3TO4D

Structure of mouse valpha14vbeta2-mousecd1d-alpha-galactosylceramide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
243
structure length
243
Chain Sequence
LLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLFTLRSPGDKEVKSLPGADYLATRVTDTELRLQVANMSQGRTLYCTSSADHWTNTGQLYFGEGSKLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Vbeta2 natural killer T cell antigen receptor-mediated recognition of CD1d-glycolipid antigen.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2011-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3to4D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3to4D01
5D7SL 4P5KB 2OI9C 3IDGB 3U0PA 3C6LA 3OWEA 4HWNA 1K85A 3STLA 4Y2DA 2XI9A 4ZTOL 2BERA 5C0AB 4A6YB 2Q76B 1DQQB 1UJ3B 2E7CA 3S37H 3P0VL 4OFDA 1N6QH 3HNSL 3TESA 3V5KB 4JQIL 1A7PH 2DF3A 4KMLB 4P9HC 2RFXA 2K7PA 3C8KB 3VXUB 1HINL 3G5VA 5IWLC 1WWWX 3BEWA 1G9NL 3THMH 1U8PA 1KPVA 4KRMB 3RWDB 4D8PA 3X14B 4HCRA 3OQ3B 1WQVT 5DO2D 4NUJB 4CUCA 4HD9A 2YD4A 3SEPA 4HLZG 3TH4T 5D96B 4F7MA 1NFIA 3CFCL 1LNUB 1FGNL 2ICES 3HZKB 1D6EA 3S35H 2BRQA 3ES6A 1U8MA 3HPJB 4OV5A 5L2KA 1DLHA 1AI1H 4ZUUB 4HS3A 2DQGL 5DD5L 4G7VH 1INEH 3VDAA 3RUGB 4MNGE 4S1DD 2A77H 5CHNB 3N1QC 1A9EA 3K8LA 5EZIL 1M71A 5I1JH 5HPMA 3BQUC 2VH5H 5C0DA 3TN0A 4CVZA 4I2XE 1NBQA 3SQOL 1YUHB 3WD5L 2EXWD 2VKXA 5ESQB 4N8CL 3MBEB 5FGCE 1GC1L 2RIKA 5DJAA 4M48H 1C5BL 1SM3H 1L4IA 3VRLF 5ENWA 1FO0H 2QBWA 1IM9A 3VWKD 1FDLH 3EYSL 3ARRA 4XBEH 1QBLL 2VQ1A 4D2NA 2ADIA 3CZFA 3LVEA 5C0RL 4HCRH 3C6LD 5T33H 3S5LG 1X4ZA 5EUOF 3MRHA 1VA9A 3KS0H 4F3FA 2OZ4L 2AK4B 4JCMA 4YUEL 4QLRA 4OGXL 4LSTH 4PRHB 5GSVA 1EEZA 1OPGH 4YGVB 5F97E 4F15C 3KS0J 1AJ7L 1EMTL 3TCLA 1NCAL 2GK2A 4N0UE 3BDYH 2QL1A 4NQCB 1IKNC 2NY7L 2P24A 4O4YL 3QHFL 4IOIA 4L4TB 1CXLA 3G5XA 3HMXH 3D0VA 5TE4L 3ZE0E 2H32A 5BZDB 3ZE2F 1QVOA 4G6KH 1DL7H 5C70A 3PP3H 4PP1C 5EU7C 4WDIB 2Y36L 4AM0A 2OI9B 3WFBL 5L2KD 4NNXA 4J8RA 4NQDA 1BQUA 1JHLL 4UBDC 1HYSD 4U1SA 5DZNA 4YHYC 2D03L 1XEDA 2C3VA 3VE0A 1AP2A 3KNBB 3MFGB 1IAOB 4XMPL 5BRZE 2A9NL 4GFTB 2BSSA 3TN0D 3PP4H 2G2RB 4Z5RA 1H8SA 2FB4H 3C5ZC 3BDXA 4P5TA 1FFPB 4MJ2A 3E6FA 4KJPD 2NXYD 5C07A 4JB9L 4PJAA 4KTYA 3A6OA 3DI2B 1QBML 1JVKA 1T04A 3H9SA 1C5DB 4H5SB 1QRNE 1LQSR 2O5ZL 3NA9H 1L0QA 2FO4B 4PJFF 1IM9D 1X5KA 5DGQA 2BP3A 3PWVB 1FL6A 4HSQA 1RK0B 5IVXE 1J0IA 4M1CC 4NKOB 1R3KB 1N6UA 3UJTH 1JBJA 5C0BE 2WQRA 3FQNB 1BBDH 5E99H 3BH8A 1Q9KB 3WS3A 1TPXB 3S34L 3S36H 4X99A 3HRZA 2XXMB 5FGBC 43CAA 1CDGA 3BQUB 1W8NA 5TGBB 3H42H 3JV6B 3QNYA 4QRSB 4NQEE 1JNNH 4S1RL 3AM8C 2P45B 4G9DB 4YH6A 2IFFH 1JJUA 1T21A 4NNPH 3R06A 4MVBC 1T7ZA 1A6ZA 3BP5A 4M7KH 3VMPA 4RAUA 5KS9E 4E0RA 3NTCL 4JZJA 3MLWL 4OFVA 5F7KC 3VFOB 5IB2B 3KHOA 3X12A 4CVXB 5MEPA 3B8YA 1B4JH 4JHWL 5FV2A 3B43A 2X4PB 4OCSH 1FVEB 2ICEB 5DSCB 1TETH 4NQSB 5CWSA 5IB3A 3IRZA 2N56A 4NOBA 2FHFA 3MRPB 2P5WE 2NW3A 1FG2B 3QHTC 2QQLL 2VDML 2IQ9L 3L3JA 3HNTL 4NM4L 1BOYA 4PJHE 3ZHKA 2HFTA 3QUZC 4QTHB 1UH3A 3I3EA 1QZ1A 4NQDD 1T89A 1A5FL 3F12A 5HGAB 3MLRL 4PUBL 2F53E 2Y72A 4NPYA 4LLYA 1LDPH 3QFDB 1A7OH 3BPCA 4F15B 1HHKA 1U8NA 5EU6E 4XNXL 4PJGA 3RAJH 4V1DA 3TIEB 3NZ8A 1S7TA 2J8OA 1E6JH 4FQ1L 4P5TD 2XZCL 4OCNC 3DRTB 3Q48A 1NL0L 3JUYA 3FB6A 3CK0H 1Q9LB 2Z4QB 5C07D 2OTWA 1IGCL 3NACH 1DUYA 3H9SD 4ZNCD 4ODTH 3IXTB 3CPLA 4GAYB 4GAJL 1A1OB 3MRGB 3PJSA 4E5XB 4WU7A 3BH9B 2HH0H 3FRPA 3ARDC 2NQCA 5I1CL 3T3PE 1HWGB 2DL9A 4N0YH 1KFAL 1PZ5B 3IJYA 3RX7A 4YHYB 3BPLC 1DN0B 5DQJB 5HVHC 1UVQB 3SDCC 3KPPA 3EYUL 5HGDB 1H3WM 3FFDB 3GSNH 4N90D 4N8VA 4R0LA 4M1GH 3DYMA 3ARXA 3BPNC 3W39A 4LRNL 2ADGA 1CFNB 4EI6B 3OX8B 3NAAH 4GW1A 5D1ZA 4PV8B 4RQQB 3TWCL 4PJEF 2VLJE 2P5EE 1FL3A 2OL3L 1FNHA 1T5XA 2W0KA 4BH7B 1K4DB 1YQVL 5JR1L 1EO5A 4AEHH 3ULVC 4G43B 2CR3A 4Y1AD 2ZKHL 1NSNH 4XP6L 4HWUA 1UKQA 5LAXB 2H1PL 2JLLA 3VXNA 5MENE 3HG1A 1IZJA 3HB3C 3RPIA 4RGND 3EYQD 2R4SH 3ZKXB 2OJEB 4NGHH 4MNGA 4OM0H 4WUKL 4M02A 4MD0B 5KSUB 2VDQH 3VRIA 1JZ5A 2A1WL 5D7JC 4K55A 1P4IL 2CSPA 1GXEA 1WGOA 1CDHA 2HLAA 3OJ2C 2GFBA 2AJSH 2R8SH 3M1BA 5C9KA 5IIEA 3SDDA 2FYYB 3I3BA 3PWNA 5HHME 4G9FE 5L8KB 5F1NB 3MRBA 3SOBL 2F54A 3O3BA 4CMMA 4OGYL 5BQ7B 4ODUA 5DFTA 2AEWA 4PLKD 2A6DB 1E4WL 2X05A 1UZ8A 1V7ML 2E9WA 4JFXB 5ITBL 2FEDC 1KJVA 4QXUL 5DD3L 2A6KA 3HPLB 4E41B 1UM5H 2I9LA 4XX1G 1KCUL 3QDJB 2R0ZH 3SGKA 3V4UH 5C6TH 1IKFL 2FBOJ 1NDGA 4HF5L 3ZYIA 3QCVL 3DWTA 4HH9A 4TUJB 4AIZA 5C0GA 5E2VL 3BGMB 1LVEA 3WIHL 3CFKA 2CK0H 4RZCA 1ACYL 1CXHA 1MVUB 3V6FA 3E6HA 4JPWH 5LBSH 3BUTA 1I9JH 3ZT7A 1T1ZB 3HC4L 3UEZA 4PJ9B 5CUSL 5DD0H 3MX0A 5KAQF 4RWHA 1KBGH 1AHWC 5MERA 4DGVL 2DQUH 4EUPG 4AEFA 2DYPB 4I4WB 4MNQA 3MNWB 2YN3A 3AY4C 2H45A 1RV6X 5I8EB 2ZUQC 2EC8A 1U93B 2FECI 4JANB 2H3NA 2P8PA 5GJTH 4R6UA 3WFCH 4Z18A 5FYJL 4FQQB 1N26A 4NKIL 1LO0H 1S7RA 4PG9B 1N4XL 1N7ML 1IQWH 2O5XH 5D7IF 4LF3A 4U4BA 5DI8B 2J4WH 3ARDB 3ULUH 4GRLA 1T22B 1N6VA 4ZOEA 1NH6A 2VL4A 5E8NA 3BPLB 4MJIE 2R2BB 5CFHA 1LE5B 1X4XA 1HWHB 3FN9A 2AS5M 1A7BA 5JUEL 4AEIL 5SWSE 4QY8A 4PV9B 2UVFA 3ARBA 2WMPA 5T5NG 4PJBF 4OKVB 3DV4B 1IGTB 4U0RC 3JVGA 3BI9X 2XKSA 4X7DC 1HQRA 2IAMB 4JQXA 2WUCL 5FM5O 3GSXB 5GZOD 1CR9H 5JHDE 5CBAB 