4Z3HA

Crystal structure of the lectin domain of papg from e. coli bi47 in complex with 4-methoxyphenyl beta-d-galabiose in space group p21
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
197
structure length
197
Chain Sequence
MAWNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGSWAYYREYIAWVVFPKKVMTKNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDQRAFDTANLCQKPGETTRLTEKFDDIIFKVALPADLPLGDYSVTIPYTSGIQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unexpected way nature improves solvation entropy
rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
molecule keywords PapG, lectin domain
total genus 45
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 4z3hA00
4Z3FA 4Z3EA 4Z3JA 4Z3HA 1J8SA 4Z3GA 1J8RA 4Z3IA
chains in the Genus database with same CATH superfamily
2DWEA 3W5MA 4XVTH 3FO9A 5I8OH 5LNGA 4F57H 1VA9A 1KFGA 1I4FA 1ZSDA 4P2OB 4JAMB 4KQ4L 2P5EB 4FTVB 3UTQA 3CUPB 1U8HB 3IE9A 1MVYA 1PKQB 1SJHB 3BRDA 3CN4A 1RIVH 3MV8B 2LFGA 4PJ8A 3ZE2B 1UKQA 3ILQD 4LGPB 1GC1C 1JDAA 4GIAA 4PY8J 5IM7A 2CIKA 1MCJA 1Y7VA 3GMQB 4NJ9L 3IPEA 5C2UB 2AMUA 4EDWH 1MAJA 1U8JB 3B2UD 5KYUA 3KNBB 4KJPD 3LNIA 3G5ZA 4UOJA 1MW1A 2CSPA 2E46A 4NQDE 4U6YA 3SKMB 2BNUB 3M17B 3GJFK 4PJXA 2KERA 3MBWA 2V2WA 3LEXA 2BIQA 3P0GB 2IQAA 1S5HA 43CAA 1B3JA 3L3OB 4NUGH 2OL3A 3QQXA 5EBWA 4G6KH 4CGUB 1E28A 2OJ1A 3PDOA 2DTML 1C12A 5FKPA 2X1PA 2DB8A 3VTMA 2EIKB 3ECUA 2GFBB 2YPLA 4XCFH 4HEPG 5C3TA 2A0LD 4LEEA 5INCA 5TDOA 5IMMA 3W1ZA 1DEEB 3PXHA 5I8EB 4OM1H 4JFXB 1H3PH 4OKVA 2XXFA 1PMYA 1GGIH 3RWIA 1W0WA 3L3IA 3O8XB 2XICA 3C87A 3LHAA 3MRQA 4HA1A 5D72H 4NXSA 1TJHH 4IKKA 3FYIB 3APFA 4HF5L 5IJVB 2ZYHA 1IGFH 2WGNB 4KV5F 4ISVA 5C08A 3CQQA 4IOSA 4PJFF 4UT6L 1T6BX 4QJ4B 4ZMQA 4GSDL 1IBFA 1TJMA 1ZLUH 5C0BE 3H3PH 1FV1B 3SCMA 2J6EH 3U9UB 2G2RB 2OX5A 1HHGB 2VITA 3S37L 3KXFD 4AGPA 4JUSA 1H8NA 3PABB 2A4ZA 4GMSL 3C5JB 4ZO9A 4FZ8L 1NGZA 2HVJB 3II1A 5LG1A 3EH2A 3MCKA 2OJZL 4P2RD 5D4QA 2GJPA 1DQDL 3DECA 5MENE 3QYCA 5SWQB 1G84A 4KY2A 1QBMH 5DURB 3DXAE 1PAZA 2B59A 3LEVL 3O4LE 4M9OA 4NT6B 1PX4A 2WNXA 2JF1A 3Q5YA 4BWWA 4P5TB 3BAKA 4N8VG 3HG3A 5DEJA 2IXQA 3ROOB 4XI5C 1KB9J 1PAMA 3INUL 3BVXA 3AREA 2ATAA 3FFCE 4X0KA 2B0SL 4Y1AB 4OJEH 1NUNB 3SPJA 3IJSB 1IBHA 4L3EE 3K6DA 3LNFA 5IF0B 4Y4HB 2FQFA 3MKKA 3GSXB 3VDCA 5GRJL 1NCOA 3J07A 1YRKA 1Y0LB 4TNVF 1M05B 1XVSA 4P5TD 5EO1A 3RL1B 2X1WL 3FB5A 4XMLH 4NN6B 4HKXB 3NCMA 1A65A 5JXAL 3K0YA 4XT1C 1S9VB 2PABA 1I3VA 4MCNA 1YEFH 2GBUA 5E8NA 3FHAA 3O2DA 2Q6WA 5I9QC 3JWDL 4LPXA 4MTMA 3VG0L 4WWKC 3BJLA 3O45B 2P48B 3OZLA 4L3CB 3WFCL 1TCMA 3ZQWA 1N6QH 1LWJA 5FHAH 1QEXA 1AGCB 3V55A 5IV2B 43C9B 4EIBA 4W68A 2NX5D 3QDJD 2FBJL 3DPBB 1I7ZA 3MFGB 5E6UB 4XPHH 5C7ZA 3EYUH 3QCUL 2OSWA 5J06A 4BFJA 1PYWB 3VXUB 4XBPA 2WVUA 2YD1A 5DD6A 1JTPA 4NJAH 5EDSA 3QUML 5F7BA 3EZ8A 1Z32X 5B1JC 4MDJA 1RLWA 3SDAB 3GRBA 4I3RH 1X5HA 1XH3A 1JHTB 2CDEA 3D39D 1NC2D 3QP3A 5KW9L 4PJHF 1B6UA 2KZ1B 3VE0B 4KZEH 4ODHL 4FXKA 4BFRA 3IVKA 4LLMA 3W39B 2DH3A 5CD3A 3UDWA 2X10A 3HS0B 3CSYA 3KPTA 4RMWA 3WY4A 1ZHNA 3EHBD 4HEME 4JGJA 3GB7A 5D7KD 4BZ2H 5FKAA 1JAEA 3WE6B 5IBUB 4G9FD 2GQHA 2MH4A 4DEUA 3O8XC 6PAZA 1MHHB 2PR4L 3NSXA 5KBPA 1G1KA 1SYVB 3C2AH 1OP5K 2V8MA 3DRQB 3H9SD 4JRXB 3RAJH 4C4UA 1OE3A 2ZNXA 1VACB 1I9JH 4AVJA 4PB0H 3NIGB 5ID0A 3RWHA 1YC7A 3UYPB 2HH0H 1M4KA 3N85L 5JR1H 1RSFA 4AEIL 1WISA 3PU7A 4KK5D 2WP3O 1MFUA 4ZPVB 5E2TH 3QFJD 4FEMA 4HWBL 1I7TB 5GS0L 5TE4H 2DJMA 2VR6A 4W9EC 1UWEL 2F61A 3D33A 4FXKB 5KVEE 2F0CA 3DURB 2I25N 1AQKL 4OFYD 4XZUA 1X5AA 3U7AA 5B7FA 3WCYA 1GYUA 2QHRL 4PMFA 4TRPL 1U91A 1MCSA 1WBYB 4C56B 4CKVX 5MERB 2YEVB 5ALBH 3SE4A 1XF3B 1NTDA 2PNDA 1LO4H 4KVCL 2X53A 3QT2A 1MLBB 4KK9C 3JT2A 5BVPH 4X99A 1PLGH 2ZOKB 1HCFX 1LP9B 4JRXA 1J9TA 3JV4A 2Y7OA 2G3XA 3IK2A 1MSPA 2DAVA 1QBML 3AU0A 4UV4L 3NSFA 2ITFA 2FJFA 2OJZH 2WSDA 4X7DC 5IB2A 1ZLEA 3T6VA 4GMSH 1K3ZA 4ZUSA 1QUNA 1F42A 3KLKA 1EXUA 3CX2A 4Q6YA 1V8HA 1A14H 1G9NH 4JDEB 1C1EH 5AD0A 4JGMA 4ZUTB 2HWZH 4IK7A 4JO1L 4JFZL 5ICXB 5LQBH 4M43H 2CJUH 4LLYB 4XZUB 1QA9A 2WINA 2GUOA 4XOBA 1XH1A 2R2BA 3MLZL 4ZFQA 3WDHA 1LE9B 4NGHL 1D5BB 2NY3C 1WZ1H 4A6YH 4E0RA 3UC2A 3I9PA 3EJSA 2FH6A 4G8AC 3BGFC 4GKLA 3QQ9C 4GRLA 4X4ZA 5HI4C 4CJ1A 3CHQA 4KK5C 1UC6A 2AZAA 1HCVA 1PVHA 2UYLB 2E86A 5E8OA 1S8DB 4LRIC 4O58H 3GI8H 4L4JA 3OGOE 3L17A 2X40A 3F3HA 1TJGL 3IDMA 5HI3D 1NFDA 4AIXA 2HJLB 5E6YA 2UWEF 3F85A 1XAUA 2W94A 5ABZA 4NRXA 5JIPA 3V0WH 3PHQB 3SDDD 5IVXA 2XJKA 3CDGB 4UIKL 3DROB 2ENYA 4Y4KA 1X4XA 3ZZLA 1NQBA 2QVIA 3FO0H 1YHPA 3ULUL 5GGTL 5IROD 3V9EA 3KLQA 2OR9H 2I7OA 4MX7A 2WTRB 1I1FB 4EEEA 5KZCD 5IT2H 2WWKT 2C9SA 4NBXB 4D2NA 2VDMB 1IC7L 3CVHH 2Q8AH 3M88A 6FABH 1N2RA 4TV3A 1XEUA 2E6JA 4ZPTB 4K7PY 2C3HA 2H26A 3O4OB 1U8LB 4HHAA 2COVD 5F88A 3SBQA 1LHZA 2EINB 3V4VB 4MDIA 5I0WA 5CS7A 3D9AL 2D73A 3PWPE 3P3TA 2BXZA 2R2CA 3J7HA 3DX9B 6FABL 1PZBA 2XTJC 2IH8A 3H1ZA 4OGXH 5C0GB 4GI6A 4NYLB 1KJ2B 4KX7A 4Z7AA 2VABB 3ES6A 2OXGA 4FQQB 1N26A 1BBJA 1MJ8H 4OSUH 4NPKA 3CFIC 3PP4H 4JCMA 4KROD 3AABA 3DO7B 3IFNL 1HHGA 2FIRT 5I24A 5L7XH 1XIWC 5AZ2H 1Z5YD 1R5IA 2BHZA 3G5VB 1FBIH 2YUWA 2XFXA 1RUKL 4TQIA 1LD9B 