5JUEH

Crystal structure of uic2 fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
225
structure length
225
Chain Sequence
EVQLQESGPELVKTGASVKISCKASGYSFSNYYIHWVKQSHGKSLEWIGFISCYNGATFYNQKFKGKATFTVDNSSSTAYMKFNSLTFEDSAVYYCARLPIQFGNFYPMDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords light chain of UIC2 Fab
publication title Crystal structure of the antigen-binding fragment of a monoclonal antibody specific for the multidrug-resistance-linked ABC transporter human P-glycoprotein.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2016-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jueH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jueH02
1KPUA 4JG1L 1UADC 5CJQH 5J6GA 1T2JA 4DQOH 4NGHH 1F6LL 1DQML 5JXEA 2DYPA 1CDYA 3HRZB 1FH5L 2PUQT 4UT9L 3B3IB 1EHLH 1QO3B 2FJGA 1D9KC 2W0FA 3MRLA 1CFSB 1QYGH 2VAJA 2ED8A 4MJIE 3QUYD 1FO0H 3EOAB 1FN4A 4GRWF 4QYOB 3HUJA 1KIQA 4H26A 4XMKH 2HFFB 5AG9A 4GG8A 1FIGH 4ODTH 4UILH 1CXKA 3MBEC 2VXUL 2XQYG 4UQ3A 1MCLA 1RIVL 4Y4HB 5DJXB 4PV9B 3NZ8B 4M7KH 4ALAH 1TVDA 5GHWH 1AQKH 4MJ6A 5IMMA 2OL3L 1ZLSL 4UTAH 3KDMA 5LBSL 3ZKMC 2RAMA 4RMRA 5IR1B 2IH3B 5DD5L 5KVMC 4X7SH 2R15A 2MMXA 4TYUA 2QQLH 3VA6A 1KV3A 2UYLB 5B38B 1KGCE 4RMUA 2VABB 4ONHB 4NRZB 1MPAH 3BOVA 3DV4B 3VH8G 3MLWH 4KDWA 2BSED 1MJJA 4LSVH 1JPTH 2BVOB 3LKPB 4LVHB 4NFCA 4XTRD 4OCSL 2E7BA 2Y07L 3L5JA 3S6CA 3ZHLA 4I1NB 4IIQB 3GGWA 3QUMB 1KJMB 2UWEB 2YD7A 2W38A 2ICCA 4NCC1 1G9NL 5E8NB 4M03A 3JV4B 1X6LA 5EZOL 3TT1H 3VXSD 3UP1A 5I0DA 3B4NA 4XCCL 4FXKA 5DJ2A 4HXAH 3H42H 4ZYKA 4MX7A 5HHQA 3DXAE 4Y5VB 3DVNA 3WJJC 3ARBC 3NPZB 5BZDB 4IJ3C 2AKRB 4HFWB 3GK8H 2VDNH 4NP4L 5GGVH 2IADA 4WHTA 4D9QE 1FCCA 4OAWA 3DPBA 3L7EB 4D9RE 4OBSA 3SGEH 3VFUB 2CH8A 2V2XB 3VFSB 1W72H 1ZKAA 1KFAH 1V7ML 4NKIL 3QO0A 5CUSL 3RDTB 3TF7C 2C26A 1MHCB 4QRRB 4P5KB 3TZVB 4WEBH 1RU9H 2XN9D 4P2RD 2OJEB 4LK4A 2FEDD 3LKRA 4ZUWA 2BHZA 1V3KA 4WDIA 1KJ2L 4M9OA 1KIPB 3Q48A 1GPOL 2VB5A 1VFBA 1MHHA 4BQ9A 3OB0K 1LMKA 3CSBA 5C6TL 3VFPA 4G80B 1EA9C 4MD4A 2WK2A 1ITCA 1CGUA 5EB9A 2KZWA 1KLFA 4RGNE 2XA8L 3W9DB 4NM8L 4OF0A 3W81A 3FB7B 3SDAA 5FYKD 3WEXB 4M7JH 4S11A 5K9KA 1DQDL 5LGHH 4Z7UB 3U7YL 3ARFD 4KK8C 4LSUH 3RY5A 1XCTB 2JELH 2W0KA 4HMEA 3MRGA 3BRDA 1G7IB 2ICEB 4GG6E 2H41A 2Y6SC 4F33B 3CIQA 2AEPL 3VD9A 4Y1AA 3TH4T 2IALB 3PWJB 1Q9LA 4FQ1L 1I9RH 5F7KC 3O3BA 4FTVD 4MJ2A 3EFDL 2V17L 1MHEA 5HHOD 1ZLUK 2OTWA 4UDUB 4Z7WB 3QHZL 3JUYA 3AXLB 3RVWC 4WV1B 2YC1A 4K9EL 3PGCB 4P5TC 4ESKA 5JW4Q 1DSFL 4NBXB 2ZZUT 3FN0H 5CD5D 1JI1A 3GNML 2IH1A 3ZDXF 2FGWL 2UWEF 1FFQA 4N8CH 4R3SA 1JRHL 1R3LB 1VA9A 3BO8A 5D2LB 1IC4H 5KOMC 5IKCB 3JVGA 1HN1A 1BFTA 4M5ZH 2ICWJ 5E6IC 5DSCB 2CDGB 5L2KB 3VW3L 2MJWA 4UOW0 4RBPH 5EC2A 1FE8H 2VSDA 3IDUA 2HFGH 1G7HA 4LU5H 4HX1B 2AJZA 4PRHE 2X4RA 2P8MA 4PJ5E 1EZVY 4KTEL 2FZ3B 2FCBA 1QSFD 2C3VB 1NGYA 1T83C 5HHVH 3ROLB 32C2B 1I8LA 3WIHH 2FECL 3IDGA 1HHHB 4NQDD 3ULUL 1HH6B 1TZGL 5CILL 3QCTH 3VD3A 4KRPB 4EDXA 5I1CH 2YWZA 5GISL 2HAZA 3O4LE 4BSJA 4GXVL 1X7QB 4X7TA 2HJKA 3AY4A 1S7WB 3CFBA 1S8DA 3TBTB 3IDXH 3P9LA 2VLJB 4X7DC 3IYLW 3SPVB 5I16A 4MYWB 5GRUH 1EMTH 3TH3T 5ENWB 3WO3B 1PG7W 2YMXH 3MZGB 3A6CL 4YE4H 4PJGE 4JPKL 1HHIA 4JKPH 5KN5B 5MEQA 1A7QH 1RIUH 1EFQA 3QQ3A 1JGLL 4X80L 4Z7UF 3T08A 2ZOKB 3W39A 4RFNC 3C5ZB 5I19L 5A43C 1K5NB 5IHZB 1XGTA 3T09A 3LN5A 5INDA 6FABL 1B88A 3MLXH 2GFBB 4OZGE 4O00A 5ELIA 3KPRD 5AEAA 1UH3A 4UB0H 3QZWB 1T6WA 3SKUD 3IS1X 3EO0A 4MD5A 4PGZA 1N6UA 4AL8H 2A1WH 4PTTB 4F37K 3MCKA 3H3KA 3MJGX 4HJGB 4QT5B 4P3CH 3SDXF 4WWKC 5IVZA 1MWAL 5HHMD 1CGXA 2EEBA 2VJXA 2NZ9D 2NY4C 3FRUA 1HSBB 5KVGL 1W72B 2VDQH 5KTEL 2Y5EA 4AIOA 4KY1L 3OKLA 1JHKH 2MQ0A 5JDSA 1IMHC 2NR6D 4I77L 5IEHB 3BMWA 4U49A 2BSTA 1MFNA 3V5HB 1MCRA 2O93L 3RBGA 5H2BB 1A6AB 1AP2A 3T2QA 4P59H 2NY6D 3TA3C 1MFCL 3MO1B 5H37H 1MI5A 2KDGA 5D2LF 5F88A 3P0YL 4YZFF 1IC7L 4X8JA 5FA4B 2VL5A 1BQHA 2GAZA 1V5JA 3P4OA 3H9HA 2AXJA 4TTDC 2P5WE 4I4WB 3DX8B 4U1NB 1NUFA 2V5YA 2CIKB 3RKPA 3VXMB 4X5WB 3ZDYE 1UFUA 5F9WC 1JL8A 2XKSA 1Z9MA 1ZEAL 5EOQH 5T1LB 4XVTH 4P46C 4JRYE 5TF1L 3BISA 2LVEA 5DLML 1REIA 2XZQL 5FCUL 1ZOXA 3DSFH 4XP9H 1OGAE 5HHXH 4OJFH 3A6BH 3DVGB 3VXNB 4QY8B 4FXLA 5MERA 4ZO7A 3ZKNC 1L0QA 4KXZI 4DZ8B 1BBJA 4JM2B 3O6KL 5J1AB 3JWDH 5CLWA 5HTSA 3RY6C 4LCUB 2PR4H 3N1QC 2VZVA 2XWTA 1IGCL 1QSEE 4ZSOA 5D7JB 1WIOA 3MJ9H 2AK4D 4KV5F 1OGTA 4RMSA 2DL2A 3GB7A 4C56D 3W0WB 5EPMB 4NT6B 1AC0A 3CLEH 4N9OB 3BSZH 4KKBC 4MVBD 4QRQB 3GSVA 4OFKA 1UWGH 3B9EA 3CMOL 2HWZL 4AT6B 3GDBA 1QA9B 5BW7A 1TVBB 2JK5A 3NIFE 4LEOA 4OGYL 2VLLA 4JFYA 3VA2C 1YYLH 4K2UL 4YHNB 4L8SA 4U1MB 3FHQA 1D3CA 4JFPA 3MOQA 1A7OH 4PJEB 4EIGB 4HS6A 4U6HA 3VFRB 4RRPG 3T0WA 3RWHA 2X40A 3MJ6A 1U91B 3QUYC 3HTLX 4PJIF 4CU7A 1AKJA 4EXKA 1ZHKA 1J7VR 5IB2B 4KROB 1HHGB 3AM8A 7CGTA 1RZIA 3HN3A 5C0JA 1A4KB 3ETBF 5GS1C 4I18B 5T1MA 3HG1A 1D5XB 2DOCA 2O5XH 4PJDA 5A16B 3UBXG 1PDKA 4GBXB 4HXBL 1E6JH 3MRKA 1IFHL 4Y19D 3QEUB 4FMFA 4JDZA 3TIEA 3V7AG 2I26N 2R0WL 4A6YL 4HKJB 1RV6X 4NKMA 2A0LC 1N5AA 4LCWB 1DFBL 4I0CC 1OSZB 3AFLA 3E2HC 5C0AD 4P49A 2X70A 1IAIL 1ZT4A 4QHUA 4YXHL 5C0RH 1DVFA 1QBLL 4L3EA 2NY3D 4XTRC 3IETB 