1AZCA

Structure of apo-azurin from alcaligenes denitrificans at 1.8 angstroms resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
AQCEATIESNDAMQYNLKEMVVDKSCKQFTVHLKHVGKMAKVAMGHNWVLTKEADKQGVATDGMNAGLAQDYVKAGDTRVIAHTKVIGGGESDSVTFDVSKLTPGEAYAYFCSFPGHWAMMKGTLKLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of apo-azurin from Alcaligenes denitrificans at 1.8 A resolution.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport(copper)
molecule keywords AZURIN
total genus 33
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 1992-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1azcA00
1ASOA 3S3BB 4DP2X 1E5ZA 3L45A 3JTBA 2BZCA 2PPAA 3FU8A 2BWIA 3EHBB 3FQYA 5B7MA 5F7AA 4CSPA 1V55B 1I53A 1SNRA 4A2FA 2ZXWB 1BXAA 3FPYA 4RH4A 1OOWA 5B7EA 2YAQA 3EH4B 5I28A 4E9YA 3EH3B 4UAHA 4HHGA 2CJ3A 3H4FA 2VM4A 4YSTA 2GB2A 3DKHA 2J5WA 1SF3A 4MFHA 3X2QB 1L9TA 5PCYA 4Q89A 1OCRB 3FU7A 1OE2A 1W6WA 3CZUB 1A65A 1ADWA 5D4JA 2R7EB 1CYWA 2MRYA 1ZV2A 2JXMA 5FC9A 1JZEA 1TEGA 1BYPA 2XYBA 4BDVA 4G7SB 2FQGA 2I85A 6PCYA 2FTAA 4DP0X 1AQ8A 1PNCA 1SDDB 2IDTA 3G5WA 3ERXA 1PLBA 4BWWA 1MG2C 3TBCA 1OCOB 4A2HA 3UACA 2XXGA 1KGYE 4X4KA 2HX8A 1BYOA 2PPDA 1KYAA 3CG8A 1NWOA 2CCWA 3FQ2A 4GP5B 4GXFA 1NPJA 4KOBA 1PZAA 2PP7A 1NIDA 1KDJA 1AR1B 3NP3A 1IKOP 4W1TA 1ZIAA 2DWTA 5I26A 2FJSA 3FSAA 4NERA 3WG7B 1CURA 4YSQA 2VSKB 1WA0X 4DPAX 3RYMA 4FAAB 1GY1A 2UXTA 5AZUA 2P80A 1A8ZA 3NJFA 4A2EA 2HLEB 4QKTA 3T71A 2I7OA 5D4HA 3OMIB 4DP5X 2UX6A 2YAOA 3IN2A 3OM3B 3FSZA 3QPKA 4KO5A 4NB7A 1PLCA 4G72B 1SFDA 1MZZA 2OV0A 2FQDA 2EINB 3FYEB 4BDVB 1ILUA 4KNTA 3S8GB 1TU2A 4G7QB 1JZIA 1BXUA 3OD3A 1QHQA 3S3DB 3UGEA 3GDCA 4AZUA 1R1CA 3UADA 3EF4A 3QQXA 1ID2A 2YAHA 2UXVA 1FA4A 1ZDQA 4KO6A 1WS7A 3NJKA 3NJGA 3QJSB 4JKNA 1E67A 3CVBA 1V10A 1DZ0A 4P5RA 2AZUA 1VLXA 2FWLB 2CBPA 1PNDA 3GYRA 2BO0A 1SJMA 4AX3A 1OCZB 4YSOA 2FQEA 1NINA 2AFNA 2PLTA 2DYRB 1WS8A 2VW4A 1HFUA 4G71B 2VW7A 3PPSA 2VSMB 2H5UA 2IH8A 3AG4B 2MTAA 3X1BA 2IWEA 2PPFA 1KBWA 1AZRA 2HXAA 1J9SA 3FSWA 2XVBA 3SBRA 4EF3A 1AANA 3FYIB 2XX0A 3T6ZA 4UANA 3JT2A 3MX0B 1ET7A 2YAMA 2HX7A 2XV0A 2HZHA 2GHZA 3NSDA 4QLWA 1ASPA 4HALA 3V9CA 2IH9A 2BP8B 1AG0A 4G70B 2TSAA 2YAPA 1IUZA 2WO2B 3AG1B 4YSUA 5I6MA 5LDUA 1MG3C 1J5DA 2GI0A 5I6NA 3CDZA 4JHVA 3SBQA 1BXVA 2YAEA 9PCYA 1NIBA 1DYZA 3D12B 1KBVA 1XB8A 5EHFA 3H56A 2AVFA 1CUOA 3SQRA 5I6OA 3WNJA 1BAWA 2HRGA 3OMNB 2VW6A 1V54B 4YSRA 4E9XA 2UXGA 2XV3A 1KCWA 3TBBA 5F7BA 3PXLA 2XX1A 3CVDA 3FT0A 1ZDSA 3ZDWA 4GP8B 2CUAA 3FS9A 3NT0A 1GS8A 4PCYA 2AANA 3AY2A 3T6WA 5D4IA 3X1NA 4BXSV 2DWSA 4BWTA 2IDFA 1L9PA 2B3IA 2R7EA 5B1JC 1GS7A 4P5SA 2W88A 4W9ZA 3TASA 4GP4B 1GW0A 1SF5A 2TSBA 3X1FA 2EIKB 3NJLA 4E9TA 1HAUA 2GBAA 1GR7A 1AZNA 3V9EA 1TKWA 1W8EA 1XB3A 5I5JA 1AZCA 2VN3A 1QNIA 1F56A 1WA2X 4DPBX 4F7KA 2BP0B 2PCFA 2ZWNA 2EILB 1L9RA 3ABLB 3HB3B 4A2DA 1AIZA 1BQKA 3X1EA 3QJUB 1J9QA 1EHKB 4YL4A 3AW5A 2OCCB 3PCYA 1YLBB 3FQ1A 3PLYA 3ZBMA 1E65A 4N4YB 4Q8BA 3UAEA 3FSVA 1OV8A 1A4AA 1W6LA 2JKWA 2VMJA 1X9RA 3ABKB 4GYBA 1JXGA 4KO7A 2BHFA 2GC7C 4A2GA 7PAZA 4DP9X 3TU6A 4DP1X 4DP6X 2HX9A 3UAAA 4DPCX 3AG2B 3NSCA 4DP7X 5A7EA 1AACA 2YARA 2FT6A 2W8CA 2ZONA 3WKPA 4E9RA 1L9QA 2IAAC 2FNWA 2YQBA 4K9JA 3SBPA 1OF0A 2JFCA 2QT6A 3KW8A 1N68A 4YSSA 2Q5BA 4WTQA 1GSKA 4YSCA 4M4RB 2B08A 1JVLA 2J57A 3ASNB 3QJRB 1AOZA 1JXDA 3IBOA 2NRDA 1KCBA 1AS6A 2HRHA 1MZYA 4HIPA 2IWKA 3QJVB 3AG3B 2FQFA 2DYSB 1TEFA 5TK4A 1JZFA 5B3SB 3QJQB 5ANHA 2BP8A 1BQ5A 1A4BA 4YSDA 2WO3B 2X88A 4DP8X 1NIEA 3IN0A 2XV2A 2QPEB 1SHWA 2H3XC 2PP8A 3CDZB 4KO9A 4BK5C 1IBZA 5B7FA 5I6LA 1CYXA 1E30A 2YAFA 5TK2A 1ILSA 3WNIA 3IEAA 1AAJA 1SFHA 4YSEA 2VM3A 5B1BB 2BW4A 3GXUB 1JERA 1SHXA 4F2EA 1PAZA 2PPEA 3NP4A 2BW5A 1KDIA 1JZGA 4E9QA 4AKOA 2X87A 1E5YA 5E9NA 1IC0A 4A66A 4CSZA 3NSYA 4E9WA 4E9SA 3PAVA 4UF7C 3NJIA 1NIFA 2Y1AA 3PAUA 1NDTA 3ABGA 3WKQA 2RACA 4TXVB 2IDQA 1FWXA 3NJJA 5I6PA 1AS8A 4AI7A 4GY4A 2UX7A 2PPCA 3ZIYA 2DV6A 1NPNA 2XLLA 3ZX1A 4DP4X 1NIAA 1M56B 1M57B 5B1KA 1A4CA 2IDSA 2PCYA 2E86A 4YVUA 1PCSA 1JXFA 1CC3A 3EH5B 4YVNA 1M9WA 1ASQA 2P80D 1BQRA 1J5CA 3BVDB 3OQRA 5B1JA 1RCYA 2DY2A 2H47C 3NSFA 4KOCA 1JZJA 2UXFA 3H4HA 2J56A 1NWPA 1BEXA 1GS6X 4YSAA 1ZIBA 1NZRA 3NJMA 1GY2A 2IDUA 2YXVA 4NAJA 1RKRA 1RZQA 4JHUA 2YXWA 5I5MA 8PAZA 4BWUA 1RZPA 2QPDB 3NJNA 3UABA 1OE3A 4L0PB 2FT7A 3WI9A 4HHWA 2BWDA 2ZOOA 7PCYA 5I5IA 3KW7A 1XMEB 3N55A 4N8UA 4HZ1A 4M3HA 1A3ZA 1AZUA 2IWFA 4E9VA 5IY5B 1JZHA 1J9TA 1UATA 3WIAA 1IBYA 1ET8A 3U25A 1NTDA 2A3TA 3DTUB 4HCFA 4KNUA 3QJTB 3CVCA 1PLAA 2QDVA 2BZ7A 1JOIA 2OJ1A 2AZAA 1OCCB 4PAZA 3NYKA 4FA7B 4BXVA 2I7SA 4ENZA 4HAKA 2BP0A 2GC4C 1J9RA 3T9WA 3MBWB 1NICA 1PY0A 1ZPUA 2Y69B 1L9OA 1X9UA 2PP9A 3OMAB 4ZK8A 3FU7B 4KNSA 1T5KA 1URIA 3T6XA 1EZLA 1XB6A 2XWZA 2XUWA 5AKRA 3BQVA 2XXFA 4A68A 1QLEB 3ASOB 4A67A 1HAWA 3PAZA 1AS7A 2LLNA 4WKXA 2Q9OA 2FT8A 4HCIA 1SDDA 4HCGA 1FFTB 3X1GA 1B3IA 3ABMB 3FPXA 1PF3A 3T6VA 3S3CB 1AG6A 3HEIB 3TA4D 4F2FA 1PZBA 3IE9A 1ETJA 3FU9A 5AFAA 1PZCA 1ET5A 2CAKA 3NJHA 3DIVA 1AZBA 3AZUA 5I6KA 1GYCA 1L9SA 4YSPA 2XU9A 1JVOA 4G7RB 1WAEA 1PMYA 2N0MA 2WSDA 6PAZA 2CALA 4AKPA 1N70A 2GIMA 2EIJB 3N2JA 5B1AB 1OE1A 1MDAA 2GSMB 3C75A 3S8FB 2EIMB 5PAZA 2J55A 2QDWA 4AKQA 1KV7A 1WA1X
