5JUEH

Crystal structure of uic2 fab
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
225
structure length
225
Chain Sequence
b'EVQLQESGPELVKTGASVKISCKASGYSFSNYYIHWVKQSHGKSLEWIGFISCYNGATFYNQKFKGKATFTVDNSSSTAYMKFNSLTFEDSAVYYCARLPIQFGNFYPMDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords light chain of UIC2 Fab
publication title Crystal structure of the antigen-binding fragment of a monoclonal antibody specific for the multidrug-resistance-linked ABC transporter human P-glycoprotein.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 43
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2016-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jueH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5jueH02
1P7QA 3KLAB 3W9DA 4JPIA 4Z7QE 5J13B 4MXWL 4WU7A 4FFWD 1U8KA 3FN0H 5KVGH 5CUSH 5HGDB 4NZRL 1S3KH 5DJ2A 4N1EA 4NRZB 3P0VH 4Q9RL 1KC5L 4YPJA 5AEAA 2EXYC 2FWOB 5IJVA 4F9PC 2JJUA 1K6QL 2HKFH 2XN9A 4OGXH 4JFFE 3EHBD 4LSVL 3REWB 2O5ZH 1RK0A 3VGHA 3C09C 3V5KB 3L5WA 4JB9L 4CADB 1FPTH 3C6LA 3CFDA 1R3KA 4ODBD 4EKXA 5IP4A 2VLME 2YD9A 4WGWB 5CINH 3CD4A 2EH8H 3DX9B 3UYRH 3PWVA 1RK1A 5GRVL 5D1ZC 4N0UA 1ZKAA 3CVIL 4KPHH 4PRHA 4XWOD 3O4LD 3B2UD 1QD0A 1Q9LB 3WFEL 4N8VG 4PRIE 1TETH 1RJYB 4KY1L 1TQBC 2AJZB 4X7FC 3KPSB 5DRXA 1TENA 4XAKE 3RWHB 3A6CL 3WMSA 4ZS7L 3FN9A 4WDIA 4YX2H 1EFXD 3F7PC 4UILL 4DTGL 3FFCD 4IMLA 5FFLA 2DQIL 3QNZB 4OGAD 5FA3A 5A16B 5I0DA 3QNXA 1F6FB 5IEHA 3PQYD 3H3PH 4F7MA 4M1CC 4HK3J 4EEEA 1EFXB 1ZANH 4MCZA 2VO5A 5ANMA 3T4AB 1QRNB 3FFCB 1FL6A 1UQSB 1I9RL 1YPZB 2FHFA 3EOAA 4Z7WB 5CZVL 3GMOB 3BDBA 1YPZF 2YC1A 3PQYB 4HPOL 1N6QH 2CKBH 3O4OB 3P2TA 4UU9A 3KPRE 2FEDD 3CUPA 1MRCL 2C7UB 2OR9L 3TNMB 5F7LB 1GZQA 3HE7C 3QDMD 5I1AB 2A6JA 2XY1A 4OM0H 3O45B 4LLDB 4LSSH 4O2EB 1XGQA 2EYRA 5CCKL 3V6BR 4PGDB 2WP3T 2XTJC 5I19H 1AR1C 4MA3A 1J87A 3OKYA 3V6FB 2I5YH 4PUBL 4XMKL 4ELME 5FKPB 4LVOB 3EYQC 1PZ5B 2VLRB 4XCEB 4CDHA 2Q3ZA 1KELL 4P3DB 3CNKA 4UUJA 5DC0A 4RA3A 3ZYJA 4UI2A 2PO6A 4D8PB 5DWUH 5CS7A 4JREC 2Z0BA 2NX5A 1A7OL 5I8CB 3QFJD 2X4TB 4QCIB 3NZHL 4OJFH 5A2LH 2YUWA 1H9VA 4ZDHA 5E7FA 1QA9A 3PXHA 1DBBH 4WU5B 4PR5A 5B4MD 2QHLA 4JLRB 2NW2A 2PTTA 4ZQKB 5HGBB 2ICCA 3ARVA 2H9GB 1KG0A 2DQFA 5CGTA 3QFJB 4N0CC 4F7EB 4WY7L 1AGEB 1B0RB 1JZ2A 3UJTL 5HYQB 4KRPC 1DBAL 3QPQC 3HNTL 3N0PB 5GGQH 1PX3A 3JVGA 1CU4L 3HMXL 1X4XA 5J7CC 1ERNA 1YEJH 3W9EA 3CZFB 4HUVA 1II4E 2XWBA 3QXAB 4TNVF 1TZHB 4HKJA 2CLVA 5HI5C 1AC6A 3M17A 3MCLL 3C5JA 4OKVB 4OFKA 1T21A 1WVZA 3FCTB 1CR9L 2GJ6D 3K3QA 2CK0L 2PXYB 4OUOA 3SDCD 5MENA 4CVXB 2X1WL 2R2CA 1D7FA 2YSSB 5D8JH 3QWRA 1A7NL 4NN6C 2BCKB 3MJ7B 3RY6A 4HH8A 4JPIB 3W9DB 4K8RL 4JM4L 5IFHH 3DIFB 2QADD 3LRGA 4AEHH 3RQ3A 1OWWA 3WDJA 3MZGB 3UTSB 5C0EA 4I8DA 4DGIH 5H94A 5IB3B 4I77L 1N5YL 1JHKH 2DQCL 3DETD 4UBDC 5DJ2B 1UACH 2A74A 1JF6A 5IJVB 4PGEA 1LO0L 1BZ9A 4XBGA 2EICA 3SGKC 5IESL 5D7KD 1HI6A 1HCVA 2WBWB 3MJ9A 1I9IL 4I3RH 2A2QT 1QQDB 4PJFA 4RNRA 3L5WB 1FYTA 4MJ5B 2AK1L 3RVVC 1GRWA 4ONHB 3IDMB 4LCYB 1A1NA 5GGVY 5AWNH 4U7MA 2C4FU 2XQBL 1JBJA 5CZKA 3H0TA 2IPUG 3KHQA 2BSTA 5DYOB 4MAYB 4OFVA 5GISH 5FGBC 3UTZA 1XCTB 2MCPL 2BVQB 4LPUA 4XH2A 4DVRH 2AP2A 1S7XB 3SCMA 3JTTA 3P9LA 3E8UH 2D7MA 1MFEH 1KPUB 2A83B 3LSOB 1U3YA 2V9TA 5EOCH 3MV8A 1KTDA 1T0NA 4L3EE 3P0YL 1SJEB 4IMLB 1MF2L 1BIHA 1F11A 2Z91A 2WINA 3O6FB 2R0LL 3QNXB 5J1AA 3BFOA 4HUMB 1CL7L 5K9KB 4F7MB 2VZ1A 2VQUA 3DO7A 4NQDD 5EA0L 3NIDF 4Y4HA 2FB4H 4CNIB 1G7QA 4LF3A 1WF5A 1FLRL 3S35H 4Q0XL 4KJPD 4K23H 1AQDA 3GO1H 5FV1L 4E42A 2YC1B 5CJXA 2NW3A 1PZUB 2HWZH 4KUCF 5HYJE 3F62A 1NAML 1ZVSA 1ZA3A 2NMSA 2WBJA 4QOKE 3UBXA 3FT3B 2AJ3B 2A6JB 1UKQA 1K8DA 3C60D 1T4KA 2OR7A 5GS2D 5GS0C 5JOFA 3KVQA 3QO1A 1N7MH 3GHEH 2EYRB 3VFNA 1NDGB 1YEEL 4JHAL 4TRPL 4WTZA 4LCCC 3V0WH 2IQ9H 3LD8C 2GI7A 2PW1A 4MA3B 1XIWB 5DGRA 1FNHA 4S1QH 5J6HA 4MA1B 1MCWM 1PG7H 5GJSL 4LAQH 3NCJL 4PJ7A 2D9QB 2ENYA 4EDWH 1RZIB 1WAAE 3BSZH 4WCYH 2JJTC 3W82A 1LEGB 3GSUA 3QXDB 3A67H 2OBGA 4DZBA 3O3BA 3NMEA 4OLXH 3MV9D 3GGWB 1VFBA 2VAAA 3FONA 1T89C 2ILLA 4U49A 5DO2D 5DUMH 1BLNB 2BY1A 4RFOH 3RWEB 4X6BA 2ERJC 3ULVL 3CLEL 4NQSB 4JRYE 5EU4B 3DVNA 4XVUD 1JGUH 1XGTB 3N1FC 4JG1H 4JN2A 4NKMA 3CPLA 3MV9B 5ACZA 4K7FA 1S5IH 2NY4D 1NCWL 4FQHA 4X80H 1AE6H 4FS0A 4YH6A 4KRNA 4LSTL 2PR4H 3V6OA 1RUAL 2CRZA 2VXTH 2B1HL 3WEXB 2OL3B 5MI0B 1BECA 4IOSD 6FABL 3LS4H 2FCBA 4JE4B 4NP4H 2DD8L 5TDPA 3MROB 1I8MB 1QFWM 2R1WA 4YHKH 3VXPA 4HUVB 3OG4B 4ZFOB 1A64A 4OM1L 4JRXD 1XGYH 2D7OA 5JNYB 3X3GH 5DRWB 4K9EH 1QVOA 3WFCL 5BCAA 4I0PD 2ZSWB 3BKCL 4Y4FB 3K81A 1LO5B 4NQVB 5DVNA 3E0GA 5C0FB 1S78C 5C0IA 3BGFB 3LKOA 2H32B 5TQ2L 4P46B 3P4NB 1N26A 4HK0B 1YY9D 4I0PB 5IV2A 1M6OB 5FEBA 4O2CA 2P8PB 4MB4A 1J1XH 1X5GA 4P2OD 4XP6L 5GZOC 5C09D 4L29A 4ENEC 5IROC 1D5XB 1YNLL 3MOQA 2GW5A 8FABB 4WW2B 4AM0A 1MNUL 1C12A 1Q9KA 3LN9A 4M8QA 3HTLX 4J6RL 1WEJL 4UTBL 1D5IL 4ETQB 3PP4L 2C26A 2A74B 4P2OB 3C5ZA 3AS2A 4PLJD 4POZC 2DDQL 4OCYL 1A5FL 2RIKA 2YKLH 4PJGA 4XBGB 2ITDB 5C8JA 1T2QH 3QIBD 5I1DB 2C3HA 4Y16D 3ROLA 2BK8A 3EO9H 3HC0A 1MLCB 1HE7A 3KYNA 2H45A 4PJFB 3GSOA 3NABH 4J7RA 5HJ3A 3MLYL 2DTSA 1XR9A 2BX5A 2FL5B 