4LSRH

Crystal structure of broadly and potently neutralizing antibody vrc-ch31 in complex with hiv-1 clade a/e stran 93th057 gp120 with loop d and loop v5 from clade a strain ker_2018_11
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
231
structure length
217
Chain Sequence
QVQLVQSGAAVRKPGASVTVSCKFAEDDDAPEHFIHFLRQAPGQQLEWLAWMNPTNGAVNYAWYLNGRVTATRDRSMTTAFLEVKSLRSDDTAVYYCARAQKRGRSEWAYAHWGQGTPVVVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multidonor Analysis Reveals Structural Elements, Genetic Determinants, and Maturation Pathway for HIV-1 Neutralization by VRC01-Class Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords ENVELOPE GLYCOPROTEIN GP120 WITH LOOP D AND V5 FROM STRAIN k
total genus 43
structure length 217
sequence length 231
ec nomenclature
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lsrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lsrH01
3FOMB 4LKCB 3BI9X 1G7IB 2F58L 2NY3D 1NGPL 1C5DB 1ZMYA 4HJJL 4CL7A 3EYQD 1OSZB 1SYVB 2DQHH 4MNGB 4PB9L 2XIDA 4KRPB 1YJDC 4PLJD 4LLVB 4QF1B 3CUPB 5GHWL 4XPGL 5BJTA 3VFWA 4XMLL 3TZVA 4N90E 5DHYB 4L8DA 2XN9E 3G08A 5DZOA 3CK0H 1RFDH 3OX8B 1G9NC 3DO7A 4OM0L 4U6VL 1AR2A 5DJYA 1N2RB 1UVQA 3C5ZC 4X6EA 4FXKB 1NC2A 2BSTB 1LEIA 1LDSA 1J1XH 4K3JH 4LSUH 2ZCLH 4ZUUB 1J05B 1E6JH 2VR9A 3STBA 2NR6C 2DWDA 3Q3GB 5FM5M 2XZAH 5IB5B 3WDJA 3K7UA 1K3ZA 3DSFH 3VFSB 5K9JH 1QSEB 1X4ZA 2W1NA 1ZHLA 4H1LG 1EPFA 1IAOB 1YDPB 5GGVY 4IJ3B 4YGVA 3SQBA 2F15A 3GSUB 2ZCKH 3ECBA 3TWCL 3FQTB 5E0QA 2QTEA 1O7SA 1TFHA 2X41A 4U6XB 1IGML 4F7EB 1YPZF 3UJIH 5I1HL 3A6CH 3QP3A 1IGYB 2X09A 1G7LA 3PQYD 5HI3C 1U36A 4WJ5A 4RDQF 2H3NB 1A6TB 4PG9B 5BO1H 4GO6B 2MMXA 4EDXA 4PP2A 3P9LA 1S5IL 1JTTA 4UUJB 3WIIL 4TNVF 4M6AA 4NC1E 1JL8A 3WE6B 5H2BB 4F7CA 3FO9A 1IAKB 1QUNA 1N8ZA 2R1YB 3V4PL 3QDAA 5HHOB 1J5OL 5GPRA 4D0CA 3FN9A 5DQ9B 5C0EA 1XF2A 4O4YH 5D96B 4FTVE 4MAYA 2WQ8A 4F8TA 4OBSA 2C4FU 4I3RL 3FB5A 4U2ZA 3UBXI 3HC4H 3BD5A 1HINH 3STLA 3HE7A 4JFXB 5I8OH 5D7LA 3C08H 1FPTL 4POUB 1I1YA 1YPZB 4HK0A 4ZDHA 3HAEA 4G3YH 3TA3C 4R4BA 4P3CH 1GJIA 1X4XA 1N0XH 4PUBL 3L9RA 5AWNH 3E6FB 1MUJA 3HUJA 4OB5L 2C3HA 1FZOA 3GB7B 1HK6A 4GUPB 4JPIA 2QHRL 3WBDA 4JANA 1VACA 2ZSVB 4I77L 1NJ9B 4D9QD 5IM7A 1S9VB 4GRLD 3PV7A 4IMLB 2AXGA 2E5EA 4D9RD 1G6RL 4LPWA 4GMSL 4EVNA 3GMOB 4Z78B 1JWMB 1YEHH 4PJAA 4GW1A 4WFEE 4YGAB 1OM3L 4EKXA 2PF6A 1T7VA 2HJKA 1DQJA 5DR5L 3FZUD 2XXMB 4WDIA 1XGQB 1AXSA 1ZS8A 3MLYH 4P4RA 1VA9A 4GG6F 5LAXA 3QULB 3O6FB 2YWYA 1KPVB 4X6DE 5JDSA 1IGJA 5GGSA 4JFQA 1NBVL 3NCEB 4OGAC 5JDJA 3WEXB 3UZEA 5GISL 4ODUA 7FABH 2V9TA 1GIGL 3LMJH 3RWHB 5DJZB 3SKUD 2F19H 4OD2A 2CQVA 1M71B 3RIAK 5C6TH 4HF5L 4N0CD 4XNZC 1BEYH 4HWNA 3MNZA 4NO3B 3EW3B 5DO2C 3W9DB 5JNYB 1LE9A 1GRWA 4TULH 4PJFA 2HJLB 1P7KB 3RWIB 1S7SA 4ZYKB 1JGEA 4G9FD 3L95A 4G6KH 4G8GE 1NMBH 2VH5L 5CCKL 1ZSDB 3BX7C 2OP4H 3HE6A 5CEXB 2MQ0A 1QLRB 1L0QA 2J8UE 4JO4H 3DX9A 1QEWB 1ACYH 1UQSB 3HB3D 3RWDA 1DLFH 1HEZA 1YYLL 1AQDA 4HXBL 2HG5A 5DJ2B 5DD1L 4IJ3C 1E6JL 5BS0D 4CGTA 1YEDB 3S5LG 3ZKXB 5GS0C 4KZDH 4X7FC 3IYLW 1OSPL 5D7KD 4D8PB 5EZLA 4HS3B 2D4FA 3HG1A 3HZYB 1R5VB 1MCBA 3QEQA 1ED3B 2ATKA 4Y2DC 2BRQA 4KTEL 4J1UB 3U4AA 2ARJQ 5I16A 3QDJE 5DJAB 5J13C 1P7KA 3RWIA 3QDMB 4P2RD 2BMKA 4ZAKD 1G0YR 4QTIH 1RULH 3EO9L 3SJVB 1EFQA 5MP6H 4WTZA 1WITA 4JM2A 5EU7E 4KZEH 2D7TH 4F9LA 5EU5A 4OT1H 2BY2A 4HEPG 4I0PC 3WLWD 4R90L 3GEWB 4U0QB 4K3HA 4G9DA 3PGDA 2A83B 1FGNL 1VESA 5TDPA 3EYFB 4PJGE 3BPOC 2ITDB 3WKMH 4B41A 3R1GL 3OKOB 4XGZB 3O9WC 4KAQL 3WO3B 3AAZA 1OTUC 3QUMB 4JO1L 5C09E 3BPOB 4X5XA 1HSBB 4GMTH 3U0PB 4K55A 4MVBC 1DBAL 2KDGA 4EDWL 4KJQC 4YFLI 3HUJF 3UBXB 2DYPA 4KDWA 3I3BA 3B6SB 4RRPG 1BQHG 1U95B 4J3TA 2H45A 1Q1JH 2JK5B 3LV3A 4Q9BA 2IAMA 2DICA 1QYGH 1HE7A 1U41A 1DSFL 1JHLH 3MLWL 3NN8B 4EQ2A 2OTUA 4EI5A 1CD8A 5ISZA 4HBCL 2R69H 5I0DA 2WUBL 4HV8B 1D9KB 4BQ8A 3B8YA 3P9MA 3O6KL 3PL6A 4LLDB 1PW3A 1INDH 1QZ1A 1OGTB 1QBMH 3HRZA 3HMXL 3NPSB 1QACA 2A0LC 2YBRB 3VFTB 3ZKXC 3K1KC 5FUCE 1TLKA 4X7CC 4MB4A 2Z92A 4AT6B 3IRZA 1XR8A 4PGEA 3C8KA 5L2KB 2DLFL 5FYLD 4F2MB 3KWWA 4HMCA 5IG7A 1URLA 4IDJH 4F9PC 3UPAA 4S1QH 2HH0L 2HVKB 4Y1AB 1NGQL 1AIFA 5HHVH 5KW9H 1S9XA 1PKQE 3IJHA 4OF6A 5F1KC 2HT4C 3WNKA 4ZYKA 1AGEB 4Z5RB 3HPLB 3MFFA 3IGAA 3UO1L 4OFKA 3CC5A 3T1WA 4KJPD 5BO1L 4EEEA 4LPCA 4XZUB 4ALAH 1O7VA 3WYRA 1T0MA 2J6EH 5FYLL 5IOPB 5DVMA 3CZJA 3VH8B 2AAVA 4HUXB 1U3HD 3TFKD 1UACL 4XCNA 3VXQB 3O9WA 4WI9A 5B3JE 4MSWA 5JQ6H 1I7RB 4LHUB 2C7UB 5TDOA 1M7DA 3CX2A 1N59A 4L4VE 3ALXA 2AI0L 1QSFD 4TUJB 3RUGE 4NT6A 3RWJA 4FRWA 3AS3A 4FXGA 1VACB 2ZSVA 4UAOC 5ISZE 4I18A 1MFBH 1AD0B 1NL0H 4PJIF 2R8SL 4L8BA 5H94B 1J05A 5AZEH 4ZOBA 4L5FH 3CFDA 3PWLA 1T1WA 2CJUH 2LU4A 5DSCA 1FN4B 3GJEB 4JKKA 4LSVL 5C07B 1QBLH 3WFDL 3QIWA 4TUKL 2JJSC 4LKXB 5FB8A 1OSPH 5EBGA 4Z76A 2OJZL 5JXEA 2K9UA 2MHAB 4AMKH 4PRIA 3WXVL 1G7MB 3FN0H 1ZANL 3GI9H 2IG2L 2HTLC 1NSNL 1AHWB 1M7XA 3VE0B 3UCRA 1CE1L 4M9OA 4BFBD 3QUZC 3HZKA 4YFLF 2GUOB 4IHOA 1NCBH 2PXYB 4MJ2A 5EWIH 1ZT4B 4LGRB 3X3GL 1QVOB 4P5KA 2ZWLT 3LB6C 3TBYA 1I8MB 4J4PC 4I3GA 1JF1A 1FNHA 4P59H 3T09A 2KPNA 2EO1A 5D7LE 1FH5L 3ULVE 3FTGB 3DUUB 3MACH 