4LSRH

Crystal structure of broadly and potently neutralizing antibody vrc-ch31 in complex with hiv-1 clade a/e stran 93th057 gp120 with loop d and loop v5 from clade a strain ker_2018_11
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
231
structure length
217
Chain Sequence
QVQLVQSGAAVRKPGASVTVSCKFAEDDDAPEHFIHFLRQAPGQQLEWLAWMNPTNGAVNYAWYLNGRVTATRDRSMTTAFLEVKSLRSDDTAVYYCARAQKRGRSEWAYAHWGQGTPVVVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN GP120 WITH LOOP D AND V5 FROM STRAIN k
publication title Multidonor Analysis Reveals Structural Elements, Genetic Determinants, and Maturation Pathway for HIV-1 Neutralization by VRC01-Class Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 43
structure length 217
sequence length 231
ec nomenclature
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lsrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lsrH01
4YEFA 2QJDA 3PDDA 1U42A 4Y5YA 2NTFB 1P4LA 3H6JA 5CGYC 5DFVD 3MV9D 3M17A 5CBEA 1EZVX 3DUSB 3O2WL 4AT6A 4DFIA 2V5YA 1HH6B 1PKQA 3H3KA 5C08B 1HHHA 2HJKB 2FL5B 4F57L 1CGTA 3WO4B 3A6CL 4Y88A 4NNYA 3S3JA 4Y2OA 4M6ML 1S7UA 4S0TD 4IMKA 1XIWA 5FGBC 3LH2H 1ITBB 3TC9A 2EE3A 5SWQB 1U93A 3RA7L 3C08H 3B9KA 4K8RD 1S3KH 2EE9A 5GIRA 3U0TA 1UEYA 3V52L 3FQNA 1JMZA 3QJFA 3I6KA 1F90L 2AEQL 3VFRA 1NFDF 3MRBA 3VFWA 1TQBC 4OGYH 3I6GA 4NKQB 4PJ9C 3ZE2E 2HKFH 5TFSH 1U9KA 5C0JA 3MJ7B 5I71C 4TSAL 2DQGL 1F4HA 2VIRA 4XVJL 1U8NA 1D6VH 3NA4A 1MFAH 3ULSA 1QEWA 4M9PA 2R15A 4KY1H 3D39D 2VLRE 1HK6A 1EO7A 1MQKL 4NQTA 1I9EA 1KJ2L 4LARL 1Q9KA 4JFPB 3JTTA 4NHCH 1KEML 3JWDH 4FFZH 3M8OL 3QHZH 4WVRA 2Q7YB 4GBXB 3IGAA 2OTUA 3RDTB 1QFPA 4UIMA 5FDWA 2CPCA 4KRPC 5MP6H 4P4KB 4PIRF 1BREA 3SGJC 4H88L 3MRFA 3VG0L 3IXTA 4HS6A 2YZ1A 1KPUB 2COQA 5EO9B 5GGVL 1KTLB 3RWJB 4ZO7A 1A1OA 5T1KD 5BOZG 3KXFE 3O6FA 1Y0LA 4G9FA 3S96B 1YEDB 3REWA 1PJ9A 3EO0B 1HQRA 2DKMA 1WFNA 5GRXG 2VDNL 2OR9L 4PRHB 4PD4K 4NN7B 4PJEF 1YN6A 2FJHB 4HWBL 4Q9CA 2G75B 4NQSA 5JO5B 3RKDD 1UXSA 3ARED 2CRIA 1DQDH 1MJJB 4G8FB 1KN4L 4NHUB 1WTGT 4OI8A 3VDAA 4QHUB 4K7PY 4U1HB 4JRWA 4IOFD 5BMFH 2OTWB 3ZKND 3UYRL 2EXYC 5HPMA 2BY0A 2HVKA 3OB0K 3P4OA 1CT8A 2AK4E 1K8DB 3K2UH 2YR3A 4WEBH 3RZCD 2D7OA 4F3FA 5J6GB 1YEIH 3WKML 4U7KA 3OXRB 3ARFA 1OAQH 4OCWH 3GO1L 4XC3L 4G6FD 2PYFB 1JRHI 4YHMH 5E8PB 4RRPA 3HCVB 4JFHE 1U2HA 5IP4A 2NTFA 1QFWH 4HGMA 3LZFH 5ISZB 1WBXB 3BMVA 3DUSA 5LWYL 3OXSB 3A6OA 3DUUB 2R4RL 1HH6A 3BESR 4Z7OF 1O7SA 4PJCE 5C08A 1F58H 4R4ND 3R4DA 2HJKA 2FL5A 5FYKD 3PWPE 2YKLL 1R3IL 5EB9A 3S9DB 1I3VA 1NFDE 1J5OL 4KAQL 3RL2B 5HDQL 3L3IB 1D3CA 2D03L 3T77B 5SWQA 1GRWA 2DN7A 5JHLL 1JHLL 4AEEA 2ZUSA 1S9XB 3HAEA 1A3RH 1E28B 4TULH 5IFAL 2FO1A 3MJ7A 3SDXF 3CDCA 4K2UH 3RIFF 4LBEB 3KDMB 4YQXL 5M95B 1UM5H 4QXUL 3W11D 3UP1A 2ZCLL 4PJIB 4MXWL 1KB5B 4JFPA 4YUEH 5CSZB 3DRTB 4N8CH 5DMIL 3ARQA 1CVRA 4JFYB 4GBXA 4PB0L 2IBBA 1H5BB 