4Z3HA

Crystal structure of the lectin domain of papg from e. coli bi47 in complex with 4-methoxyphenyl beta-d-galabiose in space group p21
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
197
structure length
197
Chain Sequence
MAWNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGSWAYYREYIAWVVFPKKVMTKNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDQRAFDTANLCQKPGETTRLTEKFDDIIFKVALPADLPLGDYSVTIPYTSGIQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unexpected way nature improves solvation entropy
rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
molecule keywords PapG, lectin domain
total genus 45
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 4z3hA00
4Z3EA 4Z3FA 4Z3JA 1J8SA 4Z3GA 1J8RA 4Z3IA 4Z3HA
chains in the Genus database with same CATH superfamily
1MCKA 1OW0A 4UQ3A 4G7RB 2DQFA 2HX8A 3QFJA 4F33B 2GJJA 3SBWC 4PRHA 1Q0EA 2J3SA 4ZFOA 1EHLH 4BINA 1K72A 1OTTD 5KYUA 2V3FA 3VH8B 3BKYH 1TZHB 5FECA 2ED7A 3TESA 5FYJL 4ZMAT 1P9MC 4MJIE 3V8OA 3NYKA 4U0QB 4HJGB 4CUCA 4PJAA 5L4IA 3B7YA 2ORBL 1XGQB 5HGHB 2FR4A 4W4OC 4OFDA 2RCSH 1JZ8A 3D85D 1QSFA 4ALAC 1MSPA 5AW6B 2CQVA 3ML8A 5DWPA 5IROC 4BFFA 4OCNC 4QRPA 4KTDL 3JYBA 3GSXB 1GCFA 3SE8H 4D0BA 3NJVA 4ZFQA 2UWEE 4E9WA 1HDMB 2YLKA 1DJYA 4TQEH 1NPNA 1YHPA 4OLVH 5E6RB 2Y5TA 5D7SL 5JZ7D 3EJPA 3Q2LA 1CFNB 2Y7LA 3MHZA 3QXVA 3OC8A 4TS6A 5D2LF 1DBJL 4NQXB 4PW9A 3L6FB 3OHXB 3QG6A 1VIWA 4HLJA 2WCSA 4U4IA 2FO8A 3PGDB 5CGYD 1SM3L 4RWYL 4NJAL 1EFQA 3K5SA 3ZE1B 1NCJA 3VE0A 1GYWA 2HVKB 1KV3A 5TDPB 2V33A 3APFA 3VB8A 4O51B 4MNQE 1QLEB 4I9WE 4NAMA 6PAZA 3FZUC 2H0JA 3QWOB 4ZTPH 2A5UA 2MH4A 3FHEA 1S7VB 2BFVH 1G0XA 2CZNA 4QXTB 4XAWH 3ZT6A 1GGBL 2IWEA 2Q76B 4MJ6A 4XPFL 2Z8RA 3SE4A 3ZTEA 3MNDA 1J1OL 1QO3B 1F4XL 3AU1A 1NBZB 5AYQA 1Z9PA 4LL9A 1RK1A 3OJ2C 4XBGB 4X8GA 4ZPTA 1F6AB 4N2BA 4BELD 2CXKA 4NKDA 4GMTL 2WWOA 1WEJH 3SDXA 4URKA 4FQCL 1WS7A 3P9MB 5CKAA 3OL2A 3SOBH 1SEBA 4GH7B 5JDSB 2EE6A 4C4KO 5CBEA 4LAQH 2C9VA 1HH6A 2CR0A 2BNRB 4LZKA 5DI8A 2FD6L 3NFPB 1SUHA 1E65A 5I74B 3OB8A 4BJLA 1IT9L 5ALCH 1L0QA 2Y7OA 1M42A 1VFMA 1CFNA 3FB6A 4GRLC 5D1QD 5D9SA 1QACA 2W0KA 5FYKH 5FA3A 5EZJB 2VM4A 3PP3H 2PN5A 1KIPB 4IMKC 5CZVL 4BSWA 5EF2A 1FVEB 6CGTA 1U8HB 3ETBJ 3SKOA 3CZEA 3DIFA 3OF6A 5FYJU 4UT7L 3EZ8A 4ELMA 1N64L 1TIUA 5I8CB 3QEUB 3LHAA 2OPCA 4PJGF 1AHWB 3HAEA 4F3FA 4PW4A 2WZPD 5FYKU 2CM5A 4JG1L 1JI2A 3HW7A 2EYRA 2N7SA 3MYZA 4MSWA 4MAYB 1P5UC 2AXJA 2HN7A 3KYKL 3MODL 2B4CH 1OTSC 2CRYA 4ZUWA 2WSKA 2F8IA 3KR3L 3PP4H 1TQBB 5KG9B 5K9KB 1GGCH 4PRNB 5D7LB 4D8PA 1E3XA 4E41E 2YD9A 5ID0B 1GMEA 4N0FB 5CSZB 1A0QL 2AJVH 4O02H 3CZNA 1RK0B 1KLGA 2DTML 2W60B 4J1UA 5ANME 2YS4A 4A2DA 1JGDB 5E51A 2VC2L 3ARTA 1DFBH 3IJSA 1SEQH 5FOBB 2HRLA 1NCAL 2H1LM 4EDWL 3KCPA 3RNQB 4NUMA 1XB8A 4AEFA 4IHOA 5CINH 2K0RA 1WFOA 2WLLB 4UAHA 2BCKA 3NJXA 3Q2CA 1QPKA 1R5IA 4LSVH 4YMPA 1A4JA 4LBEA 4MDRA 5FHBH 5C07D 2XG5A 2WAHA 1AXTH 2O5XL 1S7WB 3Q48A 1W8NA 1DBBH 1UVQA 3H2PA 4APQB 1IAOB 4RISH 3LXUX 3CVIH 1OALA 2VN3A 2VDPL 2BXYA 5EWIH 2FATH 2W38A 3P4MA 3T4YB 2BRRH 3O4LE 1WTLA 4ZNEA 5ABZA 5DUBA 2AXHA 4HJTA 3QIWC 4HJIA 5KUMA 1DBMH 2ZX9A 3RURA 1B3JA 2WJ7A 8CGTA 5GRVL 2OMZA 1FSKC 2VIRA 3VXMA 1I4FB 3KXFD 3REWA 1XR9A 3BSGA 4AIZA 5CEZL 3UABA 2X5PA 2GJ6D 5IBUG 2CLVB 2LABA 1K5WA 3QPQC 4UT6H 4NRXB 3CLWA 3GXDA 1MF2L 4UINL 4LSUH 4PU2A 1TT6A 1YEWA 1MFBL 1H9VA 3V5DB 5KANI 3BSZA 2BNQA 3OR6B 1U8LA 1Z3GL 2ZCLH 3VFOB 4JO4L 3E8UH 3F00A 3BUTA 4AIZB 2AQ1A 4GBXA 4MCYB 3MREB 2CBQA 2FUQA 4TVPD 1KACB 4UBDD 1N10A 4CVWA 3RTQA 4JKPH 3L3GB 1UD3A 3C5JA 4OI7A 5LN8A 1QFWI 4KNSA 3V79C 1KY6A 3U25A 4PWIA 2ZIDA 4D9LH 4UV7L 2VXQH 1LO2H 1NMCC 5ADOH 3U79A 1P6FA 4OGZA 5DTFA 3VXSB 5D2LB 1OTSD 1M71A 5TPWL 2DQIL 3CFEA 4RZCA 4OJFH 2GY5A 2WZ6A 4PY7B 3V4VA 2UZYA 1HHGA 3GI9H 4ODUA 4P9HL 4BKLA 4HIIA 4KI5F 2C3VB 4HDIB 3GJFH 4AQEA 3F7RA 4R4NC 4OFIA 3U0PA 3V5KA 1NFDE 2I9LB 4LLMA 4LNRA 4QOKE 1DQLH 4YWGH 2CJTA 4GRMB 1JZDC 3HEIB 1W16A 1QFWM 5J6HB 5FPIA 1IGYB 3GMPB 4AC4A 3FU5A 4XH2B 2ALAA 3A6BH 1UADC 1K4CA 1C5CH 2M8XA 3ARBB 1TJXA 4N6RB 2DIEA 3BVNA 5G5DA 3MUGB 4JJ5B 2MNJB 4KGLA 1E5CA 4NJ9H 2XTJB 2X70B 2LOEA 1U8PB 4HK3J 1WZLA 2NTFB 4XN5A 1TOXA 1U95B 2F58L 5KVFL 3N85H 2R2HA 4YX2L 5JHLA 2VN4A 4YDKH 4YHOL 4WF7A 3B6SA 3CVHL 3U6XS 1CR9H 1XXFC 3LZPA 3PQYB 2NY0B 4PJIB 1R3IH 3ENEA 5FO9B 5AW8B 4DPRA 2FSDA 1S3KL 4WUUB 1H9DA 3IPBA 5FS5A 3STLA 3LEYH 3UP1A 3U0WH 5HHMB 3K1DA 4GI8A 4WW1B 2EKSA 3KEDA 3EGSB 3F7YB 3JTBA 1FDLL 1ZK5A 4ZW5A 1MAMH 4PCSA 3VDBA 1CT8B 2AJUH 2R2EA 4DUWA 1E8ZA 1UXWB 4U1JA 4E9LA 1NCNA 1A1OB 1OGPA 4ZAKD 5LNGA 3S3JA 1MQ8A 4OUUA 4OFYD 1E4XL 1ZA6A 4JQIA 1SFDA 2LLLA 5IESH 2DM7A 5AYUL 5FEBA 5JOPD 1A0QH 5DS8A 1OLZA 5HHNB 2BOLA 4IJ3C 4GSXA 3UX9B 3TA4D 2YD4A 3CWGA 3U2JA 5CBEB 1YEJH 1RIHH 3CN2A 5KUKA 2XWBA 1MG3C 3PWVA 1ONQA 3IMTA 4UBDC 3DXAE 1S4IA 4WHYH 2DD8H 1EJOL 1YEFH 1PPIA 3LV3B 1BJ1H 2E8ZA 5G4NA 4LOUC 3VXQB 4Q89A 1IBZA 3COOA 3FBQA 1H3PH 3C5ZD 3CFKA 4WI9A 2JTYA 3E3QE 3IDXH 1XH3A 2EIKB 3ZIMA 1UC6A 1OF0A 3IKCA 3EOTH 3MV9D 1IGJA 1E5BA 1JV2B 2OAAA 4NB7A 3L3DA 2X3AA 1MCOL 4GP4B 4PJBE 2YKKA 4YSPA 3GJEA 3QZWB 3PJSB 2ZJSH 4QHLB 4I9XA 