3I3BA 5C09E 1K9TA 1KXVC 2P4AB 1HWHB 4U2ZA 2VDOH 2X4TA 3OB0H 5C0FA 4G8EB 1K4DA 3RGHA 4ELMB 2BMKB 2Z8WC 2Z0BA 1T0NA 3C09C 2IFGA 2RBLA 3VXRA 1KB5A 4JFQB 5C3LD 4LP5A 4GJTB 4NPYB 4AM0A 1L4IA 4P23A 2PF6A 2H9GA 5FM5O 4X6EB 1NGPL 4F7MB 1RUMH 2Z31B 3GBML 5E24E 2BP3A 3DROB 5E2TH 4XPTL 3BGAA 4NZRH 4LLWA 4H8WL 4TUKL 4ZDHA 3DX6B 2NY1B 4PR5A 5I1LA 2DQEH 3B6SB 1YEHL 5F7UA 1UEYA 2WWMD 2J8UB 1T0MB 2FEDC 4G3YH 5ID0A 5LCVL 4DGVL 2FO4B 1ZLUH 5I66A 1A9EB 1YECL 1N6QL 2E3VA 4D0DB 1AO7E 1U3HA 1UM6L 4C57C 3IRPX 1UH4A 4TVPD 3SQOL 1NKOA 5DJ8B 4KKAD 1RUPH 1S5HB 4K71C 3FJTA 2YOCA 4QHMB 1A47A 3PWPB 4LVOB 2V6HA 1QFWH 4O2EA 1DLHB 5DXWA 4X8XA 2N56A 2Q76A 5GGUB 3ARFC 4GW5B 1CFNB 4XZUB 1TJGL 5F7EH 3R1GH 4MB3A 5C1MB 3VFOA 3L3HB 3KYAA 4DW2L 3ARDD 5DQ9B 4N8VG 2FO1A 4JFDB 3QUZD 3EOTH 4Z7WE 1CFBA 3T1FB 1O0VA 4F7TA 3P4MA 5IROA 3L9RA 4WTZG 4F15C 5FK9A 5GS3A 4EI5D 1RZKH 3IJSB 1FFNB 2B20A 3LY6A 4LHJB 1ORQA 2ZCHH 5HHNB 5KJRH 2V9QA 1VEOA 5F9OH 5JOPE 5I9QC 1NLDL 1MVUA 2BNRD 3TM6A 1U9KA 1MFAH 5JPNA 2H6PB 5IW6A 4WHCA 2B5IB 2IFFH 2KQMA 1WJ3A 4HF5H 3SJVD 3WNLA 5CD5C 1CT8B 4K9EC 3GIZL 3NA9H 4U1LA 4NZTH 4H5SB 1QUNA 1MFBH 2D0GA 1UEMA 3EKCA 5HDQL 1IM3A 4KVCH 1EFXB 5JXAL 3QIWD 2XICA 4ELMF 1A6VH 1BVLB 4LCCB 2APXA 3L6FA 1NCAH 1WFUA 3BPOB 4XNXL 3RWFB 5IB3A 4XP5H 3VXUA 1YEFH 1DDHA 4G5ZH 4M93B 4ZXBD 5I71B 1AGFA 1DE4A 5LGKA 3RTQA 3O9WA 3K4ZA 5KSBB 3C8KA 3DIFA 2CLRB 2J88L 4JAMA 3AC0A 3D18A 1WGOA 3HI6H 1PYWA 4OF7A 5TFSH 4QNPF 4JPWL 4JGJA 4V1DB 5DQDL 4NQCA 4OLZH 1NDGA 4TUJB 4L4TA 4ZPVB 3AROA 4DZBB 4FFYH 3UJJH 1WAAF 3ARGB 1QPXA 1K85A 5BS0E 2EKSA 4AENB 5T3ZD 5TQ2L 3SE8H 3NN8A 4IRZH 3GSQB 1JPGA 1HHKB 1PD6A 5HGBB 3RWDA 4JFHD 4JFEB 3GSUB 4YBLB 1U8OA 1YMHB 1N5YH 1G7LA 5KZCD 4YGAB 2Z92B 2DM4A 4UQ2B 3C6SB 2FL5B 1MRCL 1SEBB 1RIHL 3K2UH 2D7OA 2CIIB 2DQGL 2F19L 1GGYA 5ITFA 3ALPA 2ZPKH 2KL6A 5MHSD 4GKZA 1CLYH 2Y7QA 1N8ZB 2QHRL 3PWNA 2F54A 1D9KA 5IMLB 1ZT1A 4KK5D 1CD9B 2DQUL 4UBDD 3BZEB 1YEDA 1RMFL 5EIIA 5D1ZD 4JQXC 2Y06L 4PRAA 5EC1B 2MCPH 4LSDA 5TE6L 3D0VB 4FFZL 4NOFA 2VKWA 4YDIL 4M48L 4YDKH 2HJLB 3JWOL 3MBEA 4HJ0D 3S37H 1X5ZA 3S4SG 4WFGE 4PG9B 5HGHA 4FFVD 1KCRH 1VKXA 1JNHB 3QDMA 3UTSA 1QFWM 4G6KL 3DUUB 5IEKA 4V2BA 1E0OB 2NZ9C 5DHYB 3BHBB 2DJSA 1SVZA 3G04B 3VXTB 1C7TA 3Q6FA 1SYSA 5EZJA 1C5BH 3ROOB 1UT9A 2EKJA 3LKNA 1VADA 2NR6C 1YQVH 5F44A 2WWKO 4HZLA 3RVXC 1AE6H 3VCLA 2XZAH 1ZLVK 2NTSP 1KTDB 2X4OA 4PRDA 1P7QD 3ARXA 2ZSVA 5MENA 4E0RB 4GMSH 4JO3H 3BGFC 2NY6C 2ZCKL 4PD4J 2W59A 1T0PB 2DB8A 1U36A 1WC7B 2V7NB 3GSNH 4JPVH 4TNVF 2F8XC 4P3DA 1G7QA 2FJHB 3OR6B 1QBAA 4R8WH 4YDVA 5IV2B 4JM4L 4ZNCD 1XZ0A 4QXTA 2XG4A 1P4BH 4XH2A 3VXME 5FV2A 3FQNB 3O2DA 3ME0A 3WIIL 1CGTA 4D3CH 2GITB 3ZE0E 1TZHA 1X5GA 1I7UA 1T1WB 5EU6A 1BF8A 1W8NA 4KAQH 3WNOA 4BFIA 4G8FB 5KSBF 4ZOCA 3TBWA 3WJJA 3ARBA 1XGPA 5B22A 2GTZB 4F3FA 5BJTA 1B0RA 5T1KD 1ZV5A 3NVQA 2EIZA 4MNGB 2NY7H 4CVXB 3ZZ1A 3MNVA 1QEWA 3M8OL 4U6YB 3L3DA 5KANI 1GH7A 2VH5L 4L4VB 4MNHB 3KR3L 2WBKA 4MCYA 1GHFL 1OY3B 1IGFH 2F8VA 2P8LB 1P7KA 5FUCC 5T1DL 4XVJH 3L95A 1N2RB 4Y2DB 1Z3GH 1DL7H 3H2WA 4WHDA 5JOFA 4U6VH 4U1HB 1FPTH 1JWMA 2Y5TB 3D9AH 2A73B 3NBNA 3L7FA 4XVSH 3B5HA 3MV7A 5C0GA 1P84J 2YD6A 4P57B 5D7SL 3U4AA 5EOCH 2NQCA 1F5WA 1D5MA 1BBDL 2J3SA 4MVBC 5EBLB 5IHUL 4OD1L 5EULV 3OAUL 5EO9A 4QTIL 5GGRA 2ZOLB 2C1PA 4KHXH 2MKWA 3DX7B 3CFEB 1KPUB 4M7ZB 5BV7L 1FRGH 2DWDA 5J6GB 4OI7A 2Z8VC 5ILTH 2DYPB 2R4SH 4OUUA 5IBTH 3NPSC 5ITBL 4WCYL 5HYJD 4LFHG 2FJGB 4YXLH 2W0FB 2EEAA 1YZZA 3MRLB 1F97A 5CIPA 1CLOL 1YEJH 3FFCD 5SWQB 5HHPA 4WTZA 1QHPA 4LSQL 2A74A 1FN4B 2BX5A 3HUJB 4Z7OE 1KIQB 4H26B 3VDBA 4H88L 3MUGA 3MZTA 4WW1A 1CXLA 2PCPA 3UCRA 4P5TA 4XPGH 2V2TA 4M1DH 3SEPA 3PJSB 1CFVH 4FQXC 2R4RL 5DJ6A 3MRJA 5IMMB 1XGUA 1KJVA 3KDMB 2J6EH 4OIIL 2YD1A 1M6OA 4DKEH 4HGWB 4YHZL 3O6LL 2ZUQC 3BN9D 1I7ZA 3LEYH 3QYCA 4XNZC 2BCKB 1QFUH 4K8RD 4ZUSA 5E6IA 4Y4HD 3LH2L 2VQ1A 1MJJB 1C12A 3PL6D 3MFGB 3HFMH 3IFOA 2NY3C 4JDTH 3R8BB 4JO4L 3S7GA 1EBAA 3VU2A 4O02L 5C0CA 4WO4D 5EZIH 2EDBA 3B2VL 1T83A 4DGIH 4Z7NF 1PVHA 4LAQL 4FZ8L 5IBLD 4FQIH 3MA9H 1W0VA 4PJ9A 4J3OC 5DJ2B 1KEML 4MX7B 4P9HC 4PJHE 4LQFH 3DVNB 4PB0H 1FZJA 1JHLL 2NTFA 4LPWA 4HLJA 1UQSB 3G5VA 2VERN 3LEVH 1EVTC 3UPRA 2IADB 4WHTB 2J8UE 4RGOH 5F93C 1QRNE 2ICWI 4OAWB 4HQQL 1WFOA 3OX8B 2R0KL 5FYKU 4LSSH 4CN6A 4PYGA 5BXFB 4R9HA 5IUSA 4HS8H 4HW6A 1GC1H 2JLLA 3L3GA 4OM1H 5D6DC 3OXRA 2WWMC 3GSNB 3Q1SL 2X4PA 3MV8B 1J1XL 3LKRB 4GMTH 4QRPD 4ZUWB 1JZ8A 3Q5TA 3RZWA 3RP1A 2OXGA 1GGIL 1VFBB 4YHMH 1A7RL 3RWCA 3VFPB 3OPZL 4KKAC 4MD4B 4X6BA 1BOGA 3MLRH 4WUUD 2C4FT 4D0CA 2HMID 2CUHA 1I9IL 5E4EC 2W9LA 1OAYL 3THMH 3VWKC 5K9KB 3LRHA 3NACL 4OKVA 1E4XH 2A77H 5FEBA 1ROWA 4WWKA 3MRGB 4MLSA 3ARDC 1S7VA 3PG2A 5CEZL 3QUZC 4IHOA 4JREC 1CVRA 1FP5A 3KPPA 3SCMD 4Y1AB 4CGTA 3TEUA 2N7AA 4S2SB 4U0RC 1BFOA 1HDMB 1BZ9A 5FO9A 4O2CA 3HNSL 4O4YH 4EI5C 4B5EA 3O3BB 5FHAL 4YQXL 3TA3A 1MHEB 2OTWB 4EUPA 2AK1L 3WS6C 3KPMA 3QPXH 4OCMC 3IF1A 1XF2A 3V9FA 3QXDA 3MXWH 5C70A 2UY6A 4NQSA 2WM0A 2YC1B 4NUJA 1RZ8A 3STBA 3BFOA 5JW3L 4ZTOL 4KK6D 5I8KL 2IH1B 5DMYA 2BXYA 1AXTH 3QIWC 1FSKC 4Z7VB 4R3SB 4MWFA 3BO8B 2Y9RT 2LU4A 4QF1B 4YNYA 