4Z3HA

Crystal structure of the lectin domain of papg from e. coli bi47 in complex with 4-methoxyphenyl beta-d-galabiose in space group p21
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
197
structure length
197
Chain Sequence
MAWNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGSWAYYREYIAWVVFPKKVMTKNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDQRAFDTANLCQKPGETTRLTEKFDDIIFKVALPADLPLGDYSVTIPYTSGIQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PapG, lectin domain
publication title An unexpected way nature improves solvation entropy
rcsb
source organism Escherichia coli
total genus 45
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2015-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1370 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesin receptor binding domain 4z3hA00
1J8RA 4Z3JA 4Z3HA 1J8SA 4Z3IA 4Z3GA 4Z3EA 4Z3FA
chains in the Genus database with same CATH superfamily
2GJPA 4K7PX 5FV1L 1GAFH 4HIHA 4PSRA 3VMOA 3RFZB 5FFOA 5ENWA 1EVTC 2G3XA 3RZCB 3GO1H 1Z6JT 1Q0YH 5AL8A 4PG9A 1C5DB 3HVDA 5JHDD 2R2BA 4YHPA 4J3OC 2X4RA 1UT2A 4LSRH 1NUFA 4X5RA 3QA3B 1JE6A 3MOBH 4PGEA 1NOLA 3DGCR 1EAJA 4J4PA 5F0PB 3QR2A 1D6VL 3H0TB 5BO0D 5BZDB 4MQ7A 3UACA 1SXCA 5I30L 4N0FA 4TQPA 1E2VA 1EZLA 2W0PA 2VC2L 4AL8C 2C3VB 4EJ1C 2O6CA 1PKQE 1HDMB 4R2GC 4YH6A 3D4GA 5D9SB 4IKJA 1KB5H 4XHQA 5B38G 1GOGA 1MCLA 4P8QA 4ALAL 4DVBB 1IAOA 1S7RA 3ZR5A 5HI4D 3WHXA 5I1KH 2PN5A 2UXVA 4HUUA 3VFVA 4LGRB 3QUKB 3UZQB 1EHXA 1F97A 5HDBF 3SDCB 3H9HB 5MHSD 4XMWA 3T09A 3BVNB 4JFEA 3AM8C 4JQXA 4IKIA 5D55A 3V5HA 5IBTH 1ZHNA 2NQCA 1Y07A 3LNFA 4U1GC 2DQTH 2EXSA 2CO6B 2XZAL 5F88B 4YE4L 5FOJA 2C1PA 5I5JA 3RTQB 3S2CA 2EDRA 2VDLH 5H35A 3UEZA 1XF4A 2X40A 3T3PF 1ZSDB 5D2NC 4ZO8A 5EO0B 3SKUD 3UAEA 5AENA 5DJZB 4MA3B 1EGJL 2PO6C 3CZEA 2M2DA 4WK0B 3X2QB 3PAUA 5B1JC 4JJHA 4DETA 2DBJA 3I2CH 4GQPH 4R83A 2V7HA 2NT0A 4NDMB 1PMYA 2KZBA 4UM8B 5HGHB 1JGIA 1KN4L 2M83A 4FKEA 1R47A 4QRTA 4OB5H 3UYRL 3KPLA 3LXCA 3B7UX 3MV8D 4GLRI 2HMIC 1AD9B 1JGEA 2R69A 4IKNA 5CAYB 3QIUC 4NZUH 1DANT 4BZYA 4UAHA 2XT1B 3RNQB 2EO9A 2KPNA 4UOW0 4BRVA 4LVHC 4B60A 4DHLA 4MJID 1MCOH 4JZOB 3VM5A 1DLFL 1ZKAA 2QL1A 3SKMA 4PWFA 5JO5A 5J0BA 5GS3A 3AFLA 3QI9B 3BXNA 2ZCKH 5DQ9B 1IL1A 1Z0NA 4JREB 4OGYL 5SWSD 3A24A 1YEHL 5D4IA 5F9AC 1OHZA 4LLAA 1N0LA 1AKJA 5BW7A 2ZUYA 4ZFFA 1T21B 4K7FB 4P2QD 2JI1A 3DURA 1AANA 2QPEB 3L3OC 1LP9B 4EDXB 5SV3A 3JQOB 4OU3A 2ICWA 3K71B 3OMAB 4APQB 1JTTA 1E2WA 2FJHB 4LEEA 5J5EA 3BUYB 4R8WH 2Z7ZA 4U4BA 1TDQA 5F7DB 4BWUA 4JO4L 3N91A 1E8YA 1CJYA 1ONQA 1TF4A 4MAYA 3TA3B 5BV7C 2DV6A 2EEDA 4U7MA 4GSRA 3TIDB 2AQ1A 3CFTA 1TQCC 1JHLL 1KEML 1TZGH 4Y1SA 2VO5A 3QPQD 2NXYB 3KPOA 2E56A 1IAIM 4ATWA 3FU9A 2GIXA 4EUPG 3D39B 3DUUA 2EZ0C 4N90D 5KW9L 2KERA 3QNZA 1ZDQA 4BBWA 2XLLA 1CWVA 1MFCL 2VLJA 5ANME 4NCC1 2JQAA 4PS3A 4LLUB 1G6VK 2XZCH 4PEEA 4MDIB 3LKQA 2VITA 3MGTA 3WGVB 4PTUA 4DQOH 1M4KA 4DGWC 5L4FA 5FO7A 1KGCE 4GRLB 3BP4A 4FQCL 3WN5A 5KBLA 3D18A 4D8PA 3M46A 4LRNH 1TFPA 3LKOB 4LASH 1EDYA 4YLQT 3UGEA 4CVXB 4ANUA 3NIGF 3LKPA 3QEGH 4OZIE 2B9AA 4LLQB 5TD4A 5DTFA 3NAAL 1BJ1H 2WW8A 1XZWA 4Y1AA 1TFHA 5JXEC 4X6CB 2Q7YB 1OW0A 3MDJA 1A0QH 2OXHA 2V2TA 4ZTEA 1G0YR 2QGEA 5D1ZB 2BINA 3EYFB 2A6JA 2EKSA 3I74A 1QFOA 1X5ZA 4RMSA 1OD7A 3SE4A 1J8RA 1OEZW 1CD1B 1F4YL 4RFOH 3T04D 3VFMB 4RDBA 4IBWA 2RIKA 3I9AA 1XV8A 3O6FB 2XWBA 5KAQF 1VZHA 3LN4B 2V2XB 4JR9H 2OQJB 4GAAA 4ALAC 2HAZA 1UA3A 1AACA 4XOAA 2W60B 5KS9A 1BZ7A 2GFBB 2R83A 3X14A 1MI5B 3M17B 3I9IA 1UOWA 4BEIA 2J5WA 1T2QL 5DFWH 2A9DA 3X3FL 2J4WL 4W9KC 5ELIA 4LCCC 3POCA 2ZWZA 2IAND 3A4FA 1X9LA 4ES8A 1DVFB 3V6FA 4CKVX 1P9MA 1FCGA 3RL1A 5L6YL 2J3SA 4ZMVA 1AO7B 5JW4R 5MEQA 3F62A 3ZSTA 1CXFA 3F83A 4PREB 1BYNA 4L8DA 3BO8A 4BUGA 1AJ7L 4JFHD 3P3SA 5J13B 1SLXA 5K59E 1XEUA 3DYOA 3L4WA 1KCRL 2YGQA 4G6KH 3SPJA 3L08A 5F3HB 2DQUL 4BK8A 1W15A 1E5YA 2Y25A 5IUSA 4IOSD 3WD5H 1KTDA 1FFPB 3KYKH 2J2ZB 3K3QA 3QQDA 3QQ4A 4JPSA 2ZPKL 2I26N 4HGKC 1RJLA 5CIPH 2OP4L 3RLSA 4JY6A 1CFNA 1LO3L 1U8KA 4RBPH 2G4EA 2H5UA 3QJTB 5MENB 5EFIB 1ZV2A 1SJVA 1U95A 2YPLB 3QJFA 1FAIH 1AVAA 1EUUA 5B38B 3LN5B 2WUBL 3NCEB 1BJ1J 3B2UC 5HHOA 4F9PC 1QZNA 1WFJA 4KJQD 4OD3L 2NXZB 1UWGH 5FGCE 1Y6MR 5AW5B 5CUSH 4MMYB 1CG9A 2GY5A 4U0RB 1AR1D 3M8OH 5DU7A 3QNXB 1UWXH 2B59B 3TBSA 2I9LB 4UDUA 2YBRB 4XNMB 4FABH 4JGUA 1GGIH 2X42A 3T71A 1EEQA 1Z5HA 3AT8A 4PCSA 5FUCC 1FIGH 3SDXE 1ITCA 1O7DE 2YBGA 4YDJB 4YO0B 4XVUC 3AG2B 1F3DH 2GBTA 1GGYA 2HFGL 1FZKA 1NINA 3I02B 4ZFGH 3I85A 3OKOA 4NAMA 4ZSOA 2DYPA 5HDRA 3LV3B 5GPRA 2BRRH 1O5DT 4PGJA 2UX6A 3C08L 3ESPA 4A7GF 2VYRE 3VRJA 1N26A 1WBZA 2VIRB 2JLPA 3NH7L 3ZTJH 4PH8A 4XMKL 3P9WB 4QXWA 2BP8B 2AEOA 4P57A 5FCSH 4YS4A 4PJCF 2P24A 4R4FH 1UEYA 3AU1B 1ZTXE 3REWB 3MNVB 1FNHA 2IQ9L 1U9KA 4GW1B 3VXUD 4OF7A 4PJ7E 3TJEH 4ZW8A 5JXAL 3NSXA 3BPNB 2GTWB 3UFIA 1CGYA 1T5WB 1XGQA 5EOQH 4Q89A 3SJVE 1QRNE 3EBHA 1BXUA 3EBIA 4AW7A 3D0LA 4PJIA 5ICZA 4AH2B 3SHSA 4GI9A 4YSOA 3LB6D 3WNJA 3NRFA 4NJAH 2CH8A 4JM2D 4BSWB 1JXDA 2E9WA 2RCSH 4HKJB 1WCQA 3K4DA 4J3OH 1FV1A 3MREA 4LOEA 4YUEH 1F4XL 3SGEI 5T1DH 3C2SA 5E5MA 4RFNB 5KEZA 4RAUB 3BYYA 1OVZA 4XI5C 