2CIKA 3QDMD 1NC4D 3SDYL 1TTBA 1KCBA 2AQQA 7PAZA 1UH2A 2IH3B 2WUCL 3LVEA 5E2VL 2WTOA 5IFHL 3MRQB 1B2WH 3HOGA 3B34A 2UY6A 2NY4D 5I82A 5C0FB 2CO4A 1CXKA 3VE0B 3ISYA 2B14A 2WWNA 3DHJA 4N0UA 2CMRL 4AEIH 3PHQB 5C0GA 4TNWK 4ZUWB 3HHSB 3RP1A 1Y1UA 3IXAB 3HMXA 1TQVA 4UM8A 1RMFL 5IB4B 1H0DA 2WKLA 4IU3B 1QUNB 2R0KH 3MLXH 3WAJA 2D7NA 3M8OL 4RWYH 4L3ED 4K7PX 1BZ7B 5HI3C 1IC4H 4BK5C 3HG0A 4YO0B 2DLFL 2DQCH 3BKCH 1CTMA 5E99L 2FQFA 2NY0D 2Z7YA 3GKWL 3HKFA 1KCUL 3CC1A 2WIIA 3FB7A 2MCAA 1M2VA 3CZFB 5LHDA 3GSNA 3Q06A 2MCMA 1VERA 1V7NH 2HJLB 2KMWA 4YO0A 2CPCA 4P5TA 3GMMB 4XN2A 2B5IB 3OZ9H 4NUJB 1LO3L 4PJHB 1RZFL 4MD5A 4U6XA 1LMKA 1CYWA 1F97A 3WMQA 2LU4A 3TYFB 1FNHA 5HHVL 4X8XA 3HHSA 2FX7L 1WFNA 3CDGB 3T77A 4QI3A 3H9ZA 3QUMA 4F15B 3ULAB 3CN1A 3DRQB 1QUNA 3OKKB 1RZ7H 3H9SE 4HD5A 4OD3H 4ZAKC 3P9MA 1JRHL 3DIDA 4NO2A 4AQ1A 4HEMA 3OM3B 2ZNXA 1PY4A 4KQ3H 4L4VA 5DLMH 1GL4B 4LHQB 4UQ2B 1AP2B 4N9OB 5F7DA 1T0MA 2HX7A 5FW6A 1OD7A 4IBVA 4RLDA 3GI8H 2E0PA 4YXHH 2EVFA 1Q9KB 3SE3A 4WTXA 1TCRB 1WP6A 5BVPL 4NO3B 2ZKYA 3KM2A 3FL7A 4R6UA 3SQRA 3HR5A 3GEFA 1QQDA 4PHXA 2H3KA 1T1YA 4XMPL 4NO5A 3ZQWA 1WA1X 1NGYB 2DMBA 3MRLA 2XTSA 4BE5A 4LESA 5CGBA 3ZTNH 1NAKH 5DJAA 2XWBB 1RP8A 4ZJ9A 4AJWA 4OAWA 1WIOA 3QZPA 1LO5A 1J11A 1NANI 1TTCA 3CDGA 2FT6A 4DIXA 2C9UA 5F9DC 4F8OA 5HVWA 1RUKL 3ARGA 5FR3A 1HE7A 2ICWA 4XP6L 4YDNA 4HWZB 4W9EC 4L3CB 4MD5B 4YUEL 4X7CC 5D1ZD 2IH1B 5DO2D 5F9OH 1YYLL 2B0SL 5JZ7C 4HFUL 4OJDH 2TRHA 1A2YB 5IQ9B 2AW2A 1AGFB 1UB6A 3BH9B 5LWYH 2DMHA 4LU5H 4U31A 5AWNH 5SWZE 5TE4L 2PMZA 3FXIC 3QFDB 4JPIB 4RAHA 3QXTA 3ZR5A 3WUZA 2O6FA 2FWSA 3NRQA 1DYZA 1UT9A 2EDRA 5HI3D 1C5BH 4PGBB 2PR9A 2VQTA 2GW5A 5HY9B 3W39A 2XN0A 5E70A 5DEFA 1HKLH 3FZUD 2NY0C 4HBCH 4PJEE 5IB2A 3PWLB 3MTXA 4XZUA 2IMNA 4LLUA 4G6FB 4PJIA 5CLTA 4LHUB 3UIZA 3FUDA 1E43A 4UQ3B 3VGEA 4F27A 1MY5A 3X12A 4WI0B 4X4XA 1EXUB 1N6VA 4MXVE 3U9PL 2DMKA 1GHFH 4L1HA 1LK3H 3NJMA 2J7LA 3GZQA 3SYCA 5EPMA 3U9WA 2WBWB 1FWXA 3SDXF 2E4TA 3FTSA 5AZ2L 1SY6A 3SJVA 4MHHI 1Y1DA 4ZMOA 2YD8A 1MCLA 5CEYB 3P4NA 2QADB 4XCEB 5CD3A 4W9GC 1WFMA 3VRLF 3TBBA 3C8DA 4AVIA 1YQVH 1TTAA 3ATDA 5TDOB 5B1JA 2D3VA 2GYSA 3FUIA 1OAXH 4G7YH 5TFSH 3ZVVA 3D69B 3EFFB 4JG1H 1VFBA 4KRLB 4W9CC 1EDYA 3RU8H 4HG4J 1LVEA 1GPOH 1YVLA 2HJFA 4LVOB 3UYOD 1CFSB 2EO9A 1UASA 5B8CC 4UANA 5E9NA 2Z8VC 3PWVB 4D9QD 2ATPB 2AKRB 2DQ6A 4YVUA 4OV6F 1GYCA 4FD0A 5FGRA 1ORQA 2ZXCA 3T09A 4IBSA 5TDOA 4RGMB 3IM1A 4JLRB 3INUH 1YEHL 4JZJB 2ZWZA 4MLSA 2BWIA 4Q56A 1NMCB 2R83A 2EXYD 4FFTA 1QW8A 4U1LA 4S0HA 1ZT7A 2EDXA 2YLHA 4MJ5A 2A4ZA 4UTCA 3D1MC 1LD9B 5IR1B 1E8YA 3K2UL 2ADGA 5JR1H 3OG6B 1HOCA 5F89B 1A6ZA 3IBEA 5H94A 2ZWSA 2QSCL 4WI5A 5I76B 5EPMB 1KJMB 2K4AA 3MREA 2WLIA 3Q8AA 2R2EB 1DBAL 3TEYA 2ARWA 1IBDA 4QLWA 4NDMB 3VB9A 4HMDA 3VSUA 3WS3B 3IKKA 1K3ZA 4PRIA 1KY7A 3T71A 1VGEH 4OCSL 4QAMB 2PW1A 1A1NA 3OMIB 1MHEA 2BY0A 4O2CB 2Y7SA 3CNKA 4PREA 4HCRL 1PD1A 3NDYE 4M1DL 4WHCA 5DO2C 1TITA 5JYMA 4AQAA 2OJEB 4GG6A 4RGOH 1LO3H 4HG4K 1J0IA 1ZT4A 3B6SB 1F3DJ 3DVGB 4YQXH 2A9AA 3KG5A 4K5NA 4ZDHA 1I3UA 5T1MA 1MRFL 4DESA 5DR5L 2D7QA 5LKNA 2MIZA 2VDKH 2NTFA 1T04A 5IOPA 3V6OC 3UTTA 3SE9L 4X9BA 1JPSH 2MFNA 1JJUA 2XN2A 3DHPA 4JQVA 1KIRB 2GJRA 1WWAX 1ZY9A 4G6KH 4WWKD 3S88L 5E9DD 1ORQB 3NG5A 2X28A 3C60D 3PWPB 2WZ0A 5C0AD 2IXQB 2X4TA 3BAXA 1F90L 1ZE3C 4D9RE 1XGTB 5KW9L 1XGYH 4AEHH 3QYNA 3GZKA 1WD9A 4U1LB 4P59H 4XN4A 3RVVC 1NBYB 3IJHB 4APQC 5GGRA 2NQDA 4N90E 4PJXB 3PPEA 5D6CB 4D9QE 1ET7A 3A4DA 1HNGA 2H0FA 2NY1B 2JMRA 1RZGA 4A2GA 3TNMA 3AY4A 4X6DF 5JIDA 4D0DA 4L9LA 4BXVA 1MI5E 4MQ7B 1A6PA 4FHKA 4JZNA 1XCTA 3MLTA 3MUJA 1P6AB 3HLAB 3IFOB 5IQMA 2GY7B 2XIDA 4I77H 4UQIM 5TGBA 4FXLA 1OF2B 4Z7VE 2V7NB 2Y7NA 1FFRA 3G08B 4PJGB 4EOWH 5CEYA 3QPQD 5F3HA 1MEXL 5JPMC 1P2CB 4WWPA 4RDQF 2Z31C 2DQUH 3QEQD 4XZUB 5CJXC 1TQBC 2A0LC 3VA6A 5K1NA 1WCQA 1J10A 3BP4A 3IFOA 2PCFB 2X89D 1C7TA 2YWZA 1MFAL 3LZFH 1AQKH 1R3JA 4UT9L 3QFGA 2AJYL 4M8UA 4O00A 4F9PC 1P5UB 1TG8A 2Y7QB 2ZOKA 3CU7A 3LKQA 4H5SA 1NC2B 4Z95H 3T4AA 2VDRB 1WBXA 4ALAL 5IIEB 2B3IA 1ZV5A 3QIUD 4WNSA 1N5YL 2OZ4A 3GGWB 4KZ0A 3ABGA 3OKDB 3EFOB 1XTMA 3JZYA 4IGBD 4YDMA 5BRPA 4J4PA 4ZSOA 4GBXD 3L7FB 1JNLH 5L8LB 4YXLH 3MCLH 4I85A 4UV4H 4PRID 4MTMA 4KK9C 3P4MB 5GZOD 3EO0B 3BHBA 1KIUA 2QLYA 2J6EA 3GBMH 3X11B 2XYBA 4QGTA 3QR0A 4AZUA 5I74C 5FA3B 4JN1L 4YBQC 4XX1E 3X17A 1GC1C 4NGHH 3V52L 3D2TA 4E5XG 3KXFB 4MJIB 2ICWB 5EUKB 4HX1B 5EA0H 3VXMD 1NGYA 2AEIT 4WEBH 3DVGA 2E76C 1KYUA 5L6YH 3PHQA 5HXMA 1WA2X 5AKVA 1J7VR 3N41F 4I1RA 3O6FA 3BP7A 3DROB 4W4NA 5D71H 3UYPB 5HHPB 4X6EA 3TEWA 1M4KA 1BBDL 2I5YH 3CZUB 3OG4B 4N2MA 4B9ZA 3HUJF 4LOFA 3PJSA 1MCCA 4APQD 1S9WB 4G6FD 3PGCB 4XWGH 2A4CA 3WY3A 3DROA 1CGSL 5EUOE 3VQ1C 4QXTA 5E5MB 1H8NA 1EFXB 3NJGA 5DYOA 3HG3A 3BAJA 1PS3A 3APMA 1GGIL 3RWIB 1Y6KR 1ED3B 5EUKA 2YD3A 4K9EH 3D08A 3PHOA 4PV8A 4S1QL 4DZ8B 2IFFL 2C5DC 1KGYE 4DVBB 4IOFC 1F4WL 3IETB 3K6IA 2CJUH 1QWHA 3BHBB 4K7PL 3MX0A 3GHEH 2VZ3A 2DJMA 2EH8H 4H8WH 1BQ5A 4MQSB 5B38A 2C1PA 1SBSL 2W92A 3G6JA 5FC9A 4S0SD 1H3VA 4YXHL 4G5AA 1UZ8A 4PFEA 1TQTA 3CXHK 5HHVH 4YLBA 5T8IA 3OAUL 2WAQA 2J72A 1DQTA 1I3RB 1X5XA 5AW5B 3EXLA 2EVJA 1H0DB 