2WSKA 1KLFB 1SJEB 2OYMA 4HBCL 4X6DB 2X4PA 1VGEL 3L08A 1UWGL 2E5EA 4X4XA 1AJ7H 1RH8A 3KD4A 3TCTA 4BXSV 5B3JF 2QADC 5IQ9B 3VA6A 1JNHB 3IETA 5KVFL 1BM3L 4J4PC 2OM5A 3QG6B 4N4YB 1TJXA 3QIBC 2NSMA 1URLA 4WWOA 4WEBH 3CVHA 5E2WL 2WVTA 5MP6L 3OGCB 2VDKB 3MBXH 2RR3A 2VR3A 4KAQH 1DQVA 3SJVB 4WJKB 3DOSA 3VFUB 4KPHL 2HWZL 5DUMH 2AXFA 1G43A 5CJOH 5ACZB 1J18A 3OZ9L 1G1YA 3VXTA 5DRWB 3RY4A 4JHBA 1HQRA 5IVNA 5EEYA 4BFBD 4HC1L 4UNIA 2G3MA 3WDJA 3FONA 5CUSH 5KSBF 3VWKC 2HN7A 5FB8A 3V5HA 1RJYB 3HUJE 4JZJC 4BIKA 5BVJB 3LZFL 4BELD 3GDBA 4MNGE 5CN3A 5I18L 2OMNA 3WTWA 1AS8A 3RDTD 1J0HA 3REVB 3O3BA 2FATL 4S1QH 5DFVD 4PRIE 4XCNB 4HG4J 5DMKB 2ARJA 4D3CH 3L5HA 4JFDD 5EEVA 3MODL 4JFEE 4B60A 4FNQA 4CNIB 2Z1KA 2EH7H 5FYJU 3WG7B 3WHE0 1YMHA 1HI6A 1OF2B 1XH0A 4MMXA 1A7OL 1AKJB 4M6AA 4YUEH 1AIZA 1L0YA 2VZOA 5ALBL 5E1GA 5E8NB 5TF1H 1NFIA 3OXRA 5I75B 4W4NA 4I2XB 4TRPH 2A9NH 1CYWA 1MG3C 3GRWL 3O3AB 1EANA 1DQTA 1L5GA 4R90L 4ZFGL 5E2WH 5C9JA 1FORL 3CBKB 1KCUL 1XT5A 1U21A 3WNLA 4P4RB 2NY7H 4XVSH 5L2JA 2CPCA 2DKSA 2WLLA 4KAQL 3OKKA 4NUMA 4N28A 4HXAL 1NDMB 3WN5B 2IFFH 5I2IA 3RFRA 3TYFA 3GIVB 2F74B 3BXNA 1K9TA 1QFPA 3OKEA 1SPDA 4KK8C 1DJWA 5IB3A 5I0DA 4JL2A 4QUOA 5IVXE 2XUWA 4ZXBA 3RFZA 2AK4E 1OK8A 3D3VA 2JFCA 2D7PA 4JPKL 1U3ZA 3BMWA 4RFEA 4UWQB 2WD0A 2PPAA 3BAEH 3UAJD 4H7VA 2VOTA 4Y5XA 3PWJB 4DJMA 2K0RA 1OF2A 5C6TL 1CMOA 1F4YH 5AW2B 5GRXG 3BKCH 5IK3B 4M5ZL 5T33L 4HJJH 3ZHDA 1VACA 4U1HA 1NPJA 4ZAKA 2ZKYA 5ERWA 3GF8A 1DVSA 1WA1X 2WZAA 4JKPL 3QIBA 5I16A 4IU3B 3E9UA 1WGOA 3ETBF 4K94H 1IGCL 2DPKA 4AEFA 3HAEH 2FEEI 3QEQE 1U8PA 8FABB 5KN5A 3NA9L 1H8SA 3C6LA 3LRMA 3SOBL 4F91B 4LLMB 1CD9B 5DVOA 3SGEH 3C12A 1A6TA 1KCVL 3GIVA 4NZRL 4QRAA 4Z5RB 3MUGB 3EFDL 5TGBA 1CICA 1JMZA 2JLLA 2NY0C 1SN2A 3FOMB 5T3XE 4AGNA 3ULUH 1UVQB 4GS7B 3SDXE 3SZ6A 3MAWA 4MB4A 2ZE0A 1TQWA 4UDTA 2A9BA 2Y2YA 4OLUL 2YUZA 2AJUH 4N90E 5FV2A 4KZ0A 5T1LD 3V0WL 1WAAA 1B0RB 3GSUB 2WYHA 1CFVL 4MKMA 1Z5HA 4LSQH 3UO8B 4JFYB 2HPTA 3T0VA 2FVNA 4J2QA 4MRBA 3WU1A 4JG9A 3FU3A 5D71H 4PV1C 2DWDA 4AC2A 3MV8A 1MQKL 2ZOTA 4A6YL 4IOIA 4PS4H 1JYWA 4NGHH 5CWSB 4K3DH 3GMRA 2I5YH 2XQBL 3FK3A 1L3WA 3KLSA 4X6FA 2C9UA 3LSOA 2B9AA 2X1OA 1WWAX 3TT1L 4FA8A 4YFLF 2L04A 5FO9A 1JWMA 1N6UA 2X89A 1YMMA 4K2UL 3WLBB 1HX0A 3FDWA 3MRHB 2J88H 1MXGA 3Q9QA 1M7XA 5E1HB 1OGAD 1DJGA 1UOLA 5DTFB 4FQCL 2CJUL 3QIUD 3U2SB 4NKOA 5T1MB 1QA9B 4YHLL 2EKJA 5FUOH 2ZAIA 4A66A 4OFPA 4AYGA 2NY5C 4MA1C 5FV1L 4NAQA 4W9CC 3AVEA 4WEUD 4XH2B 5HHOD 3FF7A 3S3JA 5LLIC 1TEYA 1EEYA 1E3ZA 1TDQA 4JCLA 4GT0A 4FHKA 5CHNB 4NRXB 5SWSB 4TL4A 4AI7A 4KMLB 3P9MB 3UTTB 2BSRB 3VMPA 2CHDA 2VXQL 4Y16A 4AYEC 4PG9A 5SWZE 3LY6A 1EFXD 4YHZL 3N06B 2BSTB 3ILDA 3CWGA 4N2OA 4J3OF 1BFSA 3DV6B 4LMQI 2QQLH 2OX5B 2VITB 2V7NB 4HIEB 2X41A 4HUNB 5F0JB 2XWEA 1CF1A 2WLIA 4W9GC 5C07B 4XMXA 1ZHBA 4AMKH 2EDBA 4JFEA 4MDIB 2XTSA 2ROXA 3MV7B 4XCFL 4HDIB 2A83B 2H47C 4MZ2A 4Q74A 3FFCB 3M1OA 1OARH 5DVPA 4N2FA 2P8MB 2I85A 2QQKL 4A55A 3HKFA 1IZKA 1KIPA 3NIFF 4OV5A 2A6DB 2Q10A 4TSCH 1X5IA 7PAZA 3WAJA 3GJFB 3ROOA 3ESNA 5IWLA 3D85B 5EZIL 4GRWE 3N1PC 5SX5H 5I6NA 2GIYA 4LF3A 1VGEH 2O61B 3ULVD 3MNVA 3LAFA 4I4WB 4BK8A 2R0WH 4PRHB 1SEQL 1TZOA 4KRPB 3DX7A 4P48A 5ITBH 4MX7B 1OAQH 5E1AB 1KLFA 1SJEA 2OMYA 2F7IA 5EU3B 3ESUF 4Y0GA 1UM6L 1ZY9A 4PR5A 2JXMB 2ORBH 2YGOA 1P7QD 1ZS8A 5FM8A 1UTDA 3UABA 4P5TC 4KZEL 3U9PL 5BNXD 2H6PB 1RVFH 1LMKA 2R7EA 4PCTA 3D48R 3NDYE 2EVJA 2IPTH 3MV7A 2AC0A 5FYKU 4WNJA 4MCMA 3O6LL 4YFEA 4P4KA 3ZE1F 1PZ5A 1ACZA 1XGZA 2GG1A 5FFGA 1W6WA 4NENA 4N0CD 2A9MH 4M61A 4YXHL 3MOBH 5DEFB 4U1JB 2LLGA 4RMRA 4ZS7L 1WIPA 4TUKH 2MQ3A 1YO4A 1KMGA 3QDJB 3PGCA 3TBSB 3G5VA 3VO0A 5BXFB 3IGKA 1ZT7A 3P9LA 5DD5H 1ET7A 5GGVL 1XCXA 2P24A 1PSKH 4P9ML 3RVUC 3TZVC 4L8DB 2FGZA 3WFDH 3RNQB 1ODAA 4LSDA 4JREB 4ABUA 2GJZA 5C1MB 2DQGL 2O5NA 3SE3A 4X2UA 1DN0A 4AXWB 1E9PB 4TNEA 5IB5A 4CMMA 2DQTH 3AMLA 2H8PB 3FONB 3GINA 4DGYL 1PCSA 3V4VL 3DK0A 4FNRA 3E6HB 4J3UA 4FQJL 1J8HA 4GXVH 3L4TA 2OPCA 5BZXA 3UDWC 1AKJA 1JGVH 3AY4A 2FEJA 4M7ZB 3D50A 4WRLA 3EH3B 1NBZA 1VFAA 2VQ1A 2MMXA 3FTZA 4N0UE 2CR6A 3S88L 4L18A 2RD0A 2ARJB 1EZLA 4XHJC 1E27A 4P4KC 4A38A 3MV11 1KTRL 4XAWL 1P7QB 2XT1B 1D6EA 4KGLA 2DMBA 3MLZH 1UD8A 3CHXA 1HEZB 4TLKA 1RJYA 2WUBL 2IO5A 2H1LM 3ZKXB 5I19H 4YDJB 1TEFA 4U1IB 5CSZB 3VYNA 1BAFH 1DL7L 4ZS6C 2NMSA 3KYNB 1AGDA 1T22A 2XOTA 2WBXA 1MFBL 5IB3B 4TXVB 5E6IA 5DDHB 4J3OC 4FZ8H 5E56A 3J2PA 2BSCA 4YVNA 3F7PC 2EKSB 1H19A 3OM3B 3WN5A 2BIOA 2LVCA 1ZANL 2DLTA 2ZG1A 4KNTA 2YJQA 1TTGA 4QYOA 1A3LL 1VF5C 4CBZA 1A64A 2NUTB 4QXUL 3NACH 3UYPA 1KULA 3IN0A 2XZQH 1NKGA 5BVPL 1E0OB 4LVOC 5KVEH 5JPMB 2O72A 3VXSA 2BS71 4HALA 3IGFA 2YD6A 3OKKB 5DHMC 4X7SL 1Z9SA 2ZOWA 1MI5A 3MJ6A 4DSYA 4PVMA 3FRUA 3W9DB 2YXVA 1VENA 1ZPUA 4N25A 1T4KA 1JZJA 4HHWA 5AALA 4NUGL 5FEBA 3VQLA 4E5XA 4YZFE 4J3OD 4GG8A 5DUPL 1XBRA 2A7BA 4PJCB 5EBMA 1YCSA 1ETZB 2H32H 3D09A 4DGIL 3HKZA 1YYCA 1UEYA 3ZHKA 4BH8B 4XX1E 1U93B 5KYXB 3TCXA 2RCSH 3TO4A 4Y4FC 1IIKA 1JIBA 3CIAA 3MXWH 1IX2A 4EDWL 3T6ZA 5IKCB 3NK3A 1NCGA 3X1BA 3H53A 4LVHB 1E3XA 4YEFA 3LXCA 4HMEA 3DK2A 4X42A 3VVWA 1F02I 2H0PA 4PJHB 2C7FA 1E2VA 3QS2A 1TNMA 2L7EA 