3Q1SH 4PJIE 1OY3B 4PJFF 3MLZL 4X6DE 3X3FL 4CAGA 1JIBA 1JPGA 1ZHBB 2FR4B 5GIRB 1SY6A 1LO2L 1LNUB 3HRZA 4B50A 1JF5A 1J8HD 4Y16B 2R69L 3FQWA 2IEPA 4X9FA 5LGHH 5IJKA 1U8MA 3UTZB 5FUCC 4QRSA 1A3QA 1S7TB 5FOJA 3QEQA 4WFFD 3UX9B 1MRFH 3SE9H 2P5EA 5IBTL 5C0ND 1C08B 5GGTH 3OGOE 4C56E 2CXGA 3OQ3B 35C8L 1XGUB 2IBGA 5C08E 2BVPA 2CK2A 5EUKA 2EECA 2GCYB 5EZLB 4LHUG 1D5ZB 1KJMA 2A6DA 3Q6FA 1T0PB 3BI9X 1ULVA 5D6DC 3IDJA 2WINB 5IQ7H 3O0RL 5D1QD 4Y19A 1UVQB 3OKEB 4Y2OA 3Q48A 3VFUB 5DUPH 5C86A 3FO1A 3NCYP 5TQ0H 5SX4I 4Y4HB 3VFPA 3JV4A 3ARGD 5GGVH 4GAGH 1IE5A 2EC8A 3Q5OA 4RISL 1JZ3A 1VEMA 1JYVA 3LZFH 2BERA 5ESVB 1UZ6F 2YPVH 4OIBA 2WBJB 3ILQC 2H8PB 5IB2A 5JOFB 2NR6D 3HB3D 3UTPD 2EYSB 3O2DA 4D94A 5F89B 4NUGL 5EC1B 4TVPE 1PY4A 3QXTA 5CP7A 2UV3A 4HC1A 2PW1B 3EBAA 2EE3A 1F6AA 5KAQG 3SO5A 4F7CA 3B5HA 1FFOB 3WFHB 3Q2CA 5JXEC 4QHLA 1MCLA 1HXYB 3L7FA 4PJ7F 4GXVH 5BQ7A 1NC2D 1VGKA 5ADOH 1QZ1A 1BOYA 4OD2B 5TF1H 3TO4D 1CLZH 3ARSA 4IRJD 4WJ5B 3MJ8B 3CSPA 4I18B 2E9BA 4J4PD 4X6BB 2W92A 2PXYC 5E08L 5JIIA 4JFFD 3N85H 4XMPL 3HUJA 4OV5A 3RVUD 1SBSL 1ZGLM 3EKCA 1CL7I 1M4KA 3TO4B 1CICD 3O6MH 2GT9A 1CDUA 3RX7A 4K3GA 2VLMD 4AY0A 4FXGA 1K3IA 4XBPA 2GKIA 4AQ1B 3O3AB 2C3VA 3GSXA 1A3RL 1Q9OA 1JGLL 3UJIL 3ILPA 1BD2B 1FZKA 2V5SA 2WLYA 5ALCL 3V0VA 1CXKA 3GSNB 3RPIB 5LAXA 5DMYA 4OSUL 3DX7A 5C0CD 3SDXB 4LLQA 1LWRA 5D7JA 3EJJX 4PRID 1HWGB 2QSVA 3SDXF 3I84A 3TIEB 1CBVL 4F3FA 1T1XB 2R2HA 4XAKD 4LP5A 4RGNB 4KV5F 2A6IA 3T0VA 5GS2H 4QF1A 4LLWA 3TBYA 2FBOJ 2AQ1A 5GRXG 1AXTH 3G5XB 5C0CB 4G8IB 1U42A 3P30L 1BVLB 2EKSA 1J1PL 3WCYA 1T66D 3C6LC 2VIRA 2EO1A 1IC7L 3U1SH 4D9QD 1DQML 5JPNB 4E9LA 3ZE1F 1T1YB 4MAYC 2ORBL 4PJAB 1EHLH 2AV7B 3OSKA 1SJHA 4PJAF 4EZMA 3B8YA 5GRJL 1OP5H 5IK3A 3NBNA 1IM3A 3OZ9H 5BV7B 3WJJC 1Q9KB 3S96A 2VL5A 4GW1A 4Y7MA 2NPLX 2R9HC 3HE6A 4PJGB 4U0RC 4A6YA 4PJGF 3BP6A 1FC2D 4M5YH 3ROLB 3D3VE 3KYNB 4R90L 1DVFD 4M7LH 4FG6D 5F6IB 4S1RH 2BRRH 4HUWA 2DBLL 3AB0B 5JR1L 1O0VA 5GSVA 2HKHH 4IMKA 2ZJSL 4HIXH 5GXBB 5CD5C 4Z5RB 4HLZG 5KOMC 1X44A 4RAVB 4TN9A 4F7PA 3FQWB 1I75A 2KUTA 5EC2A 4OTXH 3J7HA 4JO4H 5IT2L 3KLHC 1T1ZA 5GGRB 4CMHC 2Q86A 2BVPB 1U8OA 4QTHB 5JXAH 3SPVB 2FYYB 5ISZB 4RMRA 3U7WL 2VISA 1MCDA 4Z7UB 4EI5B 4OZGB 5CKAA 4HF5L 3MRIA 3P4OA 4Z7UF 3GHBL 4OZGF 1XIWC 3BPNB 3IDJB 5F88B 5L7XL 4GRLD 2I27N 5ESAB 3ARPA 1AKJB 5TH2B 3PV7A 2ESVA 4JZOB 4Y19B 2X6MA 4QT5A 2CKBA 1IAMA 4QWWD 1OGTB 2HVJB 5HYFA 5F9JA 1OP3H 3T0EB 4F57L 5KTEL 4PBXA 3P11L 3U7YH 3JV4B 4XVTH 3W0WE 4UIMB 1UCBH 1BMGA 5I76A 5HYIA 2HN7A 4PJXE 1Z3GL 5EFIA 2OSLA 3M1BA 4GS7B 2XRAL 4R0LA 3B5GA 1GAFH 5KG9B 5I73C 1FORL 3BKJH 2CIKA 1ZS8A 1U3ZA 3SDDD 3NFSL 3IAPA 5E4IA 5IB2B 3VI3E 1IAKB 1NGWB 1HKLL 5IHUH 4KMTL 4QXGL 2IADA 5DK2B 4RWYL 4XPTH 2LTQB 1H3WM 4NO0D 5GPRA 4QHMB 4RX4A 5TE4H 4IOFD 4R96B 2ED9A 4GAJH 2AEWA 1RFDH 3JVGC 3WN5B 4S1DD 3QUXA 4M8VA 1J10A 3MUGB 1QBML 2YBRA 3D85A 2WUBH 5HY9A 4GMSL 5KJRL 3TP4A 5E6IB 1U93A 2XG5A 5KSBB 1VGKB 4JHWH 2B1AH 4LLUB 1FG2A 4RGOL 2B39A 4NO0B 4QEGA 5KSBF 4K7PX 5LGJA 1IGCL 5IMOA 1EEYB 4Y4FC 2XY2A 3PABA 3NCYS 2WUCH 4UOJA 4HWEL 4X9BA 1SM3L 2AJYL 3W39A 4UINL 4BSWA 3HUJF 2AXFB 3LHPH 4KRLB 5FYLE 1UWEH 3GBML 3WKMH 4XPGL 1UT9A 1B6UA 3EYUH 2ED8A 2ZP0T 3ILPB 2ENSA 4I4WB 3WUZA 4D0DB 4Z6AT 4LARL 3GI8L 4LHUD 2X89D 3PDOA 2W07A 1WCBB 4Z76A 4H0GA 3KWWB 4NT6A 4TOYL 4EXKA 4ZO9A 1WJ3A 4R8WH 2AEQL 3QRGH 2VB5A 3VGFA 4ONGH 1HYSC 2ZOLB 3DBXA 4WWKD 2EZ0C 2IQAA 1WZ1L 5F93C 4KZDH 1KPRB 4KI5D 4DN4H 3QI9A 5IBLD 3TGXA 1KPVB 4ZS6D 3FQTB 3OPZL 4DUXA 3KR3L 4U05A 4Y8DC 3UTTB 3ZKMC 4HKZA 5CD3A 1SJHB 4CMMA 1HH9A 1DLHA 1IBGL 2HJFB 1FVCA 4L4VE 2XXMB 3SCMC 5FOBB 3DUHA 3H9HA 3QRFM 3VFWA 1FFNA 3MO1B 4QXWA 4GG6A 5TFSL 3GJEA 1OGAE 5HYJD 5TPWL 3EOYG 4GKZB 1VHPA 4P2QE 2PW2A 4OZ4B 2CRYA 5ITFB 3EIFA 4WGVB 4EBQH 3DJ9A 3WLBA 2Z4QA 4XPFH 2A0LC 3LPWA 1S7RA 4G43A 1J1OH 3RZCA 4IHOA 4PB9L 1YJDC 2EDOA 5B38G 1CGTA 5HGAA 3ARDD 3B9AA 2VDRH 4OLVH 4Y4HC 4GQ9H 4XPBH 2PTUA 1R5IB 3LKQB 4WI7A 1PG7W 1PBYA 4HUKB 2D0FA 1RUMH 3TYFB 4HS6A 4NM4L 3RGVA 3VFGH 4EN3D 1T1ZB 2YWYA 3IDYB 1X5ZA 1NC4D 3PWPE 3MFFA 3TNNA 2Q86B 2WBJC 1F3JA 1L7IL 2F19H 2HJKA 5DJ6A 3VXSA 3MGTB 3V6ZA 2H6PA 4S2SA 4ZO6A 4L8SA 3H3KA 4N68A 4EN3B 1XF5A 2VABB 3P4OB 3IDNB 4KU1A 5IVNA 1KB9K 2ADIB 4ERSL 1OAQH 4YHYC 2FIKB 3SO3B 3T2NL 4JKPH 4KHTL 2Q8BL 1GOFA 5IHLB 4OUUA 2ESVB 1BQLL 3SKNB 1N5AA 5HHPA 4OD3L 2CO7B 3VI4E 3CDCA 2V5RA 3VMPA 1CXHA 1CDYA 1H15A 3NOIA 4G7VH 3PL6D 1K5NA 3N1QC 3THML 3VFRB 5I76B 1PYWA 1Z5LA 1P2CB 4U6HB 3OKOB 1EIBA 3ARWA 1FGNH 1TJGL 3BE1H 2RGSA 3CCHA 1CI5A 2DTML 3BEVA 2CIKB 3LCYA 2J8OA 1AQKH 5FF6A 5ETUB 2ZCHH 4P0DA 5DD5L 5FDYA 4X6FB 1K4CA 4Y0GA 1H3VA 3FJTA 3O4LA 4JM2D 4UT6L 1NFIA 5E6ZA 2L7JA 5HD8D 4MNGB 3V6OC 3NFNA 1R24B 1UWXH 5FIEA 1QFWH 3BJLA 5E99L 3S34L 3S4SB 4HGWA 1MWAH 5GHWH 3QUXB 5GRUH 3RUGB 1D5BA 5HY9B 5JIPA 3EOTH 5I18L 1EZVX 1CGSL 4U1KB 2NXZB 4P23B 1XF2B 4Z7VE 1N64L 3VDAA 4C83B 1VFOA 1X7QA 3GBLA 2AJXL 5F7EL 4RGNC 3VMOA 2R0WL 1IC5H 2AV1B 3M45A 2VERN 3F12A 5ERWB 3Q6GH 4YBLC 1VGEL 2VLJA 4GMTH 4LNRB 25C8L 5EWIL 5T5FH 4X6CA 1QRKA 4QXUH 4BSWB 5C9KA 1XCQB 3EO1B 4MS8D 2HFGL 5KSVB 3O2WL 2IALA 2P8LA 1MY7A 1DL7L 1FRGH 