1MFDL 2E9IA 3S8WA 4B5ZA 3C2AH 5CMAB 4RFEB 4UOJA 1CGWA 4BWTA 1FJ1A 4PV8B 5DU7A 2FLMA 4LFHG 4MAUH 4ODTL 4V2BA 2AK1L 2I60H 2GAZA 4IBQA 4AQ8C 3RTLA 1HL4A 3UGEA 3ARUA 3IVKB 3TCXA 4Y19A 4YDLB 1HCFX 1MFCL 4XNXL 4LSSH 4M5YH 1MCOH 4NCC1 1W72L 1ZS8A 4M7ZB 1G7IA 4X6FB 3IDYB 3K7UA 1EV2E 1T1WA 2NW2B 2JI1A 1E9QA 1Z7JA 2NXZC 2BOCB 1A7OH 2E75C 2X4NB 4J8QA 5E6IB 3S2AA 1FO0B 1IIIA 3Q44A 3H4HA 4ZFZB 1CICB 1OAUL 1NFKA 3E38A 4NBYB 4XBEL 3SDCC 1BF2A 2N59A 4PD4K 3D0VB 4PJXA 4PVNA 3JWDC 2JCWA 1HJCA 3B7SA 1GZHA 1FNGA 3S3BB 2QHRL 3T0DA 4NFDA 4KHXL 3V9EA 4M5SA 2VQ1A 3OC5A 2JJUA 4TUJB 3MRIB 1IFGA 5D72L 2WLZA 3FONB 4MJJA 4XP1H 2AJUL 1HHKA 1PZ5A 4ELKA 4WKXA 1IC7L 3U2SA 2OR7A 5E4AA 3BQUB 3H0TA 3KR3H 4S2SA 4JS7A 3QIBC 2YMXL 1EBPA 1U4EA 3QUZD 1CDGA 1FYTB 1QLEH 1PIFA 3UC0L 4Z7UB 1J0HA 5E94B 1V3LA 3GPEA 4NP4H 3IU3A 5HYSB 2FL5A 1KF9B 3FTGA 3UXFA 4KRPB 5D6DA 4HFWB 3PDOB 2BP8B 2JCCB 4BXSV 1QBAA 5MEPA 4W9LC 4G11A 4TVUA 1BD2B 3VXRB 2OFQA 3QDJA 4TL4A 3B9KD 1G0DA 2IWKA 2ZCHL 3RFZB 4S1DD 5EU7E 2IANA 4HZLA 4YL4A 3AZUA 2DOCA 2E6PA 3OMZA 1NC4B 4NZTL 2PETA 3WNIA 3D85B 1T2QH 1I7RA 3WJJA 3CFJA 2WQXA 3N42B 4L1BA 4R2GB 1NIAA 4BQBA 1I1FA 2ITFA 1TJIL 4I3RL 4MZ2A 1OE1A 5MI0C 2A6DB 2NY3B 3RU8L 4OI8A 4WFEE 3ET9F 1WWBX 3GWJA 4TNWF 4M61A 2HKFH 3SDAB 4Y19E 1PG7H 1OHZA 1ZEAL 2G75B 3Q1EA 4FLRA 1M2VB 1SQMA 2F1BA 2WXGA 4WO0A 4YLCA 3VJ6A 2D0HA 2WY3B 2KHAA 2OW6A 1C5DB 2P24B 2VW7A 1MLBB 2WLYA 2EKJA 2EO1A 3D33A 4WEEA 5AVRB 1Z5LA 4F7TB 2HT2D 3FUNA 3EXJA 1HJBC 3NSCA 4CDHA 3LZRA 3TWYA 4ECNA 1I9RH 2KDGA 3FU8A 5KJRH 4W1TA 2OP4L 1JXDA 3VXOA 3GIZH 4JPVL 3LRLA 3UYRH 3B56A 4POZC 2OXGB 3WEXB 4AKOA 2OZ4H 3V4VB 4M5ZH 3GTVA 4KI5E 2P24A 1CCZA 5AD0B 4BSJA 4ZX3A 3BESR 3H3PH 3KLQA 3QUZB 1FF5A 3WE6B 5I1LB 2CSPA 2JTDA 3QG7L 3T8VA 2H0PA 2IQ9H 5KVMC 1UZ6E 3IDJB 2XETA 3ORJA 1I82A 1WHPA 3SDCD 2B3RA 3TFBA 1MFEL 2DQGH 4NQDD 4FQXA 4K7PY 1NWOA 1U42A 5B21A 5EIIA 5BNXD 2HG5A 5IMMA 2NR6D 3UAEA 4H88H 3CLFL 3BVDB 4WCYL 5HHOE 1OXYA 1BJ1J 3HZMA 4PJ9D 4Z7OB 4G9FD 1GYUA 3KGRA 3OJDB 4KXCA 3VFMA 4YK4C 5DFTA 1AO7D 1YPZF 4X5RA 1ZPLA 4S11A 1FPTL 4KTYA 1A6TB 1KXQE 5F44A 4W9DC 3IAGC 3W3BA 1A14L 1BEYH 1U8HA 1BPLB 4NYLB 4PJ5B 1E9OA 1P0SE 2RFXB 2YAPA 4G8GA 3WY1A 1CIDA 2QFRA 2HKAA 4XPTL 3QWQB 5H2BB 3GNMH 4ZMYA 5DQJA 4AIXA 5FK9A 1I8IB 3MA9H 5DXWA 3OR7B 1VJSA 1TQUA 4U1JB 3B9KC 4I1NB 3I6KA 2VDNL 1E9PB 3FQNA 3NGBB 2CJSA 3O3EA 4KDWA 3DWTA 1UGNA 4HCRH 1U3JA 4HUUA 4TUJA 3CFCH 2HG0A 4JDVA 1PZ3A 2EXYC 2NDGA 1LO0H 1NA8A 2IMMA 4FQ1H 5A16B 3VTMA 1V3KA 4BZ1L 2A9ML 2TSAA 1F4YH 5EOCH 1DN0A 1LWHA 3H53A 4X6DA 1DEDA 3UZVA 3TF7C 3VFMB 1OARH 3OJDA 4OKVB 2Y1ZA 5CNHA 3AMKA 4HEME 5TE6H 3Q01A 2OCCB 4Z5RB 4R97C 4NKMB 4WGKA 1QSZA 1F3RB 3I02A 3O2WH 3PP4L 4TVSa 4RH4A 1JV5A 4MS8C 3NCWA 1OWWA 4F80A 4DAGH 3H85A 1XF3A 3OGCA 3WSQH 1JHKH 3QP3A 1TJGL 3MLRH 1JGDA 3MV7D 3BFQG 1KXTA 1QI4A 5BO1L 1U3HB 4B27A 2HFFA 5L9DH 4PWKA 4JHAL 3PP3K 3DARA 4UNTA 2X2IA 2NQCA 1O7SA 1IMHC 3VFSB 1B4TA 4POZD 4HAFA 3SDDC 5DMJB 2OI9B 2AJXL 1R4XA 3HPJB 3KVPA 5D2NE 5LCVL 4N8CL 3O9WB 4DVRH 2UZIH 3NCYP 4QO1A 4R7NA 1S7TB 3UJTH 5FHBL 3WEXA 1SJHA 2H7WA 3QUYB 4XX1G 2X53A 3VNYA 3WXWL 4ZYKA 3LHPL 2CRIA 5I6XC 1SMAA 4TTDC 3F7VA 1F56A 5F1KC 2J71A 1NBVH 3V4UL 4HPHA 7TAAA 3CFEB 4RZCB 1TU2B 4U1HA 1HL8A 5DYFA 3CDCA 2VWEE 5FYJE 2GTWA 2YPVH 4JZOA 4WFHD 5ESQB 4FRWA 2CDEA 1DQJA 4GKOA 1AS6A 2AEQH 2NR6C 3VGBA 2ZKMX 1BLNA 2FECI 3VD5A 3ELAT 4PRDB 4K3JH 1D5XA 3QI9B 4P2RE 2W1NA 2IH1A 3R0MA 1BVNP 4CKVX 4ZMVA 3PDGA 5CN2A 2KZ1B 4F9LC 2AJYH 3RZWA 2YPLB 1K4DB 3MJ6A 4LRNL 4PJIE 4JQIL 4PSPA 1L5GB 1QOKA 4MA1C 4PCTA 1QUPA 3CDFA 1HHIA 1AIZA 3MBXH 1VACB 2DQEL 3OKLA 4L8CA 4NQDE 3ARXA 4NUQA 1OCOB 3T0XA 2AEOA 1OGAB 3GBEA 5EBMA 4PS7A 3ZDYF 4OZIB 3PDDA 2VH5L 5EF1A 4IGBB 4Z7IA 2Y23A 5AAWC 3QNYA 3WY4A 2EVIA 4PJEB 2H1PL 3BUQA 2YQBA 4G9FE 4UQ2A 3ZQ9A 1IAIL 3A23A 4DCQB 3JBG7 1FI8C 1B4JL 2ARJQ 4G8FB 3MA9L 3T4YA 4ISVA 3DMMA 3DX7A 1A9BB 3VGAC 5D2NB 4I5BA 1IVLA 1E4HA 3GHEL 4UQCA 1CO1A 1AH1A 3PHAA 5LUMA 5JLZA 1XD0A 2IADA 2OMNA 4P5MA 5AW4B 3ZE0F 4JFEA 1FL3B 1J05A 1QHQA 3QFJE 4OIIL 3UP6A 4HEPG 2A7BA 2MEJB 5I2IA 4Q52A 5SWZA 1NFAA 1ZIAA 5BZZA 4WSJA 3P54A 1WWWX 5IB3B 4XN8A 5E6IA 1MOEA 1FG9C 3P1VA 3FTUA 3SDDD 5AL0A 1WZAA 2IV8A 4ZUTA 4DGYL 4P3CH 1KYOK 2OMVB 4A2HA 3INOA 1C08B 1L9OA 4PV9B 5DJ2A 1A5FL 4P2RD 3VI4F 5F7LB 1M7DA 3CLEL 4PJEA 3HG1A 5T3ZH 2FWOA 2LHAA 1JF1B 5D6DC 4HWBA 4Y16B 4K3GA 4ZTOL 4DZBB 1ND0B 9PCYA 1A47A 2FE0A 2CKBH 4J3OD 4R83A 1SYSB 4XB8A 2BHUA 3U48A 1FC1A 4A2FA 4M62L 3STBA 4FABH 3CPLA 4H26B 1UCBL 3OF6D 3Q0HA 2LAAA 4FJ6A 1X5ZA 3HI1A 5K1JA 5C0BA 4Z77B 2B2XL 3K46A 1FAKT 2VDPH 4YPJA 5GS1C 2PTUA 3H55A 1JG9A 4LCIL 1AHWA 3HAEB 3DA0A 5FFLA 3GK8H 3QIWD 4R7DA 1B6DA 2HT4C 3QUZA 2VN6A 3LPFA 2V5MA 1RPKA 4NIYE 4V1DD 4PRDA 3APDA 1NUNB 1T20A 3HC3L 5H4YA 4YXKH 4YHZL 1F0LA 3FSWA 1NGWA 3P40A 2P5WA 2VLKA 5CZXC 4AGQA 1P4UA 2AK4D 2FWOB 2JI3A 3EYFB 3GIVB 4LNVA 1JN6A 3NJLA 1PLGH 1SEQL 3CFQA 4ETQA 5BUAA 1EAQA 3Q13A 2APSA 4F7TA 3NIFB 1YEFL 3S36H 1YJDC 4HU2A 2CHDA 3NIDF 2V0AA 3ARFA 4Z7AA 1LP9F 2CXGA 2ESVE 4NHCL 1KULA 3N50A 4PTUB 3WKNA 1U3NA 4YBLB 3F12B 4OIBA 3ARFC 2C7FA 4GO8A 2OM5A 1P4BH 4N9GB 3MLPA 