3MRBA 2BSSB 1WFUA 1YEGH 5T1MB 1UWEL 5HD8C 4ZTPH 5E6ZA 3T0EE 3VXMB 1UXSB 4PJGB 1CFVH 4LCIH 2XN9B 3I50L 3CFDB 4XP1L 3RTQB 4WIQA 2WWKT 2J12B 3MV9A 4NPYA 2D0FA 4M1GH 4X4ZA 2GCYB 1T6WA 3P9LB 1D6EB 1XCTA 4U6VH 3VD9A 5DJZA 4R0LB 2IF7A 5FYJU 2CRMA 1QD0A 4ZUTB 3MV8D 4HEME 1IRAY 3QNXA 5DYOA 4C57C 5KS9E 4PGDB 1H3PL 5KSUB 3IDMB 4WRLA 1C5CL 3SKOB 4C56A 1J7VR 3MTRA 5DVLA 3X3FH 4Q9QH 1R5WB 5IMMA 5F7UA 2QQLH 1KIQB 3WIHA 4HKXA 2EZ0C 5F9JB 5I1GH 3SDCC 1OT2A 3SDDD 2VDMH 1FQ9C 2PO6B 1MQKL 4J12A 3GIVB 4NO5B 2R15A 2PW1B 3VFSA 3QSKB 1TVHA 1MRFH 3CXDL 3I3EA 4PJ5D 3SY0B 1MJ7L 5DYOB 4KVCH 4CMHC 2M1KA 3ARSA 3MBXL 2WP3O 4K7FB 4KFZC 4C56D 2NY5C 4X7EC 1I7ZB 3U4EA 5MERA 3BXNA 1FNSL 4IRJA 4NSKA 4FQQB 3WV0A 1TITA 5T3XE 4ZUSA 12E8H 5DK3A 4LEOA 4DTGH 2DN7A 2B1AL 1I1AC 2GY5A 3GKZA 3C9NA 2CLVB 3MLZH 5FYLE 5DUML 3R4DA 4XHJD 2A74B 4GXUN 1FCCA 4JVUA 2HWZH 5IWLC 2YPLA 4WO4B 4MQ7A 1HYRC 1NAMH 2FEEI 3NTCH 1I1AB 4E42A 5ESQA 3DTXA 2D9CA 2MSPA 1D5IH 3NFPB 1IT9L 1XF5B 1CLCA 4X83A 3ZDZF 4LEOB 2Y4SA 1EZVX 2FJFA 1XR9A 5K59E 3V0WL 3ZHKA 2HVJA 4GXVL 5C2BL 3FAXA 4RWHA 4YHLH 4NCDA 5CWSA 3N1MC 2OL3H 5HJ3B 1INEL 2EIEA 1WZ1H 3OAZK 1R3JA 3BHBB 4PJDB 2P1YA 5D1QB 4PG9A 3C5ZD 3NA4A 2DWEA 1EGJA 3QXAB 4I18C 3SY0A 3IDNB 4JVWA 1FYTA 5CLTA 2R2HB 4PP1D 4JRYB 2DM2A 1H8NA 2VR4A 4YWGL 2X05A 3GSRA 1NMAL 4U7MA 3QO1A 4CJ1A 2X9YA 3H9SE 5F7MC 2OMNA 3WJJC 3I50H 1PAMA 4LBEB 1G7JB 4NC2B 4PG2A 5I30L 3H9SB 3QO0B 1LP9A 4WV1B 5E1AA 3WUWG 3BDYL 2CDFA 2IFGA 2YSSB 3IB4A 3OKEA 3D3VD 5IB5A 1QBML 4QHLB 4F7TA 4HUUA 5F70A 2F5BH 3IFLL 2BVUA 4JAMB 4BSVB 3MRGB 4XNUH 4BZ2H 1HQRB 1AXIB 3SE3A 2D31B 1F2XK 2UY6A 1NBYA 3VG9B 3PJSB 2IH3A 5I6XB 3CXHJ 5F7EH 3NGBC 3OXRA 4WHCA 5ITBL 5FYKU 3CVHB 1FVDA 1WEJH 1R24B 4XXDB 1ROWA 1X6LA 1QFOA 5ITBH 1GGYA 1TZHB 1EEZA 3MOAH 4AMKL 4C83B 2NXZB 2V17H 2IPUG 5ECJE 1PX3A 1Y6NR 1V3KA 2E9IA 4MNGA 3KPSB 1S8DB 4NNYA 2HFEA 4UMGA 4GMSH 2I9LB 3SCMA 4ENEC 1MRCH 1TCRB 4FQXC 2VOTA 5DQDH 1JZ3A 2XY1A 3RNKB 4NN5C 1I3UA 4H1LA 4I48A 1SYSB 1CE6A 1F6AA 3VFVB 1UM4H 1T22A 4JFOB 1N26A 2J8UF 1E4JA 1FH5H 1KCRL 3L3DB 3C9NB 3EDFA 4HLZH 3E3QE 2FD6H 3OGCA 3BPNC 3I9GH 1DFBL 3G6JF 1BMGA 5CINL 4M8QA 4GKNB 2YRZA 1T2QH 2R0LL 3P4NA 3QIWB 2QQQA 1OCWH 3WL9B 1I1FB 4JDVA 5GGTL 3G5YA 1XCQB 3DSFL 5J6HA 1WWCA 3G6AA 1OPGL 1T21A 3CGTA 4JQIL 4YZFF 1JHKL 4PS4L 4DZ8B 5KSBE 3PIQA 3MA7A 4GW5B 4JG1H 4CADB 3DI2B 4WI7A 4LSVH 1CG9A 1FVCA 4LL9A 3E3QC 4CN1A 2X4TA 4PY8I 2NY7H 1CFTA 3HFML 3MLTB 3MGOA 4R90H 5GIRB 1RZIA 4R97C 1JWSB 1RY7B 2CKBA 4UDTB 5E94B 3BIKB 2UYLB 1RK0A 4K3GA 1U8HB 1KJ2L 2B1AH 1AXSB 1C5BH 4X5WB 5DJDB 1DBBL 4QRUA 3ARDD 1JV5A 4J3VA 1H5BC 1Y0LA 4Y8AA 2OLDA 1JRHH 5MEOB 2BVQB 3QFJD 4JHWH 3KYOB 3ORJA 2FX9L 4HS6B 4U1JB 5IB1A 4OIIH 1WBXB 1EO8H 5F71A 5C8JB 4LCYA 4NQUA 5D1ZD 5F7DB 2ZPKL 2OSLB 3EOAA 5IB3A 2JTDA 3GO1L 2G5BA 5IHZA 2LFGA 3EAKA 4DZBA 2BXZA 4P9HL 4QXWA 2F54D 2VXTH 1QSFB 2XRAH 4NKIH 1YY9C 3BZEB 1YY8B 3RGVA 4L4VD 3HNVH 4K94H 2X40A 4XXCC 4D9QE 4ONOA 5IR1B 1AGCA 4O2CB 3BUYB 3FFDB 3TV3L 1JPFB 2UVEA 1I3RB 3JTTB 4DVBB 5I1CL 1L0XA 3QQ9C 3FB8A 4LSSH 1I8KA 1WCBB 3NCFB 1CXIA 2X7LB 2VXVL 4XBEL 1WC7B 4Y5XA 4RFEA 2OYPA 3ZDZE 4DZBB 3VXRA 5JHLL 3ARVA 1ZGLA 1OAUL 3W11C 1BFOB 3K8KA 3NN8A 1IJ9A 3OQ3B 1F6AB 4F7CB 1P7QA 5E7BA 3WNOA 4O51A 1MRCL 2NZ9D 2EECA 3VW3H 4P23D 2XTJD 5DRWA 3I6KA 3PWNA 4OM1H 2BOCB 5T5NG 4GQ9H 1X44A 1KFAL 4ONFH 3WEXA 3O4LB 3TFKC 5E95B 4S1DD 3IU3B 2APTA 3L3JB 2J3SA 4PRHE 4UNTA 3AM8C 1GZQB 2SEBA 4NQED 2XG5A 4Z7VA 3OXRB 4JHBA 4ZXBD 2EDWA 3QZWB 4HXAH 3O2VL 3MRPB 4KKNA 2B20A 1T21B 1IEBA 3LPWA 3MR9B 3LEVH 3NZHH 3MXWL 1F4YL 1LEIB 1XT5A 4JFFE 1EO7A 2MTPA 1KBGH 2NZ9C 3QFJA 1P84K 3FMGL 3BIKA 4KKCD 4NN6C 1T20A 1O0VA 4B7LA 3H9HA 3TBVB 3WIHL 2G75B 2R0ZL 1CFTB 3MLTA 3MYJA 4X6DB 1TQCB 3QRGH 1A4JB 4Y4HD 1UYWH 4XC1L 2DM4A 4XCYB 3DV4A 3BPLC 3I6GB 3MNWB 2ORBH 2XICA 3DX8B 4NQSA 1NUDA 5D70L 4D0BB 1CQKA 2GYSA 4MD5B 3VFGH 1V8HA 1CU4H 3F7YA 4AL8L 1NJ9A 4Z77A 1R3JB 2HKFH 3BHBA 5BV7B 4GRWF 1BOYA 2ADIA 3MGAA 3M45A 3W5NA 1EXUB 3MRCB 2OBGA 4RA0C 3KYMA 4NNYB 3KPPB 3V7AG 4ALAL 1FRGL 1CR9L 1YYML 3FKUS 5J7CC 2X4RA 4R2GD 3X12A 4GBXD 4OI7A 1EBAA 3BKJL 1D5BB 5IV2A 3Q6GL 8FABB 5AZ2H 1FGVH 4Z8FH 1JCKA 3TO4A 1WUNT 3RX7A 1A7QH 1KG0A 2QADD 2CGRH 2VZ1A 4ZUVA 3TLRA 3RRQA 1N64L 1KF9B 2GFBB 5HGHA 5IEKA 1P53A 1BQHA 4P99A 5E8DL 3MRHA 3I84A 1N6QL 4LSPL 4DGYL 1L6XA 5SWZE 4P57B 3B2VL 4GS7B 2CMRL 4XPBH 3MMEB 15C8L 4PJAF 5D72L 2EH7H 2AJ3A 4JFZL 4OIIL 3VXOA 4QRPE 1JWUA 4JEGB 4TRPH 2EYRB 3GM0A 4LK4A 3LN5A 4PJBA 3O0RH 2FBJL 1RJZB 4N5UA 4PRBA 2X1OA 4PY8J 2YPLD 4FXKA 1JGUH 3ROOB 2YRLA 2W0LA 4KQ4L 1LO4L 2NY6B 4MA7H 5C92A 4GAJL 1JP5A 3RZCA 4XP6H 1VADA 1OP3H 2X4TB 1JJUA 3D2UB 2FX7H 4QWWD 2QL1A 1MHCB 1A1MB 4MX7A 1RU9L 2XQBL 1TVDA 1YQVH 4OSUH 1BJ8A 4RBPK 1MCLA 2AGJL 4F7PA 3CUPA 3CFIC 3HR5B 4U1GC 1CDUA 1UC6A 5GRXG 1AJ7H 1IC5L 1K6QL 4ZFOB 4PJ8A 5D7SH 1IKNC 2FIKA 3KG5A 2QQNL 3C5ZA 3V79C 3GSRB 3BO8A 5GGTH 5D7IB 4Y89A 3V52H 2QBWA 3ZKQD 1NGWB 1F6LL 3GSQB 1L9NA 1A6UL 3U6RA 4WFHD 2QR0B 1G9MH 4Z7WF 1F02I 3HLAB 5L7XH 3Q5OA 1I9RL 3BKYL 2COQA 3DMMC 4JRYA 4TQEH 1BGXL 2DQCL 3BKCH 3TH2T 2WIIA 4YJZL 3IDNA 4LGPB 4P3DA 4P5MB 1HXYA 4JFFD 3HZVB 3O3DB 