chains in the Genus database with same CATH superfamily
3N40F 1CGYA 2DM7A 4Y4HB 3HNTH 2J88H 1A6ZA 1I7UA 4AXWA 3WEXB 3MMEB 2XN1A 3O6KL 4CU7A 2BC4A 1BOGA 2EO9A 1N67A 3GJFK 4NDMB 4MHHG 2FDBP 4HJUA 5AVVB 4AGNA 3PNRB 3FN0L 4F7EA 3S3SA 1DLFL 5TD4A 1QUNA 4JFYA 3L3OC 1TQUA 5CEXA 4PS3A 5HHNA 1DL7L 4OIIH 3V6OE 3DJ9A 1UH2A 5DF0A 5J1AB 2Z34A 1WRFA 2X4OB 2Y5QA 3B37A 4OZIA 5FC9A 4BKTC 4M5TA 1EZUA 1OB1B 4JKKA 4PB0L 4PRDB 4S2SA 2GK0A 4NNPL 4MCYB 5E4EC 3UIYA 2YXMA 1SEBA 2Z31C 3ARDA 3UYRL 1BZ9A 3MRBA 4LSQH 2HVJA 4H8HA 2J25A 1WIUA 3U30C 5IZ7A 3BVNB 3U0PA 5G55A 3Q5YA 3H7LA 2XQBL 2PPDA 1EVTC 1U8CB 2XI9A 4P3DB 3CQFA 2CCWA 5CD3B 5LGJB 3FQ2A 1F4WL 3VFOA 4BKSC 4OFKA 2H2SD 4ZW8A 5I76B 3IDIB 3ZUNC 1FGVL 4W9DC 3BT0A 2C3GA 4W1TA 3WY4A 3RVUC 3AWFA 4XOEA 3DC0A 3LPPA 3BP6A 5KJ4A 4XZUA 3LKSB 2OJZH 2P5WB 5GHWH 1KTDB 4FNLH 4ENEC 3BYYA 3OKKB 4YHNB 5B1CA 1N0XH 4K7PL 1IM9A 4DKEL 1FO0H 4ORGB 2PW1B 4I3GA 5AZUA 2JIXD 3I6KB 2W95A 1KCSL 5H37G 2NNCA 5INCB 4OIAA 4X99A 2WUBL 1SHMA 3WKNA 3Q2CA 2BSBA 3GSQB 5KVFH 4JM4H 1TZGH 3K6DA 2ZXAA 4I48A 4JRXE 3G9AB 2C9PA 3M8OH 1MFAL 2WQWA 2VISB 1M6UA 4Q97A 3L5WB 2VDKH 4BKLB 4NQCD 5AVQB 2FD6L 5HI5C 3WFEH 3IAPA 4HIHA 4A6YH 2VRQA 5E8DH 3UMTA 2VXTL 3ARRA 4L8DB 2J43A 1ZTXH 4AW4A 1NMAL 2BSSA 5DD1L 4LSRL 1NC4A 3MV9B 4KO6A 4QD2E 4XPTL 3B6SA 1T0MA 3RA7H 3ZL2A 1XD1A 3LOWA 5CLXA 3T0VA 3DX7A 5AAMC 4IKIA 2AZUA 2LR4A 1YEFH 5E6IC 5FFLA 4G8EA 1PYWB 1JZ8A 2HLFD 4LL4A 1WICA 3Q8EA 3F6JA 4AL8H 4RMSA 2NR6A 4K73A 4WFFD 4YSOA 5J1AA 3TVMD 2I24N 4XRCA 2XC8A 2H5UA 5T3XD 1J5IA 2RAMA 4LIQE 3EFOA 1KBWA 4G3YH 4L4TA 4M1DH 2VLKB 4K71C 3RP1A 3SYOA 3FUNA 3W0WA 1AANA 3H9SD 4L4TE 4TPRH 5IOPA 5FOBA 5F7KC 2AQQA 1DDTA 3MRNA 2YUWA 3O4LE 4IBWA 3GHEL 2HX7A 3U0PB 4QTIH 2X2IA 4TLSA 4RWYL 2WJ7A 4JFFA 4NNYA 3WO4C 5JHMA 2KZKA 1AGFB 1ITCA 1OTTD 1Q9LA 1BAFL 2W65A 1JUFB 2O5ZL 4PH8A 1GMEA 5B3JF 1KTLB 3AG1B 4Y2LA 4HWZA 2WQUA 1IGCH 3FFDB 5GS2H 5D93B 3S3JA 4Y4KB 1JN6A 2EYSB 1OT2A 3HAEH 4YDKL 1LO4L 3TVMB 1WDAA 1SDAB 5KYWA 3E1F1 2TRYA 4O2EB 1CI3M 3SQRA 5DD0L 2F53D 3SOBL 5DZ9A 5FK9B 1M3IA 1T0NB 2ICEC 4PJGA 5AW6B 5JXAL 5F88A 2IG2L 1D5RA 2XN9D 4N2CA 3MLSH 1KCWA 3ISRA 3U9UA 5K33A 1EA9C 2KI6A 3NCWA 3DV4A 4WDIA 4F33B 3S37H 2WYIA 4R9HA 2RALA 4M02A 3M1BB 1HWWA 4Y1AA 3EF7A 3QIWA 1KFAH 3C8KA 4NAMA 1D7DA 1WFJA 4NRYB 4TMPA 3T6WA 2ATKA 3SY0A 3VWKD 3GXTA 1M71A 3COOA 3EO1B 3LIUA 3NIFF 3TVMC 4UTBH 5E94B 1CL7L 3LKOA 4M4RA 5IJVB 3E80A 3UCQA 2UWEB 4R96B 2ED7A 1F8TH 3W39B 1MCPH 2IFFH 2OZNA 1GW0A 1NQBA 4H4NA 4XCEB 5CWSB 1CN4A 1XIWD 1MAKA 3NJLA 1LO0H 3T5WA 1HAUA 3SQOL 3GRWL 3TCLA 3VXSA 2C34A 3WNPA 4Z7VB 5HHOD 3CLFH 4QJ4B 5HI4D 1OSZB 2WWKT 2JH2A 4TV3A 1JXJA 4DPBX 1N0XL 4E5XA 3F7LA 5D6DC 2PCFA 3IJEB 1ECZA 3LB6D 5CUSL 3RU8L 4NN7C 3X1EA 1KCSH 1GZQB 5AALA 3GMOA 2IEPA 3P4NA 1OGSA 4FI7A 4XNZB 5ANMA 1WBYA 3ZBMA 5JXED 1MRFH 3PWUA 2E9WA 4Q9QL 3OKLB 4MJID 5AVUB 3FSVA 3VXUA 1P9MC 4FJYA 4P59H 4APXA 3E9UA 4HKZB 4D94A 3S88H 3MRJA 4GYBA 1KPUB 3L7EA 5K9OA 4A2GA 2ZKXA 2FR4B 2WXLA 4DP1X 5EIIG 4DK3A 1N7ML 3BFQG 1G4MA 1DUYB 2LAGB 4D9LL 1W91A 1ZHBA 2B1AL 4JO3L 3VWJA 3K2MC 1SEQH 4OZIE 2F7RA 1JDCA 2JMRA 3MA7A 2M26A 3OKMB 4EUPG 1IFHH 4I0PD 5JQIB 1QR1A 3V6OA 1Y1UA 3HG1B 4B5ZA 3S9DB 1WSST 5DMKA 3KGTA 2ID5A 1P53A 2W59A 4HUUB 5TH2A 3I6SA 4XHJD 1FHNA 3K46A 1F58L 2QSVA 4N26A 5E6IB 2JJSC 2QVTA 4R7XA 2OSWA 3QJVB 4FNLL 3VXUD 4XTRD 3GBDA 3L4XA 1IO4C 3POCA 4F8QA 5BXFB 2BNRE 5JXEA 4L9LB 1D5ZB 2DYSB 2PXYB 3QEQA 5I1HL 2EKJA 5ANHA 3KYNB 4L48A 1JYWA 3GFUA 2CA3A 2FJHA 2B1OA 5DJCB 1FLTX 4MB1A 1EXUB 5CLWA 2FB4L 4P2RD 3FHQA 4OUUA 3U36A 1IGFL 3OKEA 1XO8A 5SWSA 3CDZB 4KNQA 1AY1H 3X11B 1VENA 4BCZA 5HHME 1QHOA 1T7ZA 4JFFE 4O5LL 4Z9KB 5E8PB 1LNUB 1SN2A 5SWQA 3L4ZA 4RMVA 3SO3C 2H7WA 3LRKA 1ZA6B 5J6GA 1HX0A 1M7UA 2J88L 2VM3A 1S9KC 4F2EA 1SHXA 3TM6A 5KG9B 3P2TA 2BFGA 3DA0A 4YBLB 4C55A 4B9PA 1AGBB 4AKOA 4TNFA 4FULA 5ICUA 5IJVA 1A9EA 2RJMA 1JP5A 2VLRB 2HT4D 3QO1A 1Q9OB 1RPKA 4CSZA 2G75A 1U8PB 4Y7MA 2CCLA 2MPVA 4Z7OF 1KACB 4G8FB 2BVQA 5HYSB 1CDBA 1VKXB 2ZP0T 3PDOB 1J18A 1IGYB 1MAML 3ZZLA 5F9WB 1A2YA 1FWXA 1FORH 2Q2EB 3O8XA 4ODSL 4Z7VA 4ELKA 3GMMA 2WKGA 3PS6A 1C1EL 1IRAY 3P40A 2ADIB 4PJEF 5CKGA 2AJXL 3G5ZB 3MRKA 1EEZB 3MNZB 3O4OC 2FSEA 2Z31B 1RIHL 5B1KA 1IAMA 3RY6A 3QJFA 2OMBA 2QFRA 2YRBA 3HZVB 5HYJB 3BIAX 3KGSA 4TQEL 5C09D 1FI8C 4IJ3B 5IFJB 3P54A 1IGFH 4MNGE 4AV5A 3IDXL 1QOKA 2V2WA 4U6TA 3ZDZE 5AD0B 1JZJA 4TUJA 3WY2A 2UXFA 4XB8A 2CR0A 1BGXH 4HMCA 4GKSA 4ZTEA 3D2TA 1BEXA 2DLHA 2P5WE 4HZAA 4YSAA 5F89B 3T4AA 1MWOA 1GMIA 1R3IL 3CFUA 5L4IA 3MC0A 2DAVA 4JHUA 4J3UA 2HUHA 1MCDA 3P9LB 2ORBH 1KC5H 4ETQA 4GRWH 4OJEH 2H6UA 4YXHL 2IC2A 4HZLA 3K2UH 4LO9A 2AXGB 4JHAL 1B9ZA 2P24B 5DURB 1E4HA 3GUTB 4OCMC 5IT2L 2ZCKL 1BZ7B 4GBXB 3ZZSA 4ZMNA 4DW2H 4Q6IB 3VXOB 1UATA 3TBYA 1A66A 4P2AA 1A1OA 2IDCA 4YDVA 5E5UB 4QIRA 1OB1A 5JIDA 3D0AA 4OZFB 4OCWL 2GTWA 3EJQA 1T04B 4NKMB 1U36A 2GBUA 2IWGA 5HYEA 3MODL 2AZAA 5I1GH 4H8WC 1HNGA 2B16A 3BPCA 4FA7B 1UOWA 5EZIH 1HESA 1O6SB 4MMZB 2X6MA 3VXPA 2NLJB 3SDDD 1F6LL 4F7MA 2BK8A 4L1HA 