3MJ9H 4M62L 5DK0B 5LBVA 1SBSL 2YPLD 4BZ2L 1RD6A 1DDTA 4AV0A 3D18A 3ARDA 5I8OL 2R0LL 1P4LB 3MJ7B 2FWOB 2CG9X 1WT5C 5G55A 2CIKB 3ZXAC 4KI1A 1JPEA 4IRJA 3S3PA 1MFCH 4HIPA 3ZW3A 2BSSA 3S5LA 4C8XA 3M86A 2YSTA 2Z91B 1DQQA 1JVLA 3RVWC 3VU1A 1WUNT 1SJVA 2JLPA 5JZ7D 4EN3A 4F8TA 4WI5A 1IFRA 4QRTB 4RNRA 4HXBH 1L0PA 1RI8A 2VTFA 4NNYB 3VX0A 2YMOA 1IGIL 3LHPL 2EIDA 5EUKB 1RMFL 3EJUA 3V0DA 3OKOB 1E28B 2WXOA 3EAKA 3QO0A 5IY5B 3QJXA 4I13B 1FRGL 1KBWA 1U2YA 2OMZB 3APMA 4PJ8C 4D8PA 2C34A 4CKQA 2EDEA 2ADFL 4OTXL 4L1SA 4L8CA 3WFDL 5A2KH 1MCIA 3OLIA 3G6JF 1FAIH 3VTTA 1KJ3H 3CX5K 4LCWE 1WS8A 4ZTOH 4K5PA 3P2BA 1T66C 3RUGA 3MJ7A 5D7JD 4JE0A 1UXMA 1BVKA 3MOBL 3AGVA 1RJLB 3ARED 2YC1A 4KU1A 4LESA 3KJ4C 4IBTA 4PJDB 5KSBA 3TNMB 1MCWM 3AM8A 3IE4A 3FN0L 5J13C 1KNOB 4XP1L 4FMFA 2KPNA 3VFMB 1RP9A 4O9HL 3EJTA 3V7AE 5GRJH 1HKLL 2NQCA 1QX1A 1Q9WA 1UXSA 2ZXGA 4NNYA 4J3WA 2V37A 3RKDC 1NA8A 1ZTMA 2CO3A 4Q8BA 4DUWA 4B27A 4BWUA 1LO3H 4ANXA 3ZTNH 2VDQL 4FFZA 4I89A 4J4PA 4MNHA 5HYSB 4LOVA 1DLHB 2K1MA 1QSEB 3U83A 5EU5A 2R0WL 1KCBA 3VI3E 1A7QH 1JNNH 4RX4D 5JHBA 1PZAA 2QSTA 2QQQA 5A2CA 3CZNA 1ES0B 1ZVYA 1ED3B 3MOAL 3OC8A 1ZGLA 1RZ8A 5HDRA 1ND0B 2G5BA 3MV8E 3APDA 5HPMB 2ADJB 1ML0A 1QEWA 4A7GA 4R7NA 4KZDH 3E0GA 3HG1B 5E4OA 4CN6A 5B3SB 5DJDB 5CU9A 2XRAL 3QAZB 4JPIA 3EYVB 2HXAA 2VYRE 2WC7A 1QRNB 2WLHA 4QMEA 5A7BA 5SWSD 3TVMA 3MRLA 4LE8A 2G0LA 3D5OF 3QQNA 3CZKA 1XWVA 3ETSA 1MAMH 2YLHA 2HT2C 5L2KA 4G6ML 4HDIA 4JJOA 5G5DB 4WWPA 1DO6A 3FSZA 1G9HA 2X2IA 1UA6H 4RLDA 5K9KA 3BSZA 4HG4K 1E3FA 4RGNC 2EH7L 3RDTC 1GJIA 2AK4A 2OV0A 1DLHA 2FJSA 4CU6A 1I8AA 3G5ZB 3B6SB 4JO8A 3TONA 5JW3H 3ARZA 3GSQB 3ISWA 3ALWA 1QBLL 2FQGA 4M1CD 4PWJA 5CP7B 5F3HA 1JWUA 4X8GA 1NL0H 2WKGA 3GMNA 1QBBA 4JQIA 2VR9A 2CGRH 4ZQTA 4PRDB 5LAPA 2J21A 4U1JA 3BH9A 3ZHNA 3TT3L 1GKOA 4LPVA 4KJQC 4NCDA 3K1DA 3B5GA 2XN9D 1I1AA 1NDMA 1K2DA 3AW5A 4JL1A 3G9AB 3NN8B 4HLJA 2NY2B 4JY6A 3U46A 4A67A 5I75C 3MTRA 3BP7A 1SDDA 2R8SH 1WZLA 2YARA 4TSBL 2EDRA 4P57B 5HDBB 4YE0A 2N56A 4I9WE 3TZVB 1A3RH 2W9EH 4TL5A 3ETBJ 4HJTA 1EDQA 4PS4L 5IHWA 4AEHH 3SKUD 3WY1A 3KXFE 4XVTL 5L4JA 4FQHA 4LVOB 2ZX9A 5HVHC 3KPQA 1KLGB 3FMGH 1XTLA 5D1XE 1N0XL 5I17A 1A3RL 1OPGL 1XF5A 2D3NA 5CP7A 5L7XL 1KACB 3KYOA 3CH1B 3K6IA 3OKLB 3G5YA 4GBXD 4XNDA 1BJMA 2F68X 1KG0B 3BUPA 4FQLH 5D1QC 1ZPLA 5C0EB 1IC4H 1KTJA 3FN9A 1EQWA 4IS6A 4MQXD 3SPVA 1NMBL 1AZBA 1LEGA 3TPKA 1OM3H 1DVFC 3OKDB 4Z76A 3AREB 1M6UA 3C60B 1Q1JL 1TETH 2JQAA 1NBZB 1VFAB 5IQOA 3QUYA 5KVGL 2PCFA 2EDWA 1KLUA 1KXTB 3E9TA 5CMAA 3TNNB 1PIGA 2PPEA 3NFPA 4V11A 5C0CE 2E56A 2VLLA 2O4EA 1U8KB 2GIMA 4LOFA 1L7TH 1M7DA 5I0ZA 1OAYH 3SE4C 3RX9A 1TMQA 3U9WA 1HXYA 2YXFA 1HWGB 3BPLC 5LBSL 3KWTA 1RIUL 2FX7L 1CXIA 3GRGA 3V0AC 3VG9C 4GRLD 2BZCA 3VWJB 3Q0HA 5F1KC 4UIKH 4MQ7B 4I3SL 2Q5BA 2GHWB 2ZAHA 2VC2H 4LIQH 1SOKA 5E6ZA 3GXNA 3LVEA 2GB2A 1AOZA 2CD0A 1LDPL 4HX1B 4FTVE 4R4ND 4NDMA 3HC3L 1BAGA 2AJSH 3SBRA 3U1QA 2WB1A 4KJWD 2UXGA 1Q0XH 4CRPA 2AABL 43C9A 4TVPE 3SDDA 2WVVB 1MUJB 2DLEA 1JZFA 4PU2A 3S36X 5JW4Q 4QRPE 4XRCB 2YXMA 2NY3D 4FCHA 4PJ7A 3ARUA 2J8UA 4UTAH 1FZOA 2Z31A 4YHIB 3LNEA 3HZYB 3VD4A 4HV8B 1M2VA 3QHZH 4N6RB 3ZUNC 4TQPA 4A2MA 2ZUSA 1FSKC 5I0YA 4X5XB 3F12B 5CGBA 5CJBA 4W9KC 2EDNA 1EHLL 3M45A 1HSAB 1ZAGA 3GGWB 3S96B 2QL1A 1MF2L 3RDTB 5DCCA 5EIIB 3QIUC 4L8SC 5AZEL 5M7QA 3QJUB 5ANHA 3KJ6L 3HAEA 4N1EA 1YNTF 4XP4H 4YDZA 4YL4A 3U6RA 2V7HB 2YWZA 2GCYB 1MRDH 3FUNA 3SB3A 4NAMA 4HZAA 5FHBH 5HHNA 3CCHB 5FO9B 2CXGA 3DVGA 3TM6A 5J5EA 1U8NA 1QSZA 1ZXQA 2MHAB 1XCWA 4MXWL 5I82A 5C71A 3WS6A 2FQDA 1XF2B 2UZYB 2ZCHL 1BDYA 4XP1H 4ALAH 1MZYA 1I1CA 5CEXA 3DTDA 4PG9B 5FX3A 5DC0A 4UIMA 1THAA 1H0DB 1BD2A 1Q4NX 2BSTA 1DCEA 4AJYV 2DL2A 1S78D 4V1DB 4OBSA 4HJ0C 2Y06H 4G8EA 2D4DA 5DJAB 1G6VK 3CN0A 3HUJB 4OLWL 3O3DA 1NJ9B 5C07A 4Z7NB 4RNRB 2MIZA 1EEYB 1L9OA 4ZD3H 4RZCA 3T77B 4BBWA 2IG2H 3Q06A 2CU9A 1O5DT 3R8BB 4ELKB 1RZIB 4U7KA 2G5RA 1KXQA 1T0MB 3HJEA 2V7HA 2ENPA 2Q87A 1FFPA 4N2AA 5KG9B 3A6BL 2J1WA 2PWFA 3KW7A 1RZQA 5HJ3A 3QUXA 1GSMA 1RZFL 4EI5A 1D7CA 3N3EA 5F8RC 2FO8A 2X4QA 3FS9A 3N85H 4EXPX 4HS8L 4ZUTA 3M17A 1BM3H 3QUHA 2P8PB 1QSFE 3FQWB 4JANB 2PW1A 3HE6D 3I9IA 3GMLA 1ASPA 2OMZA 3D8MA 1OTTC 2ZOLA 5D9SA 1E8ZA 4G8EB 1ZV9A 4HBCH 1ZVHA 3DIVA 3EH4B 3GXFA 3TXAA 3C08H 5DJ8A 1UD4A 3B9KC 4YHMH 3MRPA 5HY9B 3ZMRA 2IAMB 1NCHA 2V5SA 1W2KT 3QDMD 4FLOA 2ICCA 3Q2NA 1PPIA 3CHSA 3O9WA 4IMKC 3HR5A 1SHMA 4OSUL 2PWEA 3F5WB 4KNQA 4JW3A 5DXWA 3LN5A 1U42A 4TUOA 4XBEH 1CDBA 1EXGA 3CVIL 1ZS8B 1HQRB 2VXSH 2VB5A 7TAAA 4JFPB 3SCMC 1PZSA 5IBLC 5D8JL 4AQ1C 4APXA 3GXIA 4W4OC 3OMAB 1TNNA 3HMXL 4LSVH 3QXVA 1UH3A 1EO8L 3QCTH 3T2QA 1G9ML 4MJ4A 1G9EA 5EV7A 2IOOA 3RNQA 3SBWC 2BIIA 4S1RH 3QULB 3S5YA 2N3JA 5BQDA 5ETUB 1NUDA 1T1XB 3CFBA 5HHXL 4A7SA 2OMBA 1I82A 5GS0D 4HEMA 3EO9H 3RGVB 1F86A 1U58B 4MYPA 5GQBA 5TD4A 5DEFA 4A7TA 2ZCKL 3QQ3B 1T3FB 4AENB 4LLWA 1JXKA 1MFEH 3TWYA 1G7QB 2WLNA 2D7OA 1GJWA 4Y5VA 4WTZA 4L8BB 4QTFA 2VMFA 5D7SH 3U4KA 1KV7A 1NZRA 1UGKA 1HHKA 4BSWB 2F5AL 1LQBC 1CDJA 4OU3A 1H6UA 4KBPA 3QZLA 5I1IL 2IGLA 2LABA 4L5FH 1V3JA 5ENWB 3DO7A 3D0LB 3WTSA 2WXJA 4PGBB 3RA7L 5ESAB 2CRMA 3K6SA 4Y89A 3BO8B 1A6PA 3P9WB 