2RQ8A 1G9MC 5F7HA 2CLRA 3WNMA 5A16A 1QRNA 3DVGA 4RX4A 3EAKA 2IALB 5HDOA 4QOKE 4JY4A 3MLXL 2ATKA 2V6HA 3CIQA 1DBJL 1UM4H 4PIRF 4UIKH 1M6OB 4OI8A 5F1IB 1WEJH 4WW2F 1NDMA 2V17H 5C0BA 5F88B 5HHVH 3DX7B 1Q8MA 4WO4D 4PREB 1F3JB 5HSFA 4W4OC 3GMLA 3UJIH 3EFFA 1SVCP 1T5WA 2HMIC 1BVKA 5D7JB 43C9A 3AMKA 3PWPB 8CGTA 1R3IH 1NBZB 5J9PA 1MY7A 5C7XH 5TF1L 3ARQA 5IT2L 1PQZA 2GCYA 3GI9L 2OZ4A 2ZPKL 3T4YA 4BZ2H 1JHTB 1O5DT 1RK1B 1T66C 4JDTH 5I66B 5KS9A 4HPOL 3UAJC 5J6GB 4X7EC 1NC4B 3WFHA 5K9JH 2FX7L 4HG4J 4FQLL 1BVLB 5DMYA 3V5DB 1S8DA 2QQKH 2L7UA 4YFLF 2HTKC 4ZPTB 4LLUA 2APBA 2ZWLT 2P5WA 4RISL 4QRQA 4L3EB 5HI3D 3TT3H 1FIGH 1YN6B 4ZUSA 1I85C 1YA5A 1HHGB 5FUZH 5FKAA 1Z3GL 1CDBA 5HHXL 3IU4H 3O4OC 3WFEH 4Y5VA 2QADC 5HJ3B 2VAAB 4YFEA 1WCBB 4U6VL 5J3HD 4HXAL 5E56A 1TQBC 3FO2B 3TA3C 3UC0H 4LLVB 1Q9WA 4RA3A 2GK0A 4H88H 3VFNB 2NY5H 4FZ8H 1JV5B 4GAGH 4LNRA 3ZTNL 4Z7WF 1AHWB 4WUUE 3KPRE 3MR9B 1OAZH 2O61B 5IJVB 3JV0A 4WTWA 2UZIL 3DIFB 3HUJF 1T3FB 1F6FB 2ZUQB 3FFCE 2Z31C 4WW1B 1QRND 3MRQA 4XXDB 3UTSE 2HJLA 4FFZL 2NY1C 5DK2B 3KWWB 4PTUB 1EFXA 2XQBH 3QXDA 1I7UA 3LRGA 5CP3H 2IF7A 1QFWH 3RKPA 4XWOC 1H3GA 4YR6A 1JPFA 1U8HA 4XVUC 2CDGB 5C0BD 5K9KA 1E6OH 1UZ6E 2MSPA 2VZSA 1CD0A 4LCCA 4IMKC 3MV11 4POUB 3QZWG 1A3LH 1VACA 5DEGA 4O51B 1KELL 5DHYB 4U1JB 5I0DA 3LHPH 5F1OB 4APQC 5C09B 2FHCA 4NQED 2R2EA 4OZIB 4NDMB 3MRNB 4JRWA 1B0GB 4ZS7H 4U1NA 4U0RB 3SPVA 3U0WL 3DX8A 4KKNA 1I3UA 4MB5A 1RUAL 1UCBL 1FJ1A 2VLJA 1RUPL 3PNWA 1FAIL 4DKEH 1T7VA 2A9ML 4GW4A 4HULB 4J6RL 1QHPA 5E4IA 3TPKA 3V52L 3H9HB 2NTFB 1EV2E 3K2MC 5F8QC 5KVDL 4EN3C 2P5WD 3UDWA 5MENA 1T2JA 2AERT 4M7ZC 5HVGB 2WLZA 4O02L 3RY4A 4L8BA 2F53D 3I6LE 2WINB 1S5IH 3NCBB 1SEQL 5L0QC 1PKQB 3SE8H 5EU6D 1JGEB 3B9KA 2UWEA 4XCYB 1UB6A 4RWYL 1DQLL 1RZKH 3O6LH 4JR9L 5IB5B 1MCWW 1J5OL 3P2TA 4BUGA 1MHPL 1NFDB 4G9FA 4XNMA 1TTUA 4GXVH 2DTMH 2HWZH 5DQ9A 4LHJB 2AAVA 4G5ZL 4JJHA 4KK6C 2WWKO 4LKXB 1HILB 4Q9RH 3ULUF 4OZHB 2ORBL 4PR5A 1MJUH 5D70H 3S96A 2EXYD 1EFXD 3P4LA 3DROB 3CH1A 3VRJA 2EDQA 4Y16C 4LSPH 4FQXB 4JO3H 3D39E 3PWUB 3L5WA 2EKSA 4QTIH 5GRXG 3O4OB 3VW3H 1NGZB 2QADB 4XTRD 2H41A 1FZKB 4S1SL 4PG2A 4H26A 4L4VA 5EC2A 4JPKH 3IXAA 1TQBB 3PQYB 1BMGA 1IGYA 3PWJB 2WANA 4KJQD 4WHYG 4HJ0C 2D4FA 1GJIA 2G75B 1RUQL 3BJ91 2VLJD 1ZLVH 4CNIB 3D25B 4N0CD 3SBWA 4YHLL 1I3GL 3L3HA 5C9JA 1C1EH 4G6ML 5CEYB 1OHQA 1NEZB 1IEBA 3WMSA 5JW5A 1AH1A 1CE1H 5DVNA 4BSWA 1F58H 2EE2A 3LEXB 4MS8C 4MQTB 3WCYA 4D0DB 1Q38A 3OAYK 5BO1L 2DI8A 5MEND 2HT3D 2P7TB 4HMCA 3CFEA 3CVHB 4HK0A 4MJIA 3EHBC 5FOBB 4Z95H 4N5ED 2VLKE 3O11B 4H20H 3UYOD 2DM3A 4O2EA 1NUGA 2X10A 4APQB 2JKXA 5JPMA 3MLSH 1UA6L 3KJ4B 4L9LC 1OAKH 3LEVH 1H3TA 3GJFK 4GS7B 5E2UL 2OQJB 5HHMD 4G9FD 1BQLL 4P49A 4O2FB 4UDUA 3P9LB 1JMXA 3VG0L 5JHDA 4QXGL 1GOFA 4WJ5A 2DQHL 2DWDA 5IQ9A 1QSFE 2EH8L 4GMSL 3F7YB 3EGSB 4QOKA 1AC6A 3QDMB 4WCYH 3TO4A 2WIMA 4YFLI 3A67H 4M7ZB 3HAEH 2MTPA 1OARH 1MCEA 3FKUS 5EU3B 2W59A 4R9HA 1NCNA 5GZNC 3HI5H 1XFPA 4ORGA 3JBG7 2J8UE 1JPSH 3M8OH 5B21A 5IVXF 3D87B 5L0QB 3E3QE 3P4NA 4XNYL 4IRZH 1IJ9A 4PJIA 5IHLB 1T2QH 2EDTA 4QWWD 2GW5A 1W0WB 5JZ7D 1V3KA 1SVZA 5DUBA 1P4LB 2DBLH 2X4SB 4NC2B 4U1LA 4AK1A 4QXWA 1P9MA 3MZGB 3ZDXE 2R1WA 3RIFF 5KS9F 4C56B 5D7LA 3VXOA 1KIQB 1YNTB 1OAQH 5GGTA 1N0LA 3MXWL 5DMIH 1E0OB 4OB5H 4Y16B 2OJZL 2FGZA 1FAKT 2UZXB 5CJBA 1DVFC 3T09A 1EXUB 4LSUH 4MJID 3GMRA 4FQIL 1H15A 3TF7C 1HSBB 4O00A 3RVWD 4PJHF 4S0SD 5E5UB 1D5XA 1WWBX 5SWSD 1FZJA 5ITFB 3G5YB 3S5LA 3L3IB 4W68A 1LD9B 3R1GH 4DFIA 2ATPB 4P9HL 1T1YA 4R97B 4XHJD 4JZNA 1JWUA 4MD4B 4WUUA 4P9ML 1RIUL 5B3NA 1IL1B 4JKKA 3MCKB 4HMEA 2Q8AL 4OLYL 5F71A 1EAJA 2I5YH 5L9DL 4XNQA 5IKCA 5JHDD 4XCFH 5E8EB 3S4SB 1FZMB 3UTSA 3T1WA 2QHRH 1WBZB 4KK9D 2HVJB 1JP5A 1AD0B 4Y5YA 3WLBA 4QOKD 4AL8H 4RGMC 1OW0C 4KK8D 5I8KL 5DRZA 3GMOB 2AV7A 2FIKA 3QWRD 3NN8A 4CW1A 4HUKB 5L8LB 1WT5C 1UWEH 1KYOK 3B4NA 2X4RA 1A1MB 3OHXA 4AH2B 3T2NL 2NY0C 4K8RC 3CCHA 4Z78A 1YEHL 3SGEH 2MPAH 1FNGA 3N9GH 3RDTC 4M6NH 3LS4L 2EE6A 1TQCC 3TVMA 4IJ3B 4N5UA 1WV7T 1AO7E 1AGFB 2DQJH 2NY3C 3ROLA 1UADC 1SHMA 4MDJA 5CJ8A 5T1DL 3QRFM 1J0ZA 2QR0A 1A9BB 1GIGH 4LCWE 3FONA 5GGUA 4LSRH 3O2DH 2HLFC 1RQ5A 3BUYA 3LRSA 3P77B 1RHFA 4D9LL 3D9AL 3U9UB 4POZD 1MRCL 3QCUL 5JW3H 5SWZE 1MEXH 2E7LA 1CE6B 1PSKL 4PTTA 4WI9A 1CIUA 3WBDA 1DSFL 4JFFE 1IRAY 1L6XA 4YXKL 4JFEB 2V7HA 2D7MA 2F5BH 1G6RB 4ZXBB 4OT1L 4R4BB 1FG9C 2EICA 3PDOA 2FWOA 3QEHA 5J11C 3GBNH 5I18H 4DFHA 2BRRH 2W65B 4BKLB 1VADB 1FV1A 2HFEB 2VSCA 3L95A 4LHQB 5AEAA 3RWJA 1UWXK 2N7BA 3AREA 2IC2A 4KHXL 4EI5C 2XNAB 2C4XA 3KPRD 3B5HA 4WUUD 1KN4H 5FV1L 3UPAA 1YNKH 3DGCR 4TULL 3F58L 4PGDA 4I18A 4NOFA 5HY9A 3RRQA 3DX9B 3FFCD 3W2DH 4ZFZA 3UTSD 5E2TL 3GSOA 1BLNA 3FOLB 1YYMH 4NZJA 4PJDA 1CBVH 5IMMB 3EO1B 3LKRB 5TDOB 1CICB 5ESAA 2ARJB 2BNQB 1G6VK 7CGTA 3VXRB 2C7UB 1TTGA 5FFLA 1RZJC 1T1WB 3WIFB 1EIBA 1KCLA 1YN7A 1ZAGA 3T4AA 4HKJA 3OGOE 1ZVSA 2CXGA 1KPRA 3EO9L 5CD3B 3IGAB 5DR5H 3VWJD 2D0HA 2NY2D 1X5LA 2QSVA 2O93L 3IDMB 3MMEA 1ZT7B 1GGUA 5IESH 3TVMD 1XGTB 1Z5LA 1KB5H 3HC3L 3GMNB 1L9MA 2OR8A 3RZCA 1S78C 4NQXA 3PF2A 1U8QA 3FTGA 1S9YA 1PLGH 4UAOC 4FQ2H 5EOQL 2E9JA 5D6DA 