3RDTA 2QQLH 4P23C 5CCKH 1ADQH 3UTSD 3HR6A 4WWKB 1ZE3C 1A6UL 5C0AA 4P4KA 5F44A 2VYRE 2JJTA 5EOTB 3DTXB 3LEYL 6CGTA 4N9GB 5EO9A 4CVWA 2D0FA 1KTLA 3QIWB 3RWJA 3U0WH 1KT2B 3LMJH 5CJQH 4JPWL 2F8XC 5DVOA 5KSBB 1ITCA 1CDUA 1NMAL 4O02H 3BW9B 1YEDA 3SE3C 4MXQC 3EO0A 5C71A 5SWSD 4KDTC 3RI5K 2A6DB 4O58H 5I18H 2P8MB 5D7LB 3SE8L 1FGVL 4PBWD 1OCWL 4OCLC 2FJHA 2G75A 4PJHE 5JO5A 4K71C 3AC0A 4ERSH 5JPNB 1A7NL 1QPPA 3N85H 1MJJA 4G8FA 1CXEA 2D7QA 4NHUA 1F8TL 4U1HA 1IC5L 2OTWA 2QBWA 4MS8D 2J4WH 5EUOB 2F53E 4MB4A 1U8MB 1K8DA 2PO6B 5E2TH 4LPYA 5J6GA 2AEPH 1NKOA 2VXUL 3OXRA 4Z7OE 4OLVL 5IJVB 4JN1H 2PYFA 3QYCA 2E9IA 3QIBD 4DTGH 5DC9B 5E8PA 3LB6C 3HCVA 1U58A 4S1RH 3MA9H 4F8QA 2X10A 4KRLB 5ISZA 3SDAB 3VXPB 3EDDA 1BF2A 1WBXA 3OXSA 3DUUA 5AYQA 5F6IB 4LSVL 1FYHB 2VMFA 4RGNB 5C0ND 4AIOA 1RZKH 1R3HB 1K3IA 4AMKH 4APQB 1FV1B 1MAKA 2D31B 3QWRD 3RL2A 2IMNA 4HUXB 2A9NL 3DUHA 3IRZA 3R06A 3L3IA 3TCLB 3OQ3B 1PG7X 4KMTL 4FTVB 5T3XD 3T77A 3VGAB 1OWWA 3AROA 3ULVD 2FYYB 3IDXH 4HBCL 4X6EB 1OHQA 2YPKB 3HE6A 1BVZA 5T1LB 4CVUA 1TVBB 3ZT6A 1E28A 4HCRL 1OGAD 4GRWH 3VXME 4CN6A 4WEMB 4PLJD 2VWEC 5D5MB 5IHUH 1A4JB 1TZGL 1HXMB 3WFBH 2BHYA 4Z7WF 3KDMA 2WBJB 3C60C 1HINL 4I0PD 5GS0H 4PJIA 3WXVH 3DSFL 1KB5A 3BEWB 1RURH 3MOQA 1GPOH 3RVWC 5CSZA 1MCBA 3DRTA 1R3JB 1NBYB 3C09B 4PJFF 3D39E 4JFYA 1JZ3A 4MNQB 5TE6H 2ATKB 3SO5A 1H5BA 2XRAL 2VL5B 4WWID 2AERT 4WWKA 3EO9L 2IEPA 2KH2B 1QR4A 2HT2C 3DOSA 4Z7UB 4WHYG 2K9UA 4S0SD 1KELH 3GFUA 1CGSL 1I1AC 4RQQB 4N9GA 1DEEB 1U95A 2EEAA 3QIWA 3AU1B 2RR3A 5LXGL 1KT2A 2JK5B 2ARWA 5KSBA 3BW9A 4FQHB 4FXKB 2VDQH 3BZEB 3K3QA 5LGHL 2A6DA 5I15H 2GK2A 2QQQA 3DRQB 3DXAD 1KCKA 2IBGA 2P8MA 5BS0D 2DMBA 2ENSA 1H3WM 4HLZG 5D7LA 3UCRA 3QFDB 5JPNA 1KJMA 5E03A 1Q9LA 4G5ZL 4PJGF 3VI3F 1QSFB 4ORGB 5EUOA 4OB5L 4MZ2A 1FDLL 5GRVK 4KJWC 1YEFL 1I1FA 1WICA 5E5RB 2PO6A 4IJ3B 5EBMB 5MI0C 3LEVH 1TCMA 2GCYB 1IQWH 5JOPD 4EKXA 5IJVA 4NNPH 5EWIH 1WEJH 3ARGB 3MC0A 1AY1H 2ZPKH 4GLRH 3EFDL 5JQ6H 2DLFL 3SDAA 3VXPA 4B53A 2NPLX 2PTTB 3LQAH 4M7KL 3DO7A 4LCWB 1P84K 3BYTA 1J88A 5JIHA 3BO8B 1HSBA 1N6QL 1OAZL 1OOAA 3DHMA 3S98A 2WWKO 4GQPH 2A2QT 4XPGL 5E2JA 1R3HA 2YMXH 5E8EB 1A5FL 5GZOC 4XP6L 4APQA 1FV1A 4FABL 1IBGH 2D31A 1MCWM 2CH8A 4HUXA 3TCLA 2Y36L 1UH2A 4ZD3H 3ZTNH 4FTVA 5FYKE 1RMFL 1MIML 3VGGA 2FYYA 2VTFA 4ONFH 3EGSB 4M7ZC 4X6EA 1F2XK 4GW1B 4OZFB 3TH4T 2YPKA 3K74B 5T1LA 1LE9B 1TVBA 4LASL 1C5BL 5HVHC 3LPFA 5D5MA 1A4JA 1HXMA 3B9VA 4YDIL 4HUWB 1CE6A 2WBJA 5DYOB 5FYLD 3ARZA 5DK2B 5T3ZD 3MLRL 3MCLL 2EIBA 1LQSR 1QHOA 3N9GL 2EDWA 3BXNA 4KRMB 4A6YH 2X4NB 1R3JA 1NBYA 2YD9A 5KOVC 1MJUL 1U8JB 4MNQA 1ZA3A 2VL5A 4J4PD 4XXDB 5HHPB 4KJQD 2VZ3A 1HCFX 1HHGB 3MXVL 1UT9A 4Z7UA 2WUBL 4JY5H 5IM7B 1NUDA 4NRYB 4RQQA 2WBKA 1DEEA 1T5XB 3IFOB 3AU1A 3UPCA 4IMKC 3ULUD 4JKWA 2ESVB 3NCFB 3B9KC 4FQHA 4FXKA 1MFCH 3BZEA 4QHLB 4MCZB 3RKPA 1JPTH 5BO1L 4I18C 3INUH 2SEBB 4FFVD 3O4LE 