4Z3HA

Crystal structure of the lectin domain of papg from e. coli bi47 in complex with 4-methoxyphenyl beta-d-galabiose in space group p21
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
197
structure length
197
Chain Sequence
MAWNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGSWAYYREYIAWVVFPKKVMTKNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDQRAFDTANLCQKPGETTRLTEKFDDIIFKVALPADLPLGDYSVTIPYTSGIQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PapG, lectin domain
publication title An unexpected way nature improves solvation entropy
rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 45
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 4z3hA00
4Z3IA 4Z3EA 4Z3GA 1J8RA 4Z3HA 4Z3FA 1J8SA 4Z3JA
chains in the Genus database with same CATH superfamily
5DJYB 5CCKL 1IGCL 5FYLE 3ILEA 2R2HB 1ZE3C 3JWOL 4J3UA 5LG6A 3SKJH 5AW6B 5E4EB 3L5XL 2FEDC 3HJEA 2EUWA 4KKLC 2PPFA 5CMAA 4U6HA 1JMZA 2OMYA 4TLKA 3G5XA 4UV7L 1NPUA 4UTAH 4ODSL 3EYOB 2G2RA 3B9KD 1KTKE 2BP0A 4GSRA 3DVNA 3KYOB 4HGWB 5AUMB 4KV5E 4S2SA 3RU8L 4MMYB 4FCHA 3ABMB 2AVFA 5F3HB 3NCYS 4IRJC 1CYWA 1M9SA 1JE6A 3QAQA 3MRQA 2DQCH 2R0WH 1OARL 3V6OC 1J9RA 2X4SA 4NP9A 5C07D 3ROLB 2IBBA 1W0YT 4GQ9H 5HYJD 2WINB 1K4DB 2XKNB 1HI6A 5T1DL 2ZCLL 1AE6L 3BJ91 3HBGA 1WS7A 1ZHBA 2ZICA 3DUSA 1U8OB 1E27A 3HG1E 4QDGA 4PGEB 2Z8WC 4ZO9A 4GBXB 1HDMB 3U1SH 5ESVA 5A16A 3N91A 5I1JL 3B9VA 2H5UA 1LEIB 1J1XH 2KQMA 4L1DA 4DO6A 3RBGA 4NPJA 3HG1B 4FQIL 1CFNB 2WQXA 4YC2C 5ADOH 4GSDL 1ZLVK 1NLDH 3ULUD 2A4CA 2DWSA 4YDIH 3SDXF 1T4KB 4CC1A 2X4OB 1KELL 5JW3H 3V0EA 2ZF8A 2YZ8A 5GJTL 4JHUA 4WW2A 4L5FH 1SF3A 1UEMA 4XPBH 5BZXA 3DV6B 2UY6A 4FADA 2NZIA 5ITFA 2KQNA 1BAGA 3IMUA 2BWDA 3WO4B 1A0QL 4NO5B 2JELH 5KYWB 1I1YA 1U9KA 3OHXC 3LQMA 5I71B 4XCEA 3B4NA 2QHRL 1OY3B 4JFUA 2D2CC 4KO5A 4ODXA 3LRHA 1K3ZA 4ZO6A 4F37F 4E42B 3CZSA 4DKFH 3BQUB 1L7TH 3F7RA 4F33A 4U1GB 2QJDA 1P6FA 3UDWC 4B0MB 2WLMA 4I13B 2CMRH 1DJGA 1YEIH 2GTZA 4YHPA 4AYFB 3EOBA 4K55A 3ELQA 1JV5B 1WISA 2WBXA 4MJIB 4YVUA 1PSKH 1E3XA 4JN2A 4DHLA 1PG7H 2FQGA 4X5XB 1I8UA 1QSEE 1T04B 3I2CL 4KK9C 3TJPA 5D9SB 2N0KA 4PJHF 1IM9A 3NCMA 1YNLH 4AG4H 2WWKO 2VL5A 2ENSA 3MLXH 2F7QA 2R69H 3DRTB 4GBXC 4WNQB 5E5RB 5IOPB 4OZFB 3R19A 4Y2OB 1QSEB 1EO5A 4IMLA 3OMZA 4M56A 2YXWA 2OMWB 3T0XA 3UOAB 2VZ1A 2V5SA 1WEJL 3T2NL 3BWAB 1N64L 3LZOA 5I5IA 2QL1A 1G9NC 3I6KB 4PV8B 2PO6D 5C0FA 2IC2A 3V5DB 2AHIA 1NGWA 1ZSDB 1LK2A 3C6SA 1NBCA 2JB6A 4S0TD 5KWYC 1GYUA 1PLGH 1RPQA 2WCGA 3AW5A 3I9GH 3NZUA 1ZHNB 2X5PA 3QIWA 3WO4C 3ZTDC 5DEGB 1IBBA 1XSJA 4Q8BA 4AM0Q 2YO3A 3T0VA 5MEPB 3V4LA 3TOPA 4RA3A 3V9EA 1N3NB 4IKNA 4OLZH 4Y9CA 5I71C 2WQSA 3GMOB 1MNUH 4ZG1A 4Z7UF 5D6DC 1E2WA 3QI9D 4M6MH 5IB5A 1AZCA 3OKLA 5HY9A 4Y4HB 3GIZL 4ZSOE 1FG9C 2PCYA 1K72A 3EHBB 3RGVA 5F7DA 5LDUA 3II1A 2XICA 3WIFA 2YD7A 5DC2A 3WIHL 4PLJD 3TFBA 3PPSA 2ZOOA 1NFDA 4ZSOB 4HIXH 4CU8A 5DD6A 1JZ4A 1VLXA 3RPBA 3O9WB 3N85H 4GXFA 4YHLH 2ESVE 5F89B 3QEUA 2Y3NA 3LPPA 2HPOA 4L05A 3AB0B 3BWUF 1IEBB 3NIFF 1HL4A 4HEMA 3NJVA 3MBED 1AZUA 3GBLA 4K3JH 4NKIL 2XQBH 2WOBA 1MAJA 3GLAA 3NCYP 4L9LA 1GGBH 5DK2B 2P5EE 4FEMA 4LCCA 5BS0D 2CCVA 4LLYA 4NI6A 3OXSB 2D31B 3X1EA 5HYSG 5CEZH 3PY9A 5DEJA 1CYXA 3RYMA 1B9ZA 4GW1A 2P5EB 4YGVB 2WVVB 5CD5D 3EJSA 2E75C 4KJYA 4NN7C 2XN1A 2P8MA 1Q1PA 5LKNA 1DVFB 4XPHL 5AW8B 2FO4B 4NHUB 3PGFL 1M1XB 4FABH 1SDDA 3FH8A 2W9EL 4HKXA 3ZDXE 3VFMB 5BOPA 3CDGB 4OZHE 4XB3A 4HWNA 4S1SL 3G08B 4GKZA 1RZQA 1DO5A 3ZSTA 1OPOA 1EJ6A 4L2LA 1B0WA 1XR9A 4XGZA 4QO1A 4AI7A 5GIRA 3LXCA 1RUKL 2HTKC 2ZCKH 3QEGL 5D2NE 3ZDXB 1DBJH 4AZ8A 1PQZA 2FBJH 4OZHB 4S11A 4ZUTB 5GS2D 3C60D 4CVZA 4DEPB 1B0RA 1NAML 2V7NA 5C7ZA 1FRGH 3W2DL 1FNLA 2BCMA 2VXTL 4UZGA 5D2NB 2E9JA 1U4FA 2APWA 3RNQA 3U7WH 1MLBA 5GGQL 5D7JA 4UOW0 4N0UE 3ZE1F 3H1ZA 3MSPA 1ZVSA 3NCEB 4APXB 4HAKA 3ZTCC 1KJ2H 2ZP8A 3IDJA 1MCCA 4QJ3B 3CVHL 1ORQB 4NO2B 3RLSA 1AZNA 3GGWB 3LRLA 1D5RA 4UQ9A 2BOBB 1XF5A 2EO1A 4YBHA 2AI0L 2G2NA 1JFQH 3Q6GH 2JQAA 5BOZG 2ARJQ 3A24A 1EANA 3MRGA 3HC3L 2C8NA 1BZ8A 4AX3A 3BUDA 1IM3B 2BS8A 1T89A 3QQDA 3W38A 2HT4C 3N04A 1Z5HA 3ULVD 3EYUL 4UDUA 5DZ9A 1G0YR 4YR6B 3V6ZB 1FHGA 3G6DL 5DFWH 1JERA 3D8MA 3E9UA 1QA9A 4OZGF 4F2EA 4FHBD 5ID0A 5E6UB 4ADIA 2APTA 4M5YL 5T1LB 3IGKA 1PDKB 1E4WH 2LU5A 3QIUB 1ZLUH 2I85A 2A74A 3WTYA 3V2AR 2VDMB 4BXVA 1I7UB 4WI6A 2VDNL 2PXYD 2ZX8A 4FLQA 4LIQH 4BGDA 3UG4A 3CV5A 4PP1C 1HNYA 4WI8A 3TS8A 4NQTA 2WXKA 1OOWA 5CJOL 3K4DA 4JY4B 4ODWA 4RIRB 3RI5F 1GH7A 3HVNA 3JZYA 4QXUL 3RIAF 3VU2A 2OL3A 4MAYB 4WI0B 1VFOA 4TPRL 3RIFK 5B3JE 4ZFGL 2WBJA 4NNYB 1ASOA 5AVWB 4CMHB 1A2YB 2PCFB 5I1AB 2WQAA 1MCPL 3K2UH 1DSYA 1HCFX 3QZLA 3EXJA 4H8QA 2ICWJ 3MOBL 1JHTB 1HZKA 3PABB 1NGXB 4ODHL 3OMNB 1R47A 2Z92B 1MJUH 2OCFD 3AJ7A 1JXDA 2AABH 3RZWA 1H0DB 4K9EH 2MQGA 5FIEA 5B3NA 1M6OA 3L4WA 1U8KB 1TR7A 1Z6JT 2F54E 3WFDH 3OVUB 4NT6B 2HFGH 5I1HH 3UG3A 3LPGA 1G4RA 1BFVL 1UJ3A 2BOCA 3UZVA 4R0LB 1JK8A 2WZ5A 1Z5LB 2W9DH 3RPIA 3T0AA 2DJ4A 4K15A 2OMBA 2HG0A 1NCOA 3MTXA 1PZUB 1KEGL 4PY7A 2W81C 1MIEL 1TTGA 1ZIBA 3VB8A 2VWEE 4CAGA 5ISZA 2CG9X 4LFHG 3C8KA 4U6YB 2XX0A 4UDTA 4OIAA 2XU9A 4ZQKB 3A23A 2ITDA 3HG1D 