1NMBL 5CCKH 4OCLC 5HHMD 3ZL4L 3UJIL 5I1HH 1HH6A 1C5DA 4FQQA 4MLIA 1RURH 3QEQD 2Y7QA 5JZ7D 1L6ZA 1MIEH 1MAML 5HGAB 4U31A 4AY0A 3BAEL 1DE4B 4Z7NE 1E4XH 4FG6C 2D7QA 3WUWB 2D7OA 3X11B 1PZ5B 1FNFA 4Y19A 5FM8A 5CSGA 1YEIL 1BM3L 1DVFD 1YMHA 5EC1A 3GUTA 5KVEH 3ROLB 5KOMC 1B0GA 1MCQA 4E41E 1Q72H 4FQ1L 1K4DB 5CHNA 3GSOB 1R3IL 5ISZD 4UQ2A 5DDHA 1ZLUH 5A16A 4LHUD 4GAGL 3VD7A 4WEMB 3D3VA 5ACZA 3REWB 3U7WH 5FYKE 12E8L 2DLHA 5IFHH 5MENE 4ODBD 1XCTB 2GITB 3X13A 4FFWC 4U1NB 4C4KT 3LSOA 1CD1B 3MJ6A 2B7DT 2FCBA 4WDIB 2QSQA 3ALPA 3I85A 5A16B 3LKPA 5DLMH 5J57B 2Z93A 4YDKL 4YAQA 4K7PY 1MCOL 3PWUA 5A3IC 2QHRH 3DGCR 1BQLL 4PJAE 2CPCA 3CCHB 5ENWA 4NQCE 1NC2D 3G6JB 2ZKHH 3BDBA 4KRPC 1A6WH 1CGTA 4XPHL 3ZKMC 4BH8B 1B2WH 1FAKT 2DJSA 4F57H 1G0DA 3OB0H 5CZXD 2V17L 2KZWA 2PUQT 1WZ1L 4WEBH 2RR3A 3H9YA 1CICB 4XRCB 3QUZD 4I1NB 3NVQA 3MGTA 3PNWA 1UFUA 3SCMC 5CSZA 4PRHD 2ERJC 5C0CE 1GGCH 2BNRA 1OW0A 4YX2L 4D94A 1U8PA 3BN3B 3DOSA 3TN0C 4I3SL 3KPNB 5D7SL 5MENB 3P30H 4HDIA 1RZJH 3VXSD 3EO0B 1BREA 1CL7H 2OJEB 4XB8A 1F3JA 4DW2L 1UKTA 2NY3C 3MV8E 3A6BH 2UWEF 3HLAA 3FHQA 5DD5H 2W92A 4O5LH 4Y4HB 5I75B 1A7RH 3IAQA 4NNXA 2F8OA 3M17B 1F3RB 3ZL4H 5D71H 2EH7L 4IRJB 2W9EL 1EGJL 1J18A 4LPUA 4PJCF 4Z7WE 4YK4C 3L5XH 3NGBB 2MCPL 1C12A 3O0RL 1R6VA 1X5AA 1I9IH 4PY7B 1YEFL 5C1MB 1KCUH 3TT1H 1Q1JL 1UEMA 2XI9A 5I1DB 5JOPD 3L3KA 5KSAA 2FZ3A 4CDHA 4Y16A 1ADQA 1MY7A 5EOTA 4JZNB 3GK8H 2A73A 4I4WB 1HHGA 1NAMB 3WSQH 1A4JA 3M07A 1LO3L 3BZFB 2X4NA 1GL4B 3GZKA 4FQLH 1CICD 2OI9B 3KPRB 4Z7WA 1MF2L 3MYJB 3FZUC 2CRZA 3MCG1 4QNPF 4XVTL 1RIUH 3SKOA 3HPLA 1ERNA 1XMWA 3MFFB 2F53B 4BUGA 1AIFB 2BHZA 2L7UA 5HY9A 2NY3B 5BRZA 2P7TA 5HD8D 4Y16D 3AU1B 1T7XA 3TP4A 2CRYA 4MXVE 2P49B 3D5OF 4NUJA 4POZC 4F2MA 4UB0L 4G43A 4UIKL 2XTJB 3S34L 5T3ZH 1JYNA 5EO0B 1GOGA 1BF2A 4TUJA 1VFOA 3VFWB 3F7PC 4P23C 1NAML 4KMQA 2JF1A 2RIKA 3QDMA 4H20L 2FJHA 1CD0A 4XP4L 2GK0B 3VGDA 1CICC 4WO4D 2Q8BL 4YHYB 2C1OB 5JOFA 3LKNB 3S37H 1DE4A 3PWNB 2P5WD 4LSPH 5BMFH 5IP4A 3HC0A 4ZXBA 5ISZB 3U9UA 4Y19B 2VITB 4XP5H 4HUKB 1RIHL 4NZDA 4JFYA 5ANME 4OI8A 5IWLA 2GJ6B 3FN0L 4YO0A 1U8OB 5AAWA 4OCSL 3BISA 1I8LC 1RZ7H 1OOAA 2VKXA 4IOIA 1R3IH 5T5NF 3P77B 3V5HB 4RMUA 1AJ7L 2R2BA 4Z7UF 1T1ZB 1QHPA 4GBXC 4U6HB 2YC1A 5J8OA 4YDLB 3QUKA 4Y16C 4W81A 1P1ZA 4AG4H 2CJUL 2ZG1A 5E2UL 3HAEH 1IM9B 2G75A 4P9ML 2VZOA 5I66B 1ZAGA 2X9WA 2IMMA 1SEBB 3CSYA 4ODTH 1FZMB 4OKVA 3D39B 4FABH 1BP3B 2HLAB 4MHHI 5D2NA 2HAZA 3C60A 1LO0L 3DWTA 4H1LH 4O9HH 3LY6A 3REVB 4FOMA 3QG7L 1T2XA 4DN3H 1PKQA 3HG1D 4KHXL 4JE4B 5I1CH 1MRDH 5C0IA 1YECH 4NM4L 3R8BB 3N9GH 5D1ZC 5FO8A 2DKUA 1N6QH 5FF6A 4KKBD 3IRPX 2UYLA 1R3LA 4RMVA 3OPZH 2EIDA 3PE9A 5E1HB 1CZ8H 5T1DH 3SOBL 3GMMA 4HFWB 4UTBL 2VLLB 3V7AE 2IEPA 4PJXF 2IALA 4IM8A 1Z0MA 5INCA 4E9LA 1CGSH 1PKQB 3CDGB 5KS9B 5T1KA 5E9DA 5AYUL 4PJCA 3ULUC 4JM2F 4EVNB 4Y2DB 3U0WL 1ZLUK 4LARL 4IMLA 2YPVH 3G5VA 1YNLH 2UZIH 2YC1B 2FX7L 4K23L 4AK1A 1J0KA 1JVKA 4N8VB 4KTDH 1ADQH 3FOLA 5I1LB 1YN7A 5F9OL 3SCMD 2YWZA 3WFCH 5E2TL 3QEUA 4DKAA 2ADIB 2YD7A 3F5WB 3R0NA 1A0QH 3THMH 3MLXL 4YXHL 1UT9A 4Z7OF 3CJJA 3W9EB 3EOTH 1EVUA 2H2PD 3TZVD 1QLEH 2HYMA 2XKNA 5TE6L 1CBVH 2G9HB 3IAGC 5TQ2L 1T0PB 1U3ZA 3D87B 4YO0B 3P9WB 1RUAL 4NO0B 2WWMD 3V6OE 3V4VH 1FFQA 5F7LB 2DJUA 1BQUA 4OCSH 1DEEA 3GHEL 5C0AE 3CFJA 2VLMD 3DV4B 5HHME 2YRPA 5EOCJ 2P45B 5CEXA 2OZ4L 4LSRH 5IVXE 3ULSA 3NA9L 2IBZY 3VXSB 1VFUA 3UTQB 5DRNB 4X8XA 2R39A 3F62A 3HMXA 2DYPD 2YS4A 4RQQB 2JE8A 4XPFH 4Z78A 4UU9B 3LCYA 2Q76B 1SBBA 5HHPB 2XA3A 5DJ0A 2FB4H 4NO2B 1JHTB 5ALBL 1NGXB 5F7WC 3P4MA 5C71A 1MAJA 3KVQA 4PJ5B 4ODTL 5MEOA 3QULA 4LCWD 4H5SA 5AD0B 3RGVC 3VFMA 4PBVC 5DMJB 3WHE1 4PGJA 2R2EB 2AEPL 1NC2B 2BSTA 1S9WB 2BX5A 1KB9J 3GFUA 3KS0J 4X9IA 5JORB 1JWMA 5E7FA 3WO4C 4RIRB 1A3QA 3DGGA 4MDIA 4Y5VA 2PYED 4WHTA 5GRUL 2F54E 4PRDA 3AREA 1FZMA 4OKVB 4MS8D 2OM5A 5I8CB 2AV7A 3NCMA 2EKSA 5ACLA 1FL5B 5DHXB 3T4YB 4ELMA 1SYVA 2EEAA 4OLYL 4XNMA 2IMNA 1K4CB 3RX5A 3U0TB 4NQXA 3BW9A 2I9LA 2B2XL 5DVNA 2D7PA 3M1BA 4NFBA 2ADGA 4MQXD 3HUJB 2UUDH 2NY4D 1FNSH 2W65B 2IPUK 1MWAL 1W0VB 1MCJA 1YUHA 1XZ0A 3FFDA 1JUFA 3HMWL 3LOWA 3L3DA 1CD9B 2DQGH 2C3VB 1FG9C 1KNOA 1XGYL 1FDLL 2AK1L 2PO6D 1DN2A 2R29H 5CP3H 5E5UB 3H3KA 3HMWH 1HHHB 1XF3B 4M00A 2JB5H 3IF1A 4ZXBB 1ZLSH 2XZAL 3CFKB 1NUGA 3CDFA 3SCMB 1XGPA 2OX5A 2F54B 1S8DA 3NZ8B 1MQ8A 1HH9B 2DS4A 5BZDB 4XRCA 5GJTL 3V9FA 3T2NL 4F7EA 1Q9OB 5EZIH 3U0WH 5FECA 2VDQL 2CXGA 3K3QA 5D93C 2FO1A 1FFNA 4GXVH 5C2BH 5FUOH 4MCZA 2PO6A 2J4WL 4K7PL 1HIML 4J3XA 2J2ZA 1T5XA 2AJXL 3JWOC 4QHKJ 5IJKA 5EB9A 1MFDH 1ACYL 5D2LE 1WV7T 1EEYB 2R23A 4CADA 5AG9A 4JZNA 4M7ZC 4YLQT 5D2LB 4P5TA 1JWSA 3HUJE 4PRID 35C8L 5I1DA 3I75B 3TPUA 2X4QB 5MEPA 4FZ8H 3ARBD 2DWEB 3QXAA 1QRND 1D7FA 4MA1C 3VWKA 3BKMH 5TE4L 1JWUB 5EZJA 4L3CA 1BBJA 3FQRB 3EOTL 3FO0H 3NMEA 3J8F7 3IXAB 3U48A 3EDDA 4LBEA 4APQB 4M6NH 3VXRD 4X6EB 4X6CA 5J11B 1T1ZA 4U33A 4RSVA 3L5IA 5IEKB 5IVZB 3LKQB 5KSBF 4XP9H 5C0CD 4ERSL 1PG7L 5FHAH 2YPLB 4WO4A 4LSQL 4QHUA 1JF1B 4EUPH 1ZLVH 3SKNB 2CLZA 5T33H 2N7AA 4MMXC 2AABH 4WGVB 3H8NA 4ELME 3VDAA 5D1QD 4W68A 4XMKL 4YXKH 1AHWA 3LPGA 4CN6A 1CFQB 3WKML 5HHNA 3GSNA 2Z31C 1JZ6A 1FLRL 3HPJA 