2PW2A 4M5SA 1NCJA 4M62H 3ZKMC 4OI9A 1DANU 2OM5A 1I8LA 4IDLA 4MNHA 3EOAB 3QNYA 5DJ8B 4AL8H 2APXA 3P2BA 3FQ2A 2A6DB 3P4NA 3OMIB 4JBSA 4JO3L 4E9VA 3U7YL 1HILB 5GS1C 3KBFA 2ZIDA 5LN4A 3CFBA 5G55A 1M7UA 2Q0ZX 3H1ZA 3VXME 4CRPA 3ULVL 2X4TB 4WGVB 1IGJA 4IRSC 5EOTB 3VXNB 3EJYD 4LSUH 4EOWH 4UUJB 3CFEA 3L7EB 2JKNA 3E6FB 3WO4C 3U9UA 4ZUSA 3LZQA 3PAZA 4FL4B 2DQDL 5MEPB 4B5EA 4GG6E 4PCTA 2NW2B 3EGSA 1RZFL 1UJTA 2H2SC 2W1NA 4OZFA 2OI9B 3MYJA 1OP4A 3BW9B 3EFOA 3RA7H 4HCFA 5C9KA 1BEYL 3ARFC 3G5ZA 5HHVH 2BC4B 2VDPL 3V4VA 1NIAA 3FZUC 4D3CH 2OJZL 4G8GE 2VISA 1IE5A 3R8BB 4O2EA 4YFLF 5FDWA 2VXTH 2PW1B 3PF2A 5CCJA 3OV6A 5HDLA 3AGVA 4X80L 1AP2A 3H7BA 2IH3B 4GKNB 3P73B 1TZHA 2XNAA 2ZX8A 1QA9B 5DJYB 5DUJA 3U30B 2Z3FA 4JX0A 2W81C 3O2VH 1NM9A 5DQDH 5LWYH 2BVQB 3BD4A 1EBAA 4OFPA 3QUXA 4FFYH 5BJTB 2F54B 1JPSH 5EO9A 3O6ML 3T1WA 1W0VA 5DMIL 4QHNA 2J6EL 4G8EB 2MCPL 5KSUB 1GOHA 3PUUA 4PP1D 1ADQL 3WY2A 5GSVA 4UIKL 2V9UA 1EEYA 4JRYA 3GJFK 4YXLH 4HW6A 3FB8A 4B50A 4IHBA 5KSBA 2R27A 1X44A 3BCDA 1K4CA 3UTZB 4UIMB 4XB3A 2QDVA 5JW5B 1NFIA 1DQQA 4N0UB 1RK1B 3FO1B 4IKLA 1SEBB 3BKML 3CH1A 4MS8C 3V0WH 4GXFA 4R0LC 3WTVA 3B7YA 2ZOLA 3TEXA 4Z7WA 2JCCA 5I1AA 1J9TA 5ETUA 4OZGA 2BMKB 1AGFA 1MUJA 1UKSA 2D03L 2R29L 1JCKA 1WPCA 4NI6A 2G5UA 3FONB 1F56A 1CD8A 3DPBA 2CRMA 3L3HA 4PYGA 1J0ZA 2NY3C 3UGXA 1N8ZB 3D9AH 1PY0A 3PPEA 3CQPA 4XWGL 4APXB 4U0QB 5E6ID 1E8XA 4JHUA 4WHDA 3T0AA 1K2DB 2QLVB 5EU7C 3D51A 5D8JL 3EGDA 5EU3B 2Y1AA 3L45A 1WHOA 4UI2A 2NCMA 4C4BA 4RAHA 1JZ7A 4WFHD 5DJCB 3QDME 3L3OB 4NN5B 4P23C 5IWLC 2H47C 1EXUA 1CFVL 2CQVA 3NJLA 3KMDA 5HVHB 1A1NA 2YUZA 1YNTA 1UD5A 5LAXA 5FKAA 4TPRL 1HXMB 4ACPA 2MHAB 3DYMA 1YN6A 3ZL1A 3RPKA 1HIML 1FQ9C 4JPWL 4DCQB 1F6AA 4GXUM 3U25A 1NUGA 1YEEH 3ZYIA 4DN4L 5H2BB 1KF9B 1N5YL 4G7YH 2B8OT 3ULUL 1HC1A 1Z9SA 5EZIH 5D71L 2YSSA 3U7AA 1S3KH 1YEJH 5LGJB 3DVFA 2P49B 2L7QA 3GXUB 4NQDD 3U1QA 5DJAA 3WS3A 3IMRA 3D3VB 9CGTA 3FHQA 4GH7B 1WT5C 3D1MC 1CGTA 3QXDB 2QHLA 3KW8A 3MUUA 4Z0BL 4QTFA 3K6OA 3GMOB 4ZOAA 5KS9F 4ZO6A 3ULVC 4QD2E 3QWRD 1UH3A 3WHE1 1KBKA 1ZY9A 4HX1A 5LBSH 4ENEC 2QMKA 2OMVA 1Q9OB 4JCWA 3IDYB 5D7LD 5D7JD 2VR4A 2EDJA 3RVUC 1SUJA 4P2RD 2WNKA 3CXFA 5AVWB 5GGRB 3ESOA 2OTUA 3T4YA 1FPTL 1C5BH 4BFRA 4ODWA 3FL7A 4WJ5A 4PW4A 4O02A 2P5WB 4HWEL 2PYFB 3B7TA 4R5TA 3C5XA 3DI3B 3EJZC 4LVOB 3GZOA 3WO3B 2YEZA 1P4IL 1CVRA 1ZJBA 4BD4A 3AUWB 1CFQA 4X99B 4Y2DA 1VA9A 1IM9B 3OPUA 4JPKH 2FBOJ 5T1MA 2AQ2A 1RLBA 4M4PA 2FBJL 4ONHB 3HIZA 4R3SB 4L8SA 3BN9D 4P5RA 5ECGA 1NUNB 3TJHD 4DP6X 4K5NA 4XN1A 1WWWX 2MQCA 1EX0A 3KNBA 4L4VD 4V1DD 2D4FA 4LPXA 1QLEL 8PAZA 1ZLWK 3GJFA 1OPOA 3G6JA 3TBBA 4RMVA 2G60H 4U31A 3AABA 3E1ZA 2FJFB 1SY6A 5F1SA 3ZE1E 1L9MA 4QRBA 2BOCA 1KJ3H 1EH9A 4XNUL 2A2QT 2ENQA 3WS6C 5DZNA 1SMOA 1FHGA 3GB7B 4NNPH 3VFWA 2G5RA 2Q86A 2J1KA 1K8DA 1UENA 3FTZA 3PGDB 5A6MA 3KWWB 1C7TA 2E47A 3JV0A 1AD0A 2WO4A 4DGYL 4YFDB 4YX2L 4JDEB 3DV6B 1LM8V 3TVMA 4CVZB 5I8CA 1LQSR 4CN6A 1AE6H 1IO4C 1JMZA 2P5EE 3OKKB 5D7SL 3OL2A 1R5VA 3SEPA 3MLUL 3OPZH 4F1SA 4WO4D 5EBWB 4RGND 1PZSA 4JHAL 5FA3B 2BJMH 3IU4H 3VX1A 3CHPA 3RUGA 1KJ2A 4ERSL 3GSOB 4WW1A 1UOKA 1XZ0B 4M7ZC 4ELDA 1PYWB 3VFRA 1ZV5A 3OZKA 4JFFB 5C0AD 3V0VA 4LSSH 4PJIF 4JFOA 2VN6A 4Q6KA 3FN3A 3KHOA 1IAMA 1VFUA 1FNSH 4KNUA 2AP2A 1JZ6A 1MJ8L 3MKGA 2X9XA 2TSAA 3T0EE 3MOQA 3TO2B 3RWCA 1PG7L 1PY9A 1KXVA 3QEHB 3W0WA 1ZPLA 4AZ8A 1CFSA 4XAWL 4NKMA 4F7KA 2ADFH 2BOBA 3MNWA 1G7MA 1SEQH 3PWVA 1HHKA 3FTYA 1KIPA 4P9HC 4FZ8L 4PJHA 2DS4A 4HHAB 1QO3A 1GJIA 2WIMA 4L1TA 3GMRA 1CD0A 4XWOD 3WNKA 4UTAL 1E27A 2CKBB 4QTHB 1A25A 1WA1X 2A83A 4M1GH 2EACA 3MJ8A 4JHZA 1KELL 2C9QA 2YAOA 1RIHH 3NABH 4H88H 4L23A 2VRAA 4XZ4A 4MNQA 5EU6A 5K39B 3NFNB 1BD2B 1A7OH 3QXWA 5E99H 4QRRE 2WXLA 2B4CL 3GMLA 4X5LA 2OZ4H 5DS2A 4PRNB 3X1BA 1F58H 3WKPA 2WBJA 1A8ZA 2EVFA 1DQLH 1FN4A 3LY6A 3SE6A 2EIMB 1A21A 3GMQA 4E0RA 3A67H 4ZO9A 1A6ZA 4FNUA 2UYLA 2R7EA 3VFSB 3FBKA 5F9JB 3U0TB 4N20A 5DUMH 1ESOA 4I5BB 4BCZA 3VYOA 2R2HB 2D2CC 5BCAA 2P46B 3MRIA 4NWTL 3FB6A 1I9IL 5EZLB 4PCKA 4L3EA 3HI6H 3KPRA 5FW6A 4TUJA 3L1FA 4QY8B 5BXFA 3QW9A 3SKJL 2GEQA 3KW7A 5G4OA 3L6FA 4LLDB 5IROC 1MLCB 1AXTH 2ITDB 4IU3B 1AMXA 5BS0A 4NCDA 1EJOL 3ARVA 2YA2A 4KKPA 4MA1C 1M2VB 4WUKL 4Y4FD 3KXFE 4NENB 5BNXD 4OZHB 4NS0A 4KX8A 2J20A 3QCUL 2O6DA 3PP4H 4GP8B 4TLSA 1DE4A 5KVDL 3ILPA 3FFCB 5DMGC 5E03A 3TCXA 4Z5RA 5DS1A 5F0MB 4N8UA 5AZEL 5FYLD 4ZNEE 3R7RA 1JWUB 3FO2A 4PLKC 2W38A 4WEUD 5KN5A 1GGBH 2B1AH 2ICEB 1P7QD 4NI3A 3PWNA 2D0GA 1J48A 4WUUE 1DJWA 1H3PL 3CXDH 3MCKA 4ZUUB 2Y9RT 2KMWA 1UVQB 3ARGB 4M8VA 4QIRA 4M93B 3Q5YA 1URZA 4G70B 1S2EA 3UIZA 3B9EA 1TXKA 5KSBF 2CALA 3X3GH 2N1TE 4QGTA 2ISDA 1D7CA 1IGMH 3OKNA 1BM3L 4MJ5A 1I9JL 4WFGD 3TGXA 4HC1H 4G3YH 2YHGA 2A9NH 2NR6C 4ZZKA 2VJ8A 3V7MA 2L3BA 3LDBB 1TZIA 3DVNA 3HN5A 3S34H 1NGWA 2CDFA 2EE3A 3ZHLA 5DJDB 3WI9A 2PXYA 5IFHL 4GIOA 5GZOA 1DR9A 3MRDB 3TIEB 4Z7WF 2JCCF 1OCCB 5ID0A 2EEFA 4OZGF 1D5IH 2CUMA 1LO2H 1S78C 2GSIA 3CDZA 4PJ8A 1QAWA 3HBQA 1T6WA 4ISVA 5C8JB 2V3DA 1IJ9A 3KDMB 1NDMA 1LILA 3DBXA 4JQIL 4L3FA 5KYUA 5HHNA 5C7ZA 1OM3L 4KRPC 1M71B 2J7LA 4OT1L 1AKPA 5D93B 4P3DB 5BOJA 1JVLA 5F3FA 3TN0B 4HK0B 2AJUL 4GFXA 3VWKD 3BIKA 