMNA 3MRHB 3VFMB 3WDIA 1QBMH 4YDZA 2RTTA 1I4FB 1E5UI 3UG5A 4GEJA 5I2IB 4EN3D 4H8QA 4HIIB 1L7TL 1FRGH 5CGTA 1J48A 2EDJA 3K1DA 4KQ3L 3QUXD 4TUKL 4EKJA 4DP9X 1PNCA 3FT4B 3QI9C 1NDGA 3OMZA 1CYGA 1A3RH 4N5ED 1CI5A 1NLBH 2BFVL 2Y07L 8FABB 4JHAL 1BFVL 1QEWA 5AOLA 2VXVH 3T8XB 4HFUH 2GTWB 3OKKB 2MOGA 3MRRA 4Y5VA 4PIRF 3LDBB 2X38A 4JFFE 2WKOA 2O5XH 1JZ6A 3BPOB 2BIIA 2IOIA 4WKZB 4BFOA 4ZUVB 3S5LB 5I30L 5JPNB 1LYQA 1JUFA 4G7QB 3GMPA 3QQDA 3CXDH 3MLVH 1SNRA 2XWJA 3Q6FB 1B4JH 1JS4A 5F7EL 1CL7I 1G9NC 2ZUQB 2CJUL 1QP1A 4M4RB 4KROD 1ZMYA 2VLRB 1JVKA 3S3DB 2KLTA 2FO8A 1O6SB 3I74A 3KPSE 1BD2E 1GKOA 3IBEA 1JYWA 2C4FT 1AQMA 1CYXA 1HX0A 2B2XL 4WNJA 3H2PA 3BSZA 1VZGA 3DPDA 5C97A 5I71C 2XG4A 2X42A 3UOAB 3VWJC 4MNQD 1UM4L 5F7BA 3QEHA 3TYGL 3HZYA 1CFSA 4UTBA 1S6NA 1A7NH 3V0VB 5CEZH 4LF3B 3U6XS 3KLAA 3HG1A 3P11L 3SOBL 3GGWB 3F01A 2BNRA 1SFHA 4LLUB 3F83A 1B2WL 1ZLUK 1SDDA 1JE6A 1G7HB 5A2BA 2VL4A 3DUUB 3TBYB 3JWOL 4DP7X 4LQFL 1WAPA 1E5CA 5B1BB 2VRQA 4GFXA 3TH4T 4DCQB 2NXZC 1RULH 1YDPA 3QAZC 2EP6A 5C0IA 3WN5A 4OD1L 2B8OT 2V3FA 3FTGB 2EYRB 5JZ7C 4CUCA 3UAFA 1GTNA 1CLYL 3FH8A 4MNQB 3B5HA 4HSQA 4I4WA 3FB6A 1ZT4A 4NRZA 5FGCB 2YHGA 2R23A 5IOPB 2ZJSH 2H0EA 1ZANL 2IBBA 3FMGH 4WFGE 1IV8A 1FA4A 2R59A 1G7PA 2ZX8A 3B83A 3LQAH 1OAUL 5J11C 2X6VA 5KG9B 3CIAA 2WVSA 2OI9B 5DHYB 3OJVC 2YRPA 1F56A 4POUB 2H45A 1EEZA 2NCEA 1RL1A 1FO0H 5E2WH 2FD6L 1FNHA 1TJMA 4A7TA 5I2IA 2NY1B 1U8HA 2VIRB 1QW9A 3WNJA 1IEBA 2H0PA 1H3GA 4F80A 3FSOA 1BZ9A 1AQDA 1CN4A 1GGCL 4GRWF 1LO2L 2AGJH 1MAKA 3P30L 4RGNC 3V4VB 2ZYHA 1HXMA 3FRPG 4X7SH 1U8LB 1MCPL 1KB5H 4ETQA 3IFPA 4PJ8A 5ESAB 5C9JB 3DA0A 3V6FA 1ECYA 5KBNC 3T3PE 2HUEA 1U8PA 5HDBF 4AT6B 5F9WB 1BJ8A 1GAFH 4OBSA 3IN2A 