2DI8A 5DUBA 1ZLWK 3GSWA 1S5IH 5CUSL 3ZYZA 2VLRD 3U6RB 2QKIB 1MCSA 2DMCA 4JY5H 1RIHH 4MQXC 1FC2D 2FL5A 3BDYH 4EBQH 4ZUSB 1XGRB 2NY5H 3TPKA 4LARH 4PJ8C 1AGDB 3P4OA 2XZQH 5KJRL 1FFPA 1F90L 2YD3A 4UBDD 2PCPB 1I7UB 1TZIB 4PGCA 3SGJC 5MI0B 4R8WL 3QIUA 2WINB 4Y8DC 3V52L 5I2IB 3G04A 3O6LH 2EKJA 4HAFA 4JFPB 3AB0C 1H9VA 2FATH 1JGLH 5HGBA 3MJ9H 4GJTB 1EHLL 1N5YL 2P44B 3MREB 3ARBA 4QRRD 3VMPA 4MZ3A 2NW3B 3BZ4A 5HYQA 1XGRA 3GSOA 4XCCL 1T5XB 3HCVA 5ERWB 2XQYK 3QO1B 3TZVB 5IT2H 1KIQA 1OAYH 4N8VG 3RFZC 1FFNB 3QQ4B 1KXQE 2V7NA 4NWTH 4Y16B 1QLEL 5EOTB 3IGAB 2LABA 2EDRA 2DM3A 4JO2H 2JJTC 4UI2A 1LNUA 5DK0B 3UYRH 5E03A 1J8HE 2PN5A 1AXTL 3SGEH 3JTSA 1JNLH 3RVVD 5K9QG 1BQHB 4HJJH 1RZ8A 1KCVH 3TO4C 1OP5H 3RVVC 1D6EA 2M8XA 5IVNA 4UNVA 5ID1A 5E8PA 2R29L 5A2FA 4XXCA 1BVKA 5EPMA 5D96C 3P0VH 4XPFL 2DIBA 3ARPA 1FHGA 3GMQA 1VEMA 2YKLH 2H26A 3LH2H 4RFEB 3KXFD 1UJTA 2V5MA 5T1LD 3PF2A 3SDDA 2YD5A 3KPPA 2DDQH 1S5HB 5ID1B 2BVPA 2BY0A 3OL2A 3PL6D 3U9PL 3DIFA 4AG4L 3QHFH 5A2KH 4KV5E 4LVNB 2A0LD 2VQ1A 2X4UA 4P9HH 2CUIA 5I8CA 3V0AC 3BXNB 3WIFB 4XMPL 5EBMB 2VDQH 5KS9F 5CILL 5E99L 1DBJH 2H1PL 5ICYB 4PRIE 3WFBL 4S2SB 2V2WB 1MPAH 4LHUA 1YYLH 1V3MA 1V05A 3VFUA 2E9JA 3R06A 5EC2B 5EUOB 3ME0A 5IMLB 4HCRA 3NZ8A 4XP5L 1MHPH 4LLYA 1S7WB 1VFAB 3WFZA 3FJTA 5D1ZB 1XAUA 1IEBB 1R5WA 2HJFB 1QNZL 2B5IC 4JO3H 1AD0A 4KJYA 4OGXL 3QZWA 2C3GA 1MCCA 1AGEA 1F45A 1W0WA 1QP1A 1Z9MA 5TFSL 2YPLE 1D6VH 4I2XA 1C8PA 4XVSL 2C3XA 1CG9B 1U8JA 4P59L 1CGSL 5C70A 2P5EB 1V3JA 5ADPH 4M8VA 4HKBB 4BZ1L 2GJ6D 4DVRL 5IB4B 5I1EL 1XIWB 3VGBA 3FQNB 3C8DA 1MH5A 3GHBL 3ROLA 3ARRA 4FFVD 3CMOL 2RGSA 5F89A 4E5XA 4QHMA 1D5XA 4WGWB 3O4OB 4LMQE 1RVFL 3HI6L 4U2YA 2DIJA 4Y19E 5CZKA 4Y4KA 4NQDB 2BC4A 4XMKH 5A43C 2ZOKB 1HQ4A 1E4KC 4YX2H 4YBLC 3SDCB 5ANMA 3RL1A 3TESA 3TN0B 1MJ8L 2GJ6A 4H25B 1AO7D 3QT2A 2H32B 1F4XH 1CIUA 1JFQH 4JKMA 2XG4A 1IQWL 3HZVA 1K2DA 2RCSH 1ORQB 3OMZA 1OM3H 5CLWA 1YN6A 2K7QA 4U1KA 3J7HA 1OAZL 2VWEE 1INQA 1FG2A 3EOBA 5KS9A 4ZTPL 2MHAA 2RCSL 4ZTOH 4NQDA 2ZOLB 3MBEA 3F7QA 4BK5A 1PQZA 5AD0A 5BS0E 5DMKB 5I76B 3OGOE 5D71L 4FN0A 2JCCB 2ZNWA 2ZJSL 4TUOA 3FQNA 1VEPA 2AK4E 2XQYG 4R6UA 4JFHD 3CVHH 3L3GB 4KRLB 1SJHA 3C60C 4I18B 5B4MD 1JZ7A 5EIQA 2DQDL 1NKRA 1Y0LB 4FXGB 2CIKA 5L6YL 4A2MA 4EI6A 5FAAA 3ZE0F 5DFWH 1IKFH 5KN5B 3ULUH 1J10A 4JFDA 3GO1H 4QT5B 2HH0H 4M43L 4LOUC 5GS1C 2CDFB 3L3JA 2RHEA 5DTFA 2W60A 4PJ7A 5C09A 4HGMA 4CBPA 3AAZB 4X0KB 2YA2A 3RVUD 1S7WA 5EO9B 2ZCHL 2ZUQC 2VKWA 2VLKB 2WBJA 3BP5A 1E4WH 3MA9H 5BZWB 4PJBE 4OQTH 1QNZH 4QRRB 3MUY1 3MA7B 2A1WH 4CVUA 3DVNA 3Q48A 4AL8H 2HFTA 4NQVB 3SJVA 1B6UA 4G3YL 5SWZA 2NY6D 4FHBD 4M48H 1ETZA 2ED9A 2JCCE 3F7VA 4NBXB 4NJ9H 1OAUH 4YQXH 3ZMRA 2LU3A 1WC7A 5GGVH 3D9AL 3KLAB 3O45B 1KTKE 3E6FA 5DJ6A 5D5ME 3UBXG 1A7OL 4NP4H 5IFAH 1D5BA 3S35H 3G6JE 1IC5H 2B2XH 5IBUG 4GRLC 3X12B 1QLFA 5IR1A 5CJBA 1OGAB 3FRUA 3L95B 5JOFB 1UA6L 4H1LB 1R5IA 4KKCC 3OSKA 1AI1H 1N5YH 3QUYD 3O8XD 5KBNC 2UZYB 1SEQH 1A3LH 5E9DB 2NX5B 5ANMB 3ARFC 1R3HA 4LIQH 3O6LL 5C0FB 4LLUA 3VFNB 2XWTB 3DGGB 4J7RA 4YHZL 4WHYH 4X8JB 2ICES 3N1GC 2X1QA 4W4NA 1FGNH 4R26H 3RI5K 4KGJA 4GXUM 1TQBB 3K2UL 1Q0YL 5EO1A 2VE6B 2VLLA 4F8QA 1CVRA 3BZEA 1G1YA 3VRIB 1A21A 5B4MC 4JQVC 3IU4L 4L8SC 5ILTH 3UZQA 3KGRA 4W6WB 3L6FA 2EEBA 5K33A 1CK0H 1TJHL 3BVNB 1P4LA 4YC2C 3WNMA 1A3RH 3RY5A 1EHXA 4XGZA 2HKHL 4U1GB 1WTLA 1OHQA 3L7EB 5DJ0B 4WFFE 3EZJB 1E6OL 5IQ7L 2UY7A 4JG0L 4Y7MA 2HRPL 3B9KA 4JGUA 1F3DH 1FE8L 5I16B 4MXQC 4S1SL 1JV5B 4PGDA 4BYHA 4JM2B 3OJDA 4JG0H 3CMGA 1B88A 1N0LA 3VRJB 1HNGA 1NPUA 3KXFA 4BA8A 5CGYD 3VWJA 3IU3A 1CXLA 3GM8A 2AV1B 2HWZL 5J6GA 3BP4B 1VERA 4RAUB 1PG7W 4Y5VC 3RWGA 1WAAF 1IQDB 1OAQL 4JDTH 1YN6B 3N85L 1KPUB 2XWJB 4YDKH 1VGKA 1NEUA 4L8CA 1EFXD 2EDEA 3SDAC 1G7IA 5CGMA 4NQCD 1EEQA 5E8DH 2N1KA 3L3IA 1T5WA 2GSIA 2X7LA 3STZB 1NLBH 1PEWA 2VDRH 2H2SD 4GKSA 4OLVL 2FH8A 1CDGA 2VDNH 4H8WH 1FNEA 3HR6A 3UYRL 4HW6A 3DLQR 3S34H 4OZIA 4MJ6B 4W4OA 1RZKH 1IGTB 1VPOH 4HIHB 4V2BA 3U2SA 3IJSA 1T22B 4L4TE 1RPQA 3HCVB 5ERWA 2B8OT 4ETYA 3IXAA 3MLVH 1A7OH 4JM4H 1NUNB 1DQLL 5FDWB 3FQRA 3QDJA 1J5OH 1JMXA 1T89A 1ZT7B 3LD8C 2VXSH 4YHOH 3SDAD 2X4PB 3HNSL 4YUEH 1CFBA 4DAGL 1ND0B 3ILPB 1W72H 2BNQA 1A6VH 1EBPA 1QSEA 4UIMA 5L8LB 2C4XA 1NEZB 4I0PA 5IW6A 2IQAB 3RWJB 5E4IA 2R4RH 2X4NB 5CEZE 3PP4L 4J6RL 2F53A 4WI2A 1NCWH 3L5XL 3QIWD 4KKLD 1GGTA 1QFUH 3LKPB 2R23B 3L3KB 2W9DH 3O41B 4GAYA 3FO2A 5DUPL 1T0NB 1V7MH 4HUUB 2JJTA 4JFEE 2OCFD 4R0LA 4UOW1 3VWJD 5DFTA 3QQNA 4ZD3L 1DQQA 1JN6A 1KN4L 4B7IA 2DWDB 1MJJB 2X89A 2E6JA 3JBG7 4G7VL 4ZOAA 5I18H 4P9MH 3V8OA 2NR6D 4L29B 2DI9A 3EIFA 5C08A 4L1HA 3QISA 4MLSA 1PDKA 2ZJSH 1AH1A 4TVPE 3RTQC 3VMNA 5K9OB 2FWOB 4P49A 1OW0C 3PDOB 1NLDL 2JB6A 5FA4A 1QHOA 3STLB 1T4KB 2AEQL 4Z7QF 1EFXA 1U8LA 5HDOA 1SJXA 4EN3D 5I0ZA 4CVXA 4RMRA 2VDKL 4HKJA 1LEKB 2ICEB 5EN2A 5LBSL 2XRAL 5LCVH 4G6AD 5C08B 3EFDH 2FSEB 3C2SA 4KHTH 3PNWB 4KDTA 3RIFK 3P9MB 2DKSA 4X4XA 4MMZC 2ICWA 3R8QA 3U7AA 3LEYL 1CGXA 4L1DA 5HHOA 1Q0YH 5E2JA 3VXPB 4BSWA 2C1OA 1R3KA 3JSSA 4WEUD 2MCG1 5DK2A 1ZWIB 3U83A 1DQQB 4JPVL 5D2LA 1LEKA 3QCTL 1BFVH 4I0CC 2VZVA 4KKBC 1UADC 3AS1A 3O6MH 5EFIA 3TBWA 5GS2H 3UJTH 1QQDA 5D7IE 