3RUGF 3DRQA 4PG9B 2EH7H 1L9MA 4JY6B 4M9OA 3ALPA 1KNOB 3O3DB 5DUPL 4LVHC 3VFSB 2E7MA 1V7NH 2J8OA 2NY0B 2WQ8A 3QIUA 4FQLL 5SWSE 1HKFA 4MB3A 5CSBA 4F9LA 1O7VA 5T33L 5D1XB 2BFVH 3T3PF 2OBGA 5IMOB 1QSFA 3C6LD 4ORGA 2VDLL 4OCSH 5F97E 3ZTJG 5HI5D 2HJLA 2I24N 3MREA 5EBMA 1A7PL 4L4TB 1T0PB 4NOFA 5JW5B 3U4BH 1G7PB 5IESH 2QKIB 4K23L 1I3GL 2V9TA 3ARGA 3MR9B 4OIBA 4JR9L 4P46C 2QHRH 5JNYB 3MNWB 2PTTA 4I9WD 4LCWA 1AFVL 3BO8A 1ES0B 4MXVE 1TJGL 4HIXH 5DJCB 5DMKB 1YNLH 4GRLB 1SEQL 4NJAH 3RWFB 1Q72L 2BSTB 2P49B 4FQ2H 4OT1L 5FYJD 5TF0A 2BSED 3CVHB 5JUEH 5KVEL 5E8EA 1BFVH 4U1NB 4JRXB 5HD8C 3O6FC 4X6CF 2XY2A 1CN4A 1NCWL 1QLEH 5E24E 2CIKA 3O2DL 2BNRE 5IWLC 4MAUL 4RWHA 1FORH 3EGSA 2A74B 4Q0XH 4IRJD 3TFKD 2JIXA 4GW1A 4OZFA 4Z95H 3IFPB 5C07D 4JQVA 1LE9A 4ZS7L 4P2RD 4OGZA 4GW5A 5IW3A 1B88A 5L7XH 4EVNB 1NMCB 1RZFH 2R0KL 2RBLA 3U30B 2YRZA 1NGYA 1U3JA 4HUWA 4Q58C 2P43B 3TZVD 2IWGA 3GKZA 4O2FB 1MFEL 4NQCD 2EXWC 1PKOA 3ARFC 4JFED 5FGSA 3W2DH 4W4NA 4XHJD 5FGRA 1R5WB 2X4NA 3QUXB 2HN7B 1YEKL 1U8JA 5CGTA 3PWJA 4XXDA 3O8XB 5HHPA 1FPTL 5DMGD 1HN1A 1FH5H 2DM2A 1HHGA 2VDMH 4UV7H 3ZO0A 4XPHH 5IM7A 1ZANL 2X4RA 2WZPD 4NRYA 3MTRA 1NGPL 2VN4A 4BSVB 2ESVA 3EOTH 3SJVE 5EO1B 4CL7A 2DB8A 4UI2A 4D9LL 2ZUTA 4QHLA 4MCZA 1MNUH 3WHE1 3T3PE 4M1GL 4XRCB 2SEBA 3QEQD 4P4RB 4XT1C 1RUQH 4PG9A 5IT2L 4JY6A 2YA0A 2B2XH 3BPOB 4NRZB 3O3DA 1AD9A 5K9OB 5BVJB 3PJSB 1FNSH 3VFSA 1LILA 2R69H 4FQ1H 4NZRH 4GXVL 3DXAE 1LE5B 1EAPB 4Y89A 4LSSL 5D1XA 1CFVL 5DURB 5IMOA 3UTTB 3MOBH 5K9JL 1CVSC 2IG2H 3ZT7A 1EFXD 5J57B 4M6AA 5BZWB 1UKSA 3TYGL 4L4TA 4MNGE 5JW5A 1I9IH 3D0VB 1G7PA 4N68A 3P4MA 5LQBL 2X1XR 2ADIB 5FUCE 5SWZD 4GBXC 3MCG1 2HT4C 3MR9A 4KROB 3T65A 2Z91B 3RDTC 2BVTA 4LLVB 1GCFA 3NFNB 2GFBB 4YDLC 2GSIB 3FT3B 4XP5H 5JNYA 5JOPE 3MNWA 4P4KC 2AS5M 4LOUD 4IRZH 4F80A 1ES0A 5DMKA 3ESUF 2Q3AA 2J88L 3RWFA 2BSTA 5JR1H 4WO4D 3CVHA 4M7LH 3LH2L 3HB3C 4U1NA 4JG1H 4JRXA 1S3KL 5C3LD 5ADOH 5E7FA 4A6YA 2NY4D 3HG1D 3A67H 4OZHF 3F65A 1X5ZA 2EICA 4OGYL 3WFZA 1R6VA 1EVTC 1HNFA 1YN7B 2FGWL 4JHWH 1T6WA 1ZLUK 2A74A 2HKFL 5TFSL 4HIEB 2ED9A 3MBEB 3CLEH 2J6EH 4BFIB 2C9AA 3IFPA 4EDXB 1D6VL 5F7DB 4TOYH 2VLLB 1MFAL 1UC6A 5FKAB 2CGRH 5EA0H 3S5LB 4EVNA 2W0PA 3NIFF 4RGOH 1ONQB 3PP4H 4ONGL 4MAYD 1JHKH 4NHCL 4O2FA 3QHZL 3WYRA 5TQ2H 1RUMH 2HLFD 4D0BB 4QRQB 5MP6L 1R5WA 3ARSA 3L3HB 4U1JB 5GGTH 3QUXA 2HN7A 4PJDE 5T3ZE 3BN9C 1UENA 4JCLA 4KQ3H 4BQCA 3O8XA 3T0EE 2D7TH 5DLMH 4JE4B 4YBQD 1JZ8A 5DJYB 4PJ7F 2E9JA 3P11H 5GGSB 4KKAD 1T5WB 2GUOB 1OP5H 1ACYH 1X5XA 1TITA 3BH8B 4BSVA 4R7NB 2XWTB 4TRPH 3L7FA 1KB5L 5EO1A 3OKLB 5E56A 3UROR 3BGAA 4RGMC 3OB8A 3R1GH 3ZHDA 5J6HB 3LRSB 1TENA 4XRCA 4L3EB 2DQJH 3HRPA 3ULUE 4Y16B 3RY6A 3V5HB 3GJFK 1DQDL 3HE6C 3D18B 4ZODA 3CU1A 3L3OB 4NRZA 3WJJA 5BMFL 3GJEB 5BVJA 1Z9OA 3PJSA 5C6TL 4MQ7B 5DD6B 3BD4A 4GKNB 4NO2B 3PWVB 3KLAB 3NIGF 1LE5A 1EAPA 1IGIH 4WEBL 2HH0L 1YEIL 2HA1A 