4MJ6B 5D1XD 2QHRL 1OTUD 3QDMA 3WUWB 1JPTL 5TDNA 5A1AA 3BZFB 4HGMA 4L9LB 1UKSA 5JA9A 4D0CA 3A6BH 5IG7A 5DT1L 3OAUH 3ROOA 1U2CA 5BMFL 2EYTB 4H88H 3WXVL 2R23B 4OQTA 4C56D 3WNOA 2Z92B 5DJDA 3C5ZC 2VITB 3TEUA 5C08D 4WEMB 5C0BA 4JFPA 3RU8L 1GGIH 3CLFL 2MFNA 4HSQA 1W2KT 1KCSL 1TZGH 3CMOL 3V4PL 2BOCB 2YN3A 2GUOB 1FHGA 3WFBL 2DKUA 5HVHC 1EJOH 5F6IC 2E7LA 3VJ6A 3DGGB 4KKBD 3MMEA 3AB0C 2OK0L 4J3VA 3PGFH 2PCPB 1HINH 3CVHL 3QI9B 1Y6MR 4LLVB 4IS6A 1D6EA 1QSEB 4JO1L 2ZUQC 3OXRA 3QQ4B 4JFOA 5IJKC 4ZUUA 1BPVA 2J1KA 3W11D 3FQNB 1TVBA 2OJEA 2ADGB 2DOCA 4DAGL 5EPMB 4RIRA 5GGSY 5EBLB 3RIFK 3GK8H 4JJ5A 5LVEA 4YFDB 1YEDA 2JCCB 5AYQA 4GG6F 3EFFA 3E3QC 3BISA 1FV1A 1NGXB 4P2RE 4UV4L 3EZ8A 2EDWA 5F9AC 3BPNC 3U9UA 4TVPD 4MWFB 2C4XA 1FZOB 1C5CL 2HFFA 1JPFB 3U2SB 1PDKA 3FO0L 5DZLA 3QUML 4P3WA 5HGAB 4LP4A 1IGYA 4YDIH 2GJ6A 1KENH 3OJ2C 3SDCA 1YNKH 2A1WH 3L3KB 4W4OC 2OMBA 5DC4B 5LXGL 4PB0H 5DD6B 5JDJA 4HDIA 1NFDA 3S5LB 4RRPG 3DROB 4JPWH 1ACYH 4P3CH 1NPUA 4LU5L 3WS6A 4MHHI 5IKCB 1D5MA 2VLKA 1EMTL 3HC3L 1KN4H 1BFOB 5B39G 5F1KC 3FB7A 3OG6B 4U6VL 1NSNH 1RJLA 4YWGH 2XI9A 4JR9H 4M00A 3EDFA 2MHAB 1OP5K 4M6MH 3IJSA 4BZYA 1QSFE 4LSQL 3VFSB 5E6IC 1I3GL 1IGML 5IIEB 3S37H 3FQXB 4P9HC 3SGEI 3V5DA 3IFPB 3OJVC 2E27L 5DFVD 4Z78A 5F3HB 3P77A 1N3NA 3LRSB 5IFAL 4TSCH 4KJYA 1FFRA 1PAMA 3B9DA 4PY8I 4WHTA 1A7BA 1TTGA 4ODTH 2DLFL 1DE4B 1BOGA 5DDHB 3QDJA 4JFDB 1U8LB 4KK6D 2HLFC 4M02A 5IOPA 2OI9B 4CN1A 2SEBA 3F7YA 3BH8A 4XC1L 3VMNA 2OQJA 5A2JH 3NFNB 5JOEA 1WC7B 4R3SA 4HGWB 4LKXB 1J05A 1H3UA 3F5WA 4TUKH 4U1GB 5E8DL 4RMUA 1B4JL 2I25N 1LP9B 1ZA6B 5D7JC 1CE6B 3MYJB 3H6JA 3VG0L 3CSGA 4U1JA 1ND0B 5T3XL 4PTTA 4WUKL 1NGYA 2R2EB 3GUTA 3ZKNC 1DSFH 1LK2A 1P6AB 1E4XH 1HHIB 1JGEB 2YZ1A 2IANE 2VLJB 3LN5B 3D3VD 1WBXA 5GS0L 4OF0A 3U4AA 1S8DB 3SE8H 4X6CF 3VGBA 3C8KB 4KROD 4Z7NE 4M61B 1AH1A 3SDAD 1NLBL 1CF8H 3SJVB 2RAMA 3RWGB 1AY1L 4YGAB 5IHZA 1NGQH 3C60A 3BWUC 5J12B 3R1GH 2OP4L 5HHXH 5IB4B 5I1JL 3TYGH 5IG7B 3HN3A 1KLUA 3HPJB 3BAEH 1MCSA 3SDAB 2CIIB 4ZSOA 5HTSA 1RU9L 2Y36H 1W72H 2EIZB 3HE6C 4XTRD 5C0BB 2AERT 3LQMA 4HZLA 1IGFL 4MD5B 3HFMH 5A2KH 4LK4A 4Y5VB 4DOHE 4AG4H 1TJHH 1F90H 1F45A 4L4TE 5D72L 4G8GE 4UQ3A 1IC4H 1HXMB 5C0RL 1JHLL 4QGTA 3G5YB 4P57A 3CFJB 4IMKC 4ODUA 1NAKL 3MRNA 3A6OA 3BEWA 3ZTJG 5DMKB 3G08A 2A73B 2X4NA 2Z35A 1G9NC 4YR6A 4P4RB 5DTFB 4KHXL 3KJ6H 3W0WD 3UROR 3AREA 4OCSL 3MREB 1EO8H 2FO4A 1NCCL 5KS9E 2OJEB 3T09A 3H7BB 2BNQE 1NDMB 1S5HA 1CD1A 2W0FA 3ULSB 4ZFFA 4PYHA 4NQXA 3BH9B 2R8SL 3I50L 3L3OB 3RDTA 1CXLA 1FV1B 3SKOA 2VDPH 2XNAB 5TDOB 4N8VA 4R26L 1WBYA 5D2NE 4HLZH 4ODHH 3L1OL 2J88L 3KPPB 1OW0A 3CDGA 3SO3C 5I75B 4RA0C 4JRXA 1UB6A 3LEYH 1ZLVH 1RIUL 3S35X 3WFDH 4M62H 1T3FA 4G9DA 2J5LB 5CSZB 3G04B 2YD6A 1TNNA 4X6EB 3FB5B 5CEZL 4PRAA 1K3ZA 2FJGA 1G1CA 3RVTD 1YDPA 5CKGA 4FOMA 3CH1A 2JB6B 1FDLH 3NA9L 3ULVE 3QO0B 5E9DB 4ZTPH 3PWLB 3OMZA 1A3LH 4Z8FL 1MIEL 5C0JB 3UC0L 2D31B 5C09A 4FQ2L 4QYOA 5D71L 3RI5K 2RFXA 3HMWL 4FHBD 4YHOL 2FIRT 1PG7X 5DMIL 2O5XL 2XACC 4U6YA 2VLKB 2L0DA 3QUYD 4FABL 5FYLD 2FX9L 4B53A 2NY1B 2FBJH 1MHPH 3MA7B 4OCNC 4B7LA 2CRMA 5F1OB 1M7IA 1G6RB 3QAZB 1H0DB 3QUXC 2WIIA 3TCLA 3IJSB 1FBIL 1T03L 3QIBA 2NXZC 1BFSA 4P23C 1N0XL 4KVCH 4I48A 2LABA 4ODVH 2XKNA 1QBLL 5HI4D 4OLZL 4R7NA 1RULL 3IF1A 1JGVH 1C5BL 1A8JH 3MACH 1MJ8L 5B8CA 2IPUK 2EDFA 2IMMA 2NXYD 3TWCL 1OAXL 1UM4H 2F58H 2V2WB 3KPLA 5IOPB 1X9QA 4EI6A 1A2YB 1MSPA 1N59A 2CKNA 3BRGC 1IQDA 1CIUA 3BGMA 4FQLL 4CGTA 1DQJA 1JNNH 4QRRD 1A7PH 1VFAB 3C8DA 4TUOB 4AZ8A 3F5WB 3R0MA 1I9JL 3EJZD 3AUVA 4L4VD 2F8OA 3RIFF 4WO4D 4FTVB 4EQ2A 4L8BB 4WHCA 4QRRB 3FT4B 3OKLB 5I2IA 4PTTB 1OGAD 2OMNA 3IXAA 5C2UB 1I85A 2FSEB 4MQXD 4P2QD 1P4LA 5CP3H 1MAKA 5FK9A 2WWKT 3BKMH 4JAMB 4UDUB 5ICXA 3UPRB 1ETZA 3BPOB 1J12A 3TT1L 4LVHB 3I6KB 4KI1A 5EBMA 1A7RH 1MFAH 3ARGA 5FYJL 1UB5B 3QI9C 3HZYA 5EOQL 5BS0E 4XXDA 1ZXQA 3BIKA 2AGJH 3GMPA 4RGMB 2ICEB 2GSGA 1CFQB 2DBJA 3TV3H 4NPYA 3IU4L 5DK0A 3QCUH 1INDH 1KCLA 1XR8A 4JFQB 2O5YL 1JWMA 3RVXD 4TSBL 2OZ4H 1IVLA 1YEGH 4WRLA 3D2UB 4XBEL 3PWPD 2BVOB 2V2XA 1NMAL 3QQNA 4HZLB 3NH7H 5CGYC 4Y4KD 2LE9A 5FHBL 3ZDYF 1K4DA 4MLIA 1MPAL 1I7UA 5DJAB 5HHOB 1L6ZA 5HGHA 1NC2A 4BQ9A 5BXFB 3KPOB 2CUMA 3RZCC 1MCWW 4YHLH 4G80B 2BJML 3MRNB 4OZFB 4IRJA 3QHFL 3OKDA 1IJ9A 4J4PA 5JQ6L 1OTTD 4JFFA 1W0WA 1Z9MA 3P73A 3LQZB 4KK5D 2G60L 1AXSA 5HSFA 4HCRA 3UCRA 3AREB 4YBQD 4POUB 5EUOB 5GS3A 4NFBA 2B2XH 1CICA 3DUSA 3BDYL 3MNZA 5EUOF 1PVHA 5A40E 1OAYH 3X13B 4NQXB 1N8ZA 3KDMB 4YXHH 2VSDA 3B6SA 1QPPA 2F54E 3VRIA 4L8SC 3MRMB 5DLMH 1WBYB 4FFWC 1G7HA 1AI1H 4HIHB 1CXFA 4JZJB 2ZNWA 3BP4B 2YPKA 1JK8A 4OCRH 1IAOA 2VKXA 4PRIA 4JDTL 2Q7YA 1B88A 3MX0A 4N0FA 4M7JH 4PJBA 4HXAL 3IJHB 4JG0H 3QHTC 4V1DE 1CD9B 2VDNL 1CTOA 5F7MC 3NACL 3IGAB 3AY4A 4PV8A 1YDPB 5DGQA 2D0HA 2F5BH 4ZMAT 2W0KA 3T0DA 3L9RA 3OKKA 4BFBD 3WIHL 3EZJB 4XWOC 1X5IA 3FRPG 1T2JA 4PRNB 4K07A 1CN4A 4IOIB 3S88L 2FJHA 2GTWB 1NEZG 3WHXB 4LSDA 2YWZA 1QO3A 3KPRA 4LLAA 2BFVL 1MJUL 4UQ2B 4YHIB 1QR1A 2FD6H 4HWBH 1EERB 3TCLB 3U7AA 1A6WL 2DM7A 1ZOXA 3MA9L 5D93C 5DEFB 1KULA 4WFHE 4K3DL 2APTA 5MEQB 1IZJA 4I48B 1A6ZA 1RUKH 1DVFA 3L3HB 5ALBH 2OTUA 