3BZ4A 1KSRA 2BVYA 2GHWB 1S9KC 2YR3A 4X7CC 4P46A 5D7LE 5CJBA 4ZXBC 4JY5L 4G7YH 1VEMA 5DD1H 2IPUG 3X13A 3ZL4L 4UOW1 3AS1A 5EC2B 1G7HB 1J5OH 1T89C 2AJZB 2DJ4A 4FQCH 2X4RB 4WW2C 2CO6B 2P8MB 2WLZA 5E5RB 1NGYB 4YPGA 5ICZA 3C08L 4PRIE 3VGAC 4R0LC 3IFLH 1FFOA 4MA1C 4JFEE 3RY6A 4QHLA 5L2KD 2GUOA 1UM4H 1Z2KA 4EDXB 5JIKA 5FB8B 4LPYA 1XCQA 4KZEH 3ECBA 4NSKA 4G7VH 4X7TB 3SE4C 4N0FA 2HJKB 3P40A 1EHAA 1FZKB 3CFBB 1S8DB 2DI9A 3I6KA 5HI4D 3P9LB 2VDMH 4QHKJ 1FNFA 4GQ9L 4MNQE 4A2MA 1AD9A 1J1OH 4F7PA 4APQD 5EBGA 2DTMH 1ZLVH 2OXHA 1HHIB 1Q0YL 3NFPA 2ZSWA 1LO4H 1O7VA 3I3DA 5MEQB 3QQ3B 4NKDA 3IAQA 1VPOH 4KJWD 4F9PC 3W39B 1HEZA 2CDEA 3PWUA 2X4QB 5DZOA 1XGTB 1KLUA 5I1JH 3A67L 4KK5C 3RUGA 2IQAA 3V0WL 3LN5B 2VLJD 4UBDC 5T3XE 1JK8B 5INDB 2FX7L 5D1ZC 2W91A 3QUYA 4QRSA 1QPPA 5T5FH 4XCYA 3EO0B 4MD5B 1RK0B 2LTQC 5GGQH 4HJ0C 3UTTE 2OQJA 5GS1A 3QWOA 3MCKB 4FFVC 3UROR 2NYYD 4YFLF 3JWOC 1FBIH 1KB5H 2J5LC 3VDAA 1HIML 5IVZB 1BPVA 1E4WH 4LHUD 3GBNL 3C8DA 3JWNC 4L5FH 3MRBA 3EDFA 3VMOA 1MELA 4EBQH 1SHMA 3BKYL 3WHXA 3TBVB 3OKLB 4OZIA 2VLME 3HPLA 4RA3A 2I24N 5JDSB 4OLUH 1ZHLA 2FX9L 2BSTB 4M43H 2QKIB 1TVHA 2DIBA 5L7XL 1UZ6E 1AY1L 4Z0BL 1OCWL 3G08A 3HR5A 3PNWA 1D5BA 2NY0D 5JA9A 4V2CB 1FZOB 5F1IB 2NX5E 1JGUH 1JYNA 3SE9L 4Z7VF 3QI9D 1MOEA 1YA5A 5E7BA 4X8JB 2VL5B 1BQHB 2GAZB 3HC3H 4PLOB 3P4OB 3H9HB 4NZUH 5DMGD 1UXWA 4NC1E 1RZFL 1RULL 3VXSA 3LQZA 1MRFL 5I8CA 2VL4A 4MNGE 5FYLE 5DK2A 4PJAE 2JJTC 2B2XH 2DBJA 4AEHL 1G9MH 4MDIA 4HIHA 2VXTH 4TUOA 4PBXA 4WUKH 1T03L 3MYJA 1CBVL 1KACB 4HSQA 4JO1H 4L4VE 3BKCH 4OD3L 5C86A 5GRYA 4OZHA 3K8KA 3TO4D 3KLHD 2XN9A 2NY2B 4P2RA 1L6ZA 2YPLE 5MERB 2IAND 3KHQA 1KC5L 2OSLB 4HEPG 2AJXL 2F53E 5D1QD 1OP5K 1IGYA 1HINH 1MF2H 2Z91B 3EDKA 2X1WL 4G8GD 4N5ED 3BPNB 2XWTB 4ZSOB 1GGBH 4YFLI 1FJ1A 1OGTB 3RIAK 2FRGP 1WEJH 1X5JA 3GB7B 1DLFH 3N1FC 4K3EL 1N59A 1S5IL 3NIFF 4NN5B 3ARFA 3BAEL 2GSGB 4DN4L 1JF5A 3GSVB 1U8KA 4HGMA 1YYMH 1UCBL 3KJ6H 1CIUA 3MBXH 3MUJA 1B0GA 1AXSA 2JK5B 3HNVH 1YPZE 4LEOB 1QLFA 1SBSH 2VLLB 2C5DC 2NY5C 2VMFA 1H15A 1UYWL 4L8SB 3ELAT 4JFPB 3U7WL 3HUJE 4YHIA 4XC1H 2DI7A 2VZTA 4HS6B 5LVEA 4U6HB 4FTVA 3RWHB 4W70A 4XNMA 1AI1H 5HHOA 3RJDA 1LE5A 1S3KL 2BSSB 2NMSA 1KCLA 4PGBB 1AKJB 3IU3A 1CS6A 1ZHKB 3HC4H 2HVKA 1QBBA 1RZIB 1ONQA 5C0JB 4IM8A 1W0WA 1YEEH 1UKSA 3MYZA 2B4CH 5T1MB 2ZKHL 4HK0A 4QXUL 5FAAA 4AEIH 1DUZA 4PJDB 2OR9H 5GS0D 2E27H 3MRKB 4GW1A 2H45A 2XXMB 4E9LA 4HHAB 4PGDA 4JDZB 3TIEB 1FNSL 2D0HA 1QBMH 1PSKH 3BN9C 5CSZB 3B2UD 3CVIH 5DR5H 2RCSL 4KROD 4G43A 4NKMB 1T2QH 3GM0A 1LEGA 1C1EL 1N5AB 4RFEA 4BSWA 4K8RC 2OR7A 2VWEC 4X6DA 4FQ2H 3WFEL 1BIHA 4QHUB 1MAML 2B7DT 3S5LG 1DVFB 3PL6C 4L3EB 3K8MA 2VNCA 3GJFK 5IG7A 3VGGA 3IU4L 4GAJH 4WO4C 4OLVH 1QSFA 1MJUH 2X4TB 5C0FB 3MV9E 4IRSB 2CLVB 4LHQB 5C7XL 4KTYA 1K4DB 5IBLC 2YK1L 2IF7A 3DHJA 4NQDA 4POUB 1EBPA 1KB5B 2YD3A 4MHHI 4MAUL 4AM0B 1RZGA 2JKXA 4P23B 1NGZA 4EOWL 2H9GB 4L9LC 4Y5XC 1BFVL 4QXWA 1RZ7L 4M7LT 4Z7QF 3FT4B 3I50L 3QH3A 5EU3A 2VDLH 3CX5K 3U7AA 3S3PA 4LLWB 1OAQL 2UZIH 4ZDHB 4MQSB 2D4FA 5FYJE 3QUKA 4PR5B 5I74C 5I1LB 4HG4K 1R5IA 4Y5VC 2EIDA 3KS0J 3UO1H 4P48A 5ID0B 1G1YA 3OKNA 4GQPH 5I66B 8FABA 2VDPH 1U3HB 2G2RA 4ODVH 3KPRA 4MS8D 2ORBL 2DN7A 2AJUH 5AZEH 4JQXA 2HMIC 2VZUA 1RJYA 2CGRL 3H3PL 1J18A 3DRTA 4O2EB 1CE1H 4Y1AE 5DS8A 3NZHH 2Q76B 3DGCR 1RJZB 2XPGA 3EYSH 3GUTA 3E6HB 4HPOH 1CK0L 4NQXA 3VFOB 1N64H 1IAOA 2VAAA 2B1AL 1NGXA 3SCMC 5ETUA 4MXVF 5M94B 3P4MB 3IDIB 4LVEA 1UCTA 3L9RB 2BNQD 3PWPD 1P6FA 4KHTH 1IGJA 5AZ2H 1ITBB 5FK9B 1WWBX 5CBAA 1FNLA 1ORQB 3DURA 1GOHA 2DDQH 5IF0A 4HFUL 3O45A 2XKNB 1IBGL 2X09A 2WP3O 3H9ZA 2W07A 1MVUB 3TLRA 1A8JH 4ODBD 1B2WL 4DCQB 5I17A 3OSKA 1L7TH 1I7RA 2DIAA 5JPNB 3M1BA 5IW6B 1UACL 1HHJA 5DGQA 1J0ZA 4BH8A 4JHBA 4KK6C 3FMGL 1TJIH 2DQJL 5GGSA 2RJMA 3NFSH 3CFCL 3T04D 1UWXK 2ERJB 5MI0C 1IM3B 3P4LA 4N90E 2EDEA 4NYLA 4Z77A 4RGMC 2CKBA 3TBYB 2EDQA 5B3JE 2W92A 3L6FB 1BEYH 4G42A 2P1YA 4I13B 1QLEL 1DDHB 4C54A 2CD0A 5DUPH 5HVFB 4F9LC 1AGFB 4PS4H 1DE4B 3MV11 4B7LA 5ADOL 1TETL 2G5RA 3UJTH 3RTQB 3O9WB 1RAMA 4O51A 4PTUA 4U3HA 1YEIL 3R8QA 3C8KB 3DIFB 3MCLH 4JAMB 3ULUE 3D18B 1PYWB 1EFXD 4R6UA 3OKOA 4MXWL 4KZDH 4NQCB 1J05A 1OHQA 1NDGB 5CIPH 5F6IC 1Q1JH 3KPNA 1E6OH 4L4TB 5EWIL 4I5BA 2DM2A 1IGIL 2AW2A 2WAHA 3HCVA 1VB9A 5F21B 3EAKA 4ZQKA 2BVQA 2AK4A 2EKSB 5CJOL 5C2UB 3K1KC 2EE9A 3L3JA 1F02I 5I1KL 3DO7B 4C56A 3NN8B 3X12A 1NEZG 2ZUXA 1JPGB 5HI4C 5EO0A 3NIDF 5TQ0L 4V1DD 4JR9L 1U8OB 3W9EA 1DCLA 1EK3A 1A7NH 1Q94A 4APQC 2BVTA 1ADQA 1MIMH 5E8PA 1I1RA 4DEPB 4OFIA 1MCOL 1T22A 4HT1H 3MMEA 1C8PA 4J3TA 2OI9C 3KYMB 4X0KB 2CSPA 2E7MA 1KT2A 1RUKH 4KJWC 2UV3A 2YPVL 2Y7QB 2QLVB 4PJXB 1T7YA 2YD5A 3PQYE 4ORZC 5AWNH 1JZ7A 1D9KB 3BP6A 1ZT1B 3FN9A 5J7CC 3VFWA 1M05A 1YEDB 1IEBA 4GUPA 5EIIB 5DUBA 4ZODA 2I60L 4PRAB 3LS4L 2C4FU 2ARJQ 1UZ8A 1X5KA 5EU5B 3MBEB 4XPHL 2NYYC 5HGHB 5IB5A 1VKXB 3SKJH 4G6ML 5DRZA 3VD5A 2YD9A 5IEKB 1HZHL 3MRPB 1JPSL 1XMWA 4Y19A 5DJDA 3IVKA 5F1OB 2IPTL 5EZJB 1SYSB 5TPWL 5AD0A 4Z8FH 3WFBH 1I1FA 5IVXA 3LKNB 2CQVA 1MI5E 1VADB 1NCUA 4HZLB 3VCLB 4A6YA 4PRDB 2X4OB 5EU4A 2ZSVB 1MVFA 4HIJB 2NY0C 4POYA 5MENB 1UWEH 5C0AA 5CLTA 