2R0ZH 5IUCA 1KXVA 2B5IC 1EPFA 3SPHA 5I2IB 3V7MA 3CXDL 3SE6A 1CI5A 5GISH 3IAQA 2IAMD 2VLME 2G75A 2GABA 2YGNA 3KEHA 5F97E 1YY9D 4MD0B 2X2HA 3C6LD 1RK0B 1ZMYA 5CLXA 3WV0A 2IGTA 5BOPA 1VSCA 5IHBA 1X7QA 3S3DB 4X5QA 1IL1B 5KVDL 1IQDA 5DO2C 1WYJA 4F7CA 5KWYC 4E41D 4ZFFB 4J23A 4YDVA 3QAQA 4OCWL 3CVHB 1I7ZB 3QDGB 3A3YB 2VDKH 1CGSL 3NP3A 1JWUB 3ZE1E 3WSQH 1LO5B 1Z66A 3QBTB 4OCNC 3DUUB 2Y7SA 2J6EA 2D9CA 4XXCC 3AS0A 3QA3A 3MO1B 3DNKA 4N0YH 4GSDH 2PKDA 2OBGA 1IGFL 4A2FA 4CW1A 3R19A 3BH8B 1KENH 3LIZA 2WSPA 5FGSA 4GUPA 2VDOH 1XR9B 2RIKA 1A7RL 3D05A 1AR1B 1ID2A 1KTDA 1KXVC 2EDOA 3BT2L 3LKRA 1KCRH 3TZVA 1HZLA 1JK8A 3HMWH 4P5MB 3GSOB 1KB5L 1M1XA 5CEZD 1I7RA 5KJ4A 1KGCD 5I1JH 4QRUB 4IBQA 3VXTB 2HVKB 2D2OA 2NXYC 3IDJB 3RPIA 1OLZA 5DMGC 2ICWI 2EO1A 3A23A 4UINH 1N5AA 3BN9D 2BS8A 3A21A 5E8EA 3ZE0E 1ZLVK 3V5HB 3WKPA 3F2LA 1NGYB 4A2GA 1J1OH 4WSGA 1PNDA 3G5YB 4LL4A 2Y1YA 1IKOP 1BVNP 1TCRB 1OGAB 1S3KH 4J28A 2PWDA 5C0DA 4AEEA 4GFTB 3OMIB 4Y5VC 5D96C 1X5XA 2XTJB 2KQNA 5F71A 5DEZA 2WVVA 2ZX5A 1JGIA 5DHVH 1U8QB 3LPWA 2O93L 2ZP9A 3MLTA 2HKHL 1VFOA 3KLDA 4KKAC 4Y16D 3KM1A 4YHML 1YNTA 3QRLA 5J11B 4ZX3A 2J6WA 3TH3T 3D3VB 3LRHA 1JWSA 4JFHE 2VN3A 3LKPB 3NAAH 4DKEH 3CN2A 3CG8A 1NLBH 4LQFL 4KHXL 5F0PB 4TQEH 3S3BB 2HJFB 2LAAA 4FNUA 3I3EA 5LDUA 4FADA 3FU9A 4NWUL 1HSAA 2Z7YA 4KXZI 4RA0C 3UBFA 1QASA 1NGPL 2YAHA 1RZJC 2VLJD 3DXAA 3FXIC 4O5LL 4HIHB 4HP5A 4ZPVA 2AEPH 1CE1H 3NCCB 3FUDA 2EVGA 2I32A 1WPCA 1PS3A 4NLHA 1QUNB 5SWZD 2V17L 4F3FB 4JHZA 1ASQA 1U8OB 3JV6A 3MRKB 4NO0B 4U3CA 4WI6A 5CZVH 1HCZA 2APWA 3DMMD 1MCDA 1ZLSH 5HDBF 4YHOH 1AANA 2GIXA 4W9JC 1INQA 4Y4HD 5ICXA 4Z7VA 5DQ9B 5A43C 4X8CA 2EDKA 2B16A 1N6QL 1HYSD 1A6TB 1JP5A 4XNYL 3VCLA 4GT7A 4U1HB 4P3CL 3SE8L 1XZ0B 2X42A 2ZUTA 3NYKA 3RY6A 1AGBB 1EWHA 3PNWB 5J0BA 3D30A 2ZXWB 4WHTB 3D51A 1P9MC 1GC1L 3N44F 5I73C 3L2LA 4QPEA 5EZOL 3MQIA 3OPZL 1G7MB 1BMZA 3PJNA 5DHXB 3ME0A 1NGXB 2VR7A 3FCGA 3H4HA 4I0KA 5DS2A 1W72B 4Q9BA 2IBGA 2J8HA 3QUMB 3L4UA 5D1QD 4DK3A 1PEZA 5I1DB 1LLAA 2WUCH 4DKDC 4B9KC 5AVWB 1LJMA 4MCZB 3HUJA 1F4WH 3ULVL 3A4FA 1ODUA 3ARTA 1N70A 1AE6H 5KG9A 2DQUH 4BFGA 4YS4A 5FAAA 1SXNA 1WBZA 5KJ7E 4IBSA 4Q2ZA 2OS7A 3DSFH 1CDHA 2BFGA 1UA7A 1QUPA 2A77L 4YSUA 4G7RB 2CQVA 3KE0A 1INQB 2WQRA 3ERXA 2ED6A 4UDTB 5AKVA 2AJYH 4X5WA 3W2DH 1LMIA 3WFZA 3K81A 5DJ0A 4BZ1H 4JPIB 5KVGE 2DLFH 4FULA 3FSWA 1S9XA 4XVJL 3OB0K 1F90L 1DVUA 2GTZA 4OGAC 2ED9A 1EJ6A 3LIZL 4WI7A 1BZEA 4NC2B 3ZKNC 5ECGA 3O6FB 3O6ML 2IMMA 1RY7B 1QNZH 2HRHA 1PU0A 4NKMA 4O51B 4K7FB 4LEBA 4ONGH 1JCVA 3DX9A 1EEQA 1J8HD 1THCA 3LH9A 3L3GB 3GBLA 4LBAA 3GMRB 5KANG 1R33A 1VDGA 2YEZA 5K33A 5C7XL 1ORSA 5DYOA 4PBWD 4MASA 1RZKC 1KIRB 1RAMA 1RZ7L 1YY9C 3ZL4H 3WJMB 3P0VL 4XNXH 4YDMA 5DF0A 1NIAA 3K1KC 3GSQA 3ILQC 5IFJA 3ALPA 3UTTD 4UQ3A 4DP8X 1AH1A 1DANU 5D9SB 1TTCA 2L0DA 2VXSL 3S48A 1S9KC 1UG9A 2CM5A 2D0GA 2H3NB 1OAKL 1T1XA 3CFBB 4XCCL 2IH1B 2ZF8A 3N1QC 3IETB 3OVUB 2BSED 3C5ZD 3AU1B 3WHXA 4JKPH 2YMXL 1GCFA 3NJVA 1BSIA 2XN9B 2WN3A 2G2PA 1E2WA 2TRYA 1YECH 1ET8A 2GPZA 3P73B 5C0AE 5FYLE 2Y0SA 2AQQA 1J0ZA 3DJTA 5D7LE 2JTYA 5CKGA 5DD1H 4D9RD 1XGQA 2CUMA 1G7LB 4MJ6B 5L4FA 2ZXCA 2YFOA 3RILA 1PD1A 1T5WA 4J6RH 4P3DB 3ZUCA 1G1OA 1Q90A 5LGKA 4BE6A 4PD4K 1AGDB 3DBXB 4WWKB 5GGSB 3P0VH 4XNXL 1RZ7H 3ZL4L 4KHTL 4PR5B 3P0YL 4JM0A 1UD5A 4KXBA 3O45A 3EG9B 4HXAH 2IWEA 4JFFA 5HHQB 4NKQB 1CLYL 4QHNB 1G7PA 5E4EB 4E42B 2Y6TE 5TDNB 4PJ7E 3OKNB 1TG8A 1NFDE 1T21A 1ZHKA 4NO3A 1OSZA 3N9GH 3V5DB 3H2PA 1FORH 3BPOB 4K8RD 1VFMA 3C60A 3REWA 4ELMB 3H2QA 1IVLA 1ITBB 1BLNB 1KFAL 4AG4H 4XO5A 4QOKA 3LN9A 1KPUA 3GXDA 4YIQA 1EGJH 2A99A 4D9LH 4LHJB 4PYHA 5KOVC 3RE0A 4N2LA 3FL7A 2Q3ZA 1NL0L 4HMCA 1HVXA 5E4IA 3TJPA 5L2JB 1AXTL 1B4RA 1TENA 1CLZL 2ICEC 2VXVH 2LT9A 2K3HA 1O6SB 3BHBB 3EBGA 4P2QE 1RFDL 5GSRB 3VI3F 2PXYB 1LP9E 2VIRB 2GYSA 1HL5A 3HS0C 4ODWB 3US1A 3SY0B 2IPUG 3T0EA 2H32A 2P47B 4I0PC 5GGSA 3TJEL 1E43A 5C0IA 4PGCA 3K2MC 3T6QC 1SHXA 3EG9A 5HHQA 1J9CT 1HHHA 3N41F 3VWKA 3LZQA 1MJ7L 2CR0A 4BH8A 2PTUA 2WZ0A 3SDDB 2OW7A 4YXLH 4DGVH 2A74A 2CALA 4WUKL 4XXDB 4EIUA 3FB6B 4O2FA 4QXWA 4F9PA 2P5EE 2Z0BA 3MRNB 1EO5A 1WWCA 2NCMA 3GUFA 4WFED 5KSUB 3IFOA 1QMUA 4DQOL 4G3YL 2PTVA 1DSWA 1HAUA 2V5RA 1UQSB 2UZXA 4JG5A 2FUQA 3CZSA 2R29A 3EOBA 4PJHA 3I9GH 4TVPH 3RJOA 1OIOA 5I5RA 2ERJB 3TU6A 1CURA 4G5AA 1FO0H 2NR6D 2CRIA 3KGRA 3M8OL 2F7QA 5B3JE 5FDWA 2CCWA 2BZ7A 3QRFM 4HQQH 1E6JL 4ORGA 1E5AA 1NM9A 1RPQA 5LGHH 4AM0Q 4RWYL 2EICA 2Q6WB 2PWGA 4M29A 4I0CC 4WY7L 1T22B 5D70L 2BCKB 5E94B 3IDGB 3QORD 1I7RB 3WS3B 3G7TA 3FUMA 1FVCA 3FU8A 4J3XA 3W57A 1UB6B 1S7TA 4I9XA 3BMVA 4UV7L 3RWGA 3UTPD 2C9AA 4ETQA 1CFNA 2C3WA 5J56B 3OSKA 3TFKD 4Z6AT 4FQIH 3NIDE 3MRNA 5KSUA 3KBHE 3VI3A 3E1F1 3SYCA 5M95B 3BP4A 1B9ZA 4IOFC 1RU9H 3V6FB 4HFWA 3NAAL 4UUJB 3E8UH 4YSQA 3FKUS 3RVTD 1N8OE 5E5UB 4I8DA 3R0MA 4WCYL 1YC8A 4JFDE 3RNKA 4GAGH 3FQTA 1QWHA 4PJAB 1TQCB 4AT6B 1IC5H 2CIIB 3KDMA 3QR1A 2IAND 2OMWA 5AUMB 2GBVA 2HFGH 4YEEA 3IVKB 2A73A 2C1PB 4OFIA 2DI9A 3BC9A 5CP3H 1EAQA 4HUCA 3I2CH 2XWJA 3BD4A 2OLDA 3TA4D 4OZHA 3T4AB 4JHUA 4ZMXA 3WUWG 4Y4KC 2AXJA 3U48A 4ADIA 2MKLC 2C3GA 3O81A 1HNYA 3PQYE 1P7KB 3DYMA 