1CD9B 4RGMB 2V7NA 5DT1L 1AR1C 4YIQA 4WWKA 4P48A 4X6CB 2VL5A 2ENYA 1GGIL 2VXUL 1SBSH 1P2CA 4M7JL 4I5BA 3AAZB 5D6CB 1DFBL 3BIKA 1ZVYA 4EOWL 2PYEB 4UQ3A 2VLKA 35C8L 4NZRL 1DBMH 5AZEL 1TVBA 4J4PA 5J1TC 2NY0B 4U7MA 5IMKA 4CDGC 2DLGA 4TTDC 1EEYB 5IJKA 3RDTB 4QHLB 4AMKL 5I19H 3UCRA 1TQCB 5FEBA 3ARED 1SJEA 2Q86B 3GGWB 1H0DA 2D9CA 2ESVA 4ODHH 5GQBA 2NY3B 4M6AA 1PG7L 5E5MA 1D9KC 1NQBA 3TZVD 5GRUL 4BQCA 3FT3A 1RJZB 5HI5C 3EJYD 1I8IA 1G7JA 2I9TA 2D0GA 3FAXA 5ILTL 4ZS6D 3HZVA 4IDJH 1M7DB 4UIMB 1QFWI 3QNZB 2V2WA 4PRNA 1MFBH 2X9XA 4GQ9L 3FB7B 3FQXB 1TZHA 2NXZD 4ETYA 3D39D 1CDIA 1S7UA 3FQUB 3EDFA 3CC5A 2J8UA 3LKQB 2PW1A 2Y07H 4PJ8A 1CYGA 4O58L 3ZKNC 5SX5K 3O9WA 1CTNA 3QIBB 4FFYH 5DJYA 2HT2C 4N1EA 4MA8L 2AXGB 2DIAA 3U4BH 4NYLB 4JAMA 4ISVB 3QH3B 4XP4L 5HI4D 4YBLC 1NAKH 4KZDL 1NCUA 4DCQB 4UT7H 4HIEB 3GIVB 4OGAC 3LKOB 1NBYA 3TV3H 1YEKL 3L3KA 3P9WB 1XF1A 2DQEH 4WWKD 3EDDA 4GG6B 3DSFH 1SMOA 4ESKA 3WNLA 2VB5A 4UOW1 3X13A 3TNNB 3MRDA 2NNAB 2VLKD 5C08E 1A6WL 1KJ2H 4XB7A 3RZWA 4J4PD 1NAMH 2IGFH 4JRXE 3LN4A 2QSQA 1A7NH 1KPUB 4TQEH 5E6ID 1EO8H 2GTWB 2B39A 2FJGA 3U7YH 4YHIB 2V5TA 3GIZH 1RIVL 3L5IA 4LPWA 5DK0A 5DRNB 4XVTH 4XXCC 2X1WL 4HKZA 4UAOB 3V95A 1LGVA 4HPYL 4ODVL 3W9DB 3MRFA 4ZO6A 1FNLA 3H2WA 3ULVL 1IC4L 3D3VA 3OBAA 3TH2T 3WN5C 1S7QB 4LIQL 2R2HB 1FL5B 5I1KH 3T0WA 5E5RB 3BD4A 4ORZC 3U2SB 3EZJB 5D93C 1AR2A 1DQTA 4PJ8D 1ZHNB 4M7LT 4IRSC 1KIRA 1RZFL 4L1HA 3E8UL 1UZ6F 3O9WD 2GJ6E 4HUUA 1SJHB 3VXME 4QXTA 3WLWC 4NKMB 2HFGH 4RRPG 1XH3A 1B88A 3T0EC 2CLZB 1CXKA 5KSBE 1D9KB 5CP7B 2BNRA 5FO8A 2O5YL 4TOYH 4PJ7E 3MRLA 4FQCH 4MMZC 3VGDA 2GAZB 1Y6MR 4PRDB 4BUHA 3HA0A 1HH9A 1FE8H 4I9WE 4LCWA 3UTQB 1LP9A 4HS6A 4X4ME 1RFDL 1WAAA 3NZHL 3V0VA 3VI3E 1JWMB 2IH3A 4DVBA 1CFTB 3VJ6A 3FQTA 5FECA 1B0RA 4JFFA 5TDNA 4KKCD 4ZUVB 1NUNB 5T3ZL 5CS7A 1MIEL 4ETQA 4LSSH 1EBAA 4LDOB 5I1HH 1R3JA 5J1AA 5IB4B 2YD6A 1QA9A 4XPHH 4BK5A 4DZBA 4OTXL 1CG9A 1U8JB 3EOBB 3QI9D 3K1KC 4XAWL 2NLJA 1CFVL 4CVUA 4YBLB 4PGBA 3B5TA 1OAYL 1I3RA 3QG7H 4OD1L 3F8UB 1N5AA 5LCVL 1KLFA 1TNNA 2C1PA 4X5XB 1ORQB 4I0PC 1I9RH 4X8JB 1JNHB 3REWB 4WI8A 2ICWB 2D7OA 2YPLB 3AROA 2RCSL 4GOSA 4MAYC 4OLWH 1UKSA 3LKNB 5DEFA 3SQBA 1Q1JH 1S7XA 1CXFA 3LKSB 4FP8L 2FJFB 2KQMA 3ILPB 4NO0A 4HX1B 3I6GB 5IG7B 3KGRA 2OR9H 3QHZL 4RMQA 4D9RE 3SCMC 3GMQA 5MEOA 1QO3A 4JKPH 5IR1A 4U1HB 4DZ8B 4LAJH 1AO7D 2BNRD 4QHMB 5ANMB 4K2UL 1A7RL 5E8PB 3MRRA 4XVJL 5T1MB 4L8CB 3B2VL 2PKDA 4JM2C 2Q7YB 2AKRA 4BJLA 3G6JB 1G9ML 4LCWD 3KPLA 5F8RC 3RNKA 1TENA 3WN5B 1FC1A 5CIPA 5GGRB 5SWZD 4KY1H 2YA2A 3KDMA 4HUWA 4KI5E 3Q0HA 4JFDB 4JFFD 4FOMA 1JPTH 4NJ9H 4G6JH 4KJYA 3OPZL 5KOVC 2EH7H 1YJDC 2IMMA 3WNNA 3RTQC 1OGAE 4IRSB 3CFDA 1YPZB 1FGVH 5DJDB 3T04D 2P48B 5DYOA 2JJTC 1Y6KR 2PR4H 3L7FB 3T0EB 5M7QA 1XR9A 2P1YA 3G6DL 3QZWA 2IANE 4QCIB 1EGJH 1EAPB 3CFBA 4D3CL 4HC1H 1OVZA 4X4XB 1IBGH 1KXVC 3H3PL 4L4JA 2X4UA 4GXUN 1XF4B 3ESUF 1E28B 5AAWA 1G7MA 2XZAL 4A2LA 4HIHB 5C0ND 1D5BB 5C0JA 2FCBA 2FBJL 4MQXD 4WU5B 3LSOA 3MCLH 1JN6A 5LQBH 1JRHL 5CD5D 5CZKA 5F93C 1JPGB 2D3VA 2DI9A 4JFOA 1Z0NA 1NGYA 4FTVA 5I75B 4FRWA 3EFDL 4KRLB 3O6FD 5IFHL 4HUVB 1JZ3A 4ZNEA 1T4KB 3SGEI 2NTSP 2ZP0T 5J7CC 5IMLB 5EFIA 2C3GA 1R5VA 4XHQA 4XMKH 5BW7A 4GUPA 5DMKA 2BSED 5MEQA 2R4RH 1FYTB 2E27H 4TVPL 2XZQH 1MHEB 4EDWL 1FPTH 4BELD 3BT2L 1G7QA 2H2SC 3L5HA 4QO1A 1JPST 4I0PB 2KZWA 4RGOH 3C5ZA 4JY5L 4OM1H 3U6RB 1S7WB 4F7CB 3PGCB 3W0WE 3MYJA 4XP5H 1KNOA 2AW2A 1J05A 3RL1B 1QLRB 4JGJA 1FNAA 2H2PC 5CINL 3ZDXF 1I9EA 5F7DB 4WI3A 1S9VA 2GITB 3B6SA 3TBTA 3TT1H 5GS1B 3VCLB 4K9EH 3RY5A 3CVHL 3B9AA 5F7EL 4XP1L 3BN9D 4L1DA 1AGEB 3B83A 3MRJB 1RVFH 5TQ0L 1YEDA 4JRXA 5HDQL 3SCMB 4JO4L 1X6LA 4HUXB 2BCKB 4JQVC 3LEYL 5JO5A 5L7XH 2IPTH 1FNSH 1ZTXL 5DQDL 4EBQL 1LEIB 4DQOL 1E4XL 5J12C 4JM2B 4K3JH 4TSBH 5J89A 4RA0C 4XCEA 3IF1B 2WP3O 4I3RL 2EO1A 3BKYL 3U9PH 4IRJD 4Z8FL 4PJCE 3NCYS 5D1XB 4JN1L 5FDYA 1J8HB 3STBA 1BBJA 1NCWL 3MROA 1I8MA 3DHJA 2CIIB 3O6ML 1KENL 3D6GA 4XP9L 3M17B 1RU9H 4P2RE 3AU1B 3I2CL 1BQHG 4FTVD 3KYAA 1QR4A 1U8IA 2Q1EA 3QT2A 3UTPD 4YDIH 1ZHLB 2E6PA 2FEEL 1T20A 3JV4B 3QUZA 5F96H 5DO2C 4YBHA 1S5HB 1QFUH 2ARWA 5EBMB 2D31B 2B1AH 2WWKT 2DQCH 4K23H 1ZT4A 1A7QL 1KCSL 1AC0A 3VFRB 4KU1A 4Y0GA 3P30L 4H25B 1HCFX 2BSRA 3PWLA 5L88L 3EYFA 5FYKL 1MCKA 1FNFA 4OZFB 3D0LA 5E2WH 4RFEA 4S1DC 5GRJL 4H1LG 1A6VL 1HDMA 4NRZA 2FATH 1N0XL 3BMVA 3WHXA 1U95B 1I7TB 1SY6A 2BJMH 4ONGH 4M43L 2EXWC 5E1AB 5C08D 1R6VA 1PZUB 1HCVA 4WNQB 1A0QH 3TJEH 3FT2B 1A14L 4JRXD 3KXFE 1P7KB 1A3RH 4S2SB 5JIHA 4GRWH 5GJSH 4O9HL 3CSBA 4NN7B 3ISWA 4KMTH 4NKDB 1QLFB 3VWKC 5JNYA 3VGEA 4YDVA 4X7TB 3V2AR 5CGYC 1ZEAL 4FQJH 1BGXL 3QP3A 2X70B 3C6LC 5DA0B 4Y2DC 25C8H 2BOCB 5ID0B 3UJJH 1QLEH 1RZ7H 3O3AA 4EDXA 5I17A 2BVOA 2VDOH 5GIRB 5KN5B 3SKJL 2YKLH 3IS1X 4ZDHA 3UTZA 32C2B 5HHOE 1KLGA 2OYPA 5D7SH 1CGVA 2XZZA 3TC9A 3RVTC 3SGDI 5BXFB 3P0VH 3QIUA 3VXMD 3O3EA 3HNSH 3IT8D 5F3HB 4JQIH 4NO3A 3DO7B 4ZOBA 3SJVE 3IDJA 1FBIL 3F7VA 1F2QA 2R2CA 1SY6H 4QGYA 5J12B 4KC3B 1OWWA 4UOW0 1T0MA 4I9WD 1YMMB 1HYSC 3DETD 1KTLA 3FO9B 5J56B 3CFCH 2ADJA 1MCPH 3C5SB 3BZFA 1FGNH 5KW9L 1OSZB 1DBKH 5FA4B 2W07A 3ARGD 5BCAA 