3FCTB 3BEWB 3V52H 2OMXB 4X4XB 4ANWA 2NMSA 2IG2L 4Y19D 3UZEC 1D5BB 1LEKB 2GK0B 3LIZL 2VAAA 3QFJB 5FK9B 1UQSA 1D7BA 2DQGH 2IXQA 3VFOB 1FGNL 3L9RB 2MTPA 3ZRFC 2H32H 3HMXL 1LD9B 4NO2B 1U91A 2NY1D 3IXAB 1A14H 1M56B 1C8PA 1BM7A 4NKDA 5EORH 4DO4A 3IFPA 1INEH 2VDRL 5FYKL 1AHMA 4OFQA 2IBGA 3DX9A 2HVJA 3U82B 1WO2A 4R4BB 2VDQH 2F61A 3VCLA 1E90A 4OD1H 3B37A 5D2LA 3O8XB 3APDA 5KSAC 2JJVA 4H1LH 2W9DH 4AM0A 1U6AL 4FFVC 1RLWA 4XBEL 1QASA 4YHZH 4N2DA 3CZUB 4PU2A 5EOCH 3O4LA 4JFYB 1DO5A 3NCMA 2B4CC 4WI7A 4HAGA 4ZK8A 3F7RA 1LNUA 3NCBB 4PHXA 3AM8A 1R3JA 4M02A 4JFDA 1FH5H 4PJFE 2G30A 3QJZA 1A4BA 4PG9B 4UOW1 4YHPB 2GJZA 4AG4L 4I0PD 2ZUVA 5D2NA 2XFXA 4ORZC 5I6KA 2PO6A 5DRNB 3VD3A 4XO4A 2YRLA 3GSUB 4FTVE 1KGXA 3H3PH 3L4TA 5IFJB 4JG9A 2GTZA 5I9QB 5B1JA 3V9CA 4N0FB 2UWEE 2EVGA 1GYCA 3SODB 4ZOBA 4KKNA 4NXSA 4OCRH 5DGQA 3VSVA 3EDFA 4PJDF 3RWHB 1WZKA 2BNQE 1RULL 4C56D 2ZWLT 4GW4B 5E5LA 2WQAA 3LRMA 4L4TD 3W3BA 5A3ID 4DGVL 1II4E 3EAKA 3CPUA 4XPTL 2WXJA 3QIUA 1VFMA 4RRPM 3VXOB 3EJJX 2G0KA 4HUUB 3OQRA 4O2CA 4XMPL 4BK5C 4BXVA 4UQIM 4XCNB 5EN2A 2X12A 3LPWA 4Q9CA 3SGKA 4A38A 4E9LA 1MAMH 2A9CA 3NK4A 4PBXA 3MLVL 1DFXA 1I8KA 2RD0A 2W92A 1CXHA 4DFHA 4GRWB 2Z0BA 4XGZB 2C1PB 5CGYD 1OALA 1QBLH 1LJMA 1ROCA 2WVSA 1HEJC 4A6YA 3BQUB 2RTTA 3ETBJ 5CJXC 3MSPA 1J8HB 5CP7B 1L9TA 3ARRA 2DD8L 2IWFA 5EUOE 1UXWA 4GSDL 2OTWB 1NMCB 5EEYA 5EOCJ 1IGIH 5IMKB 2JB6A 4EQ2A 4AXWA 3ML9A 4FNRA 4HETA 3HE7C 4P2OD 3AROA 4MVBC 1WZLA 2F5AL 3QSKB 5JPMC 4NRXA 3UPRA 1BX2A 3DDFA 1QNZL 4BWTA 1ZVHA 1RPKA 3ZHDA 5J6GA 4Z3TA 4OLEA 3NCYS 4LHJB 4ODHH 4G9FB 4B6ZA 5HXMA 3RUGF 1RMFH 3GI8H 3LQMA 3OX8A 3IGUA 1KBGL 4ZG1A 4S11A 4Y7OC 3VDBA 5BOZG 4DQOL 1HQ4B 3DV4B 5BO1L 4LARH 3SDYH 5HPMB 2AK1H 1OTTD 3UP1A 1I3GH 1FNGA 4TL5A 4WI0B 3G6DH 3QT2A 3TYGL 4YAQA 3TURA 1CYGA 1Q9LB 1GC1L 2FNBA 2NW3A 5FO9B 3NP4A 4KO6A 3CVHL 4R5XA 3SY0A 4KC3B 3KZ8A 1OE3A 1CDGA 2MPAH 4LCYB 3PWPE 5DZ9A 3GXIA 5EU5A 4X5QA 3WSQH 1A64A 2G75B 2UVFA 5E70A 4PJHF 1BQLH 4U1KA 3QEQB 5J1AA 5F7EH 1CL7H 5I8KH 3ARBD 3R0NA 2WNGA 3NZ8B 1MPAL 5AL0A 4CN1A 1P7BA 1CDUA 5JXEA 5L2KE 5JIMA 4FQIL 5JA9A 2DQJL 3NTCH 4PRHE 3C5SA 2DJMA 4FTDA 4JG0H 3UJJL 1JZ4A 2G4GA 2NSQA 3CD4A 3UDWC 1E28B 4XCFL 1A3RL 4Q74A 3FH7A 1PLGL 4FI7A 4F57H 1DL7H 3L54A 3QNZB 3AS3A 1G7JA 3AWFA 4HIXH 3VXSD 1TCRA 1F3JB 4JLRA 3TFKD 1R34A 3X12B 2LU7A 2XWCA 3BUBA 3H7LA 4HJJL 3VYNA 4Z7NF 5MP6H 3HPJA 3OAYH 4EIUA 2VRKA 1VB9A 3GSVA 5LBSA 2CUIA 1HINL 2NLJA 3B5GA 4LCCA 5HD8C 3CVCA 5IEKB 1E9QA 3BP7A 1JTPA 4NQXB 1D6EA 2JTDA 3QR0A 4Z78A 5KYWA 3PQYA 3TLRA 3FRUA 3II3A 2YD2A 3TBTA 3IAQA 4QRQA 2QLYA 1AXSB 1BQHA 2YXFA 3KJ6H 4Y1AB 3F04A 1WWAX 3G04B 4EN3B 3VSQA 2X7LA 5IR1B 2OXHB 2X70A 2V2TB 1ORQB 2WC7A 1J0JA 4FA7B 2OMYB 3BVDB 1KJVB 4PJ5E 5F8RC 2VXSH 4CC1A 2XWJA 5D7KE 2IH1B 3AMLA 4NKQB 5SWZA 3QIBC 3R8QA 1K5NA 1XGZA 1R0AL 2G0LA 2CCLA 1CCZA 4HOMA 4WEMB 4OCYL 3A22A 1JZ2A 3F12B 2GJ6B 1E7VA 1XB8A 3CN4A 1EZVX 2KQMA 3S5LG 1TSHA 2OL3L 3QJHB 3SQBA 2Y7QB 4WFED 3QEUB 3LPOA 5JQIB 1IM3B 5H94A 5L0QB 3BGFB 5DJXA 1OAXH 4FABL 1EDQA 2Y06H 1NOAA 4I3SL 2QJDA 3D48R 1T5XA 4AJYV 2UY7A 5TDPA 4HA1A 3T8MA 3Q0HA 1IT9L 2H3XC 2WLMA 5ACMA 4AQ8C 4O58H 4YL9A 1YNLH 4AYFA 5ABDE 3TESA 1OLLA 1MHHA 2WO3B 4H8QA 2ZXGA 5E8NA 4K8RC 5T5NG 1J88A 1WCBB 3IMSA 4AIZB 4IRJB 3ILQC 1INDH 3NSFA 2AKRB 1VZIA 1ZV9A 4HG4K 4TV3A 3HMWH 4RLDA 3QQDB 2NPLX 2YGPA 2VABB 6PAZA 5B7EA 1CL7I 1U8LA 2VR7A 4PRPB 4JFXA 4WU5B 4YGVA 3U36B 4U49A 2C9UA 4H7VA 5D5MF 4XP1H 1IAIH 3QJFB 4UF7C 3VFTB 5EOQL 5EF3A 1KCLA 2DWYA 3VXRB 1SUHA 2ED6A 1AZZC 1G7QA 1ETZA 3ECVA 4NUJA 2EEAA 1WLHA 2ZOWA 3ABZA 3O2WL 5D1XD 1XMEB 4JVPA 3R4DA 3HG4A 3R1GL 1IMHC 4A39A 4YUEL 1SHXA 1RSYA 2K8QA 3T8VA 4YDVA 5IB2B 4J3OF 4KQ3L 4X5XA 2JMRA 4M62L 1YHPA 4K3DL 4OF3A 4PVMA 2Q8AL 3S3JA 1JPFA 3L4ZA 2ZUQB 3NACL 1SLWA 3BD5A 2IOIA 3PGFH 3QHZH 2GYSA 5BMFL 4OLXL 3IKCB 3KJ4B 5E1GA 1JPTH 2D7MA 1EMTL 2VXQH 4LVNB 5D2LF 2VDNL 1CGVA 1RPQA 3BPOB 5CLZA 3CMGA 5EU4B 4F37F 5GS1A 4YPGB 4E41B 1LEGB 2J44A 4GQQA 1A47A 4J3XA 5C3LD 2FL5A 3JWOL 4KGLA 1MFVA 4FXTA 4AYID 1TO4A 3QDGE 4UM9D 4JPVL 4G8FB 3FU7A 1AFVH 1MKFA 3IMVA 2DH3A 3T65B 5E9DB 2YZ8A 1MQKH 4X6DA 3M7FB 1KLGB 5KANG 3UTTE 3GSXB 4KVCL 5SV4A 8FABA 1W0WB 3BMVA 3FQXA 3V4PH 4Q4IA 2Y3AA 4D3CL 3ZGHA 4BZ2L 4QRSB 3ARFA 1OE1A 1U92A 3EJPA 3EH3B 5I18H 2Q8BL 4XZUB 1HT6A 4L48A 4MNHB 3BP5B 1ED3A 3KBPA 1JMXA 4W9JC 2XZZA 4QWWD 1Y1UA 2NQDA 5EZOL 4HS3B 3HS9A 1B4TA 1G7LA 1YUHA 4MCYA 1G5AA 1UXSA 3F58H 4U1MA 1LO0L 2ATKB 5IQMA 5C0CB 2SEBB 3UBXG 2EDWA 2K1MA 1E4XL 1KNOA 2BX5A 4QRPB 1LXMA 2XQ0A 5K9OA 1A4KA 5CWSB 3DX8B 3BLPX 1ITBB 2UUDK 3POHA 1XIWC 1V7ML 1J1XL 4ODVH 1QFWM 5FA4A 3K5SA 3GSRA 1JV5A 3MV7B 2F6AA 4JS7A 1F6LL 1TT6A 1A66A 3O4OC 4PRBA 2ZICA 12E8L 1G5GA 1YYLH 4N8VA 4HLZG 4RZCB 3NCYP 1YAIA 2APFA 1XGRA 4UV4L 1OCWH 4TN9A 5FDWB 4YHIB 4GBXB 4HC1A 4PJ9B 1ERNA 1UWYA 3GNML 2DM7A 3US9A 1MHCB 1AP2B 4R0LA 1MWAL 4KI1A 1GA2A 1HVXA 3FQUB 4MD5B 3RVVC 1GSKA 4YHKL 3HG1B 1IBDA 2Z8SA 3MBWA 5DFTA 1RH8A 4HJIA 1DSYA 5ANMA 3UJTL 3UTSE 5LQBH 1X7QB 3AJ7A 5C86A 1LQBC 3QUXB 2F9BT 3GRGA 2D3VA 4JUSA 3C5ZC 4FZEH 1S9XB 1E5ZA 3OG6B 2VW4A 1TQUA 1FVCA 2VLKB 3AXIA 1AI1H 3CCHA 4FNTA 1GYUA 1VSCA 3FOLB 