3LS4L 3OLEA 4YSRA 2Q9OA 3PY9A 4NQQA 3LRHA 2OL3B 4S0TD 3W2DH 5D55A 4LAJH 3NZ8A 2JNZA 2FHFA 4KRNA 5F96L 2VLRA 5A2IH 1NCWH 1CL7I 5J1SC 1BVNT 3QEGL 4PJFF 5A2AA 5IJVB 3OPZH 1UXSA 3ZTJG 3RE0A 4B9PA 5JW5B 3TC9A 1M05A 1A7PL 1WO2A 4OF7A 3MLYL 5KVGE 3TZVB 2VN5A 4ZW6A 3PE9A 3T1WA 4FNLL 4I3SL 3HG1D 4JFYA 4J2QA 4Q6KA 4PH8A 1BQHB 3LXBA 1PL3A 1VA9A 3K6SA 3E1F1 5BVJA 5EN2A 4G82A 4IDLA 3RPIB 3V0GA 4DP8X 2F74B 3X11A 2DQHH 3LNFA 1A7BA 2DLEA 4P57B 5JMRA 2QV2A 4L1TA 4E41A 5L0QC 3MLUH 4B9KC 2J6WA 1K6QH 2WWKT 3B2XA 3QI9A 4NZRH 3QFJD 3I84A 2ADFH 1DVTA 5E8OA 1AD9B 1NGXA 1YSOA 2GSGA 5DR5H 1JWSA 5AVWB 3DI2B 3R19A 1DUZA 4RETB 4ZUVB 3QQ4A 1U8CB 1S7RB 5F9OL 4H8VA 1QFOA 5F1IA 4MX7A 1S7UA 1T4KA 1D5BB 3QIBD 2HT3D 1UUSA 1Q9LA 4ZOCA 3CZKA 1S6NA 2DWEA 1TQSA 3IFNL 4XVTH 2ZPKL 4ZMQA 3ZHNA 3DV6B 3QDME 3KYOB 3SJVE 3EH4B 3IMBA 3B7UX 4U2YA 4TPRL 4X7EC 1FZKB 4OCWH 4ANXA 3IS0X 4PP1C 3H42H 3JWNE 1OF2A 1NEZA 4J3OF 1EO8L 3MJ9H 4MCMA 3QR2A 2BZDA 4HWUA 4X9IA 3WHE1 1FG2A 1UWEL 3FBKA 3EHBC 2VUKA 4MJHA 1RVFL 1VDGA 4K5MA 2R2BA 4BGDA 1KCKA 3R06A 5DFWH 4D9LL 1QR4A 4PGDA 1MFVA 3REWB 4JJHA 3UTQB 4LASL 1UWGL 3DVNA 3MLWH 4HWBH 2O5ZH 1ZE3H 3NT0A 4ONHA 1DVZA 4BFIB 2XSKA 3EBHA 3FQRB 3BVTA 5GZOA 4K3EL 5DJ8B 5AW7B 1P7HL 5I6OA 2QHLA 3AADB 5MHSD 3I2CL 4EVNB 3VD9A 5E24E 2NY4C 4JHZA 3T2PA 4LRIC 4CC1A 2DW5A 1V3JA 1BZQK 2FUTA 3MBEB 1L9TA 4WCYH 4OCWL 3TOPA 1YPZE 3ZRFC 4FQQB 4XODA 1T80A 3HE6B 4G59C 3OHMB 4XOAA 1RFDL 3QCUL 5IFJB 1XIWD 4OCXL 2YOCA 3P3RA 4PJ7F 3LMJH 4Z7UE 5EEXA 2WLJA 3QRGL 3DK2A 3MCLL 1IC4L 4UV4L 3UAFA 4KVCL 2P8PA 4YN3A 3T0EA 1OSYA 4FADA 1NDTA 4YEFA 4N22A 1QSVA 3NIGB 3EOTL 5ENWA 1X5FA 4X6EB 1CD1B 4H20L 3E6HA 2BIMA 2P28B 2Z91B 4PJ9C 2QSQA 4HIQA 3QXAA 3VM5A 3UO1L 2V2XB 2Q86B 1XZWA 4L4VB 3SE8L 2IBZY 4YXLL 1J0KA 2MHAB 5F7MC 5AVTB 3V5HA 4OY9A 4DP2X 4FGMA 4NFCA 4Z3HA 3KWWB 1NDMA 3MRIA 4U7SA 2ZCHH 3A4FA 3LRSB 5L2KB 1FLRL 2XV0A 3MRFB 5TQ2H 1B0GA 2DWDB 4L29A 4NKIH 3PAZA 8PAZA 5IEKA 3QB7C 1T4KB 3ARQA 4QHNB 1URZA 2X12A 4TSCH 1HNYA 3FQTA 3HS0B 4WJKB 1JGUL 2IG2L 4A6YL 4Q9RH 1NEUA 4FX5A 1IFRA 3X3FL 1TPXC 4GRWE 5D6CA 2VDLB 2WTRB 1T03H 4K7FA 5MHSE 4RMWA 5FO8B 1N70A 1UACH 4F7MB 3BPLC 4JAMB 4F37F 2C3XA 1LO4H 2OV0A 4XP5L 5DDHB 3BP6B 3SBQA 1OSPL 2MPAL 3C5ZB 3P73B 4K5PA 3L2MA 3QHFH 4XRCA 3NJNA 3NEOA 3Q43A 2GB2A 2VZVA 4FQ2H 4OLXH 2F5BH 2JJWA 3E2HB 3VFTA 1KBPA 2YC1A 3RIFK 2B16A 2APFA 4FNRA 1MIEH 3MROA 5I1EL 1BWMA 4X5QA 2J1XA 5EF3A 1F4YL 1NZRA 5EOCL 4L2YA 1UWEH 1QZ1A 5HI4D 2CLZA 1KJ2L 2XN1A 3KPOB 2LTQC 3QPKA 2B59B 5D1ZC 1AANA 2PF6A 1BAGA 3FUHA 4AKPA 4CBZA 3TEXA 4XI5C 3T3PE 2WUBH 3SPJA 5CN3A 4HWBL 2G9HB 4ZSOE 3EH1A 3ARDD 3BWZA 2ATAA 1IT9H 1Z6JT 2OYLA 4XVOA 2IAMA 2NY2B 5HI5D 4MS6A 1ROCA 3BZ4B 3BGAA 1JPFB 1PZAA 3CSYB 5E2UH 4A7UA 4ZNCD 5F9JB 1WIPA 3QH3A 5BUPA 4XMTA 1ZTXL 2M83A 2VLRB 3M7OA 5GZNC 3BKJL 1BXUA 1JUFB 2EYSA 3DOSB 4TTDD 4YHLH 2HVKA 5I76A 4UCFA 4WHDA 2ZX5A 3KPNA 4LCYB 5IUCA 4X0KB 1JZEA 1GW6A 3BO8A 4V11A 4Y0GA 5I26A 4J27A 1T6VN 4X7TA 3H6AA 3LEXA 2DLHA 1J9QA 3P2BA 5DUPL 2MRYA 4BK4A 3OKEA 5EO9A 2E9BA 3QA3A 2XFXB 4OSUL 3RAJL 3KBEA 4U1IB 4MD4A 1IBFA 1FZMA 1L4IA 2NNFA 4XNAA 1WBZB 2HFGH 2V9RA 3MRHA 5AZEL 5I5MA 1BMWA 3QJXA 5C08E 3ULSB 5M7QA 5KSBB 3LKRA 1MCDA 3QEHB 4H2CA 3C09C 1BP3B 4Y5XA 4BEIA 4LE8A 1OY3B 3C9NB 1OPGL 1ZXQA 4M3JA 1E67A 2X4NA 5FM8A 3MPCA 1TVBB 5C0DA 1W0YT 1A22B 3QDJD 4WTQA 1AR1B 1QZNA 1E8XA 2O5YH 4D2NA 4NWTL 3UPRA 3VD4A 4PB9L 4X2UA 5MP6H 3LKQB 2X7LA 4H5SB 4JM2F 3T4AB 5HYJB 3F65A 2ETWA 1ZHKB 1GJUA 3G6JF 3AAZA 3L3IB 4QRUA 2XZAL 2JKIS 5AW2B 3TO2B 3THML 4CJ0A 5FGCB 4HWEH 4TULL 3RWEB 1RIUL 3U7WH 3ZMNA 1GGYA 2WVUA 3UPRB 2R7EB 1MKFA 3QZMA 3ZSSA 4GO9A 2QVIA 3TWCH 3ZE1E 1IKOP 5HY9A 2VQUA 1PD0A 1DFBL 1CBVH 1KENL 3U9PH 2VR7A 1SPDA 1KWGA 3EO0A 2JJTA 3SE6A 1N4XH 3WI9A 1W9XA 1L9SA 1ZV2A 3UERA 1IGTB 3GBML 4WI2A 4X50A 5ESQA 1IAIH 1GOFA 1R24A 2E74C 4NC1C 1O7VA 5MENA 4OKDA 1NGPL 3QO0A 3T3PF 5C0JB 5DD5H 5EU3A 3VDCA 3ZN6A 3GJFK 4YS4A 2ZJSL 1LWRA 1ZGLB 2UY7A 5I0XA 2D0FA 1K8DB 4TXVB 4BHUA 4CC0A 3FFOA 4ABWA 4L8SB 2D7PA 2AP2A 5AW1B 5EG6C 4XCEA 5CD3B 3BDYL 5BRZD 3O4OB 4P07A 3QULA 3GFUA 5GRJL 2PWDA 3UG4A 4NQVA 4HS8L 5TQ2L 4AQ1C 1L9NA 2VSDA 3QUML 4IBLT 5CGYC 4CKQA 3RUGF 1JWUB 2A38A 4X4ZA 5PCYA 4Z7QE 2LGNA 1JK9A 4YHZH 2PCXA 3MV9E 3LSOA 5GS0L 3W5MA 4Y4HA 4YE4H 4N68A 1JHLL 5DVKA 1BXXA 3L4ZA 4NQEB 5C08A 4PI2A 1NCIA 5FKPB 4ZX6A 3E80A 4IGBA 5IY5B 1BFOB 4BD4A 4MCYA 3P4OA 3B8YA 4RFOH 4XPTH 1IBYA 2B1HH 4RCAA 3HG5A 2ZG1A 5EIIG 2ADIB 1SYVB 3O3DA 1WT5C 1O6SA 3HMWH 5TDNA 3RGVD 3HB3B 3RVWC 4P9HH 1KB3A 1WFIA 2Z7WA 4DGWC 1MCQA 4HIHA 5C6PB 2JLLA 5J4MA 1OAYH 2FLBT 3JQOB 3WS3A 2BS71 4N4YB 1BAWA 2EACA 1EH9A 1QNZL 1RHHA 5F96H 3BDYH 3PWJA 43C9A 4PJ8A 1KELH 4C56A 2XY1A 4JRYD 1JMXA 4DH2A 1OK0A 2A77H 2PR4L 2VLLA 5D1QC 2Z31D 3T6QC 1K8IA 4JO2L 1XT5A 3IN0A 4F7MA 3RWFB 2A0LD 5BV7B 3UPCA 4PJ5A 4Y4HD 5EEYA 3PU7A 3JT0A 5I6NA 4H0LC 3DX8B 1LNUA 2E3VA 1DQKA 2J5LB 1G5GA 1MFAH 1Q4NX 3VVWA 3UTTB 1NCCH 2NOYA 4E9QA 4K4KA 1HEHC 4WO4B 3V9CA 4L3EA 5HYEA 5J06A 4NBXB 5F0PB 2ZSVB 4PB9H 1IGCL 2E86A 2ADIA 1MFBH 4WI4A 3KJ4C 1CFMA 4OFYA 2K8MA 4TPRH 1BZ7A 3QIUC 4LKCB 3MRFA 4KKBC 2V9UA 2VQ4A 1RV6X 