1T83A 3OR7B 1F41A 1WBXB 3M6DA 5D2LB 5H4YA 4YSAA 3UP6A 4OF0A 2N7SA 4ABVA 2QHLA 3SGKC 3M1BB 2I27N 3PFQA 3ECBA 1KN4H 4GIPD 4A2EA 4EO5A 1XCTB 4EOWL 4YSPA 1ORQB 4NKIH 5DZNA 1QSEA 4U4IA 1X6LA 1HHIA 5LB1A 5GGQL 4PP2B 2YAEA 2B4CH 2YPVH 3UGEA 4N0RA 4Y5YC 3ZZ1A 5EU6E 4DP5X 2AJ3B 1X5JA 2R0KH 4JJHA 3SO5A 3ZKMC 5ISZB 3IYLW 3P9MA 4U6HB 3U0WH 2PETA 4B5EA 3EBIA 2I9LA 5DQ9A 1YEKL 2EJ1A 2KZBA 1IC1A 2PYFA 2RBLA 1W80A 1JGDB 2N4IA 2H45A 4YDKH 1WVZA 2DRUA 2CLRA 4OQTL 1XDTT 1DQQB 2C5DC 3IDYB 2VERA 3OLGA 3RJQB 1CU4L 1XF3A 4G2AA 3KBFA 3RX8A 5J13B 1HE8A 3MYZA 2Q8BH 2XDHA 1F6AA 3HS8A 3VXMD 1FZKA 4XCCH 3OLDA 4NQEB 1T7XA 4LCCA 4X6EB 2WZPD 2AV1A 1MNUH 1FNFA 2XNAA 3OKMA 4YGVB 4W6WB 5JHDA 4RMVA 1E4XL 2IAAC 2H2PC 4QXTB 1YEDB 5KVDE 3MRBB 4UZGA 2F6AA 1MWAB 1XGYH 4DH2A 2CBTA 5IZ7A 3B7SA 1YNLH 2NZ9C 3ZMNA 3NESA 3BISA 1KEMH 2GW5A 4M6OL 2CKBL 1JGEA 4LKCA 1IM9D 4PLJD 2WO3B 4HK3J 2H1PL 1WT5A 3RDJA 4GOSA 4MFHA 2D7TH 3CFCL 4FMVA 1K4CB 2B1OA 2PP9A 2XKNA 3X3GL 5IJBC 4PGEB 4PJDE 4OF6A 2OAAA 2X4PB 5BOJA 2HFFB 4UAHA 4U3HA 3TO4C 2AGJL 2B1AL 4MJ5A 5EU3A 3MRJA 1FG2A 1IBGL 4MJIA 4BYHA 1T4WA 1ZCRA 3ARPA 4ODXB 4QO1A 3KWWA 4P23A 2JJTC 1XGUB 3ARWA 2EXYD 5FB8B 1IC0A 1OAXH 2RMNA 1IEAB 5HDBE 1KIUB 5E2TL 3JUYA 2Z8WC 5KUKA 3BWZA 4M9PA 4MD0A 1M3IA 1ZGLP 2CJ3A 1CVSC 1USQA 1OAZL 3O3UN 1OCWL 1OSYA 2AJXH 3RAJL 3DMMC 4FI8A 3KNBA 1LDSA 3VFPB 1QQDB 3BQUD 3BIKA 2CLZB 5FYJD 2M26A 3CJJA 4HIJB 1QSVA 5HGDA 1MELA 4POUB 1M6OA 4RFNC 2ADJA 1SXBA 2KZWA 3D69A 4LCYA 3IKCA 4HCRL 4ODVH 1FYTD 2L7UA 5C3LD 1WICA 2HFFA 2WJ5A 3ULUC 1QLFB 3FJTA 3VFVA 3WI9A 4JM2D 2VDMH 4R2GD 3Q2WA 5AAMC 3HMXA 3LXUX 4RQQA 4S1DD 3IFPA 4J39A 1ZV5A 1HDMA 5D4JA 4MAUH 5BZDB 5IQ7L 2DI8A 5DHVA 5I1HL 4P2QB 1OE2A 1A66A 5B1JA 5K59F 4GQ9L 3QUMH 3PS6A 1KTDB 2IADA 3I84A 1I8LA 2VW4A 1CXKA 1YYLH 1R19A 2AJZB 1U8KA 4HWZA 3S98A 4ACTA 3GK8L 4CJ0A 3MYJA 7FABL 1ZLSL 3HNTH 4G1MB 1WHOA 5FPIA 4R9HA 3IXAB 1T5WB 3NZHH 4YAQB 4OD1L 5FOJA 3WFCH 4QRRA 4OUOA 2AQSA 2DYRB 5HDWA 3ARBC 4WKXA 3IJSA 1QI4A 3PFUA 4NLAA 4IU2B 3VMNA 1RERA 1XBDA 5JIMA 4NKIL 3GSXA 2HPOA 4R8WL 3WKMH 1Y1DA 1SVCP 3CZFB 3KPSE 4KJWC 4GPVA 3UTSD 3QORC 5D7IB 3FSOA 1MCHA 4AYSA 5EU7C 2OP4L 4H1LB 2XQYA 4QLRA 2XWBA 1IAKA 4ETYA 4N9OB 3FFCD 4RQQB 4YHNA 4WU7A 2B7DT 4GRWH 2WKLA 3DX0A 1CWVA 3MLRH 3F58H 4F7MA 3QNXB 2E59A 3JT0A 4EZLA 4LT7A 1NGYA 2VDLB 3T0WA 5TGBB 5ELIA 1K8IB 3D7PA 3GO1L 3W82A 4P23C 1PZUB 3GHBH 1JNLH 3JVGA 1TITA 3JZYA 3A47A 4CVWA 4X5XA 3MGAA 5ISZD 3MCG1 2E27L 3LKPA 1A47A 1QZ1A 4ZOAA 3FU5A 1HE7A 3BDYL 2YD2A 5D1ZC 5T3ZD 3IKKA 3ZDYF 3WAKA 5ILTH 2IDUA 2GSGA 3FZUC 3VNZA 1NCWL 5EZIH 4GAJL 3W0WA 3MA7B 3RL2B 4JO3L 1IQWH 1NC2B 3PWPA 1I1YA 2Q3XA 4N1CA 4KMTH 1FF5A 3JWNG 1P2CA 4F3FA 3NFNA 4O02B 5ADPH 5AOJA 4HH9A 4GKNA 3HR6A 1PLAA 2ITDB 1P5VB 5F1IB 2OCJA 3K7UA 4U1GB 1E5YA 1A2YB 3GSNB 3VA2C 2FUTA 3Q8FA 4JMXA 4NO5A 5AOIA 4ECNA 1D9KA 2L7JA 3VXRB 4KDTC 4NOBA 3LQZB 1L9SA 4MQTB 1Z7JA 4JQVA 3F7QA 4HQQL 4BE5A 2IVFC 4H2AA 1I85C 3B83A 3TA3C 1R0AL 2VDLL 1JHKL 2D2CC 1ZA6B 4QAWA 4GLRI 2WWKO 2ZKHL 4QHUA 3EF4A 1SVBA 4CVUA 3HZVA 4CDHA 3U7WL 2NYYC 3GPEA 1U33A 1OSEA 5G4OA 5HI3C 1CR9L 2GY5A 4IHBA 1AZCA 4MDRA 3SDAD 1TFPA 4MXQC 3UIZA 2P46B 3IMBA 1OY3B 4KTDL 5K9OB 4U6VL 1KB5B 1QSFB 1L3NA 2B2XH 1AGFB 2VLLB 3HCVA 2SEBA 4H1LH 4JQIL 2IGFH 3UYRL 2X6VA 3B2XA 4H1LG 1U8CA 4WEMB 5ANMB 1X6NA 1U3HD 1G7MA 1UM4L 1OTTD 5E2VH 3ARFD 2BHUA 1P5VA 3HG5A 1S5IL 1FO0A 1KBVA 3NFSL 3SPGA 1BFOA 2VAAB 3KWXA 1WP6A 4X6CA 5H94B 1XR8A 3W38A 2OI9C 4Y16C 2QPFA 1EHAA 3QS3A 1QP1A 1ROCA 3BQUB 4K2UH 1XCTA 2JQZA 4BK4A 3GNML 4ZMYA 5KTEH 1WC7B 1QKZH 1TQCC 1ACYH 4POYA 4P0DA 1RXLA 4UM8B 4ADGA 2VXVL 3IWUA 5F9WC 5HY9A 1WBZB 2BC4B 2X9WA 4BCZA 3MUZ1 4Q2ZB 1JE6A 3BZFB 5LGJA 1DSYA 3KPSD 2J5WA 1EK3A 1ZWIB 5DJXA 1UH2A 5MEND 1LTXA 4PS3A 5FUZL 4OQTH 3MNZA 2R29H 1D5IH 4HSCX 5I8KL 3SDXF 1BYNA 1CFVH 4M8QA 4YFLI 4Z5RA 2K3TA 2X2UA 3DIDA 1YQVL 4W9DC 1A8ZA 3TH2T 2B1HL 3U79A 5F8QC 1HXMA 3B9VA 3UZEA 4AL8H 4G9DA 2RACA 1A4JA 1I4FB 2BNRD 5MEOB 4E9XA 3ZE1B 3BVNB 3MA9H 2P1YA 3QPXH 2D03L 1ZT1B 1YNKH 1FZKB 1RJCA 5GGQH 4ZZFA 3W5NA 3KBPA 3U6RB 2AQ1A 1KIQA 3UBGA 1CI3M 2OW6A 4X7TA 1H5BA 3QCTL 4WFGD 3CCHA 1BGXL 2EXWC 1INDL 3VXMB 1EXUB 1U8NB 3MBED 4KY1H 5F1SA 1BXAA 3B8SA 4PJBB 4U1NB 1DBKL 5HPMA 1IGYB 1BOYA 2RFXA 2CR3A 2FEDD 5J9PB 4YC2C 1YEHL 3RZCA 3NPZB 5E1IA 4YX2H 1RVFL 2WXHA 1K6QL 4ZMTA 2IV8A 1UM5H 3V0IA 4MJ5B 4HSAC 2XX0A 4E9SA 3CAFA 3WELA 3CDGA 3IDXL 1LO0L 1F6AB 4JG1H 5FGCB 1XGUA 1F4HA 1OAKH 5BV7C 1KGWA 2OZ4L 3PGFH 5G5DA 1KIUA 1BG9A 1ID5I 2AI0L 4NS0A 4H44C 3TO2A 5AOLA 4YLQT 4ELKA 2E7MA 3FQRA 3C6LC 3F6JA 3U46B 3ZRFC 3NG5A 2DEYX 4JO2H 4E9LA 2VM9A 4XCYA 4ZUWB 4HOZA 3WO4B 3CDCA 4CC0A 1NKOA 1Q9KA 1E9QA 4QTHB 1CXHA 5EN2B 3WNOA 3BLPX 5AFAA 1G5GA 2IBBA 3LKNB 3UTZB 5HGHB 2UZIL 3FH8A 4NRZA 3KG5A 4WW1B 3LZLA 4V33A 3L9YA 1QEWB 1CBVH 4L3AA 4U1NA 2ICEA 4R4BA 3C5ZB 2R1WA 4I48A 3S36H 3MRCA 4MAYC 1II4E 2VABA 3ES6B 3F5WA 4LEXL 2EDXA 5CCGE 1DR9A 2NY6C 2NY5L 4K3JH 4ODXA 2HMIC 5GRUL 3KYKL 2Z92A 4YDLC 4BUHA 3QXWA 4PTUA 1E4XI 2C8NA 4APXB 2KYIA 2QTEA 4ZXBC 3RFZC 4NZUL 1MCLA 1FO0L 4HHGA 2XFXB 5CINH 4ES9A 3MBEB 4PCSA 1D2OA 1F90H 2AJVH 1RZKL 4A6YA 4I0PA 