4I2XE 4KFZC 1HIMH 5MERB 4ELMA 3DMMB 4OD1L 3MRPB 2W60B 1PFCA 3QEUB 1H8NA 1FN4A 1MWAA 3K8LA 1EUTA 4POYA 2F53E 4HFUH 4BELD 3MYZA 1RVFH 2E9WA 1E4WL 4HT1H 4DVBA 3Q0HA 3VA6A 43CAB 3WIFA 4K9EC 3TVMB 4X83A 5I8OL 5L6YL 3NPZB 2DLEA 4PJEE 1BJ1H 1YQVL 4ODWB 3KXFE 5TE6H 4NDMA 4YDJA 4RMTA 1GOGA 3AROA 3QCVL 2HRPH 4GRLA 3IXAB 2UVFA 2EEBA 4ZPTA 4Y5VC 4P2RD 4KQ4L 5FCSH 5I8EA 3ZT5A 4NWTL 1NJ9B 1I8KB 4GAYA 3CZJA 1KLGA 3WIIL 4M5ZH 2DQTL 4XNMB 5GZND 5JW4M 5DSCB 4XHQA 4JO3H 4QRUB 1YYLL 3LEXB 3SKMA 1U2HA 3BKYL 3WO4C 1FSKB 1Q38A 2JKXA 2OL3L 4OFIA 3SDDA 3DUUB 5FM5M 1XR8B 5F3BA 5CZXD 1LEKB 3RTQD 4Z7OF 1IEAB 1A4KB 5TF0A 3UAJC 1A6VH 4LRIA 4ZFOL 5L2JA 3ARYA 4UV7H 2DIAA 5CJQH 3JTSA 2Z93B 1X5LA 1TTFA 5I1EL 4H25A 1PD6A 4ZYKA 5IFJA 1VEPA 3VXOB 4WI3A 1AO7E 1BQHA 3FRUA 2AJSL 3VXQB 4K2UL 5HGHB 2W65B 3BZ4A 5DJZB 5L8LB 4UOW0 3QULA 1EXUA 1G7MA 1BM3H 3INUL 5C7XL 3VFVA 5C0AD 3VXUE 4JFXB 1QSFD 2J5LC 3HS0A 3P73B 3SDCC 1FNSH 5I1CH 4K3EH 1BWMA 2R56H 4DKFL 4OFYD 1FE8H 4DFIA 3HLAB 1NCAL 1I1CA 3CDFA 5IF0B 3DUSB 3MNZB 3R06B 3S6CA 5AZEL 5C0AB 5JHLL 3ME0A 2EH7H 2VDOL 3V5HA 1CFVH 2QADC 3MRJA 3MRHA 4YDVB 2QQKH 3WS6C 5DD1H 2NY1C 2X89A 4P5KA 1UM6L 3DPBA 3DWTA 3IRZA 3ZE2E 2OTWB 1DN0A 1JK8B 2J4WL 4OFPA 4YDKL 1YC7A 1OARH 4YXKH 2H3NA 1B0GB 1YMMB 3FOMA 4XHJC 3HNVL 2IFFL 4K8RD 3JXAA 3SEPA 1F02I 1URLA 2ZPKH 1KF9B 5IWLA 4L4JA 1KIQB 5F96L 3U30B 4MDIB 4PTUA 1WBZA 1RUPL 4ZUTB 4L3EA 4PJBF 5IQ9B 4YC2B 4WWKA 2PF6A 4NNPH 5FO9B 1MEXL 3QDGE 3TPUB 3VCLA 1S9WB 2P24B 1NH6A 4Y1AA 5D4QA 2ZG2A 1SJVA 4MSWA 2KZ1B 3OKKB 2JJWA 1F3DH 4DQOL 3F7RA 4NQCE 1G9EA 3TT3L 3QG6A 5IMKB 1NEUA 1KB5A 4X4MA 5C07B 5FECA 3QIUB 5E5MA 3LB6C 5HYJA 3BN3B 2EIDA 4QOKA 4WI9A 1YJDL 3LV3A 1ZGLA 5IR1B 3REVA 1LE5B 3BP5B 1BX2A 4RMQA 4GJTB 3OV6A 3GRWL 1UWGH 4WUUE 1JV5A 4WW1B 3WNMA 2UZIL 4G6KL 4L8CB 4LCIH 4FQXB 3ELAT 1BVZA 4ELMF 3ARDA 1FQ9C 3CFEA 3I6LE 1C8PA 2HTKC 3UZQA 5IHBA 3BPOC 4MVBC 3IVKA 1ZTXL 4GG8B 3BIBX 3BMVA 3QZWB 4L4TD 4G8GD 1ZSDA 1ZLVK 2HT2C 1N2RA 1BEYL 2Y5EA 4ZUVB 1VB9A 5B3NA 3T0XA 3FB6B 1NC4A 2FJFA 1DANU 3BO8A 3FO2B 4AENB 4JRYA 5T5NG 3C60C 5L2KB 4D3CL 1KJVB 5DMJB 4LRNL 4QXTA 4NSKB 5GJTH 3U46A 4FZEL 2I24N 4ETYA 5BVPL 3ARQA 4GRWE 1XF4A 4ODXB 5KSAB 5MHSD 1ZGLP 2BNQD 3E6FA 2D7PA 1Y0LB 1DQQA 2R4SH 1TCRA 4ZPTB 5I1KL 4P59H 5J9PB 2R15A 3VW3H 5E56A 2XPGB 1TNMA 4JANA 2Z31D 1R3LB 4PRPE 3D39B 3RJQB 4W4NA 1INQA 4RMSA 3OGCA 3CX5J 1VADA 1NAMB 1NCUA 4Y2DB 5L9DH 4RZCA 1E4KA 4TULH 2BY2A 5DO2C 1RUQL 2F5AH 4X0KA 3OXSA 1CXIA 2DRUA 4PJ5E 1KJ2A 2Z31B 3PJSA 4XVUC 1CDHA 1PKQE 2CXKA 4X9HA 3H42H 2BSRB 5JW3H 3GSNL 3AREC 3L3JB 4N5ED 2BNRE 1P53A 4AIOA 5I1LA 5DQJB 1JP5A 5F3BB 4W6XB 1P5UA 2P4AB 4JM2A 2QQLL 5JPMA 5DQ9B 4X5LA 3NVQA 3O6LH 1YN7B 3NFPA 3RDTC 3ULVD 3RBGA 5IBUG 1DDHA 4TUJA 2D2OA 5E8PA 1YEFH 4ZS7H 1DEEA 2ZUWA 4HV8B 4PJ9B 2XZQL 1BQHB 3RJDA 3N06B 3B8SA 1OAUL 4G6FD 4PJDB 5ELIA 5IW3A 1E0OB 4NOFA 2JELL 1IAIM 4OZHB 4PJDF 1Z0NA 3ZKQD 3BW9A 4ISVA 5FHAL 5E00B 1MHEA 1M05B 2B20A 3AAZA 1F00I 2IAMD 2MPAL 1HSAB 2BVYA 2AJUL 4M48L 3DVFA 1DUZA 1KXQE 2NTFB 3VXNA 3MFGB 5BV7L 3DYPA 4PJIA 3I02A 1S7UB 4X6DA 1MRCH 1B9ZA 3GIVA 3VD9A 2OR9H 4YZFE 1YY9C 2XZAL 2X4QB 4GH7B 1GIGL 4KJWC 3RA7L 2OXGA 3V5HB 5D1XA 5T1LD 2YK1L 3UJJL 4P5TD 1OSZB 1PSKH 1YECL 5I16A 3TIDA 4JQIH 3B9KB 1PLGH 4H5SA 4PG2A 2E6PA 4C56A 4FP8L 1EGJH 1HOCA 3AXLA 5C08A 1SHMA 4XNUL 3I9GH 4LEXH 4JY6A 3DX8A 3FT2A 5FO8A 4YE4H 4NKIH 4M1DL 3ULUH 1N4XH 3QA3B 4MQ7B 3VGAC 1A7OH 4HHAA 4U1SA 2X70B 3T3PE 3LMJL 1JYXA 3VCLB 1U8NA 5GGSA 3FO9A 3DMMC 3L3DB 4Y1AB 3CFKA 4U2YA 2ICWA 3H9SE 3IJYB 5DRZB 2G75B 5JW5B 4H26B 1FO0H 3LEVL 4JRWA 5CMAA 4G7YL 3DHMA 2IJ0C 3DVGA 4PY8J 5FO7B 5FAAA 2VLLA 5BS0D 1ADQL 1EBPA 1DBAH 2XTJE 3QG6B 1S7QA 4HJ0D 5GRYA 2IH3A 3TZVD 1RJZA 4FNLH 1FZJB 1RURH 2HT4C 4FFYH 1AFVH 3D9AL 4HKBA 3QBTB 1W0VA 5KAQF 4X4YA 1NBZA 3MCLH 2JJSA 1JV5B 4XVJH 2E7CA 1I85C 4UT9H 5T33L 2DB8A 1A9EA 2FZ3B 5F9WB 4GBXB 3UO1H 2O61A 4FQIL 4OGZA 1IGTA 3W2DH 5FKAB 1N2RB 2YA1A 2ID5A 2BOBA 3DTXA 4PLOB 3PHQB 3QPXL 1J5OL 3U83A 2FJFB 2HTLD 2Q87A 3BO8B 1IM9B 1JWSB 2DJ4A 1AR2A 4PREB 5C6TH 4ACPA 1EAJA 2UWEE 4HJGB 5I71C 1ZHLA 5LCVH 4I77H 5CP3A 1MRDL 4MHHG 4P9HL 2ZOKA 1RHHA 3ISWA 4TSAH 3VWKB 1ZHNB 2VRAA 2ZCLL 3STZA 1P4BL 1DQQB 1S9YB 3GI9L 4O51A 1CFNB 1BBDL 3QH3B 4UT7H 3E6HB 5SWSB 4JANB 3RWCA 1G7PA 2AK1H 2NY6D 1CFTA 2O93L 1BFVH 1J0JA 4QRQB 3HPLB 2YPLD 1IKNA 3ECBA 4F8TA 3SOBH 5IVXA 2XA3A 5FDWB 3DXAE 5BJTA 4MMZC 2X1XR 5C0GA 2X1OA 3BRDA 4G3YH 2Y5TA 1VPOL 3PV6B 1W72B 3RX8A 3WXWL 1DUYB 2HJLB 1RZJC 4V2CB 4V1DD 3SKUD 4XNXL 4NQEE 3VRLE 4YEEA 2C4FT 2YPLB 5GS1A 2W38A 3RVUC 1YYML 3PGCB 1CICC 1A6AA 1JE6A 4Q6IA 4UTAL 2WBKA 4BK5A 5JLZB 2VQTA 1T20B 3UBXI 4WIQA 1VSCA 4JM2F 2VZUA 5AD0A 4IIQA 2E5EA 1A6TA 4QY8A 4C54A 2P48B 4G6AC 1O7SA 1AIFA 2V5TA 5E8PB 5INCB 4DEPC 4YXLL 1KCRL 1HSBB 3CH8A 1EO7A 4CRPA 1U3HB 3GIZH 4YGVB 4ZXBD 2JTDA 3FN0L 2I26N 2CUHA 4U3XA 5KVGL 5CUSL 4PJCE 1S3KL 3MNVB 3P0VL 2RB8A 1AGFB 4ISVB 2PKDA 3JWOH 4YNYA 4J23A 2DQUH 5J6GB 4YC2C 2CDEB 3ARUA 5B38A 5J3HD 4ZXBB 4WFHD 3D3VA 5FUOH 2GIYA 1GZPB 2O5ZL 1A1MB 5JUEH 3AY4C 5D5ME 4C58B 4MQSB 2YS4A 4GW5B 4O9HH 4OLEA 5CINL 3WV0A 2UVEA 3HG1D 4MDJB 