5CLTA 5AKTA 1G7HA 4RGOL 2A3TA 4BFFA 2RB8A 4NPYB 5IWLA 2VNCA 4P23A 2WXGA 3S5LB 2FATL 3S4SG 3UOAB 4ELME 2H32A 2BDNL 3CH1B 1O7SA 3EOTL 4ATTA 4KAQL 1DVTA 2X9ZA 1BGXL 5DWPA 3KLAA 4Z7OE 1EIBA 4E5XG 1QHOA 1Q0EA 3OB0H 5ETUB 3CFCL 5CGBA 4AE1A 1DDTA 2HN7A 1U58B 3MA9H 4UQ3A 2ARJA 3ARQA 2HP4A 3VYPA 2WWMD 3IAGC 5E2UL 3PL6B 2C1OA 3DXAB 2WXPA 1WA2X 2CNZA 2XBDA 3PHSA 2GC4C 5E2TH 4NQCD 1RUKL 1NCWH 4AEHH 5CLYA 1JFQL 3VG0L 4PS7A 2GB2A 4PB9L 2APSA 3FT9A 2OX5A 3CK0L 4ZDHB 5C08D 3BISA 1WT5A 1CS6A 5GISL 3CPLA 5KVFE 4LPVA 1DFBH 2J8UA 2HT4C 3WDJA 1MXDA 2H26B 1BQUA 1BYOA 3UBFA 3S36H 5IB3B 4B7IA 2KYIA 2DIJA 3VGEA 3I50H 3LKRA 3JWOC 1OQOA 4YSRA 2GI0A 4NKOB 1YNTB 3PHOA 1NZRA 1I1AC 1GS6X 1QSEB 4KROB 3CE1A 3ZKQD 1YECL 2OSLA 3CWGA 5DD1L 2K70A 3MCYA 4QR7A 1NANI 2CIIB 1F6AB 5LCVL 2OV0A 5DEZA 1DVYA 2VDRB 3NP3A 3RZWA 1YLBB 4QHMA 4JO2L 3FH5A 4GIAA 1KXTA 5IVZA 3U9WA 4B9JA 4OQTL 4MXWL 1IAKA 3WKQA 5KUMA 3ROLB 5E8OA 3Q2NA 1OB1A 1KB5B 2NDFA 3L5IA 5CBEA 3NT0A 3P2DA 1A1OA 2R1YB 3MA7A 3MUZ1 1RUQL 4GPVA 5IMOA 3RWFB 4J3SA 5ERWA 5IK3B 3VD9A 2HFEA 1T1WA 4EBQL 3ME0A 5FYJD 4OLUH 3OHXC 2FLRT 1VHPA 3H85A 3UH8A 4WSGA 2R9HC 4D7PA 5B8CB 4H0HB 1TQWA 1OAKH 2WK2A 2ZP9A 3EHBB 4HUMB 1RK0B 3BH8A 3HFFA 5I1EL 4RA3A 1OY3B 1NAMH 1OWRM 5IHHA 1IBBA 3QWOB 2YLKA 4MD4B 4HU2A 4A2LA 4TQ8A 3Q8FA 1ZS2A 1LE9A 3KPQB 3WLWD 5FUZH 1W72L 4NNPL 2X0UA 4XXWC 3OJ2C 3VXUE 3CFUA 5C0RH 1OSEA 1ADQA 4WWKB 3WLBB 3WS6A 1DBJL 2FX8L 3INUL 3KHQA 4HV8A 4N2OA 4UV7H 3HCVA 4PB0L 1DUZA 2JXMA 5D1QD 1NDTA 1IBGH 3ZTJG 1XCTA 1KT2A 5ACZA 4IGBD 2QDWA 3VFGH 4IIQC 4TSCL 5C0JB 3SGJC 1QMUA 5J6HA 3OPZL 1PW3A 3BGMB 4JFSA 4DT2A 2D7TH 1CFQB 1RZQA 1IE4A 3IFOA 1A7PH 1WRFA 2ESVB 4KV5E 1DEEA 1ZHLB 1J5CA 4JDVB 2CMRL 5HI4C 3WNMA 1HL5A 1JFHA 1ES0B 3KVPA 1JHKL 4QXUH 4R26H 2VH5H 3D2UA 4DKEH 5CF3A 4WHTA 1C08A 4WTZG 2OMTA 2F08A 3H3KA 3H4FA 4F2MB 4BH7A 1PSKL 4LSSL 2EIZA 3UBXB 4EDWH 1UG9A 3G6JB 3FYIB 4BSJA 1ZGLB 4JHWL 4KDWA 4EZJA 2OR8A 4TUUA 2WB1A 3OG4B 1E4HA 3ZT5A 1FZJB 3S36X 2HT3D 2VZ1A 3MODL 2AV7B 4AWJC 1VIWA 2BHFA 1MLBB 3L1OH 3NVQA 5IF0A 1AD0B 4YBLC 3WU1A 4Y4HD 4Q14A 3VXMA 2ZUUA 1HCVA 3TBWB 1DJHA 3DMMC 2WLLB 5CHNB 4ELKB 5CJQL 3D39E 2W91A 2BIQA 4NZDA 1OT1A 3KD4A 1F4WL 5HYJD 2V5MA 4Y5VB 3QDJB 2Z4TA 4PD4K 1INQA 1A7OL 1S7VB 3P4MA 5B1CA 1U8HB 2OZ4L 3HUJB 4NCC2 1ND0A 3B9DA 4WW2B 4YOKA 2XVLA 2VGLM 3X1EA 2CUAA 4JW3A 5CFHA 3P30H 4F91B 5T8IA 5GRZA 2C3WA 3GWJA 4X7FC 2N01B 2YUWA 3KL0A 3WE1A 1F1GA 4AOFA 2RQ8A 3VFRB 4TNGA 3UJIL 4CMHC 4HU8A 3NSYA 5KYYA 3RRQA 3MRLA 1R33A 5DK0B 4ZS7H 2P52A 2VDKH 1BREA 2X4PB 3N85H 3GSWB 5E51A 2WXMA 3TZVB 2ZOOA 5GSRA 4AZ8B 4X6DF 1Q1JH 5ISZB 5FLUA 4FA8A 4ZOCA 4Z7QB 4AX3A 3C6LB 2UXFA 2IDFA 3ES6B 3CVHB 4HPYL 1TEGA 1KCWA 1QO3B 1DSFL 4JFTA 3BQVA 3ZE2F 2V0AA 4IBYA 4O9HL 5IROA 1VFBB 3SYOA 3T3ME 1MFUA 3GFUA 4FQJL 1MN4A 4B7LA 5JW4Q 3CFQA 1BXAA 4KRMB 1I1FA 4WQOA 4LSQH 1S7QB 3Q05A 2VJXA 1PL3A 4LQ1A 3VA2C 3QQNA 4E5XB 4N6QA 3GJEB 3QPQC 4U1IA 5E4OA 3QH3B 4LKXB 1FZMA 1FZOB 1ODUA 1XQ4A 1MCHA 3GD1C 3FYEB 2WQ8A 2O4EA 2IPKA 2YN3A 1CTMA 1HESA 2TRHA 1I9RH 2YEQA 3K6NA 5PCYA 4MB1A 5G2NA 2AGJL 4N9GA 4W9CC 1T66D 3MLXH 3WNNA 1IBZA 4HWBL 4LSPL 2BS9A 5TE7H 4HKBA 1L9PA 3JV4A 4PJEE 2IWKA 5JZ7D 1IGML 4HJ0D 3SDCD 3UTQB 3MRIB 3FB6B 1ZLSL 1JF5A 3WXVL 3TONA 2R0WL 4TVPE 5BS0B 3IT8D 3RTQD 4JO1H 1A9EA 1KIRB 3DGGB 4XX5A 4G6JL 4NC1E 1EAQA 4P2CG 3F64A 3KPSB 2LFEA 2ITFA 3ZDZB 5FCUH 3VI4A 1NC2A 3E7JA 3L1EA 4K71C 1KZQA 3QCVL 3CFNA 1DN0B 5I1IH 1MJUH 1V5JA 2XQYG 4GS7C 5CIPB 3LZPA 2OW6A 1Y7VA 3WUWA 4NQEB 4X42A 3L4VA 2Z91A 2NY2B 3MV9E 4L4JA 3FF7A 4XP9H 5HI3D 2BNUB 3WEMA 2QADB 3D2TA 4B9YA 4FF9A 4G6AD 1I75A 3UZEA 1BBJA 2OL3B 5C07B 2DQGL 3VVWA 4O2FA 3T6WA 2LTQC 1J05A 3FPYA 1BLNA 1QATA 4W81A 3OKNB 4Z1PA 1OAZH 4MJ5B 3CU1A 3QI9D 1A1MA 1TZIB 1X9UA 3DVNB 1BW8A 3MLWH 2P8MA 2HH0H 4L3AA 5E4EC 4JO8A 2DKMA 3LEVH 4PYHA 3HBPA 4XN4A 2E7DA 3DSFL 4KKZA 2YWZA 3OZ9L 3KVQA 5FAAA 2WXOA 5FV2A 3WFEL 4CBPA 5BVPH 1NIEA 3QXAA 4AE0A 1S5HB 5LDSA 2GSIB 1E5CA 3CZFB 3MLYL 1QSFA 3F7QA 3STLA 3UTPD 4APQD 1JN6B 1KC5H 3LS4H 5DYFA 3GIVB 1NDMB 5KYUB 5HHNB 4LCWB 2EIBA 4UTAA 5E2VL 4BZ1H 3K0WA 5KSAA 3HNTL 1FFQA 3TA3D 2XG5B 3N6YA 1N8OE 5E7BA 4O51B 4BRJA 4Y8AA 1N3NA 1PDKA 4P5TB 5HGDA 3MI6A 3SGDH 4KJQC 1JYNA 4IBLT 4I2XA 4Z7UE 5CEZD 3O11A 3ULVF 2J8UF 4JDZA 3MJ9L 1AR1C 2ZOKA 5EZJA 4XPHL 3PIQA 3ZUCA 4HULB 1H19A 2BCKA 1CIUA 4OIIH 2BK8A 3SBQA 3WMSA 5L88H 4QT5A 3H3PL 2K4WA 3B3IA 3IFPB 1G7IA 3OXRA 1OSZB 2XTJD 2A4EA 3IDMA 1OAUH 3NGBB 1NC4A 1KGYE 3MO1A 1OPGL 4GRLD 4X8XA 5AW1B 1DQJA 4Q6IB 5DLML 2HJKA 4OLVH 4D9RE 3P9MA 1TCMA 5C0GB 1E6OH 1JD9A 3F7YB 5C0BE 5AVSB 2EDHA 2WLIB 3VG9B 4KOBA 2R0LH 5M95B 3TV3H 3WFBH 2Y36H 1NIDA 4JPIA 4EXKA 4FQ2L 2PTTA 4IK6A 1IBYA 3AY4C 1WIOA 3PP3H 1QFUL 2R1WB 3CBRA 1ZEAL 3W1ZA 2HVKA 4BK5A 5B21A 3GPEA 2MKLC 2DPKA 1PZCA 1KTJA 3W81A 2P7TB 4YXHL 1LNUB 5D1ZD 1YDPB 3HNVH 1W6WA 1IC0A 1JXGA 2Q5BA 3LB6C 1A6TB 2R39A 1S7XB 3NFPB 4F92B 1WHPA 2F58H 2GJJA 4JM2C 1B2WH 3S5ZA 2BSEA 4AYDC 3V7AG 1WFUA 3O6FD 4KMTH 1ZTXL 2BNRD 3N2JA 1YQVH 1NEZG 4HIIA 4M9PA 3WNIA 3ZDYE 5CJXA 3EOBA 43CAA 5EBLA 1ZOXA 1KZYA 2FUQA 4H25A 1MF2L 3SE8H 1MI5D 2QHRH 5F21B 4Y2NA 1ZHKB 4F8NA 1MFNA 1ETB1 