2DDQL 1ZKAA 2BW5A 5IHHA 4Y88A 4JGNA 4HLEA 5F44A 3R1GL 3MBEC 1MJJA 3NIGE 1R34A 5D7IE 1FAKT 1PY0A 4JFQB 1XMWA 5DHYB 5D2NB 1ITCA 4AKPA 4YXLL 1IAOA 2VLMD 4UT9A 3X17A 1ICTA 4YHLH 3UAFA 2ZSVA 2P8LB 2VRQA 3L2MA 5EIQA 4MHHI 5HVWA 1OW0C 2BOBB 2FJGA 3CLEH 1BXVA 3QZBA 2ZUYA 1BIHA 2ESVD 3SDCB 4HGWB 4R97B 4FQCH 4KRLB 3T1FB 4L8BA 5IHZB 1HKLH 2BZDA 2ODHA 5EMYA 1EBPA 4AV4A 4NN6C 4O9HH 5JPNA 4IKIA 3ATDA 3Q2LA 4KROB 3VFVB 2VDRB 1BZOA 4UT7H 2QPEB 4U7SA 1IAIL 2PN5A 1GY2A 3GUTB 3BDBA 4AKOA 1BQKA 3Q1SL 2A5UA 3RX5A 2A74B 3JTTA 4XCEB 4NBYB 4LOUC 1DDHA 1W8NA 5I5JA 1DVFA 4HD5A 4MCYA 1CIUA 1CYXA 2Y7NA 4KDWA 1C08B 4Y19E 5A3ID 2BCKA 1BREA 5F1NA 3IJ7A 2WOBA 3T65A 4JPSA 4X83A 5CZVL 2BNRB 2X5PA 5IBTH 2AABH 3AQYA 4N24A 4NFBA 4DFHA 4LEXH 4LVNC 3K6SB 4K73A 2XWTA 1MG2C 5BVJA 5GJSH 1WEJH 1AO7A 5FFOA 2PTTB 2ZP0T 1SZNA 1TZHA 3IMWA 3C9NB 2GBAA 2PPDA 1KXQE 3V6FA 3OAYK 4ODSH 5A2AA 3L3DB 1I8MA 3HJ0A 1GGCL 1MLCB 3D0VB 4OJDH 2XPGB 1U8OA 4HS3A 3VDBA 3GJEA 3NTCH 4P9HH 4OGXL 1WQVT 4JFTA 3L7EA 2DY2A 2MCMA 2ITDA 5F1IA 4IRZL 1J10A 3NJHA 3BZ4A 1KBBA 5AYUH 4Z0XA 5GSVB 1ZOXA 1SBSH 1JZGA 3E3QC 1NLDH 1A6AB 5LXGH 1KGIA 2BWQA 1NEZA 2XIIA 1RZJL 1V7ML 3ECVA 2DYPD 3EYOB 4RVBA 3NCYP 2CUIA 2YR3A 4L4VD 3TASA 2OR9L 3C09C 4JZNA 1UH4A 4YX2L 3IDIB 4E9VA 3ZR6A 4N2BA 2WCPA 1B0GA 4PY7A 5EBLB 1JF5A 1WCBB 4IEFA 1R3HB 5C6TH 4P59H 3X3FH 1I3GH 4ZFZA 3NJLA 2I60L 1N4XH 1AZVA 2CNZA 2DM3A 4YBQD 5BV7L 4CMHB 2FJUB 1JHLH 1TJIL 1K4DB 1DQJA 4JX0A 4PYGA 3T3PB 3QHFL 3G6JE 5E6IB 4P46B 1BVLA 2Q3AA 4FRWA 2LTQC 4JRFA 4KKCD 1QPPA 1JN6B 3FNKA 4AUJA 3RWCB 4DVRL 5E08H 4N90D 4AEHL 4KKBC 4F37F 3LS5H 4QYOB 5MEQB 1V27A 3R7QA 3VH8B 5D1ZD 5E99H 4APQD 4NWTH 3VX1A 1MZZA 2GEEA 3BSHA 1ORQA 3D4YA 1F5WA 2FB4L 4TPRL 5TTRA 5IMLB 1HH9A 1MIMH 5IJDC 2ZICA 2F1BA 4LCWB 3TO4D 4RGOL 5EEWA 4QXGL 1D5IL 5I8KH 2JB6A 4QRSB 3OKMB 1C1EL 1CFMA 3MV7E 1E4JA 2N0KA 5KSBB 3FRUB 1VGKB 3V5KB 3D4CA 4WHYH 1EDHA 1U8JA 2WINB 4XMUA 1SDAB 4PJIB 3BEWB 3TC9A 4CU8A 4RCAA 1CGUA 3DRTB 2O5YL 4CAGA 4LLDB 3GNMH 5AOMA 3ZT6A 5BRZE 2HX9A 4XP5L 4CC1A 1SF3A 3L54A 1DQKA 4XPFH 1UD3A 5I5IA 3DC0A 2VDPL 3FF8A 1OT4A 5LAXA 1ZA3A 4RDBA 2WUBH 5D7KE 1H8LA 3SQRA 5MEQA 1JD7A 2OZNA 3VXQB 2I26N 1XZ0A 2R69H 1LO4L 4KVCH 2V9TA 3BT0A 4KKAD 3TWCL 1QACA 2LVEA 2VXUL 5EN3A 2KLTA 1RCYA 4OZFA 5LHDA 1XQ4A 1QRND 4NP4H 1NGWA 4X6DE 2DYSB 3MBXL 3A67L 4N2CA 4D8OA 5FGCE 1J86A 3U2SA 4G83A 1A6VH 3VACA 2FWOA 1PD0A 3MFFB 5F7KC 3CFEA 4E41B 4ELMF 3CIQA 3OKYA 5AL8A 5TE4L 3E3QE 1PDKA 3RTQA 1L9MA 5JIHA 1RUAH 2BDNH 4HJGB 4PGZA 3UL4A 4DWHA 5FW8A 2BFVL 3W9EB 3D08A 2BIMA 4U6XB 2HRLA 4ODUA 4H25B 3NJGA 2CO1A 3DJRA 1FN4A 4AW4A 4Y2OA 5CJQH 1J11A 1NGZB 3BFOA 1U36A 4JEGB 5CLTA 3CK0H 1QLEL 2I24N 2X4UA 3CXFA 3D1MC 1IT9L 2DBLL 3T4YA 4TUKL 3FQRB 2RA1A 4EN3C 4JFFB 4RIRA 2NW3B 5HVFB 1OXYA 4HIEA 3P3SA 1P84K 3HI1B 4NWUH 5GGRY 4FNPA 5AWNL 1FL6A 1CCZA 4Q9QH 5IREA 4NKMB 4TOYH 1AS6A 4IRJC 4KTEL 2EDHA 5ESVA 3CVIH 1IGYA 1VEOA 4CU7A 2VLRA 1TZGH 3T3MB 4FFVC 2QVKA 4BFEA 2G4EA 1OP3H 3FH5A 1AP2B 3GIZL 1T0NB 2UXTA 5ESQA 4RX4A 5L9DH 2EC9T 3ZTJG 9CGTA 4R5VA 5HI5D 5BZWA 2YLKA 2VISB 4FL4B 4XNAA 3RIFF 4HT1L 1X3DA 4AWJC 3X11A 5BQ7A 3V0EA 25C8L 3JVGC 1KLGA 5TPWL 4A7UA 3BZEB 4E9YA 1MFDH 4TSAH 3SKNB 5GHWL 3UC0H 2DQDL 2ERJC 2V2WB 1IFHL 2WBKA 4ODWA 5IESL 5KJRH 1JPSH 5HDQL 2KKQA 3WLWC 4GAFB 4XO8A 2R1XA 1QFWL 2IDSA 2EYRA 3IEAA 4FXKC 5KS9B 3PIQA 4P57A 5IM7B 2D4FA 4RMBA 4UT6A 4OI9A 1QO3A 4OB5H 4OFYA 4KH9A 2ENSA 2GJRA 1WAAE 2K45A 5DYOB 2PYEB 2H6PA 1DE4B 4JRXE 3WEOA 5JOPD 2LW3A 2NNCA 4F7CB 3JWNE 3U2IA 5JYLA 1IAOB 2X7LB 1A6VL 1AR2A 2FZ3A 5LCVH 2FX8L 3O8XA 4KMQA 5D93C 1O75A 3H3KA 2XVKA 4DN3H 3RU8L 1FDLH 1KB5H 2ZPKL 1KBGL 4GP4B 4HGWA 1K8IA 2YKLH 2V2XB 3UCQA 1V7NH 1NCNA 1T80A 4OD1H 3SE9H 1FA4A 1JOIA 1A7RH 4D0CB 3HW7A 5INDB 1WIOA 4OLVL 1K85A 3QNYB 4FI6A 4J1UA 2IOMA 3RURA 4DAGL 4IQHA 2BJML 2VH5H 1BZ9B 35C8L 3FTVA 1UZ8A 3HHRB 1OT2A 4F2EA 2XG5A 5GZOC 1YEGL 4C54A 3INUH 2NQ3A 5JPNB 1RK1B 4YO0A 1ZVNA 5E2JA 2ZTBA 4FFTA 4P5MA 5IHUH 5IB5B 3QJFA 4L29A 3VFOA 2FTAA 3HI5H 4KROC 4M93C 3HTLX 4OCRL 5KOMC 4M03A 1U3YA 1IKNA 4LLQA 1DUYB 8CGTA 3FT2A 2GEQA 2AMGA 5DMJB 1ZVSA 3ZZQA 2VJ0A 5GPRA 1MHPH 1TYRA 3REWB 5I1KH 5DUPH 1KWKA 1QTPA 2K4WA 3ISYA 4BZYA 3VB8A 5K59E 4NQDA 1TQBC 1IZJA 3HZYA 4M7JH 1XIWD 2EDQA 4UILL 2QFRA 3SGDI 3FU7B 4DP4X 1U3HC 4XP4L 5FCUH 3RNKB 1SVZA 4OZHE 4PVBA 1E5BA 4JDVB 4Q9RL 3L3JB 1S7QB 3HN5A 1JYVA 3KWVA 3TA3D 4K3DL 1F8TH 2Q76A 4HS3B 1AQKH 2VL5A 4XXWA 5A2IH 3RWDA 3BLBA 4U1IA 5I15H 2RQEA 3C9NA 3MLXH 4K7PX 1E40A 4DNLA 1JZ6A 2GCYA 4WO4B 4Y4KD 5FW6A 3A0OA 1D9KB 2XZCL 2DQIL 3TBYB 2Y23A 1YNTB 5HHNB 1BQRA 2YPLE 2RH0A 3L4CA 1EJOL 3QGVA 1AD0B 3L13A 3EJRA 2XYBA 3AWFA 2NY6B 1S7UB 1XH2A 1IIIA 3HZMA 1W8OA 3DX2A 4LLQB 1WAPA 3B5HA 1Q9LB 2FL5B 4HGKC 1U2CA 3B9KA 2XPZA 5BRQA 4Y4HC 5GJTL 4Z9KB 4OV6F 4E41E 1CXLA 1Q94B 3B9DA 4XNUL 2VN4A 4F2ME 4FQXB 3QUXC 4X6CF 2UVFA 4EI5C 1UJ3A 4R7DA 1TCRA 5T3XL 3JV5A 5LXGL 5SX4I 1YN7A 3US9A 4Z3TA 3HOGA 1T5XB 2EKSA 4YR6B 4IS6B 1WA2X 4H8UA 3SPVB 2DKMA 4QHMB 3E80A 1KZQA 1E4XH 4CN4A 4OGZA 5I8CA 2VR8A 4ZSOA 2Z8SA 1MREH 1RURL 4IGBC 1BFOB 5H94A 3VXNA 5HYFA 1GZHC 5C08D 1WJ3A 4LP4A 3L1OL 