3PGFH 1P5VA 3TN0C 5F9OL 1OGAA 3I6KA 4IS6A 4WTXA 1FLTX 3ALXA 4P46A 2DQGH 1CDYA 4KJPC 1INQA 2NXYC 3QYCA 1RUKL 4LCYB 2E6JA 4XPFH 2B4CH 5DJ8A 4LEOA 3U4AA 3SQOH 3FO0H 5ICXB 3P4OA 2X1OA 4HJGB 2XWJA 1JF1A 5HGBB 1I8KA 3BRFA 3WL9B 3KJ6H 2ED7A 1FFOB 2H26A 5HHPB 1GC1H 2ITDB 5HGHB 3WUWB 1FYHB 3KYOA 5IMOB 1K2DB 3W82A 3HI6L 4HMDA 2DJUA 1KJ2B 3AY4A 1M05B 4W6XB 3SE4A 4NFDA 4YEFA 4GJTB 2YRLA 4DK6A 2ZOKB 3PP3K 5ACZB 4AENB 4UDTA 3QFJE 1GZQB 1T6WA 3VA6A 4TUOA 5MI0C 4D9RD 3VXQA 3CXDH 4OGXH 1F2XK 3QIUD 3C60A 4YXHL 3VWKB 2YD9A 1AJ7H 1RY7B 3OKMB 4U2ZA 3PL6A 1WITA 1NCAH 5E08L 3BWUC 3D2UA 3EOAB 2NY7H 3QEQE 1NCBL 4O4YH 5HYJA 4HZLA 3QHFH 3U0PB 5FHBH 5C0EA 3OR7A 4DVRL 2PUQT 3STLB 1X5JA 4Y2DB 4XPGL 1MNUH 3W0WA 4M8VA 5TE4H 2JB5L 5I8CB 4KI5D 1JTOA 4KXZH 4XNZC 1BD2E 4NWTL 2RFXB 3WFBH 2BY2A 5H2BA 3U1SL 2R0KL 1OGAD 3BEWB 1ZS8A 1IARB 3VD3A 4LPTA 5JXAL 4P46D 4B53A 1JGUL 1KPVB 4D8PB 4P5TC 2IJ0C 7FABH 4K94H 3MACL 1V3JA 3VG9C 4K8RL 1KIUA 5E94A 4F7MB 1AKJA 2IAND 1NFIB 4WW2C 4XMPH 4BSVA 3DUHA 1D6EB 4WHCA 3ES6B 4OV5B 5L2KB 3MLVH 1DLHB 2I07A 4IHOA 3DPBA 1TZGL 2X2YA 4HS3B 4XPTL 2AXFA 4JB9H 1QBMH 1X6NA 4UU9A 3GHEL 4UT9L 2DMCA 3O2WL 2RBLA 4CADA 1M71B 5HPMB 2W0FA 3W9EA 2P46B 5C0DB 5J57B 5TDPB 4CVZB 3IB4A 4R3SA 5F70A 4EVNA 4GRWF 3SGJA 5F6IC 1WIOA 2NXYB 1BIHA 4JZJC 2OK0H 3LKPB 4I0CC 2YD7A 3KR3L 4NT6A 3S34H 2MHAA 5DJAB 3C60D 3U36B 3ZKSD 3C08H 3RGVA 2PO6A 1K9TA 4OZGE 1IM9B 5KVGH 3PL6D 3GNML 1IM3A 2YWZA 5EZJA 3HN3A 2VQ1B 4D94A 3CZFB 3TA3A 5KSBF 3BGFC 4KUCD 3EDEA 3VD7A 4RGNC 3EYQC 5GSRA 1T03H 1T89C 3MRHB 4PJ7F 3PGDA 4JHWH 1TJGH 4TPRL 3W0WD 2MKWA 4YXLH 4OCMC 3PIQA 4ZFOA 1EEZB 5FIEA 1NJ9A 2W9EH 1TCRA 2ENSA 3F65A 3VI3F 3GMPA 2QQLH 2VDMH 5FOJA 1RZJL 3TCLB 3HNTH 3V7AE 1CFBA 4LBEB 4RAHA 5HVFB 5IFAL 2CO6B 2P24B 3GKWL 1DBAL 4G8EA 5IHBA 4NZTL 4KKAD 4X6EA 4IOIB 1P4BH 5MI0B 3KXFA 4PUBH 5EZLA 2JIXA 4IIQA 4R26L 3G5XB 3D0VB 1AKJD 4XNXH 4IMKA 1T1XA 4TRPL 1CXIA 4I8DA 1QVOB 4J3VA 1HK6A 4PLKC 2BOBA 2R1XA 4KKLD 4ZAKB 5HD8D 3HLAA 3CSYA 1WFOA 3AFLA 2IBBA 4AM0B 4FQ1H 4NNXB 3RI5F 4WHDA 3IETA 1WBYA 4NQDB 1KSRA 1IGCH 4DN4H 4U1SB 4OZFG 4P2QA 3BIAX 3GRWL 4XNZB 4M5ZH 5IW6A 2C3VB 3D85A 4WEUD 1AP2B 1JIBA 4GAJH 4HJJL 5HHOA 1WZ1L 2BSSB 4UMGA 1AQKL 4Z5RB 2WBKA 4EN3A 4PLOB 4D0BB 5E7FA 3TH3T 3IFNL 4P5TB 1U8OA 5D1ZC 1SYVA 1W72B 1KFAH 1U91A 5C07B 4PJAB 3VXSE 1T04B 4HDIA 3H9SB 3SJVA 4JVUA 3WHE1 4RMVA 3FZUD 2V9TA 5B4MD 4U6TA 1A2YA 2PO6D 1KF9B 2KH2B 3GEWB 5FO7A 4LRNH 1FL6B 1BAFH 4HGMA 1KCKA 4J2XA 3TWCH 2DLFL 3CU7A 4W81A 3OGCA 2OL3H 1P53A 1KGCE 3AS0A 1MSPA 1TTFA 5CZXD 1UEYA 3BH8B 1Z6JT 3WS3B 1CN4A 5ICYA 2MKLC 2R69H 3HRZB 5C0AE 2JCCF 1TJHH 43CAB 2FLBT 4KVNL 4P23A 2H1PH 1RULL 1T21B 4KI5F 3R06B 3SDDC 3GDBA 3BP5B 4YWGL 4RAUB 5T3XL 5F6IB 1KG0B 4WUKH 4JZJB 5C2BH 3KXFD 3OZ9L 2A1WH 3X12B 5MEPB 1TDQA 1PY9A 1NGPL 1P4IH 5IB3B 3SDAB 2D7TL 1OB1A 1CVRA 2NW3B 2QTEA 2VDKL 3IDUA 1MCSA 5DC9B 4RGNB 3AGVA 5CSBA 3GJFA 2VC2L 2GTZA 2VIRA 1I1AD 3F12B 4Y5XB 3SGKC 3ZYOA 5JOEA 4MDIA 1G7LA 4CL7A 3AUVA 4M03A 2DOCA 4NPYB 4LLYB 1JZ6A 2Q20A 3BPCB 4KDTC 1HHKB 1U8NB 4UUJA 2HN7A 4PJGB 4V1DB 5DS8A 5HHOD 5INDA 1MAJA 3NZ8B 4X7SL 4QXUH 5DD3H 1S7TB 2LV4A 1RMFL 5D1QA 3QFJA 1KCUH 4HF5H 3NCEB 3QCVH 3IFLH 3FB6B 2WW8A 4M6ML 5JDSA 2OTWB 5E2VH 1DUYB 3WIHH 1RZIA 4LLDA 2A0LD 3PHQB 4R90H 3SJVD 1G9NC 3BAEH 3CPLB 3DBXA 3TBWA 4OCXL 4JG1L 3QO1A 2EDLA 3PJSB 3OAYH 1ONQB 2V5MA 2NZ9C 3E2HC 3HC4H 4WU7B 3QEQA 5CUSH 3HI1A 1FFNA 1DEDA 4GRLC 4DGVH 5HI3C 4L9LA 1LK2A 1S7SA 2VDLL 3QUKA 1BD2A 1UG9A 3KPPB 1BZ9A 5FO9A 4WVRA 5HTSA 4NKIH 1FQ9C 4P23D 1OCWH 1N4XH 4R0LB 5J3HC 4PRHE 5D72L 1KIPA 2JELL 3KPNA 3W39B 5KJRL 2ADGB 3EBAA 1UWGL 2JK5A 4GW1B 5D1ZB 1J9CT 3MZTA 1UM6H 4JQXC 1FL3B 1M7XA 3DMMA 4MA7H 3A6CL 1T5XB 4UILL 5JUEH 2APWA 4L4TE 2XN9A 4ELMA 5B8CA 1Q72H 2X4NA 3IDIA 4I77L 4R8WL 1KCRL 3OKEA 1Z2KA 3C9NA 4NNYA 3VXNB 3HG1B 4B7LA 4Z7UF 2XTLA 4Z76B 2C3XA 2WUCH 4PRIA 4HWBL 1V3MA 4MNGB 4HG4K 2VXSL 3BSZL 1RJLA 2XYCA 3SKUD 3VRIB 2MFNA 4DUXA 1B6DA 4MCYA 2VYRE 4PRPE 4YHNA 4UV4L 4U3XA 1II4E 4PJCF 2HLAB 3O81A 2GFBB 1HIML 5ABDE 5IIEB 3SDDB 2HRPL 4G3YH 4KDVA 5TH2A 5E1HB 5E70A 3G08A 3PWNB 3QFJD 5D1QD 5FGCB 4P2OA 3FO1B 3ILQD 5DA4A 2F54B 4CMMB 5JHLL 1MH5A 1DVFA 5JIPA 5E4EC 3BP4A 4HT1L 4ODUB 5CKGA 1MCQA 5HHQB 5TF1H 4OZGA 5IT2H 1JZ4A 4XRCA 3GI9H 4MXQD 2ZPKH 3U0TA 1UZ8B 4TSAL 1RZ8A 1I8LC 1KJVB 1CU4L 1WICA 2A6KB 3QEQD 3QQ3A 3KPQA 1XGRA 2I9LB 1H8OA 1NC2A 3BXNA 2FX7H 2FD6L 2X7LA 3PXHA 4TUKL 3HR6A 1NDGB 1OQXA 3OKDA 3RL2A 1ZXQA 4HH9B 4NBYB 4AIZB 5C0GB 5CEZE 2J88L 4P5MA 3I9GL 1MPAH 1BD2D 4LGPB 3CFKB 4Y5VC 4RZCB 3ARTA 4X9IA 1A6UH 4XBPA 3V6FB 3E6HB 4RISH 1OF2A 2H8PA 5IVOA 5I8OH 4X6DE 3QPXH 5F9AC 3RFZC 5D2LA 5IBLD 4JPVH 1ADQL 4KTDL 1KN2L 4KROC 4K07A 5MERB 1Z3GH 1F5WA 1FN4B 3RIFK 3DMMD 4RDQF 4MNQB 2EDJA 1S9XA 2VQUA 1DQJA 1JHKL 5JPNA 2AK1L 2H3NB 2P8PB 4HXAH 1OM3L 4P3CL 3E2HB 2EXYC 1XAUA 4EIZC 1S7RB 4KPHH 5F9JA 4LF3B 1RZKC 3ZTNH 3OKYA 4Z0XA 4GRLB 3QQ4A 5I0ZA 4KK5C 4PRBB 1JFQL 2UZIH 2VXQL 5CAYB 1BOGA 2O26U 4HIIB 4OI9A 5E8NB 1M1SA 3HMWL 2YMXL 5DURD 4LCCC 4FFZH 4XBGA 1AXSA 4ZUTB 4QY8B 5KAQG 3ARBB 1YJDL 4KJQC 3MA7A 3NPZB 1LE9A 3LRHA 