1KJ2A 1BYNA 3V4UH 2AABL 1Q9WB 4IRZH 2UUDK 1NLDH 4ERSL 1MUJA 4NM8L 4LBEA 1AJ7L 4KNSA 5K9QI 1UOVA 1ZD6A 1HI6A 3KPSD 3DSFL 3MJ9L 4EDXB 1U8MA 4JHWL 2P5ED 4EN3D 4PJBE 2Q20A 2CO1A 1YYLH 4IIQA 3T8MA 1EO8L 2X6CA 4GQ9H 2FX7H 2LLLA 5D2NB 3UAJD 1T5WA 4O4YH 3LS4H 2FUQA 3EJUA 3NESA 2ZKMX 2GTZA 4TTDD 5DO2D 1QYGH 1L0PA 1FFTB 1NEPA 1NCAH 3FMGL 5JPNA 3OKKA 1QWNA 3ECQA 4FQQB 5JQ6L 1J0IA 2GITB 1T0OA 1I7RB 2FL5A 3HEIB 3T3PF 2WWOA 4XPHL 4WHYH 4XTRC 5B39B 5BRZE 4N3UA 4PJCE 2HFEB 3I75A 2WLLA 3D18B 4OZFG 4LARH 1L9SA 1M7XA 1QBBA 4PMFA 4L8DA 1PX3A 2JB5L 1T22A 5EIIA 1BD2B 4JY6A 4LCWB 2WSDA 1EJFA 4WK0B 3S5LG 3LYRA 3HUJF 4OI7A 1UXWA 3ZK0A 4AQ8A 3ULVL 1G7JB 5KJRL 4PVMA 3S5ZA 3T4AB 4X7CC 2J55A 1A8JH 3GO1H 2OYMA 4HEPA 4TQIA 5C0FB 3VGAB 4GFTB 5ABZA 1H0DA 4BFNA 4F7TB 1O0VA 3NZUA 1FGNL 1W0VA 3VI3B 4KDVA 3UZEA 4WVRA 4E5XG 4CC1A 3G6AB 4N90D 2YLHA 4L1SA 1QSFA 1TZ8A 2ZXWB 1BXAA 3P4MB 4HPOH 4RH4A 5I16B 3M86A 5A43C 5TF0A 1NFAA 2FB4H 3VH8G 1NJ9A 1O7DC 2FCBA 1A6AA 2N56A 2WOBA 3CFJB 3DKHA 1OVZA 2IADA 3ZTCC 1BG9A 1TDQA 3KPTA 2DW5A 2VR6A 4UT9L 4KAQL 1ADWA 2QVKA 2QHRL 4DKTA 3MPCA 2O6EA 2Q3ZA 1LEIB 3PFQA 4M6MH 4HJGB 3LAFA 4WFGE 3MJ7B 1R3HA 5AB0A 4PJXB 1AQ8A 5K1JA 2AXHA 4U3SB 4YDIL 2X44D 3TJEL 4HIJB 1A6TB 3VFMA 4N0UB 3B2DC 3G5WA 3B9EA 4WCYH 4DGWC 3IDUA 1K2DA 5AVXB 2AK1L 2HLAA 3RIFF 2XNAA 3TBCA 3FUJA 2XXGA 5LBSA 1P4LB 2X0VA 3BH8A 3CWGA 3HS9A 3OAUH 4AGOA 1KB5A 1FORL 1U8MB 1REIA 4LOVA 1IB5A 2V17L 4ORZC 3PQYE 3QAZC 3R0NA 4UQ3A 1EAOA 4KQ4L 4HUNB 5EBWB 3FCBA 4B6ZA 3TZVB 1DQML 4HS8H 1A3LL 3KHQA 2E74C 3FO1B 3R8BB 4PJCF 1CXHA 3D33A 5BW7C 1BREA 1CR9L 1QPXA 1I3GH 2YOCA 3ZSTA 1RFDL 1WA0X 5KAQF 3D69A 3RBGA 5HYJD 1WD8A 1RY7B 2XTJD 4NIYE 4YHYB 3APDA 4MMXA 2EDTA 2X7LA 1BZQK 2CUMA 2ROXA 3QIBC 3F7YA 3RVXD 4RMBA 3V4UL 1D6VL 2BIHA 2I7OA 3PF2A 4O2CA 5FS5A 1QBLH 2FATL 2X1XR 4EIUA 3SE9L 2RD0A 1MI5A 3BKYL 1YPZB 1PLCA 4PWIA 5HGDB 3OC8A 3Q2NA 4G8GE 1SFDA 3N0PB 2FQDA 2C9UA 2X9WA 4GW1B 3BSZL 3BZ4A 1XGYL 5DVKA 4PSRA 4Y0GA 2CBMA 3GLEA 3S3DB 4R96A 3QRGL 4XVTH 4YE4L 3UJJH 2EDQA 2XG4A 4HUCA 4LESA 4CU8A 5JDSB 3RKPA 4N2OA 5BO1L 1P4UA 2UV3A 4JPWL 1ID2A 4EI6B 4J6RL 1UQSB 2WBJA 4WUKL 4YDJA 3GPSA 1FA4A 4KWUA 2W0LA 1VPOL 2BS8A 4MZIA 5C08B 5BPPA 4JDVB 1DLHB 5KYUA 3WUZA 3L16A 2X40A 1Z9SB 4C4UA 3NFNA 3N1QC 2FWLB 3UDWC 3BX7C 4Z3FA 4MAYB 3D0LA 4NT6A 4C83B 4BH8A 1F4YL 4KHTL 1KZQA 2H3NA 4I9XA 1DQVA 2R2EB 4JFQA 1RSYA 1OCZB 1OXYA 4AX3A 2Z7WA 5JNYA 3DK2A 2PLTA 4PG9A 1FNHA 1GIGH 1U33A 2BINA 2J20A 1WC7A 3O45B 3OSKA 4K94H 1TQSA 3UYPA 2YOAA 2WGXA 2UY6B 1TSHA 2ZOLA 3Q5TA 3TPUB 4GI6A 2R1XA 3QUZB 1S7RA 5KUMA 4URKA 5FUCC 2EE3A 3CIAA 1F58H 1SJHB 1YC7A 4ZPVB 1I4FA 1V7NH 1ZAGA 3FOLB 4J28A 3VSQA 3X3FH 1U8IB 2A6JA 1QP1A 2WM0A 4N0YH 4UQ9A 4YHOL 3RWHA 3CX2A 2TSAA 4HIIB 4GOSA 4YHIB 4Y88A 1QFWL 5BS0B 4IRSD 4JG1L 4PJDB 5HDOA 5I6NA 1UYWH 2GTQA 3P3RA 1AIFA 4B9KC 2WQSA 2WVVA 1JPTH 2AXJA 1GAFH 1HILA 1Q72H 1NIBA 1QFUL 1MCFA 3JWOL 4RFOL 2VDOH 3L9BA 2JLPA 4YHMH 2FZ3A 4FXKB 4YXKH 3WSQH 1U8QA 1BBDH 1OTSC 4WU7B 1N19A 4F8PA 1G7HB 3Q44A 1KLFB 1RZKL 1T1WB 1FNSH 4ZTOH 3W9DB 4P23D 3BRFA 1E4XI 2F7QA 3FFCB 4G42B 2H6OA 3RX5A 1WBZB 3EO0A 2F68X 3TBBA 2FEDC 5DJAA 3VXMD 4FFZH 4X5WB 5AG8A 4B0MB 2AQSA 1ZCRA 2CXKA 3S5LA 4BFKA 1U8LA 3OKNA 5DZJA 3ZXAC 3UZVA 2PW2B 4BM7A 1HEZA 3M88A 3DVGA 4B60A 3SKMB 5LN8A 4MJ5B 3QC6X 1FNGA 2AJYL 2A73B 4EZLA 4K3DH 3V6ZA 1K8IA 2DQGH 2R7EA 4M5YL 3RPIA 1FL3B 2HG0A 3T8XA 1MNUH 5D7JB 5IP4A 4O00A 4TLTA 4L5FE 4RZKA 1WIPA 4IBSA 4M7LL 3BVTA 4OTXL 3OHXB 1U8JB 3B9KC 1GR7A 1Z9SA 3IBEA 5DHEA 3VFNA 4JDEA 5DS1A 3QUMH 4HISA 5GRUL 4WHTB 5EN2A 1PG7W 2KLTA 3AREB 4JQVC 1HHGA 4BQ9A 2OBGA 4V1DE 5GGQL 4TUJB 5C9JA 4G8GB 2DJUA 2IQAA 2QGCA 3VSTA 4JO4L 1UM4L 4GAAA 4P2RE 1DTUA 4J3XA 1VZHA 4YHLL 1N8ZA 1YQVL 5HHVH 3PGCA 3KPRD 2BM3A 1A5FH 5A2IH 2APXA 3MR9B 2GC7C 3N1GC 4MZRA 7PAZA 2HJKB 4HZLB 4AW7A 3R1GL 5BV7B 4JM0A 5E2VL 3RVXC 5C0JA 4GMTL 4IOIB 3BFOA 4HUVB 1XGUB 1VCBC 2YD9A 3A21A 2XPZA 2R56H 3B7RL 2NY4B 2ZCKH 3BDXA 4XB7A 1ZS8A 3VFSB 5IT2H 3AS2A 1P7BA 4HPYL 1JVLA 1V7ML 2J57A 1D9KA 3D39D 3WFDL 4AQ1B 1KTRL 1E4KC 3IBOA 5HI5D 3AWGA 2VC2L 1NANI 3Q8BA 3BQUC 3FFCE 2XXCB 3ILDA 3PWNA 5DFAA 4HKJB 2A9DA 1QG3A 1M2OA 5FFGA 1NOAA 1J8KA 3BOVA 1NIEA 3PIQB 1Z0NA 1A3QA 3DOHA 3J7HA 4OFPA 3CZFB 1MCBA 1N64L 3LEYH 2EXYC 2X2HA 3KBPA 1TTGA 3EH2A 4MXWL 4X6FB 3TFBA 4OFYD 3J27A 1DQJA 5AVTB 5CJQH 1P4BL 1AAJA 5AKTA 2V2TA 1JNLL 4YQXH 5BO0D 5B1BB 2ZKHL 4OLUL 1GGCH 2PPEA 2WXHA 4KVNL 2BW5A 2OK0H 1LK2B 1I8UA 1N10A 3AXLA 4A6YA 4OZGF 1H6UA 1HDMA 1UM5L 4BZ2H 2WXNA 1NKRA 3B7SA 2K9FB 1RZJC 5DMIL 2WZ5A 3KPPA 4NSKA 1DL7H 2WINB 4OIIL 2CMRH 3ABGA 1ZTMA 4U6YA 2RACA 4UCFA 2QLVB 4FNRA 3GZOA 3STZA 3D50A 2YZ8A 1IEAA 2P48B 3QCVH 4Q7DA 5GJTH 3OR6A 3SCMA 5IWLA 4J5VA 3ARBD 3S35X 5D9SA 1LO3H 2FJGB 4NZTH 2MSPA 3Q2LA 4N2FA 1M57B 1BM3H 1N5YH 4A2MA 2PCYA 5EBMB 2OTWA 3GB7A 2DQJH 2J7LA 4QRFA 4FXGC 2WWNA 1ASQA 5AW0B 4CC4C 4P99A 1X9LA 1J1OH 2LHAA 1LE9A 5DC9B 1BZ8A 4FXTA 4RZCA 4IRJC 1UCBL 2HH0L 3RIFK 1A6PA 2ODHA 1IBGL 4XMKL 3KJ6H 4R0LB 3DGCR 5F96L 4Z7WF 5D8JL 5FA4A 3D85B 3VWKB 4XZ4A 3TC9A 2EUVA 3PDGA 1C7TA 3BP5A 5C0GA 4NAJA 5D7EA 4HPOL 1QSEB 