4TRPH 4EVNB 2EH8L 1G7IB 2F53D 2NNAA 3LKRB 3UYRL 3QQ3B 4C4KO 3LDBC 3RL1B 4I2XB 3TIDB 1BIIA 4MNHA 4KPHL 3BP7A 3NTCH 4OCWH 3D69B 1UJTA 1TETL 4XGZA 2FECL 3HG1B 3JBG7 2V5YA 3U0TB 4E0RA 4X4XA 3VE0B 2A6KB 3VWJB 3VFMA 5EDXA 5HDLA 3D25A 4FQPA 3KXFD 4YX2L 1U3JA 5DA4A 2KQMA 4FG6C 5T3XE 4MQTB 3CLEH 1EDQA 1I3UA 2ICWB 2BSSB 1I4FA 4G42B 2GITA 1H8OA 5AAMA 1IGIL 4ORGA 1EHXA 1T22B 2PYEB 3H3PL 4NRXA 4QRPB 4HWBA 1ZANL 3W0WA 4QHUA 2HT3D 4U1MA 4PJXA 1GGUA 3FQRB 4LDEB 1I7ZA 2KKQA 2F74A 4K94L 2XZCL 1N6QL 1ZEAH 4YEFA 3MRGB 4ZOBA 3VGDA 1MFBH 4XMLH 2NY3C 4U6XB 5KSAC 3CXDH 4OM1H 1T5XB 3PWNB 4OAWB 4OM0L 4LSSL 2AK4E 3WNKA 4I5BB 4GRLC 2X4SB 3V2AR 3I85A 4JVUA 2X4OA 5I19L 2E6JA 1A9EB 3IKKA 4OCXH 4G6JL 4XNQB 3EO0A 2CR3A 1AO7D 2HMID 3VFOB 3C8HA 1XH3A 1VERA 4LFHG 3MNWA 1U8JB 3QQ9C 1JFQH 4Y2DC 3ARFD 4PGBA 3FN3A 4GUPA 4AH2B 5DWUL 3GSRB 3OWEA 3WFZA 2P7TB 4N8CH 5D7LB 4F80A 3MLUH 3CFCH 4H0IA 3VXUD 4G8FB 2G5BA 3SDDC 2NLJA 4OJFL 1PJ9A 2QSCL 4C59B 3OB0H 4E41B 1DZBA 4RFEA 1MNUH 5C92A 1U8HB 3ARFB 1DBBL 4PJ8D 4J8RB 4LRIC 2QKIA 3QUYA 1IC1A 4HWNA 1A5FH 5ESQB 5J89A 4IOFC 1I1AB 4FQJH 3L3GA 4P4KD 1EHAA 5KANI 2CO6B 2JK5A 3IDGA 4PJ9C 1OPGH 4XCCL 3GSVA 2NY2B 5GGQL 2FATH 1CFTB 4MNQB 1JHTB 1XAUA 5K9JH 2WANA 1OF2A 4LCUA 4JO2H 1FFPB 1OAZH 5IVXB 3RZWA 5BJTB 4P4KB 4CBPA 5IVXF 2R69H 3V4VH 3I6GA 1BQSA 1FNEB 1T5WA 2HG5A 2Y06H 4R4NC 2Q7NA 1HHJA 3KPQB 4N8PA 2VQ1A 3MXVH 1JVKA 3QDGD 4IRSA 5D96C 1XZ0A 5HHNA 5CEZE 3I75B 1A6AB 4Q6IB 5EZOH 5T1KB 3OKMA 4GKSA 2AS5M 5AD0B 3KPSE 3LRHA 1IEBA 5T1MB 1R3IH 3U0WH 4X8JB 1I7TA 2G9HB 3WO3B 5IFHL 4KDTA 3MCKA 3BUYB 1OP9A 4X9IA 3ES6A 1JF1A 4L4VA 3PWUA 4WO4A 2AI0H 5GGUB 5EZIH 2X2YA 4DGIL 1T0MA 1E27B 3TN0D 3GMQB 4I3SH 4LNVA 3TBSB 1JHKL 1OGAA 3G5VA 1UACL 3D0VA 4XCNB 1C16B 3GBNH 2XA8H 4XNYH 5KW9H 3JV6A 3MRRA 1QRNE 3FFCE 4LBEA 3F7QA 5KVDH 1YN6A 4JCLA 1YPZE 2HVKA 4XZUB 4Z7WE 5FUCE 1HZHH 2FH8A 4KVNH 2W59A 4I3RL 5T3ZH 3PQYE 3QUZB 4ZS6C 1UZ8A 3BPCA 4PV9A 3GMRB 3OR6A 5AWNL 3I6LD 3N1PC 5DEGA 1MCRA 3D18B 4LCWA 3TFKC 2BVUA 3CFBB 5GISL 4GKNB 4RRPA 4O4YL 5I17B 1BIIB 3QHZH 5C2BH 2V7NB 3MRBA 4MNHB 5GRVK 2VWEC 5DZOA 4DVRL 1JNHB 3DRQA 2NQCA 3PWPA 4BUHA 4NNXB 5DVLA 4ZOCA 2X7LA 1MFEL 1F4AA 2VLRE 4ZUWB 5B39A 1HHGA 5F7DA 4Y4KA 3EYFB 2I60H 5EOCL 4PJHB 3T8XB 2IF7A 4LEOA 4PJHF 3B9VA 5T1DH 4Z0XA 2XWTB 2ADFH 5F9WC 5E08H 4GBXC 1JN6B 3ARDC 1I4FB 3S97C 1QBBA 5J11B 3NIFF 1A4JA 4PRPD 1SBSH 2LQRA 1FZMA 3LKSA 3U79A 5IMLB 5FYJE 5DS8B 2FB4L 3S35L 5I1GH 4K23L 1A22B 2YMXL 2HWZL 4NBYB 3VXTB 2AVGA 4P48A 4KXZH 2R2BA 2XT1B 1M71A 2P8MA 4HGKC 3S9DB 3VWKC 5CBAA 1N7ML 4NM8H 3GHEL 1TFHA 4U1IA 2XZZA 1ZT1A 3MZTA 4YQXH 4MD0B 3MJ9H 1Q9WA 2EXYD 3V0WL 2IQ9L 2FRGP 5F9OH 1TJIH 4OIIH 1P7KB 4R7DB 3KPNB 3AFLA 1PG7L 1XH3B 3DV4A 1FL5B 2GTZA 3HNSH 4QHNB 3VXMB 1QLFA 4EDWL 1QOKA 4WCYL 3BSZL 5ICYA 2ZKHH 4PGJA 3PG2A 2FECI 1E4KC 3IETB 4F58H 3A67L 5H8DA 4D9LH 1LDPH 4OLXL 2HFEA 3ZTNL 5ITBH 1XGPA 2YRLA 1B90A 5DUML 3QUKB 1UA6H 4RFOL 2H2SC 4P2CG 5I66A 3C09B 3UTSE 1JGUL 4I1NB 4JM2C 2IPKB 3P4MB 1GXEA 4DUWA 1S5IL 1AE6L 2C1PB 3BHBB 4HIIB 1A9BA 3L3GB 1C5DA 1J0IA 4G6MH 4MD4B 2PR4L 1IAIH 3DYOA 5INDA 2VXTL 5D1ZB 1G7JB 4R90H 3BD5A 1U3HC 2EDKA 4GO6B 5GQBA 3STLB 3OKNB 3KNBA 2VC2H 1ORSA 3LS4L 4LCUB 4NP4L 3OJDB 4YHKL 1E6JH 1TQBB 1L9MA 2ITCB 5CJOH 4HWUA 1UEYA 1XGYL 1JL8A 4OLUH 3KYOA 5D2LB 3X3GL 1UXSA 3CSYB 4M1CD 4U1HB 4K9EL 5E5UB 4BH8A 1MH5A 5F44A 4L9DA 1ORQB 1IILE 1Q94A 4LLYA 2J8UA 4N5UA 5DRNA 2RCSH 5E6YA 3H9SD 3GB7A 5D1XC 5F1NB 3EYSH 3HE7D 1QBAA 2BC4A 1XF1A 1DBJH 1AD9B 4GSDH 4J3OC 2EEDA 3X12A 3OF6D 1A7QL 3ES6B 3FTGA 1FVDB 3GFUA 2XTJD 3L5JA 2PYFA 2VE6B 4IDLA 1TTUA 2ZSVB 2VR9A 1ZHKA 3HE7B 3TBTB 3BWAB 2GSIA 3P11H 1WISA 3EYQD 5FB8A 5JOPE 3BESR 4EUPB 3NIDE 3S36X 3TBVA 5J56B 4P2RA 2XQYG 3JV6B 2YKLL 1PX4A 5L0QC 1T2QL 4FQCH 5KSUB 4LQ1A 4D0BA 1SMAA 4LFHD 2BDNH 5MEOB 3NABL 2EDYA 1J11A 1FORH 2QSQA 3Q1SL 2QQNH 4HEPG 3U36A 2KL6A 4N9GA 4G9FD 1MUJA 1HKLH 2JLLA 1LEIB 3H9ZA 4LCWB 5LGHL 4JREB 4HLJA 3RTQA 3TA3A 2YD1A 3SE9L 2E7HA 1IFHH 2CDFA 4G9FB 5I15H 1A6UH 5GGTL 1NUGA 3BYYA 5D7SH 2NY0B 4KRPD 4F8QA 3UZEA 1P4IH 3ZL4H 3SGDI 1DP0A 3NCEB 4RGOH 1FO0A 1Z9SA 5ACMA 3CVHB 1IGCH 3ZSSA 5MEPB 3DARA 3NPSB 2JJSC 1I7RA 5C6PB 1EBAA 3E1F1 1YC8A 1P84J 1D9KB 4R4BB 5HI5D 3VXRB 3PDGA 1V3JA 5IQ7L 1YY8B 3HAEH 3QWQB 1QSFA 1QKZH 4YHPA 2IFGA 3MTRA 5EU7E 3DRTA 4J3SA 3MV9E 4ZG1A 5DUPL 3GBMH 4OFYA 1I1YA 5DJCA 5TQ0L 3V95A 3BZEB 3OTTA 4GAGL 3VRJB 5FA4B 5FYKH 3KGRA 3F7VA 1FC1A 1CVSC 3LZFL 1MVFA 1BZ7B 4EDXB 2YPVL 3R0NA 4KKLC 3RL2B 3U9PH 2V2TA 4TVSa 5HHQA 4DW2H 4NN6B 1HILB 5DHVH 3QUMB 1I1AC 2CH8A 2AEQH 4UBDD 3QB7C 1NLDH 2CSPA 1R5WB 2YEZB 2EDLA 1JUFA 2NY7H 5D7IB 1SYSA 3LY6A 4MJIB 2NY2C 2K3TA 5D7IF 5I8KL 4NUJB 1IKNC 1SY6H 2FLRT 32C2A 5ADOL 1HH6B 1MQKH 3O3EA 2I07A 1C7TA 3OJMB 3OPZH 5EG6C 3V7MA 5TF1L 1CLZL 1AHWA 2WWMD 5EIIA 5EO1B 2CLRA 3TO2B 2BMKB 2P5WB 5GS1C 4NHUA 2IANA 5I66B 3JZ7A 2GJZB 3N85L 3MRFA 4Q6IC 4Z95H 4J1UB 3KYMB 3DX6A 1S7SB 1ZE3C 5IW1A 2DQJH 3K74B 4V2BA 5TPWH 4IIQC 5CIPH 3O6ML 1A9BB 4YPGB 3RNKB 3T2OA 1ZK9A 2XXCB 4KKAC 5C71A 1CYGA 3U6RA 5H2BA 1NBYB 3O6KH 5DQDH 3C9NA 1OAKH 4PJFE 1C1EH 2DQGH 3MV7B 4GQPH 1I8LC 