1KULA 2FHBA 3EYVA 4ZFFA 3IFPA 2VDRH 3BEWA 3QI9C 4ZTPL 4P3DB 1G7QB 3ESVF 4YDVB 3S35X 1YNLH 5E2WL 3ZDZE 1NFDE 1XZ0B 4N0UA 1IRAY 4S1RL 3NABL 4QXTB 4JKLA 4XH2B 1B6UA 1Q72L 1OP5H 1T5XB 2WINA 3QQ9D 1TZHB 3TYGH 5EU6B 4OZ4B 1V7NH 5IB1A 1I1AD 4BFIB 3TBWB 3ARBB 1XGPB 4XXDA 4G9FD 1X6NA 3QJHB 4IJ3B 5TDNB 5JOEA 4F3FB 2EDTA 3BUTA 4LASL 3IXTA 4RAUA 1CZ8H 2BY0A 5K93A 1B0RB 3DRQA 2EIZB 1PQZB 4YWGL 1BQLL 3BH8A 5KVDL 3TO4C 1OT2A 4RA0C 3KLHC 4O9HH 3MNVB 4K3JL 2NLJA 3BJ91 5D6DA 1ZMYA 3EJYD 3L3DB 4UV4L 4NIKB 2VZSA 4MCYB 4ZSOE 2XTJC 1P7KB 5FOBA 1CGSL 1SJEB 3QHFH 3CXDL 3L95B 1NCCL 5D1QC 5ALCL 2W0LA 3W2DH 2AGJL 4EUPH 5JOFB 4OQ1A 5D8JH 1JWMB 2MHAB 4N5EC 3GMMA 1MLBB 1SJVA 3L7FB 3TNNA 4MZ3A 1H3WM 2QADD 2SEBB 4GOSA 4FP8H 4PJXF 3MV7B 2E9IA 4RNRA 5C0GB 4FQJH 3BN3B 1T6VN 3MREA 3QULA 2BC4B 4GKOA 1UJTA 1D5MB 3S3JA 4U6XA 1N26A 1I7TA 4DJMA 3U46B 3ARDA 5EO9B 2Q8BH 3LKSA 4XPBH 1UKTA 2C1PB 3QUZA 3RX8A 1BJ1J 2PYFA 4N0YL 2BSRA 2BHUA 2DWDB 4XMPL 1FYHB 1YDPB 4OUUB 5L88H 3QEQE 2I5YL 4EI5A 3MGOA 3V4VH 3GJFH 3I02A 4QOKB 1VHPA 5CIPB 3HG1E 1A1MA 2G60H 4PJDE 2W60A 3WS6A 1OARH 2A74B 1DQQA 4FZEH 2BNRA 2AV1A 2L7UA 3QQNA 3GRWA 2XY1A 2FWOA 1QP1A 2QTEA 4WW1B 5INCA 2PCPB 1R3IH 2DQCH 4FMKA 5DD0H 4P5TB 3REVA 2V2TB 3GSWA 4ODUA 4OCLC 3SJVA 5KSAC 2X41A 2H3NA 1MFDL 5GS0C 5DJ6B 1CTOA 3MRJB 4YK4C 1XGUB 5MP6H 1KJVB 1CF8L 3TP4A 1NFIA 4S1QL 2ADFH 1M6OB 15C8H 3QIWA 3B2UC 4IDLA 4KROC 3KG5A 1I7ZB 2YUXA 5IWLC 3HR6A 5A2IH 4JN2A 1U6AH 2XNAA 2D7TH 1FLRL 2R2BA 4ZXBA 5F7YC 1J12A 5E6IB 4NN6C 4DAGH 5F7FA 4QKXB 2VQ1B 2OZ4L 1FGVH 3VRIA 5GZOD 3IFOB 5B38G 3VXRE 1T89A 1F3DH 1U3YA 4WW2A 1NMAL 4QRTA 2WUCL 5D71H 3CVHL 4JG1H 2K7PA 4D8PA 5C0CB 2BVEA 2ITDA 2MCG1 4PYHA 3NMEA 5DJCA 5KVFL 1AGDB 4R0LA 1W0VB 2O61A 1BQSA 2A2QT 3BXNA 1PAMA 1JBJA 5GJSL 4H25B 5E00A 2NTFB 3KYNA 3O6ML 5IIEA 2APFA 4K07A 4JQIL 3G5VB 1BM3H 4JCMA 3QT2A 1EUTA 3H7LA 4OB5H 3UPRB 2WP3T 4NNPH 1EO8L 1J8KA 4NUGH 2BRRL 3W82A 2VXUH 4JRXE 1RIVH 1LVEA 1MCWW 2KPNA 4MXQC 2BFVL 1A1NB 3L3GB 1ZLSH 3QFJD 1H3XA 5BOZG 3OXRB 1PKOA 4PRHD 5DQJA 4PJ5D 5DD5H 4OSUL 1TCRB 1GAFH 5DC9B 4KFZC 1U58A 4PPTA 4F9PA 2V7HA 4HPYL 4PGCB 5TE7L 4G6FB 1C16A 5I76A 1CGVA 1YNKL 4MS8C 1IGML 5KOVC 3MACL 3RWCB 2ADIA 5D1ZA 1G0XA 1T3FA 1BOGB 3D0LA 4D0CB 2R69H 3O4LD 3CK0H 2AJYL 2AABL 3N1PC 4Y4FD 1F4HA 4QHKI 1E4JA 3MV8D 3PGFH 4OKVB 3Q5YA 4MMZC 1UWXH 3FB5A 4WWKB 5EZOH 1DQLL 1JF1A 3QDJD 1IJ9A 1S7VB 2NY4B 3CH1B 5DI8B 4EQ2A 4UT6L 4IHOB 3KYKL 3KPPB 1F4WL 3E6FA 2Q6WB 4EQ3A 1L7IL 1ODAA 4NHCH 5BMFL 1FFPB 5FO9B 1BZ9B 1P7QA 3DX9A 5C07D 4NHUA 4XP6L 5SWZE 3TA3B 3ZE1E 3HMXA 4EUPB 1V7MH 3KPMB 5CUSH 2BZDA 4I3SH 3REWA 3IF1B 1XF2B 4NJAL 3EYOB 5IVNA 2BOCA 3QXDB 4M5YH 5GSRA 4NQSB 4NUJB 2AI0L 1RZ8B 2AJVH 1N3NA 3MGAA 1KJ2H 4JFXA 4W6XB 1GPOH 3G5ZA 3BGMA 2JJTA 4YFDB 1F8TH 3VXUE 5I73B 3ULVE 1U8MB 5E9DE 5D7IF 1EGJA 5FYKH 5F9WB 2EDRA 1QACA 2R1XA 2UVFA 4MWFB 5T1KA 4Q9RH 4YNYB 3BZ4B 4P46B 1DQDH 2AEWA 3BPLC 3V6OC 4OCWH 3U7YH 3V52L 2P47B 2CLZA 2Y72A 3GJFB 2E8YA 1BFSA 3OKMA 2AEPH 3SDCB 2X6MA 3LQAC 3D3VD 2PTTA 3I84A 2R0LH 4YPGB 2GTWA 3BPOC 4FQ1H 4ZOEA 2AXGA 4WFFD 1T1YB 1X5XA 2VLKB 3EFDH 2Z35B 5I71C 3LEXB 1GGUA 4QHLB 2GUOB 4BA8A 1JNNH 3O2WH 2IMMA 4ZUUA 3FQUB 1IKFL 1A22B 2DQTL 1XCQB 3ECBB 4NSKB 4NWTH 1SVCP 2J8HA 4ZO6A 1LD9A 3PP4L 4JRYD 4K9EH 3ARUA 3ARYA 5CWSA 1LO3H 4BZYA 3RIAF 1J87A 1AD9B 2F54E 2R2HA 4F7PB 1Y18A 1OGAD 4HKBA 2VXVL 1TQCC 3NFPB 3QFDA 2ZSWB 2WBWB 1HI6A 4KRNA 2YRZA 2A6DA 4XBPA 5IJKC 2FH6A 1HEZB 2CDEB 3PWUB 5HI5D 3UX9B 5HYJA 4H1LH 1KLUB 2IQAB 2GI7A 2AEQH 4YBLC 3VW3H 3WFHA 2DKMA 3CC5B 4YFEA 1URLA 3FFCA 3PWVA 3QDME 3WE6A 3QUYB 3UTSE 1U2CA 1QSED 4QRSB 1MCKA 1DN2A 1NCDH 2DQIL 5FF6A 4XCYB 1WT5C 5D70L 1MFEL 4ZFOL 4A2LA 1BJ1H 2OQJB 4KMTH 5GS1B 1A0QH 3QWOB 3QZWG 3MRMA 2XZCH 3MRDA 2LABA 1QO3A 3U4BL 3WUWA 3K8LA 3L3KA 3VI3E 4JFFB 3V7AE 4LLAA 5CILH 1J1PH 3FHAA 3F6IA 3WHXB 4I9WE 2P48B 3HPLB 4MA7H 5E99L 4OT1H 3F58L 5I1EL 5DFWH 4Q9QL 4GXVH 2PYED 1TVHB 3GI8L 1F11A 4PREA 4R7NA 3G08B 3HR5B 3PNWB 5DJXA 4PV9A 3F62A 3NOIA 4P4RB 5CJ8A 5C6WH 1OPGH 3PL6A 4GXUM 4I3RL 3A6CH 2BDNL 4KRLB 3RHWF 4JPKH 3SGJC 4WO4A 4Y4KD 1INDH 1JWUA 3S3SA 4X80H 3QQ9C 1JGLH 1UXWB 3EZJB 1KN4H 2UYLA 4AK1A 5B38A 3VXSB 5B39G 3C09B 4ISVA 1I1AC 5DK2B 6FABH 5DFTA 3L5XL 5DWUL 2CJUL 3CH8A 4MDIB 4Y5XA 2IAMD 4TUOB 3KXFD 3X14B 3MYJB 2EDDA 2CR3A 4U1IA 3QUMA 2UWEA 3FQWA 4OZHB 4MA3A 1FORH 5F3BA 3T3PE 3RVTD 1MWAH 3BKML 3EJYC 5KVGH 4I0PB 4Y5VA 5KTEH 3MUZ1 3HC0A 2XN9B 4P2CG 5C09D 3T77B 1NANI 4QRPA 4I77H 3MV7E 5D96C 3S34L 5GRJL 4L3AA 2VSCA 3SDYL 4MA8L 5L6YH 1IGYB 2VO5A 1KJ2B 3VFUA 3RWJA 4WUUA 1MFCH 3VRLE 2QADC 4K71B 1FJ1B 1UJ3C 1IC7H 2OJEA 3G6DL 5C9KA 4RIRA 1ZHNA 1UM5H 4U4BA 3ARFB 2WIMA 4WTXA 1U8KB 4FHBD 1R6VA 4LLMA 5LWYL 3FO9A 1EH9A 2VZ3A 1B0GB 1C5CH 4K7PL 2DAVA 4G80A 4HUWA 1AXSB 5J13C 3SCMA 2OBGA 5SX4H 1H15B 3B5GA 4YHIB 4BKLA 5MEOA 1ZEAH 1AO7D 1OM3H 4FTVB 5JUEL 4U1JA 2OLDA 1EZVX 5TF1H 5IESL 5HHOB 3DMMB 2YBRB 4DWHA 1R0AL 1K2DA 5DLMH 5FCUH 3BDYH 5IFHH 1G7IA 1JI2A 4XNUH 5I9QB 3IU3B 1YEKH 4TN9A 4OCNC 2HTLD 2BJMH 3FO0H 2HVKB 4LAJH 4XPAH 1O7SA 2IALA 2BNUA 1F2QA 1W0WB 3IRZA 4HK0B 4Z76A 1DUZB 5JHDD 2WUBL 