5EUOE 3HPJB 1IJNA 1XO8A 5J3HD 1JZ8A 5DJYA 3UPCA 2TSAA 4DUXA 4RAVB 2B15A 4JM2B 1WG3A 1OOAA 4LP8A 1IEBA 4Z7UA 2BC4A 4EDXA 1PY9A 3UGXA 5E8OB 4JLRA 3SO3B 2K4AA 3EJYD 4NKOB 4FQLL 2NR6C 4NIYE 3MREA 2P5PA 3HC0A 1GOFA 3HN8A 3INOA 1OAUH 3OBAA 1IAMA 4M8QB 2L3BA 1VGKA 1WUZA 3CN3A 3V5KA 4G7QB 1HILB 4W1TA 4DZ8B 2HUHA 1KN2L 5CR8A 4XN8A 2VLKA 1PLCA 3RTQC 4FQ2L 1DP0A 3VG0H 3OQRA 4XP6H 3MRHA 3H85A 2YAQA 1SFDA 1J0YA 3QRGH 5CD5D 2N1KA 1F58L 3Q1SH 4H0GA 5IKCA 1DBBL 2CBMA 1R75A 4TUUA 2W80C 3MZGB 1EHKB 1GMEA 1BV8A 4NNPH 4AQOA 4MBOA 4F27A 1BWMA 3NIFE 3B1UA 3MJWA 2PCPA 3EDFA 3O4LB 4N85A 2YAOA 4IHOA 2R83A 5GIRB 3X1FA 3RIAF 4Z3FA 3RHWK 3QCVL 4GH7B 1V3MA 3QO1A 4GSRA 4Z7UB 4LNVA 2ZP8A 5TE6L 2EIJB 4WI8A 5DZPA 3TWCH 1NCUA 3SOTA 1Y6MR 3LN5B 1AXSB 3QXDB 5C07D 4B9FA 3MODH 3P4NA 4OD3H 2OK0L 4WEEA 2Q2LA 2VDPH 1ZIBA 1S7SA 2YRZA 3HRPA 5E9DB 2GY7B 4R4FL 5EZJA 1PJ9A 3QUGA 1FFRA 2EUVA 2V3EA 3EOAA 4ZUVA 4YHYC 2V33A 1C5BH 2GJ6E 2V9QA 3VSQA 2NY0D 1R3JB 1TQBB 4NQED 4AQ8C 5E1AA 2MQCA 3QDJE 3VM5A 2DEWX 5GRUH 5FKPB 4E5XG 3FUIA 2W0LA 5IQ9A 1SFHA 3MLWH 1ZEAL 4G72B 2GFBA 4LCWD 1L4IA 2VO8A 5AZEH 5JZ7C 2YJLA 3D39A 2EEFA 3IFPB 4NSKB 2X0WA 3KPMB 2R7EB 3OHXC 3ABKB 4LHUD 4PBXA 2APSA 5LBGA 4XHJD 4TUJB 5DVKA 5MP6H 1WZMA 1NICA 3BOVA 3UTPE 5FLVA 4YGVA 2I9LB 1WDAA 2R2EB 4RAHA 4A7GF 3ARBB 5GS3A 3V0HA 5F9OL 5AENA 2CRZA 5AB9A 2DM7A 3NT0A 3HC4L 4G1MA 3CFDA 1SGKA 4PLJC 1UWGH 3S7GA 1P7BA 2APXA 4LKCB 4J3SA 3F00A 1LO2L 1FNEA 3FHEA 1IEHA 3E7JA 4HKBB 1BECA 2CKNA 2H0EA 1KT2A 1G1CA 2X9XA 3TN0D 3VNYA 2AANA 5JTWA 2O26U 4POZC 2VISA 1CFTA 4P07A 1FL3B 3QA3B 1OHZA 1BFVL 4Q4IA 2HJLA 2Y5QA 2W92A 2ZIDA 1PG7H 3BKMH 2FSDA 4YHNB 4TTDD 1E30A 3L4ZA 2BX5A 2E7LA 4M56A 1KY6A 1XR9A 2FYVA 3GI9L 4XX5A 1PFOA 4RFOH 1G6RA 4PJXF 3RUGF 3D06A 3GXUB 1TIUA 2IDTA 2I5YL 2XQBH 3EFFB 2WQ8A 5JHLH 4FE9A 3S3CB 4KKRA 3ELQA 1KELL 3BVWA 1LK3L 3QQDA 4LB8A 3H8NA 1RJZB 3VFPA 5JW5B 3AAZA 2WLLB 3SKJH 2EDJA 4E9RA 2CK2A 1OM3L 5EB9A 4LU5H 1KYAA 4G7SB 1LEIB 3V6ZB 1F4XH 5GGTH 1S9VA 3X13A 3D52A 4HKBA 4FA7B 4TVPD 2AJUL 1GAFH 3T0EB 3ASNB 2VQ1B 1QLFA 2A6IA 5H2BB 2E7LC 5EU6A 2K70A 4JHVA 4C56E 5TF0A 3H55A 1FE8L 4S1SH 1EERB 3QORB 1FL5A 5E7FA 4R0LB 4NQCD 4KK6D 1QVOA 2CM6A 1BWWA 4GRMA 1TLKA 2BY1A 3QQ3A 1UCTA 2EE3A 4IJTA 1PY4A 3DPBA 4Y1AA 3L1OH 2WANA 3D69B 4QOKB 5LNEA 2VRKA 3EOTH 5ICZB 1EDYA 1OF0A 3K8KA 3BWAB 5D5MA 4F7PA 3UAEA 3SYAA 5H4ZA 1L9PA 4O2EA 3FU7A 1AIFA 3D87B 2J5LB 4OCXH 5JO5A 2AXFB 4L0ZA 1JRHI 1KUMA 4MMZA 5AW4B 4K5OA 4OR1A 2J4WH 4X8JA 2Y6SD 3GJEB 5I17B 4GO6B 4G5ZL 3II3A 1HL9A 1PKQE 1T7WA 3MUGA 4UQCA 1GS8A 3A6CL 3QE5A 1N59B 4JQIH 3D2UD 5T1KD 4U33A 4HJJL 2X4RA 1J0IA 5DRZA 4EJ1C 2VLJB 3WFHB 1CYGA 3DYOA 4QT5A 1F1AA 5JW3L 2XFGB 5K1VA 1MJUH 5DRWA 5C0ND 1H9VA 3ARRA 5KAQF 3HC4H 2DQMA 3WNJA 5E00B 4Z77B 1A5FL 3ARGB 2DQIH 4I2XA 3WMPA 5D6DA 3RVUD 4JUTA 1S9WA 3TZVD 5C09E 1UUSA 5I15L 1UD2A 15C8H 1SXSA 5GGVY 4HOXA 1CK0L 5JO5B 4PWHA 3UTTE 1SM3H 4F8PA 3SGEI 2WJ7A 5AYQA 3H2WA 3PL6C 5ITFA 3S9DB 4PREB 3DKHA 1HN1A 3VD7A 1UWEH 4NHCH 4WKZB 4BFKA 4R97C 4YE4L 3W0WB 4M4PA 5CMAB 5AOKA 1KC5H 1JPTH 2K6WA 4OCYH 4DETA 2EAEA 1TLMA 3N1GC 1I9IL 4F7KA 4C47A 3MRFA 4OKDA 4CBPA 2IQ9H 4OUUB 3B9KB 4EN2A 3AT9A 4L3EA 4B9CA 1SBBA 1LK2B 2ITCB 5T5FL 1E9OB 3K5SA 2ZJSH 3M1BA 1N7MH 4PLKD 4WHDA 3TYFB 2PR4H 3UMTA 5DJYB 2YOAA 1KGYE 1OP4A 4ZTPH 4P8QA 1M9SA 1X9QA 5AVRB 4DPBX 1CPUA 4CGTA 4A2LA 1JFQL 4NZTL 4G8IA 4PPTA 4XMVA 5EC2B 2HSIA 4OLVH 4OLXL 4TVUA 4YDLB 3EFOA 1CD1B 2LV4A 3QUZD 1FHGA 2ZXQA 1VRSA 3BI9X 1H6TA 2W95A 3B7RL 3T8XA 2A4EA 3DX4A 1OK0A 3K71B 1F2QA 3VI4A 4WEBL 4HGMA 4TF4A 2NXZC 2GT9B 4JKKA 4PWFA 5CSGA 4AZ8A 1HIML 3DA0A 1J05B 4QHLB 1FNHA 4YH6A 3BKYH 4R83A 3QDGD 3SE8H 4FQ2H 3ULVC 1V55B 2JE8A 5JOFA 3MMEA 2Z93A 3R06B 4GSQA 1BD2B 2AXGB 1FAIL 1UJ3C 4QRFA 3VXSE 5JQHC 2ZCLH 1LK2A 2XWXA 4K71C 4ONOA 2F53A 5DZOA 4P49A 5JHDB 1FG9C 1AR1D 2P3YA 4KXDA 3FU0A 4M7LL 2AEIT 4D0BB 1ZLWK 2NW3A 5KJRL 3RTQB 3KPOA 4KVNH 2JK5B 3RTLA 1RUKH 2ZWNA 2IH1A 2VT0A 1XGTA 1B3IA 5C0JA 2HFEA 2F8IA 3O11B 4LSPH 5AB2A 4JFYA 4OIAA 3U25A 4KI5E 2R51A 2P9RA 4YXHH 2FD6H 3P77B 1QZNA 4MS8C 3NJFA 2B1HH 2JNZA 5IFJB 3NZUA 4Q89A 1JGDA 1TTRA 5DO2D 3W81A 5KS9F 4PGEA 5CJ8A 1A7NH 1JZHA 1DQLL 4KHXH 1MFCL 3SKJL 5FYJH 2FBRA 3OXSB 3SQOL 5E5MA 1E4WH 3KHOA 1ZHLA 3OAUH 3DGDA 3HPLA 4IIQC 2BVUA 4HCRH 2BP8A 1N0LA 5F9DC 3FUEA 3SYQA 1MNNA 3QR2A 2EO7A 5J12B 1OB1B 3E2HB 4FG6D 3KPLB 4P5SA 2X2YA 3MOQA 4WGWB 1G9MC 4PVLA 5EUOF 4PJ9B 1KJ2A 3BKJH 2JKTM 5IFHL 3MRGB 4AE1A 1FFPB 1H6FA 4M8RA 1WITA 1IB5A 3ULVE 3UXFA 5BZWB 1FFNA 2AQTA 3VRIA 1NMAH 5E9DA 4N1HB 3MACH 4XN2A 5HGBA 4KKQA 4LL1A 2BOBA 2WB7A 4UB0L 4WJG3 4RDQG 2BRRH 2VLKE 4CSSA 1TO5A 4HWEL 3T6XA 4DGIH 3O9WB 1BLNA 2H9GA 4QI3A 5IF0A 5HHVL 2QQKH 3A6OA 1I1FA 3Q8AA 4PM1A 1FG2B 2XZAL 3R18A 1FZMA 5F89B 3L16A 1D5MB 2QPUA 3HHSB 4FFWC 2K8QA 5DQDH 2AK4B 1A1OB 2DWXA 1D3CA 3QNYA 3DYPA 2DWEB 3ESPA 4O4YL 3QZWA 2BMKB 2DMCA 1DVZA 5AAMA 4B9JA 5FLUA 5F9OH 5CHNA 3K4DA 4OF3A 1JCKA 1QR1A 2R1YA 4LARH 1T66D 1U8HA 2YPVA 1OLLA 5I30H 5C0IB 4Z23A 5F1NB 2K9FB 5IFAH 4N0YL 4YHPA 1T1YA 4MYWB 4PRID 4PMEA 3QJFB 1M05A 1FNSH 3AREC 4NO0D 2HRPH 2DWYA 3QQDB 5K9JL 1DBAH 2DTMH 