1MOEA 5ERWA 1HQRB 3N85H 1WFUA 5B39G 5EULV 4N0CC 1NFKA 3VXSA 3QEGL 2Z8WC 1KELH 1VPOH 2CLRB 5A16B 3DVGB 4JO2H 3X17A 2CD0A 5BS0E 4Y4FD 5EOTA 4JY4B 2ATKB 3UDWC 2VOTA 3O8XD 3NGBC 4EXKA 2HT3C 1N64L 1RUAH 1UCBH 2YUVA 3L3DA 1FAIH 1JL8A 4Q0XL 5C0BB 1NC2D 3HS0A 4KV5E 4P5KA 3ESVF 4EI5A 3GMLB 2VXTH 1T5WB 3EZ8A 2ZUYA 1BVKB 4N5EC 5C0AA 3SO5A 4A6YA 1ZA6A 2Q76A 3T77A 2XOTA 5J9PB 1QFHA 1R3LA 4U6YA 1UWXH 4F7EA 2P8LA 1PQZB 2GCYB 5JA9A 3T4YB 3MJ9A 3DUSA 2QKIA 3WFHB 3WIIH 4YHML 3TEUA 3MUZ1 1ED3A 3F5WA 1MAMH 4KH2A 1AXTL 2HVKA 1J7VR 1P7QA 4LLUB 1DQLH 2OLDA 3VFVA 1K8IA 1K5NA 4W6YB 3ARSA 1J5OH 5T1LA 4CMHC 5E8DL 3V5HA 1TVHB 3C09C 3ZLQC 2MCPL 4ZUSB 5FKAB 5BV7C 4KGLA 4Z7VA 1WLHA 1ZLVK 2ORBH 2P8MB 4Y5VB 5KSVA 5TE7H 4PG2C 2A83B 5LXGL 4O2CA 2A6JA 2E7HA 4ZD3H 4POYA 4QWWC 3M07A 3GI8L 2MMXA 2GK0B 3GRWA 2FECL 5JZ7C 4CN6A 2CKBH 3B3IB 4F57L 3ARFA 4HAFA 3DYPA 4H1LA 1WK0A 4KROB 4LNRB 6FABL 1AFVL 2DQDH 3EKCA 3SBWC 2VDNL 3VXSD 1EZVY 2B2XL 5EWIL 4A6YH 1IEAA 3LH2L 3QUML 4S1SH 2WBWB 3MRQB 2WP3T 2HJLB 2AI0L 5JW4Q 3PV6A 5IUSA 3BZEA 3QXDB 5DVOA 1I7UB 5DVKA 1RUQH 1I9IL 4YR6B 4F9LC 1JPFB 1U8HB 3L6FA 3LZFL 1I3GH 3FQRB 3WE6B 1KGCD 1BIIA 4G6MH 2W92A 4ZPVA 5K9KB 3NCCB 2YK1L 4E41E 2OS7A 4LCCB 3S88L 3TO2A 3WUZA 3OMZA 1OP3H 3QDJE 1VACB 4PLJD 5DEGB 1MWAA 2HA1A 4PP2A 5EUOE 5C0AD 1CGTA 1G1YA 1NCDL 4PRHA 1VGEL 4YHKL 3WFZA 2R2EB 3OB8A 3U7WL 3IDXL 5BO1H 3VA2C 3SPVB 4JLRA 4U1NB 4XHJC 2W9DL 3DX8B 1XF5A 3PNWB 1FJ1B 4GW4B 4LPYA 5JDJA 4QEGA 4BZ1L 2X9WA 4KK9C 5ISZA 1P7QD 2VITA 1UA6H 3QXUA 5A2LH 1N6QL 4Z0BL 1EZVX 1A3QA 3ARYA 3NGBB 4Z7NE 5T1LD 5A2IH 5MENB 3R8QA 1T80A 1B0WA 5E2UH 2JF1A 3FCTB 2DLIA 4EUPH 5DJ2A 4L8BB 5KTEL 4QXGH 4PJXF 4UZGA 4PRPA 4GMSH 1IGFL 3O2VH 3B9KB 2P47B 2UWEB 1UB6B 2YHGA 3WHE0 1PG7X 4NN6C 4N8VG 3V4VL 4OF7A 1IAOA 4NRYA 3S35L 2G2RA 4X7FC 3BEVA 2GI7A 4G9FB 4XNMB 5BZWB 4M9PA 1YEJL 3D18A 2F74A 1P9MC 1X5AA 1B9ZA 2K3TA 4GW5A 4NSKB 1O7VA 3MBED 1OWRM 1M7IB 2DS4A 2A77L 4W70A 4PR5B 4H5SA 4JFQA 3S96B 2J6EL 5I1JL 3C09B 2FO4A 3CH1B 3QO0A 3VRJB 2Y6SD 1CFSA 1KLUA 1ND0A 2DAVA 4OZGF 5BV7B 5CZVL 3L5WB 4NKOA 2EKSB 2FX9H 2IFGA 2VNCA 1KTDA 4X83A 3DJ9A 3NIGF 4JZOA 1UFUA 3MV7E 4H26B 4L4VB 5EC2B 3IXAB 3IAPA 4PRHD 2CH8A 3PWPE 4X6DA 1IGYB 3P40A 2OJZH 5C71A 3MREA 5LWYL 1FO0L 2YC1A 1FDLL 5C6PB 4FQIH 4XBEL 3L3HB 3LY6A 5FF6A 4HCRL 4JFPA 4MHHI 2YD3A 2PETA 5C0CB 1DUZA 4L4TD 3QXTA 5JW5B 5IB2A 4Q9CA 4JEGB 2N1KA 1U92A 4Y5YC 4BSWB 4LSTL 4IBLT 2VDPH 1OPGL 3SDXA 4PPTA 3VXPA 1FG2A 4Q7DA 4LVHC 3CFEB 3V6ZA 2OR7A 4OLYH 3QIWA 4HK0B 4MJIB 5L9DH 5T3ZE 1NMBL 5DMJB 4QRTA 4C4KT 4O2EB 4PRPD 1WSST 4KHTL 5T1KB 1ITBB 3VWJC 5JPMB 2PTTA 2XWTA 4G8FA 5I8KH 2NY2C 2HKFL 3QFDA 5KG9A 1NLBL 2VZ1A 2DQFA 3ZT5A 2X89A 3TIEA 3TVMC 3Q5YA 4TN9A 3WSQH 4J3XA 1MELA 2VR5A 4UDUB 1BECA 5CEZH 3DRTA 5JHDB 3BJLA 2FR4B 2Z4QA 2DWDB 3T08A 5BS0A 5IQ9B 1YEHH 5D2NB 3W5NA 4KZEL 4XH2A 3ZDZE 5F7MC 4G80A 3TO4B 4LSQH 5GGSA 1UXSA 4GAYA 4ZSOB 1NCTA 1BFSA 3PXJA 1HXYA 2E7LC 2VRAA 4ORGB 1QUNA 3L7EB 2COQA 1LEKB 5CEZD 6CGTA 1EVUA 3EIFA 2QSTA 4D9LH 4TVSa 1DN0A 4PJIB 3EOTL 1MRCH 5HDBE 4NN6B 3QCUH 4OFKA 1QR1A 3BQUD 3AREC 3JUZA 3UZVB 4TNVF 5C09E 5LGHH 2HT4D 5CJQL 3IDNA 4OZIE 5DUBB 4U1LB 4MJ6A 4MAYA 1ZA3A 2BXZA 2XICA 1CFNA 2AV1A 3TZVC 3OX8A 1G7IA 1R5WA 3EJYC 4OCLC 1QFOA 4F7PA 4PJEE 3WKML 4I18C 1NLDL 2R1WB 3DECA 5D7LB 3VXOB 1BBDL 5E99L 4IMLA 1RJYA 5DVMA 4NRXA 4OCRL 1FP5A 4KHXH 4ZG1A 5E24E 4G43A 2CJUL 1VFMA 3OB0K 5FGRA 1JNNL 2NXZC 4YHZH 2ZUSA 4NNPL 3G6AA 4TULH 3QIWD 3F6LA 1H15B 2APVA 5IM7A 2PTUA 4HWZA 5E2TH 1D5XB 1P5UA 2C9AA 4U6XA 1ZGLA 3BIBX 1B4JL 3S5LB 2V9QA 1F11A 4OCSL 1PKQE 2Y23A 1E4KC 3CGTA 3RUGF 4JZNB 1JWUB 4F7TA 1F3RB 5DJCB 2LU7A 2YD8A 1NCCL 5HI4C 1BQSA 1NFDE 3EO9H 4LGRB 3C6SA 1IGIH 4LNVA 5F7YC 1HN1A 5SV4A 1EUTA 2AJXL 4Q9BA 5BS0D 4Y5YB 3WLBB 5BQ7A 4JY6A 2X6MA 5D6DC 1FCCA 1H5BA 4MJ5A 4XCCL 5DRZB 4OZHE 3Q6FA 2AV7B 4WWKC 2FIKB 1FHGA 3ELAT 2FL5A 3NN8B 3DRQA 1XR8A 1G7HA 1A6AB 1I3VA 3GSVA 3W11C 4M9OA 5EUOA 2X4RB 5EOQH 2YPVH 3LS5L 4ONFL 2YBRA 5CBEA 5D71L 3CK0L 4J4PC 1IC7H 3OHXB 4X9GA 5DT1H 2NY2B 3CCHB 4BFEA 4Z78B 5IJKC 1FNGB 5E6IC 1GGIH 3TVMB 4PY7B 1Q9OA 3MC0A 3PQYE 3WYRA 2VXUH 4GKZA 1KXQE 4DEPC 3ROLB 4EXPX 2NX5B 4PJ9A 1DFBH 2JE8A 4EOWH 35C8H 3LPWA 1BX2A 4NZRH 5AAMA 1OAUL 4YJZL 4PYHA 1UKTA 5IROA 4OCYH 4NZDA 4ZYKA 2QR0B 4AMKH 3FONB 4S0TD 5GGUB 5GGVY 5I8EA 4J3SA 4M8QA 3GBMH 4HUMB 3OV6A 1PG7H 3MXVL 4PTTB 4BQ9A 4U3CA 1AGBA 5EC1A 5DMGD 3T0DA 1KC5H 2V7HB 2AXHA 2Y25A 3UO1H 3PDOB 1IQDA 2FWOB 3NAAL 3QEHB 4QRPE 3RBGA 4ONOA 3E3QC 1HE7A 4PJ8C 4X6FB 1WC7B 3DVIA 4OFIA 2PYFB 3VGAC 1FV1B 3ARWA 3L95B 1K3ZA 3RWJB 2LAAA 3O9WC 3S3JA 5KZCD 3AREB 3LQZA 4YPGA 1WWAX 3QDAA 4PJBE 2WBJB 2R1YA 3FB5A 1CVSC 4PGDB 2IAMA 4I18B 3MRIA 3EYOA 5HY9B 4NGHL 3MLTB 4ZFZB 4YDKL 5TFSL 1YMHA 3GSOB 3I85A 4PJDB 5DJ6A 4UNVA 2G60H 3KPTA 5ESAB 3LMJL 1QSEA 3JTTA 5MHSD 4PJFA 4NWUL 3IS0X 1CQKA 4JQVA 2I60H 4F9PA 2NXZB 4KKCC 4DAGL 4XP4H 2AJSL 2R8SL 1YN7B 3T4AB 3MUY1 4E41D 5CEXB 1HHIA 3DTXA 3HC0B 3QDJD 4OF0A 1PD6A 1ZVSB 1KPRB 3PHSA 4XC1L 1J1XL 3MV7A 3RNQB 5F72S 5ESVA 3WDHA 4XZUA 4LCUA 1YEKH 1PFCA 2IPKB 4B41A 2WIIA 3MGTA 3MMEB 2VLRA 4GKOA 