4KTDH 2CBQA 1ZVSA 4NP4H 4XP6L 1FF5A 3HB3B 3HE7A 3V9FA 1DVFD 3OKMA 5JPMA 1AO7D 1RY7B 4OAWA 4KK6D 4LRIA 4ODHL 1LE5A 1E9OA 1JZGA 4GAJH 3H9SA 5ESVB 3BWSA 5ADPL 3T0EA 3T6QC 3J2PA 4BFEA 4KUZH 5BUGA 1PNDA 3SO3C 4HEMA 5IB1A 2PYEE 5ILTL 1SBSL 1UB5A 3EJYC 1I8MA 3FF8A 3WIHH 2Z93B 4LARL 3EYSH 4N0UE 3D8MA 3EJSA 3TO4A 2LAGB 2DKSA 5GZND 1T1YB 2Q2EB 4JRXE 4PWGA 5T33L 1KV7A 3P0YH 4HUKB 3A6BL 3RQ3A 3GSNA 1I53A 3U2SB 4R97C 2UXTA 2YPLD 2TAAA 4QHLB 5D70L 3RGVB 5CCKH 1UXWB 1CO1A 1HHIA 2MPAL 3ASWA 1N2RB 1BFVH 3LIZA 6FABH 3VRIB 2O30A 2NXZD 5F7EL 1DP0A 5BRZE 3TH3T 1P4LA 3DGDA 1BV8A 4M7KH 2DF3A 3HMXA 4AV4A 3IKKA 1EEUA 4M5ZH 1MFDH 1BX2B 3CZGA 4ZS6D 4WWOA 3M86A 2Y22A 3UZVA 5J6GB 4ORGB 3QR1A 3L3GA 4GAGH 3VGAC 4NZTH 3D4YA 3C6SA 3D30A 3E9TA 3CX2A 4FYSA 5IM7B 4FNPA 1JZHA 4N2EA 1T03H 3NEXA 2YD3A 3UDWA 2N7BA 3V5KA 4IS6A 4HKXB 2FSDA 2OYMA 3QRGH 4K4KA 2DIEA 2HKFL 2XN9E 1WBYA 2H9GA 2B5IB 3IF1A 5LBVA 4DKAA 2AF2A 4PP1C 2YD4A 3KPTA 5AW4B 1S7WB 4P5KA 2WOYA 2QVTA 4RFEA 3CZKA 2I7OA 2NW3B 2PR4H 1XSJA 3BDXA 1BQRA 2Y7NA 4C47A 4F8TA 4RMWA 4JGMA 4U3SB 1EO8L 3QFDA 4QCIA 4OJFL 5FEBA 1AQHA 3NIFB 4TUKL 3C9NB 2VN3A 4J28A 3OJVC 1MDAA 4CGUB 4CSZA 4HS8L 2JB5L 5EPMB 4QDGA 5F71A 3DPDA 2AJ3A 5J3HD 1CDYA 1U41A 2VXSL 5L7XH 3L5WA 3FQRA 1JDAA 2BOLA 1AGCB 4AENA 1JHTB 1B0WA 2XOTA 4N0YL 4XNZB 1AG0A 3C5JA 1YO4A 1GL4B 1NBVL 3QIBA 5E6IC 4YHLL 4HXAL 2C3GA 1NCUA 4W6XB 5DQJB 1DVSA 2CK2A 4RMBA 4BFNA 1CLOL 3IVKB 3FN0H 5ALBH 5F7NC 1KBWA 1SJHA 3HR6A 3VAEA 1HXYA 4CADB 1X5AA 3U6RA 2NY5H 1KGJA 1LEIA 5C0IA 4WLCA 2NNCA 4K2UH 4ZYKB 2NLJB 1FYTE 2CE6A 4AVJA 2FT7A 1RUPH 2OS7A 3I6GA 1CK0H 1D6EB 5T1KB 3FT4B 4XN7A 1FNLA 3FRUB 2ZG1A 3PY9A 3ZE0B 4BFIB 1X5YA 3K6DA 4FQPA 3L3JB 4LHUG 5GGVH 4L29A 4AQ8A 4UZSA 1AIZA 4Y19E 3U7WL 2ZWNA 5HDBE 1V3LA 3NJMA 2H7WA 4Y5YC 4OI8A 1JGVL 2ZT9C 1CXKA 1X5JA 3K4ZA 4XMLL 5CILL 1NBZB 2EYSB 4PGDA 3VWJA 4Z7VB 1QWNA 4HS6A 4NM8H 1LK3H 4P5SA 5LVEA 3VI4F 1ZVNA 4WDIB 2JJTC 25C8H 2XVGA 2Q7NA 5KVGE 4LU5L 2NUPA 2IDTA 3REVA 3BYTA 3D85B 4R2GD 4U6YA 3W2DH 3U9PL 4G42B 4OF0A 2X1QA 4WRLA 4YHML 1KYAA 2YD0A 3CUPB 1FO0L 3S97C 6TAAA 4FG6D 3OSVA 2BP0A 1MFAL 2BFVH 4BGDA 2NDGA 5FO8A 3AS1A 5D7JC 4KU1A 2F54D 4R7DA 1BAFL 1I7RA 1UWFA 4PIRF 1QBAA 3ISYA 4OFIA 1W72B 2L7UA 3BSZH 4LAQL 4AYFB 2O6PA 1IKFH 2CSPA 4LPYA 1JWSA 1NEZB 4W9GC 4DOHE 1AQDA 3CSPA 4UOQA 1FL5A 5FYLL 3O45A 5KVFH 3B83A 5SX4H 1E4WH 3THMH 3ZYJA 1YEGL 1KB9J 4D9QD 1A6AA 3AXLB 4YR6B 2WWKT 3S4SA 3QUZB 1T0NB 1IGTB 4UQBA 3B5HA 4YDLB 4F7CB 4FXGC 1W8OA 3GKWL 4UT9L 5GRJH 4CNIA 5IT2L 2EDKA 2N59A 3BN9C 2QPFA 1U8QB 3ABKB 3CHSA 4MHHI 4ICWA 3TJHC 2BY1A 2MIZA 3CAFA 4LE8A 4OFYD 1B0GB 2HMID 4FYTA 1KEGL 2B39A 4PJBA 2Q76B 5ESQA 4MKMA 1KPUB 3LRSB 1G7QB 2GKIA 1CGUA 1AFVL 1M9SA 2AJXH 4I3GA 1MQKL 3CSTA 1IVLA 2FGWL 4I87A 4OQ1A 3KPMA 2VDMH 1PKQB 1BVLB 2YZ1A 4X9FA 2MNWA 2EDDA 4ABVA 5J7CC 2WNXA 5JMOC 1H3WM 2ROXA 4YPJA 1KPRB 1PD1A 2XJKA 1YY9D 1A5FH 3BAEH 4BQ9A 2R2EB 4JY5L 1KBPA 2YMXH 5CEXA 1A3LL 1OE2A 2ITCB 1C5CH 4NGHH 5T3ZE 1ACYH 2WSKA 3FFDB 4Y16B 4FQ1L 4Y4KB 2X5PA 4NZRL 2ED9A 4WO4C 2P28B 4RGNC 5J4MA 2KT6A 2ADJB 3KLKA 4ZJ9A 3FT3A 3U0WH 1G4MA 1HSAA 3DVGA 2XJLA 4ZFOB 2IDUA 4XVSH 1WFTA 3E2HB 3MLSH 5IGXH 1BWWA 4AEEA 1OANA 4S1RL 3E1F1 3KLLA 1GGCL 4ODVL 3NIGE 2WKLA 3NEOA 2XPGB 4BA0A 3BZEA 3VW3L 1HOCB 3FU7B 1L5GB 1XIWA 2NTSP 5DD3H 1HYRC 3SPCA 3LN9A 4JN1L 2EZ0D 3T0DA 1CBVL 1CBJA 3L7FA 4QUOA 1UYWH 2LFGA 3D3VD 43C9A 1KXQE 2RH0A 3ZE2B 3BAXA 2VLRE 3D4CA 3ZDWA 2DDQL 5CN2A 4YSAA 2I32A 3D50A 4XWOC 1UXLA 2QKIC 4ANKA 4ODBD 3I84A 1G7LB 1YUHB 4LLMA 1HI6A 4U1MB 1P1ZB 3RL2B 4Q4EA 4W6WB 1TJIL 1XBDA 5DHVH 2Z35A 3BP6A 4MA7H 1CF8H 3C5ZA 5E1QA 2P5WD 4EZLA 2ZXWB 5DJ0A 3Q3GB 4JNXA 3EYOB 2HG0A 5E95B 4LCIH 2J88L 1IM9D 2CJSA 1KIQA 1PD6A 2EE2A 2HLAB 3ET9F 3KGUA 1CUOA 1WEJH 2WCSA 5C6TH 5I1HL 3K8MA 1BOGA 1QPKA 1Q9KB 2FSEB 4Z9KB 3V8OA 4S1DD 4CVUA 5IV2A 1BVKB 3VGFA 1HL8A 4PRIE 4CVWA 3BH9A 2V2WB 5B3SB 1OSPL 4JHVA 4Y4FC 1TU2B 3ELAT 3ZX1A 5ANMB 1VADB 3PWUB 4FEMA 1OAYL 2ZAGA 5DDHB 4LHUB 3KYNA 3N1PC 3ATBA 1MZZA 4W4OC 3IPFA 1L9RA 5BUAA 1DTUA 2H0FA 2VXUH 5ALCH 5ES4B 5D6CA 2CBOA 3W11D 4BZ1A 4HQQL 3ZHFA 3I9GH 4KTGA 1FORL 3WDIA 4DGIL 3LYRA 3ZW3A 3AREA 4OZIB 1QVOA 5B39B 3CSYA 2HJFA 3GRWL 5E00B 5TFSL 1JXFA 4XPAH 1SMDA 3K6FA 4DEPB 4X9YA 3CMOH 1LWJA 2CDGB 2VMJA 3LS5H 5F7YC 1J1PH 4F93B 2PPEA 4HFUH 3TM6A 3B2UD 3FUFA 3ZN6A 2H32B 3ARDB 4PJCE 3FOMB 4PIBA 2NTFB 4JFFD 1I1AA 4TNWK 1RZJH 1IBHA 1K8IB 5C0EB 5DEFA 2MOGA 3H3BC 1RL1A 2VSKB 2WAQA 3E8UH 4PS4L 4LGPB 2ERJB 3IS0X 2XICA 5BVJA 2DAVA 5E1AA 4EI5A 2J71A 5K9JH 2DWDB 3DOSB 3N43B 5LXGL 2AXJA 4AVHA 1LGVA 3UPCA 2CRZA 4OTXL 2XKNB 3RNKB 1IEAA 1YMMA 3VGBA 1BF5A 4XC1L 2ZX7A 1CT8A 3PREA 2XETA 2BSDA 3D52A 4H1LB 4J3TA 1OP9A 3CFKA 2BWQA 4NNYB 3HI5H 1GS7A 1OARH 5GIRB 3VWKC 3ZLQC 5ITBL 5JR1H 1U8OB 3BUTA 3KL3A 3OHXA 4N4YB 1AY1H 1P7KB 3ATFA 4JY4B 4YIQB 2COQA 1QFWH 1BD2D 2WOBA 3MRPB 5DRXB 2WKOA 4FHBD 4XPGH 1QQDB 2PKDA 1FRGL 1CFTA 1S7UB 5I1JH 2GPZA 3N40P 1NFDA 4GRMB 3KWXA 2HX8A 5K9KB 4OLYH 4R9HA 5JHDA 1QWUA 4XXWA 4PMFA 3WFCH 3VVVA 4N68A 2NY1C 4XNQA 4NNXA 4PI2A 4F33A 1IBGL 1CE6A 3KPNA 4QEGA 4HBCH 4JKPH 1E43A 3RU8H 3T8XA 4Z8FL 4BWWA 4NQQA 4GG8A 4FJYA 