4LARL 5H35B 1KMGA 3MACH 5C3TA 1VJSA 2AJSL 2Q8BL 3B56A 4FDWA 3IWUA 3QEUB 3F01A 4PS4L 5D1ZB 1ZXKA 2H3KA 2NT1A 4PJBB 3WLWD 1L7IH 1JE6A 4U6VL 4JBSA 4LSQL 4YS4A 4PJBF 2XT1B 5GXBB 4ZS6C 1MW0A 2EDBA 4LSTH 1P4IL 4BRVA 1FVEB 1HXMB 3UAFA 3EBAA 1FZJA 3P69A 4QHLB 4M3HA 3KPOA 3HHMA 1P1VA 3HNTL 4K7PY 2AK4D 3WDJA 1ET8A 1KFGA 4PRHA 4JPIB 2ITCA 1EDYA 1BD2D 1QABA 3NA9L 1FIGH 1NCJA 4EBQH 2I27N 3ARVA 1KIUB 2WXKA 1SLVA 2CHZA 2I7SA 3QEQE 2OMUB 3LDBB 1ADQH 5H4ZA 2G9HA 1E9QB 5I73C 4LFHD 3VFRB 4BV1A 3QNYA 4OVUA 1W80A 3LKPA 2AEQH 3MDJA 3P9MB 3EXLA 1T2QH 2QVMA 1T1YA 3SY6A 3DXAE 3QXDA 3MUGB 2X4SB 3GS0A 2FH6A 2VLKD 3D0VB 2R2BA 3CDGB 4G9FD 3RY5A 1MFDH 2E9BA 2QTVA 4LMQI 3BHBA 2ED8A 3N44F 1A7RH 4OKVA 2D7QA 1SVZA 3L3DA 2G30A 5JW4M 3EYUL 3L5XH 4WKXA 4DGYH 2FT8A 3QFJA 1UM4H 2BCMA 3TBVA 5I1DB 3NK4A 3S34L 4AYMC 1AXSB 5AENA 3C5ZC 1KYOK 1ZVHA 2VH5L 5FX3A 2VNCA 4FN0A 1C5BL 3AM8C 4ZMZA 3V5KA 1S9YA 1MJJA 3U4BH 1CLZL 3ZHLA 3G5YB 5L8KB 1UWXK 2YD6A 4Q4EA 4UT6L 4GEJA 2DLFL 1NCHA 1KXQA 3KPRB 3MLXL 3QXVA 4PJ8B 4OZHA 5CJQL 4YGVA 5F3FA 2XU9A 4FQPA 1JVOA 1NGPL 1YMHB 1M05B 1OP5K 3MVSA 3T0EE 4YR6A 3NFSL 4AKPA 4GQRA 4AEHH 1F4XL 2PYEB 4ILDA 5T1DH 5IV2A 3FTGA 3QIWD 1KTBA 4Y1AD 4GBXD 2OULB 3LNGA 1JL8A 2LE9A 1RZ8B 3L45A 4OZHE 4Z7WA 4NWUH 2W60B 2VN6A 5IHHA 5SX4H 1OAZL 5I66A 1WFNA 1ZRUA 2XN9A 2JJWA 4NHCH 2NY0D 1PQZA 4OI9A 4Z7OE 3V4VL 2NYYD 5GISL 5IOPB 5F72S 3IDNB 3QDMB 4EOWH 2XACC 3TYFB 5K39B 1E9OB 3FZUC 3BZDA 3CFQA 5EC1B 5I0VA 2P7TA 5LO7A 3QZWG 1E2WA 3BAWA 2IH1A 1QA9B 1XGTB 3AB0B 4OCRL 4TKWA 4XVUD 2EDNA 4N85A 2MRYA 4HGWB 4YXLL 5FDWB 4DJMA 4LHUB 3V52H 2K4AA 2YA0A 3KE0A 1B88A 4X9IA 1ULVA 1DQTA 2C9QA 1DP0A 3TIDB 5C7ZA 4N0YL 4QRPD 1M3JA 3E8VA 5IBUB 3CVHH 1IT9H 3ROLB 5FO8B 4MXQD 2P5EA 4L5FH 5TDPB 2WYHA 1OAXL 3PHOA 1OCOB 1KB9J 2I07A 3H9SE 1ZXQA 4L4TD 2F19H 4PJIF 3QUML 1GVIA 3HI6L 4UT7H 4H8PA 4LE8A 3QJHB 4C4KT 4GUOA 2WP3T 4V1DA 4FNPA 1AH1A 1S3RA 3EO9L 4OKVB 2ZYHA 1HILB 5IBTH 4TVPL 5C0BA 4GG8B 5E5RB 3TVMA 4KKCC 3HN8A 1EAJA 3SDYL 3BUYB 1NC2B 1LQSR 3ATBA 3VTTA 3V6FB 5B38A 2WO4A 1T1ZA 3O9WB 1XGRB 2DH2A 1Z5YD 1IGCL 2JK5B 1W72H 3T4AC 5IJCC 2H2PD 5T1LA 3LZPA 2J8UB 2C7UB 3SKOA 3X12B 2ITDA 4H1LG 4F93B 4XNZC 3F12A 2J71A 3HE7B 4KY2A 4NN6B 4AV0A 2HLEB 3M1BA 2VDML 4Y4KC 1DANT 1E8XA 4FYQA 1GGTA 2YAOA 4LDOB 4BSWB 4KO5A 3FSZA 3T1FB 5KZCD 3KCWA 1J8HD 3SDCD 1H9VA 4FXLA 2UVEA 5FKAA 3OHXA 4U1IB 5JXAH 2Z4QA 2OP4L 1XH3A 4OF0A 2FK9A 3SPHA 3UFIA 5CJ5A 2Z0BA 3F7QA 4WO4A 4PRID 3AAZB 2WTOA 4A39A 3UGEA 1U3NA 3MNVA 5MENB 3PWUB 1FLRL 1INQB 1MCLA 1LQBC 4G7VL 1U6AH 3RGVC 3TWYA 5CCJA 2UXVA 3QR2A 3HHSB 1Q8MA 5CU9A 1B2YA 4POYA 3VFGL 4PQXA 3NEXA 4MNGB 4LCIH 3VTAA 2JIXA 4QWWD 1HT6A 1NCGA 4FX5A 1ES0A 2IALB 2BVYA 1FYTA 4Y16D 2XQBH 2B2XL 1UD3A 4Y8DC 2Y7SA 2Y25A 2OJEA 3VYNA 3KEDA 2I9LA 1QQDB 1PNDA 1G1KA 1O6VA 1Q94A 5F97E 3T0EB 4G7YL 1CFSA 4LU5H 4R8WH 2XZAL 1HINL 4F8TA 1E3ZA 1SUJA 1MJ7L 3OTTA 4MAUL 4ZTPL 3UTSA 3UP6A 1ZVYA 4G71B 4JN1L 2FR4A 1U91B 3S36L 4ONGL 1SQ2N 1JNHB 1Y0LA 4HC1A 1NA8A 1TQTA 2CO6B 2Z92B 3MRRA 1DANU 3WCYA 8FABB 5AOMA 4DPRA 1D5ZA 3WLBA 2AJVH 1MCCA 5LQBL 2Y5TB 1GOGA 5ADOL 4PRAA 4XPFH 4XMZA 2ZIDA 2GUYA 2D4FA 2XV0A 4JM4L 5E6UB 1XF2B 4M61A 4NQED 1TZHB 5AAWA 4AGQA 2B77A 2AJXH 3EJPA 4FFZL 3HNSL 4FXGA 4CC4A 5FUCE 4I3RH 1IUZA 4Y2DA 1T6WA 4G6KH 2K8QA 4XBGB 1MHCB 3OGCA 5EA0H 3SE6A 1OAYH 1SDYA 5B3JE 4ZUSA 3BD5A 4DUWA 3RNKA 1SY6H 4ZFOA 2QMJA 1RZGA 5I2IA 5L88L 4KRLB 3H9HB 4UOJA 2X4UA 1FRGH 2KQNA 5JHLA 4ZODA 3ARGD 1NGXB 3VFOB 3OMNB 3UTTB 3WBDA 3QS2A 3MRCB 4NUQA 4TNWK 1INEH 1BOGB 4RFNC 3SSGA 2HWZH 6TAAA 3L4YA 3GMNB 1JCKA 2EKSB 1U8NB 2GAZB 1HSAA 1NPUA 1TQCC 3CZSA 4GO6B 1U2HA 2VL5A 3BZEA 4D9LH 2MCPL 5CCKL 3QO1B 3QUZD 5D4IA 5EWIL 3CQPA 4C58B 4U4BA 5MERA 1UKQA 4BXSV 2C4XA 1NGZA 5TF1L 4NO0D 1TVBA 1IAIM 2BZDA 2GI7A 3MSPA 1VFBB 1Z1WA 3TF4A 3AS3A 1U3YA 4G80B 4H25A 1ZHLA 2BIIA 3SE3C 4L8SC 4BE5A 1QNZH 3ILQD 4F9LA 2RGSA 1PZ3A 2GBAA 1S7VA 2OMXA 3B3IB 4WEMB 1O7DE 3Q2VA 5EF1A 4RNRB 4QRTB 1DVTA 3FW6A 5DU7A 4G6KL 4PGEB 3P11L 4Y19E 3WDHA 4HBCL 3HPLA 3QUYB 1KC5L 3FCTA 2ZWNA 3ABLB 3S3PA 1Z6JT 4WW2A 1BQKA 1J9QA 4I18C 1TSRA 4ZQTA 3LNFA 4NN6C 1E65A 4N4YB 3BAJA 2AAAA 4LLDB 1W6LA 4W6WB 5KOVC 2R4SL 2AXGA 2PR4L 4Z23A 4PRIE 4A7VA 3MRMA 1JXGA 2NTSP 1G7QA 1AQDA 2HFTA 1SXNA 2CLVA 2NNAA 1YC8A 3CHXA 4RQQA 4NQXA 1MFAH 3UERA 1OGTB 1LEGB 3CFKA 4X83A 1CTOA 1BZOA 2F19L 4NUPA 4ZAKD 5FO9A 3FOMA 1FFNB 5IROA 2QFPA 1NAKL 1WAPA 4H20L 5BMFH 1CF8H 3ELAT 1CBVH 1OF0A 4NQSA 3UO1H 2JTDA 3MJ8A 1UVQB 3EGDA 2A6KA 3DWTA 4NCC2 1JZ2A 2V6HA 3CPLB 3KPMA 1AGFA 1MCSA 3QJRB 4EZMA 1AOZA 5KSUA 4I77H 5CR1A 2IWKA 5FB8B 3BMVA 3MV7E 3WTTA 3CSBA 4P4RA 4QYOB 1YG9A 1GGIH 4CMHC 5ENWA 2X05A 2DD8L 2X4UB 2FBJH 5E4EB 4TSAH 4JHWH 4B9YA 1T80A 3WNMA 1BQ5A 2E76C 3JTTA 3S36H 3FH8A 5E2UH 2X88A 4RVBA 4BIKA 3ESOA 1ZHKB 5IW1B 3QHTC 4R90H 3F65A 3C6LA 3DSNA 3PABB 5DS2A 1E30A 1FC2D 4NQEE 3L3KB 1XCTB 1SFHA 3M45A 5F71A 4L4VD 1E27A 3EYSL 1JERA 1L5GA 1XH0A 3RVUD 3D9AH 1T1YB 2B3RA 3QIWB 4PR5B 4YGAB 2FO4A 1QFPA 1UD4A 2AQ3A 3FMGH 3L3OB 4MB4A 4WDIB 4F33A 4WJKB 4E9WA 3IFOA 1GTFA 3D30A 3IDXH 3O3EB 4UF7C 3U83A 3NJIA 3V0VA 4DGVL 3SD2A 