1U3NA 3U1PA 2Y3NA 1JUFB 2O6FA 4GKNA 3D0LA 3VNZA 4DN4H 1Z32X 2BWDA 4L4TB 2B1AH 3BPNB 3HZVB 3P4OA 4ZUSB 4CAGA 1MFAH 1ILUA 2Y0SA 1U6AL 1VLXA 2BWIA 2V3EA 4M48H 4PW3A 4RRPG 3LPFA 2ICWA 3AXIA 3MRBA 3VQ2C 1T0OA 5E9AA 5F1SA 3ARBA 4KQ4H 3GDCA 1J1XH 5DD6B 4WHYH 3H6JA 3RZCA 2Y06L 4PY8J 5I73B 4IBWA 3T0EE 4HV8B 4BH7B 1PEZA 3EHBD 3RBSA 1AO7A 1LWRA 2CKBA 3ETSA 5TTRA 5CGYD 2XBDA 3P9LB 4LOFA 3PWLB 5ANME 3RGVA 1JGLL 3D18B 1V54B 1XGYL 4PMEA 3MN8A 3C60B 3TONA 1I1AA 4OZFA 3GXFA 1JNLH 3TJPA 3MLWL 2R7EB 1IMHC 4E0RA 3KJ6L 3BOVA 5GZNA 4HF5H 3AMKA 1HL8A 5A16A 5DJCA 3GMOB 5DD3L 4J6IA 2R29A 1R3LA 3EOAA 3QFJE 3QEHB 3ARGD 5E2VH 1OCCB 1OSEA 5EBLB 1ECZA 4TTDD 2Q8AL 3QI9A 5IFJA 4QRTA 3DPBB 2BP8A 2VE6B 3C5ZD 2HTKD 5D7IB 3BAIA 4GLRI 1QI4A 3ILQD 2HMIC 5CR8A 5GS1B 3BPNC 4FFYL 5LQBH 3FFOA 1HCYA 4U1SA 4OQTA 4C4UA 3UYPB 1MW1A 3BH4A 5BNXD 4AEFA 3SYOA 2HT4C 3O3DB 4ELKB 5BS0A 5LJYH 5A2AA 2W1NA 3P9WB 1NEZA 5C0IB 3UBXG 2K8MA 5TJWK 1C5DA 1NM4A 4ELMF 1I9IH 1KCBA 2PCXA 2N01B 3FUHA 5ICZB 3GINA 5GRZA 2OYKA 2KZBA 3JYCA 4HWUA 5C70A 1YQVH 4AW4A 4YFDB 5FW8A 2AXFB 3MZGB 3NJIA 4OI9A 1JTOA 4YHKH 4R97B 1U42A 4NLHA 3IKCA 4OFVA 1NCJA 3D33A 3WV0A 4EI5C 1VENA 2I9TA 2EICA 5KYNA 3GSNH 2FIKB 4ZDHB 2EYSB 4WTZG 4JHWH 2L7JA 3PHQA 3BH9A 2PTUA 4PLKC 2J1YA 4AE0A 2TAAA 2FECL 4JEGB 4JKNA 3LZOA 3UX9B 2I60L 1A22B 1WAAE 4WEMB 3DUSB 3EW3B 3B2XA 1NGXA 2AQQA 1I7RA 3QUML 4HKZA 1WLHA 1YAIA 2A4ZA 1A3LH 1CIUA 1VFAA 3SKJL 4W9DC 1HDMB 6FABH 3TIDA 2BZDA 1I85C 3OKOA 1E43A 2EDKA 5EU4A 2IDQA 3D9AL 5B3JF 3X1BA 5A43C 5I17B 3PHSA 1RJLA 3ZT7A 1TJHL 3EUDA 2IV8A 3HNSH 3HJ0A 2B2XH 5DF0A 5CKAA 1M7UA 4XPTH 4B97A 3HZVA 2QADC 1E3FA 2ZXWB 1E9PA 4KJWD 5AOZA 5AW3B 3WO4C 1OK0A 1SYSB 1OAQL 3CU7A 2DMBA 