5AYQA 3OTTA 4PBDA 3AU0A 5C0FA 4OJCA 5IVZB 3BZ4A 4IIQA 1U8PA 4L9LB 4DK5A 1UWEL 1CE1L 5FGCB 4JFEE 3NSJA 4KHTL 5AVRB 1A7PL 2JE8A 3ZKMD 1ZMYA 1DCEA 4OLWH 4QF1A 5E6SB 5H37H 2VL5B 5FHAL 1MWAA 2J5LB 3B7RL 4DKEL 1T1ZB 3JTSA 3WIIH 1T1WB 3HC4H 3GMMA 5D72H 2CR3A 1QYGL 1WBXB 3SDXB 2HWZH 2X28A 1XTLA 1RAMA 5EN3A 1M57B 3ABMB 4POZD 3M7OA 5HHXH 1GMIA 3B8YA 3FFCD 5MEOA 2EUZA 1G6RL 1AGEA 3MXVH 4MAUH 3MUGA 1VEMA 4H8WH 4LDCA 4LKCB 4HUXB 2PTVA 3MJ7B 4IRSD 3LHPH 3P11H 3MLTA 5KG9B 1NCAL 2GVYA 2R23B 2AEQH 2LV4A 4I0PC 2EEXA 1K72A 1Q8MA 5DHEA 4AW4A 3CC5B 4LP5A 3PHAA 1A2YB 3ARGD 3NPSB 1DVQA 1XCTB 1U2YA 3IDNA 4B27A 4PJ7B 4X98B 3OHMB 2A9MH 1JRHH 1M05B 3FT0A 4XMTA 1GHFL 1F90L 1M6UA 3JSSA 5BRQA 1NGQH 1QP1A 5FB8A 1QRNB 2YD8A 1ZANH 3I75A 5IJBC 5DRZB 3QG7H 4PJAA 5IQOA 2WXKA 4U4IA 3MV8A 4LB8A 2YRBA 4X6BA 4L2YA 5KJRL 3RX7A 3D69B 1XXDC 4OM1L 1HFUA 4F7TB 1RZKH 3GUFA 1NCOA 2E0PA 4EXPX 2OMTB 1RJYA 3WFHA 1UTDA 4MJIA 3T4AC 3IDXL 4BH7B 1RURL 2VOTA 3OB8A 5FHBH 3ILDA 4PJBF 1T80A 4RMRA 2C26A 2Y5TB 5SWSA 2R59A 2XV6B 4CDHA 1S7TA 4MKTA 5CGYC 3TP4A 3ZL2A 1VJSA 3NCXA 2FB4H 1JZEA 5CJ5A 3QFGA 4UQ2A 35C8H 1QHQA 1MCNA 2OCCB 3CZLA 4P2QA 4X0KA 4BE6A 3SQOH 1CDHA 4UNIA 1M7IA 3G5VA 3JTTB 4OCSL 2IFFH 2FO4B 1HEZB 1QFWI 4FN0A 1L9OA 4FX5A 1IIKA 3VXMB 1IGYA 1FE8H 2DTMH 3VSTA 3EYVA 4P2OC 3QFJD 5IHLB 4DAGH 3P0VL 1OL0A 4M5YH 4LEXL 4NBYB 3UYOD 4XODA 1CZ8H 3I6LD 3ZTEA 1QFHA 2VLJE 1GRWA 4GG6B 5K9QG 3U4KA 3NJGA 5LCVA 4WNQB 3ZPDA 1ND0B 4NQSB 5KZCD 3HN3A 5IESH 1H3UA 4LSTH 2O5XH 2F74B 4PG2C 1RUML 1I9RL 4RRPA 4UOZA 3SCMB 1KLUA 5EULV 4NWUL 4XCYA 1O9ZA 4TQEL 3U79A 3FQTA 5L9DL 4G82A 2X1XR 1GJUA 3CHXA 3CV5A 3MLXL 3OAUL 1IKNC 4G8GB 4KY1L 1YYML 5JIQA 3IE4A 4F7PB 3MROA 3MRLB 5AZ2L 2C9PA 1H0DA 1YNKL 2VB5A 2XXGA 5IBLD 3IAPA 5AW9B 2BWDA 4JFUA 4F3FA 4NEHB 1QR1B 3PJSA 3EO1B 5F9OL 3P4LA 1S9YA 1JZ3A 1JGDB 2N0KA 3LKNA 1DJGA 2AS5M 2BVEA 2E59A 3CDGA 3ZYOA 2NOYA 1IX2A 2V5RA 1AGBB 3EO9H 2VUYA 2C7UA 5TE4H 4JKNA 3GTNA 3BC9A 4QLRA 2HRPH 2YPVH 1ZLUK 2APVA 3Q5OA 3UO8B 3ARBC 3L1GA 4CMMA 3L9YA 1U93A 4DQAA 4Z3EA 1B9KA 4FD0A 2EUVA 4DW2H 1D5RA 4UT6H 3NZHL 5KS9E 1B0RB 4AC4A 4O4YL 1CICB 1JRHI 1R1CA 2DLGA 4EZKA 5I75C 2WXIA 2CM5A 4UBDD 5D7IA 3T1FA 3IU3A 3BDBA 4A2GA 2QQLH 2W9EL 2VMDA 2NNXA 4JKMA 1UM4L 5DVLA 4LQFL 3SPVB 2IO5A 1NFAA 4MCZB 3VGHA 3TFKC 2ZCLH 5LDUA 4JM4L 2EVHA 4KI5C 4B3VA 5IQ7H 4JGNA 1PNCA 3Q1SH 5DJ2A 2B1OA 5I74B 5JHLH 2LGNA 5C9JB 1ZLDA 1BBDL 3F6LA 2CBTA 4FC3E 4Z0XA 1HWHB 3M45A 1JNLH 3O3DA 3EYQD 1E5BA 2UZYA 3G6AA 1HQRA 1SN5A 2FYYB 4Q9RH 4EI6B 1S7SB 2IANA 3ATDA 3TX4A 5F1OB 2X4UA 4UCFA 1NJ9A 4LFHG 4ZRGA 4ENED 5FLVA 3QJUB 5TGBB 1H3VA 3ZIYA 4FQXB 2JKJA 5CLXA 3RPIB 5GGSY 4MJHA 1Z5LA 3BQUD 4ETQB 5FOBB 1XCQA 1J11A 2PWFA 1FFOA 4I77H 5HHOE 1J8HD 5KVEE 5IQLA 3EDEA 1VGKB 3RWGA 3IJYB 3QC6X 4CGTA 4IOSA 4ZW5A 3QDMB 2AJVL 3U46A 3LCYA 3WUWB 5IOPB 2D0FA 5K5YA 3BDYL 4Y5XC 4HOXA 1R9FA 1V55B 1V7NH 1PFCA 1OK8A 4QPEA 2DWXA 4OUUA 4OY9A 5KWYC 3DIDA 1RVFH 2JTYA 1N0XL 5C0DB 2BVPB 2HTKD 2XBZA 3HE6C 4AUJA 1FO0B 1BBJB 3IB4A 4ZSOE 1DZ0A 2VUOA 3B2VL 4U1JB 5DD6A 4AGMA 4G9FD 3P02A 1F6FB 3MRMB 2DKUA 2C5DC 2YD9A 3C12A 4WHYH 5GGTL 1A7QH 5INCB 1D2OA 3PXLA 5FYJE 1AZVA 2WINA 4JFZL 4UAOC 3TBYB 4D0CA 4HBQA 4ZUVB 2P8MB 3IPBA 5ICXB 3AITA 32C2B 3WIAA 3HRZC 1K4DA 4RH4A 3LSOB 3VTAA 5EDSA 3BE1L 3QHFL 4MMXC 4N28A 5E8EA 2JNZA 3GRBA 4OI7A 2AZUA 1ULVA 2DQMA 4OD2A 2WTPA 4WCYH 2WQRA 1RFDL 1GPOL 2V6HA 5HBBA 4K23H 4PJIE 4XOBA 3EGXB 2ZWYA 1GTFA 1DQDL 3UCQA 1MEXL 2AEIT 3QEQD 1MFEH 4HWUA 3ZKXC 3AY4A 2D3LA 4I8DA 3VXUA 4J8RA 4CJ0A 5IVXA 4HK3N 1FL3B 3HZ3A 2KKQA 4S2SA 5LBGA 1E30A 3CLWA 5FECB 1M6OB 4N2NA 3CJJA 2L04A 2NRDA 4OCMC 2ZOKB 2F58L 4NKIH 2DLIA 1B2WL 3LVEA 3Q7JA 1IC5L 1YEIL 2XIDA 2WKOF 1U2HA 4HEPG 2FWOA 4OSUL 4JM2A 1PVHA 3TCLB 4L8BB 1NFDF 3F6IA 4YSUA 4XC3H 4QT5B 1PJWA 2BS71 1E5AA 5KVGH 1NPUA 1MIML 3OXRB 3MRBA 3V4PB 4GW5A 1RZIB 1ASPA 3JWNE 4OR1A 4NAQA 1ZPUA 4JB9H 4UWQB 3U2JA 2K78A 3P9LB 4NP4L 3TNMB 3TPUA 2RALA 4NM4H 4D94A 2I9TA 3BWZA 4L5FL 4QTIH 1JPGA 2GG1A 2OXGA 4JRWA 4NC2B 2V33A 1Z3GL 3UO1H 4G7SB 1NMBH 3HC3L 3Q43A 3ZE1B 1KJMB 2AEPH 4QHUA 3Q9QA 1JWMA 5T1JA 4KUZL 4WENB 1UZ6F 5I6PA 2X89D 3KCPB 5DHVA 4EN3D 5EUKA 1XWVA 2FZ3B 3WIHL 2CDEB 3GXFA 2AAAA 1OO2A 4HFWA 5IIEA 4UQAA 4GYBA 4V33A 4BFBD 4ONFH 3GC3A 2XY1A 3P69A 1SDYA 1JVOA 3D33A 4HF5H 1A7NH 4AJWA 3ULUD 2P5EB 2GSGA 4F8PA 4DZBB 4M6NL 6FABL 2A6KA 4NHCL 4FLHA 4AYGA 4F7MA 2GJ6D 4J6IA 2ZXBA 4PJ6A 4C4UA 2W0FA 1L7IH 3WFDL 1DBAH 5IG7A 4K3EL 1IM3D 1G7PB 5DURB 3PNRB 3QZWG 5D7EA 3E3QE 4LK4A 4K55A 3OKMB 1PZ5A 1FHNA 1GYWA 1OAQL 4GAGL 4IDJL 2Q3ZA 3MACH 1NLDH 2P1YA 5CU9A 3BZFA 4PJAF 3BSHA 3DO7A 3LQAH 3T2QA 5I1DA 4JRYE 3DROA 2CLZA 3T0EB 4G6FB 3OKEA 4G6MH 3K81A 1FFNB 4YDIH 2QPUA 5KSBE 4U6VH 4HCIA 5DR5H 5AVTB 4MX7A 4IRJD 4AIEA 3BFQG 3F2LA 5IHZB 3DX4A 3TO4B 1P0SE 3A6CH 1IFHH 3MRKB 4PRPD 5AW6B 4JUTA 1E2ZA 2NYZA 4PP2A 3S7GA 3WOVA 4Z7WE 3AQDA 2JCCE 3QS2A 2NNAA 3Q6FA 4L1LA 4OZGE 1HHIB 3PDDA 3ZTDC 3NN8B 5DRWA 3MRHA 3HHSA 2QSCH 1QOKA 2F18A 4PTTA 5GGQL 4PN6A 4QRRB 5EC2A 1D5XB 3VXRD 2BSTA 2CG9X 4FG4A 5CJOH 3DHUA 4LOUD 2W65B 5IW3A 4PV8B 2R1XB 1VPOL 3ZZSA 2I5YL 3LAFA 2BIOA 3RY4A 4KKBD 2CHXA 3V4UL 2EICA 