4B41A 2H26A 2UZXB 1JNLL 3GMPA 4GW1B 4UDUA 2EE6A 3SDXA 2Q87A 5KBNC 2HJFA 1JTTA 1FDLL 4G43B 5I1GL 4R26L 1PGRB 5C0CE 3GIVA 4BSWB 3PGCA 2FIRT 1A6WL 1ADQH 4X6DB 4F9LA 1GZQA 4H1LB 5TE4H 4PJCE 5GZOC 1FYTE 5JOPD 2HWZH 1FAIL 4CKVX 3I9GL 2DQHL 2M1KA 5IG7B 5CJQL 4LEXL 5BO1L 4K2UH 4DQOL 1QSFB 4J12A 4NGHL 1RQ5A 5I1AA 4KQ3H 5D2LA 2G75A 2HH0H 3VJ6B 1EHLL 4XPFH 5DSCA 5L2KA 1WIUA 1QYGL 2EO1A 5BRZD 1CR9H 5F8RC 1NGZB 4L3ED 2H2PD 1MEXL 4M1GL 4XMKL 5JW4M 4X9FA 1Q9KA 3G5XA 1FO0A 1FIGL 4GSDL 4ODTL 3QH3B 5EU3B 5D5MF 4IRSD 4RFOH 4XMLL 5ISZE 3OWEA 4APQA 1AQKL 4EKXA 3QUKB 4UTAL 3QEGL 2WZPD 1YMME 3B5TA 2DKUA 4X7SL 1V3JA 1JF6A 4A6YH 5L9DL 2G9HB 3OKNB 1X7QA 5CINH 5I1HL 8FABB 3T0DA 5JPMA 2G2RB 2VLJA 1DFBH 4P4KD 5H37G 3BIAX 1MPAL 1PKQA 2FBJL 3KPRB 2APTA 4KPHL 4LSVL 4YXHH 3W5NA 1JPTL 4AMKH 4LARH 5BS0D 1NC4D 1NFKA 1RJYB 2W9DH 3CZFA 4AIZB 1ZVSA 4Y4FC 4YHPA 2VQTA 3DRTB 5DS8B 1ULVA 5ADPL 2XPGB 1HILA 4ONGH 3GUTB 1K5NA 4P9HH 5HHMB 4NQXB 4LHUA 1W8OA 2VAAB 1IAOB 2GFBA 3MRQA 5HI3D 4HXAL 3H42L 5ABDE 3BWAB 1NGXB 3QZWA 4Z95H 3C6LD 2FHFA 1S7XA 1A21A 2DS4A 3GK8L 4OLXH 4OCXL 3BYYA 1EEUA 3GBMH 1VFAA 1WUNT 2H2SD 5DEGA 5CBAB 3BGFB 2NY6B 3ARQA 5BQ7B 3DURB 3P73A 4H8WH 4LMQE 3O45B 4S1SH 2N7BA 3QI9A 1KFAL 2X42A 1W72A 1YEHH 1RU9L 4PJ7F 4PJIA 1I7RB 3FOLA 2A6KA 3W5MA 2H1PL 3M1BB 3WNPA 4DGVH 4WFGD 3V5HA 1HHJB 1YECH 4TVPH 4BH8B 4WEMB 5M95B 5GGSB 3L3OA 2Q86B 4KVNH 1IM9D 3MFFB 4QO1A 4Z77B 1LEIA 4M1CD 4WFEE 4WRLA 5DGRA 43CAB 5HVWA 3QAZC 3T2OA 3U9UA 2IMNA 1RJCA 3DX8A 4I4WA 3TO4A 1JPFA 4NO5A 2JELL 3ULUF 1MCDA 5HYFA 4NNXB 4RX4D 4O51B 4PTUB 2R39A 2IANA 2X2YA 1FG9C 3OR7A 5FA3A 3OKOB 4IEFB 2WSKA 1I9RL 1J05B 3NAAH 4FQPA 5D1QA 1D6EA 3IKCA 1JNJA 4RCAA 4I5BB 3K74B 4G8GA 2JB5H 3HCVB 1GOFA 2I25N 2R9HC 4ZQKB 2BVQB 3GRWH 4GT7A 2AK4B 3JZ7A 1NLDH 3O0RH 3U30C 3GO1L 3L3JB 4FQQA 3O41A 3O9WD 3V0AC 1NBQA 4PGJA 5F1NA 1U42A 2EXYC 3X12B 1K3ZA 5EO0B 3OGOE 3V7MA 3MLUH 3WKNA 1DBJH 3W9EB 4P2QD 3E8UH 1Q94B 5DTFA 3QHTC 1HKFA 3IJYA 3OXSA 5E8PB 3RUGE 1AFVL 2J8OA 1U8LA 2D03H 4IOIA 1BJMA 5IGXH 5HDQH 1D6VH 4QEGA 4KJYA 1KT2B 4Y89A 1T04A 5JXAH 5ICYA 3P0GB 3OKDA 3NPSB 1IC4L 5HI5C 2N4IA 1S7QB 3BP6B 4M5ZL 5JDJA 1JRHI 2ZP0T 3VFWB 1M05B 3WHE0 1IEBB 4GUPB 1FE8L 2HFGL 5DUBB 1SYVA 5C2BL 2CXKA 4TOYH 1UZ8B 4OZIE 5I8EA 1ZT7B 5DQDH 5IB5B 5GSVA 4FQXB 4HUUA 5DRZB 3FL7A 1D9KD 1CXEA 1WWWX 5T3ZH 1U93A 4Y19B 5DJDB 4LIQH 5I1CL 4CN4A 5AD0B 3N9GL 4PP1D 4HIXL 5JR1H 3ARZA 5IVXB 2FECI 2ZUQB 5IB2A 4DGYL 1HXMA 1YUHB 4AYFA 4HULB 1SJXA 3TJEL 1OWRM 4A6YB 5EU4B 4XNZB 4YX2L 4ENED 3EYVB 5EZLB 1D5XA 1EMTL 5DEFA 5JMOC 2YMXL 3IFPB 3BEWB 2Q8AH 4YE4L 3ZHKA 4GH7B 2LAAA 2NY3B 4JPIA 4Y4KC 1GC1C 1WV7T 2F19H 2DQGH 1A7QL 1RIUL 1QKZH 1U2HA 3INUH 2HKHH 2WINB 1WVZA 1P7HL 2WMPA 4W6YB 5EN2A 3MLXL 3WXVL 3O2VH 2DQUH 5DVOA 4OZHE 4JLRA 5DC0A 4UB0L 1DANT 1RMFH 5EUOB 1G7JA 2IAMC 2L0DA 3IETA 4URTB 4FFZH 3IXTB 1HNGA 4RAUB 4M48H 4P2RE 4EZMA 3JWOH 4AL8L 2A1WL 1B3JA 3DRQB 1L0XA 4OI8A 2JCCE 4ELMA 3BH8B 3UZVB 2YS4A 4DK3A 3D39B 3RVTC 2GIYA 3FRPG 3TYFA 3O3DA 1JMZA 35C8L 2NLJB 4JFQA 1NL0H 2X4UB 2QSCL 1JHKL 5L8KB 5DYOA 2DLIA 2X1XR 1MCBA 1LE9A 3HMXH 4R4FH 4KKCD 4TRPH 3GMMB 2V5SA 1R3JA 3TNNB 5E4EB 4RNRB 4JM4H 4GRWH 3MREB 3QULB 3VWKB 1QRND 4JGMA 1M71A 2FO4A 3D25A 4HH9A 4U6XB 1UH2A 1I7TB 1OD7A 3ARDB 4FTVE 3HKFA 4H0HB 3LKSB 4KGLA 3QUZB 4JREB 2PYFB 3I3EA 2BSRB 1S5HA 1IAMA 3WXWL 1BD2D 2BNQA 4U0RB 2GQHA 1IZJA 5EU7C 4EI5B 5EOQL 1DLHA 5C0IA 3MGOB 4XVTL 5FM5M 3PABA 5SX4I 1OD9A 1QD0A 2P49B 5GGUA 2Q7NA 3QUXB 1XIWD 3I02B 1G7MB 1S9VA 1MNUH 1A1MB 5IVXF 3DSFL 5HHXL 2W60B 3LOWA 4OV5B 5HSFA 1DQQB 3GM8A 1NMBL 2BNRB 2HTLC 4H20L 3M8OH 2AV1B 2FWOB 1CGYA 2VH5H 3HZYA 3E3QE 5BVPL 5SWSE 1BF2A 4XP1L 4U3XA 3AUVA 4IOFD 3REVB 5D7KD 3GSWB 4ODUB 4J3SA 5T1DH 1ZGLB 3SJVB 3WKMH 2H3NB 3ZE2E 5HYQA 3JWDL 2R56H 2PR4L 4QOKD 1NFIB 5IHLB 2I9TA 3QIWB 1FSKB 3NCEB 1IT9H 3MJ9A 1YNTA 3QQ4A 4JN2B 3CLEL 1LP9F 3V6OA 3BSZL 4ZXBB 2R2BB 2QL1A 5EDXA 5IHUH 3UTPE 1F6AA 5EUOF 3O3EB 5DT1H 2NY5H 4NQDE 4QTIH 3VRIB 3ZTJH 1RHHA 4WW2B 5I0ZA 4QRTB 4RMTA 2E9WA 3L1OL 3WV0A 4D8PB 1Y6NR 1EFXA 2ED9A 1G1CA 3R06A 1P5VA 2ITDB 4LL9A 4M6OH 3RPIA 1A7OL 5A1AA 2ZJSL 3JSSA 5DJCB 1YJDC 3VGAB 4WCYH 4R0LB 3E0GA 4MA1B 2FLBT 3P30H 3BXNB 1CLOH 4NM4L 4OGXL 4L9DA 3VWJD 5E00B 3KYNB 3OKYA 4JO2H 1U92A 4LSQH 3BH9A 2H2PC 3ZLQC 1HXYA 2DRUA 1HYSD 3T2NH 5KSBA 2ZG3A 5CZXD 5I2IA 5F1KC 4H88H 1BLNA 2CUIA 2XTLA 1FZMA 3QRFM 4IRSC 4V1DA 3MOBL 2JB6B 4ZD3H 1KYOJ 3G5YA 2O5XL 4K94C 5KZCB 5E5MA 2R4RH 2JIXB 4DZBA 5FHBL 4U3CA 4OLWL 5DQJB 4OIIH 4OM0L 3O6LH 4UT7H 4K8RH 5IJKA 1H3PH 3C60D 2V7HB 5C0ND 3V79C 4P4KC 4U7MA 1C16B 3QG7H 2ADGA 2R8SL 2OK0H 3GSUA 1TNMA 5LQBH 5I76B 2ADIB 2QSTA 5D1ZB 5DURD 1AGEA 1T3FB 1Y6MR 5HHME 3D0LB 4UQ2A 2FL5A 1JZ2A 1WT5A 2RQ8A 1IAII 2LTQB 4O02H 2VDOL 3B2VH 1GGCL 3FB5B 2J5LB 3HMWH 4FZ8H 1C5DA 4L4JA 5IMLA 3GKWH 5HI3C 1JF1B 1OOAA 2XG5A 4GAGH 2IJ0C 4EJ1C 5I8OH 3SOBH 4CMHC 1KEMH 1OSPL 3C6LC 5HDLA 4R2GD 3E6FB 3BUYA 3VGHA 4RISH 2ICWA 1A2YA 3TV3H 3ZE1F 1OQOA 1P7QB 1RUML 3CCHA 4KUCF 2YZ8A 4UU9A 3DX9B 4HQQH 4PG9A 4NHUB 4NZRL 5T3XD 2R0KH 4G6JH 3DUUA 1AHWC 4MJIA 2DBLL 4KI1A 3BHBA 4KUZL 3EYUH 2NY4D 