2QQNL 1E0OB 1T5XB 1WO2A 1QSZA 5IBTL 4NGHH 1AGDA 4R4BA 3SPVA 1S9WA 4L3EB 2DL2A 2WZPD 2XLLA 3GC3A 2DI9A 4Z77A 2WMPA 2V9TA 3C5SB 5M7QA 2WLLB 4OLXH 3QYNA 1TZIB 3S96A 3WMSA 3II3A 4PGBB 1NGWB 4KJYB 5IV2B 2O72A 3GBEA 4MYWB 2P80D 3TJPA 2OAAA 3OQRA 5JQ6H 1R3JB 1P84K 1HHHA 1QVOB 2DY2A 3QHZH 1SXBA 5HYSG 4J8QA 5HHPB 2CK0H 4Q9RH 1BLIA 3TCXA 2A74A 3MRDA 4WI0A 4PJAA 1T0PB 1NZRA 1GY2A 1G5GA 1WWCA 1K5NA 5I66B 1C5CH 4H5SA 1LP9A 4XAWL 5FF6B 1D5XB 3G08A 1NGPH 2OSXA 1KPUA 1ZJBA 2QPDB 1Q38A 1U8CA 2VAAB 1M1XA 2ZXGA 3L7EB 5LGJA 1JGVL 2AQRA 2OMYB 3Q9QA 4GBXC 2ZSVB 5GJSL 4EXKA 2WY3B 4GRMA 5I5IA 5DEJA 3RTQC 1WFIA 3U6XS 2MKWA 1H3PL 1NBQA 3R06B 4JFOA 1Z2KA 4R7NA 4NLAA 5TPWH 1AZUA 2R1WB 32C2B 4KZDH 4OZGB 3HG1E 4NAQA 5J6HB 2V5RA 43CAB 2XZCH 4AC2A 4PRNA 3TO4A 2ADYA 1TLKA 1EHAA 3IKKA 5IW1A 2FX7L 5FDWA 2AERT 3DVNB 3OR7A 4EE2A 2BZ7A 1JOIA 4KK9C 1OCWH 1RAMA 4PAZA 3SE8H 1HHKA 4GJTB 4FQCH 2DIJA 5I19H 1FC1A 2R2HB 2H1XA 4EOWL 1IKFH 5DVMA 1DBBL 4ZYKA 5GRXG 5GZNC 3S4SG 4GQQA 5E95B 1H3WM 3PL6B 2YUXA 2BNQD 1YN6B 1HOCB 4JRYD 3ML8A 4Q9RL 5G2NA 5EU3B 2CKBL 2X9YA 1IL1A 3B2VH 3H53A 3AQXA 3NN8B 4UZUA 2QADC 3WUWG 5FLVA 5FM4A 3KS0J 4A67A 3CSGA 3H9ZA 4J6IA 5KN5B 5K9KA 5CD5C 4QHPA 2X10A 1QRNB 3AU1B 3KVDD 4P5TA 4AEHL 4XOBA 3OXSA 2DQUH 4EZJA 3WTUA 4I2XA 3DYMA 3RUGE 5K9QG 1B4JH 4FQ2L 5TDNB 3HE7A 1DEDA 1FZKB 4B3VA 4LVNC 1KJVB 1WFOA 4Y5YB 2J1XA 5KW9L 4NXKA 5GS0H 3NPSC 4HUWB 1NSNL 4ZMQA 3G04A 5EZJB 4LNVA 5DZLA 5CP3A 1TITA 2Y9RT 2H1LM 1E5CA 1E4KA 1KBBA 1SN5A 1X44A 1BF5A 2VZ3A 1RJYA 1BW8A 2YK1L 1CU4H 2CALA 4Z7AA 1WITA 4U2ZA 3MLPA 1P7HL 3BZFA 4FTVB 4M7JH 1KB3A 2E7CA 3P30L 4OR1A 4Z7NE 2DEWX 3V55A 5K1NA 2J44A 2VXSL 1ASOA 1UJ3B 4QHKJ 4NI3A 1E5ZA 5C0RH 4MSWB 1BV8A 3VTMA 4ABWA 4FLOA 2IOMA 2UY6A 3U9PL 2ZOKB 4WUUB 2I9LB 4EI0A 3MV01 5HGAB 4WWID 5AUMA 4FKEA 2QQLH 4E9YA 4J1UB 5KS9F 3OKOB 1CFVL 4F3FB 2R29A 1S7UA 4PWHA 4YSTA 1SM3L 3HZ3A 2GB2A 2W07A 4IOFC 5HDBF 5I1CL 2J5WA 4MFHA 4GFXA 4Y5XC 3EG9A 3IJHB 1OGAA 1NEZG 4PRAB 3NCJL 4WENB 3HE7D 3RL1A 3DX8B 2CIIA 3Q8CA 3E38A 4F9LC 4KTEH 5DZPA 5E9DE 4JVPA 3WHE1 1MLBB 5ITBH 1F3JB 5D6DA 4TUKL 5D2LA 3CFBB 4J3OG 3V4PH 3FTZA 1YJDH 5L2KE 2HTKD 1GL4B 1T7XA 5E08L 4A2HA 1TCMA 3F58H 4TPRL 2KC0A 1QSFD 2HX8A 1KYAA 1H19A 3P73A 3OGCB 1INDL 2V9QA 5LNGA 1TJGL 1NCBL 5C0ND 3PGFL 4GXFA 1EZVY 3ZJAA 3D09A 5DK0B 1G7PA 2I25N 3VXNB 4J4PA 3GTTA 4K3DL 5FYJE 2OMTB 2OL3L 4WFFE 5D5MF 3O2WH 3O3AA 3VQ2C 2FGWL 3MX0A 3HC3H 4WI9A 3F2LA 1KXQE 2PWEA 4NRXA 1BQUA 2CO4A 3GMOB 4DPAX 1G87A 4F20A 1J86A 4X6CF 2FHFA 4JKPL 2YRPA 5I74C 1DE4A 3IGFA 1VEOA 2Z91B 4QCIB 3I75B 1JYVA 1IGMH 1Y18A 5T3ZE 1T4WA 5EORL 5IIEB 2Y4SA 2C9AA 3KLHD 5J1SC 3L2LA 2V9UA 5MI0B 4NQDB 3S8GB 4KNTA 2BCKA 5C6WH 3QRGH 1QHQA 2QSQA 4H8VA 2K6WA 4OQTL 3GDCA 5BOZG 4I77L 2GSGA 4PJGE 4WW1B 2XXMB 1B4TA 3BGMB 1YY8B 3CFEA 2PTTB 4NZ8A 4UTBL 3V4VB 4S11A 3KHOA 4N5UA 3VI4A 2FAUA 4N2IA 3OG6B 4JO5A 2ETWA 4NZUH 3NJKA 1INDH 4LP8A 2GCYB 4RIRB 1G7IA 3P0YH 1E67A 4MWFA 3QEHA 3HKZA 4AYID 4FQLH 4IOIA 4XPFL 2FHCA 5ITFA 4EQ3A 2E7LC 1QHPA 1JF5A 4P07A 3GYRA 4QT5A 1QATA 2C1OB 5HD8D 4C4KO 1T4KB 4DFIA 5A16A 4NDMA 4XOAA 1KT2B 4G3YL 1ZTXL 4M1DL 4P5KA 4YEFA 3P4MA 3R19A 4AUJA 3CFNA 4LDCA 4DQOH 1TETH 2FEEL 2APVA 2HXAA 3QH3A 1EAPB 2ZTBA 4JL2A 5ADPL 5CGMA 3BRGC 1XTMA 3QIUC 3GF8A 3P3UA 3HI5L 1LYQA 2KQMA 4PJXA 4TQHA 1IIKA 4MAYC 5J12B 1D5MB 3R4DA 5BRZD 3ZHKA 4ZXBA 1M9SA 2AV7A 1RIVH 3G5VA 3MKGA 1ZT1A 5FGRA 3UL4A 1OPOA 4LLAA 4I1RA 4EEEA 1CLCA 5GHWL 5DZNA 2FX8H 3QZWB 1BXVA 5HHMB 3GMMB 2EXWC 3DOSA 3I84A 4HJTA 1KG0A 3MGOB 2J8UE 4LLUA 4QWWC 2CDGB 5FGBC 3SKJL 9PCYA 1AHKA 2AXFB 3JV0A 3C6LD 4NKIH 1CUOA 5DJ6B 2VERN 1H5BB 4PJ6A 5HGHA 3N3EA 4K8RL 4OF7A 2J6EA 1CFQA 2VW6A 1V54B 2X4PB 3FDWA 2LU7A 3F85A 5TE4L 4X8JB 3SCMC 3VGBA 5F7BA 3L3KA 4LLWB 4N90E 4MGXA 1XL4A 1YECL 3OB0K 4Z76B 5IR1A 3RLSA 3GSXA 4JRXA 3BP6B 5DHYB 1BZEA 1ZHNA 2JQMA 1O9VA 4KPHH 1TFHA 3WUWA 4BKLA 2MEJB 4YDZA 3WYRA 3SPVB 3QDGA 4BWTA 2ZX9A 3HUJB 3O8XD 4QEGA 4P3CH 3SB3A 4ATWA 3VXUE 3IJSB 1FGVH 2M2DA 4JFXB 4A7GF 1ZLSL 1GSMA 3IFNL 3HR5B 1W0WB 3B2PA 1R4XA 3LRGA 1F2QA 4MD0A 4ANXA 2X28A 3MRHA 1LE5B 3QEHB 4OB5H 1BVLB 4FERA 3BWSA 3VI3F 4I0CC 5DXWA 1XB3A 4MCZB 2RIKA 5DRXB 1X5KA 1XR9A 5KYUB 1R3JA 3ZDZB 1AIZA 4AENB 3LN4B 3O3UN 3LKRB 1C5DA 2HVKA 3FQ1A 4HF5L 2H41A 1WD9A 5JYMA 1G9HA 2IPTH 3EGXB 2BSED 3UAEA 4LF3A 1HZKA 2CK0L 1Y7VA 3MRLA 3L3GA 3L13A 4CGTA 1I8IB 5KTEH 1B2WL 3EDEA 4E36A 4XBPA 2VLKA 3ULUH 3DX0A 2ZYIA 3O45A 1YAIA 2WTRB 3D0LB 1Z66A 1KYOJ 1KY7A 4M5ZH 3V10A 4OLZL 4P8QA 1A14H 5H94A 4JL1A 1E4WL 2D03H 3MBWA 4LK4A 1G7MB 3Q6FB 4QHUB 5LCVA 2XWTA 4LVOB 4MMXB 3FB7B 1DN2A 1KB5H 1M7IA 2G4EA 2QT6A 3KW8A 1DO6A 4GO8A 1N68A 4HQQL 1X5YA 4OJDH 3CJJA 1VFAA 2KPWA 3SGDH 3RVTC 4H8WL 2XIIA 3EJSA 1NH6A 4NYLB 3H2QA 1DHKA 2FWOB 2B4CL 3L9RA 1MFUA 4P2QD 2AITA 3IDYC 3K0WA 4HK0B 3LNIA 3B9DA 2AK4A 5KYWB 1S7QB 1YYLL 4LNRB 3LKPB 5HGHB 3BJLA 3HNVH 2FX8L 4I5BB 1JZFA 2C3VA 2OTUA 4LSDA 4YFLF 4BFOA 1D5BA 2ZAIA 3HAEG 1JWSA 1RZFH 2WO3B 1KN4L 2A83B 5C0DB 1BJMA 1CU4L 2YK1H 2RBLA 4WFEE 3QUGA 1I9JL 1EK3A 1GYVA 1YMMA 4HLJA 4YIQB 1E4XH 1A9BA 5FIEA 1J1OL 3P4OB 2VQ1B 2G5BB 4IBZA 1CYXA 3PL6D 