4PY8J 4DERA 2NR6D 3QAZC 1YJDL 5IVOA 3N04A 4Q58C 4KPHL 5E1IA 4NO0B 1CDJA 1AGDB 3T0BA 5FUOL 2J1YA 1R5WA 3LQZA 1DQMH 1HH6A 3WTSA 4RIRA 5E6IA 5LNEA 4YK4B 4TSAL 2HG5B 2P9RA 4P5KB 4D9LL 3KXFB 3JT0A 4E41D 1MWOA 4JANA 2HVBA 2KI6A 4X5WA 4UT7H 2ZJSL 4WU7B 2J1ZA 2LHAA 3CC1A 4PJXA 5T3XE 1Z66A 3QFDB 3HS8A 5L2JA 3KYMB 4HWZB 3TT3H 1WUNT 2WBWB 3U6XA 2VQUA 1SOXA 4PVNA 2UZIH 4PY8I 4WUUB 1UD8A 2CM6A 1N59A 2AJ3B 5E9DD 4W9FC 2WWMC 1EEZA 5HYQA 1U3HB 2EKJA 5AZUA 1X7TA 3GZPA 5FF6B 2Z7WA 3HBZA 2N1KA 4KGJA 3IGLA 3MGOA 3QPXL 3QCTH 2LLLA 2JJTA 5H37A 1TTUA 5D7IF 4FS0A 5DCCA 3WIFA 4NQDA 1THAA 5MI0C 4S1SH 3IXTB 2VZVA 2IBBA 2WQXA 1SGKA 4MD0A 2V9QA 2A74C 2DY2A 3QWRA 1NAMB 4FFVD 1QW8A 4NO3A 5C0CD 5K93A 4PJDE 4YNYB 1SN0A 5D7LA 5AYUH 3RKPA 4WAFA 1L0QA 5F7BA 4QRPD 3OLDA 5D7JA 4HKZA 3NFSL 3VD1A 1YMHB 3P3TA 3BSZL 4P2RA 3TF4A 1KCUL 1AHWB 4KZCA 3GHBH 3NJFA 3PE9A 4ZX5A 4M48H 4AJ0A 5A2KH 3EZJB 1KTLA 3MLZH 3MV7D 1DBMH 3RAJH 1E4WL 4KHXH 1FNEB 4PGDB 3VWJB 2D4DA 1U8MB 3VJ6A 4YHYC 3Q6GH 4HMCA 4FP8L 4XBGB 2VE6A 4B95C 3LD8C 1KTCA 1RZ8A 2AQTA 2O93L 1YEFH 2NUPB 4GBXD 3REVB 4PJ9D 1CB4A 2NY4B 3SE9L 2XTJE 4U6YB 5EC1B 2J73A 3HAEG 4YDKH 2OR9L 3HG1D 3MBEC 5EIQA 5GGSA 4E42A 4PV9A 2Y5EA 1T7YA 2IMNA 2WLKA 2P8PB 2ZUWA 2VMEA 4L4VA 4ZUWA 4V1DA 4HALA 3U83A 4PUBH 1C7SA 3II2A 2VDML 1G6RB 2ATPA 1ZT1A 3IWUA 3MCLL 3WLWC 1A7RL 1QR4A 2CLVA 2GIMA 4O5LH 4HMEA 1B4JL 3STZB 4UTBL 2VLKD 5HGAA 1MZYA 1JK9B 1QLRA 2YAQA 1G9EA 3FTXA 1NGYB 3IJEA 3UC0H 1R3KA 5D1QC 2G5BA 1JWSB 1GW0A 5DEJA 3RUGE 4IGBC 4DP0X 1A6PA 4ZT1A 3O45B 4WTWA 4XHJD 1MRFL 4DP1X 1HHGA 2Z31B 4XRCB 2BNRE 4HXBH 4L3CB 4WI2A 4PJFB 4WO4A 5IEHB 3QZWB 4M43H 5E2WH 1JNNH 1SJEB 5E8PB 3ZTCC 3GLEA 5M94B 3GBMH 3VXQA 1KWGA 1NGPL 3W0WE 4Q9BA 2ZF9A 1OGAE 2I60H 5IVXF 1E42A 5I73C 3HC0B 4FTVB 4DN3L 1IC4L 2WIIA 3L3KA 1I82A 2NY0B 1PCXA 3PL6D 3GLZA 1ECYA 3DXAD 4PJHE 4I13B 2UWEB 5DD3L 4FFTA 5C0AA 1QABA 1T0PB 3M07A 2HFTA 2HFFB 1I8IA 2BNQB 2VDKB 1EANA 2D8KA 3QNFA 4JM2F 4WO0A 3GMNA 4N1HB 2ZYSA 1PEZA 4LLWB 2HT3C 4YFEA 1NKGA 5F70A 3T2NH 3FU5A 4OGZA 3PGCA 3LNGA 1TUPA 3LHAA 4MNQE 2YC1B 3A21A 5EU6E 5JOPD 4WV1C 4ZD3H 5E5RB 4MMXB 4AQ1C 3WXWL 4G5ZH 4Y4HC 1HHJB 4YEEA 2DW5A 4NHUA 2FLMA 4ZW7A 4ODXA 1YN7A 5CJ8A 2Z92B 4GMSH 2OLDA 2QKIA 1G94A 4HUWB 4HK3J 3VX0A 4QOKD 4JEGB 1TVHA 2Z8RA 2X4OB 2DQIH 1ETA1 4NPKA 3O2DH 4UT6A 1QSED 4Z7NE 4KROD 4ABQA 2VDOH 2PCPB 4Z3IA 3TEUA 4MA7L 4X6EB 2SODB 2R8SL 4JAMB 4Q9QL 2R69H 5EUOB 2A4CA 1CR9L 1VACA 5FYKD 3LNIA 2HSIA 4L3EE 5F9WC 3KPRE 3I3DA 2ZUXA 2E3VA 5FS5A 4AQAB 4KDVA 2F68X 4K94L 4D0DA 5TPWH 4IKKA 4XNYL 1L3NA 5TJWK 4LXFA 4G43A 4JJ5A 1JS4A 1XF5A 4AQOA 5ID1A 4J27A 4G7QB 2CHDA 2OSYA 4RQQB 4PJGF 5EWIH 3EHBD 2X10A 4H26B 3IGFA 3L4CA 3OXSA 5AG8A 1KCVH 1VAHA 5HDQL 1JUFA 3RFZC 1KLFA 1NAKH 1YPZA 3D25A 1G0DA 1GZPA 2DL9A 3RZCC 1S8DA 5SWQA 4E9RA 1TJHL 1K3ZA 2H8PA 3ARXA 4G1EA 1C16B 1G1KA 3MR9A 4Y4FA 3C8HA 4HGWA 4WI9A 1PQZB 3MU3A 4WWKD 2X3BA 3DBSA 3MFGB 4GAYA 2FD6H 4P3WA 4P4RA 1FFRA 1ZT7B 3BSGA 4W4OA 5D4QA 2ZUTA 2C4XA 3C75A 3OGCB 1OP5H 4YBHA 4N2CA 4OUOA 4UILL 1SM3H 3VD5A 4M1DH 3W39A 5J89A 2CIKA 1P6AB 1P7QA 3PWPB 5GJSL 2LR4A 5BQ7A 4K3JH 1T1XB 3UABA 4A7QA 1O9WA 1OXYA 1J7VR 4LT7A 3K6IA 4QRAA 4UT9A 3HZYB 1KIQB 2ESVD 2YLHA 3BJLA 1NMAL 7FABL 4CSTA 1A4JA 4IRZL 3CHOA 4I3RH 4K3HA 3LKSA 4LIQH 5L2KB 3BEVA 5H4YA 2E6JA 1BOGB 5JZ7C 4PRHB 3SDCC 4XOEA 3FTGA 3ZT6A 4LLYB 1S9KC 4I4WA 3B6SB 1DLHA 3O3AA 5E6UB 2J1WA 2J1XA 3E8UL 3IJ8A 5D5ME 2AI0L 4NPJA 3RTQC 4M5TA 1UM6L 5CEYA 2X6AA 3O9WB 1EFXB 1UOLA 3UTOA 3MRQB 1XSKA 3KYNB 3V0HA 5DYOA 5F6HJ 5FR3A 3DHPA 1EJ8A 2GEEA 2ZD0A 2Z65C 2FEDD 3T6ZA 5MERB 1F42A 4NT6B 1PY4A 2WHVA 3EG9B 4UDTB 3DJRA 2QPSA 3EFDL 2V3FA 1OT2A 3GXTA 5DI8A 3ZDXF 1J5OL 3UMNA 1SYSA 1BFSA 1L9SA 5GHWL 2WCGA 1VFAA 3U4BH 5JR1L 4KZEL 2ICWJ 4TVPL 1KDIA 3AREB 2DQEL 1QVOB 2WMPA 1G9MC 1D9KB 4J6RH 5HI3C 3VWKA 1J1OL 1ZE3H 3KCWA 2YUVA 5JNYB 1MIEL 3QDJD 4IHOB 4M8QA 2YPKB 4G6AC 3MRCA 4Y19A 3HAEB 3VFNB 4C58B 4BQBA 2R4RH 4PJ5B 4M7JH 4PJXF 3BWAA 4MDJA 5DD5L 3QI9C 5D2LE 4LEBA 4DESA 4JREC 1NM4A 5DEFB 1U8CA 1CLCA 1HS6A 1YEDB 2B15A 5B1BB 4QJ3B 3IGKA 4EI5B 3TZVD 2WCPA 3O4LE 3QUYB 2GTQA 1A4CA 1VZGA 5ISZD 5FW7A 2G9HB 1OIOA 4OCNC 1YMMB 1X5FA 2A9AA 3C6LD 4APQC 4AGQA 1OCZB 2F0CA 2XVKA 3CLFL 2GCYB 4JFDE 1MCFA 4WZ9A 4AEIH 1N5AB 1MJJA 4YZFF 1DBKL 4F15B 2JELL 3B3BA 1UD2A 5A40E 5IQ9A 3TA3C 5D2NE 3WHE0 3RDJA 1YVLA 4BSVA 5DSCB 1VKXB 2FT6A 1VFOA 1ZWIB 2F5BL 1I7UA 2O5YH 2OJ1A 3FRPB 1UJ3A 5JORB 1MCEA 3FSZA 4JPQA 3WJJC 3PV6B 3VI3A 3D0VB 2NXYC 5KVEH 2YUXA 1UOVA 3AG1B 3DHJA 5AAMC 5KBPA 1PKOA 5TE6L 3P4OA 4KK9D 4I0PA 1NDGB 4NNXB 4QRUA 3US1A 4K94C 2FR4B 1TEFA 2CO7B 4G5AA 4NSKA 3FU8A 3N44B 1AQMA 1E6JL 2IPUG 5IQNA 3DX7B 3NCFB 4GRLC 3BZ4B 1QEXA 5IMLB 2JIXB 1ZIAA 1Q72H 1H8LA 4PLJD 3QG7L 3FQWB 1WD9A 2UV3A 4EIBA 3O3EA 3J8F7 2QVIA 4RDQF 4C56A 3UG5A 2DYSB 4MA8H 1WH0A 4L4TA 4ONGL 4C83A 4H44C 5I17A 1F41A 4HZLB 3GMMB 3ZY7A 1MHPL 3OQ3B 3UYPB 5SX5K 3PDOB 2AV1A 2Y1VA 1O7VA 3BT2L 1O6SB 5FYJH 5HHPB 3D0AA 1N6QL 5FGBA 1EVUA 1UA6L 3BPCA 3KPSD 4TRPH 2YQGA 3IWVA 4IOIA 4N6RB 5D1ZC 4MAZA 3NOIA 1CD9B 3ESMA 3QO1A 4M4RB 5D96B 2Q3XA 3DRTB 3MLTB 2GW5A 5HYSG 4DKTA 5I8OH 3MAWA 3O6FC 4ZXBB 