3G5YB 3UTTA 2E6QA 1OAQL 4OCWL 3S5LG 3TIDB 3MLUH 5DTFB 1B6DA 5C0BE 4OF8A 3MRJB 1NC4B 5BZWA 5DJXB 5E2VH 3D0VA 2PN5A 4X5LA 1QFWL 2YPLE 2VLJD 3VW3H 4BFEA 3LZFL 4BQBA 4E9LA 2ADIA 2V5MA 4K7FB 3KPQB 4KI5F 4EUPB 3MCKB 4AL8H 1H5BC 2IPTH 2Z91A 1F58L 1JTTA 3NFNA 2GFBA 3FT3A 4PRNB 3SDYL 3VFUB 2ZOLB 3AUVA 4OZHE 1YPZF 3FRPA 3RGHA 1OGTB 3QIWC 2H2PC 5CGYD 1U3YA 1RIUL 4I9WE 2IPUK 4KI5C 3V6OA 4Y4FB 3NZHH 3FFCE 4N1HB 4WGVB 4RNRB 2FD6H 3BVNB 1KIUA 5CJ8A 2YD6A 2WWKT 1A3RL 1YN7A 1PLGH 3HLAB 3MOAH 5CGMA 1UWGH 2NY3B 2RFXB 4TULL 4U3CA 4HH8A 4HIEA 2VDKH 4EDXA 3MBEA 3QUYA 5F6HJ 4BFIA 3DBXB 3DETC 5F7DA 3KYKH 2VLLA 1KYOJ 2R1WA 1HYSC 1BJ1H 5I9QB 5FKAA 3ZDYE 5CJ5A 3GSQB 5MENB 3S5LA 1UM5L 5CJBA 1G9EA 3X17A 4XB7A 4NQDD 1ONQA 3KGRA 3DX8B 2GT9B 4NQXB 2PO6C 2XZQH 4YUEL 4N8CL 4XMKH 2P5WB 4W4OC 4PJ9D 1T0NB 4HK0B 2IFFH 2UWEF 4HUKB 4QRQA 5E4EB 3PQYD 2XY1A 4FQCL 2QQLL 4PJ7E 5CCKL 1ADQL 2R0WH 1BQSA 1CDIA 4H8WH 2DL2A 3L3HA 4U1JA 4UAOB 4WCYH 3SDAC 3I75B 4OCYH 5ITFB 2PETA 5E9DE 4JANB 2R0ZL 4RGNC 5FAAA 3U0WL 5CJQL 1W2KT 3LMJL 1J10A 2OSLB 5DJYA 2FLRT 2WP3O 4P5KB 3FL7A 4QOKD 3BFOA 5C0EB 5LGKA 5GGSA 4O02L 1J0KA 2V5RA 3NTCH 3P0GB 4LP5A 1T5WA 2GUOA 3OKYA 5L2KD 5CILH 4KRPD 1T03H 4KGLA 3BH8A 4FXGB 4R7NA 2XWTA 4JPKH 5I18L 1NGQH 3VGAC 1KBGH 3NIGE 4ZYKB 3LRSA 5C7XH 2BNQB 4L3EA 2YD2A 4X4ME 4Y16A 3V5HA 3N85L 3KG5A 3MRRB 1GGUA 3S36L 2R29H 3D18A 3BRDA 3G04B 3L3OA 2PW1B 3UTPD 3GJEA 4G8IB 2J4WL 4PUBL 4F7EB 4BZYA 4GKNA 4NO2A 3PWVA 3KLAA 3W81A 2CK0H 3FAXA 2GY7B 2KL6A 2AEPL 3G5YA 4BFBD 3IFLH 4JN1L 5DTFA 1Z3GH 4DTGL 3MRJA 1NC4A 4WTZA 5DJXA 1ORSB 1TPXB 4I2XE 3MA9L 4KKCC 4F7CB 1WT5A 4K7FA 1BQLH 3KPQA 1XR8B 4EUPA 4XTRC 1MJ7L 2EXYD 5F8RC 4NKMA 1XH3B 2JCCB 4PRNA 3VH8G 3VFUA 4AMKL 5C9JB 1EPFA 1RQ5A 5SWZE 2VXVL 1I9JH 3KLDA 1NCTA 4O2EB 1G7IB 1OGTA 1OTSC 1FE8H 2APTA 43CAB 2PCPB 4PRDB 1IM9B 1NCCH 2IH3B 1FJ1B 5DXWA 4U6YB 3QDJD 5GGTA 4RNRA 4X9GA 3BVNA 5CEYB 3V7AE 1J7VR 5JDJA 3IS0X 4HK3J 1KIPB 1PG7W 3HLAA 4WJ5B 2RFXA 1JZ6A 3KPRA 5IHUL 4ENEC 3FQXB 5HVFB 3BKCL 3DBXA 3QIUC 3WFBL 1FNHA 1INQB 3CIQA 4LSPL 4YBLB 4EXPX 2UZIH 4JG0L 5GS0L 4GRWF 1G9MH 5ALBH 5D7KD 3DX8A 2GT9A 4NQXA 5C3TA 4G7YH 1WSST 1GPOL 4IJ3C 1YMMD 3Q5TA 1FG2B 4RCAA 2P5WA 5CD3B 1T0NA 1CD1B 4M02A 2F54B 3S37X 3EYUH 5EU6B 3UAJC 2DLIA 5FV2A 5GGVY 2X4PB 5C0CB 4Z7QE 2XQYG 4ONOA 3I75A 3W9EB 4TNWK 1KELL 3AS2A 1M7DB 5ITFA 3HFMH 2V7HB 4MX7B 5DHVB 2IQAB 1Y6MR 2OSLA 4P5KA 5C0EA 5B39B 2C3GA 2VZOA 2ITDB 1NCUA 2VDQL 1UM4H 2EDHA 1AC0A 2P8PB 3HN3A 4FXGA 4HIIB 5I15L 2XNAA 3OPZL 2NY2B 3MV8D 2UY6A 2AXJA 5TE7H 4ZYKA 1AI1H 2BNQA 2XTJE 5F7HA 4LCYB 2AXHA 2VUYA 1G6VK 3MRRA 1FO0B 1BBJB 2AV1B 5E5MB 3BPLB 3G04A 4G8IA 2EYSB 4F7EA 3TLRA 1QRND 4C83B 2G2RB 3KVQA 1IQWL 7CGTA 3GSWB 5K9QG 5BRZB 2NNAB 5HDOA 1ZLWH 5EZJB 1IZKA 2CJUH 1WEJL 1AY1L 2ZPKL 4GUPB 5EU3B 3BHBB 1ORSA 1NEUA 3BRFA 1JYXA 5E1AB 4F7CA 4UNVA 5IROC 1T4KB 4JZOB 5F9AC 