4KUZL 1CD0A 5CUSH 5D7IB 3U46A 2NCMA 3UACA 2XX0A 4JFPB 1DSFH 4XMUA 3MMEB 3EUDA 4JFDE 4M5YL 4M62H 2UZXB 3GXNA 2R2HB 5F1NA 1QRKA 3MACH 4HUXA 3EOBB 3DOIA 4M1DH 4DP0X 3CSGA 4GBXC 1FPTH 1P2CA 4D8OA 5DMKB 2HLEB 2A4EA 4JCLA 2DLIA 2PWHA 3QWNA 2AVFA 3BVNB 2BRRL 2ZXBA 4HPOL 3WO4B 4DK5A 1MCPL 4IW4C 3WFCH 5GJTL 1U3HA 2E8YA 3HZ3A 1KXTB 4ACTA 2P7TA 3L95A 3F58L 2CA3A 5DMGD 5B1JC 4OD3L 4PIBA 3C8KA 4FNUA 3L5XL 3IKCB 3EZJB 4ZUUB 3OAYH 2Z35A 2VW6A 2CO2A 3GJFA 5IW1B 5DHVB 3NIFF 3A0OA 1Q9OA 1ZTXH 1MLBA 3WNOA 4HGWB 4Y4FD 4JK0D 1HI6B 4HMEA 4PGEB 1R24B 4E9RA 2MTAA 1Q72L 3NEEA 3ATEA 3K6NA 3CVHA 3BMVA 2F54B 2W88A 1HSAA 3QQ9D 4P5TC 5IBTL 5C0AE 3TA3B 3O3EB 2EYTB 3T3ME 4B5EA 5I8KH 5ID1A 5GS2D 5JHLL 2WKOF 3KWXA 5DEGB 5EBWB 3C60B 1VEPA 3WIHA 4KJYB 4GKNA 1XD1A 3DTXA 3FCTA 4K23L 3PFQA 3PXLA 2XBDA 4WWKB 2EDQA 4YDIL 4PWGA 5DEZA 1ZLVK 4OUUB 5I1IL 5L2JB 2WB1A 1B88A 1GGIH 2EDLA 4GXVL 2ICES 3SBRA 3C08L 3ZK0A 4YHIA 2EKSB 5K59E 3BAEL 4UQAA 4QRUB 1KLFA 5EA0L 2BSSB 3DGCR 5LCVH 1T0OA 5E1QA 1Z5HA 2QHRH 4NZUH 1UJ3B 1TVHB 1AXTL 2O5XH 1V05A 3BPOC 4G7YL 4PP1D 4CSPA 5F3FA 1MHPH 1NDGB 2GFBA 1OAYL 2BVOB 1WPCA 3MJ9A 5D7JB 3KWTA 1A65A 2IDUA 4OZFB 4PSRA 3V55A 5HBBA 4GG6F 2BERA 3KPQA 5C3IA 2G0KA 1G7LA 3EG9A 4CN4A 1ZVYA 1KCWA 5DC4B 1JFHA 3WYRA 3LKNA 5AYUH 4RMTA 4UZUA 1F11B 1F3JA 4P5SA 3L48A 4JZJA 2FD6H 3IJEA 4QCIB 4AV5A 5CS7A 4FCHA 2I27N 4AYBA 4KJPC 4FNLH 1J5OL 3ZDZF 1HOCB 4TOYH 2X9WA 2ESVA 2ILLA 1RURH 2DDQL 2P80A 1P5VB 4PEEA 4WU7A 4XMZA 5J6HA 1XH0A 5ERWB 3RBGA 2AEPL 5DSCB 3IPEA 2BC4A 3RX7A 1HHHB 3MAWA 3MQIA 1ETA1 1FNAA 3S3SA 4QKXB 3TBVB 3MSPA 5TE7L 4ZUVA 2V3EA 2C26A 4RZKA 4GMSL 4JEGB 5D7KD 3TO4C 5BW7C 2GJZA 2H9GA 4GOSA 5L4FA 4D0BB 2NR6A 4Z7WB 3FFCE 2WOBA 5KVDL 3QARA 3G9AB 1XGYL 4N28A 3MCKB 5DFAA 1XIWC 4AEHL 1CDBA 1MAML 1IQDB 1G7HB 2A9MH 3VWJB 1T5WB 1FNSL 3DBXA 3BUYB 4DN4H 3KE0A 4N86A 5AOLA 5KOVC 4RGNE 3SYOA 1GS6X 2YJLA 4JFDD 3UCQA 3FB8B 2BLFA 4EQ3A 1AIFB 1R19A 2J8UA 1R3LB 1DCEA 1EZVX 4Y1AA 3QQ9C 2KI6A 4P5TD 2DS4A 1BOGB 2FWLB 1PLGL 1RL1A 3QUMB 2XV6B 4O9HL 4PWFA 4I77L 5FWQA 3N85L 1FUNA 2H4EA 1PFOA 1WAAE 3REVA 4PGZA 4K9EL 5C70A 3BP6A 4Q6IC 4ORGB 4QTHA 1KXHA 4ZI8A 5TF1L 4H44C 1IGYA 2AXGB 5DGQA 2CIKB 1UWFA 3OV6A 2EDDA 3ZUCA 4P2RA 4XBPA 2KQMA 3PQYE 3UZEC 1EQWA 4MCZB 4PJCA 1IJNA 1H3UA 2EH8L 1XSOA 2FSEA 1X4ZA 1A5FH 3L7EB 3AB0B 1FVCA 4MHHG 3LIUA 5KVFH 3MJ7A 2AJ3A 2XKUA 3FSOA 3UZQB 4G8EA 3BZFB 4KFMA 1D6VL 4JVUA 4OF0A 1T1ZA 3E7JA 2CRZA 1H6TA 3VX1A 4HAGA 1HWGB 2A74A 3GMLB 2DQDH 1J9TA 3OXRB 3R4DA 2C1OB 3PJLA 4FQLH 4NN7B 1NFDA 4N0CD 3V0DA 3T8XB 4KV5F 3VGGA 1KIQA 3BVWA 2F53A 3X1BA 4QF1A 3ZX1A 2HRPH 3B2PA 4XPHL 4IMLB 5TJWK 2J4WH 1JBJA 1QTSA 2P5WB 3DX7B 2H32B 2VDRL 3OKMB 1MRDH 1NICA 3IRCA 3KGTA 1P84J 2DMGA 3B2UD 4A7SA 3BDBA 3WIFB 3VFVA 3ALPA 3G5VA 3CTTA 1G7QB 5I9QC 2H3XC 3FPXA 5IG7A 3QT2A 4OZIF 4XI5D 3ES6B 3ME0A 5ABDE 2YOAA 4FI8A 3TO4D 2YD1A 4DW2L 3T77B 3PWPE 4KNUA 1XX9C 5JIIA 2FBJL 3NTCL 2AAVA 3RL1B 2W07A 2CDGB 3TVMB 2ZD0A 4MA3B 3RJOA 4HH9B 4LQFH 3WJJC 1Q0YH 2HX9A 3DX3A 1PEZA 3BXNA 4FEIA 4Y4KD 1NGPH 1A7PH 1DJHA 3G5ZB 3O2DA 5B38G 2FX9L 4M3KB 2VSCA 3MCKA 1KB5B 3NN8B 3SDYH 4F2MA 3S9DB 2YUXA 1IRAY 4P2OD 2IBBA 3K0YA 4JREB 1PJWA 1GPOL 1H3GA 5EO1A 5ICUA 4BSWB 1UOLA 3WO3B 4M1CC 1R5IB 4XNUL 2FB4L 1ZS2A 1S7XA 1ZAGA 2LFGA 1I9IH 4AQZA 1QTPA 4G43A 2XYCA 5KBDA 4JQIH 2VXQA 3B7TA 5INCA 2JELL 2IQAB 1XAUA 1DSWA 4JY6B 3OKNB 3D50A 1MW0A 5DTFB 3VXSA 5KYWA 2D4DA 5F1SA 1IC5H 1ZDSA 2CKBB 2EDWA 4FXGB 3N44B 1ZJAA 4PM1A 5E0QA 5DVMA 3P0GB 1J1PH 1E2WA 2FEJA 4LCCA 5JPMA 1TMQA 1F00I 2EDNA 3NTCH 3DX6B 3AREA 4PRPA 4YHOH 3P0YH 4HIXL 2EINB 1CE1H 1Q0XH 4MQXD 2Y07H 4RAVA 5E8DH 4HFUH 4JCWA 3VFSA 2XPGA 1JV5B 4HPYL 2HN7B 3WS6A 4RAUA 4F9PA 5D7IA 1XR8A 2YD5A 3U0WL 4LBAA 4JB9L 4QRRD 1DL7L 3W5NA 3DOHA 1XF5A 2BNQB 3OR6A 3WELA 2R69H 5F7EH 2XWDA 1JNJA 3CH1B 3HAEH 4GYBA 3F62A 4YSEA 1AZCA 1E27A 1PZDA 4JGMA 1FRGL 4I2XB 3ZBMA 2OW7A 4FTVE 1Z9SB 2C3VA 2GQHA 1WBYA 4TUKL 2WXFA 2ZWKA 2XVBA 1DSYA 3PHSA 1DVXA 3SD2A 4NQCB 1XSIA 1AZNA 1F41A 2WSPA 4U1NA 5E4EC 3QS3A 4PRHE 4G42B 2IBZX 5E8EA 2O6PA 1FC2D 3BEVA 3MZGB 4BFIA 4QIRA 4UV7H 1KCSL 5BRZA 4OF3A 4RGNB 2L3BA 3LB6D 3CVBA 4AZ8B 3BVUA 3LXAA 3F7PC 1DANT 1MUJB 3AM8C 4ZS7H 5C09B 3I6SA 1BQHA 4NYLA 4AQOA 4PBXA 4OLEA 5HHMD 3HFML 5MEND 2YRZA 1BVOA 1E27B 3K72B 2D2CC 4QRRB 1U0QA 2XPGB 1PKOA 1KNOA 4MGXA 5CIPH 5E6SB 4JY4A 4P2OC 2DQFB 3T6WA 2VDKL 3Q9PA 3MV11 4O5LL 4R7XA 1ET8A 5T1DH 2X70A 1NCBH 5GPRA 2VITB 3CHPA 2Y9RT 3IDJA 3DYMA 4E42A 5L7XH 4PJBB 1U95A 4NWUH 1PSKH 3W82A 5DVNA 4OVVA 2NT1A 4JPQA 3BE1H 2WNKA 5F3HB 3RVWD 3TIDA 5HPMB 1RQ5A 4XB3A 1L0PA 2DLFH 1T21A 1EO7A 4W81A 2QVMA 2ID5A 1AO7E 3PL6D 2CCWA 5JQIB 1EJ6A 2PYED 1C1EH 2HXAA 5IVXB 2DBLH 3BN9D 2VB5A 1ZMYA 2V17H 3ILEA 4H8QA 1FHGA 4V2CB 1HDMA 2YAOA 3FT9A 5EU3B 3QO0B 5C0JA 3ULUC 1Y0LA 3QEUA 3FU7A 1BFVH 2G5BB 2LFEA 3K1KC 1BJMA 3FO1B 2E7LC 4J2XA 3BC9A 2G4EA 3WUWG 3CZSA 1LK2A 1JOIA 1YECL 3QRLA 3OPZL 4JO2H 1MZZA 3FUKA 3UMNA 3X1FA 1GW0A 4XX5A 1ID2A 3MV01 3L5IA 43CAB 4YHYB 1A3LH 1RU9L 2QFPA 3CFBA 3CN0A 5KS9B 1I1FB 1JXJA 1SEBB 1WAPA 2UWEB 3OAYK 4LHUA 4ZMWA 4NIKB 2W65A 3SYAA 2AEPH 3Q2NA 2YD6A 5J9PA 2P48B 2VRQA 