3QWOB 3U0PA 1L7TH 4WEBL 3FHAA 4F2MA 3RHWK 3SY0B 1OCWH 1U8IB 4JDZA 4Y5YA 3L95B 2MCG1 1SQ2N 5FGSA 4NM4H 3MRKB 1F8TH 4L4TA 1AXTL 4G8GA 5T3XD 4XI5D 2J8UB 3G6JB 2X4RA 3PGDB 2J8UF 2G5RA 4APQD 5E8NA 2MSPA 1WZKA 3QG7H 3O2DH 4U1LA 1KNOA 3O9WA 1YNTA 4LOUC 2WP3O 2D3VA 1ZWIA 4X98A 3T2QA 5GS0D 4I0KA 1D6VH 1EHLL 5JZ7C 1NQBA 3HI1A 1CD0A 5C0DA 3SE4A 5KS9A 2BNQA 1OOAA 4I9WE 3OZ9L 3ZE0E 4E5XB 3UTQB 3VGGA 2ZG3A 1LE9A 1GPOH 1M7DA 4OI7A 1L6XA 4YHNA 3FOLA 4LKCB 4AYFA 2AK4D 4M5YL 2D4DA 4LCCB 3LD8B 5KN5A 3VFTB 5M94B 5DI8A 1EEZB 4KAQH 2BRRL 1J0YA 3ARRA 2QR0B 1V7NL 4NJ9H 2HKHL 5LWYH 4HIXL 2GK0A 4BSVA 2R1YA 4JFYB 4UDTB 1U92A 2DQHH 4BQCA 3SDYH 3TA3B 4OTXL 4X5WA 4ZNEA 3FRPA 3ULUF 1QNZL 5HVWA 1FFQA 2ERJB 1S7VB 2R1XB 3R8BB 2DI7A 1E28A 4Z0BH 4HS3B 3QEHB 5JXAL 1H5BB 3BXNB 4G8EA 1FO0B 1LK3H 1FVEB 2VXSH 2CDGA 5IVZA 2C1OA 2M1KA 2F8VA 2AXGA 1X6NA 1HNFA 2XWJA 1EH9A 4ALAL 2IAMA 3AU1A 1S78D 5E1HB 5SWZA 3U7YL 5DJCB 1Q72H 4R6UA 4XVTL 15C8L 3RVTC 3MRQA 3GSQA 3V6OE 1B2WL 4R2GB 3QEGH 4AEIH 2VNCA 1BD2E 5GZOD 4LPVA 5D9SB 5T1LA 1GAFL 3ZZ1A 4TTDC 4P5TA 4BKLA 1UADC 7FABH 3BKJL 4RDQF 3WXVH 1F97A 3QUYC 5CEZD 1X3DA 3SDXE 4A6YH 5IHUL 4P5MB 4XB8A 4XNZB 3KPSD 1EX0A 1T7XA 3FQUA 4XPTL 4L3CA 4ODSL 3SKJH 3QJHA 4RGNE 2HYMA 3CMOH 4POZD 5TE4L 3V4PH 1EFQA 4GAJL 1TVHA 5C0CE 1OHQA 1LO3H 1RFDL 3VH8B 3QYCA 4JKMA 3GJFK 1KIRA 2WUBL 32C2B 4UB0H 3RWDB 3ZE1E 4JHWL 4KTDH 5HI4C 2B1AL 2I07B 5IB5B 3TH3T 1G9NH 3S98A 3AVEA 4PJAE 3FFDB 5HYSB 5EIIB 5CBEA 1QRND 1TQCB 4CW1A 2L7UA 2WUCL 4IRSC 4LAJH 2ARJA 5JORA 5HPMA 3O3DA 1FL3B 4OLWH 2DM3A 2H1PH 4D9QE 3DURB 1ZLSH 1U95B 3LHPL 5BS0A 1QTYT 2IGFH 3MGOB 1BAFH 1EAPB 1UWEL 4PJGE 3WKML 4NBZB 4Z7NF 5IM7B 3EYUL 3H8NA 3TZVA 3U6RB 2R4RH 4KDTC 3R4DA 5HI3C 1Y6NR 4PYGA 4TTGA 3CGTA 4EQ3A 1LQSR 2BVEA 2YD2A 4QTIH 5DA0B 3HZVB 3HR6A 3F58H 2VLRD 3X14A 3RWJA 3IDXH 1TCMA 1KN2L 4R8WL 4U0QB 3G6DH 3ARBB 3QRGL 43C9B 4ONGL 4NN5C 2AKRB 4IDJH 3QIWA 3O2VH 4KZDL 2ATKA 4XP4H 1HEZA 4HUUA 3RWFA 3IFOA 3O9WB 3QDHA 1MI5B 3JWDH 5ISZE 3E3QE 3ILQD 4Z7UE 1PQZA 4OZGE 3IYLW 3MRDB 5FYJD 3HI1B 5CWSB 3FAWA 5AUMA 4JFEB 1U58A 3T4YA 3IAGC 2DS4A 2BSED 4GXUN 1I3RB 3JV0A 2NY0C 2X4PB 4Y19E 5C9JB 1UH3A 2APWA 1EPFA 1DCLA 5F70A 3T0EE 2F54A 5JXED 1FJ1B 1HHKA 5FCUH 3K2UH 4GT7A 2G2RB 1ZLUK 2GAZA 1Z9LA 3NPSC 1M7XA 1S7WB 4Y5XA 4PRBA 1Q0YH 4EBQL 5D6CA 1I8IA 5CHNB 1D9KC 3G6AA 1JRHH 3RWIB 5C70A 1UYWL 4HWZB 1E6OH 1SVCP 5DI8B 4XPFL 5IW6B 2ZCKH 3GJFA 1S9VB 1J1OL 2PXYD 2XOTA 1CGUA 2GFBA 5DJYA 3T65B 4V1DA 1RZFH 1X5JA 2VDRL 3I2CL 4OLVL 4OCLC 5JO5A 1JWUA 4XPBL 3BDXA 4MYWB 3OR7B 5E8EA 1T04A 3VFGL 5BZDA 3WNLA 3TJHC 4OF3A 3GMLB 3ULVF 4XCYA 2CLZB 4HIEB 4OLYH 4CJ1A 2F19L 3AGVA 3UTSD 2AAVA 1NBVH 4WTXA 4G8EB 1BBJB 4KKCC 5KSBE 1AP2A 3TH4T 1AD0A 1P7QB 5ID0A 2AJVH 5IVZB 3VGEA 4OQ1A 4WU7B 1OAQL 2D03H 1U6AH 1BVKA 2E7MA 1U8KB 3N1MC 3UPAA 3BIAX 1KXTB 3O11A 3C08L 2B5IC 3RHWF 5H37G 3MLSH 3DI3B 3C6LD 1AJ7H 1NLBH 2XN9B 3QR2A 4G7VL 5J8OA 1WZMA 2EE2A 1FGNL 1RK0B 2H2PC 3AM8A 3BE1L 4LQFL 4MAYD 2FX7H 3BT2H 3OAYK 2V17H 3LN4A 5DD3H 1QSVA 2F53A 1E4JA 2Q76A 1AQKL 3T1FA 3C6LB 3CFDB 1R3KB 2ZCHL 4EIGB 2H26A 3KYKL 1F3RB 5KVMC 3FB8A 3ORJA 3CX5K 1KFAH 5EZJA 3PWVB 1RK1B 2HAZA 2R9HD 4ONFH 4CVZA 4XB7A 5L8KB 4N0UB 4PRHB 1U8PA 4EXPX 4MCYA 1MWAL 1U8QA 4PP2A 3F6IA 2MKWA 5GHWL 1ACZA 1VA9A 1TPXB 5C0RH 5GRUL 3DGCR 3KXFA 2LV4A 3O6FD 4XCFH 4H1LH 3EOTL 3LIZH 5DRXB 1UEMA 4WI8A 5EO9A 3V79C 1T83A 4U0RB 5JOPD 1DQLH 4WDIB 5CD5D 3IAQA 2ZUTA 1IC5L 1SEBA 3UTTE 5FA3B 3U4EA 4KI5E 5MP6H 3L5IA 4GMTL 4M4PA 5IEHB 4KUCD 5T5FL 3KLHD 1K2DA 4QXUL 2VZSA 4MCZB 3FL7A 5ANMB 1KACB 2AXHA 1FL6B 3O41A 3EOAB 1WK0A 1A0QH 4UU9B 4CMHB 3A6BL 1XIWD 3OAUL 3CUPB 4JN1H 5CEXA 2HLAA 1GZQB 4H88L 4KGLA 2J6EH 1XGQB 5DXWA 1GGIL 2HH0H 4PLNC 1AO7A 2BZDA 5JDSA 1TZGL 2UYLA 4YLQT 1UC6A 3QIWB 5GZNC 2OCFD 3CXHK 2VL4A 1JYNA 2VTFA 4UUJB 1HINL 5D71H 4BQBA 3VXUA 2Z8RA 4M9OA 1FYHB 1B6DA 2O5XH 2FLBT 2PO6B 1KTLA 1PQZB 2NX5B 3RTQC 3ULUC 3TA3C 4PJ8A 4UZGA 4QLRA 2X4UA 3NCBB 2VZ3A 3I3DA 1NMBH 4LVEA 3U48A 4ZDHB 1QA9B 3JV5A 5I73B 2ESVE 4IJ3C 5KANG 1T03H 3ZT6A 4PR5B 4O02L 3GK8L 4RQQA 1H5BC 3KS0J 2NW2B 2PTTB 4BZ2H 1KG0B 2DQFB 5AZ2H 1QBLH 4HULB 5BVJA 2JIXA 3FZUC 3KLSA 3T0AA 4JKLA 4FQQA 3IXTA 2BVTA 4X7CC 4Y4FD 1H3XA 3OL2A 1CGXA 2IH1A 3W9EB 5MEND 3M07A 2D4FA 2DIJA 2XWBB 4YDIL 3MLVH 3PIQA 4XWGH 4DGVH 4KUZH 1KENL 3I3BA 4FQLH 3QDGA 4HKJB 2CLVB 4P46D 1YNKL 1Z0MA 3M17B 2A1WL 5FYJU 3C5JB 4MNGE 1T21B 1GHFH 4BH7A 4R2GC 1I1FA 2ADJA 1G84A 1I9EA 4XPHH 4PB0L 4BZ1H 4O2FA 3EYVA 5MENB 12E8H 4LIQH 3HAEA 4HMDA 4OQTH 3RUGE 4BM7A 3ZLQC 4WI5A 4JPWL 4NQCA 1ACYL 2PTVA 4P3CL 1UCTA 2CRIA 4XNZC 2RR3A 1ES0A 3QFDA 5EOTA 3C6SA 5F97E 1GL4B 1KN4L 4QGYA 1MAML 3TN0A 1BVKB 1NSNL 4YWGL 1SBBA 4JR9L 3PHOA 5C0EB 3U82B 4JZNA 1HYSD 4YAQA 4M6ML 5H94B 2EZ0D 1FNGA 5DJ8A 5I74C 1H3TA 3IKCA 4CVUA 1MCQA 1FYTD 1K8IA 3EOBA 4PGEB 4WUUA 3QNYA 1BZ9B 5DHVA 5HVGB 1HI6B 1AHWC 4TSCL 3IU4H 5TE7L 1TQCC 5E94A 2UY7A 3G5ZA 4RNRB 3ESUF 1FNAA 1FYTB 1MCCA 1JJUA 2XYCA 4K71B 1A1NB 3B3IA 3RKDC 3T1FB 2DIBA 3MXWH 1UG9A 4M7ZC 1IKFL 3H0TB 4UNVA 5F71A 1I1RA 2BSTB 4ZUSA 5DMGC 1MFCH 4A2MA 4ZD3H 1Y6KR 4J3XA 4PD4J 1MPAH 2DAVA 3GDBA 1OT2A 