1JYWA 3H9HA 4MDJB 5J7CC 1XR8A 5F71A 1D9KB 1G0YR 2W0FB 3GIVB 5KSVB 5HYQB 1XH3A 3VFOB 2JCCA 4ZS6C 2YMXL 5BZDB 5DD0H 2VLJE 5C9JA 3HZKB 2J8UB 1IBGL 3NH7H 2NX5D 3GJFB 4O2EA 1M7XA 3LB6D 1G7IA 4HXBL 3RU8L 4PRPD 4ZD3L 3SE9H 3ZTNL 3R8QA 5FM5O 4KPHH 3BIBX 3SPVB 3PGDB 43CAA 1MI5E 3QDMD 4Y4HB 4PRDA 1IM9A 3Q6FB 4ONFL 2IH3A 1FJ1A 2BNUB 3MRKB 2Q7NA 3D25B 1CFNB 1N26A 2I25N 2EDEA 5CMAB 1RZ7H 5CEYA 4DN3H 4HWUA 1KIPA 4WJ5A 2XXMB 3K0WA 2E7CA 2D9QB 2R0LH 3NABH 3NA9L 3FQXA 1INQA 4MQTB 2W07A 3FO2B 1FYTB 2BSSB 2LTQB 4HIHB 5DRWB 4Q6IA 4A6YL 1FG2A 3QUMH 1U91B 1DBJH 5CD3A 3CFKB 4D3CH 2DKSA 2F54A 3BKYL 1KXTB 4L8DB 2X4PA 5C0CA 1I1CA 4FQQB 4U1IB 3BPCB 3W9EA 5DEFB 1M7DA 1HIMH 4OUUB 4MX7A 2V7HA 1FVCB 1ZKAA 3QXTA 1JTOA 2JB6B 5DHVA 2IQAA 3G6JB 3RVWD 1PY9A 2BRQA 1B0GB 5B39A 1AGFB 2ITDA 5ACZB 1MFCL 4KV5E 1JPTL 3INUL 2P8PA 2W92A 1XF2B 3QULB 2EH7L 3RQ3A 5IIEB 2HT2D 2IGFH 1A7OH 1ODAA 1I1AD 2YD8A 2NXYB 4LCYA 5E8NB 1X3DA 1FO0A 1QLFB 1BBJA 2AV1A 5E5MA 2FECL 1KGCE 2QSTA 4M61A 3FO9B 3TJEH 1NMCC 3OAZH 4J6RL 3S7GA 4OCSL 4C83A 4TVPD 4P49A 4M7LT 3IDYB 4WHYH 3U4BL 4EJ1C 4KMQA 1X5HA 1ZLSH 5IESL 3GSWA 4DN4L 2CO6B 5BRZA 2NNAA 5EZJA 1D5MB 4UDTB 2YS4A 4GUPA 5EU3A 5EO0A 3BHBA 2BCKB 2VISB 3EYOB 3ROLB 4JFXA 5E1AA 4X4YB 4L9LB 3VCLB 1T4KA 4JZOA 2QHRL 3W5MA 3AMLA 1VFOA 2XZAH 3CX2A 4MDJA 5JORB 4GG6B 2W0FA 4HIXL 5K9QI 1YNLL 3GIVA 4KJWD 4MJ6B 4NJAL 5HYQA 3VFOA 4FQ2L 4HLZH 5JUEL 3QDGD 3O8XC 5KVGL 3CZJA 3IVKB 5BZDA 4OV5B 3HZKA 2J8UA 2OX5A 2XG4A 5SX4I 1A8JH 2DTSA 3LOWA 1INEL 3GJFA 4PJBF 1QA9B 1QLEL 3HNTL 3SPVA 3MFFB 3PGDA 4Y4HA 4JREB 3Q6FA 1MCKA 1FORL 3D87B 2BNUA 4OZ4A 4X6BB 2GTZB 3MRKA 4MD5A 4JM2F 4Q0XL 1CFNA 5CMAA 3WIIH 1YY9D 3RY6C 3ZT5A 3HC4H 4NZTH 1GC1H 4E42B 5GZOD 1FIGH 1FVDB 5L7XL 1IKFH 1RZFL 2NR6C 3P77B 5I75B 3QDJE 4NOBA 1MWAH 1X5AA 3V4PH 3ZHLA 1OB1B 2OQJA 4NSKB 1JTPA 1X7QB 3FO2A 1FYTA 2BSSA 4JKKA 4WV1C 3NOIA 3LKSB 4JM2C 1DQLH 4HIHA 3RZCB 4ZFGH 1FFNB 5DRWA 4HHAB 3AFLA 3WLBB 3DLQR 3HNVL 4G6FB 2ZUQC 1U91A 4F7MB 5I0DA 1YMHB 2DLHA 3LN9A 1DL7L 1X4XA 3CFKA 3MLZL 1A7RH 1JGLH 1WFOA 4KROC 4L8DA 3CMOH 3IF1B 1XR9B 4FQQA 1FH5L 4U1IA 4O00A 3BPCA 1AGDB 4XPHL 1EXUB 1A9BB 5DEFA 4OUUA 2ITCB 2E9WA 1FC2D 2W9EH 1FVCA 2JB6A 3G6JA 3VXSD 1IMHC 3CFJB 1FSKB 1WZMA 1B0GA 1J0JA 1AGFA 3VMNA 5ACZA 2DJ4A 1MNUL 3N1GC 5JXEA 1XF2A 3QULA 1JF6A 1RUQL 5JW3H 1MCLA 5IIEA 2B2XL 2AK1L 2WP3T 2MQCA 2CUHA 5IW1B 5IFHH 2R69L 3MRMB 4FQ1L 5E8NA 3MBEC 3QUYC 4Y1AB 1QLFA 4HV8B 3KPSB 5JLZB 3MNVB 3MV8E 5CIPH 2X1QA 3H0TB 3B9KD 3FO9A 4L3CB 4CVXB 3Q5YA 5HHMD 1U3HB 2EIDA 2V17H 1KTKE 5ESVB 4DGIH 1I9IL 4ZG1A 4LSTH 4KJPC 5GZND 1HHIB 2IANB 1D5MA 4UDTA 2ENYA 1HCVA 1QRNE 2BCKA 3CK0H 1MOEA 2VISA 3FT2B 3EYOA 4LP4A 4X4YA 1DQQB 4L9LA 4HGWB 3VCLA 4XP5L 4JCMA 4IRZL 3KYMA 3ARBB 5JORA 3UTSB 4GG6A 4NM4H 2ZCKH 4XMLH 4UMGA 5C09B 5JR1L 3BZDA 1IEAB 1ZXQA 3IVKA 4M7LL 4OV5A 4JG1L 1JE6A 1T21B 5ADOL 4N1CA 1P2CB 1QA9A 