1ILSA 4HK3N 3HI5H 3EYOA 4KK9D 1NEZA 1GCFA 4N2DA 1PKQB 4NHUA 2RTTA 3QR0A 1OIOA 4PJGB 5I30L 4XN7A 1AR1C 1DJXA 5HHOA 2OI9B 3RJDA 3TTYA 1MCEA 3BKJH 3NSXA 3MUHL 4IDJH 4JRLA 3GZKA 4OJYA 1OCWL 3ZKXC 2YGVA 3UYPB 4PJ5E 2MQGA 2JI2A 3GO1L 1W16A 4N24A 3QWQB 5DEGB 1SXSA 5J9PB 1IGIL 4DAGH 3TTSA 3DVGB 1T2QL 1VFOA 3EO1A 4QNPF 3FH5A 4XP1H 2EDEA 4WWPA 3REVA 3WS6A 1LILA 5CLTA 3A6OA 1RIHH 4X0KB 5E24E 2UWEA 4WEBH 3MUZ1 1QRNE 1RSFA 2X53A 1BDYA 1WISA 1XF4A 5KSAC 1HQRB 1XV8A 3BWAA 4KI5C 1G9MH 2DZEA 2ZYSA 2G5UA 3EH5B 3MRJB 3EYUH 4LSSL 5JPMA 4ISVB 3HMXA 4JS7A 1CT8B 5E8OA 1J5CA 4R0LC 3L6FA 4AMXA 1UM6H 4E5XB 3RE0A 1ITBB 2H47C 4N2NA 4B27A 5KTEL 4FTDA 4XN2A 5FYKE 2QHRH 3GMQB 5IQOA 2WWMC 4MRBA 4ELDA 1U95B 3L1GA 4Q58C 2KT6A 4NENB 4GKZA 1X3DA 2AF2A 4L1DA 4M8UA 4HUVA 1N8ZB 2R59A 5AW9B 3KZ8A 4OFYA 3DIDA 2VXUH 3S5LB 4TF4A 3RZWA 4L0PB 3GI9H 1OAQH 5D7JD 4PW9A 4PREA 5E2WH 2EDOA 3QDME 2HN7A 1KJ2H 3LHPH 1U0QA 4OJCA 3LQZA 1PD1A 1P5UC 3EJJX 5DTFB 3U79A 1C12B 1IC1A 2WIIB 5D7JC 3TEXA 4E9VA 4AE0A 3QORB 3VFSA 2D3LA 1I9EA 3QC5X 4KJQD 3CIQA 2A3TA 4CNIA 2OXGB 4JQXC 2VN7A 2HKHH 3QJTB 1QLEL 3IGKA 4DZ8B 1PFCA 2CLRA 3H2WA 3GZPA 3ZDYB 4N28A 5CKAA 1C9SA 2Z35B 1X5MA 4L8BB 4OF3A 5E08H 2NR6D 4IMKA 1BM3L 1NM4A 4LSSH 3WGUB 1P5VA 5BZDA 1N5YL 4BFGA 1DVQA 5TDPA 4P4KA 4MJHA 2ZXDA 3ULUD 1EUTA 1WHPA 3QDJD 1EJOL 5FYKL 2X0WA 5T5FA 3MV8B 1XGRA 1SOSA 3QPXL 2D3JA 2F5BH 2ITFA 3QDGD 4ZK8A 2E59A 2KPNA 5EO1B 2NY3B 4ZMXA 4IU2B 1ACZA 5ID0A 4TQ8A 1NC4D 2H32A 1WG3A 4KXBA 3RFZC 1T7YA 4BCYA 4DO5A 3NJVA 4HJ0D 4Y9CA 2ZSWB 2UY7A 3BEVB 3RVTD 4MAZA 4RRPA 2XICA 2MTPA 4MAYA 3TYGL 5DJ2A 5IBLD 1PIGA 5CEYB 2AV1A 2A6IA 2X4QB 4DH2A 4F2FA 3CUPB 4LL9A 1UGNA 1CE1L 1YYCA 4OH2A 2JE8A 4UT6H 3DIVA 1HN1A 3QNZB 5KBNC 1PKQE 4GQZA 1JWUB 2HTLD 4IBLT 4HWBL 1DBAH 1YY8A 4D0DB 3PWNB 1LO2H 3VGGA 2XG5B 4D8OA 1IU1A 3PP4L 5D1XE 3UG3A 1N70A 2RMNA 2YBRA 4NEHB 4E2OA 5EBLB 4Y4HC 2GSMB 5FO7A 3UTZA 1JZ4A 4DK5A 4NENA 3ARUA 5J57B 4ZXBD 4K0OA 5E5LA 3DO4A 5JXEC 1XHHA 2OR9H 1ZOXA 5ABAA 4N0FA 3QHFH 1MIEL 3E6FA 4FQXB 2EDLA 1MJUL 2A9NL 4IJTA 3BAXA 3PFUA 4ONOA 5B7MA 4I0KA 1OP5H 4YHOH 1I1YA 3CN0A 1I8KA 4LSUL 5TE4H 1C12A 2WIIA 5I28A 3QDJA 3US1A 4M8QB 2R15A 4WV1B 2J2ZB 1YJDC 3ARDD 1E4XL 1XZ0B 5C8JB 3LXUX 3MODH 2YUZA 3O6FA 3GSNL 4OZGE 5E1HB 4TSBL 1CLOL 3FUDA 3LNDA 4M48L 1T04A 2DQHL 3CZUB 2CKBA 3QSKB 4NKMA 2CUIA 2DMHA 4U1MA 1HH6A 3KYKL 1CYWA 1KBPA 2IOIA 5DJAB 3VJ6B 4HD5A 3AS1A 4LVNB 5ISZD 2Y6SC 3KPSB 2NDGA 2PXYC 3I6GA 2AJUH 5JHDB 3VU1A 1VA9A 2ICEA 4C56E 1EBAA 4NUJA 1PNCA 4QRUA 3FQUA 1QSFE 4JFHE 4B3EA 1UB6A 3I85A 4XT1C 3MROB 4R7DB 5EEWA 4G9FA 3LZRA 5EU5B 2Z65C 1MG2C 2NX5A 3GMPA 4EI5C 3U48A 4NCDA 3L4WA 3SJVB 3MV9D 2B5IC 5CF3A 1JTOA 1JMZA 3DV6A 5D7JA 3VG9C 1XCWA 1AY1L 2NLJA 2ZP8A 4V11A 3HBQA 1U8NA 1IEBA 4GP5B 5HI4C 1XGPA 1QTPA 1AP2B 3HE6C 4W6XB 4XCFL 5BVJA 3HTLX 4MJ6A 5J0BA 1JZ7A 3BC9A 2H9GB 3MFFA 3NP3A 5ID1A 3MOBL 2ARJA 3ZDYE 2O5YL 2DWTA 3QXDB 4NFDA 1VZIA 4E68A 3QG6A 4NERA 3NH7L 4YSQA 1RIVL 2EXWD 2VSKB 4LKXB 4HUXA 5DMJB 2X4NB 3BGFB 5SWZB 4CRPA 1GOHA 1WJ3A 3K2KA 4FE9A 2WCPA 1JWUA 3VD0A 3QDJE 3P0VL 3UO1L 5GS3A 1SGKA 3RWIB 3HMWL 2NY4C 5EO9B 3AQYA 5EOTA 5I74B 3IN2A 2X2YA 2YPKB 4I18A 4X80H 1C1EH 3KXFD 2YC1B 1RULH 5DDHA 1XH2A 4NNYB 4K8RH 4G7QB 5E6YA 1KELH 3O4LB 2IANE 1NUDA 4YPJA 2XWJA 2ITCB 2XOTA 1FE8H 2OQJA 3JQOB 4XE0A 4HT1L 3SE4C 4CVZB 4P2OA 2YFOA 5EIIB 2VR3A 2JCWA 2NTFB 3NFPB 3BIKB 2ZG1A 5C09B 1MEXH 1YN7A 3KNBA 3OXRB 3RAJL 1NCOA 4PRDA 4I1NB 4OFDA 4MB3A 4PBXA 4ZD3H 4TNWF 5SX5H 2HLFC 1RZKH 1IZKA 3U2JA 1TJIL 3ZE0B 4EUPH 4AYDC 4X6CA 1SJMA 5E8DL 1RIUL 1WFTA 2XWEA 3IXTB 4GS7C 4NWTH 5DEFA 2WZ0A 2D2CC 3Q3GB 4XP9L 2P8PB 1PFOA 3TT3L 4MNHB 5DMGC 3GIVB 1C8PA 1IBDA 1DQJB 3PUUA 4X6DE 3VW3L 1DUZA 2K6ZA 3MROA 3ZE2E 3P2DA 2PWDA 5AB2A 4ZW5A 1N12A 3RDTB 2HZHA 2EH7L 4G6ML 1MCQA 2F6AA 3OAWA 5GZOC 3B9VA 5C92A 1MLCA 4JANA 3QCUH 2NY4D 3CSTA 2ZICA 1MCJA 1UURA 4XGZB 5I9QC 1OWWA 5D2LF 1G9NC 4HT1H 3OZLA 4FFZA 1WH0A 3BW9B 1KTCA 4P04A 1JPFA 1F3DJ 1IEAB 3MNMA 2XA8H 2XNAB 3V95A 4GW5B 5AOKA 1XB8A 3B34A 4L3CA 3ZGIA 5D7IB 1U9KA 5MEOB 2J12B 2PF6A 3KXFE 3QB7C 4NKDB 4PV9B 3B8YA 3KPRE 4XWGL 1NC2A 3QQDA 1DVFC 4LSVH 1JS4A 1QBLL 4JCMA 1CD8A 4EKJA 1TMCB 3MI6A 1M53A 5BQDA 5IHZA 1BLNB 2XX1A 1L6ZA 1KENL 1T5XA 3EUDA 3OC5A 43C9B 1DZBA 4L8CA 1ZLEA 2CUAA 2UUDH 1NMAH 3BSGA 4ZUVA 2XHNA 2HTKC 1MVUA 2VDOL 4QOKE 5I1JL 5T1LB 1KGJA 2WQXA 2DWSA 4OBSA 3SO5A 1VHPA 1TJXA 2X89D 1GZPA 4LKCB 1GS7A 4WI5A 3ULVC 3RI5K 4OLVL 1I85A 3FFCD 3ECUA 4TVPH 2TSBA 3MCKA 5AYQA 4XAKD 4PLKC 5D5ME 3RZCB 1RUQL 4JG0H 2DWDA 1W8EA 5HTSA 1K9TA 1KIRA 5DVNA 1F56A 2Y23A 2OPCA 4GW4B 1PZSA 2L4OA 2MJWA 3P0VH 5AG9A 1U8HB 3ELQA 2NUPA 4LAQL 3VMNA 3RZCD 3FCSB 3I3EA 1D5XA 3Q3GA 1BIHA 3NMEA 1QVOA 2QGEA 3E9TA 4QF1B 3R1GH 2WSKA 4FG2A 3MO1B 1CYGA 3FO2A 3JVFC 3LKQB 3N43F 5HHPA 4JGNA 1R24A 3TU6A 1OAUL 1YA5A 3RFZB 5TE7L 2NY2D 1KBKA 1XZWA 5SX4I 1ZGLA 4XVUC 2C9SA 2D7PA 3BVWA 4X6BB 3B2UC 3K6NA 2W9DL 5T3ZD 4EZKA 1OHZA 3BPNC 3U1SH 4XO9A 2XJKA 4Z7QF 2ESVA 2Q76A 4PJHF 1QBML 3QCVL 5CINL 1YUKB 4TN9A 1ZGLM 2WVVB 4ZYKB 3WELA 1RI8A 4ZOBA 1MKFA 1MH5A 5KYYB 1YMME 15C8L 1CPUA 1OSEA 2FZ3B 