1UWEL 3BZEA 4L1BA 1MCWM 4TM9A 1F00I 1UOWA 3GSUA 4ZT1A 5FW6A 2ITCA 3WNPA 3QIUC 3CAFA 1V5JA 3GSOB 3V5KA 2A6KB 3WY1A 1MCQA 1OANA 2EC9T 3N0AA 4QPEA 3SDYH 1PVHA 3T4YB 3QCTL 4HIIB 3WHXA 1PF3A 1H5BC 1G5AA 5FKAA 1S78C 5DZVA 1FZKB 2EDXA 1OAQL 3CZEA 1KNOA 2X53A 3I6GA 4FS0A 4PGDA 1I1FA 2Q1EA 4CMHC 3GNMH 2R15A 2J2ZB 1JXGA 4OFYA 3A4AA 3AGVA 5FF6B 3DOIA 3UTTE 1YEDA 3P0YH 4KFMA 4YSUA 4JFYA 4G3YH 4N68A 3A67H 5AL8A 3P9WB 3G5WA 2WB1A 4Q6IA 3X13A 3HMWH 4QJ5B 5IEKA 3UTTB 3V0WL 3GUTA 2UWEF 3UTOA 3TYFB 1UACL 5PCYA 1KV7A 2VZSA 4PCYA 1JP5A 3GO1L 3S48A 5IFJB 3OKKB 4ONFH 3D30A 3MNMA 4R0LC 1TZHA 5EF1A 5A7EA 4ZS6C 5HDBE 1BVNT 1F4AA 4W70A 1HJCA 2V5MA 2OMUA 3KWWA 2B2XL 4WSKA 3QJHB 3QJFA 2O6CA 3NG5A 4AL8C 3KGUA 4GXVL 4YDVB 3FB7A 5IBTH 1R6VA 4K3DL 4O2CA 1CL7L 5I76A 1OCWL 4RGOH 3MPCA 1KXQA 1KB9J 5T3ZE 3V7AE 35C8L 4PRPE 5MERA 2LAGB 2WKGA 1T1ZB 3TIDA 4RAUA 3QEQE 3DVGA 4CDHA 4CNIA 1QSFE 3T1WA 3MYJB 1WJ3A 3B8YA 2NUPB 3FO2B 1VZIA 4DZBA 3KPRA 4PD4J 1MXGA 1X5ZA 2EDKA 1EMTL 1C12B 2J71A 1QEWB 4IRJA 1BEXA 3QEQB 5D71H 2X3BA 1R24A 3AWEA 1QSFB 4HJSA 3RE0A 2H3XC 4NFDA 3V6OA 1MIML 2FCBA 3DYMA 4HK3N 4NUQA 2BS9A 4M43L 1CDHA 4MAUH 2G2PA 5ALCL 4C83A 3EHBD 3BE1H 3FAXA 5E6YA 4URKA 1WBYB 2N56A 5T3XL 3S36H 3IU3A 2IDUA 2W60B 5E2JA 5HJGA 1T03H 1IBYA 3PXHA 5KAQG 3BZFA 3BD5A 5TE4L 1AS6A 4YL9A 3FQTB 1QFOA 5DA4A 1PAZA 2IH8A 3U46A 3H2PA 1NUDA 2HVBA 2OI9B 1E7VA 1W9XA 2DQUL 2ZCHL 3MODH 3O2DA 3S35X 5JHLL 1AHKA 5HHOB 2VDOH 4UZUA 4H26A 4R4FH 1CFMA 1Z1WA 2X1WL 4KQ3L 4OT1L 1HCVA 3FTUA 2WUCH 2CO3A 2ESVD 4N26A 2VIRB 3SGDI 2NCMA 3FQWB 2IDTA 3ZDWA 1D5XB 2R56H 5I6PA 3HZYB 4HVBA 1VPOL 3E8UH 4TQHA 3KPLA 4EN2A 1ZTXE 5BUGA 1JYXA 1S7SB 4LPWA 3LKNA 5FWQA 3WD5H 2H1XA 3FQRB 3OHXA 2YBGA 2VDQB 3GBEA 1X7QB 3K72B 4HKJB 1S9WA 3O6LH 3P9MB 1EGJA 1NAKH 3EGSB 2KYIA 3BPCB 5E0FA 3HRPA 3IFNH 3KYOA 4N2NA 1WITA 3FYEB 5D1XB 2DWXA 5AUMA 3S8GB 3UDWA 3FULA 1JYVA 4I18B 4U4IA 2YMTA 4JQXC 4MMYA 5F3HA 4JM2D 2NY1C 5EU4B 2YD4A 2DLEA 4AYSA 4FA7B 3Q8FA 2QHLA 3AQYA 3K7UA 4Z3JA 3D85A 2WINA 4BEIA 5LWYL 4PPTA 3S34H 2DPKA 5B38A 1T1WA 4QTHB 5GJSL 1U58A 1U8OA 4PGEA 3SDCB 4KU1A 1XAUA 4FXKC 4IBLT 1BAFH 4GBXA 1HDMA 1D9KD 1ODAA 1L9TA 3ZMEA 3L13A 4PJFB 4QYOB 4FTVB 2DJMA 1BIIA 4W9FC 3GBDA 2EEFA 4D2NA 5I30L 1XH1A 1INEL 1T4KA 3IDMB 3NFNA 4ZMNA 1U6AL 4Q56A 1GKEA 2FH8A 3CSPA 1KG0A 3D08A 3QDGD 5E03A 3UP1A 1ZDQA 4XHQA 4LL9A 2EE0A 5A6LA 2UX7A 4UV4L 4JFPA 3OKMA 1KGXA 2COQA 1ND0A 2XTLA 4K5NA 4XPFH 4TQPA 5E8EA 2NY0C 4JCLA 5EN2A 5KYWA 1BHGA 4LP5A 3FN0L 3HG4A 2EE3A 4CSSA 1U2YA 3HBQA 5D6DA 1NBVH 3GF8A 4E42A 4GEIA 2K0RA 4U2ZA 1MQKH 2MPAH 5LXGH 3NJMA 4NKDB 5D1XC 3BVWA 1QBLH 4LP4A 4ENEC 1RVFH 4I18C 1EO7A 2F18A 3V4UH 4HFUH 4DKDC 4E9XA 4JGNA 1GAFH 3EFDH 2RFXB 1JV5A 3BESR 5LGHL 2QR0B 1C5CH 3CJJA 4MJIA 2FX8H 4FP8L 2ICCA 1AYOA 3VDCA 4ZNEA 4ZQTA 1AP2B 3RVWD 5GRUL 1S3RA 4ZW5A 2R4SL 5E70A 3N40P 4PJ7B 3MREA 2VN5A 4J3WA 1CPUA 5IOPA 2H2PD 2AQNA 2KDGA 4TULH 2HUHA 3OAZH 1AY1H 8CGTA 4YDLB 3Q9PA 2BY0A 1CC3A 5D4QA 3CD4A 3WJLC 3MLUL 2MCMA 2C1PB 1SYSB 1IAIL 1KIQB 4NRXB 4D9QD 5E1IA 4CJ1A 4HWEL 3CWGA 5GS0L 3KL3A 1S7WA 3MCKB 1MW0A 1QOKA 1O7VA 4JGJA 1JDAA 3LH2L 4RFOH 1YMHA 1P84J 5EC2B 5JDJA 3VD1A 3SPIA 2XFXB 2KZKA 2J6WA 2D73A 2A6DA 2BCKB 3U1PA 3NPSC 4KRNA 2QLYA 4Z9KB 2VJ0A 1MAKA 1UT2A 5DEGA 2APFA 3SGEI 3SYQA 4DF9A 1DTUA 5MEPA 2YPLA 4KMQA 4MMXB 5LUMA 1QKZL 4FFWC 3B37A 2F53D 3U4BL 4HJ0D 2F54D 4QHNA 5DVNA 1MLCB 5EZJB 4FXGB 2UY7B 3FSAA 4TSCL 3B9AA 3RWHB 1TF4A 5J9PB 2X7LA 1O7DE 1N5AB 4GRWH 4CL7A 1K8DB 4M5ZH 2H9GA 1IX2A 3M1CA 4HHGA 4IU2A 5EU7E 4LDLB 4AUJA 2UUDH 3VFGH 4ALAL 1W72L 4L0YA 5IP4A 3DIFB 3BP5B 5F89A 3GBNL 4PS4H 5L0QC 4HS8H 1HYSD 4KROC 1UKQA 4IRSB 1IEBA 4IBSA 1TTAA 4K94L 3Q1SH 3AITA 1FBIL 4HCIA 4MZRA 4CSZA 3B3IB 4BZ2H 4EI6B 1A9EA 3MC0A 2YLKA 3UBXI 2CKBA 2G30A 5DK2A 3T8MA 5I8KH 5IUCA 3DMMD 1OE2A 3L8QA 3VXRB 4ONHB 2WZ6A 4WHTA 2D31A 2H2SC 1ORSA 3BVDB 4Y5YB 4GXUN 4W4OA 4YGVA 2WVVA 4OQ1A 2EDMA 4KPHH 3UTQA 2WLKA 3D3VA 1OWRM 4PTUB 3RA7H 5IR1B 4L3EE 5BZWB 3SBPA 4LASH 4NN5C 2H26B 1M1XA 4RSYA 1KTBA 2GBTA 2FUTA 1LDPL 4YE4L 2WSKA 3VFMA 4NXSA 4JDEB 3B2UD 5JPMB 2WYHA 2B9AA 4C59B 4FRWA 4YWGH 1IGIH 2PPDA 3L3JA 5KVEH 3ZMRA 4F7CA 2QQKL 3FB6A 4JHVA 2VO5A 4FQCL 3LSOA 5TTRA 4HAFA 5EH1A 4WI4A 4ZUTA 2HG5B 4HD5A 5TE7L 2I24N 2TSBA 4H88L 1FHNA 1YEKL 4X7DC 1V3LA 3ECBB 2AXJA 3MRLB 3LNEA 2YOCA 3LIZA 4X2UA 4YQXL 2V9QA 3FUHA 2G9KA 4HUUA 1X5XA 4AMKL 5KAQF 5DJXA 2HLEB 5C3LD 4BFIA 3OJDA 2ED8A 4O02H 4U1LB 2Z4QB 1UWFA 4I0PB 4HXBH 1RJLB 2CHDA 4NO2A 3HS0B 4PRPD 5T3ZD 4FJZA 5D6CB 3GGWA 4NBYB 3TYGL 1PG7X 3EOTH 1ET5A 3F62A 5CBEB 2IMMA 2QDVA 4GO9A 1QSFD 2ZUUA 4J8RB 2V2XB 1JPGB 3B9EA 3BN9C 2H7WA 2IAMB 2XKSA 1YUKB 3MACH 3GI8H 4NM8H 1WD8A 4Y5YC 4P46B 5FO8B 4XCFH 1X5IA 4Y1AE 5DC9B 1GGYA 4BYHA 5J6GA 3NSYA 1UB5A 3HZMB 1R0AL 2H0JA 3L45A 2G9HB 3OAUH 3IJ8A 4YR6A 4L8BB 3V6ZA 4MTMA 3BH9A 3ZE0B 5CILL 1RUPL 1UUSA 2NX5E 3DA0A 5T1LA 2WC7A 1MREL 5E2VL 1PS3A 3D2UA 3QIUA 2CO1A 2J73A 1OL0A 3IMRA 4WFGE 1KZYA 1YQVH 1GZPA 5DEFB 1MHHB 1PY0A 3N42F 3QORD 2FB4H 2NX5B 1Z32X 2G60L 3OF6D 3DK2A 5LN8A 4JY4A 5A2CA 1H5BA 4RIRA 1NCIA 2EO9A 4WI0A 4TUJA 2JNZA 4JHAL 4MZ2A 2MHAA 5FO2A 