3A67L 2Q8BH 5JMRA 2BVPB 4H1LB 3JXAA 3PDGA 4P46D 3MFFA 2Z93B 4PJXB 4DKEH 4JHWL 3ZTJH 4UQ3B 3SN6N 4X6BA 2GTZA 4PRPE 3RVVC 2O61B 2J6EL 2E7HA 4TOYL 4E42A 2CGRL 5HD8D 1DZBA 5EA0L 5DHXB 1FVDA 3O6FD 4D94A 4G9FD 2LAGB 1MFBH 1NFIB 2Z31B 4RGOL 4YE4H 4ISVB 1LEIB 1JHKL 1OB1A 3ISWA 12E8H 4NSKA 3NCJH 4UTBH 1X7QA 2IFGA 3LKSA 5TQ2L 1RUML 1NC2D 1NDGB 1FFNA 1WAAE 4HHAA 4QNPF 5GRUH 3K8MA 3QIBB 2V9QA 4F7MA 1YMHA 5C2BH 5GGTL 3E1F1 5C0GB 1WT5C 2AW2A 3KJ4B 3JBG7 4KHXH 2R2CA 3QI9A 4KQ3L 4MB5A 5T5NF 3U6RB 3CUPB 3O81A 1XR9A 4Q9QH 2D7TL 5DLML 4JRYB 3AXLB 3L5WA 3P11L 1EXUA 1A9BA 2EXWD 3ARFD 1EEUA 2ITCA 5E8OB 2VWEE 5KS9B 1ACYL 1KCRH 3GBNH 4JQIH 4OCRH 3CFJA 4TRPL 4ETQB 1ZVSA 2W65B 2M1KA 3G6DH 4LFHD 4JHBA 3R1GL 4DUXA 1W8OA 1I9RL 3TF7C 1MHPH 1BOYA 1PVHA 1NQBA 4KKBD 2CRZA 4FZEH 4DFHA 1T20B 1YEJH 4QHKI 2EC8A 5HY9A 3GBMH 3BAEH 4HWZA 2NXZB 4U1MB 3T0WA 5EZIH 5IW1A 1E6OH 4XNXH 5TJWK 3MRMA 2O5YH 5I6XB 4Y1AA 3UO1H 3SHSA 5BW7C 4HV8A 5E95B 1FGNH 3KPSA 5JLZA 1IGFH 4DWHA 5J89A 2H32B 3H0TA 4L3CA 4DVBB 4PLKC 3MLUL 4CVXA 1WZKA 1ZA6B 3SGEI 1U3HA 1PEWA 4ZQKB 5E2VL 1G7HB 5ESVA 5KJRH 1KLFA 1M7IB 3X3FH 5ESAB 2P5EB 4WW2B 2IMMA 1HHIA 2IANA 5FM4A 1DDHB 4AL8L 4CU8A 2IPTL 4TVPE 3MUGB 5KG9B 1DQQA 4H25B 4HGWA 1PSKH 3TCXA 3TIEB 4UAOC 3ARBA 3JV5A 4KVNH 2P24A 4BYHA 4XNUH 4JJHA 1N0XL 5C09A 1IEAA 1HDMB 2X89A 4OI7A 3GSVB 1CIDA 5C0RH 5D4QA 3NZHL 1VFMA 3NFSL 1T21A 4GBXD 1P2CA 3QRGL 3WD5L 4POZD 3RDTD 2VLKE 4JVPA 2BVPA 3GSUB 3QDGE 2FD6L 4H1LA 3ZSTA 1JYVA 4PRAB 2YSSA 2Z93A 5C0AD 4P4KD 5I8KH 1BIHA 3B4NA 4WFHD 2Y23A 1X4ZA 4UQ3A 4P99A 3CFCH 1UWGL 4ETYA 3ZKXB 2VDKL 4G8GB 4LIQH 3LQMA 3OAYH 3L1OH 4OF7A 3CDGA 3QPQC 3KYKL 1CQYA 3HB3D 5F72S 5I76A 1JP5A 1H3XA 1DBAH 4QNPE 4YR6B 1EJOH 1NFIA 2Z31A 4ISVA 1YEHH 1LEIA 2XICA 4WHDA 1DQMH 3ARPA 3CSGA 2XZQL 4TUOA 5F89B 4KRNA 1RUAH 4QTHB 4XMKL 3RAJH 4GMSH 2JJUA 2IFFL 4HJGB 1NDGA 4RFNB 5FO7B 3WS3A 4ODBD 1OD9A 5KANG 2R0WL 4H8WL 4MSWA 1ZGLP 5C0GA 4QGTA 4ODXB 3BPNB 5GRJH 3BI9X 3WSQH 3U6RA 4E5XB 1H3GA 3CUPA 5CIPA 4GG8B 5FIEA 4OZIF 3VMPA 1G0XA 4JRYA 5A2KH 1GZQB 3AXLA 1WWWX 35C8H 4AQ1B 3NTCL 4LLQB 2CDEB 3BDYH 5E8OA 5KS9A 2Z8RA 3GNMH 5J11C 3PL6B 5CILL 4B0MM 1T03L 1QP1A 4ETQA 2W65A 5LBSH 1NGQL 4NQEE 2FSEA 4KI1A 3BN9D 5F7UA 1S78C 4XVTH 1KBGL 1MCCA 3O6LH 1ZHNB 4UBDC 1HQ4B 1EUUA 1VA9A 2B1AH 4GKSB 5I8CB 1T7VA 4LSUH 5F88B 3D2UB 3LRHA 4U1MA 2RB8A 1WZLA 1ZT4B 1MUJB 1SEBB 2OI9C 3OJMB 2OR8A 5DJ2A 1S7SB 2FJFB 3TO4B 2FR4B 2CK0L 4PY8I 5K59F 4OI9A 2JJSC 4PB9L 4U1LB 3U9UA 2H32A 5KVDH 4DVBA 5CEZL 3IFLL 4BJLA 2Z0BA 1ZA6A 1S7RB 1X44A 1JWMB 1QSVA 1QBLL 3MX0A 4ZQKA 4BQ6A 1G7HA 4Q6IC 2J2ZA 1KCUL 1M7IA 3HE6D 5ESAA 2P5EA 4WW2A 1BQLL 4GKZB 1DDHA 5HHME 3MUGA 2A38A 4P2QB 5KG9A 4H25A 3T1WA 1DVFB 5CFHA 3TIEA 4FZ8H 4QCIB 1U8KB 3HPLB 3EJJX 3ZZ1A 2DTMH 3FMGL 1I9JL 4X4ZA 4YFLI 4UZGA 3LQZB 2H45A 1OVZA 1FE8L 1XF3A 5HHOE 2DWEA 1UXWA 4G6KL 1HDMA 3QB7C 2VKXA 3GSVA 