3T3PE 5EZJB 3QWOB 2W07A 3CH8A 1RFDL 3LRGA 4FQJL 1U6AH 2FECL 2DI7A 4PGCB 4NZUH 2X10A 5BVPL 3P73B 3QNYA 2JJSA 2NW2B 4Y1AE 1MCPL 3P4OB 1ZLWH 2BVOA 3MMEA 4MWFA 3L7EA 1LP9E 3OB0K 1YEJH 4LVHB 4OZHE 1RZKC 3NIFE 4OZIF 3O3EA 3K4DA 1KULA 4AEFA 3ROOA 4J3SA 2KKQA 4BM7A 1AKJB 3RI5F 5CHNB 1RJZA 3TWCH 2GSIB 3TCLA 5DEFA 3OZ9L 2D9QB 4MAYD 1RHFA 2FJGB 3SQOH 3HG1B 4Y5YC 5B21A 3EYUL 3KWWB 1FNEB 3L1OH 1MI5E 4YDVA 1C16A 1J0JA 4PYHA 4O2EA 3KYMB 3LZFL 2GJZB 1XF5A 4F33B 3KPMA 3FT2A 2A77L 3FTGA 3QXWA 3QUMH 1T4KA 5H37H 3VI3E 4Z8FL 4ZS7L 5IGXH 3O3DA 1QFWH 1VENA 4EIGB 3CSGA 3JTTA 4OLUL 3GNMH 5E56A 2Q86A 4M5ZL 4UTAL 5IVZA 2X9XA 4XBPB 4Y2DD 1IZJA 3PV6B 3H6JA 4ONFL 1H8SA 2ED7A 2AXHA 5K9KA 3MFGB 5GGVL 3GSQA 4PLOB 5FGCE 3FOLB 3WS3B 1D9KA 5EBWA 4WWKD 4Z9KB 5IROC 4MNQA 3UTTD 1T04A 4MCYA 3O4OC 2C5DC 1NBZB 4FQIL 2DQUL 1BZQK 5IBLC 4KPHL 2FD6L 2DQJL 2B39A 2NQCA 3MLPA 5C9JA 3DXAD 4M6MH 1M7IA 1ZHKA 3DX7A 2UWEB 2DQUH 2VXVH 3E8UH 4KROB 4HS8H 4TVSa 1I9RH 3BKYH 5JW4Q 3VG0H 1RVFH 3OKOA 1DQDL 2CMRH 2NY6C 3RZCB 3OKLB 4IDLA 1I9JH 2EYRA 4M43H 1RUQH 4C56B 1OPGH 3ZE0E 1JNLL 3CFJB 4A6YA 3AC0A 4X8JA 1T2JA 4NT6B 5CAYB 3VXUD 3JVGA 5IUSA 2X5PA 4PJBB 1UGNA 3UPRB 3T0WA 2F8VA 4DN4H 4G80B 4YNYB 1S3KL 4KDTC 3OKDA 5EU5B 4DKEL 3MJ7B 2EDKA 3ZDXF 5J3HD 1A6AA 3ULSB 2YKLL 5IW1B 1CL7I 2E27L 3D0VA 2I5YH 2XY2A 2HKHH 3RA7H 5J13B 3A67H 1ZGLB 4PJ9A 3WNLA 2DL9A 4JZOB 5T1MA 1J0YA 4O02L 3B2UC 4HCRL 2FH6A 3V4UL 3WS3A 4PJEB 2X4SA 1OGTA 5B3NA 8FABA 4QTHA 5C07D 1CDHA 2ERJB 3JUZA 4L9LC 2PW2B 3BP6A 1MIEL 5T1KD 2BJML 3NIFF 4NQVA 3NCBB 1CT8A 4PJCE 1KUMA 3RJDA 1XFPA 3RPKA 4N5EC 3H3BC 1JGDA 2Q3ZA 5C07E 3AREB 2HFEB 1CDYA 1C5CH 2MKLC 5CUSH 4OJFH 2VAJA 5FO9A 2VDLL 4MDIB 4G6AC 4N0CC 3GMMB 2ESVD 5F44A 5FCSH 3SPVB 1FSKC 4F9PA 5FV2A 2JJVA 1HILB 2YMXH 4H0GA 2YPKA 5FKPB 3ZLQC 1AGCB 1OLZA 5AAMA 2ARJA 1DUYA 4QNPE 5DI8B 3QHFL 4FMFA 4NM4H 1CLZH 1ZEAL 1L7IH 2JIXA 2N7BA 3MRKB 5D5MB 4QGYA 2CLRA 1RK0B 4OD2B 4OZHA 2VLME 2P8PB 3MGOB 1NGXA 4UV7H 1C7TA 5D2NE 2DM7A 4HJGA 3W5MA 5HDBF 4GRWB 1T89C 2HLAA 4JHAL 3PGFL 4HQQH 3TVMB 1KFAH 3HC3L 2FYYB 3MRPA 3RGHA 2PO6C 4KY1L 4X5XB 1WT5A 4D3CH 5IJKC 1IVLA 1UM5L 2DQEL 3H9SA 3QO0A 5EUOE 43CAA 2UZIL 1P84J 1FLRH 1DUYB 3QXUA 1HHGB 4I2XE 3RP1A 4LCCB 3N06B 4RGOL 5HI4D 4CAGA 2HTLD 4OD1L 4XBEH 3VU2A 1MNUL 4HIJA 2VLRE 3U7YL 3LEVL 1KB5B 4NWTL 2XZCL 1SEBA 3WIFA 1UZ6E 4Y0GA 5T1LA 2HLFD 3LEXB 4QHNB 3LN4B 4JFOA 5JIPA 3RBGA 1P6FA 3X3FL 4Q9CA 3DX9B 3WXVH 2Y6SC 3QFDA 3ZHDA 3DRTB 1W2KT 3HAEB 5LG1A 1A7NL 2X4RB 2NMSA 4M6ML 3TA3B 3QPXH 5I17B 4KUZH 1EX0A 1JPFA 2VWEC 1B4JH 4POYA 2QADB 4LPYA 1CXEA 4OCNC 4XB7A 3DSNA 5DJCB 4I2XB 3GI8L 3OTTA 3SDYL 3CVIL 1IQWH 3QXDB 5E9DD 1YEJL 1UM6L 1AXTH 2W0KA 5D9SB 1QR1B 4GW4A 3U7WL 4HIJB 3BJ91 2AEIT 4ODHL 4X5WA 3NH7H 3T77A 3H9ZA 4QWWC 4J8RB 4NBZB 2AXFA 4APQC 3VXUE 3ETBF 5TF0A 5JA8B 2HTKD 1LE9B 1TZHA 1RIUL 3WFDH 2AJZB 3I6LE 4QRUB 4JN1H 5F9JA 4EI6B 1N3NB 4WJ5B 1X5HA 3OKDB 3PWUB 2CXKA 4S10A 5CGYC 3U46B 3QNZB 5EBMA 4F57L 1BM3H 4PJAB 3K74B 2NY1C 5D7JD 4BQCA 1EVTC 5GS1B 4PJDE 1NCCH 4BSVA 3QIUB 3S88H 5D7JC 4G9FE 1S7UA 5LGKA 2SEBB 3D39A 3TZVC 3R1GH 2BNQE 4MCYB 1P2CA 1IGFH 4EBQL 4GUPA 3TO2A 2VSCA 5JQ6L 1QQDB 1YMMD 3NOIA 3KR3L 2VQ1B 2FJFB 1OB1B 1MFBL 5E00A 2XFXB 1GC1C 3QIWC 1ED3A 4LPVA 2ARJB 4HT1H 3L3HB 4ZPVA 1I1YB 4HK0B 3KPQA 3F65A 5FA3A 3SJVD 4GKNA 1I1AA 5JHDD 2CKBL 2KUTA 3FT3A 5LXGH 1ZTXL 3MV8B 3TBYB 4NCC2 5JO5A 2FEDC 2OJZH 5DQ9A 2BOBB 1ZA3B 2IFFL 4NN5B 4DGIH 3B83A 5JW5A 3MRNA 1PG7X 3FO9B 4YH6A 4GSDL 2V2XA 4FQXB 2VAAA 1H0DA 3STZA 1ZLSL 1D5IL 2DBLH 4CVZB 2Y06L 1GOFA 5HGGS 1YPZA 3IDGA 5BQ7A 4WU5A 3AVEA 4U1SA 3HE7B 3TT1L 5A3ID 4QHKI 4F80A 1MVFA 4WNQB 4JPVH 4AEHL 4M93B 1UM5H 2YA0A 1WZLA 4P5TD 3CSBA 4YHPB 3INUL 2I07B 3AY4C 1J0HA 5E6ID 3QDGD 4NZTL 4JRXD 1KN2L 1OAKH 2WUCH 4FZ8L 4OTXL 3GJFK 4NKOB 4AM0B 4P46B 5LVEA 4ZUTA 3SKJL 2E7HA 2Q7NA 3EYSL 3I75A 2BERA 3ESVF 2R2HA 3O9WB 3S4SG 4LSTL 3B9KB 2IBGA 3VGAC 1CVSC 1LEGA 1XIWD 1XGQA 1BX2A 1XH3B 2D3VA 5E99H 5E6YA 5IQ7H 3L6FB 2GSGB 2YOCA 4KZDL 1M05A 2VXQL 3SE4C 1J1PH 3S37L 2JJUA 3CU1A 4OCMC 1GVIA 2DQHL 2G60H 4PB9H 4FQXD 3VD5A 1SHMA 3NACH 4X98A 1BQLH 1ZT4A 1HN1A 2ADFL 5I71C 1U91B 5EU6A 5DLML 5D6DA 3EJZD 3QFJE 3L9RB 5IESL 1FYHB 2ADFH 3WLWC 2H26B 5ESVA 4K9EC 4KTEH 4PLKD 3VXMA 5HGHB 1ZEAH 1RUPH 3GBMH 2E6QA 4AJ0A 3F8UB 3WUWA 1HHIA 3MRJA 5GRJH 5B3JF 4GKSB 1YA5A 3NPSC 5SWQB 4XI5C 3MNVA 1F4AA 3ZKMD 2C1PA 4PV8A 1U2CA 4KQ3H 1ZOXA 4BFGA 1PYWB 5L88L 1NSNH 2V2XB 2XWJA 3CK0L 3VWKD 3MRDB 2VSDA 3MGTB 4DVRH 5D7JB 3D39E 3F7RA 3P0YH 3H9SD 3UTSD 3SJVE 1ZXQA 1IT9H 1FZJB 1IL1B 2OZ4A 1OD9A 4HWEH 1CXKA 1U58B 3QIBC 3KPQB 3MV01 2MCPH 1LDPL 1CTNA 5CEZH 4FFVC 3RVXD 5HYJD 1FN4A 2CUHA 5C07A 1DP0A 1WLHA 3MRGA 1IAII 3RDTC 2F54A 3OWEA 4QRPA 4R4ND 4BH7A 3BKCL 1F42A 2ICWI 3P4MB 5E8NA 4QT5A 2D4DA 1XF4B 2VDOL 1MFAH 2R56H 5KZCB 3MC0A 3FO2B 1KNOB 3OR6A 1B0RA 2AQ3A 2ITCA 4BJLA 1B4JL 3D18A 3B5GA 4M7KL 4OZHB 5BS0B 1L9MA 1FO0L 3CFBB 4L8SA 2EO9A 4XNYL 3LS4H 3NZHL 2EYSB 2QSCL 3QEQE 3TO4B 2VE6A 5FXCH 3KLSA 2XN9A 1P7QD 4N1HB 3HI6H 3BEWA 2X89D 1Q0XL 4U1IB 2PTTA 5HHVL 3H0TB 4ZO7A 5C0DB 5T5FL 4TVPD 1LK3L 1MREL 2DDQL 2DTMH 3O4LA 5JIKA 4MDJA 1U93B 1CBVL 