5FGCE 3REWB 3SGJA 3VXTA 3ROOA 2BOCB 5T33H 4LSPL 3U83A 5GSRB 3UTTD 4XX1E 3I6GA 1J1XH 4GRWB 1N3NB 3CUPA 3BGMB 1I1AA 4N5UA 4WW2F 4YLQT 3STLB 1KF9B 5E8EA 3OPZH 1WC7A 2V7NA 2AQ3A 4G9FA 3VFGH 2FJHA 3LN9A 3FT2A 4M1CC 2R1XB 1I9IH 5T1KB 1YC7A 1QFWL 4O5LL 5CMAA 3ZYOA 2NX5D 2GITA 4W81A 1KELH 2CLZB 5F7EL 3R1GL 2EYSB 5IMOB 3T1WA 2RR3A 3OKMB 1NCBH 5CEZH 1NSNL 3VFNA 4ETYA 1Z9OA 1H8OA 3OHXA 5FYLL 3PUCA 4FFWD 4NRYB 2GTWB 4C56E 1RFDL 2A9NH 2AXGB 3HNSH 1RZKL 3BW9A 1JE6A 1FL3A 2ARJA 5EA0H 5FHAH 2JJUA 4CVXA 4OKDA 3QRGL 3TCXA 3MGTA 4CDGC 1A1OA 4ZUUB 2OS7A 4LCIH 4F80A 4KXZH 3D2UD 3QSKB 1MAJA 1EERB 3SDCD 1LWRA 4N1HB 3U36A 1LD9B 1MFAL 4NCDA 3ZKND 5KAQG 1MHPL 3F7QA 1CIDA 4OF6A 1KN2H 3SBWC 5CWSB 2LQRA 5HGDA 2R2HB 1E27A 3QWRD 2X9WA 1T7VA 4LPTA 1Y18B 2B4CC 3NA9L 4HKBB 2VLKD 5I8KH 3QFDB 1WZ1L 1NCTA 4KVCL 2YPLD 4G6AD 3LVEA 1HI6B 3ET9F 4EN3C 8CGTA 1E28A 2A6DB 1NCAL 4XBPB 1K8IB 5HYJB 4ONOA 2F53D 4XP5L 1CFQA 5EBLA 4YUEL 3GKZA 1AQDA 3BP4A 3WFHB 1NJ9A 4QTHA 3PWVB 1X5AA 3WE6B 5F9DC 5FF6B 3CFEA 5E2VL 4ACPA 3HI6L 3VI3F 1GJIA 5C3TA 2ITCB 3MRMB 4OLZL 3C08H 3MRDB 3HAEA 3MROA 2D9CA 1A5FL 4GRMB 2VQUA 3WUWB 4GG6A 3L3KB 5C0AE 3UJJL 5DUML 4U7KA 5SWQA 3F7PC 3B8SA 4PP1C 2NCMA 3A0OA 3F7VA 3FQTA 5IB4A 3SE8L 4IRZL 4XHJC 1F11B 4N0UE 4YAQA 4ENEC 1P2CA 4PREB 4R7NB 5IHBA 4HMCA 1NPUA 1EUUA 1D5IL 1WCBA 3PJSA 1WWAX 4GQ9H 5I75C 1N5YL 2X89D 1UKQA 3PL6B 4XP4H 5F7DA 4OIAA 4JFFD 2D7NA 3ILPA 3RZCD 3IT8D 1Q0YH 2W1NA 4WO4B 4HGWA 1KNOA 1JWUB 2X10A 4WFHE 2OZ4A 1QFOA 3VGDA 3CVHA 4TNVK 2A0LD 4W4NA 5B21A 4OLEA 2BCKA 4ISVB 3QXWA 1BQHG 4OCYL 5E1AB 4M7LH 3D69A 4L9LB 4Y5XB 5D9SA 2MCPL 4U1IB 3EZ8A 4YDKL 4X6CE 1OTSD 3TVMC 3T3PF 4L29A 3S37L 3FQWB 2GJ6E 2QJDA 4YHKL 4NKOB 4MA3B 4CNIB 3DSNA 3FKUS 5F3BB 3ARTA 3QFJA 5I74B 4PRHA 4PJ5A 1OB1A 3HC0B 1C5BL 3WO4C 3BKYH 4RAVA 2ENSA 1YQVL 4JY6A 4QRPB 1UQSA 3MV9D 4DVRL 4S1DD 2XY2A 1AE6L 3MLZH 2XZAL 5L7XH 4Z0BH 3UBXI 3OX8A 4GMSL 4JO3L 4KKCC 1UVQA 5BXFA 3RWJB 3SE9H 4WUUB 3KPTA 4JPVL 5JW5A 1OW0C 2OTPA 2EDNA 3WUZA 3EYQD 3O4LA 4DKFH 3GSNA 4I0PD 5IK3A 4Y4FA 3MPCA 3MV8A 1P4BL 3G6JE 2EH7L 4LLUB 4RIRB 5FYJL 1ZHNB 4D3CL 1RULH 3V8CA 3QDJA 4LLMB 3FO9B 5CZVH 5IOPA 5K59E 1XR9A 5GRVL 4HUWB 2IBGA 3SCMB 4AEHH 2WQ8A 4HUVA 4CVZA 4R96A 3O11B 2C9AA 5FECA 1T03H 1M4KA 5IW1B 3CJJA 4LNRA 2HN7A 5SX5K 5MEOB 5C07A 4BKLB 3O81A 2YA1A 2C3GA 3V6FA 4OD3H 2QQQA 3WFZA 1XIWC 4U1JB 2F74A 2P24A 1K2DB 3SJVE 2AXHA 4XAKD 4WY7L 3RU8H 3LS5L 2IQ9H 5DK3A 3QG6B 1KB9J 1IGFL 2BNUB 4IOFC 1E4KC 2X1PA 4S2SA 1HDMA 1CL7L 4XVJL 1KC5H 3KLSA 1S7RA 4Z76B 3F12B 2AJXH 2KH2B 1Z3GL 1J0YA 2H26B 4U6VL 2Y1VA 4MQ7A 1FPTL 3GMPB 3DMMD 1L0YA 1MJ8L 5MI0B 3SDXB 4TPRH 2HJFB 1CD1A 2BY3A 4HD9A 4RGMB 4OQTA 4PJCF 5HGGS 3GIVB 1AGCA 5C9JB 4K3EH 1S5IH 2VISA 2H32H 5F7WC 1GZQB 4DN4H 2PTUA 1G84A 1CDCA 4NQEE 4KHXL 5CCKL 2ED7A 3MOAL 3D3VA 4Z7VA 4R90L 3ZYIA 5ILTL 1TTFA 5I1AB 2G75B 1Q8MA 4QF1A 4ZFGL 1KTLA 2H8PA 4JZJC 5F6IB 1U41A 4JFHE 2NNAA 4MD0B 2AEIT 1YEJL 3HZMB 1OAUH 3VWJC 1S3KH 1EJOL 1HYSC 1BZ7A 5CZXC 1DANU 1Q9KB 3G5XB 1FO0B 3PHOA 1WBXB 4HCRA 4KTDL 4F58H 5MHSE 4JRYA 5IM7A 1LO5A 5E03A 4F7EA 3ARRA 5GS0H 4Q7DA 3H9SB 4M1DL 3IKKA 3VFVB 1CFVL 2ZKHH 4QXUH 4APQB 1OGAA 3PHSA 4XGZA 2F5BL 1KCSH 2OI9B 5FB8A 4DKEL 1P4IL 3UYOD 3LRSA 2J6EA 2JJWA 4Q6IC 4DUXA 3ULUD 1P1ZB 3DBXA 2KZ1B 1KBGL 2RCSH 3C60C 3QIBD 1H8NA 5C0NC 3GHBL 1FZKA 5JPMB 4HEME 3RA7L 1QFUL 3CNKA 4JHWH 2Y36L 1PKQB 3WFEH 3C2SA 1QSEA 5F9AC 1MAMH 3HFML 5A2FA 2QQKL 4JDTL 4OF3A 3SO3C 3CZFB 3HLAA 3CFIC 4MLIA 1ZVSB 4YHPB 4WHYH 5C0EB 1MCEA 4NWUL 2GEEA 4LOUD 3NGBB 1RY7B 4DGIL 1HILB 5C7XH 3IAPA 3MLSL 2FEEL 2X4QA 3MA9L 4DOHE 3T0BA 2YK1H 3EDDA 4LHUB 1JK8A 1G0DA 4KKLD 3MRQB 4LQFL 1MCQA 4PB0L 4R2GC 1S7XB 1NMCC 2PYEA 2D31A 1RK0A 1RZ7H 1VFAB 3PQYD 2NY0B 5DEGB 3BRFA 1KCUL 2NXZD 5CGTA 4LSSL 4GRWE 5FCSH 3P73B 4U7SA 1ZE3C 3MRHA 3MUHL 3WSQH 3QI9B 2ZWLT 4OM1L 3LAFA 3GHEH 2Z4QA 4Y4KA 4TSCL 1EAJA 1HE7A 4YHLH 1TITA 2D7PA 2EDLA 3TBVA 2D7QA 2IEPA 4YHYC 4PJIB 3B83A 3FOLB 2A6KB 4GMTL 4N0CD 2QKIA 3RVXD 5CFHA 1T80A 2VN7A 4LPCA 1FZOA 5F1IA 3BIBX 3L3OB 5GS2D 2AQ1A 2HT3D 5FKAA 2IAMA 1VACA 3KXFA 2COQA 4HIEA 1LEIB 5KS9F 1CDGA 3THML 4NQVA 1OF2A 3U9UB 1E4XL 5BZWB 3TO4B 1JPFB 4NO5B 1CK0H 4U6TA 2R0ZH 3R0MA 2HKFH 3QIUD 2B1AH 5I73C 1WICA 4PJFE 4YIQA 5C09A 2IANB 2XTJB 4OZFH 2DM7A 4FFWC 3OR7B 5FA3B 3VD4A 5D1QB 1D6EB 3IKCB 3OB8A 4X4MA 1NGQH 4G8GB 4IDJL 4HK3N 3QPXL 1CDJA 5C8JA 2OR8A 2FYYB 4FQQB 3SDCC 1RD6A 3O41B 3SN6N 3AGVA 3BT2H 5F1NB 2FIKA 3TPUA 4UAOC 4JJHA 5SV4A 3MLPA 2OSLA 1UACH 5ESVA 5HYJE 2H32B 5DTFB 3FMGH 3ES6B 3IJYB 3OXSB 2DQJH 2Z91A 4CU6A 1G6RL 1U8LB 3FFCE 2DJUA 4G6AC 4IOIB 4J8RA 5D2NC 3SKOB 4GS7C 4UV7H 4KJYB 1FNHA 1T04B 5ICYB 3OKDB 4LDEB 2Y23A 1AO7A 2Y4SA 3P3YA 4UNUA 3DGGA 3NCJH 1CLZH 3VGFA 1QLEH 4Z0XA 2GSGA 1RZJC 3WHE1 5JQHC 1BP3B 5ADOH 1SYVB 3LQAH 4P3WA 4IBLT 3PDDA 1YEIH 5DVLA 1I1CA 3PXHA 5I15H 1KENH 5I8EB 1LILA 1WFNA 5KSAB 5JHDA 5GSVB 4HUUB 4MCZB 4YK4B 1U93B 4XVUD 1UM4L 1IGIH 2BSSA 2WV3A 5EBWB 4PGBA 5EBMA 5J8OA 4WTWA 1EO7A 5CJOH 1J0HA 1HXMB 4G7VL 5ANMB 3QEQD 3WL9A 2F9BT 2VDML 5TQ0H 4NN6B 1FVDB 1Z5LA 1Y0LA 1INQA 5DEFB 4JG0H 1T1XA 4FQXD 4TQEL 4BYHA 