4XH2B 3FHQA 4U7KA 4TUKL 3IU3A 3SCMB 2GYSA 3JTTB 4MX7A 4PBWD 1RZ8A 3MBXH 3P9LB 1U91A 5E1AA 4CU6A 5JHDA 4I9WD 4HQQL 2A0LD 1YEHH 4NKDA 4KH2A 4HEME 4ESKA 3MV8B 5JQ6H 4F33A 5JQHC 4Y5YC 1QSEE 1KTDB 3MOBH 1T0NB 5CIPA 4Q9QH 3T3ME 3ARBC 2MOVA 1DSFL 4Y4HD 4LGPB 5K59F 3I3EA 1F11B 4H8WL 1FCGA 2Z91B 1E4XL 3BDYH 3OB8A 1MCPH 1L0XA 4PS4H 4BA8A 5J1AB 3TESA 1SYVA 3O9WC 3SE8L 4IEFB 2JCCE 3DO7B 3WHE1 2DM4A 2WBJD 3ALXA 3PNWA 3JWNC 4PJ5A 1PKQA 3JWOC 1G7QB 4LF3B 2Y9RT 1CF8L 4UAOC 2VYRE 1ED3A 2BNRA 3SE4C 3RVWC 1AQDB 1NGQL 2AEPL 1CZ8H 4E42B 2NW3B 2E8ZA 1X5KA 5HHXL 3TYGL 1AGBA 1F4WH 1FNLA 1ZVSB 1ZA3B 5CJBA 3BAEL 2HLAB 2FX8H 3UBXB 3CMGA 4MGXA 2Y07H 1K8DB 1T4KB 3HHRB 3QO1B 4F9PA 5ENWA 2Y36L 1W72L 3VFNB 3CK0L 1MVUA 4PBVC 3VG9B 1BF8A 1KCUL 4YHYB 4AG4L 1TJHL 4LGSB 1F90L 5FV2A 4MAUH 2ZUYA 5J6HB 1IC4L 2RHEA 5HHMD 4X5XA 4PJ7B 5A43C 3MLWL 1VACA 4KQ3H 2JJVA 3GSUB 4GLRH 2XTLA 3R8QA 4DZBB 3O3BB 1VFBB 4XXCC 5K9OA 1A1OA 1DN2A 2VAAB 3FONB 3KJ6L 1YQ2A 3IRPX 5TJWK 5HHMB 1EO8L 2BFVH 3LQAH 3ULVC 1MJUH 2M2DA 3DVNB 4KZEL 1BD2D 4JN2B 4NKMB 5E2TH 4JJHA 3CPLB 4FFVD 5ACZB 2WAHA 4K7FB 4FQHB 2VDPL 4GW4A 4ODHL 1GGBH 3N1GC 4OD1H 1CIDA 2JIXB 4DKEH 3MRCA 3BRFA 4RGND 1AGDA 2Q6WA 3LEYL 3WFDL 2VAJA 4JFDE 4M62L 5TDPB 2BHYA 2IAMC 2R1WB 1W0YT 3VXPB 4ZAKA 2Q3AA 2VDMH 1MLBA 1TZIA 4K7PY 2NY5H 1QVOB 1CDBA 3V4UH 5H35A 1QLRA 5I8OH 3HR5A 4YBLB 3EYVB 5C0IB 1FDLL 1R5VA 3HAEB 1MJJA 3ZHKA 3LKOB 4LMQI 1A3LL 3BQUA 3SQOH 1LP9E 3QCVH 3OF6A 3S4SG 1NFKA 4F7TA 5IV2B 4O2CB 1SJXA 3C5ZD 3NN8A 4FFZH 2EDQA 4Y8AA 1MHPL 4L29B 4L5FH 3P9MA 3MGAA 4AM0B 3WIIH 3GKWH 1TPXC 1C12B 2VLJE 4KK9D 4M8QB 5SV4A 1K8IB 2EDBA 5SWQA 3V0AC 2Y7QA 3C5ZB 1EVTC 2J12B 4KVCL 1GJIA 1HQRA 3AS3A 1QFUH 4ODVL 5C8JB 2OL3H 3SJVE 3TJEH 3MLTA 2OTPA 1T6VN 3HC0B 3G5ZB 3MACL 3GSOB 5HJ3B 5HVHB 1XR9B 4DK6A 1RZKH 5EOCJ 4YHML 2DQDH 1UM4L 1JPGB 3ZYOA 3C5SA 2FGZA 5EULV 3HCVA 1H8SA 3WUWG 3HRZB 5SX5K 5C0BE 2ZUQB 3OHXA 5E2VH 3J8F7 1U8MB 3MQIA 3TZVC 5ISZD 4RSVA 2UWEA 2AJSH 2V7HA 4QRSB 3Q3GA 1WWAX 5ID1A 4EI5D 3QEQB 2P5EB 5K9QI 1JI1A 5JHDB 3MUJA 5EUKB 3INUH 1AKJD 5GGRY 4YHZH 4Y19D 1OTSD 1KJMB 3U4BH 3L6FA 2A6DB 3Q6FB 3T0ED 2A9MH 3DECA 3L5HA 4XX1E 3ZDXE 4P9ML 3QIWC 4MB3A 5BRZA 5F7HA 2P42B 1A7RL 1MFAL 1X5FA 2AABH 3DXAA 4DGYH 3VDBA 5HXMA 1SYVB 1AGCA 3GSWA 4HKXA 3FO1B 4X7SH 5IGXH 2PO6C 3VFPB 3AC0A 1UENA 2AGJL 4LSUH 4HH9A 4NQEA 1HDMA 1CFSA 5EU6A 3MBEA 3QCUL 1INDL 4F37K 1MHHA 2OZ4L 1AGBB 1YEGL 4JY4A 3MODH 3ESVF 1OB1A 3O8XA 3OX8A 3SGKA 1MVUB 4X7TA 1V3KA 5E6ID 2V6HA 4Y5XC 5I1HH 1HQ4A 5CP7B 4MA8H 4GXUM 1G7LA 1IL1A 4PGCA 4NYLA 5F7KC 1F6AB 3WE6A 4F7CB 4FQ1H 3MLXH 4RMWA 2APVA 4QHLB 5E9DE 3L7FB 1DLFH 3EUUA 4NO3A 2HP4A 4YHLL 5BQ7B 4LASH 4YO0A 3E2HB 2VLKE 4P49A 4AIZA 3S5LG 2ED7A 2XFXA 1UGNA 1RZGA 5D5MA 2ATPA 4NZUH 1FIGH 5E2JA 5BO1L 5ICZA 2B2XL 4HX1A 1RV6X 4M1GH 4YZFF 4AJ0A 4XAWH 3HUJB 1WWWX 4OV5B 4LLMA 3HZKA 2GT9B 5DLML 3RY6C 2ZUVA 4FXGB 4JDVA 1AI1L 2Y23A 1PGRB 1T1WA 2DQEH 4G5ZH 4XBPB 1HK6A 4Q2ZA 2C3VB 3GSXB 4F9LA 1Q9OB 1XF3A 4X99A 1FZKB 3NAAH 3V0VB 4AEFA 5EO0A 4OCRL 4MZ3A 5LAXB 4JFZH 1DBKL 2LVCA 3H3BC 3DX7B 4KTEH 1BEYH 5J3HC 1U9KA 1KOAA 1EZVY 2DLGA 4LLQB 4JG0L 5D7JB 4NO2A 3RNQA 3GMMA 2DWEA 1J0HA 1ONQA 4F3FB 2R2HB 5FGRA 3IDIA 2A6IB 4OGYH 4QF1B 4FZ8L 3CC5A 4LLWB 4APQA 3TBYB 5AG9A 3NGBC 5E8OA 5CEYA 3AM8C 3S36L 1GGCH 3D0LA 3UTTD 5BVPH 2F5BL 4OF5A 4HIJA 2EKSB 4NWUH 2DYPA 4K71C 2UZYB 4NN7B 3WNNA 1DANT 2CQVA 2VIRB 4FTVE 4FXKA 3L7EA 1JZ7A 4QRRE 2UUDK 4PG9A 2EIBA 3RIAK 4QNPE 5DHYA 3HE6D 1LD9A 3HA0A 2Z8WC 3V9FA 5DR5H 2XQYK 5IK3B 2F15A 1IM3B 3MUHL 5I30H 1SEQH 3S96B 2VL5B 4GW1B 4N0YL 2FD6L 4HWBL 4C57C 1NUNB 2AK4A 4JKWA 2OS7A 2Y6SC 5SWQB 4J3TA 4NRYA 1P5VA 3HE6B 4A6YB 1RUKL 1RZJH 1GGYA 4HCRH 5ALBL 3BP6B 2EXWD 1HIML 1OSPH 3GSNH 3MLTB 2R29H 4NKOA 3KPMA 4K7PH 3HZMA 1OM3H 4HUWB 1ZT4A 5GSVB 4HFUL 2XKUA 1RVFL 4H1LA 3RGHA 3KLAA 4HT1L 3HI5H 4K3JH 4XVSH 3OHXB 4F7PB 4IRZL 3ZDYE 5E70A 5EC2B 2QJDA 1WTGT 1KYOJ 4I13B 1OAUH 5CJXC 5HHOE 2JELH 3BX7C 5HGDA 4M43H 3OAZH 4WWID 1U8OB 4NRZA 5F1SA 5TE6L 2FWOA 2ESVD 4HMCA 4MA7H 2HRPL 2VISB 4M7KH 5IVOA 2RJMA 1KEMH 3VG9C 2HMIC 4Z18A 3MRIB 3REWA 4NHCH 5BV7H 1BF2A 3V5KA 5BRZB 2MTPA 2ICWI 5EUOE 4NZTL 4GKOA 1MFDH 4CADA 3TPKA 1JPSH 4NFDA 4QT5B 2CKBB 4XX1G 4M5ZL 5F9JB 4RBPK 2VDKH 1LHZA 4JO3L 3DX9A 2J6EA 4HH9B 4AMKL 4EOWL 4PY7A 4PJ8C 5EU6B 2HN7B 5EORH 2MKLC 3EFDH 1NGPH 3MBEB 2OSLB 5EFIB 3M1BB 1Q9LA 4FP8H 3SE3A 4DN3L 4R0LB 1RJYA 2VXQH 1A6VL 2AJZA 1ZS8B 3KPSA 2BNUA 3RWHA 5ACLA 4UV7L 1NL0H 5CJQL 5DURB 3QUXD 3O8XB 4M1DH 3RP1A 3D85D 2FGWH 5KOVC 3QISA 2IADB 3LMJH 4XT1C 2NXZD 4P23D 4NJAH 5EN2A 3QNZA 1G7LB 1JTTA 5A16A 2F8XC 1IEHA 4DKAA 4X8XA 4OB5H 3D85B 2YBRB 3MLRH 1EFXA 3LEVH 1U93B 1BM3L 2YD4A 3T4AA 1Q1JL 3FFCA 1FG2B 1UQSA 1YPZA 2J8HA 4Z7WA 1FNSL 5LGJB 4AIXA 5I1CL 3GMOA 5IMOB 4K3EL 2R56L 5DFTA 4YFEA 4A2LA 3PQYA 1FE8L 3PABB 3K80A 5D5MF 4NQTA 1P84K 1QYGH 2C7UA 5I1AA 2I9TA 3STBA 1XGRA 3W39B 3O45A 5JIKA 4LLDA 3L5XH 3D9AH 2EH7L 3HZKB 4O2EA 1CFVL 1JZ6A 1V7MH 2QQKL 3F6LA 4PGDA 5DD1L 1Q8MA 3V6FA 3TN0C 1A14H 5FKPA 3DI2B 1OARL 1PZ5A 4R4FH 2VLRA 4L8DA 4XCEA 5HDQH 2HFTA 3DHJA 3PDOB 2ZPKL 2VDLH 5FM5O 4Z76B 2GY7B 