3MRKB 4FXKA 3DYOA 2WYTA 4LHQB 2VXTH 2J3SA 2ILLA 3QJQB 3ZYZA 3IU4L 1A0QL 3LSOB 4MTMA 1HQ4B 4J3VA 2Z0UA 3KD4A 4DP8X 3AFLA 4HIQA 5KBLA 2VDQB 5C0AE 1FV1A 4BQ8A 2DQEL 4GAYA 3ZDXE 4WAFA 3WHXA 3DJSA 5B3NA 5B7FA 4I88A 4K23H 5AD0A 2WCGA 4LLQA 1FH2A 3MXWH 5C6TL 2DLGA 1XD0A 1JTPA 2DQTH 2Y1ZA 3UIZA 3VNYA 1RK1A 5HHMD 4KFZC 1PAZA 3CZGA 3C8HA 3UYRH 5CEZD 2G5RA 1K5WA 4E9QA 5TDOB 1UKTA 4DKEH 2D9CA 2X87A 5FEBA 5D7HA 3V5HA 4L4JA 3SE8L 2B7DT 3W39A 5DJ2B 5KVEE 4JZNB 3O3BB 4A6YL 1JNHA 5TE6L 3PNWB 4UI2A 5EFIA 1TVBB 3SPGA 2WNWA 3VXRD 3I3BA 3BUTA 2UY7B 3BEVA 2D3NA 3P30H 1YEGH 4OM1L 1CDGA 4RFEB 4RSVA 4GY4A 5I1LA 5E0QA 1FNGB 5F44A 1P6FA 2EP6A 3C6SA 4MVBC 1R5IB 3UZQB 4PJXF 4C56B 3EJRA 4MX7B 5IGXH 1R5VB 12E8L 1NIAA 2GVYA 2VUKA 1XDTT 1XCQA 3OX8B 2SEBA 4OLXL 4EI5A 5IQ7L 4PGEA 4MB5A 3PG2A 5GJSH 4KKAD 1PCSA 4WK4B 4LMQE 4K7PH 3F64A 1IM3D 4PJEA 2FYYB 2BOCB 3QPQD 4ZFQA 4OCXL 1CJYA 1X7SA 3FO2B 3H0TB 3VFTB 2X9XA 3QARA 1JNNH 1AO7A 4RGNE 5DD6A 3TNMA 3TOPA 3W56A 3ESMA 4WWKB 4KOCA 5GGRB 2LW3A 1J12A 2XTJB 4PJ7B 4RX4D 4XXWC 3SE3A 3I2CH 1U92B 3BISA 3KXFB 4JDTL 4WFHD 1RPQA 4UDTB 4LLDA 3QDGE 4MS6A 5DJCA 1NCTA 5IROD 2K7QA 4J3OF 2ESVB 4FG4A 4HWBH 4MS8C 3NJNA 3JSSA 3KWWB 3TZVD 4YOKA 4NFCA 3VRIA 4ZMOA 1LDSA 5IEKA 1U58B 4G59C 3FFOA 2IVFC 1S46A 1HU8A 1YPZF 2R69A 1BZ9B 3D4ZA 5CILH 3EG9B 4EMZA 4PFEA 1UVQA 4YZFE 3ZYJA 3QXTA 5CXPA 2X12A 4M62H 2LABA 1B4RA 4OUUB 4D2NA 2YLKA 3RPKA 5BUGA 4PLKD 5CN3A 1DJSA 1P7QA 3MREA 2HFGL 3K6IA 3VCLB 5I76A 2BMKB 3MCLH 3QEGL 1OCCB 1VACB 2PO6D 1OGAD 1JHKL 2BDNL 3IPFA 1J1XH 3Q1SH 3QG7H 5ENWB 1H6EA 2L0DA 3CU7A 3IWVA 4HAKA 4MCMA 4F7EB 4HWNA 1JDDA 3N5AA 5EO0B 2VOTA 4ODTL 3AXLB 3LMJL 1Z3GH 3K81A 1HDMB 3L1OH 5EOCL 3DIFB 3ZE0E 1CE1H 2JJSA 4NO0A 4N86A 4WWNA 2R23A 3ZT5A 4N22A 5CBAB 4JMXA 1F45A 4KTEL 3VFUA 4X42A 1KEGL 3KPLB 3KWXA 1URIA 4NO5A 1JK8B 1CVRA 4JK0D 3OMZA 5CJOL 5DD3H 4PN6A 4DN4L 3RVVC 5HJ3B 3U2IA 3GNMH 2VXQL 1HAWA 4QXGH 3KG5A 5FO9B 5LXGL 2C1PB 4ES9A 2VJ8A 3HMXH 5BCAA 3FBKA 4HKXB 2WBJC 4F5CA 2Y36H 5CGBA 2EEXA 4HS3A 3B1UA 2R1YA 4WI2A 12E8H 2Z91A 1YUHB 2QKIA 3GKZA 1CK0L 3O41B 3APMA 3BUIA 3LZQA 4AT6A 3MCYA 3UDWA 5LHDA 4PGBA 1EMTH 2E7LA 4U1LA 4P2OB 2Q7NA 3C08H 2I5YL 3QUYC 4U3SA 4KJQC 2ED9A 4FHKA 1QYGL 3IJYA 3MCLL 4CA4A 5I1HH 5BJTB 2BH0A 4QKXB 1JNNL 1U92A 3KXFA 3L7FA 1TTCA 3S8FB 3HA0A 4P5TD 4PJIA 3L81A 1VB9A 1M6OB 2PYEE 3C09C 4MASA 2DYPB 5HXMA 2Y24A 3FB5A 4UQ3B 5F6HJ 1BJ1J 3VH8B 3ECBB 5JR1L 2G3XA 2FEJA 4DW2L 4LQ1A 1Z5LB 3AITA 4EUPB 5CLYA 4JGUA 2PABA 4N2LA 3AACA 4N6RA 3RNQA 1I7TA 2EEAA 1I53A 1QUPA 2JV6A 5IQ7H 4PHZA 3D85A 3PPEA 4U1SA 3LRSA 3M7FB 3NAAL 4XBEH 4Y2OA 3R06A 5EZIL 1IVLA 3H4FA 4UQ2B 4P46C 1J0YA 3EZ8A 3ARFD 1L9TA 5F9WC 2KERA 5DMIH 5C2BL 4PG2A 1ID5I 4K3EH 5D4JA 5HPMA 3BSZH 1KGXA 1HEJC 3QCTH 1FYTD 3MRQB 5L8LB 1BYPA 1JV2B 2XYBA 1F90L 2NY3D 5F1IB 2FO8A 2BJML 2FTAA 4AYFA 1N2RA 4JHBA 4YBLC 3CBJB 1PX4A 4ZX4A 1LO3L 5B39G 5K59F 4R5XA 2AV7B 3DJZA 3G5VB 5IHUL 1WZAA 3W0WD 3K80A 1AD0A 4XCNB 4F8OA 2OCFD 5C08A 1NBVH 1X4ZA 1NKOA 1CXKA 4KUCD 1FP5A 1NWOA 3QP3A 4MDJA 1NPJA 5D2NA 4AH2A 4JQIA 3RHWF 3KL0A 4H0LC 2WLHA 1HCFX 4Q56A 1NBCA 1QWUA 3MLYL 1KXTB 2HRPL 1FVDA 2FJFA 3F8UB 3Q9PA 3ULVF 4PWEA 2RR3A 3TT1H 3IDYB 5TQ2H 4G8IA 5T1LD 4UUJB 2NSQA 3BAYA 2DWYA 3V5KB 3WFHB 1OAYL 1MRCL 4FD0A 5C07D 2DQMA 5F1NA 1ORQB 4BFEA 2P80A 3C09B 4J27A 4PVBA 1G6RL 2D0GA 3NJFA 4U1GB 4FCHA 5CWSA 5EU4A 1AYOA 1FZKA 5DQJB 5DFVD 2X5PA 2DQEH 3G6AA 2XTJE 3MTXA 4CN6A 3VMPA 5MHSE 3T3MB 2VIRA 1OY3B 1J8RA 1AXSA 5EU7E 1INEL 32C2A 2Y2TA 5GRZA 4P49A 5C0FA 1YNLL 4Q9BA 4FI6A 3FQXA 1JPTL 1YMHA 4BFJA 3VVVA 4ATTA 1J8HB 4YLCA 4L23A 3BN3B 3F83A 4XN9A 4MA1B 1PDKA 2IPTL 4XODA 2A4ZA 2CR3A 2XSKA 3BQUD 3QR1A 1MXGA 4KU1A 3IDNA 4JREC 2JF1A 1SN0A 3U1QA 4XXDA 1D6EA 1HTYA 1U8HA 3UGUA 4P4RB 1DVUA 3D2UB 3BAIA 2VMEA 4PUBH 1SZNA 4PRBB 2BVTA 5GGSA 2W60A 2P5PA 3W38A 3N04A 5IMMB 1DSWA 2FQEA 5KJRH 1A6WH 3LNEA 1HFUA 4HS6A 3PPSA 5A2JH 1L0XA 3RFZA 2AJYH 5L2JB 5E2TL 3VD7A 4WI8A 3NCFB 3FSWA 3C60C 4TVPE 2OL3A 2VDNH 5AVWB 5IG7A 3RL2A 5J3HD 4FJZA 2BNUA 3PQYB 2YR3A 1DEEB 4DK6A 1MCWM 5I1AA 5BZWA 2YPLA 3IFOB 4QXUH 5IGXL 4BYHA 4J12A 3CX5K 4XNQA 5C07B 5IB3A 4KK8D 4PS7A 1BQHG 3O0RL 4Z0XA 1J0ZA 1E4WH 2YEZA 4OB5L 2HP4A 3KPQA 1FG2B 2NNRA 4GQ9L 3S35L 2YAEA 1K85A 2ZYRA 1FRGL 1J0JA 3KYNA 4A2LA 4KKBD 5FGCB 3C5JB 5E8EB 4D9QD 4Y4HA 1SBBA 2VLRA 1UACL 3Q5OA 2HCZX 4WSJA 5DC0A 5D1XA 4OQTA 5IW6A 3HG1A 3T3PE 3RX9A 2JKSA 2XV3A 3HCVA 2ZOKA 4OF5A 5HY9A 1YEEH 1ZA6A 4JX0A 4XCCL 5C3IA 3RTQA 3BO8B 4TL5A 1NLBL 1ZDSA 4MA1C 1OAXH 4OJFL 4PLNC 3FS9A 4QCIA 4DSYA 5JIKA 2PN5A 3WSQL 4QTHA 4F58L 1XBDA 1A7OH 4LRNL 1NKGA 2RCSH 1F18A 4M7LT 2R2EA 1XCQB 4I0PA 2WJ5A 4CN4A 3M8OL 1IMHC 3GGWB 7FABL 3ESNA 4JLRA 5GRJH 1YY9C 5AW3B 3U2SB 2XFXB 4X7SL 4KHTH 4WEEA 5J5EA 4LIQH 1RZJH 5BV7H 3P3SA 5FUOH 3JXAA 4R8WL 3LRLA 1JV5B 2VN3A 3QUZA 4FA8A 5HHXH 4Z8FL 4J39A 2Z31A 2XZZA 3CFCH 5LGYA 4Z5RB 2BP0B 5L6YH 1CFSB 2EILB 3HB3B 1K6QL 5LG6A 4L5FL 4NQTA 3HZVA 1PZ5A 3MNDA 2C3HA 4PJEB 1JGUL 2NYYC 5L4MA 1IVTA 2BRQA 3SD5A 4AJWA 4M7LH 2V0AA 4BA0A 1DQQA 3DMMC 5I82A 1NOFA 2ALAA 2J4WH 1AC0A 4M1CC 4BZ1L 2JJTA 2YPLE 1LK3H 1RL1A 