5I1DB 2DTML 2F5AH 2QBWA 3RZCC 2F58H 4HHAA 1MCOH 4JPIB 3BKJL 4BFEA 1U8PB 1KIRB 5CSZA 4XCEA 1VPOL 4YDLC 3RBSA 2YPVH 2KKQA 1UXSA 1DQJA 3ZDXE 4JDVA 2YZ1A 2UWEE 4UNTA 5EN2B 5FO8B 1R5WA 4JLRB 5BRZA 3LZFL 4CBPA 3IDJB 1G7JB 2VUOA 2I60H 3Q0HA 4F57L 1OTSC 1A7PL 1F45A 3P0VH 4IRSA 2CLVA 2YA0A 4QRPE 2XWJA 1FBIL 2DLTA 1KB5L 3OF6D 3VG0H 3TYFB 2DLFH 1E4WL 3O3DB 1S7SA 1G9NC 1HZHH 1JPSH 3CSYA 5SX5H 1H3VA 1QFHA 3GJEA 2WBJC 4UINL 4EBQL 4UZGA 5TPWH 4WUUE 3V4UL 5DYOB 4OLUL 4S1DC 4QRRE 5DMKA 3BEVA 3FT4A 4P4KA 4MB5A 1F90L 3T4AA 1LE9B 4OFYD 3D39D 5BS0A 1NC4A 1R3JB 4ZTPH 3EYQC 3PGDA 1NAMA 4I0PC 4JN1H 5E2WH 3EYFA 1DP0A 4KWUA 5HDBF 3HC3L 3NABH 1Q72H 4MGXA 5J3HD 3PF2A 1VSCA 5GGRY 5JHLL 1M71B 4JRXD 3D25B 4K7FA 4HH9B 1BECA 4HK3J 4ONFH 4Z7UE 4EXPX 2B2XL 2MKLC 4XBGA 3QR2A 3C6LA 3X3FH 5F7HA 7FABH 1G9ML 2X05A 2VXTL 4WUKL 1SY6A 3U82B 4JHZA 2BNQB 4PV8A 3VWKD 2CRMA 5C0IB 3SDAC 1QHOA 4OZFB 3PABB 4ZS7L 2KBGA 4E41D 1RJZA 4TTGA 3E6HA 2EDJA 2Q1EA 4F8TA 1S9VB 3BZFA 1AHWA 1OP3K 4X98B 4OGAD 4LKCA 4LKXA 4Z18A 5L0QC 4P99A 3HNTH 3HZYB 3V5DA 3SDXE 5DF0A 5C71A 3IDIA 2DL9A 4P2OB 4CW1A 5ALCH 1MIEL 2AGJH 4NJ9H 5HYQB 2XYCA 1HINL 1MF2L 1IM9A 3QUXD 3DMMC 4W4OA 4FABH 2XKNA 2GYSA 5K9JH 2I9TB 3GSRA 3WLWD 3D85B 4Y0GA 4QWWD 5E2UL 4DCQA 5GGTA 3OZ9L 5DMIH 1YNTB 3QQ4B 3WIFA 1QNZL 3VD7A 3BPLB 4ODSL 1R3HB 2DICA 3IGAA 5SWZD 4X9GA 5D2LE 4YZFE 4LPXA 1F6AB 2LFGA 4KUCD 3KJ6L 1KEGH 4RX4A 4WJ5A 4XNYL 5L2KE 1DEDA 1RHHB 3BPCA 1SBSL 4KKNA 4JFOA 4N0YH 3FQRA 5ERWA 3R06B 4XMPH 3RPIB 3TBYA 4CVWA 1SMAA 5FXCH 3OG4B 1BGXL 12E8L 3ULVL 2ZUWA 1YQ2A 4XC1L 4L8CA 4BSVA 2PO6D 4WU7A 3ALWA 4B53A 3JVGC 5E9DD 5I30H 2P42B 4C4KO 1U92B 3BH9B 1HXYB 2WLYA 2EYRB 3OTTA 5I2IB 1U0QA 1BLNB 3I2CH 1IARB 3PDGA 2R29L 5BVJA 1FZMB 3HAEH 3SBWA 1QOKA 2EIEA 4M9PA 4P2QA 3G5YB 4AEIL 4J4PD 1MFDH 5E5MB 2E27L 1N6VA 5GRZA 2VLJE 1CXHA 3LD8C 1CF8H 5I1IL 1PKQE 1TQCB 2C3HA 5GRWA 3ULUC 1AD0A 1QBML 1MLCB 2EDOA 3QIBC 3DO7A 1T2QL 4EN3A 1FNEA 4G8IB 4PD4K 3O4OC 1QZ1A 2ADGB 2O5ZH 4KV5E 4LRNH 1RVFH 4FQ2L 4O58H 3C2AH 1AGEB 2ESVB 2JIXD 2OZ4H 4I2XA 1A9BB 3KYMA 4X0KA 2DTSA 2WUCH 3X3GL 3CVHH 3K1DA 3WDJA 3ESUF 4LOUC 4HWNA 5IFAH 5E8DL 1ZVYA 4PJXA 1PFCA 2D7MA 4O2FB 1C5DB 5KVFH 4KKLC 5F96H 3TWCH 5F9JA 1BJ8A 1J9CT 3RAJL 2XFXA 5GJSH 4HBCH 2DMBA 3BUYB 5DJZA 2ICWB 1A2YB 1OLZA 2YN5A 4U0QB 3CCHB 4UU9B 5EU5A 1CU4L 2NXZC 4PJIE 5JIIA 2BRRH 4TVSa 2VDLL 3QXTA 3KPSD 1HQ4A 3V0VA 4MJIB 3MRPA 2LE9A 1JYVA 3FO2B 5DC4B 4NNYA 3UO1L 4OSUH 1L6XA 4N0CC 4ZG1A 2FBOJ 3I6GB 4EUPG 4M62H 2VXQL 5CP3A 1KG0A 5TGBA 4HPYH 3CUPB 4M6AA 4HIJA 4ODVL 3MLTB 3TBSB 5DJAA 1I1AB 1CDUA 2CK0H 3MACH 5E8EB 3SKMA 2HT3C 5HYSB 5AZEL 3VRJA 4G9FB 3FCTA 1P84K 4I9WD 5J1SC 2V9RA 3FT2B 2C3XA 3O2DL 4MDJA 1LQSR 2IANE 3LHPL 4UIKL 3NZHL 5CMAB 1T5XA 4TSAH 4RWYL 3P77A 1INEL 2PXYD 5D4QA 3MLYH 1ZA6B 3QIUC 4OZ4A 5FGBC 4KMLB 4G8GE 4UT6H 4Q9BA 4ZOAA 3KYKH 3VFNB 1K4CA 1F4WH 4JKMA 3QJHA 5TDNA 1A6TA 2Q3ZA 3OHXB 2ATPA 1N0XH 5BMFH 5D96B 4E5XA 1ZA3A 3BW9B 43C9A 2FNBA 1FL3B 1PQZA 2ARJB 4PJHA 3FONA 2HT4C 1BAFL 3MGTB 3LV3A 3UEZA 1A1OB 1OW0A 2DLGA 4H0IA 2QADB 3CXHJ 4PJBF 1UJ3B 3EGSA 2YEZB 1RUAH 1ES0A 1QRNA 1F4YL 3U36B 3K81A 1G9EA 1SJEA 4YBHA 3U1SL 5GJTH 2AI0H 2HA1A 5HGDB 3W0WE 1XF1A 1E27B 1WZKA 4HS3A 5T5NF 5J13B 3NFSL 2MHAA 1VCAA 4OQTH 1MLBA 4ZUVA 2YXMA 1BD2A 2SEBA 5C92A 3U4EA 3QP3A 1KPRA 1E28B 1ED3A 1BEYL 2BC4A 1Z9LA 1ZGLP 3KPQB 1XIWA 1UA6H 2EICA 1CFQB 5D93B 1AQDB 2CMRH 3BP4B 5DUPL 4PJEE 1NJ9B 4PS4L 4QTHB 4FQLL 3U46A 1CE6B 1OAZL 2X4SA 3DYMA 4ZUTA 3UAJD 5DHXB 3TN0D 1T21A 3MCLL 4X4ZA 4EI6A 3BJLA 1E4KA 1CD0A 4Q0XL 2B0SL 5D72H 1YDPA 1A3RL 3QNYB 1FNGA 3HAEB 3MROB 5DD3H 4EDWH 4GG6B 4POZD 4XVUC 4JZNA 4QOKA 2EXWD 4HCRH 3EFFA 3F7VB 2E7HA 3FQTB 3SQBA 1IKFH 3P9MA 5IB4B 1J8HD 1FCGA 1IILE 2A9MH 3EO9L 4YAQB 1P2CB 1ZLWK 3RNKA 1T4KB 2AJSH 5J6HA 3ULSA 1NLBH 1WCBB 5J56B 5H94A 2E5EA 4LCWE 1A7NL 2WQRA 5F7DB 3SGKC 1MIML 2IG2L 4GAYB 3ILPB 4HT1L 1IC1A 4K7PX 3QCUH 1KNOB 5CZKA 1RK1A 3MRFA 2P8PA 1HNFA 1K3IA 3CVHB 4JZJA 3TCLA 3T0ED 1H3GA 4Y8AA 2KUTA 4ELME 5BOPA 2YA2A 3VWJA 3CPLA 1Q0XL 5IBUB 3D69B 5D9SB 2DQIH 4X6FA 4HWBA 3LIZL 2D4DA 4HMDA 5D70H 4L29B 5D7IA 1I3UA 4ZS6D 5JQ6H 3GSOA 1AGDA 5A2LH 4EVNA 1KCVL 3U4BH 3QFJB 1FYTD 4QNPE 4PRHB 1V3MA 4PJ5B 1OB1B 5FYJU 4H25A 4HKZA 1A14L 4BZ1H 4Z5RA 1HQRA 4Q6IA 4RAVB 3WFBL 4N0RA 1OAKL 2W65A 4JY6B 1YN6A 3C60A 2NW3B 5I1EH 3B9KD 1OP3H 1WAAE 3VFTB 3IDYC 1TJHL 1AH1A 1UWEL 5SV3A 4BH7A 5K9QG 2FJFA 4RWHA 4X83A 4YHOH 3UDWC 1UVQB 1RHFA 2VDRL 1A1NA 5LG1A 3N1GC 1MQKH 4E42A 5JW5B 4K3GA 4I3RH 2BDNH 3O4LB 4H8WC 1FGNH 3OQ3B 1T5WA 1WF5A 5IK3B 4Y4FB 1TCRA 4NZJA 5J3HC 2LV4A 2BNQE 4PGCA 3PWPE 5ISZD 1FHGA 3QDJB 3UPAA 5HBBA 3QXAA 5IOPB 1V7NL 2FSEB 1XR9B 1YMMD 1CGWA 3L5XH 4HUVB 4CVZB 4R96B 4JJ5A 4B7IA 5FECB 4LNRB 2HN7B 4JFDE 5C07B 3I6LD 4HWUA 4OTXL 4GG6F 3V6FB 2APVA 4OZGB 2F74B 3CMGA 5ACZA 2R1YA 2P24B 3QISA 3K46A 3QDGD 5DRXB 1CG9B 3CH1A 4OGAC 5DI8A 3EDJA 4WI3A 1U8JA 2Q6WA 3UTTA 2P45B 5ACLA 5CEZD 2D2OA 1FFPA 3S34H 2GCYB 4X5XA 1S7RB 3W2DL 4MA8H 1PBYA 3QUXC 3V6OE 1WTLA 4MQ7B 2E6QA 2BOBA 3DTXB 1Z6JT 2NXYD 3WLWC 1CD1B 4QWWC 4FP8L 4QXGH 1JTPA 3DJ9A 3EYOA 4FQJL 1AXIB 2LVCA 3QAZB 