4MA7H 4JO2H 4PFEA 1A2YA 5HI3D 4HJUA 5C8JB 2QSVA 2KH2B 1JHTA 1ERNA 4G9DA 4QOKD 4X4YB 1KLGA 3PABA 1NGXA 3O3EA 2XBTA 3UXFA 1U42A 4D7PA 4ZNCD 3PYCA 1G7JB 2WSDA 1GHFL 2NY5C 3EJTA 4I0PC 4DQOH 3HS0C 3NJKA 3TNNA 4PWIA 3CU7A 1K85A 1O9VA 3TWCL 1CL7I 2VTFA 1ZXQA 2X89D 3CCHB 3RRQA 5AAPA 3FOMB 4YLCA 5IVXB 4R0LA 5IOKA 3STBA 1JGIA 1Z5LA 2IAMC 1BAWA 4JNXA 4UNTA 3RL2B 4G5AA 4P46C 2ERJB 2BP3A 1A14H 2EZ0C 2Z6FA 5AAMC 1EJOL 3P2BA 3GXMA 5C09A 2AS5M 2HJFA 1I4FB 2EABA 3QO1B 1I31A 2VDRB 4XZUA 2AJUL 1J48A 4ZQKA 3QWRA 4ZUUA 5HBBA 1UZ8B 2DZEA 5D4JA 3PJLA 4BUQA 4WTZA 3QDJB 1HSBA 5TFSL 1MH5A 1TU2A 4FNSA 2ICEB 2A6KA 3DO4A 2HCZX 2VAAB 3MLYL 4ZW6A 1MFAH 4HIIA 1KB9K 2IWFA 4E41D 3X3FH 1RZKC 2NY4D 4OCRH 1FZKA 1SMAA 1YPZE 2D03H 3WE6A 2J2ZA 1HQ4B 1SVBA 2BVUA 2Q7NA 4PD4K 2K4WA 4W9GC 4YUEL 5CGTA 1MFDL 4NDMA 1NFAA 2XA8H 2F74B 1FL3B 4IGBD 3UCQA 5FEBA 1DLHB 2YA0A 3GSNL 3IPEA 4WU7A 3PCYA 4Y19B 3PHOB 1S9YA 4KZ0A 3TYFA 1CUOA 2PUQT 3EO9H 3HMXH 3MLVL 1NSNL 4KK5C 1BVKB 4OQTL 4XNXH 4EIBA 3OKKA 3OX8B 4PJBF 1FNHA 3NN8A 3V8OA 4YHZL 4YXLL 3K5RA 4MNQA 3QQ9C 2Z9TA 1AR1B 3BW9B 2J5LB 2VH5H 4M7LL 1ZGLB 4J28A 5I1KH 3MLWH 3GTTA 3IFLL 4J6RL 5KVFL 2WGNB 3NT0A 3QUHA 4YDVA 3JVFC 4FFVC 2OR9H 4H25B 2JK5A 1JYWA 5F7EH 3WDIA 4WF7A 1NOLA 5D70L 1DN0A 4R7DB 4FG6D 4RRPG 4G9FB 3RWCB 4HEPA 2JF1A 5MEOB 2O1AA 3SYCA 5EBLB 5SX5K 2WAHA 1TNMA 3C5ZD 3ML8A 4R96A 3BSZA 1CU4L 1HJBC 3H85A 4YXKH 2YFOA 4ODVH 2H1PL 5AENA 2F7PA 1BBJA 5A1AA 4Q6YA 3PREA 1UM4H 3S8FB 4ODTL 3NH7H 4FERA 3FO2A 4JPWH 4Z3IA 2DTSA 1KZQA 3QZBA 4MHHG 4JQXA 3ZDZB 1SBBA 5FM5O 5C86A 5IMLB 5JLZA 1BJ1J 1Q9OB 1R3HB 1AJ7H 1QEWA 5BCAA 3EYVB 5G5DA 1TITA 3HE6B 2VR7A 3CN4A 3OGOE 1GC1L 4PRAA 3LKOA 4DTGH 4PGBB 1F18A 1ZS8A 1O6VA 2BVQA 3CFCH 1XZ0A 3ECVA 1WBYA 3VUAA 1PZDA 5GISL 2PP7A 4FXKA 4L4TA 3TL5A 1Q0XL 4LSDA 4AYMC 2NR6C 2Z8VC 3BD3A 3MLTB 5DGRA 5JXAL 1WC7A 2C4XA 3FQTA 3NZHH 3TT3L 5FFLA 4Z95L 2N7BA 3UTSD 3BKYH 5DI8A 5HHOA 4IRSD 1RP8A 4YSOA 3RWIB 3ARWA 1KPRA 3DXAD 1AR1C 3Q5YA 2BSSB 2J5LC 4L8DB 5AVQB 3VQ1C 5IG7A 3TZVC 3EUUA 1AO7A 4F9LC 4AMXA 3BKJL 3MFGB 3KLDA 4R9HA 2H6PB 1PX8A 1DQMH 3FQWA 4EQ3A 4WY7L 1RXLA 1DE4A 2V9RA 3HZYA 4NP4L 2AW2A 1PJWA 3W3BA 3E0GA 4NGHH 1S7SA 2GJZB 4F1ZA 3PGCB 2Q86B 4KKNA 1B4JL 2LABA 1X7QA 1WAPA 4AQ8C 1KXTA 1FGVL 4IW4C 5CJ5A 3P9MA 2BIQA 1GA2A 1CD1B 3EGSA 3IU4H 2CIIA 2EDYA 5IW6B 4KJQC 2AJXL 3LZRA 3O6ML 5D1XA 8FABB 3K8KA 4OJFL 3SCMC 2K6WA 4I18A 3TCTA 1MEXH 2A9MH 3HAEA 3FMGL 2VM9A 1YY8B 2CUAA 3IGFA 5C9JB 4AQEB 1IAII 1AD0A 1ADQH 2C7FA 3HG3A 3IEAA 3P3SA 2A83B 4L3ED 5B4MC 4C56B 1YN6A 1LWHA 5JHDE 2IO5A 5E1GA 4AMWA 1OT4A 4CBPA 1FN4B 2GCYB 4QTHA 1XB6A 2YD1A 5DWPA 2G5UA 2X4NB 4ZAKD 5F8RC 3CSFA 3HNSL 3APFA 5IQ7L 2PWEA 1D7DA 3MBXL 4HCRL 4DKEL 5JUEH 5EN3A 3GMLA 3WJLA 1WPCA 3MNVB 5HHME 4TNVF 1PGRB 4PJFA 4FTVA 4LF3B 3WCYA 4B53A 4U49A 2BRRL 3DGDA 4AGNA 5FB8A 1RJYB 3L3DA 3ROOA 3ULSB 5IB2A 3IDMA 1V3JA 5CKGA 4MJ2A 1QEXA 3JWOC 1DQTA 2F5AL 2YA2A 3FT9A 5HHMB 3DUHA 4IBYA 1ZK5A 4YZFF 3W11D 4RA0C 4HJJL 5ADPL 3OKEA 2ZJSL 1UZ6E 1P84K 1HK6A 3EH5B 3BUQA 1TZGH 3FCSB 2DQGH 5FUOH 2YAMA 7CGTA 1YAZA 3DHMA 3PL6B 4RISL 3D25A 3FUEA 1YJDH 1MCKA 1NCDH 4OJDH 1CR9L 3OKDB 3F84A 4JUSA 2H1LM 1T0PB 2WW8A 3B1TA 1GZHC 4X9YA 4EJ1C 1YEJH 4Y1AD 3GRWA 2P26A 3P54A 3MUHL 1YEEL 4AENB 4H7VA 5KSAB 1COBA 4GRLD 3VXPB 4Z7NE 4UQ3A 1AP2A 2NX5D 2DKMA 4ZFOL 1OM3H 1Q72H 2YUVA 2EJ1A 2W0LA 1TETH 1RULL 3Q44A 3AT8A 3K1KC 4PJ7A 1TG8A 4PRNB 1YUHB 4WFED 4WFGD 1M56B 2GC4C 3FRUB 1IFRA 3FBKA 4Z7NB 4BFOA 5KSBF 2ZXWB 4PLNC 2E86A 3OZ9L 2GYSA 2QEJA 3Q3GB 4HOZA 5D5ME 5I1EH 1BQLH 1LO5B 4XCCH 2NPLX 1KIQA 4NRXA 3QHFH 2JJTC 4A66A 2EDLA 1FDLH 4Z7WB 4RMUA 3Q13A 3GSQA 4IBVA 5D5MB 3P4NB 3UADA 2FR4B 4BRJA 1MFEL 2XFXA 3ZQXA 4NPYB 2ZYHA 5B7EA 3I02B 2CLZB 2YGVA 5KVMC 2EEAA 4P5RA 2E56A 4MFHA 4Z78B 2X28A 1PX3A 4MMXA 2I07B 3SE8H 2OBGA 3PL6C 2C9VA 5K9JH 4OFIA 4OV5A 4I5BB 4IOFD 4NQCA 2C3VB 1TLKA 3NAAL 4G70B 4XAWL 5BNXD 1QNIA 3B7TA 3ETBF 1I1RA 3RWHA 3QPKA 4F8NA 5J4MA 2BP8B 1E9OA 1UFGA 2VDPB 3BO8A 4N2KA 1N5AA 2VN6A 3IKCB 5CLWA 4N8CH 5IHLB 1A7RH 4OLVH 5A2LH 4MDJA 4XC3L 5KSAC 3BFOA 1JCKA 1G7HA 4WJ5A 2VLJE 3DIFA 2E3VA 3BP5A 4FQPA 3UAEA 2PO6C 3VI4E 4BHUI 5I1CH 1AZZC 2XPYA 4QRBA 1CF1A 1DJYA 4DKTA 1XGZA 5C0CE 2VDLL 5IMOB 1OP9A 4LHJB 4OTXH 1IE4A 3O3AB 5FHBL 4EI6A 2VLJB 3VI4B 4RDQG 3PDGA 1CB4A 3MLZH 4FG2A 4WHCA 5KS9A 2XZQL 5C0CB 5J1AB 3MQIA 5E08H 2J21A 3VXRA 4ONHA 3S4SB 2BDNL 4HDIA 1G6RA 1GRWA 3QI9C 1F6AA 4IRZH 4Y5YA 4HOXA 4HH8A 1RMFL 1CTMA 4Y9GA 5ICUA 5DXWA 4R90L 3LD8B 4PTUA 2KMWA 5IR1A 1QFUL 2FHFA 1OOAA 2H26A 4FYSA 5GGRA 5E1QA 5B7FA 2BW5A 3SE9L 2OK0H 4MD5A 3U9UB 2APVA 4I2XE 1T21A 2OQJA 2YPKB 1XGQA 4FQ1L 3Q9QA 1T1YB 2WGXA 4XVUD 4U7MA 2EECA 1NAMB 3L17A 4CKQA 4NUMA 3MBEC 2VXUL 4D3CH 3VE0B 2A5UA 2HG5A 1FO0H 1A7PH 2RB8A 3S96B 2G3MA 4F8OA 5H35A 5E23A 3F6IA 5F21B 3MRLA 3K6IA 1BM3H 5J56B 2VQ4A 4JRFA 3CVHB 3O3DB 2J8HA 4KVCH 1XAKA 5CD5C 4WW2F 1O5PA 3SKOA 1WO2A 4RQQB 2L7JA 2B20A 4X4KA 4U1LA 3RX5A 2Z4QA 3LN4B 3G5ZA 4I0PA 4KNUA 4NO0D 4NZRH 1HL5A 3HS0A 1AOZA 1DQIA 3F7KA 5D6CA 3A5VA 2Y1ZA 3K0YA 4GFTB 1HHHB 1RJCA 2CAKA 3UJTL 4B9PA 1DBAH 2YD0A 1BZ7B 2HFEB 4FJ6A 5CGYC 3SN6N 2V2XA 