1TTGA 2XRAH 5I15H 4I1RA 4DPBX 2AVFA 4NQED 4X4YA 1Y6KR 3PHQB 2WYHA 2NY2D 2E8ZA 3FBQA 4OKVB 2FX7H 4RAVA 7TAAA 1H9DA 1N9PA 2QADD 1ZA6B 2X9YA 4N1CA 2YOAA 5F1NB 5B1KA 5EEVA 1KOAA 5C07D 5TF1H 1CZ8L 4LPTA 1TTFA 4P2OA 1P4BL 4PGCB 5DC4B 4M6OH 1DVFC 2VN4A 3WEBA 1AC0A 5I1CH 4PW9A 3QDGB 4U6XA 1BZ9A 1QBBA 2O5ZH 3FQNB 4KK6C 2VZTA 4H20L 1WIUA 1FAKT 2ZAHA 3WE6A 2EYTB 5I5MA 5BZWB 1M3JA 3UTTB 5J13C 3MNZB 1RJYB 2J57A 1FVEB 1I7TA 4PG2A 1WGOA 2CPCA 3IFLH 2CBPA 4B97A 1LO4L 1N10A 4XR8C 3JWNH 1T6BX 3LPGA 1RUAL 2VLMD 3TWCH 1GIGL 1S7TB 1IKNA 5GZNC 4I18B 3LMJH 2BWIA 3FO9B 1NUDA 1U8IA 4YXKL 3GUTB 4LCWD 3LX9A 2IDQA 5JW3L 4KJYB 1IC1A 5C7XH 1CPUA 1JTOA 4IJ3B 2RBLA 4P5TD 3EO9L 2DWEB 4FDWA 4WY7H 4OZFH 1BMGA 2NXZC 1KXHA 4OIBA 4EKXA 2YPVL 1TYJA 2XA8L 5KTEH 3SE3C 4DTGL 4U0RC 5EIIA 4EI0A 3MLRH 2R56L 2IWEA 5F7MC 1Z9MA 3ARBA 2X0VA 3V4VH 3GBNL 4ZS6C 4JFPA 2ED7A 4RX4D 1K5WA 4ZTOH 1N7MH 4S0TD 4DUVA 1AOHA 1CTOA 3MMEA 4OV5A 3N42B 5I73B 1JZIA 3K6SA 2EVIA 2R4SH 1PF3A 2CK0L 4KWUA 4B41A 3ROOA 4Q97A 1BPLB 3PABB 3PQYE 1IJNA 3Q1SL 4X4ME 3VXSA 3LRLA 4KXCA 3MROB 4F27A 2IBZX 1WDAA 4URKA 1LK2A 2FEEL 4HH9A 3O41B 2KLSA 4Z3FA 2CPUA 2VWEE 4X7SH 3UTSB 4Z77A 3BPNC 4TUOA 1XGYL 2EC8A 4U2YA 2NUTB 4Y2OB 4A7VA 4M00A 4RISL 4LBEA 1BWMA 1DO6A 1R3HB 3BKCH 2R0KL 4LLVB 1XVSA 1DJYA 4AC2A 1OF2A 1NCBL 3H42H 1UGKA 4XH2B 5SWZE 4X2UA 1QTPA 3PAYA 1JV2A 2IBZY 4XAKD 4ZNCD 1YPZF 2FJGA 2X4QA 3OKDA 5HHQA 1IQDA 2IAMB 2VTFA 1H6FA 5HYIA 1WSST 5J3HC 1ZA3A 3QO0A 4GLRH 3S37L 3UADA 2A77H 3RVWD 1U2CA 4UB0L 5I26A 4X7TA 1QPXA 3DOIA 3ECQA 4M7LL 1MH5A 1U36A 2ZXDA 4UOJA 1FDLL 1KENH 2WQWA 3KEDA 4I1PA 2EIJB 4ELMB 4Y5XA 4EEEA 4ZMZA 5J11B 1HZKA 5FUCE 4Z6AT 1F11B 3IMWA 4Z7OB 5J6SA 3RWEA 3RDTB 5JPNB 3WCYA 3NIDF 1AZNA 2LU5A 2UZYB 2DI7A 2HJLB 1SXNA 1Y18A 3F6JA 4H8UA 4ZMXA 5IB5A 2ZP8A 5AOKA 4LCUB 2FYVA 1JZJA 4XPFH 5DMKB 4NQVB 3GHEH 1BDYA 1ZCRA 3HFML 5LGHH 5HYEA 5FYJU 4BFKA 4U3HA 1AC6A 5I0ZA 4OFVA 4FL4C 3ZZQA 5IHUL 4F80A 1V3MA 3ZHKA 4HCRH 4PRAB 3HRZA 1JOIA 5L4MA 1J5HA 4YSPA 1RCYA 5E8DL 4UNUA 2OI9C 1S46A 2NY6B 4ODTL 3RGVD 4AEFA 2F1AA 4QAMB 1KMGA 2BO0A 4LF3A 2ZQKA 1L0PA 2D31A 2V8LA 3IFNH 4UYQA 3J07A 3IS1X 4W6YB 1XAKA 2QR0A 3OLIA 1MFEL 4Y9FA 5T3XH 2BHZA 3A47A 1ZGLP 4GXVL 1ZT4B 2VAJA 3SKNA 5F3BA 1YEKH 1KTKE 1G9MH 1N64H 3CSGA 3N0AA 3U30C 5G5DA 1RHHA 2VN7A 4XP5H 4FG6C 3HA0A 4Z95H 3VD2A 2ROYA 2H1PL 4DKFH 3NZUA 5IB4A 3PYCA 5ICUA 3HLKA 3WL9B 2ZNWA 1TMCB 3G5XA 5GGUB 1B0IA 4MBRA 5D1XA 2VDMB 1WISA 1UCBH 4HLJA 1P2CA 4FFZL 2IQAA 1GZQA 5KVGL 2C34A 1XSOA 2R0ZH 4WWID 1XD0A 2GUOB 2HPTA 3ARPA 3VD0A 2K6WA 2UVEA 5HYSB 3A4DA 2CRYA 4L1BA 4ZUTB 1XF2B 2PF6A 1H8SA 5DEGB 3M88A 5D4HA 1MCPL 4HUVB 3A6OA 4PGBA 2B77A 4A55A 1P5VA 1TKWA 3EUUA 1J10A 1S9VA 2ENSA 5AKVA 4AT6B 4ANXA 2VCOA 5TH2B 3JWDH 1NMBL 3OR7A 1E9PA 2AJSL 1EAPB 5AWNL 4O02H 3T2LA 2W0LA 3O2DA 4MNGE 3DMMD 3ZL4L 3PU7A 4OJYA 5H4ZA 2G2RB 4XP4H 5I71B 4X6DE 3VXUB 3OR6B 2EUXA 1WZ1H 3WFZA 2ADYA 4WFFE 1TVBB 4ZW3A 1JF1B 1PS3A 2ZCHH 2V7NB 4N3UA 4S2SB 4N2AA 3RJQB 2VXVH 3EH5B 3QUML 1RERA 1QBMH 3B9KB 3GQFA 3LNDA 3ZE2E 1MAKA 3KPPA 5F9DC 4HF5L 4UM9A 3VI3F 4G8IA 4P3CH 3GSQB 1Z9NA 3WNLA 1DDHB 3NZSA 5I24A 4M1CD 5L8LB 5IOKA 3CLEL 4M6ML 4GUCA 3GJFH 4LZKA 1VCAA 3SDDC 4DUXA 3DOHA 5CU5A 4DO6A 3EO0B 3M1OA 1SY6H 3IMBA 3BUDA 1BZ8A 3VFUB 1YY9C 3P77B 3TBVA 3C09B 3JT2A 4HJGB 4YHNB 4OW6A 3S48A 4NN5C 2HLFD 3U0PB 2ZSVA 1U3JA 4MB5A 1DUYA 1H5BB 5JA8B 3L3IB 3F84A 2BIPA 3MACL 5T1KD 1HNFA 4ECNA 5HVHC 4HHGA 2XG4B 3CFJA 3TT1L 2CHZA 3HR5A 2CKBL 3IMUA 3UCRA 3FB5B 4CW1B 3VXTA 4U1HB 4N22A 4UTCA 4XX1E 3SZ6A 1FIEA 5I28A 3IDIB 3L3DA 5DHVB 3QG6A 5A2AA 3WDHA 1FLRH 5T5FH 4P9MH 3ARZA 3AQYA 5DUBA 3V0JA 5IIEB 4UZUA 1KJ2H 1LO5A 3KWTA 1BFOB 1MVUA 5T3ZL 1NCCH 3MRGA 2CRIA 1SDDA 2HZHA 3FO0H 2GI7A 4GAFB 3X1GA 3L9EA 3T0VA 5CN1A 2IF7A 3CVIH 3DX6A 3D85D 2A6KB 1FG2A 5JOFA 1CLZL 2BXZA 2VR9A 1NFKA 1K85A 5CP3H 2BSCA 2QV2A 3C60B 3WEOA 4GUPB 4NRYA 3U2IA 1KG0B 1NLBL 2EJ1A 4OGQC 5CSZB 5ADOL 2H3NA 3FN9A 2KL6A 1UZ8B 2ZYHA 3GI9L 3IDYC 4HPOH 2Z34A 4Z7IA 3IJHB 2B0SH 3TL5A 1B3JA 5FPIA 2JWYA 3VE0A 2FCBA 5LN8A 2ZKHL 5EU7E 4YWGL 2XQBH 2JJUA 4M8RA 1RIUL 3DROB 3BHBA 3W9EB 4N9OB 2HKHH 3QIWB 4GMTL 4P59L 4LL1A 3DUSA 4RGMB 2DTSA 2BVUA 5I16A 4LVOC 4QXTB 4CAGA 2QGCA 2MQ0A 1R3LA 5JDSA 2AXGA 3QUZD 2ADIA 2DB8A 1MHEA 1TETL 1XT5A 4GB9A 4N5ED 3T3MB 5EDXA 1BAWA 2NNAB 3KR3H 3TBCA 1FBIH 3KM2A 3H6AA 3O6LL 1CU4H 1AQKH 4W1TA 5DRWB 1OTSC 1MREL 1IQWL 4PTTB 4A63A 3SGEH 1ZRUA 4S1DC 2ALWA 3AAZA 3F7LA 3DSNA 3U1SH 1P53A 4G7VH 4MSWB 3UERA 2V17L 4YSCA 4I48B 3MX0A 2C3XA 4QRFA 1F8TH 2LU3A 1L9QA 3N9GH 1GOFA 4BH8A 1ZLEA 4X8JA 1V8HA 2J8UE 3ULVE 1R5IB 3O0RH 3BH4A 1GYAA 1F4AA 4PJEB 1T22A 4HIEA 2P80D 4WEBL 3W11C 4RIRB 4NQCA 2B1HL 2AJYH 4HOWA 2D9CA 4XCCH 1EK3A 4FQLL 4JDTH 4Y16D 1XGUB 2WQUA 4Y4KD 1BIIB 4KI5F 5C08A 5ESAA 4TSBL 1JNHA 1MFBL 4JG1L 1MNUH 2A74A 5TQ0L 1ZLWH 2MFNA 3B56A 3P54A 4X5WB 3MBXH 1S5IH 1KBVA 2AK4D 3INOA 3L5XH 4HHWA 1GY2A 4FKKA 4U3CA 5D1ZI 3S96B 3WJMA 3ZU8A 2QQKH 1NBYA 2FEJA 3X11B 5JUEL 4F24A 4G9DB 2KZKA 3WKML 5CBAA 3NRPA 2DQ6A 3PNWB 2WTOA 4GKZA 4PY7A 1ET8A 3MV9B 2Q6WA 2UZXB 3ULSB 3R7QA 3HI1B 4UU9B 1CFBA 1EEZB 1UM5H 3BVVA 4FQQB 2XPZA 3UBHA 1GZHA