3TH3T 2XA8H 3AXLA 2NLJB 2D7NA 3LQZB 4E42B 1E4KA 4OF0A 4RIRA 2HKFL 1QPPA 4MJ5B 5A2JH 4YHMH 3DYOA 1EMTH 3MCKA 1KJVA 3RY6C 5F3HB 5JIIA 3KJ6L 3IFOA 1I1CA 2ZUUA 4X6BB 4KJWD 1HKLH 4U3XA 2H2PC 1ODAA 5GGRA 3VWJB 4LFHG 4JFFA 4PJXE 3MLRH 1P4IH 3F6LA 1C08A 4PTTA 3D0VB 4DKEH 4L29A 2IPTL 4MA8L 5EIIA 5E08H 4I8DA 4ZFOA 1Q9WB 5HHPA 3CH1A 5HYJA 4QCIB 4WV1C 3MO1B 4QOKB 3HR5A 2DKMA 1S7QB 4YHYC 5B8CB 3ARYA 5DEGB 4LSTH 1UA6H 3RY4A 5F6IB 1KC5L 3IDXL 3C8HA 2R1WB 3D85A 3KDMA 2H32H 5C8JA 3BH8B 5GGSB 2AJXH 4QEGA 5IBLD 3FCTA 1LK2A 4ETQB 2GT9B 2VERN 2OR9H 3MYZA 4QXGL 5TPWL 1P7HL 3H2WA 2ZUQB 2Y36H 5CD3B 4Z95L 1FV1B 2IAND 5E9DE 5EG6C 3VD4A 1S9WA 1CF8H 3RX8A 3P3YA 2W0FB 3QIBD 5E2VH 2AEPH 2ITDA 3AGVA 3QJHB 3EFFB 5ELIA 5IMLA 4NO0A 4CW1A 3O3AB 4RGOH 4UIMB 3RL2B 1Z5LA 3C5JA 3UTPD 1WFOA 1X5XA 4GAJH 5J0BA 1HXMB 3CH1B 2WBJC 3HE7D 1T66D 4IRSD 3MRIA 4IIQA 4EN3C 1Q9KA 1OTSD 5KZCD 4FQ2H 3LIZL 4ZOCA 3EHBC 2H9GA 1HHJA 1U8IA 3P4NB 4JLRB 4PGEB 4LRNL 5L2KA 1JFQL 3BN9D 1YEGL 5B38G 1WCBA 3O11A 5DRXB 1JNHB 5KSBB 3ARXA 4R7NB 1QEWA 2ID5A 1XCQA 3A0OA 5J6HB 3ULUF 4NQCB 1NCCL 1TTGA 3PWPB 4IS6A 2R1XB 3C6LC 4P46C 5C0JA 2KQMA 3PWPE 1AGBA 4U1KB 4R0LC 4UT7L 4UV4H 1FVEA 4IOIB 5SV3A 3EJZC 1YEDA 4G8EA 2AV7B 5C0FA 3ILQD 4XVTH 2BFVL 3ZO0A 3PQYB 1G7MA 3BJLA 4NJAL 1KV3A 4P2OD 1JPTL 2P43B 4XNUL 2XKNB 3HTLX 1ES0A 1OQOA 3L5WB 4PV9A 5ALCH 1YMMB 1U8KB 1UWGH 4ESKA 1HSBA 4FQHA 3U0PA 3K2UH 1KCRH 3RWGB 4UDUB 1RZ8B 3QUMA 3WNPA 4CW1B 1J8HA 4OF8A 4TQEL 5EU4A 1R0AL 4KZEL 1W8OA 5K9QI 1YN7B 2ED8A 1JGEB 3TO2B 3PGDB 4JR9L 3T0DA 1NDGB 1QBAA 2HMID 1SMAA 2DBLL 3KPLB 5KVDL 4QOKD 1H5BA 1BJ1H 4FQIH 4OCXL 5GRZA 3BE1L 5CBEA 1N59B 4FP8H 1J0IA 2VQTA 3TVMC 3MREA 4F37F 2PNDA 1S7QA 2VR5A 2ICWJ 2I5YL 3S3JA 4JRYD 5E6IC 4BZYA 4FQJH 1WT5C 4Z7VB 1PKOA 3LRHA 1KELL 1K8DA 4L4TB 3V6OC 3RUGF 5HPMB 3BRDA 1HOCB 4ZNEE 4G8IB 3HAEG 1RSFA 4IRSA 4GKOA 3FCTB 43C9B 3LN9A 4JM2D 4R8WH 3GMLA 5I74B 2WUCL 4C59B 5F9AC 3TBWB 1FL6B 1BFVL 5FHAL 2ATKB 2YHGA 4ELKA 5DF0A 4S11A 3QUYB 1SM3L 3ELAT 5CEZD 3L7FA 5JMOC 3QUXD 3L3GA 3B9KD 1A5FL 4JKPL 1F13A 3CIQA 5TE6H 3RWEA 3L1OL 3QRGL 4P46D 5IM7B 3HPJB 3RWFB 1XF2B 1PX4A 3CPLB 5IIEA 4MNGE 1ZGLM 1HWHB 1S7VB 3BGFC 3EO1B 4M3KB 1KIPB 4Y4FC 5MEQA 3PP3K 3OJVC 4WWKA 7CGTA 1KJ2H 3BYTA 3LS5H 4HHAB 4JFEB 3OKKA 1P9MA 4OF3A 1T7WA 4H26A 4PLJC 1RK1B 3BESR 4MAUL 1YYMH 3ARGD 4RBPH 4FQCL 2ESVE 2AJUH 1ZVSA 1UCTA 5ICXB 3V4PH 2OSLA 2BRRL 1B0RB 2ITCB 4FQ1H 4MDJB 2WM0A 4HUWB 3S37X 4XP9L 1E27A 3MRRB 4MHHG 3MLSH 4YDVB 2VDLH 3FT4B 1RUMH 1IBGL 4RGNB 5ID0B 4UOJA 1VEOA 1AQKL 1ZHLB 4NUJB 2NY1D 3IJYB 3GIVA 3TJHC 5F3BA 3FHAA 3Q3GA 3W81A 4CKVX 3ZTJH 4A6YL 4KPHH 2N4IA 2VUYA 3GJFB 3JWDL 3DMMD 3RIFF 1FYTE 5BVJA 5IMKA 5FGCB 2FJHB 1L7TH 2Z93B 4FFZL 5E5RB 4HS8L 5EU6E 4GT7A 5LAXB 3P2TA 4Z7UA 1YNTB 4KK9C 4KK5D 3O4LD 5JOPE 1G84A 4TSCH 4HKXB 3DV6A 1CS6A 4ODSH 2IQ9H 1LO5B 5C0RH 4ELMF 1T3FA 1VFMA 1JK8B 2X1PA 3DRQA 2IH1A 1MCWM 2OL3L 2ZG2A 5EU6D 5HHOE 1RZFL 1KELH 2P48B 1WWBX 2FHCA 1T1XA 1Y6MR 2P8MA 1DQTA 4RWYH 2BHUA 1OD7A 2BSSA 4WUKL 1Q72L 5MENA 1MLBB 2BCKB 1UJ3A 3FQXB 3LDBC 4XVUC 1EHLH 3UZVB 1IL1A 4JVPA 3X14A 5GXBB 4JZJC 2WNGA 1F11B 3NTCL 1J87A 1ORQA 5M7QA 1I3VA 1I9JL 2WBKA 3MRMA 5CSZB 2BHYA 2IGFL 3MJGX 1CICA 4YPJA 2Q87A 3GBNL 4MNHA 1IGMH 5DEFB 1A5FH 4JKPH 2BC4B 4LOUD 4XNMB 1LWRA 1HHIB 4Q6IA 5EUKA 4QOKE 4NQEE 1SBSL 5DGQA 3UAJC 3ZTJG 1LK3H 1MREH 1WWWX 2FX8H 2A6DB 3NFNB 1A9EB 4CVXB 4K94C 5IW1A 3BP4A 3BH9A 1MI5B 1S7RB 3UEZA 3CFBA 4OCRH 1I4FA 1N7ML 1F4WH 5T1DL 2E7LA 3OR7B 5KAQF 4MA3B 2VXTL 4ZPTA 1IEAA 2R0KL 3RDTA 5FV1L 4KI5D 3P73A 1H3TA 1AP2B 4HJ0C 3QI9B 5DC4B 5HY9B 5L8KB 4DKDC 1PSKH 1U3HA 1N6UA 2GAZB 2R0WL 3TV3H 1IGJB 2V5RA 1KJMA 2GQHA 1FFPB 2V5YA 4TPRH 4GLRI 2BJMH 4P5TB 2VZUA 3FB6A 2YSSA 3OKEB 5JPNB 3EYOB 2VXUH 4K2UH 2W91A 5DO2D 2E6PA 5F9DC 5KSAC 3G6JA 1A1OB 4KMTL 2VL5A 1MHCA 5D1XD 4P5TC 4O9HL 5DHYA 4PJEF 5BW7C 2L4OA 1FSKB 2AJSL 1F4HA 3HI5H 1MSPA 1II4E 5FDWA 1M7IB 3MOBH 1YJDL 3L5HA 3MZTA 4RNRA 3G08B 2NXYC 3OBAA 2M2DA 5DJ8A 1H15A 2AEWA 4PJDA 2F5AL 1IKNA 3N0PB 5CWSB 3B2VH 1J1OL 1DBMH 3FT4A 3DECA 3IFPB 3S6CA 1RZJC 1MUJB 4PJ9C 4ZXBC 4ZFFA 3U79A 4XCCH 3DIFB 3SKNA 1J8HD 4XX1E 5DMYA 4LLMA 5HI5D 3DYPA 4XWGL 1I4FB 3TJHD 1RUQL 4UT6L 4G42A 3TNMB 3SDXF 4HC1H 1OGAA 1KYOK 3DURB 4TVPL 4I3SH 1I8LA 4NQXB 1N5AA 3RVTD 5GZOD 3KLHC 2BVTA 1CFQA 2NXYD 4TSAL 4N8PA 4X6CB 3D9AH 3UP1A 1KIPA 1HKLL 3F6IA 1MJJA 1OCWL 1E4XL 3KXFE 4N0FA 2IH1B 2AK4A 4ZS6C 4NSKB 4HZLA 4KVNL 5GGTA 5DJ8B 4OGZA 5C0RL 1D5ZB 4UT9L 5IVOA 2CR6A 1ADQL 4O02H 2WP3T 4XC1H 4N9GA 5J9PA 2YUWA 4NQDE 2GSGA 2OQJB 5ILTL 1U3HC 5T1KB 4EXKA 2DOCA 2DMBA 4N0UE 3SE8L 3AUVA 3PWLB 2NTSP 5IOPA 2XFXA 5HBBA 4PRAA 1UZ6F 4CJ0A 5MHSE 3D2UA 1OY3B 3LSOB 4RWYL 3QEHA 4PJ7B 5I73C 2AXJA 3SBWA 1Q9OA 3ILPA 2HT4D 1N4XL 2I9TA 1G9NH 2FYYA 1T03H 1V5JA 1HH9A 1UWXK 2CK0L 3WS6A 4WW1B 1BHGA 4PJ8B 2E8ZA 3MR9A 4FQLL 2D7MA 3LS5L 3SKJH 1ZT7A 5CZVH 4WFHE 5MHSD 1PFCA 4ZO6A 1GXEA 3QNZA 5TQ0L 3MV9B 4NPYB 1OP3K 3UTQA 1RD6A 1N3NA 1ZVHA 1E28B 3LZFH 5E6IA 4MB3A 2KBGA 4LVHC 3QEQB 2JJWA 2HRPH 5F72S 3HI1A 4PTUB 1YMHB 4MZ2A 1I8IB 4QXTA 3UDWA 2CO6B 3DUUA 3T3MF 3MLXH 1AC6A 3FQWA 4YXHH 5HYSG 3N85H 2L0DA 3ZYJA 