1AGCB 2HG5B 2NX5A 2VISB 4JY4A 1TPXC 3MLVL 2OM5A 1YC8A 3UJIH 5LWYH 2Q8BL 4FNLH 1U8MA 1MCWM 2GY7B 3OKKA 3D3VB 2CO7B 4H1LG 3UYRL 1SQ2N 5L88L 5KSBE 1KTLB 2PO6C 2H8PB 4DVBA 3WYRA 3O8XC 4YH6A 4PJAA 2NNAB 4YXKH 5JUEH 4V1DE 3U9PL 1ZSDA 3ZSTA 1XGQA 3GJFA 4M00A 1OARL 3D2UA 4FZEL 2P7TA 3U30B 1BZ7B 1EXUA 3SDCA 3ZYJA 5CKAA 3PHOB 4ODHH 4JRYB 3ZTNL 5IM7B 1LO5B 4F7EB 4Z78A 4UI2A 4WNQA 2WWKT 4J4PC 1S7TA 3QWRA 5EFIA 1T1YA 1OGAB 3LMJH 2VLKA 2WUBH 4XGZB 2Z35A 1G6VK 3LEXA 4HIIA 3ARED 5JNYA 3KHOA 1T1ZA 2ADFL 2YPLA 1FVCA 1X4XA 3MC0A 5D2NA 3LRSB 3FQUA 2GT9A 3DBXB 1FDLH 5I1GH 4R26H 2J1KA 2F53A 2IGFL 4PJGF 2R1WA 1U6AL 4UIMA 3P4NB 1CCZA 4XWGL 3CAFA 5E2JA 3H9SD 1OVZA 1QSEB 1PLGL 2JTDA 3ZSSA 4RMWA 2B8OT 2DQHH 3ZT7A 3HLAB 5D71L 5BO1H 4LEXH 3CFDA 2HLAA 3MX0A 3STZB 1YJDH 4OZGF 3EHBD 3Q6GL 4OCRL 4ZFOB 4UTBH 1FQ9C 4JB9H 1DBBH 1YPZA 3CC5A 1CI5A 3DETD 1NH6A 5J9PA 3K2MC 4NO0D 1YY8A 1BM3L 1MEXH 2PYEB 3HE6B 4M1GH 5HGAA 2D31B 4LFHD 4OB5L 1T7XA 4GSDH 4LLVA 4NNPL 4HKXA 4K94H 2I9LA 4NUGL 4XMLH 2X89A 3MRHB 3IXAA 4HZAA 4JFFA 4X7FC 4HJJH 1OLLA 3QEGH 3RZCA 5LAXB 2Z4QB 4Y4KB 3GSXB 5IQ7H 2OL3A 1GAFL 4G9FE 1SEQH 5L9DH 5GGSY 4BZ2L 2MPAH 1IZKA 3BX7C 5IQ9A 5I1HH 3QNZA 5GZND 4P4RA 3CD4A 1TDQA 4J6RH 2FBJH 4KPHH 1NAMH 3C9NA 4Q2ZA 3PIQA 2I27N 5FV1L 5FKAB 2IAMB 4MJ5A 1VACB 3KXFB 1BZQK 1DBML 2AXFA 2R69L 3P11H 2CDFB 4J3VA 2DQDH 4HIEB 4WENB 2EH8H 3CK0L 4G9DB 4NQVB 1OF2B 4HUKB 3PGFL 4PJFF 5ADPH 2PXYC 4JANA 3I75A 4XX1G 3VG9C 3ZDYF 1NAKL 5D1XB 4LDOB 5E6ZA 1F58H 3ZHDA 3U6RA 4YIQB 5C09B 1SY6H 2WBJA 4IMLA 4Z7NE 4UUJA 1WZLA 3MV9A 4NHCL 3SDDD 3X14A 4LBEA 4OCXH 4JCLA 3K7UA 3F7YA 3JV6B 2OTUA 2E7LC 2RHEA 4MAYD 1I3GH 2KQNA 4X4XB 3NH7L 4I0PA 4I3SL 5C8JB 2C1OA 3DVFA 3T77A 3LDBC 2FIKB 1CVSC 4M5YL 3TPUB 2XTJD 1B4JH 4HC1L 2H1PH 1VFUA 2AJVL 3NA4A 3GI9H 4MSWA 4J23A 4W6WB 3U0WH 2MOVA 3A6OA 5ESVB 4RZCA 1OP9A 1F8TL 1KJ2A 3DYPA 5D5MA 4CVUA 3N50A 5GGTH 4J8RB 5FYKL 1ZLWH 2PN5A 4ETQB 4FXGA 1QVOB 4PRPD 4BK4A 1S9WA 4Q9RL 3F6LA 2FD6H 4D94A 1AO7B 3DGGB 2YKLL 4OCWL 1Q9WA 4Z0XB 1WBYB 2QQNH 1EIBA 1LDPL 1PJ9A 3IJHA 2ZG2A 3UAJC 3TN0C 2D3VA 1J0IA 5BV7C 4RAHA 2WW8A 2R0LL 4U1KB 1I3VA 5FGRA 5JHDB 4POZC 2EXWC 3DMMA 2YBRA 1JNNL 3O2WL 5EBMB 2IBZY 5FOJA 3WD5H 5C08D 3GMQA 3GMOA 3GO1H 1HH9A 1TENA 4NWTL 1PEWA 3WL9B 4R97C 3JV5A 5A40E 3G9AB 1LO3L 4S0SD 1UGNA 1Z5LB 2Z8RA 1Y0LB 1INQB 3C5SA 4LCYA 5KSAD 4M6ML 5CEXA 1T1XB 2FATH 3ALXA 1F3JA 1AFVH 3QEHA 2YUZA 4KQ4L 1I9JH 1AJ7L 2VR5A 3CFKA 5SWSD 4B0MM 4U1GC 4XCEB 1H0DB 4NKQB 1UXSB 1DQJB 4PJ7A 3RHWK 4JDVB 3T0EC 2AEQL 1NQBA 1R5WB 4H1LA 5BRZB 3UC0H 3D5OF 5F8QC 3D1MC 1NCDL 3QFJE 5C2BH 5J06A 4AZ8A 3DARA 2VR4A 3V5KB 4P2YA 1N7MH 1QFPA 1NUGA 4ZS6C 3GEWB 4KMTL 1A0QL 5FO7A 1VGEL 2XWJB 3VJ6A 2XZCL 5HYIA 3UTPD 3TC9A 4N68A 1NBVL 1S7SB 3IFNL 4PJ9C 3CSYB 4EEEA 2HFTA 1J1PL 3GJEB 2ZG1A 2DD8H 3N9GH 1HK6A 4HIXH 4MA7L 1LGVA 2Y25A 3QIBA 4OT1L 4DGYH 3R4DA 1U8HA 2P5ED 3B9KC 4GAFB 2EDXA 4LDLB 5DMKB 4S0TD 3BEVB 3TJEH 1XH3B 2HRPH 4P4KB 3MV8E 4YX2H 1F4AA 2AVGA 3T4AB 3V95A 3WBDA 3ZT5A 2PTVA 3MRCB 1AGBB 1TQBB 1XF3A 3RY4A 1OPGL 3WFDL 4MXQD 5BS0B 1EAPA 1NC4B 3QDJE 2OCFD 1LO0H 4D2NA 3PGDB 1NAMB 5C0BD 4X4YB 2X7LA 3EYFB 1INDL 1B4RA 5CP3H 4N9GA 2G9HA 2QSQA 3MNZA 1KN4L 4LSTL 4K7FB 4P0DA 3S9DB 3JBG7 5C07E 1ZWIA 2B1HH 4TSBH 1IL1A 4PRNB 3WXVH 4CMHB 3BVNA 1KUMA 4XBGB 2FGZA 3C6LB 3RWGB 2VKXA 1A6PA 3TO2B 1MCJA 5FKPA 3NTCL 4AIZA 3HE7D 4PV8B 3PQYA 1OAXH 1MCPL 1ACZA 3TNMA 4Z7WF 3BZFB 1AHWB 1FORL 2DLHA 3L3IB 4LPVA 2WIIA 3U79A 4L1HA 35C8H 2FX8H 4LKCB 3BWAA 4LKXB 2IBBA 1DTUA 1MWAA 1H3UA 4XC3H 1VDGA 2QSCH 4QHNB 3V5DB 1JGEA 2O5YL 3MRRA 4C59B 3T65B 1SJHA 5KSVA 4CW1B 4UDTA 1A3LH 2JJVA 5L6YL 4OFVA 5BQ7A 1BREA 1IM9B 3FOMA 4FOMA 1NDMA 3UTOA 3LPGA 5J11C 2NXYC 3GSRB 4ELKA 5B39B 4PLJD 1MY7A 4ZPTA 4L3CA 2OMNA 1OL0A 2P46B 3WIFB 3VH8A 3D3VE 1UM5L 4Z7VE 5IFJA 3SKNA 3IGAB 4P2OD 1ZTXH 3ARSA 4WFFE 3QIUA 1X5LA 5JW4R 5FGBA 2Q86A 1C5CL 1WTGT 4GFTB 4WJ5B 3S36L 3WN5C 5FUZL 3MFFA 2CKBL 1NFDA 3BPCB 4JFOB 3NCFB 3FQRB 5ERWB 2Q7YB 3WXWH 3D85D 2Z8SA 1H5BC 4BQCA 43CAA 4L8CB 4BSVB 3X11A 4WU7B 1OM3L 2F8OA 4R4BA 1N0LA 1HWGB 3TT3L 3BDYL 5IFHL 4XNUL 4NNXA 4WI6A 3JTTA 1SM3L 1YEKL 1NMBH 3HZKA 3U0TA 2BJML 4H20H 3FO0L 1ETZA 4XPAL 3MQIA 4X99B 5BVPH 5BVJB 4XP1H 2ZCLL 5CBEB 4P2QB 1BVKB 1ZANL 3AU1B 1KJ3H 1IE5A 1X9QA 3DNKA 4PUBL 2FB4L 2IC2A 3AREC 4M3JA 4D0BA 4HAFA 1AD0B 1G6RA 1WZMA 1LK2A 4C55A 4EN3B 1FNEB 1GL4B 5GRVK 3BD4A 1CXFA 1CDBA 3OV6A 2ATKA 1ADQL 1IQWH 5TE4L 3WJLC 1EEZA 1PG7L 2VLRD 3BE1L 4I2XB 4DUVA 4YDJA 2E9BA 2BHYA 1K6QH 1VFMA 3L1OH 4ERSH 1NEUA 3EHBC 3S8WA 4KQ3L 4PB9H 3WFCH 4NRXA 4ZFZA 2PYEE 3H8NA 2HH0L 4XPFL 2ZJSH 1S7QA 3DI2B 5F9JB 3DETC 1CR9L 3CLFH 2XFXB 4NM4H 4OGXH 4HWBH 2ESVD 3RGVD 5DJZB 1U8IB 3KAAA 2A6IB 1TXKA 3QEQA 2CRIA 5CD3B 2GK0A 3NGBC 1ZT7A 3O6FB 3MOBH 3BD5A 5CGMA 4RFOL 3VE0A 5I75B 1HQ4B 4FQXA 2VDKH 3SGKA 3V0VB 2PKDA 4DTGH 1F4XH 1FLTX 4AQOA 3MR9A 4X5LA 5DD6A 4QRUA 5JZ7D 5FHBH 1IQDB 4NNYB 4OLWH 5ESAB 4OM0H 3EDEA 1ZHBA 3LKQB 3KXFE 1YUHA 2OJZH 5CINL 1GIGH 1KG0B 4BJLA 5TGBB 3FO1A 5GZNC 1PX4A 2VE6A 3EOBA 1LK3H 3SE3C 2R8SH 1XGYL 5DJAB 5EZLA 3HB3D 3V4PL 3SKMB 4HDIA 3VRJB 1KPVA 4MJID