1L7IL 2GJ6B 4PYHA 3TVMA 3GM0A 3UTZB 1NCCL 4NPYB 2DI8A 3CDFA 1MCSA 1FQ9C 3BJ91 3GSUA 2EDXA 5JXAH 1BJ8A 2D2OA 4PRAA 4WWKD 1EH9A 1D5XB 2IAMC 1FZOB 5HYSG 4DOHB 3PIQB 3VRLF 1JK8B 5D2LB 4G8GA 2B7DT 3QIWD 4G42B 2H2PD 3N1QC 1L6ZA 4TPRH 2QQNH 4KI5D 2UZIL 3BPLC 5EU4B 4YR6A 4D9RE 4R9HA 5E5UB 1G9ML 1KUMA 5ALBL 3FJTA 1MVUA 3MUY1 3STLB 3C6LB 4DAGH 4G7YL 5I19H 5BCAA 2WQRA 5F89A 1UH3A 4QTHA 4NBYB 4LEXH 2NY5C 4HJGA 1IT9L 5FO7A 3EYUL 4ZSOE 3DETD 5FCSH 2LU3A 1HYSD 3VI4E 2DAVA 2VB5A 5DS8B 3LKQB 1MCWW 4H0HB 4ODXA 5FCUH 4HIJB 4OUOA 1WBYB 4E5XA 1RPQA 1VEOA 4Z78B 4GG8A 3MJ8B 1M05B 1QSEE 1WV7T 4BK5A 5DK0B 4XP4H 2PO6D 4JFFE 5KANI 3SDDB 4LLQA 2CDEA 5A2FA 4UTAH 4PP2B 3PL6A 1Q8MA 2ICEB 5I74C 4JGMA 4RAVB 1W72H 4ESKA 3ILPB 3OKEB 3SDAD 5J1AB 4JHZA 3ARRA 4BH8B 3QWOB 4Z76A 4RGND 5CZKA 4KQ4H 1HQ4A 1GIGH 4OCMC 1MCOH 4GKSA 2W0KA 5I8CA 3NIDE 4APQD 5F88A 5IB1B 3D2UA 4PJ5E 3GGWB 4DKDC 5C07B 1ZT4A 1MUJA 1SEBA 1QZ1A 5IQ7H 5C08E 1S7SA 2FJFA 3TO4A 1CZ8H 1E0OB 1OLLA 4FTVD 3F12B 5DJAB 4U1LA 1RIVH 4KWUA 1AXTH 5HHXL 1FNLA 2CJUL 2VXSH 1JWMA 1U8IB 3F7VB 1HKLH 4WHCA 4JFEB 3WUZA 5IG7B 5T1LD 2GEEA 2XV6B 3QO1B 4GKZA 2YA1A 2ZKHH 3TO2B 1EO8H 2WUCL 2HFEB 4P2QA 4X6DB 1MHHA 1DVFA 4OFYA 1TVDA 1S5HB 4PD4J 3MYZA 2WBJD 1E27B 1U8KA 4QCIA 3HPLA 4C56E 3SDCC 4M5YH 1ZHLB 3NH7L 1CE1H 5J56B 2OXGA 3O3AB 2R39A 3K4ZA 3LQZA 4N1EA 3SE9L 4CUCA 4KPHL 3U1SL 4FN0A 2GJJA 2GJ6A 3G5VB 4GSDL 4OJFL 4HJ0D 3UTZA 4MNQD 5IEHB 4KTDH 4NPYA 4U1SB 3MROB 2D7NA 5EZLB 5JXEC 1YDPB 3VFPB 1RZ7L 5HHNB 3TM6A 4DN3L 3VDBA 1D5XA 1C7TA 1FZOA 1TTUA 1JL8A 2Q3ZA 3UPRB 4YEEA 2NXYC 2R0LL 3NABL 1JK8A 1OTSD 2DF3A 4KTEH 5D2LA 3OSKA 4G42A 2QR0B 4BH7B 1B2WH 1FP5A 1G6RB 3QFJB 5GRZA 4LKCB 4WFHE 5CJXA 3DYMA 3HMXA 3ZE1F 1N5YH 3WNOA 4P5TA 2YD4A 1G7QB 3STLA 1FBIH 4D0CB 4PREB 1WWBX 3UPAA 4QRRE 3QUML 3I3BA 5A2IH 4XGZB 4D3CL 4LHUB 4ZNEA 4ENED 3QIUD 3G9AB 1UCBH 4DUWA 4E41E 4NUJB 4L9LC 3OBAA 5DS8A 3LKQA 4PRHE 1QSFD 3LS5H 5AUMB 4HIJA 1WBYA 1HIML 1BIIB 3W0WB 3A0OA 4J3TA 3MJ8A 1M05A 2DQDL 4QXTB 5DK0A 4YHZL 1RZ8B 1RFDH 4NFBA 1II4E 5E08L 3SDDA 1U6AL 2F74B 4YHLH 4PP2A 3TT3H 3ARGD 3NPSC 4YLQT 4RAVA 2YUVA 3ILPA 3OKEA 3OX8B 5J1AA 3HG1B 4JREC 4LCWD 1A7OL 3MXWL 4BSJA 1UVQB 4AK1A 3GMQB 4FOMA 3U4AA 4XMPH 5LCVH 4MQSB 1NBVH 1JBJA 5ISZE 5DJ0B 4LSRH 3RJDA 1XGYH 4DEPC 5IB1A 3GGWA 3TJEL 1BZ7B 2X44D 1NGXB 5GS2D 3RIFK 4U6HB 3F12A 5DJAA 5GHWH 4XPAH 2EDQA 5F1KC 4BZ1H 4TTGA 1ZLSL 3E8UH 4GAFB 4XNZB 1C08B 1MJ8H 3S4SB 3F7VA 4WFED 2JIXD 4NFDA 5IG7A 2B39A 3PWUB 5MHSD 3NCYP 1EBPA 3LPWA 1HEZB 2XZAL 3QO1A 3TO2A 3HI5H 4P9ML 3QI9C 2HFEA 4OLUH 5AYUH 3QZWA 4Z7VB 3DNKA 4XP9H 1T1YB 4X6DA 4PPTA 1NUFA 1BP3B 1S5HA 1E27A 3IJYB 4L4VA 1ZHLA 4ODUB 2FZ3B 4OZGB 3O3AA 5B8CB 2D0GA 3T8XB 5CD5C 1BWMA 2MTPA 4FHBD 3V6BR 3QQ9C 3QUZB 5BVPH 5IEHA 3OMZA 4ZOEA 4U1SA 4PJIE 2A0LD 5EZLA 1YDPA 1TZHB 4ZS6D 3VFPA 3WIIL 5HHNA 4HS3B 3L6FB 4NZTL 3TBSB 1GC1L 3LN5B 