3HE6D 3C12A 3JBG7 1G7LB 3QZOA 3V95A 4YBQC 4C4UA 2FL5B 3RAJL 3LNFA 1VEOA 3MA7B 2IAMA 1YMME 3NEOA 2F68X 8PAZA 4NKQB 2D7QA 4P46A 2UYLA 5FO8A 3T6WA 2ICES 1R9FA 1FAKT 4JPSA 3UBXB 3UBHA 2Q87A 4AGPA 5AAMA 4YE0A 3QQ3B 3HZMA 4N2AA 2BJMH 2EDFA 1FQ9C 1QASA 2E46A 2VRKA 1SPDA 1YMMB 5DD3L 4L8BA 4NQQA 3R7QA 4JFHE 1P4BL 1XCQB 3L81A 3WXVL 5F6HJ 3ZQWA 4OGYL 5FYJH 2NY6D 5AYUH 2VDNB 3KNBA 2BNRA 2J57A 3BUTA 2CE6A 4N2MA 3GXFA 3B5TA 1SGKA 1EHNA 4S0SD 3LV3A 4KI5E 4Z7OB 3PXJA 2D7TL 2P7TA 2XRAL 4Z7QF 5FLUA 3WFEH 1XTLA 4CU6A 1MJ7H 2CGYA 4YBLB 2I60L 4X7FC 3V4VH 4AYEC 3TGXA 2QGEA 1RUQL 2NUTB 4RMSA 2OJZL 4GSXA 3MRKB 4K07A 2JCCE 5C8JA 1GOFA 3E38A 3IWVA 4QRRB 1WRFA 1PIFA 3N1MC 3CDFA 3PWPD 1WWBX 3GMPB 1G7JA 3ULVC 1T7VA 1A4CA 4OIIL 2JCCB 1S46A 2D7OA 4G8FB 2CJTA 3FO0L 1RK7A 2W91A 3DX3A 5L8JB 3GT6A 3V10A 3CCHA 2YBRB 2E9IA 3FOMA 5IVXA 1DBML 3EGDB 4DUWA 2DYPD 4OW6A 4MDIA 1KGJA 2QTEA 3VXME 2PXYC 1A1OB 2PWGA 3RL2A 4PJXE 3FU0A 4B0MM 4M9PA 2EIJB 2ZYIA 4JKLA 4UIKH 2BNUB 3ASNB 1G7PB 1CICB 1S7VB 2OMXB 5JHDD 2F5BH 1QYGL 1CGUA 3BEVA 5IREA 3H9ZA 1HXYA 1I4FA 3IF1A 3QO1A 3VXMB 1GS8A 3EH4B 4F58L 5TPWL 4Z77B 5EO9B 2XTJD 2WXHA 4R3SA 2GJ6E 5D2LA 4C4KO 3DLQR 4YPJA 2L7UA 3QDJA 3VJ6B 5BV7H 2VC2L 1MCRA 2OLDA 2YSSB 3MZTA 2E6JA 2X6MA 4LSTL 4KITB 2JQZA 3CQFA 2DIJA 2D4DA 4QWWD 2YEQA 1JGUH 4XC1L 1GR7A 1D5MB 4XO5A 3UJIL 3NTCL 1LWJA 4QCIB 4A04A 4JQIA 3OLEA 4LLDB 1M4KA 5BO0D 2QPEB 1HILA 2B0SL 1D5BB 4I85A 3D39A 3ESMA 1HQ4A 4FYRA 2AJSL 4K8RL 1NC2B 3FCTB 3U48A 1TCRB 4LPXA 1U4EA 2A7BA 4JFFE 4WUUE 3CFEB 4MB3A 3WFHA 3ALWA 1QFPA 1WT5C 3DX2A 3NZSA 4FMKA 2E76C 4NFBA 1FFOB 1Z9LA 3VG0H 5DD1L 1S7QB 4W9CC 3VI3E 4Y19A 5JPNB 3PHOA 3F7VA 2DI7A 3MJ9A 1JK9A 2NR6A 2ROYA 4MAZA 6PCYA 2XVKA 2LHAA 5I0VA 2JKSA 1RZ7L 4G6JL 5INCB 1TJHH 4NENA 3FU3A 3QO0B 3SOTA 4PRIA 5K59E 3BC9A 1BX2A 3BW9A 1A4AA 1T2QL 2VLRD 2CLVB 3TZVA 4F9LA 2HRPL 1CICC 2ZIDA 3N43F 3DC0A 3FFCD 3CBJB 4H25A 1BJ1H 4PVLA 1Q0YL 4G9FA 3RWCA 5MEOA 2GIXA 5CGBA 4JGMA 3ARDB 4XE0A 4MVBD 1E6OH 1FNGA 1KIRB 1H3PH 4AQ8A 3VQMA 2FATH 3PWUA 3FCUB 1CFSB 3O2WH 3C5SA 2J72A 1OLZA 4QXGL 1JPTH 4HT1L 2FLBT 1ZLWK 5T3XE 3AG1B 3SCMA 1SHXA 5B38G 4EIZC 3QUYB 2IH3B 1IT9H 1Q9OA 5DZOA 4UIMA 3EYVA 3EW3B 4I7ZC 1N7MH 3IRZA 1Z66A 2XETA 1L4IA 4MJ6B 4D9LH 1JF1A 1MWOA 1VFUA 5ESQA 3PQYE 1LYQA 3LVEA 4GQ9L 1CGSL 1VAHA 2WB7A 4KX9A 1DBKH 3HN3A 1KTJA 2R8SH 4KTDH 3UH8A 5JOEA 5KEZA 2IADA 4J3OH 4DGIL 2VT0A 5IBLD 3BVTA 4PJIB 3SBWC 4A7UA 4P57B 1SXAA 4YPGB 1A66A 1YNTB 3DV4B 3QNXB 1YYML 4NM4H 2NNFA 5HI4D 3RWIA 5BJTB 2BSSA 2DIBA 4AQZA 3HI1B 1ZGLP 1T83C 3QQNA 3GQFA 2PN5A 3WKQA 2IFFH 4IKKA 4ABVA 5FKPA 2FLMA 2G3XA 1IKFH 4IYKA 4EI5B 5SWQB 1VA9A 3L6FB 5FO7B 1E4JA 5C07A 4B9GA 1RD6A 1SHSA 2F1EA 4FZ8H 2GJZA 5EZIL 4XH2A 3PGCA 4JR9H 3BIAX 3RDTD 1FH5L 2DLFH 3H9SB 4XNBA 1ULVA 32C2A 4ZMZA 4W9ZA 3H53A 4KDTC 5M94B 1MPAH 1KBGH 2XJLA 4GSQA 1UC6A 3GIVA 5JXEC 1GZHA 4DKFL 4LVOC 3H3BC 5JQ6H 1L7TL 5D72L 4P5KB 2X9WA 2YPVH 3QUYC 1YY8A 4AQEA 2AEPL 2J1XA 3LS4H 2A83A 1MCDA 2CMRL 1YEIL 4J3TA 4QHLB 4U0QB 4C56A 3HB3D 5F9WB 1FZOB 4PN6A 3X1GA 1FN4A 1N0XL 2WTOA 2C34A 2HH0H 2GCYA 4HS6A 2ZUXA 1ZJBA 5BRZB 3SODB 4G2AA 1RFDH 4WV1B 3NDYE 4MS8C 2BNQB 3T09A 4Y9EA 2NNXA 5EMYA 2XG4A 3IGLA 1QQDB 3VVVA 5KJ7E 5C70A 2JJTA 3F12A 1R17A 1G7IB 1KBKA 2CJSA 3SDAD 3ULSA 3OPUA 2QQNH 2ZOLA 1KYAA 2WYIA 3IDGA 5IHUH 4QD2E 1HESA 4LMQI 4NQDE 2CJUL 4ZFZB 3T08A 1VERA 2VO8A 1PW3A 4MCZB 2VQ1B 5FM4A 4M6NL 3FCSA 4EKJA 3DOSA 2OJEB 5MENB 5DJ2B 3TH4T 1K6QL 5DMIL 3UBGA 5KYUA 3PL6A 4X6EB 1NC4B 3H6AA 4XR8C 1HWHB 1AMYA 1W15A 1BJMA 4GT0A 1GGUA 5CBAA 2B59B 1X4ZA 5CUSH 3IXAA 1MNUL 3T6XA 3B2MA 5ENWA 2BVOB 1HYRC 1IEAB 3MA9H 2YD5A 1PZSA 1PKQE 1RZPA 1TJIH 2BVEA 4A2EA 3ISWA 4JPQA 4AENA 1KWGA 5KUKA 3EADA 3FUDA 1F4XL 2O5XL 5KSAA 1TKWB 3VXPA 2FH6A 1XHHA 3HRZB 4I48A 4JFHD 5I28A 1IC0A 1PKQB 3C5JA 2ZXEB 3FQYA 3SDXE 1N6VA 4ZMVA 2VITA 4UM8B 1L0XA 2Y24A 4JZNB 3TU6A 1UEYA 4OCXL 1IBDA 1EIBA 2JCWA 4R97B 4PRNA 3L3KA 3NSCA 5IF0B 3AQZA 4MNGE 4JREC 3FRUA 4OCSH 1EUTA 4LSUL 2JSFA 3BMVA 4K3JL 2QSTA 3SDXB 4ZS7H 3S3CB 5J13B 1PYWB 3LCYA 1C5BL 1G9MH 3P77B 4JUTA 4MA3B 3QI9A 2ZONA 4I89A 4Z7WA 4F20A 1OHZA 3M8OL 1QPPA 5JIKA 2VN7A 3P4NA 4P9HH 1MCSA 2FR4A 3GHEL 4OM1H 3VD3A 2EE9A 2UZIH 2Z3FA 4NPYA 4CSTA 2QPUA 1GGTA 3MLRH 3F7LA 5EUKA 3PIQB 3WXWL 3MRCB 2OMVB 4U1JB 2IPTH 3TPKA 3CFKB 3KBPA 2MFNA 4X98B 4Z78A 5A2BA 2Y6SD 4PJ5E 3J27A 1BF2A 4KMTH 4FABL 3WAKA 2O6DA 4ABUA 3QUXB 2I07A 2ITFA 4LGSB 5AWNL 2DM7A 1SMDA 3PNRB 5CEZD 4ZYKB 4Z8FH 4NCDA 5F1IB 2E7BA 3MBEA 1KF9B 5DJ8B 2DQHH 3MJ7B 4JL2A 5DLLA 3T0WA 4PJHE 1AZVA 2H2PC 3VXMD 4AVHA 2AQRA 4B6ZA 3FTXA 4E5XB 1W72B 4QUOA 4K7PY 1UH3A 3C6LB 5BS0A 2CK2A 2Z31D 3IKCA 3TA3B 1H8NA 5IROD 3N9GH 5TQ0L 3H9HA 4BJLA 4HLEA 4PJHB 4RMQA 4F7MB 4XCNA 1Q0EA 5AVXB 1DFBH 2LQRA 1XF2A 3HRZC 3V8CA 4LNVA 4XRCB 2GJ6D 5CIPB 3HJ0A 4HZLA 5JIDA 1O6SB 5GSVA 3D87B 5IMOA 1W16A 3STZA 1HHKA 1SQMA 4LT7A 3BXNA 2CA3A 2JKIS 5HDQL 3QRGH 1XGRB 3QUML 4BH7A 1E5AA 3GSVA 5J13C 4ZUWB 3WKNA 4F2ME 2XQYA 1IIIA 3GK8H 1CJYA 3OXRB 4LHUG 1JF6A 3S4SA 4C58B 4HJ0C 1JFQL 5EF2A 1GW0A 3ZOAA 4A6YH 1UQSB 4MBRA 4ZMTA 4EXPX 4IBUA 1CXLA 4Z7UE 1S7UB 3VVWA 3VXTB 3ARBD 