3D69B 3K4AA 1XGYH 2AK1H 5E4EC 1KYOJ 2Y6SD 2R2BB 1EAPB 4JFZH 4DJMA 1A9BA 2PKDA 1QSZA 2ESVB 2IAMC 1KLGA 3VXMD 2OR9L 4NRYB 3VXRB 3BGFB 2FNBA 4JKLA 5TJWK 5CIPB 4KJQD 4NDMB 5ALCL 2Z31A 4LSRL 3LHPH 4X5LA 3TA3A 5I17A 3WIHH 4PJEA 5HVHC 3RY6A 3ULUD 1P4BL 1TETH 3EYVA 2E7CA 4DOHB 4P2OC 3V4VL 1SJEA 1B2WL 1A3RL 4MYWB 3K81A 2DQFB 1TTFA 2O5ZL 3QDME 3ARWA 1FNLA 1HHJB 1U8IB 3BQUD 1CIDA 2F53D 2BNUA 4TNVK 4XVSH 1KT2B 5TE4H 4GRWE 3W9DA 4Y5VB 3AB0B 3MRLA 5JW4R 3DX8A 4NQSB 3JUYA 4OV6F 2VN7A 4JHWL 1KPVA 5JDSB 1MCWW 3BGAA 1WICA 4OAWB 4FTVA 4YHZH 3EHBD 2J88L 4PD4J 3VXSA 4KH2A 2W0FA 3IT8D 2GTWA 4U1HA 3ZT7A 2W60B 4KTYA 2BFVH 4CU8A 3SE9H 1OL0A 3CLEL 4NGHL 1MCEA 2E8YA 1ONQA 3HC4L 1T83C 1NANH 3CXDH 5C3TA 4ODWB 2E7BA 3S35X 1KT2A 1KPRA 2WWKO 5IJVA 1CZ8L 1FIGL 2FHBA 2PXYD 4PBXA 5CZVL 3ULVD 5JXAH 3ILQC 4EN3A 5GJSH 2OL3A 1G6RB 3HA0A 1ULVA 2AXGB 1F4WL 2J8UA 2Q8AH 3W9EA 5DI8A 1C12B 5EDXA 5DD1H 3Q2CA 3U9PH 4HXBH 3W0WD 1VSCA 5CIPH 5C7XH 2XKUA 1BAFH 2Y07L 4HIEA 5KSBA 1IM3B 4M6NL 2UWEE 5CJXA 3KPSE 2H8PA 3VJ6A 2V5TA 5I8EA 4Q0XL 4RGND 3GMQB 4XCEB 4LLWA 5JXEC 1MH5B 2I26N 1MHPL 1VGKB 5CJ8A 5BV7L 3ARFB 2ARWA 4PV9B 3HI5L 1DDHA 5F9OH 5IB1B 3ZE2E 2JK5A 1EUTA 1GPOH 3OF6D 4L4TD 4DWHA 3WJLA 1J1PL 4M7LL 5HYFA 3EOAB 2ZOKA 3UYOD 1JTPA 1IM3A 15C8H 5D72H 4V2CB 7FABL 3DVGB 1PLGH 3E2HC 2IJ0C 4CN4A 3B5HA 1FJ1B 5EU3B 2AKRA 2OMBA 1XGTB 2NY2C 9CGTA 3CDYA 3O6FA 4PJFB 1R3LB 3BEWB 2BY1A 4K8RL 5D1ZA 2HTKC 3FQTA 4XHJC 4BUHA 2H3NA 1KXTB 1I75A 4OLVH 4NYLB 4XPTL 4LQFL 4HG4K 4EIZC 1HSAB 3K0WA 1HQRA 2V2TA 3B3IB 5FHBL 4E0RB 4ODSL 3BAEH 1CR9H 1IAIH 1CLYH 1T83A 1ZVYA 3FQUA 4J3OC 4UU9A 3KYNA 2IANA 4LNRA 1TNMA 3RL2A 4GRWH 3NAAH 3RAJL 1W72A 1DVFC 1JIBA 2QJDA 3VGAB 4ODVL 5F6HI 4ZODA 3N50A 4F7MB 5IW3A 3IFOB 4X6BA 4EZMA 3LH2L 4FG6D 4ACPA 1AO7E 2J6EL 5FYLH 4NFCA 3QCUH 4MXWL 4XTRC 2YPKB 1BZ7A 3SE4A 3DO7B 2UWEA 2XTLA 2E3VA 5CJQL 1CCZA 3UX9B 4E41A 5L7XL 3FFCB 2QKIA 5GISH 1Y18A 5FK9B 1JBJA 1CGWA 3MLSL 4H25A 3ARTA 4PJIB 4XAKD 1WGOA 2RFXA 5E2WH 3UC0L 3MBEC 1VKXB 4N0RA 1GSMA 3HE6D 1IC7H 5JTWA 3GSVA 4QYOA 4M9PA 5DS8A 2OJEA 1FP5A 5F96H 3OKMB 3V0VB 1BJMA 2UZXB 3JTSB 2V7HB 3IU4H 3O6ML 4BFIB 3MRJB 2BK8A 4OT1L 4QRTA 4M8QB 4Z7NF 3OXSB 2XT1B 4JRYE 1FFOA 5C08D 2LU7A 4XNYH 4JREB 2P8LB 1BQSA 2ZKHL 4U6XA 5C0EB 1CTOA 1XEDA 4OCYH 5ESVB 4ZFFB 4NZRL 1IAKA 5FOJA 4K7PX 3ES6B 1AO7B 1UWGL 1RUPL 3GBML 4NZTH 4Y2DA 5D1XB 4HS6A 5E70A 1D6VL 2XOTA 3QWRA 4JJHA 1F00I 4MS8C 5C86A 1WWAX 3EOYG 1GYAA 3MJ9A 2Z8RA 5I1KH 4LF3A 4YFDB 3B8SA 3AMKA 4X9BA 2FO4B 5E8OA 1KJ2B 1U8HA 3NA9H 5DTFB 1I8IA 4QXTB 4XVUD 3BSZL 1F97A 2IADA 4PGZA 3IVKB 1XH3A 1A7QL 3QCVL 1MPAL 5IK3B 4JREC 2AP2A 3WLBB 5GJTH 1S9YB 4XX1G 1KLUB 3GMOA 4PJEE 4EUPG 3D18B 5DK2B 5CJXC 2NW2A 4KI5F 3DUSA 4JRXA 1CGUA 1OWRM 3SBWC 3WN5C 3MV9D 4I5BA 3S35L 3V5DB 5L0QB 3RKDD 5HVWA 1IGIH 1EA9C 4BK4A 1BBDL 5TH2A 3NFPA 2PYEE 3WN5B 4MA3A 1AD9A 3EZ8A 4JPIB 2YXFA 4UINH 3DTXB 5DDHB 4GBXB 1HWGB 4AQ1B 4AENB 1XR9B 1G7JA 3IDYB 4YHKH 2F53E 2EXWC 4L8DB 4PGBB 2C3VA 2CK2A 1AFVL 1F6FB 5JHDB 2I60L 1P9MC 4R26L 4Y2OA 5IKCA 1MFAL 2R56L 3DROA 4XBPA 3OJMB 4EQ3A 1QSEE 5DHVA 1U8LB 1U42A 4D0DA 1U8NB 3D25B 5JOEA 2OXHA 3BMVA 1BFTA 2ADGB 3IDGB 4MAYC 3ET9F 3LKQA 3RL1B 4Y4FB 1CF8L 3PHSA 4KXZI 2EIBA 4U1MA 3T0EA 4JQVA 4YHLL 2ZG3A 3GSNL 4LSDA 1VKXA 1VGEH 4MA1B 4QHMB 3EDEA 2VUOA 1NMCB 1NFIA 4P2QE 4WHYG 3EYUH 1JPGA 3DVFA 3RIAF 4R7DA 3TIEA 2Q1EA 4V1DB 5C0AA 3DMMB 3CCHA 5FA3B 4KC3B 4XBGB 1JYXA 4BQ6A 1BZ9B 3V8CA 5JORA 4WEBL 3RHWF 4Y88A 4OLWH 1G6VK 3IDUA 4J23A 3GRWA 4R2GB 5AYQA 4MJID 5E8NB 1RURL 1DFBH 3FB7B 3HC3H 5DT1L 1MIMH 1QBBA 4CNIB 1MCOH 4OIAA 3ZE1E 1VCAA 4WUUE 1J88A 5FYJH 3DJ9A 5ENWB 4PJIE 3AFLA 5MEPB 1M05B 3TPUB 5EA0H 5GGUB 4PJHB 1TVHB 3PWJA 4KRNA 1FYTB 3Q1SL 4JFED 4IOFD 1IC7L 1CFSB 1JGVH 4JFHE 1TTUA 4PS4H 2P46B 4UQ2B 1MELA 5KVGL 4KUCD 5EBLB 3ABZA 5IBUB 3ULVC 1NEZA 5CP3A 4K3JL 4LSUL 2YZ1A 4BZ1H 1YUHB 1CDBA 5D7KE 3VFOA 3IJHB 2HVJB 1J12A 4W4OC 1RUAH 1E0OB 3PDDA 1KCUL 3QQ9D 3D3VB 3L3IB 4JO1H 5D8JL 4GS7C 4HWZA 4R2GC 2BVPB 2FGWH 1H3VA 1KEGL 1ZHBB 3UTZA 4IHOB 5SWSA 4HMDA 5D2LF 1MNUH 3BH9B 5H8DA 3B43A 3MRMB 4LHUG 1S9KC 4LRIC 4P3DB 2IBZX 4WVRA 3PP3H 1B0GB 5EN2B 5IV2B 1SJVA 3MUJA 1EO8L 4ODXA 3RU8L 4IIQC 3TYGL 4N0YL 1OLLA 3ZTNH 3VFPA 5LGJB 2EIZB 4NRXA 3IKKA 5HVHB 1GCFA 2FWOA 1Q9LA 4HBCH 1NMAH 4J4PD 3RA7L 3U0TA 5DD0L 3QFDB 4UB0H 4NNPH 3BGMB 4K7FA 5CKGA 3QYCA 3ULUL 3C08L 4EN3B 4OD3L 2HP4A 3HNVL 3QQ4A 2IALB 3AROA 4JO4L 2B4CH 1MLBA 4BZ2L 5GS2D 2A6IB 2CSPA 3UYPA 1WIUA 4U1JA 5FO7A 4H88L 2FDBP 5CEYA 3P40A 1MRDL 2DLEA 3LRSB 5D93B 2WINA 4JDZA 2VDPH 1KGCE 4I77H 3GJFA 1NCAH 4OZ4A 3E8UL 3QHZL 4R3SB 5IG7B 3H42L 3MUHL 4JPWH 4C58B 1T66C 4G6JH 1MIML 2PYFA 4XCFL 1IARB 2X2YA 5E8EB 4OFYD 2A9MH 2VLRB 4OM1L 4OGXH 1JHTA 4WTXA 1FVCB 3H42H 4CMMA 3KPLA 3D85D 2NTFB 5GGQH 4PJGA 2APXA 1HSAA 5LCVL 5GRVK 1HINL 3F58L 5I8OL 3O6FD 5K93A 3MRKA 5E8OB 3TBSA 4JFDE 2Z92B 3SKMB 2CDEB 4J1UA 4LHJB 3QUKB 4N8CL 4WY7H 3HZMB 4XMLH 1HZHL 1A7NH 1T7ZA 2E27H 3JWOH 5EU3A 4Q58C 1RZ7L 1CGVA 1H0DB 3B9EA 1K2DB 3T0VA 2Q20A 3O2VH 3QHTC 2CIIB 1DJSA 1ZT1B 2EKSB 4OD1H 4E41D 4IRZL 4LVOC 1U95A 3QXDA 5SWZB 3FT3B 2LTQB 1A9BB 2ICCA 4ZUWA 2PETA 4DTGL 