2C9PA 1KIRA 3EADA 5EUOA 3KBEA 2WBJA 3VYPA 1QFUH 3D34A 3PP3H 2KPWA 3TLRA 1MW0A 2Q8BL 2DTSA 4OCSL 4WW2B 5DZJA 3AXLB 3WFEH 4Z7UF 2D7QA 4R26H 1CG9A 2PO6D 2XBDA 5IIEB 5C0NC 1YEGH 3UMNA 1GPOL 4M6NH 3AAZB 4L3CA 2AERT 5JMRA 1OALA 2BMKA 1AGCA 4JN1L 3SCMD 4CNIA 1XF4A 1YEKH 4U7MA 3CTTA 4JY4A 2YRBA 4NRZB 5EOTB 2WV3A 3WY2A 2DIEA 3ULVF 2HKFL 1HQ4B 1D5XA 2XTJD 2WY3B 2R0ZL 3I02B 3L7FB 2Y24A 4U1GC 2BJMH 4FG0A 1OO2A 4C55A 3I6LD 3RU8H 3BUYA 3FRPB 4C4BA 4CC4C 3V79C 1MQKH 1QW8A 5CCKH 3PQYD 1S7TB 3QRBA 2VLJE 2D3LA 2F5BH 3EO1B 1XGQB 3SCMB 3TEXA 3WTTA 1LGVA 3MJ8B 1KN4L 1DQLH 1A7NL 1Z9SB 3QDJA 5KBDA 1INEL 4Y19D 1OEZW 3CFMA 4U2YA 2DQTL 4Y4FD 5D7HA 3AY2A 1VIWA 2MSPA 3RVVD 3ZDWA 3WXVL 1NCBH 3RYMA 2I60H 2DICA 1AMXA 2HVJA 4UB0H 5KBLA 3VFWB 5I5MA 1D2PA 5TH2A 2DQCL 1JF6A 1NUGA 4PCKA 2NLJA 5IESH 1PSKL 4P9MH 4ANVA 1I8LC 5JHAA 4FTVD 1FL5B 4WIQA 2OMXB 4ENED 2DW5A 4BXVA 2HG5B 3TJHD 4FYQA 4P5TA 2NSXA 1PTZA 1SDYA 3H0TA 4HT1H 2P7TB 1JPSL 4PRAB 3AFLA 4F80A 7FABH 4Z7VF 1BF8A 4Z3GA 2JJVA 3O41B 3O6KH 1T89C 5BW7C 3RJDA 3V4LA 4ODTH 4ZAKB 1FH2A 3LQZA 2VQ4A 1EA9C 4ZFOA 3JTSA 1W91A 1YYMH 5I1HH 2PO6B 1QG3A 4HX1A 4GINA 3WUWB 2AAVA 1PZ2A 2Y6SC 3KPRE 4LPTA 4FQIL 4BRJA 1RLBA 4V1DE 4RGND 3BD5A 2G3ZA 4KH2A 3PWNB 2A4CA 3K2KA 5BRZD 4KJQD 2PYED 3SGKA 5FUCE 3AQZA 1VAHA 5CEZE 4MXVF 2RAMA 2B39A 4L4VB 4M5ZH 4HLZG 1P4BH 4MVBC 4HETA 1IT9H 2DBLH 4BSVB 1PBYA 3MLVL 4JZOA 3UBXB 5CBEB 1TO4A 5E8PB 4UM9D 1F18A 4WNSA 4Q9CA 3S4SA 1NSNH 5IEKB 1NCIA 2FWUA 1PCXA 4IKJA 1S7XA 4MNQB 3N0AA 2Z0UA 4U1LA 4X80L 3O3DB 3PDGA 1MVFA 1MLCA 4LDCA 3MROB 3HB3B 4WFHD 1NGQH 4ZDHB 1HKFA 1LVEA 1XFPA 2XX1A 3D6GA 4YE4H 5LGJB 2XWRA 4Z8FL 3N43B 4WUUB 1IGTB 5C9KA 3UZQA 4PJ9D 2CDFA 3H9SA 5F7EH 1KBKA 4A63A 3A67H 1KCSH 1KV3A 2H2PD 4HFUL 4NRYB 4WKZA 5CN1A 4FLHA 3NMEA 1KB9K 2VLRD 1BMGA 5HP5A 1U6AH 4JMNA 1UCBL 2AV7B 4LLVB 5D4HA 5J6HA 4DN4H 1HEHC 3VFSB 2J3SA 1BVLB 1IM9B 2VXQH 1UACL 5FCUL 2R69L 4PJFE 3VGHA 1W9XA 3BVTA 2O5YH 3VB9A 4PRHD 2RTTA 2Y07H 4H40A 4L4TE 2RB8A 5ABAA 5DTFA 4CVZA 3ESVF 3W3BA 3PPSA 3SD5A 4NB7A 4EXKA 3P30H 1DVQA 1R5VA 1MJUL 3BAWA 1CUOA 1JPGA 2NXZB 5DMIH 2VW6A 2CO6A 4OCSH 3V4UH 5B1KA 1CICC 1KC5L 4YLCA 3K8MA 4R4NC 4Z7WF 5MI0B 5F9JA 4BFIA 1S7SB 5EZJB 1GRWA 4IIQA 1IEAA 4QLWA 4RGMC 3EFOB 3CVDA 3RLSA 3WUZA 4R96A 2CIIA 3KDMB 1UZ6E 4M48L 1D7FA 2Y5TB 2BSRA 4RISH 4X4YB 4WUUA 5KSAA 2X4SA 2XYCA 5ECJE 3TBVB 1AKJD 1DVYA 1WWBX 3TO4B 4TLSA 4G71B 3FQXA 4XPTL 1FGVL 2NW2A 3GEFA 2AZUA 3L5XH 2VH5L 3X2QB 1YEJL 5EF3A 4Y9BA 3DLQR 3WEXB 3UPRB 1AVAA 3W11D 5HYQA 3TESA 4K5NA 5DJ2A 4TNWK 2UZIH 1AACA 1PX8A 4OZGF 4E68A 3IU3A 1JFHA 5GGTA 1KTKE 1MLBA 2YKLL 2QGCA 3DARA 5F7MC 3H9SE 3MGTA 5CEYA 4YVUA 1P4LA 3PIQB 1E8WA 2AXHA 2VM4A 3OMZA 5E9NA 3NRPA 4FKKA 1CFSB 4ZW7A 1VCBC 2X3BA 1OANA 1JPGB 4L48A 4A1RA 1GMIA 3RG1C 4XNZC 2XY2A 4Y1AE 4G80A 3H6AA 2LOEA 5FYKE 1MY5A 1KPRA 3K4ZA 1IMHC 5DT1H 4HC1A 1Z3RA 4P2QA 1CC3A 1V7MH 4R6UA 4Y9FA 2GK2A 2O61A 5HJDA 1G7HB 4U1MA 4AIEA 4AQAB 3CFEB 4MAZA 3N6YA 2XPYA 5A2LH 2EDYA 4X6DF 3ZO0A 1DBKH 5FA3A 3VXUE 3CFKA 4UNUA 1UENA 4FA6A 5F96L 4J1UB 5D1XC 4OZFB 2OYLA 3EBAA 2JELH 3FCSA 4ZYKA 3T2OA 4JFEB 2Z4QA 2VWEC 4X6BA 4BUGA 4I5BA 3HE7B 2JWYA 4IYKA 3F7RA 4KI5C 5IQNA 5T1DH 3I3BA 5B22A 2YIHA 2IALB 3AXIA 3SO3C 2NY2C 2XZZA 2XN0A 1AY1H 5I1EL 5EF0A 1SLWA 4PJBF 5GJSL 5CZRA 4BD4A 4G6AC 1IL1A 4X9FA 1NDGA 5TFSH 3WIIL 5I8EA 4U6YB 3LS4L 3LXAA 4GRMB 4GAYA 3KL3A 2WMPB 4WZ9A 2OTWA 3MNVB 4GP8B 3IDNB 4JPKH 1RHFA 4FFVD 4DIXA 5CR1A 1DO5A 4F93B 2WYIA 4LU5L 1BAWA 4K9EL 3RKPA 3RWFB 3M7FB 2XTJE 5D5MB 3REVA 4F7PB 4HPOL 3TJHC 1IM3D 2JXMA 5AW0B 3CHRA 5FA3B 1G9NC 4MSWA 2OYPA 2HFTA 1O9VA 1SF5A 3G6JA 5HSFA 4G6FB 1YMHB 1I31A 1H9DA 4LK4A 4UTBA 3VSUA 1KCUH 2Z4QB 3QH3A 5D7EA 4OGAD 2AKRA 4M1DL 1NPNA 4I1PA 4YWGH 1NCDH 5A2BA 5IIEA 4RMQA 2DQUL 4NENB 4NP4L 2Q9OA 4AQ1B 4WFHE 1ZGLM 2WXPA 5AKRA 3EYFB 3MGOA 2R56H 4DERA 4P3DA 5E4EC 1MRFH 4HIJA 5JHLA 1ANUA 4B7LA 3KMDA 1Z9LA 3T8VA 3UYOD 1BZ8A 1UOKA 3I6GB 4PS7A 5DUBA 4FQXA 1F3JA 4PJXE 2E4FA 2HAZA 3PCYA 4PJEA 4H8WH 4XGZA 1RFDH 4H20L 3ZN6A 1PLGL 4JY5H 4S2SA 1OKEA 1BZ9A 3HNVH 4QHMA 1GZPB 3PWJA 4OAWA 4PJ5A 4J2XA 1P84J 2EIMB 5DWUL 5HYJE 3WBDA 3N5AA 1U6AL 4KO5A 1FZOB 4PJGB 4YHIA 2AQ3A 4KQ3H 3D25B 3ELAT 1YAIA 4XN4A 3GTNA 3BUYB 3FRPA 4PI2A 1EEZA 4W81A 3DIFB 2SEBB 3POHA 1NKRA 1SMDA 3B7YA 3VFOB 2ZSWB 1A3QA 4JFHD 4X4KA 4HS6B 1SY6L 3ZHLA 3TF4A 5ABDE 3GZOA 2JIXA 2VZ3A 2P5WE 3IM1A 2PTTA 1MI5B 4X80H 1TZHB 1YA5A 2E76C 2MOVA 3B3IA 5E08L 4G9FA 2W8CA 4APQC 4WDIA 3RGBA 3ZT5A 4X8XA 5K9OA 3HE6C 3RP1A 4PV8B 4WSJA 1K72A 4ERSL 1LO0H 1HOEA 4Y1SA 2GJ6D 5FDWB 2XG4B 1F4AA 1G7IB 5ANME 1OAUL 4I1NB 5DJXB 3IFNH 1X5KA 2FHFA 4WU7B 2WWNA 5DD1L 3GHBL 3MNZB 3QISA 4YXKH 2FDBP 3ARBD 3HLKA 3T71A 4Z0XB 3CMOH 2BOLA 4LEOA 2YFNA 5J6GB 1KLUB 1KXTA 5L8JB 3TBYA 5DD6B 3T8XB 1UQSA 5F72S 1TSRA 3D4ZA 4QHKJ 4FQ1H 2DKUA 4B6ZA 5IB4B 1U0QA 5C9JB 1MEXL 1HH9B 1JV5B 4FNLH 2ZUXA 1KCWA 3B5TA 1SYVA 1HXYB 1UT1A 4F8QA 4HUUA 1MRCH 3D39E 5L0QC 2YA2A 3NCYS 3WEMA 2JELL 1OPOA 5HYJA 4OCXL 4AGOA 3MRMA 5F96H 3UPAA 1P53A 4OFQA 2BIHA 3PJLA 2P44B 3HS0A 3NTCL 4P9HL 4R7VA 3P3RA 4D0BA 4ZTOL 5T1LA 3F7YA 3GB7B 1XGTB 3RL2A 3IWVA 3STLB 4I9WD