4QO1A 3A6CH 3HBQA 5DHDA 4YE0A 1I9EA 4NPJA 2D0FA 3GJFH 3RIKA 2D7QA 2D0GA 4KDTC 4WTQA 1U8IA 4QLWA 4NSKA 3BRFA 2WYTA 3OX8A 4DPBX 1K5NB 1OSPH 2A9BA 4YDVB 3FQTB 2MOVA 2J1KA 2YAEA 5MI0C 3VX1A 4DTGH 1YEDB 2NRDA 1IC7H 2FGWL 1DO6A 1CR9L 3OG4B 4KTEH 1DQQA 3D69B 5KYUA 4JO4H 3LNHA 1FLRH 4Y9GA 5L2KA 3WEXB 4N0UE 4TV3A 1CFMA 2CHDA 3TNMA 1F11B 3GBNH 3RUGA 5K9OA 1II4E 4YDKL 2VJ0A 3I9GH 3IDMA 4IGBC 2F5BL 3WIIH 1ZLVK 4AC2A 1QWUA 5EF2A 5T1DL 2VQ1A 1ERNA 3I3DA 4O58H 4BUGA 1NIAA 1SBSL 5G4MA 2IG2H 3PE9A 1H6EA 1Z1WA 5J1AB 1M6OB 4FYSA 1F3JA 4TQPA 1X5IA 3MLXH 5I6NA 4MKTA 5KS9E 1NCAH 3OJDA 5HI4C 3UAAA 3VGFA 3U9UB 4Q6IB 3ECBA 1BQRA 3RWJB 4I77L 4L2YA 1RXLA 1E5AA 2X89A 1ACCA 5DYFA 5T5NF 1KXQA 1LDSA 3ULUE 3ESMA 3T08A 3G5ZB 1GIGL 1AGFA 3LKRB 2VXSL 3KPPB 1XGTA 4RFNC 4AQ8C 2VQ4A 4JVPA 3PPSA 5FIEA 3SDXF 5F3BB 3ULSA 5ILTL 1LMKA 1U2YA 2AMGA 1OP3K 1ANUA 2PABA 4U3XA 3VXPA 4J3OF 4KQ3H 2WO4A 1I9JH 3DX0A 3FSAA 2IPKB 3MV7E 3GSUB 1H8LA 1JPTH 5E6SB 3S37L 4GRMA 3MA7B 3TA3C 4FZ8H 3SDDA 3SJVA 3JTTA 5GGQL 1VGKB 4MBOA 1OALA 3TPKA 4MB3A 3VE0A 3N40P 2QTVA 5J11B 2C9VA 4KJQD 3BSGA 1D7FA 1Y6KR 4OY9A 3H0TB 4NQCD 3KBPA 3FC8A 3FTVA 5AKSA 5AVZB 2XTJE 1H0DB 3ULVC 3QQ4B 5BVPL 1OV8A 2QVIA 4RQQA 5EU4B 2X12A 4KQ4L 3LRMA 5LKNA 4UQDA 4HS6A 5I8CB 4IRZL 3UO1L 3S36X 1KTBA 3OHXA 4G7YL 2XQ0A 3LKQB 3TIDB 2BNUB 4Y16A 1HK6A 1Q90A 2ZXDA 1GIGH 1FNGB 1L9TA 4GP4B 3U7YH 3I6GB 2KPNA 1KELL 1VRSA 3NG5A 1NPUA 4MWFA 1CXIA 4F57H 3EYUH 1UC6A 3PV7A 3JWDL 2GJ6A 1ZK9A 2ZYSA 3MRDA 1NH6A 1ADWA 7PAZA 1T04B 4HKJA 2FT8A 5D72L 1DVFD 3T8XA 4WKZA 5DA4A 3WKYA 3MRRB 4KGJA 5DUBA 4I0PA 5E9NA 4AEIL 3TEUA 4ZFZA 1XD0A 2YWZA 4FG2A 3UTSD 3ML8A 2DQMA 2G30A 4MB5A 4OIFA 5DSCA 2R69H 2DQIL 1TF4A 3FFCD 