3OBAA 2P28B 1SNRA 2Y72A 3ATDA 4JFFD 4KTYA 4NHCH 5DJ6A 4WUUD 5ECGA 1T0MB 3U1QA 4JX0A 4Y88A 1AQMA 5H37A 4YX2H 3CK0H 3O6FB 4Z7UB 3GZOA 3DX4A 1ZANL 1EO8L 3CN2A 4P5TD 3H56A 3GKZA 3T6ZA 5BW7C 1HYSC 3KM2A 1T1YA 2MKLC 3OZLA 1H3WM 1KPVB 3NIFE 4L29B 2R2EB 4XBEL 1A3RL 4FFYL 4X6BA 3S96A 4QRSA 5JW4N 3P73B 4FTDA 5DVPA 5AZUA 4ALAC 5D8JL 3DMMC 1GZQB 4M5TA 3C87A 3FT2A 4RGMC 2EDOA 3KPMB 1TFHA 3LQAL 2VR3A 2CGRL 1MCNA 1IRAY 1T66C 5LGJB 4K94C 3CVHA 1OW0C 3I3DA 1RERA 1N8ZA 3O3DA 3BT0A 3K2UL 4G83A 2AAAA 2KLSA 2WZ0A 4B3EA 3DPBB 1H3XA 5GZOD 4TSAL 4OGXH 1IJ9A 3LN4A 3OR7A 3BLPX 2XA3A 1B4TA 1I1AB 4HSQA 1UKSA 2C9RA 3EJJX 2BFVL 4LBEA 5FECB 4QT5B 3OB0H 3L4CA 5EZPA 3MFFB 2HFEA 1L0YA 1FC2D 4LHQB 5CN2A 2V2TB 4PJGA 2CBPA 3BVNB 4ANVA 4H20L 2FL5A 3TPUB 1MJJA 3JYBA 4TL4A 1DVZA 3MA7A 3JWNC 4L8CB 2PXYA 3DJRA 3QG7H 4K7PH 5EOTB 4BDVA 5ICZB 4WTZG 3UBXA 4GH7B 1TT6A 4OV6F 2G75A 3VFUA 5AYQA 1MWAL 1KEMH 2VN3A 3PQYD 1XCQA 1THCA 5DLMH 3UC0L 3VYNA 1ZHLB 4G6ML 3CSTA 4DFIA 3FO9A 1ODUA 5IEHA 5C6TH 3W81A 3ZE1E 4FQHB 1EWHA 1S5HA 3QSKB 1JXKA 2E47A 5JR1H 3GI9H 4Q9QL 1PJ9A 1WZMA 1C16A 3PLYA 2DQDH 5TDPA 1RH8A 4XB7A 4BQ6A 3FS9A 1DUYA 3KVPA 2YGQA 3ZE1B 2CDGB 4N86A 2NUTA 5EZLB 4JM4H 1QBAA 4XZ4A 5DWUH 3FQ2A 4QRRA 5GGVY 1UM6H 3IMVA 3SDDB 1PCSA 1FI8C 2I9TB 1LWRA 3WFBH 2DICA 4DQAA 3GMPA 4J1UB 1LEKB 1WT5A 3MXVL 3NJLA 4ERSH 4PI2A 2GBAA 3P0YL 5DK0B 4POZD 1CLVA 3PV6B 1I1AC 3MV8D 4G8FA 4GG8A 1PL3A 5D4HA 1ACZA 5FA4A 2NNRA 4OZGE 1DSFL 3E2HB 1T3FB 1Q9WB 4RGNE 1OTSC 3EGDA 2P24B 4GJTB 5I8OL 4XVOA 2Y07L 3RX8A 1A1OA 3VM5A 2YK1H 3QORC 4HEPG 4OZGB 2XXGA 3D0VA 3UO1H 1G7PA 1CICA 1S7VA 1TDQA 2OMXA 4RGNB 3QG6B 3T77B 2ORBH 1MELA 1MVFA 2G3ZA 3R4RA 4EXKA 5EO9A 2EVGA 4LVNC 2HYMA 2NXYD 2MOQA 4DKAA 2W92A 3FTGA 1D6VL 3W9DB 5C0EB 3CC5A 2XIDA 3IK2A 3O45B 4JQVC 1D5MA 4OB5L 1EHKB 2OYMA 3MCG1 2WNWA 4DGWC 1KJVA 3K4ZA 4LLDA 2O5ZH 2E7DA 2FWUA 4FQJL 2ZPKL 1D5BA 4GAJL 4NQDD 1L5GA 2CM5A 4O51B 2OZNA 3FCTA 1NC4D 2F58H 2X10A 3FW6A 3GSNB 5D71L 5AZEH 3TO2A 3HIZA 4Z23A 5MHSE 3PFUA 3IS0X 3UERA 1X7SA 2X4PA 5E4AA 4MAUL 1G7MB 1GOHA 1FFOA 1OTTD 4W9EC 3REWA 4Q14A 4LB8A 4J4PD 4XNUH 2VNCA 5KVFE 4NQXB 4MDRA 1UJTA 3EIFA 3BKMH 1YECH 3CPLB 3IRCA 3TCLB 3IJEB 3G5YB 3SBWA 5L6YH 3EOAA 5I15L 1I7ZA 5LJYH 4FQXC 5INCA 1I53A 2CU9A 1PZ2A 4Y2DD 5GRJH 3BGMA 1QRNB 5EV7A 2NY7L 5ITBL 1T83A 4LDOB 3P3RA 4L4VE 4R4FL 1A02N 1N4XL 3IJYB 5BVJB 5CLYA 1NEPA 1JL8A 1ZK9A 1NCCL 3CUPB 3EF7A 3GM0A 4YIQB 3CZKA 2PYFB 5EHFA 3CFJB 2YMXH 2N0MA 1FYTE 2FGWH 1JRHL 3HAEG 1T4WA 4IGBC 4ZTOL 1MNNA 3OV6A 1CFSA 3F65A 4G7RB 1M57B 4GMTH 4WHYG 2CR6A 4KDTA 3ILPB 5JXEA 3ARGB 2WV3A 1WTGT 3HC4L 2WKOA 2ATKB 3QUYA 3AXLA 2EADA 2UWEE 4Z0XB 3PWNB 2QKIB 4PWHA 3TVMD 2BIOA 3HC0B 3U2IA 2DQMA 3VG9B 2WXJA 3HNTH 5B3SB 3EH1A 3LKRB 3LS5H 1M9WA 4MJ6A 3KPQB 4U6VH 4LZKA 4PJ5D 2UWEB 4DOHE 2VXSH 3OG6B 2X41A 3I85A 5GRWA 4Q9RH 3Q0HA 4OLYL 1GSKA 2J6EA 1WFNA 4PB9H 3T65B 3TA3D 5LAXB 1WS8A 5JHLA 3LNIA 15C8H 5ILTH 2AJZB 2AMUA 5J11B 1X5LA 1SJHA 5CLTA 4LDEB 1FNSH 2F2HA 4PJIA 3KHOA 4X8JB 5ABAA 1J8HE 4ZMPA 4M9OA 2GFBB 5T1KD 4YPGA 3WL9B 4O4YL 1E5YA 5BJTA 2OTUB 2IG2H 3ARQA 3TBWA 2AV1B 3P11L 2ZXBA 1DEEB 3HI1A 4LCWE 2W38A 1J8HB 3D0AA 1M3JA 4V1DE 2VKXA 3R1GL 4MQ7A 3X11B 3VM7A 1F3DH 1IGTA 3L1OH 3AS2A 4JK0D 3NMEA 5EO1A 4WSJA 5SWQA 5CINL 3WN5B 5FO7A 1NEZA 3QZPA 2C3WA 3DECA 4JKPH 1E8ZA 3S8WA 4V1DB 1R3JA 4RFNB 4HIHA 3H9SA 2ODIA 4H0HB 5K9QG 5KYXB 1GGIL 2Q7YB 3UTZB 1KBPA 5JDSA 3ARGC 4AOFA 3MNDA 4I1NB 5DMGC 1AGBB 4HSCX 5E56A 4P5KA 4ANUA 1MFNA 2QKIC 1QBLL 4ILDA 2Z7WA 3X3GH 1NBYA 3KS0H 3WSQL 4HFUL 3C2AL 3GXIA 4PP2B 4QHLA 5F96L 1FZOA 1NIFA 1OK8A 3OJMB 3PHQB 3QDGA 5HYSB 3KG5A 4H1LH 3PAUA 4ELME 3BDYL 1NCGA 3C9NB 3LXBA 3ZHLA 4E9SA 5IMMB 2V5YA 2WLLB 4FHJA 1WZKA 2XN9E 4LLWA 3MUJA 4CUCA 1GYWA 1O5DT 2BNQA 4LEOB 1A6PA 1CD9B 3AWFA 5J11C 1XMWA 3FC8A 2Y22A 4XO3A 4OUUA 5FHAH 2XN9B 3BYTA 1CE6B 2GG1A 4PRHE 4OVUA 1FORL 4WENB 3O2VL 2BX5A 4Z3HA 4YOKA 3D18A 5IFHH 3K6SA 5DHVH 3VWKD 2ZUYA 4UU9A 1FE8L 3ARFB 1Z7JA 4A7QA 1KBVA 4PJ8B 2OL3L 1CLYH 1UA6H 1CDGA 4AM0B 4Q9BA 4ZFZA 2H0EA 3S37L 4RFOL 1HFUA 3F58L 3DX7B 4X5RA 4HYTB 2GQHA 3O0RH 1KV3A 4DSYA 3JUYA 4DZ8B 4QEGA 5KSVA 3WN5C 5ESAA 5GGSB 2FYYB 3SYAA 2OJEA 4PCSA 4XVJL 5MENA 3EG9A 4FQ2L 2R7EA 3BP6A 1LQBC 2OS7A 3DRQB 2VXQA 4RFNC 2R27A 5EB9A 4AK1A 2J25A 5F3BA 4LRIC 1ET8A 1EZLA 1KC5H 3BKCH 3CLEL 1OP5K 4ZAKC 2HPTA 3UPAA 1HOCB 2BVOA 1CGYA 1IEAA 4HJGB 4YXHH 1I75A 3BZ4A 1WDAA 4F91B 1VGKB 2FZ3B 2GI0A 1OAKH 3OAYK 5F7KC 1JXJA 5F93C 5KVGH 2SEBA 3GPEA 4ZFOB 3QISA 3HRZA 2EXYD 1TTCA 5CZXC 5C0DA 4EDWH 5FYLH 4PS4L 1AOHA 3ZVVA 4JRXE 4MB5A 3W37A 4HS8L 2A73B 2XWXA 5BXFB 2HMIC 1DDHB 1YC8A 2FX7H 1EGJH 1NKRA 3MV9E 2PNDA 3EZ8A 5I66B 3BH8B 5FW8A 4HU2A 5TDNB 3BT2H 1OP5H 3IT8D 4JPKL 2F53A 3G9AB 1PFOA 5IQMA 5CJXC 2G4EA 5JA8B 3AAZA 1MAMH 3ELAT 5E6RB 5TDOB 3DOHA 1J7VR 5EUOB 4EUPA 3AY2A 1ZVYA 3O41A 4MZ3A 1A1MA 1V7ML 1GGCH 1I9IH 3PIQA 4XPAH 1AXSB 2OMVA 4U1JA 1VEMA 4LMQE 3CFKA 4X98A 4PJAB 4DETA 4GOSA 3IFOB 4GRLC 2EE6A 2B1AL 4LSQH 3ESUF 3H3PH 5ETUB 4AJVA 5BW7A 5FO9B 5EU6D 3WENA 4NJAH 4ZW7A 3PDDA 5TE6H 3MX0B 5I1LA 2O72A 2VR8A 3NCXA 4WK0B 2GT9B 5DJ8A 1WH0A 3WEMA 4NZTL 1F45A 