4A2MA 2EKJA 3QI9C 3WKNA 2M8XA 1BREA 4GG8A 3RZCB 4NQXB 5IFJA 3FN0L 4PJ9D 2NCMA 1HQ4A 1UM5L 1A6WH 1U8QB 3FTGB 1S9YB 2EZ0D 2R0ZL 4LARH 2DYPD 3H0TA 2V7NB 5EH1A 5IEHA 2RHEA 4YIQB 3G9AB 4C56E 2VL5B 3DI3B 1JUFB 1KJMA 4JPWL 2R9HD 1P2CB 4I5BB 3BIKB 4UQ3B 2VLKB 4HPYH 1KBGL 1TVBB 3OR6A 2EDWA 4ODVH 2DQUL 5IMKB 3ULVH 3WFDH 1IC1A 1WTLA 2DQIL 1YQ2A 1ZMYA 4PBVC 1SJEB 1MY5A 5GJTL 1H0DB 3WFCL 4KTEL 2ESVB 1LO0L 5E5MB 3IJSA 4WY7H 3FT3B 1JV5A 1MFEL 2J4WL 1SJVA 2VWEE 4MLSA 4Z7WE 1I8IB 3MR9A 1G7JB 2IAMD 1KEML 2I9TB 2ILLA 3MNZA 1RZFH 4Y2OA 1AY1L 3E8UH 3BZDA 3HZVB 1T3FA 3QUYA 4WW1A 4WI7A 3IFOA 4F8QA 3OKLB 1ORSA 2V2WB 4PRNB 1QSED 1Y18A 3MBXL 4PTUA 4N0FA 1BJMA 1Q94A 5DJXA 2O5YH 1TZHB 1WFNA 3X3FL 5C0FA 3OL2A 5EU5A 2HFFB 1S7UB 3P4MA 3CC5B 2J8UB 2AJVH 3MRMA 5JIIA 2ED9A 2M1KA 3UX9B 3VH8G 2B7DT 4D0CA 3LCYA 3MV7D 1XCQA 4V2CB 3NZHH 3O9WB 3RQ3A 3PWPD 5DJYB 4GMTL 2FH6A 4U1JA 2VLRD 3MJ6A 3N1PC 2P49B 3F7PC 3DO3A 1B0GA 1MIEH 5T3ZH 3X11A 1REIA 1UH2A 4PJEA 2E8YA 1FO0A 2BVQA 4FFVD 1QTYT 4OTXH 3NMEA 1MFCH 5GS0D 5TPWH 3BOVA 1U6AL 1ZLWH 5C0NC 1NBYB 3L3KB 4XAWH 2OSLA 2P44B 4MQXC 3T1FA 2FEDD 1P7HL 1EPFA 4L3CA 5CD5C 4OLXH 4JJ5A 1OAYH 3X13B 5L2JB 1YY8A 3CDFA 4OD1H 5T3ZD 5LCVH 4L3AA 4BZ2L 4FG6C 4JDTL 3MRDB 2FLRT 4JFEE 4BSJA 5FCSH 3VFPB 4L8SA 3MO1A 1KULA 3O6FC 2WINA 4Q74A 2F8XC 3LN4B 5JQHC 2X09A 2RCSH 3ZKQD 2FJGB 1TITA 2VLME 2JJSA 3BX7C 2OP4L 4KUZL 5I1IL 5IB5A 2FO1A 2ERJC 3HMXA 4FP8H 4HKZB 3TT3L 1XGPA 4F33A 5CJOL 3MRFB 3QHZH 1MHHA 3OKNA 3QUYD 2GSGA 3D3VB 2B20A 5D9SA 5BVJA 1URLA 4EUPB 2OTUA 2NW2A 3WFEL 3ULUE 2CR6A 4PS4H 1OL0A 2R0LL 2X5PA 2P4AB 5HXMA 1DP0A 4K2UH 1A7RH 4LQ1A 2BNQE 1UEMA 4PGEA 3VXRE 3B2VH 3CD4A 2R29H 3PWUA 1OAZL 3BN9C 4G42A 2DJSA 4YE4L 4WV1A 4Y7MA 1DANT 2N4IA 4HUUB 3SO3C 4QXTB 3C2AH 3CDGA 4HV8A 5C09D 3PWJA 1JYNA 4P59L 4HIJA 2BNRB 5FO8B 3GB7A 4HEPG 1QFWL 2G75A 4UV7H 3MRLB 4JREC 2V9RA 2BXYA 4OLVL 2X4QA 1HH9B 1E6OL 1LP9B 3CMGA 5CEYA 4HS6B 4F8TA 4IRJC 3V0VB 4G8GE 5B39A 1A3LL 5L6YH 2IH3B 3G6DH 4DVBB 3BZ4A 3P0YL 1CLCA 3VJ6B 4YDLC 2F58H 2M26A 3LEXA 5FECB 4JFFB 5TDNB 3BWAA 5D7IA 4U49A 4X6CE 2P7TA 2CDFA 3ARVA 3TP4A 4ETQB 4QRPA 4Z7NF 1JZ2A 4DKEL 1R3JB 2XZAH 1GGCL 3QR2A 4PD4J 5IF0A 2HMID 1NBVL 5J1AB 1HNFA 1QA9B 3GHBH 2DWEA 2PYEE 3O0RH 4DZBB 1CG9B 1X9QA 5AWNH 1OAXH 8FABA 4K7PY 1MVFA 1JWSB 3K7UA 1JRHH 2Y5EA 5BW7C 2NLJB 4GH7B 1ZSDA 4HZAA 4PJBA 4PB0L 3SY0B 5HYQA 2M2DA 4PGBB 1I3RB 4R2GC 5GGVH 1MI5E 1N5AB 1F4YL 1OP9A 5IFHH 2NY4D 4JVWA 2C1PB 1KB9J 4OUUA 3L3OA 5FCUL 1S5IL 3HNVL 1G7PA 1EJ6A 4LAQH 4S10A 3SE8L 4YDJA 4J7RA 1GRWA 2LE9A 1RZKL 5DEFB 1F4HA 3O6LL 4CU7A 3ULVF 4WW2A 4EDWH 3NCFB 1S7XB 2IPUK 3BT2H 2EDEA 4FQXD 3TYGL 5DEZA 2G9HA 2B8OT 2HWZL 4NO0B 4EQ2A 3EYVA 4P99A 3GMQB 4Q9RL 1QO3B 5IR1B 2EE3A 1HOCA 1UCTA 4UT6H 2DIBA 1MJUL 3PQYD 1W0WA 3MLPA 1J1PL 1VKXA 4MB3A 3CVHH 2Z0BA 2KZ1B 1WIPA 3MRRB 1IC5H 5F7EH 4K7PX 1D5IH 4C55A 4CBPA 5BOZG 2AKRB 5TQ0H 3ZE1E 3KPLB 3RNKB 1LK3H 3CZJA 3VW3L 1IGJA 5CIPB 1A4KA 1ZTXH 3KDMB 4HUWB 5DQDH 4DQOH 4EBQH 4QHKJ 4JPKL 3OXRB 2V5SA 1E4XH 2VUYA 4XWOD 4GG6E 1CK0L 1MREL 3D1MC 4Y1AA 3T8XA 4QRPD 4QNPE 2KKQA 5FKPA 3GSNA 2CGRL 4PRAB 4Z8FH 1R5IA 4M61A 1DZBA 4XVSH 4JN1H 4R4ND 5DXWA 2FJHA 2XFXB 2BVPA 4APQD 5ITFA 4HKBA 1XR9B 3G5YA 3QZWB 4OGZA 3JV5A 1KENH 1LILA 3CFBB 4XP9H 4WI6A 4ALAH 2HJFA 2MQ3A 4Z7WA 2NZIA 3STZB 5EN2A 3QDGB 2BY3A 1G7MB 3HUJA 5E8EA 3S4SA 2ZUVA 2K9UA 3DETC 5C0JB 3LQAH 2HVJA 2GJZA 2GEEA 1AD0A 1A7QH 3LSOB 5FDWB 1JN6B 3I02A 3P30H 3ZDZF 1MCLA 3KG5A 3RVVD 4JFOB 4OCWL 4B7IA 5L88H 1VSCA 1OAKL 4FTVB 5FYKH 5BV7L 1IAIL 2CPCA 3R0MA 5GISH 3HFML 3VGBA 1OT2A 2Y06L 3MFFA 5GRJH 1QFPA 3BDBA 4EZMA 3IKKA 1AGCA 5EFIB 4PGJA 1A6VH 3V6BR 4FFWD 5D8JL 1R5VB 2DIJA 4WCYL 3MA9H 4GUPB 1PG7W 4TTGA 2GUOA 5DMKB 2ITCA 5HDBF 5MEQB 3A67L 2FZ3B 4R2GB 4M43H 2R0WL 1JK8A 1FORL 5DD1L 3HCVB 1FZOA 3GSUA 4RFOH 3LD8C 3L1OL 1XCTA 1G7QB 4OZIF 4KK6D 3C5ZB 2GT9B 3BE1L 3CLFL 4LDLB 4U6HA 3MYJB 1C7TA 1KNOB 2LAGB 4C56D 3OXSA 5J13C 1U3ZA 1T2QL 1G9EA 1AXIB 2B4CC 2D2OA 1S9VB 4P4KA 4RMSA 4Y16D 3TBTB 1ZLUH 4H0HB 1ZEAH 4JFEA 2DBLL 1G6RA 1BGXH 3BHBA 1H3PL 3CLEL 5T3XE 1YEDB 2XKNA 4JRXB 1MLCA 4OBRA 2VLLA 2W60A 1WUNT 1U58B 3QIUC 3LV3B 4R7DA 1VADA 4OAWA 5JO5B 4XC3L 3GK8H 3SKJH 1OAQL 5DMIL 4Q9QL 3RI5K 4BH8A 1VEMA 1ZANH 4OB5L 4ODSH 4HH8A 3AS2A 4XCEB 4I2XA 1GZPA 2E9IA 4CGTA 2J2ZA 4M62L 1C08A 1NFDF 4JDZA 2VAJA 5I9QC 1BBJB 4KI5C 4OQTA 3MROB 1I8MB 4NHCH 2YPLE 4L8DA 3R1GL 5FGSA 5AZ2L 1XGUA 2C7UA 1TXKA 1JGDA 5CILL 4OZHF 4F37F 1U8IB 4N9GA 3EHBD 3HR5A 4P46C 3E1F1 2I5YL 1T20B 3QUZB 3P0GB 3T0VA 4WO4A 4XAKE 5IBTH 4JFYB 4R7NB 5FYKU 1ZT4B 3RVXD 5JORA 1ZT7A 5AG8A 2DM7A 1A4JA 3OKKB 5F9OH 4KDTA 1T83A 4YNYA 3GMNA 2BSRB 3PWLB 1G6RH 2MQCA 3KLSA 3EYFB 4PB9H 4ZO7A 1CGXA 1NMAH 5ANME 1FLRH 3BRDA 4N0UA 5EIIA 3D0LB 4RFEB 1PX4A 4G8GA 1UWEL 5GRYA 3WS6C 1QPPA 3TLRA 3NFNB 3G6JE 4K94C 1JI2A 4F80A 2CUMA 1L6ZA 1HDMB 5GGTL 1R0AH 2MPAL 4M6NL 3WHXB 4P4KD 3SE4C 1CD1A 4JFED 1CXEA 4MAUH 1ERNA 4ZXBD 4D9QE 4MXWL 3KYMA 3HI6H 1YPZE 4OQTH 1EDQA 3C60C 3O2DL 5HVHB 3SDCB 4UB0L 2MJWA 3PL6C 4U1MA 5JNYB 1AGDA 4YDVB 1OOAA 1MI5A 3LD8B 4HQQL 3WDJA 1EEUA 2HYMA 1INDL 1WWCA 5GGRY 