3QE5A 5IVZA 4MQ7A 4OSUH 3EH4B 3WXVH 1VIWA 2B59A 4E42A 3DX1A 5I1IH 3QR2A 5KZCB 1Z5LA 1WDAA 3GLAA 2F8VA 2VC2B 1U0QA 4PJCF 4DF9A 1BECA 3MGOB 3T2QA 4UTAL 1BF5A 1MCJA 5C0AB 5C09A 3IFNH 3FT0A 4PJGE 3WS6C 1SXSA 4U33A 3FN0L 5I24A 4QYAA 3UC2A 2VSDA 4JFEE 3X17A 4M3JA 4X8JA 4HPYL 4UNIA 4OCRL 4PVMA 4Z7QE 2ORBL 4HMCA 4XTRD 5BXFA 4X6FA 2X4UB 4HMDA 3SGDI 2GJPA 3RNQA 1RK1B 5J1TC 4BA8A 3MU3A 1NQBA 3ABZA 2KI6A 5EC1B 5EZLB 4XOEA 4E9LA 1KIQA 2PW2B 3INUH 1AXTH 4K3EL 1TTUA 4NQCE 4L05A 4WFGD 1KC5L 3MXVL 3CZFA 5EO1A 6CGTA 1IGML 3FUIA 5CWSA 5BVJA 4DP6X 2QPEB 1ZV2A 2YPLB 1ID5I 3GMMB 2J5LC 4PJCB 4ELDA 3QDJA 4W9GC 5EZOL 1CWVA 4QCIB 2B14A 1OF0A 2BHYA 2EIJB 2AQNA 2WAHA 3O41A 1SXCA 3WN5B 2IPKA 2PO6B 4OV5B 5D7JA 3U7WH 1SQ2N 3ULSB 4F57L 2AV7A 3IFNL 4F1SA 3GXMA 1I1CA 1NOAA 4F9LA 3ARTA 4OF7A 4P4RB 1J5CA 1F97A 1FZMA 2GY7B 1DJWA 3AG2B 4RAVB 1JZ2A 1DQJB 3HI5H 3CLEL 3BUBA 4JO5A 3TCLA 3W57A 1YJDC 2NW3A 2BVQA 4PWHA 3VFTB 5LWYL 3VD0A 1ZT1A 4L8DB 4PHXA 3FPYA 3MGAA 2WXMA 2Y5TA 4G6FD 1MFAL 3BZ5A 1Z9SB 4KJYB 4P05A 5CZXD 3ZKXC 1AHMA 5C9JA 1ORQA 4X99B 2AXHA 2R4SL 2YO3A 5I8KL 4AV0A 5K9KB 3B2MA 4LKCB 2FYYB 2XN2A 5BJTB 4IHOA 3I85A 1TCRB 4GG6B 1BBDL 2F9BT 3I6LD 4Y8AA 5HYJD 4MRCA 2YPKB 1KYUA 1TXKA 2NYKA 4OJDH 1T20B 3VFSB 1I7TB 1KIPB 4ZFGH 4PCKA 4DERA 2I9LA 2WZ5A 1G1OA 3L5WB 4NKOA 1J5OH 4FRWA 4UDUA 5KVGL 1KPVB 4FXTA 5D1QB 3RTQD 4PV8B 5D9SA 1BM3H 7TAAA 3C6LC 3BD4A 1OD7A 4S2SA 1SJMA 5I1DA 3FCUB 4E68A 1ZGLA 2BY0A 2I27N 4XP1L 1ZTXH 1XCXA 3HE6A 1KWGA 3QUYC 2FO4B 1YYLL 1LP9F 2VXQA 4OM1H 4JQIA 5JTWA 3DJTA 4JDEA 2B59B 1Q72H 3WJJC 3LJ3A 3W11D 1RFDH 3D07A 1XL4A 4NRXB 4DVBA 1Q9WB 5JQ6H 3PAVA 5FGBC 1GR7A 3MUGA 4MZ3A 1ZTMA 4ODBD 1N6QH 2NX5D 3ROLB 5IVZB 2JIXB 3EYQD 