4FXTA 5EEUA 4HJEA 2NNAB 1BIHA 1W72A 3VFOB 2DBJA 3H55A 5KTEH 2CRYA 3DMMA 4MYWB 1WA0X 2ZKHL 1A21A 4MB4A 1AGDA 1EDHA 1MW1A 5DRXA 5HYFA 4NZUL 4JG1L 2J8OA 2SODB 3PP4H 5JTWA 1OSPH 4F7MA 1ZGLM 1WYJA 1PAMA 2NRDA 1OW0A 4EMZA 3RURA 2EEXA 3A6CH 1R33A 3GTNA 5CIPA 3VXQA 1ZOXA 1XH2A 3MGAA 5I19H 2OJ1A 1OHQA 5CCGE 2E7MA 1S8DA 3FQ4A 4X7CC 5HI5C 2BZ7A 1V7NH 4O02L 1EXUB 5GGTL 3HPLA 3OR6B 1C7TA 1R3KA 2DV6A 1A7OH 1VFMA 4ZUWA 4Q74A 3OXRA 4MHHI 2JJWA 2K8MA 1JGEA 1VDGA 1VB9A 2W0FA 3VSUA 4IOFC 1H9DA 3Q6FB 3RVUC 4W6WB 4G1EB 4PEEA 4FA8A 1MRCH 1S7UA 4MCYB 3VXTA 5EA0H 2I7SA 3GHPA 2DMBA 5B1BB 1FP5A 3GJFB 4XCFL 1SEQL 1T0MA 3QWOA 5MHSD 1G0XA 1A6AA 2DS4A 5D1QE 4UT7L 3ARPA 5JZ7D 5D7IB 3MOAL 3FN3A 4NN6B 5EWIH 4AJWA 2XWBA 4PV9B 1JZJA 4OZFH 4OLXL 4EOWL 3QEHB 5GS1C 3VMNA 2VE6A 4XMKH 5D1QB 3O4LE 1TQVA 5ACZA 5DR5L 3TO4B 1CXFA 1MCOL 3LRGA 3VFPB 3P0VL 4UTCA 4QHMB 1MJ8H 1K2DB 5DFTA 5HGBA 5JW4R 5I0ZA 2QV2A 4L29A 3QUGA 2R2EA 3WHE0 2EDDA 1GTFA 3LB6D 3ZBMA 2VW7A 3CXHJ 1RZJH 5IJKC 4GI8A 4PJFF 4Y4KD 1FFNB 3FPXA 1QZNA 2MOVA 5EORL 5TQ2L 4DESA 4L4VD 5LGJA 2XUWA 3UGXA 4L0PB 4ZPVB 1E9PB 1MG3C 1IGJB 1N2RA 1H8SA 1ETJA 3DPBA 1CXKA 2IAAC 3WFZA 4XO4A 3P3UA 1FYTD 3ZXAC 2GSIB 2VSCA 1I1AA 2OR8A 3X14B 3ARZA 1O6TA 5C71A 2LTQC 3HZKB 4TUKL 2XC8A 1W0WB 2L8AA 2VXVH 4DQOL 5FECA 4V33A 1SVZA 3VH8A 2ZQKA 2JE8A 3KYMA 4F92B 3B9DA 3JV0A 2WXMA 4XVUC 1BLNB 3TPUA 5EEVA 5FGSA 2EKJA 1WAAF 4L8CA 4KY1L 4OZIE 3HEIB 4BZ1H 3K80A 1PPIA 4G8EB 5EOTA 5F9JA 5ICZA 2EUVA 4MXVF 2WXFA 5SX4I 3TXAA 2X9YA 2XWJB 4LE8A 4KX7A 4ELDA 4KZDL 1JV2B 2WVUA 5JW5B 1QI4A 3AQDA 1Y6KR 4DIXA 5L2JB 1WTLA 1IQDA 1ZHLA 4QAMB 1JVOA 1BECA 4GY4A 4L37B 4G42A 4QOKA 3VGHA 2W59A 4OF3A 2DH3A 3ORJA 3TO4C 2UX6A 4FFZL 4NPKA 4JS7A 4PIBA 4Q52A 4FQHA 4JQVA 4PJ7F 3LEVL 3T3MB 1MHPL 1AGCB 4L18A 3O3BB 1E8XA 3VQLA 2QADB 1PZAA 3SPVA 5CHNB 2X89A 3AVEA 1P0SE 2APSA 1HXMB 3RGHA 4LCWD 2CDGA 4OCRL 4JLRB 4AC4A 1L7IL 1M7IB 3THMH 2I9TA 1F8TH 3DJSA 4I88A 1YHPA 4J1UA 1LEKA 3MRIB 1DJIA 4M6OH 1ZY9A 3V0GA 1KCWA 1I9EA 2XA8L 3RWDB 1NJ9A 5K1NA 1UM5L 3NA9H 3F04A 1OM9A 1U8IA 2V2WA 1FVEB 5JQIB 2HRHA 1AHWB 1CTNA 2AJVH 4D0CA 3QZWG 1T3FA 1HL8A 3DURA 1Q9WA 3NJGA 1JRHI 4LPVA 1WCQA 3NSJA 4KUCF 4XNXL 4FQXA 3DX1A 1KCUH 1LO4L 3MU3A 2GTWA 4E41A 1UUNA 3STLB 1F02I 1DQLL 4Q7DA 2JTYA 3RG1C 2VH5L 1WBXB 2VC2B 5E8NB 5C08E 1SN5A 2CM6A 2IQAA 4OF7A 1LEGB 4O58H 1PLCA 4H8WL 3GTVA 4HH9B 1SZNA 3FDWA 4R7NB 3U0PB 4PHZA 3LRSA 5FS5A 3W39A 2IBGA 4IGBA 1RIHH 2B9BA 4N2DA 5C08B 3MLPA 3W9DA 2CLRB 2AQ2A 5DMKA 3O45A 5EF3A 5CSZA 3ZUNC 1TZIB 3NA4A 2BVYA 4PRHD 3S3DB 3KPOA 1OD7A 2X70B 3P69A 1SXNA 3F5WB 4JFDE 3QRFM 1IMHC 5KS9F 3NFSH 3ETSA 2A4ZA 2JKJA 1BEYH 2CPCA 3WI9A 3POCA 4WQOA 2ID5A 4HQQH 1JHKL 4XAKD 4AQAA 4AIOA 2YXMA 3V6FB 3GSNA 2APBA 4JFDB 4H0LC 3FOLA 4EI0A 1T5WA 3T2PA 3KM1A 4YDKL 2BXZA 1H6UA 1G7MA 4JE0A 2CQVA 2VDMH 4OQTA 4TF4A 4HUMB 4LQ1A 4JGUA 4NQXA 2XTJC 5C0JB 4OLWH 1AHWC 4YHYB 2UZYB 4KOCA 3TCLA 3TV3H 3G5YA 3QBTB 5A2KH 3A47A 4FQQB 2LGNA 3DX9B 4TNWK 1X5GA 1GJIA 1O75A 3NZHL 3KXFE 4QWWC 5CJQL 4EZKA 4HK0A 1QRNA 3VFTA 2XXCB 1IAMA 1NCWH 4JZOB 4RBPK 2CK0L 4UTBH 3SE3C 1SN0A 5FYJE 2MCG1 5CM1A 5DEZA 3KXFB 5BVJA 4LSVL 2R23B 4K7PX 1NM4A 4XP4L 4JRXD 2DB8A 4UINL 1U95B 3CUPA 4YIQA 2PYFA 4CA4A 4XN9A 3QHZH 3MV9D 4BQ9A 1S7XB 2BIMA 4KXAA 1Y0LB 2ZSWA 3CFBB 4NGHL 1KACB 4JN1L 1P7HL 4AQOA 2WCPA 2PTUA 1LK3H 2FX9H 3ES6B 1FAIL 2CKBL 2V37A 3RUGB 4GAGH 3ILPA 3ARGA 1F90H 1VIWA 4K8RC 4XODA 3IU4L 3PU7A 3L2LA 4IOIB 4X6CF 4BCZA 2ATKA 4Z0XA 3GMQB 2QKIA 3DGGB 4X5WA 4K0OA 3RWGB 2X1XR 3B2DC 3LNDA 3UTSA 1P6AB 4OKVB 2KT6A 1MEXL 4R8WL 5DVLA 1JN6B 1ZS2A 2IEPA 3LKRA 3DXAA 2NY2B 4PJBE 5EG6C 1E8WA 1RZFH 1WZ1L 1X9UA 3IPFA 3RVXC 3SBRA 3I75B 3ZY7A 1JGDB 3BPNB 3QIBD 5CR8A 2VSKB 3BAXA 3UPRA 5DJDA 4NC2B 3L5WA 4LOVA 3ZE0F 4OF6A 1XCTB 5E9NA 5GZND 2R9HD 4PJBB 3T65A 2LLNA 1TVBB 3KPSB 5LAXA 4HC1A 1OGAB 2W65B 2YIHA 1QPXA 4YHYC 3QPXL 1LO2H 4CSPA 4MVBC 3G7TA 2GFBA 4OR1A 5AB0A 3P4MB 25C8L 2ZE0A 4OIBA 5FYKL 1XIWB 4M7ZB 2AV1A 1DEEA 4F8QA 1OK0A 4N0FB 1TO4A 1QI3A 2QQLH 1UXWB 4M62L 1HE7A 4A39A 3B3BA 4MNHA 4WEUD 4ODUA 4OJCA 4HPYL 4UT6H 1RHHA 2Y2WA 2W9LA 3LIZL 4WZ9A 3REVA 2Q8AH 3WN5A 4PSRA 1QW8A 3P3TA 5EU3A 1TLMA 1JGLL 4LRIA 1DQQA 3UTZA 3VFNA 4ZAKA 3TIEA 2WLNA 1OAXH 2FSEA 4YK4B 5JNYB 1KUMA 1HNGA 2DAVA 1V27A 3IE4A 5ELIA 1G1KA 3NZ8B 3T4AC 4AV0A 1AGBA 3L3OC 3NSXA 5E1HB 2JXMA 4DGYL 5IVXF 1I9RL 1CFTB 2Z4TA 3RHWK 4WDIB 3CZJA 2P4AB 3ZHNA 2WYTA 4PP2A 4D0BB 3T0EE 5HI4C 1ETZB 1Z0NA 4KTEL 4N1EA 4X6DA 3F2LA 3AM8C 4TS6A 5AB9A 3QAZB 3LKSB 3C9NA 1IC7H 5IMMA 3GSWB 4UOW1 1S7TB 3GMRA 4N2EA 3O4LD 4EDXB 1LO3L 2XFGB 2ZWYA 1D5IH 2P80A 2FBRA 1OM3L 4GRMA 3T0EB 3TC9A 5D2LF 4LEOA 2AXHA 1CBVL 1VCBC 5INDB 3VFRA 4ZTPH 2OULB 5D7KE 1SBSH 1J9CT 5CJXA 1RIVL 1T0NA 3D4GA 1NCAH 3CHQA 5E6ZA 5FOBA 2YUWA 1W0VA 3RIKA 4TQEH 2FLRT 2XT1B 1CLOL 5F9OL 4HWZA 4AM0A 3QJQB 5I1IH 4WWNA 3S37X 3LHPH 1IGML 2Q6WA 3FRPA 2VM4A 5I6LA 2ZKWA 3O11A 2JMRA 2GABA 4HV8A 5EBWA 3ABKB 1JNLL 4GUCA 3OSKA 5D1ZD 1H19A 5E9DB 4DZ8A 5GGSA 2HLAB 4GRLA 4RWHA 1I3RA 4XPGH 3D7PA 2CO2A 1PCXA 1U8QA 4U1MB 3DRQA 3I84A 4CADB 2NW3B 5E8DH 1XGUB 3X17A 3MVSA 3P0GB 4LU5L 4LQFL 1HOCA 4YK4C 3RJOA 