1WBXA 3GMQA 1TJMA 3EIFA 4ZFFB 3IAGC 2IF7A 4MBOA 3UH8A 4UM9A 4DP6X 4DPCX 5EU6E 1L6XA 1NCWH 5EBGA 4JQIH 1ZE3C 2GT9B 1XIWA 4OJFH 3GIZH 5D1ZI 3C8KB 1DBML 1NDMA 2IQ9L 1TEYA 3CMOH 3GTNA 3Q7JA 3P02A 2AW2A 3EADA 4G1EA 1PS3A 5EDSA 1QEXA 4WTQA 1I9RL 3MLWH 1GW6A 5LCVL 3FKUS 1L0QA 1EDHA 4A7SA 1AO7D 1RK0B 3PV6A 4XCEA 4BGLA 2BMKA 1ACYH 1E2VA 1R17A 3AG3B 4G6AC 4ODVH 3OGOE 4QRQB 3O11A 2XFGB 4QXTB 2EC9U 2XJLA 1U8QB 1YEJL 2NZ1A 1PJWA 2NX5E 1UA6H 5EO1A 5KVDE 1H3GA 5B22A 5I8EA 1LE9B 5EZOL 2D0HA 3E3QC 2WUBH 5G5DA 1ZS2A 3SDDC 1CFTB 5I8OH 1TCRA 2CDGA 2DL9A 2V8MA 3WMPA 1CMOA 3T1WA 3HUJE 5F6IB 1T7WA 2EDYA 2CIKA 5MEQB 3U4KA 1KDIA 4KTYA 5B39A 3WUWB 4K94L 1SHSA 3DRQA 2WLKA 4H25B 1NCDL 3INUH 4E42B 1LO2L 3D3VB 5DZVA 4XP4H 1NFIA 1OOAA 5DHYA 1KIQB 1NDTA 2BRRL 4Y5XB 1WFMA 3WKQA 4U6HB 3RWCA 3F6IA 5I6PA 4M8VA 4QRRD 1AS8A 1AHWC 4UZSA 4PRIA 3FQNA 4KFMA 4MXQC 5ICXA 4DZBB 4ZMYA 2DV6A 1X6NA 3MRHB 2ENSA 3EKCA 4UINH 1HHGB 5FV2A 4RRPG 3RVVD 3U6RA 3VE0A 3ZDXF 4JFFB 4DP4X 4LBEB 1UT1A 2ATAA 3FTYA 1TTUA 4Z7QB 1ZS8B 5TGBB 4PJIB 4WF7A 4W4OC 3T4YA 1R3KB 2V5YA 1EXUA 4RBPK 5D2NC 3QZWA 1OB0A 2VXQA 5DLMH 1UB5A 3CSYA 2EDDA 1E7UA 2ESVD 1G0YR 4JO2H 3WJJC 3K71B 1ETZB 4ACTA 5HGGS 3VDCA 1SPDA 4XCFH 2HJLA 1M2VB 3B9KA 3BIBX 4G6JL 3HFFA 4ZT1A 4ZOEA 4LF3B 5FM5O 1R3LB 4KXCA 1RZQA 1AD9B 3LN9A 5I5MA 1HH6B 3QIBA 4OGQC 3BPOC 1F00I 2F8VA 4NQCA 2F8XC 1SBSH 4QY8B 1I8KB 4JY5H 1CICB 4MDIB 3QQ4B 4M1GL 4X2UA 2JKRM 5EV7A 1MW1A 4XNXL 2A1WH 3QHFL 4HZ1A 1A4JB 3QUXA 5IM7B 3T09A 2MNWA 2KMWA 5EC2A 1WT5A 4L3AA 2A9NH 3NVQA 4JHZA 4DCQA 4AYFB 4U2YA 4RGMB 5DVPA 4HEMA 3LPFA 4JFXA 1IM9D 4KTDH 2R4RH 3H42L 1RURH 4DNLA 4Y9GA 2FD6H 3MRQA 3DTXB 2H1PH 3TESA 4YAQB 2FIRT 1B2WH 3HPJA 1T83A 4U6XA 3K8LA 4MZ3A 3NYKA 4LPXA 4F8LA 1FFOA 4YEEA 4WK2B 1BEYH 2R69H 4RMRA 4ENZA 2PCFB 3IGUA 1J9RA 2G5BA 4QLRA 2N4IA 4TTDC 5DO2C 3QI9D 3RRQA 3EYFA 4W70A 2Y69B 4WI6A 5ELIA 1F13A 3B7TA 5AKSA 3KGRA 1QO3B 2PW1A 1IEBB 1ROWA 2A9ML 2GEQA 3V0FA 1MJUH 4Z7IA 3M17B 2XY1A 1JFQH 1FIGL 3WIHH 2EE2A 3IS0X 3Q06A 1QLEB 25C8L 2ZE0A 4I9WE 1EHXA 2F8OA 3ZHFA 3ASWA 3HBZA 3QDMA 3EYVA 3BH4A 2VZ1A 4MA3B 1M1SA 1ERNA 5GGUA 3STBA 4MMZC 2Q9OA 3NCMA 1SDDA 5B21A 4Z78B 3UTSE 1MAJA 2WLIB 3H54A 4FLSA 1K72A 4LOUC 3T6VA 2WVUA 1QFOA 3G7TA 5C7XL 3S0PA 1KGWA 1HHIA 2HT4C 4HV8A 1PD6A 2EYTB 4PJFB 4GRLB 5AAMA 1GH7A 1AZBA 3ZDZF 3ILPB 3O6LH 3SDDB 5F7DA 4JDVA 5E6IA 3F84A 4PHXA 4AEIH 2EIEA 4JQIL 1FYTE 3FN3A 1YEHH 1F41A 4XC3L 1WAEA 4MQTB 3HZMB 2N0MA 3CC5B 4C47A 1CE6A 1CICC 1HCVA 3A6CL 4XMVA 4J2QA 5D7SH 4QHNB 2XG4B 3BP4B 5B1AB 3ARPA 2ZCLL 3DVFA 3B5GA 4PCKA 3B9KB 1GYAA 4L37B 3QFJD 5JHBA 1MIML 1JGIA 5D1XC 1AHWA 4XP4L 1L6PA 1YNTB 3BIKA 1GHFL 4JMNA 5IWLC 3T6QC 3AABA 3DI2B 3QFDB 4NXSA 4PG9B 4DP2X 1IC5H 2D7OA 1RUKL 3G08B 3TBTB 1GTNA 1LM8V 1FDLH 1KJ3L 1KLGB 3D1MC 5GS2D 4RAHA 1RUAL 1S5IH 2YPVA 4JPKL 1QSVA 3FT4B 3B3BA 5L0QB 5KVDL 2UZYA 2ZKHH 4OLUH 3D51A 3FPYA 4HUKB 3RZCC 1OW0A 3LNHA 2VL4A 3CCHB 5GPRA 1V8HA 5GRUH 2CLZB 3LX9A 3ZKXB 3D7PA 4IRJA 5IFHH 4MQXD 1C08B 2MNUA 4D8PA 4YDJB 1OE2A 1W2KT 4JZJA 4RAVB 4U1KA 1PG7X 4PJ5D 3FBQA 2F5AH 2NY2C 2VO8A 2R1XB 1FFQA 5HHVL 4JRYB 4UT9A 3IKCA 2VQTA 1JGLL 5I1EL 2Y6TE 6PCYA 2Y06L 2OZ4A 3MA9L 4YO0A 5KWYC 43CAA 5A2CA 3VG0H 1PIFA 3MGTB 4AJ0A 5T1JA 1S7XB 3WIIH 1JGVH 1R34A 3BAKA 1JPSL 2QZQA 3C5JA 4KX8A 4LRIA 2YSSA 4R4ND 4XN8A 5F8RC 4W93A 3NA9H 2VXUL 1CT8A 4ZNEA 1GJWA 3LZLA 1MAMH 3NCBB 3B1TA 4NZUL 1YSOA 4ZFZA 3TN0A 1BQLH 2JJTC 1S8DB 1YEIH 4N9GA 4XMLL 3UTQB 3X13A 2YN3A 1CLYL 4K5OA 1AR1B 4OBRA 4MAUH 1JWMA 3ARGC 4K9EC 5FYKD 3EYQD 1NDGB 1OTSD 5BNXD 3VFWA 1FH5H 2CM5A 2WXOA 35C8H 3E6HA 1ZTXE 3NGBB 4L9DA 5E8NB 2Y1YA 3HC0A 3HAEA 3QWOA 4PS4H 1KTJA 5LGHH 1VADB 5MHSD 3KAAA 4F7CA 2K4WA 4AOFA 2FGZA 3EGXA 2RFXA 3EJCA 3APNA 4GUQA 2DICA 4Z3IA 2KL6A 2YD8A 3CC5A 1GGYA 3GHEH 1BGXL 4QOKB 5DC2A 1LE5A 1UWGL 3KYKH 4I9WD 3IGLA 3CQQA 3ULUL 3HC3L 1SYSB 5EU7C 5CIPB 1V5JA 1FBIL 1OSPH 3TBTA 3ALPA 1KLGA 2Y72A 3G04B 4YNYA 1E6JL 4Z95H 4IIZA 4H44C 1MXDA 3RX7A 2Y7QA 4ZUSB 1DSFL 3VGDA 3ZQWA 4WIQA 4K71B 3BCDA 3BPLB 3NJGA 1JGUH 2MKLC 4HQQH 2C9RA 5F1SA 2DKUA 2WBKA 3UJIL 1DBKH 1I3RB 4P5RA 4GAFB 5FM8A 3WJMA 1XTLA 4AIXA 1UHVA 1T21B 5D2LE 5JHLH 2OSYA 1S7SB 5MEPA 2J2ZA 5JYLA 5DQ9B 4POUB 4X7SH 2E27L 1XF3B 1SY6A 3QFJE 1O7SA 2IH8A 4V1DB 1RZFL 3ULUF 5D1ZD 1K4DA 4B9IA 2GBTA 4NQVA 4YPGB 4HGKC 4GUPB 4HAGA 4KPHL 3NSJA 1QI5A 3S2CA 4UT7L 3FYIB 4UANA 3QDMD 2XTJC 3DXAA 4ZDHA 4HJ1A 4URTB 2I07B 1E8ZA 1L7TH 1N3NA 4OLYH 3Q13A 4M9OA 4PP1D 4G80A 2R0LH 3FU6A 1HOEA 1LO5B 3N1PC 4N0RA 4LT7A 4R7VA 4W9GC 2QSTA 3CN1A 3L08A 1KXVC 4CMMA 4FKHA 3JYBA 1JZ6A 3TIEA 2ZOTA 4HBCH 2BFVH 3WE6B 2V4LA 2M83A 1ZANL 1MG3C 4D9QE 2NXYC 4O4YL 1X5AA 3RGBA 3L3IA 4OCRH 4ZO8A 5ALBH 4HOZA 4IK7A 3ULSA 4JFZH 5A6MA 1QEWB 2EACA 3QUXD 2W0FB 3P73B 3HI6H 1LWHA 1U4FA 3WNJA 1QBMH 3G5ZA 4UV4L 2EVGA 2HRGA 3RWFB 1D5IL 3WMQA 4E9XA 1RZIA 2JCCB 2BNRB 4HJ0C 4JY4B 4LHJB 4ERSH 1U4EA 2EXYD 2H2SC 3ZT6A 2JCCF 4DVBA 3VG0L 3O8XB 2NY3C 1EHNA 4R83A 4YZFF 5DR5H 3VXQB 3WL9A 2ICCA 1SEQL 2B1HL 1HYSC 1HH9B 5ECGA 3RY6C 3TN0C 5JHDD 2ZUVA 2AANA 3RWDA 3H55A 3X1NA 3CN4A 4A7QA 4NKOA 2V37A 1I1AB 2GSGB 3G9VA 5E1IA