1KJVA 4YPGB 4WTXA 5DRNB 3MCLL 1MFCL 1KN4H 1RIVL 2HJFA 5D1QD 3RTQB 5FS5A 3KHQA 4YX2L 3DLQR 3NJHA 3HZKB 3ABLB 4MAUH 4DEUA 1P4LA 1IJ9A 4TULH 2E75C 4BK4A 4YSUA 2R0LH 3E3QE 2NCMA 2AXJA 2FX9H 5C0AA 3TWCL 4MRBA 1EAJA 2QZ5A 1IKFL 5CZKA 5GS0H 2ZX7A 3LD8C 4U3HA 4CU6A 4PTUB 2VDKH 3P3YA 1HCZA 5FO8A 4LVNC 4UIKL 1H3TA 1YQVL 5DS2A 5A16B 3T4AA 3FXIC 1D6VH 1ZVYA 1HH9A 4P46B 1NLDL 4RAUA 4E36A 2A6DA 3QJFB 3REWB 1AKPA 3EH1A 1AGEB 3S4SA 2YPLA 5GS1A 2WUBH 5FM5O 4IBYA 1GJUA 4JKPL 2VLLB 3CFDA 5EZPA 4B3VA 2HVJA 4XXDB 5JPMA 4HEME 4J2QA 1W0VA 1RFDL 2NY6C 2H2SC 3QDGE 2ALAA 1UT9A 4XVJH 5EO0B 4CVUA 5ABAA 5TE7H 4J6RL 5D2LA 1BIHA 1J18A 1IIIA 3RWHA 2QELA 3DV6A 3UO8B 2K1MA 4OF8A 3GSNA 4RA3A 1Z9LA 4DNLA 4XBPB 1MFEL 2UX6A 3BVXA 2O5YH 4CILA 2E59A 4L3EA 4BXVA 5KSVB 4YQXL 4FTVD 1J5OL 4ZAKC 4K94H 3B9KC 1E6JH 2WO2B 1KY7A 4L9LA 2WLNA 2IDCA 1S46A 2DYPD 2R1WB 3PQYA 2BVQB 1NDMB 5HHOE 4AYMC 4JFXA 2OCCB 4NN5C 1P53A 4P2OB 6FABL 4HOXA 1NAMH 3IGUA 3E8VA 1DEDA 1DSFH 5I0YA 2P24A 4J2XA 3Q2VA 2BRRL 1UKTA 4BHUI 5JQHC 4I5BB 1CL7L 3CZJA 4IHOB 4WW2B 1YY8A 4XPGH 5AALA 5E6ZA 5ABZA 3X1FA 3LZLA 4GFTB 5IREA 2QHRH 3ASWA 1U3JA 5E4EB 9PCYA 3RX8A 5J6SA 2FX8H 3O4OC 3VFWA 1KLGA 2ZP9A 4CBZA 4UQ3B 3KPNB 3BAKA 3TC9A 2CDEB 5DO2C 2EXSA 1JDCA 4LSPH 3HPJA 1MJ8H 4R90L 5IBTH 5EIIG 3ZX1A 3OGCB 5F7NC 3S3BB 3BZ4B 2CLZA 3GPEA 2CNZA 4XNQA 3ML9A 4HIEB 3NCYP 1FGNH 5CN2A 3PWNA 4PIBA 4JCMA 1TVDA 1M71B 4H5SB 4WFFD 5D5ME 1MI5E 1WZLA 1YECH 2FBJH 2GG1A 2G75B 3BYTA 1J0ZA 5TDOA 4YDLB 5I0VA 4UZUA 1RVFH 4K94C 5IEKA 1WTGT 5HHVH 4DHLA 3KPMA 4WW2C 5D7SL 3VRJA 4DZBA 3I6KA 4JDVB 4C4BA 4NPYB 4JHAH 3K2IA 5DJ0B 4Z7OF 2FL5B 3BXNA 3AITA 1CG9A 1L9OA 3AWGA 1B2YA 4G6KH 4ZNCD 1JYNA 1HH9B 2QVMA 3FTZA 2RCSH