2WSKA 4D8PA 4NT6B 3GNML 2DMKA 1KSRA 1WWCA 3QI9D 4NNPL 5I8CA 2DL2A 4OZIA 2WLZA 2X4TA 4QCIA 3T0WA 1QSED 3CC5B 3UEZA 2X5PA 4RFNC 3DBXB 3HKFA 4X9GA 2X44D 2IQAB 1RY7B 1MRDH 4BQ6A 4WU5A 1BJ8A 3LOWA 4JLRA 4WENB 2DYPB 1SMOA 4ZQKA 5HGBA 2H9GA 3P0GB 3QFJA 1B0RA 4B41A 1BJMA 4ZODA 4HKZB 5CD3B 4CMMB 4JFHE 3UYOD 1HH9B 1DLHB 5CGYD 1CLYH 1VEOA 1FVCB 4OF6A 3WBDA 5E2UH 5FGCB 3H9HB 3CZFA 4WI6A 3VFWB 3QCTH 1FFNB 4GG6B 1NANH 3QXAA 1TZHA 3GJEB 1VPOH 4W6YB 3RZCD 2YD3A 3TC9A 2PW2B 1UWGL 3EDJA 4OKVA 5CLWA 4XNXH 1VKXA 3FCTA 4PP1C 4J3UA 2PXYA 4LCIL 1YYMH 3ZHLA 4TPRH 3WLBB 2Z4QB 4CVXA 4Z7OE 4UTAH 3AS1A 3WSQH 1WWBX 4OFDA 1S7RB 2YSSA 5I1IH 4G43B 3RZCB 3IFNH 4IHOB 2ZWLT 1DQDH 2XV6B 2BCKA 3MJ7A 4H1LB 3VXSD 1KCRH 2CJUH 5LQBH 3DIFA 2NZ9C 3MOAH 3B83A 4HS6B 2Q8AH 3QSKB 3RGVB 3UTSA 4U33A 5GJTL 5IB3A 1KEGH 3TNNB 3MFFB 1F3JB 3SBWA 4HPYH 5AYUL 2HJKB 5DJ6B 3VXSB 4M3JA 3TF7C 4O5LL 3V6ZB 2R4SL 1JI2A 2H6PB 4S2SB 4L8SB 1XF5B 5HGGS 4P59L 1KT2A 3VW3L 1QQDA 4OZFG 4HG4K 3UYPA 4YIQA 4LDLB 4MJ5A 5JA8B 4ONHA 4OUUB 3IDMA 1DJSA 4LCYA 3V8OA 4JPVH 5C0AE 1WICA 1T7VA 2BHUA 1N5AB 5HHPB 2EDTA 5L9DL 4TULL 5DD0H 2F5AL 4JFDD 5DYOA 4MAYA 2NYYC 3E2HC 1XCTA 1H15B 4PY7B 1KB5H 5B3JF 1K5NB 2CMRH 3H42L 2L4OA 2BVQA 5JW3L 3RAJH 1PYWB 1Z5LB 3N50A 3G9VA 1S7XA 3WJJA 4WFEE 1KPUA 2A83A 1YMME 3CCHB 3BEVB 3LSOA 4YK4B 2BNUB 5FF6B 1MREH 3O6LL 2H41A 4PJBE 3WIHA 1K4CB 1YEFL 3IFLL 3O4LB 1YZZA 1NFIB 1SJEA 3WL9A 5EN2B 4L1HA 1F58H 3RIAF 5KVEH 1B0WA 3O6FA 1IGIH 3JUZA 2X05A 1PKOA 5K9KA 2YUVA 2NTSP 4RAUA 2VJXA 1D5BB 2MWCA 3HC4L 4ZAKC 2VLJD 1UH2A 5D93B 2C3GA 4CNIA 1X7QB 4PFEA 3W81A 4Z7WF 4HXBH 4TQEH 4K94H 2XZCH 5GRZA 5C07E 3F12B 1JTPA 2ZUSA 3SJVD 4NQDA 3ZO0A 3FT3A 2AJ3A 2I9TB 1XGRB 4X6CB 3BQUC 4LPXA 4KMLB 4NN7C 1NDGA 1HHHA 3LKPA 2APFA 2IALB 1PSKL 2YZ8A 2P8LB 4JPKH 1MAJA 1XIWA 4JQIL 5C0BD 4QHKI 2WWKO 4G6JH 4GRMA 1PLGL 3QDMB 5TDNB 1KCVH 4L8DB 1EGJL 4D0CB 5F8RC 1EVUA 3BN9C 1RZIA 3I9GL 3HI6L 3ROOB 1FLTX 4LEXL 1LEGA 1H3GA 3QXDA 1JCKA 4YE4L 5DJDB 4W70A 4NKIL 3GGWA 3ULUL 1N4XL 4JFPB 1KJ2H 3CDYA 4OZIB 3KYAA 4AEEA 4JEGB 3RWEA 1BLNA 4FXLA 2QSCH 2N7BA 4OZIF 1GC1H 4NQSA 5L2KE 2K9UA 3B9EA 5EU4A 3MR9A 1XGTA 4M3KB 3VJ6B 4KK8C 3MMEB 3M8OL 1FO0L 3MV9A 1KTKE 3UAJD 4IS6B 1D6EB 3OXRB 4JFOB 3RX5A 3WO4B 4ZUUB 2RBLA 2MJWA 4HBCH 4XCCH 3WEXA 4ZTOH 2OL3A 1TVBB 3D39E 4JY5H 5FUZH 1RZ7H 5MHSE 4FNLL 3MROA 1I8MA 5DVMA 4RIRB 2VXVH 2YOCA 4ZFOA 4JJ5B 1RURL 1YEDB 4FFYL 1AFVL 1LO4L 2I9LA 3EFFB 1HYRC 5JNYA 1QLEL 5DRWA 3BPLC 4XC3L 3WD5H 4XVJL 2LU3A 2ZSWA 3O3UN 1VKXB 4UT9L 4OCMC 4Y4FA 3D48R 1LO5A 2YA2A 4NQVA 3U9UB 4UNUA 3UO1L 5C0FA 3SGDH 3VA2C 1G9MH 5EIQA 2H32A 2HFFB 3W2DL 4P46A 4LMQE 3P4NA 4HK0A 3MJGX 1IGYB 5EU3A 4I0PA 5E9DD 1M6OA 1MJ7H 1IT9H 4LHJB 1MOEA 1CXEA 2GJ6B 2CPCA 2P8PA 1K9TA 3SDCB 3CX2A 5C6TL 2RQ8A 1D5XA 8FABA 3MBEC 4WW2A 2VLKD 4GOSA 2NY1D 4R0LC 4PJDE 4WFGD 5LCVL 4OZHE 3UXFA 4ETQA 3WLWC 4HDIB 1NFDB 3GKZA 4TSAL 4P2OA 2E9IA 4XHJD 2AQ3A 2QADB 3O8XC 1KV3A 1NFDF 2ITDA 4R97B 5E2WL 1CE1H 3JWDC 5I1DA 1D5MB 1KT2B 3ZDZF 1MLCA 4UT7L 4HMEA 5A3IC 4YIQB 2FL5A 3FB7B 2MMXA 1RJLB 3CU7A 5BW7A 1BFVL 5LJYH 3V8CA 1ZHBA 3LS5H 2FR4A 5GIRA 3SOBL 1LNUA 1NCBL 3GM8A 2WWMC 5KBNC 4Y16A 3QDJD 3ZMRA 3V5DB 4G3YL 3B2VH 4Z78B 3P77B 2D7TH 4O4YH 1N3NB 1S7TA 4KJYB 1S9KC 3B43A 4WHTB 1C08A 4LDOB 4RWHA 1XGUA 1BOGB 1J8HA 1F13A 2GCYA 3QDJB 4WNQA 5EZLA 1D5ZA 3LB6D 4NZDA 2SEBB 4TVPH 3F7YB 3BH8B 3P3YA 2EO9A 3K8MA 4NGHH 4FTVD 3WL9B 3WNPA 2OQJB 4F9LC 2R0KH 3GIZL 4Y1AE 4R3SB 4Q58C 1J05B 1UVQA 3OKEA 4M6OH 3C2AH 1KBGH 4RAUB 1RI8A 3VFUA 2HTKD 1RIVH 1J7VR 3JWOL 3OAZK 4MVBD 4U1JB 2DQUL 4RMVA 5I9QC 4XI5C 2HT2D 1NGYB 1BHGA 3GRWA 5D1QA 3GUTB 5FUOL 2WK2A 4APQC 1CDJA 4X4ME 1LK2B 2VWEE 2YMXH 5ESVA 5JUEL 4O58H 4NQDB 4XP9H 1O5DT 2BXZA 2H8PA 1WBXB 2XG4A 3MLPA 2EYSA 4O9HL 1HHHB 5F89A 3LKPB 3D2UD 4LPWA 5K93A 5EC1A 2YHGA 1T7YA 5HYEA 4QRTA 3NTCL 4GRMB 5IHZB 4PLKC 2Y72A 1FFOA 4OCWL 3WFHA 3C60B 1F4YH 3BUTA 1JGDA 4HAGA 1HXYA 2IPTH 1KLUB 4NCDA 3T2PA 2W9DH 2JB5H 1FGVH 5HHOD 1L0YA 4ZSOB 4OD2A 3ZTNH 1ZT7A 2CGRH 4WJ5A 3MJ8A 3QZWG 4I18A 1INEH 2WQRA 3MR9B 2K1MA 4AL8H 4UQ3B 3ARED 3TO4A 4P57B 4ODUB 3BEWB 1IZKA 2WZPD 3LH2L 3G08B 3UZVB 5J13C 2X4NB 2Z35B 3RDTD 3O3AA 4YR6B 2R0ZL 1BD2A 3EJYC 2DICA 3VD7A 1QHOA 1MCOH 3RGVC 3GSNA 5SWSE 3RPIA 2FO4B 4S10A 1ZEAL 1MFBL 4XMLL 2NY4B 1S5HB 1CD1B 2W0FB 4ZFFB 3SDXA 3CXDL 1B3JA 3RDTB 2I9LB 3TIEA 4D9RE 4S11A 2FHCA 1T1XA 2VN4A 4QKXB 3SKOB 4N8VB 5LBSH 3G5XA 4OCXL 4DUVA 5C0CA 4G8IA 2YPLE 1BVLA 3CDGB 5E0QA 4JRXB 1UB6B 3PP3K 1Z9OA 2W9EL 1JFQL 2EDHA 3HRPA 3V52H 4YJZL 5JPNA 1CLCA 3EHBC 1EHNA 5EU3B 1T3FB 3WYRA 1U41A 4G9DB 1T1YA 1MIMH 4KJWD 4N8CL 4PJAA 2AV7A 4I0CC 3MLUL 3X11A 3CFCL 1A7QH 4H20H 4PRAB 3SE3C 2FJGB 4AK1A 4WW2F 4X7DC 3CH1B 1WQVT 4YK4C 1X4ZA 1R0AH 1BQHG 3TCXA 4JQXA 5C09B 4QYOB 4XP1H 2RFXB 4FQJL 1RIHH 4U6YB 3B2UC 1RMFL 2QV2A 1OPGL 4LSPH 4N0RA 4D2NA 2MQCA 4U1NA 2FATL 5E95B 1M7IB 5K9JL 3DMMD 4JO2L 2WW8A 2WIIB 1OAZL 1GH7A 2A77H 4HBQA 4Z5RA 1VENA 1YEKH 3QIBB 4RAVA 3V4VL 1KXVC 4OGAC 1J0ZA 2Q1EA 2Y06L 3VGAB 1F4XH 2XKNB 4R7NB 2Q20A 5GGRA 2VUOA 3IF1B 3O4OC 3MXVL 5JMRA 5B8CB 5EZOL 1J0KA 1J8HB 5DK3A 3TVMD 4QTHA 2O26U 1CK0H