2WPGA 2VABA 3KAAA 4RQQB 5CINL 1SXCA 4NHCH 4XMKL 3RZCB 2EECA 3VFGL 4PJFB 5EZIH 1YY8A 1EZLA 2I07B 3QUMH 1CG9B 3EGDA 4PBDA 5FO7A 3LRGA 3T0VA 2DKUA 2JVUA 1YQ2A 2GJ6B 2CPUA 5DJDA 1GSKA 4MB5A 4MDIB 1RLBA 2FQGA 4MMXB 1JPEA 4UOW1 4OLUL 2XNAB 4YSCA 1ZVSA 1URLA 4Q0XL 4X80L 4QTIH 1NBVL 3V4UH 4JPWH 1YDPB 2FECL 2YZ8A 3RL2B 3MDJA 4HK0A 4CA4A 2EE3A 3FS9A 3FU0A 3UCRA 4LBEB 2WXMA 2NNAA 1VF5C 1CDHA 3HNSH 2IQAA 4EDXA 2Q3XA 1B0RA 3KPNB 2AQ2A 4PTUA 3B8SA 1W0WA 4X5WB 4IOIA 4Y2DB 4ZT1A 3HNVL 4JO5A 3VYOA 1Q90A 1JYXA 3LAFA 1A14H 4MCZA 4G70B 4Z95L 1A9BA 3HMXH 1CFVH 4RMRA 4ZXBD 5AKTA 4F58L 1FVCB 2MWCA 1BG9A 1QNIA 4HT1L 1XGPA 4G2AA 3DETD 1QBLL 4M6NL 4NNXB 2VDNH 4LEXL 2BIHA 1L7TH 2DM4A 4V1DA 5FHAH 4PJAF 2YSSA 3RGBA 3TIDB 1BM3L 2XHNA 4R84A 4D8PB 5I8OH 3PIQB 5K9KA 4KKLD 4PJFA 25C8H 3EKCA 4R0LC 3U9UA 1G9HA 1CBVL 3GUTA 2ZONA 4GXFA 1OT2A 5T1KA 3RJDA 2DIBA 3BUIA 4FFYA 3RWCA 1AXSB 2DLGA 4LCVA 4KROD 2GITA 5AAMA 4UT7H 4P4KB 3LNDA 1ZWIB 2CKBL 4TLKA 5CBAB 3ME0B 3MRRB 1XCXA 2ZUQC 4R3SB 5AAMC 3TYFA 5HYJA 4JY6A 5DS1A 1X6LA 2ODHA 4C56E 4W4OA 2UXGA 1RZJC 2AGJH 2UXVA 4G6AD 2ZTBA 3EJCA 4OSUH 5KN5A 1HYRC 3BUYA 3RA7H 4S1RH 4R8WL 2EEDA 1NMBL 2BS9A 2KYIA 4NO0A 1USZA 4LCWD 1M2OA 2DPKA 3H2WA 4I13B 4BH8A 2WIIB 2VDLH 1U21A 3P11H 3X3GH 4UTAA 3QUXC 3ZKXC 4LVHC 2PWEA 1EGJL 5AB0A 2P8MA 4Q8BA 1FZOB 1PSKL 4D7BA 3G6AA 3MLXL 1L9MA 4JG9A 5MERA 2PTTA 3GSWB 4GAGL 5A6LA 3PHOB 5LNDA 4HWZA 4UAOB 2O5YL 3MV9A 4JFEB 5DMIL 4TM9A 4X4YB 4ISVB 4YSSA 1C8QA 2DH3A 2DH2A 3GMNB 5CIPB 1KCSH 3CGTA 2V5YA 4GY4A 1NQBA 1MI5A 2WN2A 4GMSH 5L2KE 3WGUB 3CDZA 1H5BA 4B9CA 5I5JA 3MLVH 1CD1A 3VI3A 1EEZA 5EEWA 1S9VA 4AW7A 2R1WA 1XCWA 3N42F 1ZVSB 3CHSA 5GS3A 1X5GA 4U05A 4HS3B 2X2JA 4P3DB 4TVPH 2ZG2A 4IEFB 2WQSA 2Y06H 2BOBB 4LGRB 1S5HA 3VWKA 4S1RL 2QSVA 1L0XA 5E1GA 2X40A 5AVSB 2F5AH 1H5BB 3DJZA 4KY2A 4D7PA 5IHZB 3U36B 1AKJA 2G5UA 2GHWB 2G2RA 2X88A 4Z9KB 4ODSH 3T65B 3VAEA 3F7QA 3DRTA 1F1AA 1EAPB 3HE7D 4YHKL 3LPPA 5K39A 4WDIB 3GXUB 4WGVB 4OH2A 1G94A 1A6WH 1IBGL 1T6WA 5GQBA 1IEHA 3DGGA 3QE5A 3FRUA 4FCAA 2B8OT 1MW2A 2DYRB 3Q7JA 5J1AA 4Q4IA 2XQ0A 3NPZB 1SVCP 5FYLL 5D72H 1CI3M 3I6KB 2HKFL 2YPLA 5AOZA 4FAAB 2E4FA 5AOJA 2Z1PA 1QHOA 4IK6A 2ZQKA 1RJLA 5IT2H 2Y1YA 3EDDA 3EYVB 4P46A 3KPMA 2V9QA 1TETL 1TENA 2E56A 3DBSA 4XOCA 5FLUA 2BZ7A 2BY3A 4HGWA 4LSVL 2H9GB 5GISH 4F8NA 1QLEL 4QOKD 4M93B 1X9LA 1PG7X 2C9XA 3AGWA 2F54A 1Z9SA 2XQYG 3TA3A 1JGEB 4Z3IA 4IRZA 4KQ4H 1TYJA 2Z6FA 1QSFB 3FO9B 3WN5C 1Q9OB 4MVBD 2IALB 1M6UA 5GGQL 4G6AC 2VLJB 2DWTA 2QVTA 5IVXA 1U8NA 4R90H 4DZ8A 1NUDA 4F92B 1A7NH 3MRCB 2ZUWA 1TZHA 1NDMB 1YYLH 1OD9A 2B0SH 5LGJB 2YXWA 2FGWH 1MNUH 4BRJA 3B2UC 2R23B 4FF9A 4UMGA 2XWJB 4PPTA 5D5ME 2OYKA 3D48R 1P4LB 1NAML 4XGZB 4FA8A 4MZRA 2VLMD 4GMTH 4PRPB 4HP5A 4RESB 5JHBA 1D5MB 2J1KA 3QDGB 4P48A 3SQBA 3TFKC 1VPOH 1SN0A 3FB5A 1LP9E 1BX2A 2HAZA 1CI5A 1YUHB 2YBGA 5IBTH 4FFZL 5G4MA 2N0MA 4UTBA 4W9ZA 3G7TA 2WQUA 1IZJA 4Z0XA 3M1CA 4HD9A 1P53A 3W81A 4QUOA 1QP1A 3J07A 4WY7L 2BSDA 1T22A 3RDTB 1AGCA 1KT2A 1Q94A 2R29A 3SY0A 3BD3A 4M03A 4AGMA 3GM8A 1W91A 5F8RC 2X6CA 5CZVH 2HRHA 3V4VL 1A7OL 3DUUB 1QI5A 4B9YA 2EC9U 3VFPB 1RIVL 3AGVA 5CR1A 1T1ZB 1TQCB 4O58L 3GNML 4ZOAA 2X1WL 3O2WL 2X42A 4KUZH 3AG4B 4ZOBA 1YDPA 2YRPA 1INDL 2Z4QA 3L16A 1JI1A 4KXZI 1MJ7H 3JVGA 1KJ2B 3KWVA 4U0RC 3SYPA 1Q1JH 5DZ9A 1WAAF 3D06A 3D39E 1B2YA 5H2BA 3EIFA 3QJHA 3OKDA 4PJ8B 4WSGA 1WEJL 3NCJL 4O4YH 4NXSA 3BKJH 5J12C 2FEEI 1NC4A 1I1YB 1PIGA 2YWYA 1WBYB 4JM4H 4A7GF 5C0CD 2DIJA 3SGEH 2HUHA 3S6CA 5HHOB 2VC2B 4JFQA 2V2WA 3KL5A 2RB8A 1ERNA 1QLRA 3REVB 1MHCA 1G7QA 3MRBA 4GXUM 2ATKB 2G2PA 4DGYH 4MQXC 5JR1L 4EN3B 3UYRL 3TBCA 5GGTH 3MGOA 3NACH 1J8RA 4KVNL 5TH2A 4C4UA 1BQSA 2WZAA 3LKPA 2QQNL 3SKJL 1OE2A 1R3LA 2WYZA 3CXHJ 3HUJB 1KBGL 3B5HA 1W15A 1DE4A 4UM9D 1SOKA 4XAKE 3EYOB 4QOKA 2Y4SA 3DMMC 5C9JA 4XZ4A 3STZB 3VRJA 1IZKA 1UWGH 3MLWL 4MVBC 4WEMB 1IBBA 2BS8A 4HUXB 3IU4H 4YAQB 4MA7L 3TJHC 4OW6A 4HOZA 1AZVA 3U30B 2CHNA 3D0LB 1KWKA 3D2UB 1N59B 4GIAA 3OX8A 1DFXA 4LKCA 5AD0A 3AG3B 1HI6A 3PGFH 3SOTA 4E9VA 1TKWA 4MNGB 1JZGA 1VGKB 5D71L 5DD6A 4XNQA 1KJ2H 4X8CA 5INCB 5JW4R 1AOHA 2OQJA 1A7NL 4DKTA 4XVJL 3NSJA 4HH8A 1TYEB 5C08D 3EJYD 3ARDC 4Q9RL 2R69A 3BH4A 1XGTA 1OCZB 2G2NA 5ESAA 3LZQA 1NCTA 2W0PA 3FYIB 2QDVA 2PCPA 3LZLA 5ADPL 5I1JH 5E8NB 1X4XA 4FP8H 4PIRF 1FL6B 1CLYH 4G5ZL 4YDVB 2K6YA 3BKCL 5E99H 4CSSA 4AYGA 1UACL 2CG9X 4BRVA 1TEGA 3CX2A 4YEEA 2NQ3A 1MWAH 5C0BB 4Z77A 2X4UB 2YEZA 2GJ6E 3BWAA 2W07B 3FN3A 5CZKA 1DCLA 1AHKA 2BHYA 3JUYA 3QWRA 4WJ5B 1E28A 4C83B 2YQ2A 5FUZL 4OZGB 3FT3B 4PAZA 2ZZUT 4WV1A 4ZMLA 1J1PL 35C8L 5IMOB 2R69L 1CB4A 3V4PA 2WKOA 1A3QA 4QKTA 5KSBF 2EUXA 5C0BE 3P0VH 2R9HC 4NHUB 1ZHNB 3PFUA 1AJ7L 1HQRA 3PL6C 4NENA 2IVFC 2P26A 5DQ9A 1AD0A 4TKWA 3C5SA 4WTZA 1XF1A 3IE4A 4LPCA 2ZAIA 2WXOA 2WJ5A 2OX5A 3JV4A 4LLWB 1FNGB 3ALWA 3WDHA 4N8VA 3S4SB 4LEOA 4H8WC 3QGVA 1J5DA 1MWAL 4JPKL 1OB0A 1H8LA 1YN6B 4JRXD 2FAUA 4P2QE 3HZYB 3DUSB 2XVKA 4XCNB 3TPKA 1FO0A 1UD4A 2Z7ZA 2EEFA 3GRGA 5MENB 3FF7A 3UBXA 2JKXA 4NKDB 3D0VA 5BW7A 4OV5B 4UOZA 2PXYA 4JHWH 3EO1B 4QGYA 1Q9KA 1UA3A 32C2A 3EYFA 3GIVA 3NRPA 5C09D 1RZKL 5LNEA 1TDQA 1OP3H 2DYPA 