5BRZA 1I7RA 2F5BL 3BPNB 4HGWA 3UTTB 5KBNC 3UBXA 3ULUD 5J13B 3QISA 3O3AB 2YS4A 4EDXB 4RMWA 1QQDA 5I17B 2BVOB 1CICD 4ZDHB 3UTZB 1KLGB 2AEPH 3FQXA 1NCBH 3MJGX 3J7HA 4NBZB 5BVPH 1H8NA 5I1EL 4K7PH 1YNKL 4KKAC 5IVXA 2CIKA 2HTLC 5J6HA 2MWCA 3NFSL 3O3EB 4NO3B 2NYYD 3NCJL 4NWTH 3QIBA 3IDJB 5IB1A 3F7VB 1CBVL 2ZCHL 4IEFB 3U1SH 4KKLC 1OTTC 1MJ8L 5JXAH 4NQEA 4ISVA 1JGUH 1T0MB 3KPSE 4P3DB 1SEBA 4U1IA 1LO5A 2K1MA 5CP3A 5I30L 4K8RH 4G8GD 1KTLB 3NFPB 1X3DA 5I9QB 2ADJB 3DNKA 3BZFB 3SE3A 3K4AA 1BFOA 2VO5A 5IESL 1OGAB 3I6KB 4IS6B 2IMNA 3M45A 2XACC 2YR3A 4P46B 1UQSB 1I8LA 4GSDH 2PYED 3TNNA 2NNAA 3NABL 4PJHA 1HHHA 5JW4M 1INQB 2YD5A 3SGJC 1R3HA 5AD0A 2N7AA 4FQ2L 5DJ8B 3VFGH 2F53A 4LEOB 4NM8H 3FZUC 3RDTD 1G1CA 3CJJA 3L9RA 2XKUA 3RGVC 4MX7B 2PO6C 5E8OA 4YHIA 3P4OB 5EU6A 3VI4E 1JF1B 1MI5D 4OFYD 1I8KB 3ARUA 4LLAA 5BRZD 1HSAA 5IW1A 1SBSL 2H26B 4HWEL 4AG4L 1QNZL 3B9VA 2EDRA 3KR3H 4LOUC 5F89A 5CZXC 3U7AA 4JRYB 2HJKA 2XPGA 4M7LH 2X4OA 5I19L 5IP4A 1J8HE 3WEXB 4M3JA 2LQRA 4JPIA 1FL5A 1N5YL 1DN2A 4UDTB 4UQ2A 1CGSL 3IKCA 4TUOB 1LEGA 4TPRH 3BP6B 5GRVL 3LPFA 4JE4B 3VXQB 1MRFH 1OTSD 5JOFA 4IIQC 3C60B 2BHYA 3QIBD 4GQPH 3PL6B 1RZJH 5JQ6H 5LGJA 1QHOA 3D2UB 5D5MB 5IFAH 3GKWH 1DBAH 5HYJB 4NZTH 5C0EB 3OR7B 2XRAH 4XNUL 5F6HJ 4KWUA 2Y07L 4I1NB 4BFBD 2B1HL 4PJ5E 2CO7B 4R26H 2FHBA 2P5EA 4X9HA 1TVDA 4TRPH 1CWVA 4FFYL 1ZT1A 3I75B 5EA0L 1AQDA 2IPUG 5H2BB 3TNMA 5F1KC 1ZS8B 3U4BL 1YC8A 5IVNA 2Y5TA 1J0JA 3A6BL 1NAKL 1U3HA 4GBXA 3INUL 2ICCA 4UT7L 5INCA 5E94B 3G5ZA 2A0LC 4HJJH 4QRUA 4BSVB 3EOBA 5H37H 1WZ1H 1AQKH 2DQEL 3DSFL 3NA4A 5CMAA 5ALCH 2DLEA 2I07B 4IHOB 2PCPB 5HVWA 1X5IA 4URTB 5B38G 2AXFB 1GOGA 1TJIH 2Z8RA 2KDGA 4CU8A 4OJFH 4F2MA 1X5YA 1NAML 1ZE3C 1A7NL 1PW3A 3W9EB 4P23C 4AT6A 1DLFH 3QJFA 3EJZC 1ZWIA 1MFAL 4R3SB 4EVNB 5HGGS 2DLFH 4XVTL 5CSGA 2D4DA 4LHUG 5F7UA 1NEUA 1GHFL 4KDWA 4RNRA 2FGWH 2F8VA 2QV2A 4TTDD 3I6GA 3MJ8A 2MHAB 1CD8A 1MLBA 3S98A 2DMBA 3RGVB 1D5MA 1EJOL 2PO6B 5CCKL 1N8ZA 3U82B 1CGWA 1RULH 3RIAF 1IM3B 3TPUB 2C1OA 1DDHA 1X5HA 4NQVA 4YWGH 3TA3B 4NCC1 5T3XH 5HI5D 3MV9E 5T1MA 2GY7B 1ETZA 5GSRB 3VFMA 4NC0B 2A6IA 4LSVH 3PGDB 5EBGA 3MNVA 3ZMRA 4S1QL 3MLUL 1NGPH 1YMME 3HAEA 5EZOL 2P5ED 3PIQB 4U7SA 4ZFOB 4UINL 1ACZA 2D7TH 1NJ9B 3ZL4H 5GGRA 1VFOA 2Z31B 1K6QH 1TCRB 4GKSA 2VDKH 2NY1B 3GMPB 2W0LA 2VUOA 4TOYL 2VC2H 4G8EB 3DYOA 5D1QC 4X6EB 3ARZA 5T3XD 4FQCL 3TYFA 4X6CF 1U3HD 3KXFB 4CJ1A 4GBXD 4JDVA 4OD3L 4F9LA 3ECBA 5EZLB 2JIXB 2V2TA 3ZKND 5IEKA 4IIQB 3ZHDA 5DWUH 3OJMB 1VCAA 4K3EH 4ERSL 3MUHL 3VH8A 2MCG1 1T2XA 4LRIA 1T1XB 2VDRL 1F90L 5DK3A 2BOBB 3N0PB 2R1XB 1E27A 4MXQC 3HLAB 1GYAA 5DJ0A 3CSYB 5SWSA 2ICWJ 4BFIB 1RMFH 3UZEA 1H3VA 4NP4H 1WBYB 3JWDH 1X5FA 4TNWF 4M6MH 1XF4A 1WJ3A 1GGBL 2AQ3A 4KVCL 4P2QB 2GQHA 5IW6B 1BWWA 3D85B 1BM3H 4XPHL 4OCXH 2C3WA 2YPLD 3GO1L 4K71C 4WU5A 4HXBL 5HHOB 1G0XA 2VE6A 1QFWM 4EN3B 4HKXA 2GKIA 5IBLC 3WJLA 3AXLA 1U8OB 2PW2B 1SYVB 1NGXA 3QG7L 1VHPA 1U91B 3VDBA 1WISA 3QWRA 3DMMC 2H6PA 4C57C 5DDHA 4XAKD 4HDIB 1YEEL 1I9RL 2ZOLA 1A2YB 2AABL 5D72H 1JYWA 2CMRL 5FO7B 5B8CC 4OLWL 1UWGH 3KPSA 1MFNA 5I1GH 2H9GA 4MD5A 4ZUWA 4IDLA 3A6CH 4HS8H 1KJ3H 4G6FB 1VFAA 2RB8A 5ICYB 4J1UA 3ZE1F 1F8TL 3I84A 2SEBA 4P23B 1IAKA 4R8WH 1KCRH 5F7DA 3GSRA 5GS1A 3RBSA 1OTUD 4D9QD 4HWBH 4OZ4A 2VXSH 3BSZH 4Y89A 5LJYH 2I26N 4GG6F 4P2OC 1QEWA 1U9KA 4QNPF 4Q6YA 5A2FA 4UV4H 5DC0A 1EH9A 3SKNA 4Y4FC 1OB1B 2E8ZA 2AEQH 1W0VA 5GHWH 5ADOL 1JPTL 3O8XC 4G6JL 3O2DA 2EH7L 3GJFB 3VFSA 5DUML 1JGVL 5JHLH 2GTZB 2VIRB 4XB8A 3QXWA 3IJHA 3KPRA 1G7LB 4MDIB 3UYPA 4HT1H 5FM5M 4JO1L 4XGZA 4M5YL 1EHNA 3DUUA 3UMTA 1X7QB 2AJYH 4PGZA 3QPQD 4UUJB 3FFCA 5DS8B 3S35X 5INDB 2CIIA 1CU4H 1UB5A 2BNUB 3QFJB 5HHNA 3GBLA 1C16A 2FD6H 2AGJL 2VKWA 3CFJA 3CDCA 1QYGH 4BM7A 5I2IA 5JDSB 2J88H 3I9GH 3SE9L 3P73A 1N59A 4LLDB 3TBWB 3QO1B 2ID5A 1CIDA 5DRXA 3ALWA 4HIXL 3VWJA 3QEQB 2BFVH 3HI1B 3MLYL 3MCLL 1ADQH 3KPSD 4KTDH 1KN2H 1FFNB 1MCFA 2LTQC 1A21A 5LQBL 3BESR 1RI8A 4L9LB 4Q6IC 4PJ5A 1LK2B 3V79C 1QKZH 2YD1A 3ZO0A 4MA1C 1S7SB 1WF5A 4I0PD 5B22A 3WXVH 1IZKA 4LASL 1BD2B 2AK1H 2YEZB 1BZ9B 5FO9B 1OM3H 2J5LC 5F21B 3SDYL 5GRZA 1KIPB 3NCYP 4LSDA 3KPNB 3TJHC 5A3ID 1JNLL 3GSQB 2JK5B 4L5FL 2GYSA 2YMXH 1FPTL 3DMMB 3OSKA 2ZZUT 3FT2A 1KB5A 4DUWA 9CGTA 1U8KA 1RIHL 1P7KA 1H3UA 4AQOA 1MUJA 1YY9D 2Q3AA 2XN9B 4ELMB 5B8CB 2X4NB 3IDIB 4CDHA 5JMRA 3MUGB 3OKEB 4XMLL 3C9NB 2EYTB 4NNYB 4DW2L 1CQYA 2UYLA 1IAIM 4JM2D 4PRIB 1ZKAA 4WRLA 1RJLB 4OLUL 4YAQA 3QEGH 3QWOA 4M1DL 2X70A 5DURB 3TZVA 5A1AA 4PLJC 4YPJA 4MCYB 3MSPA 4YHNB 5D7KE 5D1XD 1J8HD 4BFGA 5L7XL 1L0XA 1FNSL 1JMZA 5ETUA 5E2JA 1N64H 1RHHA 4WTZG 4Y4HA 4Q0XH 4DK3A 5TH2B 3G08B 5I71C 4DKFH 2Q3ZA 4P2OB 1CFQA 4K3JL 4OZFH 4TSBL 4OIIL 1PGRB 1MH5B 1DVFB 4MQ7A 3D39A 4K3GA 3BP4B 1VERA 4QHNB 5C07E 1KTKE 4PJAE 5IK3A 3C2SA 4XRCB 3U0TB 5EO9A 3GJEA 1RZ8B 3QQ3B 3KPQB 3MV9A 1NGQH 1XGRB 3OB0H 2WWMD 4WENB 3BXNB 4YHMH 1E4KA 2X7LB 2APXA 4PJ5D 3OKDB 3RL2B 5DFVD 1YMMA 3O41B 4YDIL 1AXTH 4P5MB 1JNJA 2CUHA 4ZQKA 3DXAE 1QFUL 3K2UH 4Z7OF 3QJHB 4XBPB 4TNVK 2B1AL 1OF2B 2H8PB 1CLOH 3G6JF 4N90E 3FMGH 5D2LB 4LEXL 3T2PA 3BKJL 1RAMA 3ARFC 3UBXI 4CJ0A 5KVEH 