3O2WH 5EUOF 1HHKA 4HX1A 1W8NA 4G6MH 3W39B 4D2NA 2VH5H 4O2CA 4IS6B 4P2OB 2X44D 4Z0BL 4K3DL 5D6CA 2NCMA 2GK0A 4H0IA 1DN0B 2VLJA 4OZGE 4XNQA 3DETD 1EXUA 3KXFB 2G2RA 4KROD 3NIDE 2X4QA 4XH2B 3Q5TA 2MOVA 5INDB 4ZFOL 4EOWL 1SJHB 1UKQA 4KJYB 5ABDE 5CILH 1M6OB 3SO3B 2Z4QB 2R0WH 4NUGL 4M6OL 4ERSH 4MXQD 3QA3B 5FECB 4KV5F 5GS3A 1LO2L 1HILA 3PHOA 4NKIL 3VRIA 3C09C 4LF3B 2BNRE 4KKAC 3B3IA 4KQ3L 3K4ZA 4PRAB 5DVKA 4M93C 5B39A 4E0RA 3EYFA 2FX8L 2HJKB 1QR1A 4U6HA 5I1KL 2X4OB 1S7TB 3PABA 4HQQL 2FEEL 1A7PH 3ARQA 3MLZL 4QCIA 1B3JA 2K3TA 1XGUA 4IOFC 3ES6A 5C09D 3V7MA 3QR2A 1Q8MA 2R4RL 3QG7H 1EJOH 5GGQL 4JANB 4OB5H 1NDGA 4JDTL 4HBQA 1LGVA 2EXYD 4LU5L 1DL7H 1GZPB 3FMGH 4ZFZA 5KSVA 3M1BB 3S88L 1AKJD 5FKAB 4LDEB 2OI9C 4FZEH 4JZOA 2YUXA 3HZYA 1CL7L 5F1IA 1X5KA 5F96L 1MLCA 3ARZA 1OF2B 4WCYH 3ZKSD 5ESAA 1TPXC 4C55A 3JWOL 4Q97A 4FQCH 4NO0D 4L9LB 3LQZA 5FGSA 1NDMB 1QYGL 3W82A 4PJCB 5I74C 4M1CC 3GMPB 3ULVF 4CMMB 4CUCA 4MD5A 3LAFA 3KPSA 4URTB 4FP8L 3H7LA 2NNAB 2CKBH 1A22B 4UUJA 5B22A 3OV6A 2WMPA 5HVGB 5BZWA 4YR6A 3GDBA 5FO8B 3VXTA 1YY8A 3NABL 3WSQL 4DOHE 5ALBH 4HPOL 4YIQA 4PLKC 1EH9A 4Z0BH 4GH7B 2VISB 5ETUB 3OKYA 5J1AB 2R0ZH 1EIBA 4JFDB 4DN3L 4LP4A 2VDOH 1KTDA 4L9DA 4QRSB 2MPAL 1FLTX 3RVUC 4X4ME 5MP6L 5K9JL 5HI3D 3TJEH 2XN9D 3UTSB 1FYTD 5DJAA 1MJUH 3H3PH 1FZOB 1EEUA 3GB7A 5CZXC 4OZ4B 3VFRA 4O00A 3GHEH 1FFRA 5I9QB 1AP2A 2NX5E 5FUZL 4NUGH 4XVJH 4ZPTB 2Y5TB 1UB5B 5AYUH 3SE9L 3O81A 1LK2B 3MBED 3P77A 5D6CB 1X5YA 4JN2A 3V5HA 2A6IA 3VWKC 4ETQA 4MD0B 5T3ZD 4JZJB 2DJ4A 5GS0L 5DD0H 1RMFL 3VI4F 4M7JL 4YDJA 5D1XC 4HLJA 1QA9B 3ARGA 4HGWA 3GSNB 4UILH 4HFUH 1NFDA 3OAUH 3BWUC 1A64A 5L8JB 3TT3L 2R1YA 4NN7C 5IHUL 4PRHB 1MAMH 1RZGA 4V1DD 2IANE 5AZEL 2EDDA 1T04B 2ICWB 2DQGL 2NY0B 3JXAA 3QEUB 4D0CB 3MQIA 1ZSDA 4M1DL 4XAWL 2CIIA 3QHZH 4P2RE 1D5MA 2D7TL 4D0DB 4GKZB 3SDDB 1KOAA 3S98A 1A2YA 3GMNA 3T2QA 4R4BB 3JZ7A 5F1NA 5TQ0H 1NCWL 4P3CL 3VH8G 1GHFL 3ARDB 1TXKA 4XTRD 2I27N 4DEPB 4NQCA 4Y4FD 4OV5A 2QR0A 5EBLA 2GIYA 4AENA 5DRXA 3OAYK 5FB8B 5HYQB 4P2QD 5FHBH 1NBYB 1FAIL 1SQ2N 4GMTL 5DC0A 3MLVL 2EDXA 4TVPH 1OTTC 4LCYB 4TNWK 4GLRH 2PCPA 1F3DJ 5DJYB 1NGQH 2AGJH 1X5IA 3H7BA 5CSBA 1RU9H 2V7NB 4WUUB 2XQBH 3MLRL 4HKZA 1EEYA 5D5MF 5L2JA 5KOVC 3KNBA 5D70H 1G9MC 4X6CE 3S96A 4NNPL 2DMKA 2CD0A 3VDBA 1EGJH 3WXWL 4LU5H 4GG6B 1TJGH 5KSUA 2BNQD 5IMKB 5J9PB 3U36B 1OAZH 1KN2H 1OAKL 4DGVH 3HMXH 3O6KH 2NY7L 3HFMH 1BECA 4I9WD 3RNQB 2EICA 5HHXH 4Y4KD 3BPCB 3WJJA 2IAMD 5K59F 5JA9A 3RBSA 4Z95H 3QPXL 4G6ML 3QNYB 1MQKH 2JCCF 4Y4HA 1OSZA 1B6DA 2VZTA 5I1GL 1RAMA 1N64H 4G5ZL 3JV0A 3WL9A 1PGRB 5KW9L 3QWQB 4K7PH 1Z9OA 2O5XH 2YMXL 3KYKH 4EOWH 4AIXA 3RTQD 3T4AA 5K9OA 2P5WB 3LS4L 3UROR 3BE1H 4XWOD 1A6WL 2IPKA 4XPHH 4AZ8A 4PB0L 1PZ5A 2HFGH 2DBJA 2B1HL 5M94B 4ORGA 2DQJH 5LWYL 5DEZA 4DFHA 4KQ4H 3PL6B 4LLDA 5EU6B 3LKOA 4YE4L 4L3AA 5ADOH 4NKMB 3BT2L 3QUZA 5BOZG 4X4XB 1I7ZA 4GG8A 5JR1L 1IGCL 3VI4E 3BFOA 3VWKB 4PRHA 2VO5A 4L3EE 3V6FA 4DUXA 3BD4A 1YEKL 2WK2A 2G5RA 3R0MA 25C8H 4JR9H 1BZ7B 1EEZB 4C83A 5B38A 3B6SA 4OZFG 3SDXA 1T1WB 1KIUA 5MEND 4RAUA 2V6HA 4OGYL 1WFTA 3NCYP 2BCKA 5DHVH 4RX4D 3QJFA 1FNAA 5J89A 2Y25A 1NFKA 1DR9A 5HPOA 4G43B 2WQRA 4RA3A 1MJ7H 1DQLH 3IXTA 3QUXB 5MERB 3U4EB 1X9QA 4AH2B 1W72L 4M4PA 3VXRE 1K8DB 5FYKL 3SGDI 2GTZB 4BFEA 4HH9A 1WFNA 3MLYL 4R97B 4AEIH 5F7KC 1ITCA 3C6LD 3DPBA 1FAIH 4NKDA 1RV6X 4G9DB 5FYKH 3WS6C 4MA8H 5E08L 1KCSH 3BQUC 3EDJA 1LO5A 1HHHA 1XF3A 3B9VA 2CDGB 3E6HA 1QOKA 1T0NA 4W6XB 1YEEH 2W9DL 1HDMA 2RB8A 5IF0B 5BJTB 4NFDA 4UBDC 4XP4H 1T80A 4GG6A 5H35B 3FO1B 1K8IA 5D1QC 4P4KA 1W0VA 4YIQB 1DEEB 3UPCA 4Y5YA 4FABL 2B4CC 3HG1E 3JV4B 3IDIB 3DHMA 4CVZA 4WO4C 3CVIH 1U9KA 1RUML 2ENSA 4GRMA 1H3GA 4WTZG 1UWEH 3WFHB 4KK8C 3RTQA 3VFNA 1JYVA 2R69L 3ZZ1A 1K9TA 5IVXA 1NFDB 1U2HA 4HKJB 3TBTA 5DWUH 3IFNL 1BLNB 4IBLT 5IFHL 1VFBB 3QDGE 1OAYL 1P69B 4N68A 1SY6L 3Q5YA 4XCYA 1NEZG 3TEUA 3GKWL 2Q8AL 3QQ3A 1FIEA 2NX5D 2GUOA 2XTJC 2Y9RT 3FN3A 3I02A 5GJSL 1JI1A 4L8BB 3VE0A 3W2DH 1LO3H 3CFCL 1MCRA 4OQ1A 4ORZC 1P2CB 3GIZL 5L9DL 4XPGH 1U8QA 2I24N 5JNYA 1BPVA 1Y18B 2YEZB 3AM8A 3DVNB 4Z7UB 1NC4B 3LDBB 4JB9L 1IGCH 3T2OA 4Z7QE 5BVJB 2V5SA 3FAWA 3OJ2C 5F7HA 2L7JA 1UENA 2EE6A 1YEKH 1PD6A 4UIKH 3ARBC 4JN2B 4XZUA 3VFMB 4WTWA 5C09B 3EYOA 4KY1H 2A83A 3DRQB 4WUUA 5L2JB 4BQ9A 4HSQA 1DTUA 1UYWL 5GSVB 3TM6A 4GAGH 2DTML 2AKRB 3HN3A 2NNAA 4YC2B 5JUEL 5HI4C 1EK3A 1ZLVK 1KB9K 1M6OA 4RFNC 4IRJC 1YPZE 2XA8L 3I6LD 2AJYH 1YNTA 1KB5H 3CSYB 4M5YH 5J1AA 3OR7A 5IEHA 3TN0D 4ZUVB 3U4BH 3MO1A 5LQBL 2BDNH 1BWWA 1DBAH 1TQBC 3EDKA 1JGVL 5CJOL 1OVZA 5TDNB 3SHSA 5C6WH 2PR4L 4NJ9L 1YEHL 1IC1A 5DZLA 5EC1B 2DLIA 1NUFA 4ENED 3X11A 1MEXL 1JZ2A 4HIEB 1DVFA 2HVKA 4NDMA 1C7SA 4G6FD 5F8QC 3IS1X 3FFCD 5GZND 2O93L 1RULL 3EO9H 3HZKB 3MUGA 4FQXA 3BKML 4JFXA 1G9ML 5DD6A 4LIQL 2IAMB 4WI4A 3B9DA 1F11A 5IMOB 4HGWB 1BIIA 2LQRA 5KVFL 5E2UH 2NX5A 2KH2B 4TRPL 4NHUB 1BEYL 2WBJB 4KDVA 3E0GA 1EV2E 1RZJL 2UVFA 2ZCHH 1WF5A 4LCCC 3LKRB 1AGBB 1F5WA 1MLCB 3MZGB 4U3CA 3MOQA 5FIEA 3SGKC 4CMHB 3IETB 4HJ0D 3BO8B 3QIBA 1RJYB 4X80H 3ISWA 5F88A 3CZFA 2H1PH 3OJDB 5EIVA 4HIXL 1PSKL 4OLZH 2O5XL 2XNAB 1JHKH 1KTLB 5A2LH 1NC4D 1FL6A 4G8GB 1YC7A