3T8XA 1A7QL 1NOAA 1ZT7A 4U7SA 4F2FA 1WV7T 1B4LA 2J8UA 2FZ3A 1K5NB 3DIDA 4I4WB 5ICXB 1MUJB 1R5VB 1PY9A 3VSTA 4WI5A 4GUOA 3BAKA 3SDAC 5DC0A 3INOA 3PV7A 5GRZA 5FCSH 3LAFA 4YN3A 4AL8L 5KYNA 2XQYG 2QZQA 5I1CL 1DP0A 3QAZC 2VDQH 1IBHA 2Y06L 1GIGL 4MA8H 1QPKA 2W0PA 1XO8A 5BXFA 4NYLB 4IDJL 4P2RE 1IC5H 4YZFE 2R2BB 5I66A 4X7TB 2W0KA 5K39B 3BH8A 4QY8B 3KWTA 4DPRA 2AJYH 2WO3B 4YAQA 2ICWI 3LRMA 4P2RB 4NQSB 4W9KC 5EUOA 1D7CA 2X1OA 1YYLH 3I74A 4M8RA 3WFCH 1HHJB 1M42A 1NINA 3RNKB 3ZPDA 1CF8L 2WNKA 1RUAL 5E2UL 3ASOB 3TEXA 2OMTA 3VSVA 3ZDZF 2GITB 2WQWA 1AXSA 5DMYA 3UTPD 2H8PA 3TN0B 2DLHA 2BSCA 4PJAA 1PEWA 4JO4L 5M95B 1P5VA 3NCJH 1R5IA 3CSGA 2JWYA 2NXZB 2YKLH 3NYKA 1OGSA 1JTOA 4M1CD 3MRPB 1AGFA 4O2FB 5ETUA 4RZKA 5FO9A 5H2BA 5GS1A 9CGTA 4DUXA 3VFVA 3IDYC 4Y4FB 1E90A 2KKQA 2A6JB 4K3GA 4JANA 5E2TH 5L7XH 4MSWA 4DPAX 4WO4B 3GEFA 2OXHA 5IJKA 2DWEA 2L4OA 5KSBE 2X0VA 3S88H 5I8EB 5BOJA 2BC4B 1TVHB 3LHAA 3CXHK 1P69B 4WTQA 5KVDL 3U9PH 4BSVB 3QJXA 1DLFL 1IFHH 3U0WL 1AXTL 4A1RA 5KSBB 1XGPB 3QUMB 4LARH 1VFAB 2V33A 2YARA 3E6HB 2FD6H 4WCYL 2DBLL 1TJGH 5G55A 1E9QB 2ARJA 1EXUA 4BK8A 2EIBA 3GRGA 3HBZA 3BFQG 3KLLA 3T1FA 2QELA 2HLFD 4LKXA 4ZXBD 3WMQA 1B90A 4S1RH 3ZKXB 2DDQH 3WLWD 3BSZL 3U4EB 1Z3GH 2V7HB 3BX7C 3EJPA 2J88H 1UYWL 1U3JA 2XWCA 2Y5TA 3V5HA 4LCIH 3O8XB 3Q6FA 1CLZH 3T9WA 4G1EA 1KN4L 3KDPB 4KJPD 1RU9L 5ABZA 2PCPA 4EPSA 5GGRY 3RJDA 5DZPA 1CCZA 5GQBA 5FYJU 5E6IB 4BSWB 1OPGH 3FTYA 4GKNA 3RQ3A 1TPXB 5D7IA 4Z5RA 2VABB 4LCUA 5C2BH 3ULUF 2WYZA 5T1JA 4PV9A 3BUBA 1EZVY 2HAZA 4N2FA 1DQKA 5SWZD 3QEHA 4JDVB 3TO4A 2ADFL 3BIKB 1H3TA 2MWCA 1MHCB 1YNKH 2Q8BL 4KO9A 2E27L 3VFPA 4QHMA 3ARYA 1K2DA 1WLHA 2K70A 3KXFD 4E9RA 1ZA3A 3V55A 4NKMA 4WO4C 1WFMA 2H6UA 3APNA 3C09B 3MNWB 2BY3A 3ARXA 4WFFE 5FYJD 4XTRD 2KZWA 4PY8J 2FWSA 4N0YH 5AD0B 4PG9A 3EJZC 3T6QC 3L4UA 1E9PA 5JO5B 3TONA 2D7NA 3FO1B 3FYIB 3ARBC 4Y0GA 3QNZA 4BFNA 2IGFL 4ATWA 5CMAB 1E5BA 3NFPA 4U6HB 4W6YB 4HMDA 2OMYB 4O5LL 1AANA 2KL6A 2R4RL 3G5XB 1JZIA 3HZKA 5F7NC 4YSDA 1W0WA 2G2RB 3O6KH 3FNKA 1WD9A 4MB1A 3DVNB 5E99H 3ZKXC 5CZVH 4S2SB 5GSRA 3KMDA 3HS8A 1SXBA 3O8XC 5I73C 1MWAB 4P4KD 3DYPA 4G8EA 4KFZC 5LG1A 3D69B 3CH8A 4JDTH 2XWJA 2X4SB 5E6IC 1JV2A 5SV3A 2E8YA 4J27A 5JW5A 3FQUA 4Y89A 4XWGH 1HI6B 4M93B 3CFUA 4V11A 1ZHBB 4FYQA 1E27B 2K7QA 1QD0A 1KFAH 4L37A 3LEYH 3PWPA 1BD2E 3N44F 4LAQL 4NLHA 3LMJH 2Q7AA 2W94A 1YEGH 4GMSL 5ACMA 3WNOA 3OPZH 1AGCA 3O3BA 4TSBH 4BD4A 1I9JH 4FL4C 2HT2D 5CHNA 4WWKD 4PJDA 4WW1A 1UWXH 3B56A 4OBSA 3N5AA 3C09C 1HXMA 3E9TA 4WW2B 2A9NH 2UY6B 2DYPA 4YSAA 4JLRA 3K2IA 4Z7WF 1QLFA 4HALA 2WPGA 4W9JC 3F85A 4XVTH 1NZRA 1HTYA 4JFEB 4K9EC 2K9FB 2A77H 3RWDA 4XCEB 3U6XA 3VGGA 3UC2A 4ODXB 4YHML 4PUBH 3CBKB 5I18L 1FVEA 4A7VA 1AHWA 3H42L 3MXWH 5HGAA 5SWSD 3EYSL 3K5SA 1SM3H 4EN3B 1WF5A 3OKYA 4F33B 2PW2A 1A22B 4D8OA 2H32A 4KKBD 3FFOA 5T5FL 4YSQA 1E6JH 4LSPL 2GTZB 3SEPA 2I32A 3WUZA 4ONGH 1KYOJ 4OFKA 1TJHL 4OD1H 3SE3A 2V6HA 3QARA 4M8QA 1BW8A 3GRWL 2ZUTA 4Y16C 4IJTA 3WG7B 4Z7QE 4E68A 5E8NA 4LSSL 2F19H 3WY4A 2AEQL 4KAQL 4B9CA 3ZTJG 4OD2B 1LEGA 3SSGA 1S5IL 2VL5B 1JIBA 2J1YA 1KT2B 1CT8A 3D4ZA 1INDL 4Z7QB 2WXPA 2LVEA 2IV8A 3HKZA 1MVUB 4TRPL 1IAIM 4IMLB 3TBYA 1WP6A 5D7KD 2VR9A 3UP6A 1QLEL 1UKTA 4LK4A 1IE5A 4Q0XH 4P2OD 2FATL 3VW3L 5DGQA 4M4RA 4JHWL 2BK8A 4N5ED 5C0FB 1B2WL 4J23A 5GS3A 1LK2B 3C6SB 2JB6B 4KRPB 3IGUA 3CE1A 2HX7A 1MCEA 3V6FA 3HOGA 3R8QA 3QIWB 1BM7A 3DARA 2VLRA 2EAEA 3MRDA 4HUNB 3FFCA 5CSBA 3KLAB 2VL4A 4QRPB 2B3IA 3VD4A 3DTDA 4GAYB 4JRYD 5IW3A 1J0KA 3GHBL 4FLOA 1G9HA 1YEFH 3CLWA 1KCRL 2WIIA 3KWUA 4JO1L 1RZKH 3A4EA 3OKLB 2IMNA 1NFDE 5DD0H 3U6RA 4EN3C 4KC3B 5F7DB 5F7FA 1CMOA 5C0RL 2E9WA 2Z7UA 4H8PA 3WIFB 2ADGA 3KH3A 4OY9A 3VYPA 4MJJA 1E43A 1NEZG 4OAWA 2V9UA 4HEME 1C1EH 2CA4A 4ZOEA 3I6LE 2LLGA 4X7EC 5DD6B 2I5YL 2IDCA 4NCC1 1S6NA 4APQB 1J5OH 3LDBB 2R23A 2J4WH 1U95A 5D96C 3BZ5A 3LZNA 2KUTA 4J3OD 5DJCB 5IB1A 1RIUH 1J12A 2AK4A 4I3RL 2H3KA 4GW4A 4TVPL 1UT1A 4UTAA 2Z7ZA 4L9LB 3ULVF 3F83A 1NLBL 2IQ9H 2DD8L 2WHVA 4LLYB 2AK1L 4L1HA 4WEMB 3RUGA 1A3QA 1F2QA 1V8HA 4J4PC 4WGKA 4R2GD 4XNQB 2EYTB 1TQCC 3T4AA 4OF5A 1N18A 1AKJD 1I8AA 2WWOA 5DRWB 5JW4M 1KBGL 3L3OA 3GMQA 4KXCA 1W8EA 4PJGF 3RWGA 1F1DA 1Y6NR 5JQ6L 1G6RL 2B5IB 2FT7A 4IK6A 4KRPC 3TESA 2VDRH 2A9AA 1JN6A 4XMLH 2Y7LA 1SDDB 1TZAA 3N41F 4KHXH 2NQ3A 4OFQA 4WUKH 3BEWA 3QZNA 3AM8A 1E7UA 4HXAH 1I8MA 1X4XA 5B39A 1JGDA 1LO0L 1UURA 2CO6B 5B1AB 1KB3A 2ED6A 4GKZB 1JFHA 1XCTA 1XR9B 4XGZB 5DHEA 3KPSA 5GIRB 4AYBA 1OGAA 1H6EA 5D7EA 1PQZB 3KLHD 1SFHA 1NWPA 1B0RB 4DW2H 3GJEB 4Z6AT 4F7TA 1CE1H 2V7NB 1BGXH 3N43B 2Q2EB 4N8VA 1H15A 4Z7OF 3LTVA 5GHWH 3DWTA 4ZTEA 3HI6L 4I3SH 2ISDA 1MLBB 4P2CG 1SLWA 2QPSA 5D7JB 1Q9LB 3TBBA 1RPUA 2XXFA 5I6MA 4KXZI 4M7JL 4OIFA 4XPTL 4WAFA 4APQC 1N5YH 2GK2A 1ECZA 1ZVSB 1CS6A 4W9DC 4K23H 3RZCD 4ANWA 5EO0A 5FUCE 5K33A 3MJ9H 2OR7A 2GY7B 5CCHE 1WFTA 3L9BA 1BXVA 2FEEL 2M26A 1DJZA 4N8PA 4MMZC 2NY5L 1NMCB 4EEEA 1L3NA 1P5UC 5JNYA 3HHMA 1XGYH 2AJ3A 3NZ8A 2KLTA 4MXWH 2ITEA 1IKOP 7FABH 3U7YL 5BMFL 3QQDB 4JRWA 4WDIA 1QNZL 5A2JH 4JG0L 4TNFA 3SDAA 4UDUB 3QJSB 4D0BA 1ETZA 3HHSA 5DJZB 1EFXD 1RPKA 3EDKA 3K8MA 3LKSA 2RR3A 