2BY0A 5KVMC 3RWEA 3BYYA 2ZSWA 1L7IL 1S9XB 3MBEC 1GL4B 1DQJB 4B0MM 5JPNB 3I6LD 3G04A 5LXGH 5ALBL 2X4TB 1OP3K 3RA7H 4LDEB 1YPZF 3PABA 4F57H 5BMFL 5F9JB 2LTQB 2FATL 2Y6SC 5E6IA 1QD0A 4Z0XB 2DI7A 1AFVH 4JHZA 2KUTA 3PG2A 3QQ4B 4MNHA 1PVHA 4ONGL 4H8WC 4MA1B 1BOGB 2VDNH 5I1DA 2B2XH 3V8OA 1YEGL 3QUMH 4LKCA 5HHPA 1A0QL 2ITDA 4XBGB 4OKDA 5IOPA 5FK9A 1AXSB 1SQ2N 2J5LB 1A3RL 5I15L 4ODWB 1R24A 1QSFA 1ZLSL 1KJ2A 1M05A 1C12A 1A22B 4RDQG 4V1DE 1LE9B 4Y4HD 1NAMA 4KMTL 3LN5A 4KQ4H 2YK1H 3V6OE 3EO0A 1NCDH 3BVNA 3K8MA 3QWQB 5J11B 4G8IB 1VGEH 3UTOA 25C8L 1MJ7H 5F6HI 3IDXH 5EOTB 3MGAA 3UJJL 1D6VH 1QLEL 1RZ7L 1X5XA 2CXKA 5DVLA 2DM2A 5IHUL 2W9DH 3DVNA 3AC0A 3HE6A 3NH7L 2YKLL 3L3DB 1WZLA 3MV9D 4ZTPL 2YWYA 3RKDC 3HS0B 4HHAA 2I24N 2AXJA 4EI5B 3B9DA 3JWNC 3T2QA 3ZKMC 4BZ1H 5E6YA 1YMMD 3PHOB 3B8SA 1ZA6B 3T77B 1R3LB 2CLVA 1YECH 3K46A 1CCZA 4U6YB 4X98B 4YHOH 3T0AA 4F7EB 5I8CA 4Z0BH 4MHHG 3RWHA 2P8LB 1NGWA 5DD6B 1BVZA 2IG2L 3Q2CA 3DUSB 5I71B 1SY6L 2QKIB 4N68A 3BW9B 5KTEH 1ED3B 3F5WB 1HI6A 2QJDA 3IU3B 1BQHB 1QP1A 1IGFH 2HVKB 1P7QB 4ELKA 3VFVB 1K8IB 1K5NB 3V4VH 5EPMA 1MCPL 5T1LB 4OBSA 3V5HB 1DBKL 2XG5A 2FSEB 2MQ0A 4NKQB 3PGFL 3QI9A 1YEJH 1JZ8A 4DKAA 5E9DB 1KT2A 2W1NA 3HG1E 1WBXA 4NUGH 3VI4F 5AYUL 4Z7VB 1DCLA 5KSVB 2YXFA 1BWMA 4JM2F 2J6EH 4UOJA 3GUTA 1W0YT 1TPXC 3OJDA 4XPFL 3WO3B 4O2CB 2A6JB 2B4CL 1QSFD 4GLRH 5K93A 3L3GB 4NHUA 1A1NA 3RWIA 2CKNA 5TDPA 2ZCLH 3ARFB 4H1LB 2HT4C 3FO0L 3LIZH 5CZVH 1IAMA 4LLQB 4GRWE 4U05A 3KJ6L 1CZ8L 1IEAB 5SWQA 3WNOA 3LKPA 2F54E 4JM4H 4X8XA 5IW3A 3GM0A 4K7FB 3PV6B 1IFHL 5M95B 3BZEB 4GRMA 3U36A 5LWYH 5KSAA 5IVZA 5FM4A 3MODH 2Q8BH 3CNKA 3HE6D 3V0WL 3MGOA 4E9LA 3L6FB 4KJWD 5CGYD 1PY4A 3VFUB 4JHAL 1BIIB 3MLZH 5ADPL 4ZPVB 1AO7A 3QIWC 3X3GL 3TO2B 4Y2DD 1MWAB 2V5RA 4PP2B 3RVUD 1MIMH 3T3ME 5E7BA 3CXDL 4ZOCA 1F4WH 3V9FA 3TIDA 3KYNA 2A73A 3WXWL 3F7QA 4JLRB 2J12B 1XF5B 2EEAA 5SWZA 4OIAA 1NMBH 4LBEA 4Q97A 1SBBA 5C8JB 1YEIH 3RVTD 4JN2A 1ZHKA 5KVFL 5FHBL 2ICWI 5EB9A 3TBYA 4KHTH 1B90A 1SYSA 2V2XA 3U83A 4HFUH 3OG6B 2EEBA 1MNUL 1LMKA 1ODAA 4U1KB 5ISZB 4MNQE 5ACMA 4LU5H 2VITB 2HKFH 3FB8A 1IT9L 1NLBH 5DLML 1L7TL 3QB7C 1P84K 3MQIA 1NANH 1XF2A 3TFKD 4ZAKA 1C7SA 4FN0A 3U46A 3DLQR 1DQML 5DJ2B 3D69A 2EDXA 4R4FL 4PRPB 7FABL 4KZEH 4AIOA 4K94L 4NQUA 4YO0A 4J3UA 3QAZC 1CDUA 3HRPA 2WUBH 4NRYB 5I73C 2W9LA 2ZUUA 4ZODA 5GGQH 1ZOXA 4AQ1B 3BEVB 2E7BA 4D0BA 12E8L 1NKRA 3MLVL 3D18B 2F74B 4GW5B 1W72A 1EGJA 4PYGA 2Y7QB 4HC1A 5K59F 1LO3H 3PUCA 3EOTH 4YGAB 4K3DL 4JFQB 4U1GC 3O6FA 5KSAD 4E42A 3QO0B 2OXGA 1DEEA 5CJQH 1CFSB 1KLUB 1ND0B 3OF6A 1BEYL 5DMGC 3DX6A 1F4XL 1MJJA 1HH6A 5DRWB 3WKMH 2HG5A 1CDCA 3ZKXC 1NLDH 1KTDB 1A6TA 3QXAA 4JZOB 3DXAA 2OK0L 3WJJA 2H32H 2ZG2A 4OCRH 3U4EA 3TBVB 4X6DB 3MRCA 2CJUH 3MREB 2JCCE 4PLNC 3C08L 4XI5C 2YC1B 4FS0A 5KVGL 4ZFFB 1OP5K 2EIDA 2IWGA 1KG0A 5FF6B 4KQ3H 4QT5A 4JKLA 4JFPB 3JWOC 5B3JE 1DUZB 1T03L 5D93B 5I74C 1TJGL 3VFTB 2QEJA 4YXLL 1U92B 3SDAA 2RAMA 1FVCA 3SDXB 1H5BC 2W9EL 3VXPB 5F3BA 1W8OA 4ZAKD 1I4FA 2R23A 3OAZK 3RJQB 1NCCH 3V6ZB 2G5BA 3QIWB 1W72H 1FNEA 3DURA 4QRTB 4Y5XA 5TE6H 1G0DA 1P4BL 2AJXH 1S3KL 2YA1A 5D7KD 4L29B 3RWCB 1BP3B 5EORL 2PTTB 2XWTB 4G8FB 4XCCH 5KG9B 3ROOA 2DLTA 4Q2ZA 2DQFB 4LLWA 4IRJA 1IMHC 3H7BA 3V7AG 3V6OA 1Y6NR 2BK8A 2BC4A 4PJ9C 1S7VB 3IAQA 3LS5H 4ONFH 3CX2A 5D71H 1MQKH 2EZ0C 1X5GA 1JYVA 1FFQA 5IROC 5BS0B 5J0BA 4DN4L 2EIEA 4XH2B 3PHQA 1BF2A 4G80B 4M5ZL 5GGSB 1UXSB 4YX2L 1HXYB 1ONQA 3MRKA 3OF6D 3HE7A 2X1QA 1RJCA 2R9HC 1IGML 1OAUH 5IGXL 3WDIA 4DJMA 3DXAD 5B38A 3QAZB 4ZFOL 5H8DA 1X44A 5FUOH 1QR1B 5EO0A 2CRYA 3MXVH 5I73B 2QQQA 4XWGH 3P9MA 1HZHL 3IDNB 2XTJC 4MJ6B 4MAYB 1ZA3B 2KPNA 1BAFL 2AV1B 1B4RA 2BSTA 1G7IB 1R5WB 4F7PB 3JSSA 4LPXA 2IAMC 4Z6AT 2Q6WB 4LQFL 4LHUA 4U1GB 4WHTA 2YSSB 3HHRB 5C08A 4MXVF 1IILE 4IMLB 3TBSA 1RJYB 5HYSG 2R69L 4NRXB 4MSWB 1TJHL 3SDAD 5BJTA 1Y0LA 4F9PC 4NJAL 1DQDL 3G6AB 4X9BA 4NO2A 4Z7UE 1LO2H 5FUCE 4Z76A 3IYLW 3BKCL 5IM7B 4I13B 3O3UN 3O4LE 4NZUL 1HNGA 4HWZB 5TFSH 4YDKH 5C2BL 2NR6C 5EO1A 1P1ZA 4RBPK 4U6XB 1ZGLB 5DZLA 5KZCB 3LMJH 2BVUA 1F11B 4NWUH 4P3WA 4ODXA 4V1DD 4F7TB 2UWEE 4DAGH 3BN3B 3PDDA 3OKOA 3MCG1 2FX8H 2EYRA 3C6SB 4XC1H 1J1XH 3FO1A 1ES0A 1S9KC 4QHUB 3RTQB 5I74B 5F7FA 1A6PA 2DD8L 4FFVC 4J3WA 4RIRA 4JY6B 3MV8E 5GS0C 2DKSA 5HHQA 2CUIA 4BK4A 1H5BB 3MJ7B 4MJ5B 4P4RA 3Q6FB 2GJ6A 3VXMA 1O0VA 2EIZA 3FN0H 1FH5L 2FL5B 3DRQB 1XR8B 3HE7D 1G7HB 3QG6A 5KSBA 3GSVB 4WWID 2WSKA 4G6AD 5EUOB 1BZ7A 1FRGL 1QACA 4PJ7A 3C5JA 2UUDH 5CBEB 2YBRB 3IFLL 5K9QI 1XF3A 5EBWA 4C54A 4R90L 4X4MA 3U79A 3BAEL 4L4VE 1MF2L 1Q9OB 4GKZB 1KEGH 4KKBD 1BX2B 5D1ZD 3ARGA 3RY6A 1FN4A 4JFZH 4LK4A 4ZYKB 2Z8SA 3LAFA 2DQIH 1CLYL 4LHUD 5SV3A 3QUYC 1OGTA 4M8QB 5C0CE 2DDQL 4KTEH 4Z7QF 3FT4A 1OCWL 1AGBB 5EC1B 1WVZA 1MFEH 5CLWA 3HG1D 2OMBA 3T65A 1SJXA 1KEMH 1MCOL 1IQDB 1LO4L 4PRBA 1AY1H 5EIVA 4OQ1A 1ULVA 1UM6L 4HIIA 2CDEA 1A64A 5ICZA 4MA7L 5E00B 2ZCKH 3O6KH 4U33A 2J8HA 5I16A 4XPAL 4MJ4A 3MBXH 4ZUTA 5H94A 5DJZA 3LQZB 3NBNA 2XTJB 5EU4A 3IAGC 4BZYA 4YPGB 1ZLWK 1Q72L 3X3FH 2KQNA 3SDDD 4Y19B 1UYWL 2R1YB 3FB5B 4FHBD 1XZ0A 4XPBL 1JE6A 2BMKA 3V4PL 4Z77A 1N3NA 1EHLL</