4XBMA 1PZUB 5FDWA 1FN4A 4MS8D 1WHOA 5I75C 4MBRA 3L3HA 3IGAB 3IJSB 1IM9B 2VDMH 2A3TA 3VXUB 1R0AH 4U1GC 4YBHA 1K3IA 4XE5B 5A6IA 4O51A 1AFVH 3O6FB 1T0MB 3L5XH 1TLMA 4F91B 5IKCA 1UURA 2NYZA 2P5EA 4NSKB 2B2XH 3IVKA 2XI9A 3IDNB 4LSUL 4MMZB 1OLLA 2ZF8A 4KMTL 2NMSA 4IRJC 3FC8A 1QSFE 3M1BB 4AENB 1VPOL 4BSVB 3WFDL 4Z76A 1ZA3B 1D5XB 1HWHB 4XP9L 4XXDA 4GPVA 3INUL 5ISZB 3AS0A 1RY7B 1TQWA 4WW2B 2CGRH 4TRPL 1YJDH 5KZCB 4FKKA 1ZSDA 1I9JL 3D39B 4OZHA 4ANVA 5I17B 2R29L 1CS6A 5H35B 5B3JF 4W9FC 3SKOB 3ZT7A 2FATL 1SJXA 2J4WL 3G5ZA 3GRWA 4M5ZL 1T0NA 3I6LE 3OXSB 1J5CA 2X10A 3DI3B 3FTWA 4FXKC 4HJGA 4UTBL 4PJ6A 1Z9NA 4AX3A 5B3SB 1NGQL 1LEKB 1U8IA 4ZXBC 4CVXB 3BGFC 4MNQA 1YCSA 3RGVC 3GQFA 2W8CA 4DP6X 2D7MA 5EDSA 4HHGA 3TH3T 2P7TB 3DETC 3L95B 4JQXC 5IW3A 4NNYA 5CILL 2CUAA 2MNUA 5JDSA 1M6OB 4BSVA 1WITA 5DEJA 4QRPD 5FYKE 3WIHL 1CD8A 4AV4A 3KLLA 3TV3L 2XTLA 3V5HB 1MRFH 3B9AA 4G8FA 1W72B 4LVNC 2KPWA 2P5EB 5DMKA 2YPVL 5EZLA 5HDBF 3V6FB 4Y4HC 1GAFH 4KROC 2YHGA 3QDMA 3UC2A 1N0LB 4G8IB 2UX6A 1ECZA 4YZWA 4DSYA 1AO7A 1YEJL 2VTFA 3WN6A 4FTVA 5F88A 3NK3A 1OOAA 3MV8D 4OCLC 2UUDH 3QZWA 4QHLA 1GY1A 3BWUF 5T1JA 1YAZA 1SMDA 1MJUL 3DRQA 3IAQA 2GBUA 4KKBD 5SX5K 1QATA 3HKZA 3QA3B 1SXNA 1VCBC 5GGRB 3IJHA 1FV1B 1FZJB 2Y5QA 1RZQA 5DS8B 3TNNB 3NDZE 5KBLA 2EDBA 3QUXD 1WUZA 3IGFA 1PY9A 4UM9A 3JVGC 4OR1A 3FQRA 1FBIL 4FA7B 1UOVA 3ATAA 4Y2OB 4RIRB 1GRWA 3NSDA 3L3OB 3WLWD 4EI0A 3P0YL 5IESL 3PAUA 4L8BA 2XJLA 1AY1H 5EEUA 4ZUSA 1SFHA 4UIMA 3KPTA 4LAQL 4XVJH 5DRXB 4BV1A 1G1KA 4DUVA 1O5PA 2ZOKB 3K4ZA 1W2KT 4LQ1A 1ZV9A 2BSEA 1CG9A 3DVNB 3EGDB 4PJAB 1B0GB 5K33A 5BZDB 5L9DL 4UNIA 5AOIA 1VLXA 3BP4B 4K94C 4O02A 1FVDA 4QRPE 5FYKD 1T6BX 4R7NB 4Y4FC 3I74A 4W9KC 4IYKA 5LCVA 4IHBA 2J8HA 3C6SA 1MRDL 3QAZC 1T66D 3TBSB 4EIGB 2UWEA 3NP4A 1YNTB 5CBAA 2FNWA 2Q86A 2V2XA 2JIXB 3MLSH 3H8NA 3BH8B 1MCNA 3VFWA 5DT1H 5IFAH 5I8KL 3ARZA 4XN7A 3QNXB 3V7MA 2JLPA 4XT1C 4FABL 3LN9A 3BVVA 3X13B 4HJJL 5GXBB 5I1LA 3HE7C 3DURA 5DDHA 1NGZA 1RD6A 5IQNA 1JRHI 3I2CH 5I73B 5K5YA 3D3VB 2ZOUA 4KX8A 3QJQB 5DHVH 2R8SL 2K45A 4BHUI 4K5LA 5F8QC 5IREA 3MMEA 2RD0A 2Z3FA 1RZGB 5CZXD 1K4CB 4N6RA 3MRCA 1VB9A 1RZIB 1CR9L 2WD0A 4Y5XB 4ANKA 2NPLX 2EICA 4OGYL 4ZX5A 1P7KB 1I85C 1T7WA 3MNZA 5ITFB 4ODUB 4BKLB 5DK0A 3T3PB 3UAJA 2R4RL 2HWZL 1TMCB 4BZ1A 2VMFA 5LAPA 5DD3H 2JFCA 1KYAA 4WTWA 5CILH 2B20A 2G75A 3DYOA 2F6AA 3UDWA 4Z78A 4PRPE 1S2EA 2P1YA 1JPGB 1NGXB 3GSVA 2XICA 3ARFD 3OR7A 3VXME 5D2LE 4NCC2 1QRND 4JRLA 3SJVB 3WFDH 2IXQA 1BVKB 5DJ8A 3CFJB 4YDJB 3H1ZA 1DE4B 4G8GB 3LNHA 3CCHA 2OXHB 3O8XB 2VXUL 3F7YA 4DOHE 3H9SD 1F42A 1BSIA 5CF3A 2Y2WA 3UJJL 1MELA 2ITDB 2PNDA 3J8F7 4JY4B 3X1NA 1VKXA 1B2WL 3VFUB 2FJGA 5L88L 3I9AA 2ZOTA 5PAZA 3WG7B 1TUPA 3N2JA 1T89C 2Q20A 3K8LA 4CSTA 1U2HA 1I1AC 2ZX7A 4KI1A 3FO2A 4NXKA 2VJ0A 3PAVA 3TFKD 4JG0H 2HWZH 2IH8A 4CW1A 1I1AA 1VKXB 4MFHA 4FQQA 5HP5A 4E0RA 2X4UA 1GR7A 2CLVA 4ELMF 3SGKA 4AI7A 1RI8A 4GAAA 5D8JH 3G9VA 5E08L 4U1SA 4GRWF 1CE6B 3SEPA 1CWVA 3HIZA 3BRDA 3MV8B 2C7UB 2C9AA 1QFUH 4DN4L 2D31A 2AEWA 4JO4H 4TNVK 1M1XA 5EDXA 1BF5A 4JFFD 5A2FA 1EEQA 1HXMB 3OB0H 2X4SB 3KBHE 1T66C 2FO1A 2QKIA 1DBJH 2DQEH 4X7TB 5HYIA 2F5BL 5C07A 4HIJA 4KKAD 4PUBH 3RHWK 4KZEH 1U92A 2BSRB 4I3SH 4BUGA 1IAKB 5AG8A 3I3EA 4Y9FA 4X5PA 5DD1H 4Y5XC 1YEDA 5IWLC 2YGNA 4DN3L 4RBPK 1G9ML 5JQ6L 2VL4A 4PS3A 5GGRY 2OJZL 3VTAA 4F7PA 3FFDB 3I85A 1ASOA 4I2XE 3WL9A 4AJ0A 4F7EB 4M6ML 3WTTA 5FUCC 3ESNA 5E8DL 3KM1A 3CX5J 4HC1A 1JZIA 4WEBL 1CVRA 1IM3B 4OLXL 3WD5H 4FNPA 4L8DB 4XGZA 3W9EB 1XF2B 3KGUA 4ZQTA 3BCDA 1AMYA 3DV4B 1E3ZA 4MZ3A 3TBSA 2MQGA 3NPSC 4Z3TA 3MO1B 4P04A 4LSRL 1FJ1B 2K3HA 3L2NA 2IANB 3P0VL 4HZLB 1KFAL 1OAUH 2QL1A 2COQA 2R0LL 3K81A 1YY9C 3EHBD 4OCXH 1DBKL 5F6IB 4DAGL 2VZUA 4RBPH 3JVFC 3WNKA 4O2EA 1JGUH 2IG2H 4B0MB 5DZAA 4QRSA 4A6YA 3WFZA 5C0DB 5JXEA 5KBPA 1UB6B 3BH9A 3SYQA 1U8QB 4F3FB 3AS3A 1T4WA 3L3OC 5IP4A 3GMRA 3GSNB 3MLZH 3KYMA 2VDOH 5DVLA 2VXSH 4B7IA 3L3OA 1U8MB 3ZPDA 1PZ5B 1HHKB 3DXAA 1KJ2A 3NSFA 5DUJA 1U36A 5FM4A 3VSQA 1WBZA 2YXVA 3VRIA 4AW4A 3IEAA 1SHWA 2NSXA 1BFVL 2OL3H 4LCWB 5I2IB 1I75A 2X0VA 3RWGB 4DP4X 2IOMA 1ILUA 4JRXA 2X6VA 4YX2H 1A9VA 1O7DE 3II3A 4IIQB 1PNCA 3TCLB 2OK0L 4NSKA 1UCTA 1PMYA 2Q7YB 3WGVB 5C0EA 5MEQA 3ULUF 1MAJA 5DJAB 3CH1A 1EGJH 1BFOA 2ZF9A 4J4PD 5BOJA 2X9YA 4PJCF 2B15A 3BP5B 3FQWA 4K23H 4PYGA 3EJUA 3T1FA 1Q9WA 1CYXA 1LHZA 4Z7WF 5T3ZL 1W72A 4Y4HB 2VUOA 3IGAA 2VE6A 1MF2H 4UINH 4YR6B 1EEZB 4R0LA 4M1CD 4KNQA 5C2UB 5H37A 4PBVC 1IGIL 4KI5C 3IT8D 5D7SH 4FG2A 5DVOA 3Q6GL 5LGHL 4DK6A 1V5JA 1WVZA 2IO5A 4LSPL 4TULH 2VR5A 2R9HD 3LRKA 4NQSB 4C47A 1MI5B 4BWWA 2XN9B 3RGVB 3BGFB 3WKMH 2EVGA 2PO6B 4NKOB 4EKJA 3BD4A 1ZVNA 1CFQB 1LE9B 5DMIH 4FXKB 3KH4A 5T5FA 4FA6A 2G30A 5I28A 1F45A 4JFFE 3CIAA 4HGMA 4XPBL 5ICYA 3V0WH 2Y6SC 1ZSDB 1H3TA 1A1OA 2OSXA 4XOBA 3BFWA 3GHBH 1SMOA 5L4JA 3AMLA 5EO1B 1QG3A 4MMYA 3IFPB 3NA9L 4TNEA 5DJ0B 1R33A 3RVXD 5IQ7H 1R5VB 1RUAH 4HLZH 4WW2C 2WB7A 5JORA 1U3ZA 4JO3L 3QUYA 4EKXA 1NCAH 2FZ3B 4OCRH 4KUCF 1PG7L 3AC0A 4B0MM 4UDTA 4ZODA 1T1XA 3MTRA 5CJ8A 3VMOA 1FFOA 4IRJB 1MPAH 4M7LT 2PLTA 4MMZC 5GRYA 3E3QC 2OSYA 4A67A 1KCLA 3B43A 5JUEH 5KJRL 5C7ZA 