3WO3B 2DQEH 3TEWA 1TTRA 3VXSE 1QBML 3GSWA 5DUJA 2R69A 2EICA 3HLKA 2A74B 1OF0A 2AITA 4LCYB 3TH3T 1Y1UA 3CMOL 4HISA 3GSRA 4EUPG 4UQIM 1DVYA 5INDA 2WLJA 1CN4A 3MYZA 1CFVL 1HIMH 1QG3A 1A7BA 5BO1L 1JJUA 2IFGA 2OL3B 3ESPA 4PS8A 3VXOB 3VRIA 3WNMA 4G6KL 4F3FA 4XP5L 2WBJB 4UM9D 5AKVA 4WFFD 5DURD 2FEJA 2MQ0A 5IFAH 4ZUSA 4A2GA 4A2HA 3ASWA 5C7XL 3KYKH 1A25A 5D55A 1NBQA 3NSFA 4Q4EA 2Y2TA 1BQUA 4AV4A 4OM1L 3IVKB 5E9DA 3HE7D 3KR3L 4KX8A 4FF9A 5MP6H 3L48A 5F8QC 1N10A 1M6OB 1MFBH 1I82A 2KERA 2C9PA 3MOQA 4U1MA 3FH7A 4NJ9L 4KXBA 5J7CC 1UJ3B 1IGCH 1VESA 1F4YL 1JK8B 3S5ZA 4PWEA 4DP9X 5ISZE 5LGKA 2N59A 3RPIB 1J05B 5F6IB 3ARSA 3JTTA 3L5XH 2VISA 1AG0A 2DOCA 4PY7B 1K5NA 3SE4C 2IV9A 4BK5C 5ICXA 1AQKL 3L54A 4G6AD 4ACTA 4AKQA 3L2NA 1BFOA 1GJUA 4QTIL 4IBQA 4UDTB 3VWKC 1HEJC 4ODSH 2JTDA 2YQ2A 2UZXA 2ITDB 1UH2A 3IJ9A 4WLCA 3BZEB 3MV01 3GSUB 1BD2D 3LYRA 3RVVC 3P4LA 3AG2B 5CCJA 3RU8H 4PLKD 3A6BL 3VXUD 5K39A 1URLA 4ZO8A 4QY8A 2OAAA 4OJYA 2ADYA 3PFQA 2VLMD 4H2AA 4HKBB 5BRPA 2DWDB 1OARH 4RMVA 4RMBA 3UYPB 1JWUA 5FKAB 2GAZA 3DBXB 1ZA6B 4NQSA 3WEXB 1KNOB 3MLSL 3I6GB 1TUPA 5T1DH 1XEUA 1AE6H 2ZOKA 1T03L 4JQIL 1QWUA 2XBZA 3DX0A 4HWUA 1QHOA 3DSFL 2X3AA 4K3EL 3KW7A 1YEDB 4A37A 5I1JH 2BIPA 4JFYB 3SOBH 4GAFB 1NA8A 1P53A 3X13B 4A2DA 2EXYC 4GSDH 2Z7YA 3MRPA 5E8PB 1E5ZA 1KELH 4KK6D 3LXUX 4NRZB 4A67A 1VZHA 4HMEA 2CBOA 4L3CA 3U7AA 4XBPA 1TZHB 2DMHA 4F57H 4PJCB 1SY6H 1GMIA 2NTSP 4WO4A 5F6IC 1EEZB 2O5YL 4NZFA 1IM9D 1NICA 2OMUB 4PJIF 4PRDA 3SJVB 2YN3A 2EIKB 5DO2D 2FJHB 2TRYA 4LLAA 4QXTB 5CP7A 1KXQE 5F2FA 2OYKA 1RQ5A 2QHRH 5I2IA 1TSHA 4BSVA 2IPUK 1MSPA 1UOLA 3IGAB 5H8DA 3ZHKA 1KJ2A 3VH8G 4MYPA 3ARBA 1QBBA 1XGPA 4RAHA 1BF5A 1WGOA 1V55B 3QFGA 5BUPA 3FT4B 5MERB 5C0GA 3MV7D 1GVIA 3KPRE 3SGDH 5F44A 1T7WA 3OD3A 3NDZE 1JZ8A 1IQWH 4CNIB 5K9KB 1NGQL 3V6OE 4P9ML 3U4EA 1J5IA 4B7IA 3FUJA 4KKCD 1VFBA 4DZBB 1FJ1A 3KPRB 1X5YA 1D2OA 2R1YA 1EDYA 3T6VA 3O8XA 2ZWLT 5FR3A 3I2CH 3HC2A 3QDMD 4QRQB 4B60A 6CGTA 1R24B 2YJLA 4G6FB 3RILA 3U4AA 4DPCX 5E6IA 5GRVK 1U8HB 3DVFA 1TTUA 2EXSA 3NCFB 4XMUA 2VABA 4HUXA 3RGVD 2ICWB 3SD2A 2DKUA 4KQ4L 4G8IA 1WEJH 3RWFA 4F9PC 1PKOA 5DLML 3T2NH 1N64H 3F7YA 5JIQA 4FE9A 4A2LA 1KCVL 1LVEA 4JDVA 5EOCL 3MRFB 4FFYA 3FTVA 1HWGB 1V54B 3BIKA 1U2HA 3RFZC 2Z64C 5L9DL 2Y36L 3P02A 1J9TA 3U46B 5BQ7A 1P4IL 3D9AL 2HT3C 1T6BX 4RDBA 5CF3A 5KVGE 1KIUB 4H26B 5JR1L 2H45A 3MNWA 1Z5YD 3I6LD 5CN1A 1A5FL 4JJ5A 2K78A 5AD0A 3VD9A 1JGVH 2R0ZL 3KPTA 4AIXA 5JO5A 3QC5X 3FO1A 1GCYA 2E7HA 2VLKD 3KPLB 3GIZH 1A7NL 3LKNB 4K7FB 3OHXB 3WFBL 4NZ8A 5K9QI 1U8JB 1OE1A 2QVIA 3PQYA 4MWFA 3MKKA 1S9WB 3WIHH 1Q4NX 2A3TA 4RRPA 3RKDD 1FVCA 2VDPH 4JFOA 5IGXL 5KYYA 1EAOA 3GB7A 3NJIA 1MWAA 4Q89A 1TQTA 1FIGL 1JVLA 4JY5L 3D69A 2GBUA 3LB6C 4NKIH 2ETWA 2OM5A 3CFDA 3FUNA 4Y16A 3D85B 4Y4KC 1Z9NA 2E9GA 3ATAA 3B5HA 3ZKSD 4ZFFA 1KYOK 5B38B 3ULUL 1T1WB 2GSGA 3TFKC 1U58B 4JFZL 1EVTC 1XB8A 2CUMA 3SD5A 5GXBB 3GZKA 3FQ1A 2LV4A 1OGTA 1HN1A 2EEDA 2JIXB 2R59A 5HXMA 2ZX6A 2FIKB 4ZK8A 1BIIB 3B7UX 3MV8A 4RCAA 3ABZA 3ZYZA 3PGFH 3NFNB 5AVSB 1JNHA 2AQ1A 2GSMB 2W9EH 4P59L 1KG0B 1U8LB 3G04A 3VGAB 1CXHA 2IOIA 4JFPB 3OKMB 1A6WL 1L6ZA 5H37H 1ND0B 1U21A 2AANA 5L2KD 1N59A 5C0AD 1RUKH 3QEGH 4JFEA 4QHPA 5E8EB 5EN2B 4NNPL 3SYOA 1C8PA 1TMCB 2CBTA 5LBSL 3VCLA 4FN0A 2W07B 5J1SC 3OHMB 5K5YA 1NAMH 1TTBA 5CD3A 3W2DH 4CRPA 1TEYA 2VXTH 2AVGA 3QCVL 3CFNA 5AG9A 1J9SA 4XNUL 1U3HB 5JHMA 3SGEH 4EN3A 4X8XA 4MJIE 5HHQB 5GGQH 1N19A 3QUZD 5KZCD 4ZNEE 3ZIYA 1IAKB 5IMKB 1X9LA 4B7LA 1J1OH 4G7VL 1X9RA 2G0KA 3CVHH 3IJ7A 3HUJA 2BVTA 4OI9A 1FCCA 1IGFL 4YFLF 4GO6B 1MRFL 4LBAA 4OD2A 3VXSD 4ZMYA 2P8PA 3ZO0A 2NZ9D 1RURH 5LVEA 1GYAA 3MREB 2EDTA 4TTDD 3ABLB 3VU1A 1KT2A 2F9BT 2PW1A 3HC3H 5K9OB 1M6UA 2BHZA 1MVUA 1OTUD 3KEDA 4GKLA 4ETQB 1CI5A 1S4IA 4HLZH 3ZT7A 3EYUH 3RDJA 4J4PA 1WFUA 3UX9B 4G72B 1S7WB 2R1WA 3G6DH 2EH8L 3WKMH 2AMGA 2JKTM 3VX1A 4M5YH 1YMHB 4NN7B 3VGAC 1SJMA 2YPLE 4U6TA 1TXKA 2A6DB 1G87A 3TTSA 1RHFA 4ZW8A 1F0LA 2VDNH 3NGBC 1XSIA 1SOQA 3HNTL 2ZKYA 3LS5L 4OFDA 2YPLB 5CJOH 5I6KA 4QXUH 3KLAA 4QRPA 1MCFA 2VXSL 4GAYA 4TPRH 4QHNB 4ZFGH 1U8NA 1NFIA 2J44A 1M7UA 3BPLC 3OG4B 2DF3A 1MCPH 4XXWC 1U3HC 5ISZD 2DQJL 3UACA 2FEEI 2PP9A 4QYAA 1ID2A 2VAJA 3MRNB 2I9LA 1P7QB 4UNVA 2X7LB 2PYEA 4ODHH 1NM9A 4JKKA 5DSCB 2H9GB 3QW9A 4IU2B 3PF2A 2M1KA 2IG2L 1QRKA 2B1OA 3L1FA 4APQA 2CR0A 4H8WC 5J0BA 3QS2A 4X0KA 2FHCA 4LKCA 1N8OE 1CGVA 4KHTL 1Q1JL 2Z91B 3Q2LA 3ILQC 5DJCA 1BFVH 3TBVA 3TEYA 3L1OL 2GK0B 4ANXA 1A9EB 3PPEA 2CKBB 2J1WA 1EEYB 1CFBA 1RUML 4G80A 1KEGH 1A8ZA 4MMZA 4U3SA 2B1HH 4OJAA 4J3BA 3D3VE 3RX7A 1P5UA 4WHTB 2XVBA 1NIDA 4XNQA 2EYTA 5AVZB 5F1NB 1ORSB 1VGEL 5DRWA 2E74C 5FV1L 2VLLB 1E67A 4X80L 1IBFA 3UTQB 4K2UH 4ZMWA 3D3VB 5T1KA 3JZ7A 3P4OA 5D7LA 2YHGA 3BYYA 1RK1B 4HCFA 5LCVH 5DYOA 1ZHKB 5DQDL 3E8VA 3DGCR 5DYFA 3QCTH 5C0BB 1XSKA 3UROR 2CO6A 3EDDA 4PGCB 3L3JB 1NMAL 4GLRI 4F7CB 3FB6B 4MZIA 4RMWA 1AYRA 2BW4A 5AOKA 1OAQH 5HVHC 3LSOB 3WTTA 1ZLSL 4ZX3A 4MKTA 5I5JA 3TJHD 2WVTA 2PTVA 4JEGB 1EZVX 1KGYE 3FRPG 3GJEA 3UJJL 2E7CA 4HF5L 2FEDD 3LQZB 1FA4A 3CVBA 4HUUB 3PUCA 1Q9LA 1T7XA 3V0WH 5DJXB 1UACH 1DANT 4J39A 1UA6L 4BFIB 3OJDB 2ZAHA