3FOMA 2VCOA 2YEVB 1QLFA 5AUMA 4F1ZA 4P4KA 3N43B 3HI6L 2EUVA 2PABA 3QORB 4OGXL 5KBMA 1KV7A 1VFAB 3G5YB 3KW8A 3UMTA 5JW5A 3LB6C 3L4UA 4Y1AD 3TPUB 5GGSA 1S7VA 3UZEA 3UTZB 3VXPA 3WAKA 5C3TA 5A3IC 3V52H 1F4WH 2K6ZA 2ZXQA 3RY6A 3NCMA 3LV3A 3VXQA 3S3PA 4GRMA 2VERA 4ELDA 4MD4B 2Y36L 1IGFH 2OQJB 5GRZA 5KYNA 2IH9A 5A40E 1TZIB 4GXUN 4GO6B 1W0WB 4X5WA 4Y2DA 3JWOC 3K6FA 5IB1A 1JF6A 3IMUA 5J0BA 2Q5BA 3HVNA 4M7LH 3U6XA 3ZOAA 1A3RL 3FQNB 2AMUA 4FQJL 4A66A 4OBRA 4MLIA 2X3CA 3UBXG 2N1TE 5C2BH 1IKFL 4RA3A 5INDA 5IGXL 1I9IL 3GSNH 2X4TB 5F7FA 1UM4L 1MPAL 1YN6A 4G9DB 3N0PB 4XCNA 4XC1H 5CCKL 5I30L 2DI9A 1GZHC 3MV8A 1SXBA 2RFXA 3VRIB 2CBTA 4KI5D 2WVTA 5E03A 2IDSA 3ZE2E 1PFCA 1MAKA 1N0XL 4XXWC 5J6GB 3PL6B 2HTLD 5BO1H 2DMCA 3ILDA 1LDSA 1KTLA 1ZXKA 2WVVA 2P80D 4N2LA 1E5YA 2BO0A 1EBAA 2JQAA 2FQDA 1FFNB 3EJZD 1UM5L 1TYRA 2WLKA 3ESMA 1WSST 2Z0BA 3N9GH 2EC9T 2H47C 4WW1A 5HVGB 3SGDH 4QTHB 1JYNA 4ZYKB 5E0FA 2D03L 2G3NA 4KOBA 4AC2A 3ZTJH 2B08A 2EDYA 1E7UA 1HHIB 3OKLB 1DZ0A 5BZWB 3ULUD 1M05B 4KY1L 2CGYA 2YAHA 1KLFB 5CJOL 3V2AR 2Y6SD 3IDGB 4FYRA 4G71B 2Q8BL 5HHOA 3EYSL 2A73A 4NX0A 5EU6E 2GK0B 3OSVA 4DTGL 2CA4A 3LH2H 1NH6A 3DHUA 3JV0A 4FQCH 4OIIH 2R0WL 1N18A 2GABA 2QPUA 3GS0A 2HFFB 1YC7A 1N5AB 1PF3A 4XXCC 5AVVB 5F89A 1J12A 1SRDA 4YGVA 1ACYH 5F7HA 5IHWA 1V7MH 4P3CL 5LQBH 1JP5A 3HLAA 3KPRD 4J8RB 1OKEA 4UI2A 3TF4A 4WI3A 1WFTA 4QAWA 4ZD3H 4NN6B 5L88H 2DQCL 4G9FA 2I60L 1RULL 5ITFA 4FQIH 2WBKA 2DYSB 15C8L 3H4FA 3TONA 5BS0D 1NIDA 2LT9A 1QPXA 3K2KA 2AMGA 1RUML 1T3FA 2FBOJ 4ZUUA 2CR6A 4NQCD 3AXLB 1OSZB 3WLWC 2DEXX 5D5MA 2VDQH 3L3GA 1T20B 2GIYA 3U30C 4JFSA 2RGSA 5I23A 1AGEA 1GSMA 3S8FB 4JFEE 2UXFA 3ROOA 1DVFD 3DMMB 2BNQD 2LLGA 3B1TA 5FF6B 5IV2B 2QQLH 3MRGB 4BFNA 2A73B 1DBML 3TASA 3L4XA 1PQZA 5JXAH 3KNBB 2P5EE 3OGCB 3QNYB 1EHXA 3CBRA 5B1AB 1PLBA 4U6HB 1QFHA 5JNYA 4A04A 5DEFB 3T6ZA 1DVQA 3VXRD 4I3RH 3G04A 5KW9H 1HZKA 4GQ9H 4MB1A 4ZTPL 3D51A 1MUJA 4Y1AE 4QRRE 2JCCA 4CVUA 2HTLC 4JFQB 2XWEA 5IMLB 4QXUL 4AL8H 2HFEB 4G1EB 4OZHE 3DIFB 1J0ZA 3LEVL 4LL1A 5GISL 4BFOA 2V2TA 1L6XA 1UB5A 2C9SA 3HZVA 4RX4D 3V7AE 5FDYA 4UB0L 1L3NA 4UF7C 2VQ1B 25C8L 2Q8AL 4WU5B 3V0VA 4W68A 4IBTA 5F7EL 1QA9A 1EMTH 1NFDB 1QSED 1WG3A 4L4TA 5HVHB 2WXPA 3KMDA 2BRQA 3C08H 1BEXA 1ACZA 1HQ4B 3B9KA 3NFNA 2R56H 5AAPA 2ZWLT 1E4JA 4YPGB 4NN5C 4AXWB 3ELQA 4EI5B 2V4LA 4U3SB 1XQ4A 2IDQA 3RNQA 3UTPE 5AKRA 5DHVA 5JHAA 4K3JL 3T65A 4NO3A 3SPVB 5TE4H 1YMMB 2PP7A 1RUQL 2J5WA 5CLZA 1IKFH 4LSTH 2WO4A 5C08B 5JPNA 1JWMA 4YGVB 2ZUVA 2FLRT 5A2LH 2HVJB 3I75A 3ZW3A 2EQDA 1ADQA 5J89A 1J8SA 1IC0A 2X0WA 2KPNA 3HN3A 4LPVA 1I7RB 3LQAC 3QS2A 1X7QA 2GK0A 4PG9B 4KITB 4BQCA 1HESA 5DA0B 1CXHA 4NNYB 2D2OA 3OKOA 4MBOA 2WSDA 3AT8A 4HV8A 1E5AA 1CQKA 3CPLB 3QZLA 5DMGC 2DEYX 1KTCA 4HHWA 2NY6C 4G8AC 4G7VL 1MCPH 1IE5A 3I02B 4HIXH 5F6HI 3WN5B 4JE4B 1GGCL 1MFCH 1WK0A 3FT2B 4OZGF 2IALA 3M7FB 5F0MB 4AV0A 3N1PC 5C09A 3S37H 1S3KH 1KIPA 2ARJB 1HSBA 3R7RA 3DYPA 1BZDA 2EDEA 3P77A 1NIEA 1KB5A 5ICXA 4HZAA 3V6ZB 4N8UA 1KPRA 4DGIH 4EAEA 4Z6AT 5IQ9A 3MCYA 3MA7A 2WQAA 3BAYA 4JDEB 5HDBE 1CGTA 3C2SA 5TE6L 4ALAH 4MZIA 1IC1A 1SLWA 4CNIA 4PW3A 2XCMC 1AZRA 7FABH 1HKFA 4FQLL 4HWEL 5J56B 3CZGA 4K71B 2IBGA 1KGCD 3MFFB 1MWAB 5HHME 1F6AA 3U4EB 3MNVA 5IF0A 5FX3A 5FYKL 3DSFH 3PWNA 3A4EA 1MXGA 1O6SB 2Q7AA 2PXYC 4PLJD 5TDNB 4MJ6B 5K9QG 4RX4A 2JB5L 1H5BC 2GC7C 2XKSA 4YNYB 1X9QA 4L1SA 1DJGA 4HS3A 5D1XA 2VZOA 3HLKA 4UMSA 4WWOA 3P2TA 3ZO9A 5D7IF 1X7TA 3A6CL 2KZKA 5F1OB 5D1XC 3L3DB 4F8QA 1JV2A 1M3JA 4BCXA 4K73A 3KZ8A 2XWZA 2P42B 1SBSH 1RZFH 2F19H 4ELKB 2X4QB 5HHPA 5I1KH 4GI9A 4Y5YA 3K74B 2XZZA 3WTUA 3CLFH 3IBOA 3KJ6L 3D30A 1YEKL 1V3MA 4WNJA 4O5LH 3BVXA 4KJPD 1JERA 3L3KB 3MFFA 5D7LE 1F4HA 5CGMA 2Q2EB 2DN7A 3KGSA 4WHTA 1BG1A 5I0DA 1NMAL 3UO8B 1EX0A 2O5NA 1QYGL 3AJ7A 4X7FC 5FYJD 4JO3H 1BA9A 3AABA 5DC0A 2EYSB 3R0NA 4LVHB 3ZDYB 1MCBA 3AQXA 1A6VL 5KYXA 2VM3A 1BLIA 1ZTMA 1GMIA 1GTFA 3MBWB 3QC5X 5EOCJ 1K5NA 5DC2A 3SCMA 1D7FA 3V6BR 2NY6D 3H56A 3MX0B 1YNLH 2H1XA 1ACXA 5FO9A 2A9CA 3VD1A 3MLUL 1I9RL 1EA9C 4F37K 1NC2D 3HZMB 3T0ED 4MXWH 5IB5B 1MLCB 2NZ9D 4Z76B 1HS6A 3VTTA 2ZUQB 3HMXL 1JZ5A 3K8MA 1YNTF 5SWSE 1RUPH 3AXIA 4HXBH 1GKOA 2NY7H 3BYYA 2A2QT 2VDML 5DRZB 2GJPA 5I30H 2OSLB 5C3LD 4TSBL 2ICEA 4DOHB 4WWID 1XO8A 1BD2A 1CVSC 4XAKD 1BQRA 2RHEA 5KVEE 4I4WA 3W0WB 2CHZA 4JB9H 3B9DA 3GMPA 3JSSA 3NSYA 1J0JA 3VU2A 3VD2A 1HC1A 1K5NB 1F2QA 3MBWA 4NUGL 3K71A 4IRSB 4S1SL 2IAMC 1FNSH 4G7SB 1FYTA 1NUFA 3VWJA 2BSTA 4Z7NB 1D9KC 1IAKA 4Y5VB 4Z7VF 1G5AA 4K8RL 5C07E 1XCTB 2JXMB 2PPFA 2ODIA 1FP5A 4HDIA 3O4LB 3Q05A 3CFKB 3OZLA 3FH7A 4HEPA 3UIYA 2CCLA 5F70A 1N12A 4FNQA 4JKWA 5FIEA 4JKNA 4R4FL 1E42A 3C6EA 5I15H 3DIVA 1IC5L 3GLEA 1BVLA 3D39D 2I7SA 3BEWB 3WEMA 2DKSA 3RVXC 2ROXA 1YEIH 1E9PA 2ENQA 3BPCB 4NZFA 4X9GA 3APNA 5KZCD 4N0CC 1HCYA 2AK1H 3UBXI 3VI4A 3P3YA 4Y16D 5GHWL 2D31B 2JQMA 5D4IA 4TSBH 4YGAB 4C56B 2DI7A 4YSTA 3FHAA 4ESKA 2V2TB 1CT8A 3PGCA 5LWYL 2Y2TA 4P2RB 4XBPB 4FQXC 4B9IA 3MRKA 4MMXC 3QRFM 5DJ6A 3ASOB 2OCJA 1AQ8A 3O6KL 1U8LB 2W9LA 2YQGA 4JY5L 1UJ3A 4NQTA 1LO0L 5AQ0A 1VFUA 1I8AA 3IDMA 3RZCC 2PW1B 4JRYA 1OP5K 4YHLL 5D7JA 3A47A 2DQJL 3U7YH 4GG6B