4K3DH 1F11B 1IKFL 3I9GL 3UPRA 1JGVH 4MD0A 5CS7A 4FQJH 1MWAL 5SX4H 5D1QB 3V4PL 1E4WH 3TP4A 1MHEB 1G6RA 5DDHA 3QFJA 2ESVD 4LKCA 4Y8DC 2VR4A 2VLRB 3P0YH 2VZVA 4ZXBC 4ZFGL 3Q6GH 1U3HC 1G7QA 4LDEB 1ETZB 3RVUD 4D0CA 4PREA 4QY8B 5D7SH 1GVIA 4J3UA 5KSBE 1U0QA 1MF2L 4XGZA 4LHUA 1JGLL 1A2YA 1GC1C 2NY0D 4MDIB 3CMOL 5FOBB 3MGTA 5JHDE 4A2MA 4NUJA 3IAPA 4ELMF 4KVCH 1YC7A 5D1XD 5D7LE 5AUMA 3W0WA 1BIIA 3DGGB 3ZKMC 4CVZB 4ZFFB 4QXTA 2E3VA 5D8JL 5B38G 2X09A 4L4TD 2HVJB 5ERWB 1PZUB 2D7PA 3QQ4B 2QSCH 2F74A 5KAQG 3RVXC 1CL7L 4N5EC 3QCTH 1JWUB 2M8XA 4YGAB 4N0UB 5JW3L 3OX8A 3HG1A 3H7BB 4AENB 3SGDI 4RDQG 4PS4H 3I3DA 5IFHL 1UVQA 5CP3H 3GMQA 2NY1C 3X13B 3WNKA 3VFGL 1YEEH 2Z35A 4O9HH 4K94L 5DJ0A 4BFGA 4KKNA 3JTSB 1BZ7A 4N0YH 4R4BB 1NGXA 3EOYG 2AK4B 4U6HA 2Z31C 2V17L 4P0DA 1QNZH 2Q1EA 4DGIL 2FEEI 3UJTL 2R2BA 4LSTL 3UC0H 1Q9OB 4NQDB 1R24B 1ROWA 2WAHA 3OTTA 3S4SA 1AR1D 3FFDB 1TQBB 5I1GL 1N4XH 4UINL 3CK0L 1VSCA 4PJ9B 4Q7DA 3C9NB 4I5BB 4XBPB 1HEZA 3PQYB 3O2VH 1CK0H 3F6LA 3IDJB 2ZCKL 4HUUB 3KJ4C 4XMLL 5CINH 4Z7VA 4K94C 1T1YA 2VKWA 3UMTA 1HILB 3O3EB 4RA0C 4RAUB 1OAUH 5HI3C 1NFDB 3IJYA 4U49A 2VR5A 4ODUA 2FZ3A 4OZGA 4Z0XA 4M6NL 5AG8A 3PNWB 2Q8BL 5IVXF 2X9XA 3T8XA 1F4YH 2H2SC 3EIFA 3DVGB 5L2KB 3HUJF 4DKEL 3QUZA 5EOQH 3QUXD 5FKPB 4IM8A 3CXHK 1I8KB 2ICWB 4HZAA 3QEGH 3B9AA 4LRIA 1TZHA 3O8XD 4HS3A 2G60L 3TBSA 3QG7L 3OWEA 3LN5A 1P6AB 1F11A 4MNQE 1FL6B 4IHOB 1IGTA 2NXZC 2FIRT 4OIIL 4P3WA 1MFBL 5D1QA 1J86A 5I6XC 3GSNH 5JPMA 1MHEA 1KJ2B 12E8L 3MRNB 1P84J 3NCJL 4UTBL 2VLRA 4Z7UE 1IC7H 1UJTA 4NIKB 3HZVB 1DBBH 2F5AH 1P4BH 1X5LA 5CLWA 1ETZA 5GRUL 3RPIB 2ED8A 3MUHL 3KJ6H 3DPBA 4WW2C 1VCAA 2NR6D 3BP5B 4KHXL 1K85A 1RUKL 4MDIA 1HXYB 5I1KH 4Q9QL 1ERNA 1WCBA 3RTQC 2OYPA 3FQRA 5DURD 2LV4A 4K8RH 4JM2D 3UTTD 4G8EB 4CVZA 4ZFFA 1KCRL 3GBNL 1MRFH 4PJEB 4YBHA 4JQIL 4OCRL 4X0KB 2Q86B 2HVJA 5ERWA 3I84A 5GS3A 5J12B 1QSFE 3F7RA 3G6DL 2VUOA 3TVMC 2HJFB 1Q0YH 1TJIH 4KROD 1OF2B 2HAZA 1RV6X 2EH8H 3LKNB 1Z9LA 1JWUA 4FZEL 1YEJL 4N0UA 4WI6A 1JCKA 3GBML 3H7BA 3BAEL 3VD9A 4AENA 5EZIL 4YK4C 1E6OL 4XNXL 2BVEA 5IBLC 2O5YL 3I02B 3X13A 3UO1L 1IGFL 3UZEA 4HMEA 1CGXA 4EI6B 3HC3H 1MH5B 4R4BA 3IB4A 5AWNH 3UXFA 2C1PB 4B7IA 2AK4A 1EHLL 5DJ8B 1JPGB 2IALB 4L1HA 1L7TH 4X5WB 1Q9OA 2OTPA 4NQDA 5CJOH 1T6VN 3GMLA 3ZYOA 3WIHH 3FFDA 3UEZA 2YOCA 3E3QC 4Y0GA 4XP1H 4PJ9A 3MBED 3QUYD 4I5BA 4XBPA 1PSKL 2IH1A 4NP4L 3KS0H 1M71B 1UH4A 4Y4KB 4KVNL 3IDJA 4HUUA 1CDGA 4EZMA 4WFEE 4XNUL 3QA3B 3LKOB 3QCVH 5I8OH 1H3VA 2IQ9H 4U6TA 2E9BA 1AO7B 1V7MH 3O3EA 2FGZA 4W6WB 4RAUA 2FEDC 1NFDA 4KJPD 3ZDZE 4O51B 5C0RL 1A02N 4QHMB 3PNWA 3PL6C 3MV7E 3V2AR 1AGBB 2GITB 1HH9A 2WINA 3SDXB 1K9TA 3ZE0F 5L2KA 2EIEA 5I8KL 1T1WA 5FKPA 4P23B 4LMQE 1F4WH 2JELH 3CFCL 1I8KA 2ICWA 4LIQL 1K3ZA 1ZGLM 3V0WH 1KSRA 5LVEA 3ES6B 1FL6A 2H9GB 4IHOA 2BY2A 1EJOL 1FIEA 1MRDH 1R3LB 1YEHL 1UWXK 1DQML 1KJ2A 3MRNA 4H26B 1RVFH 3AM8A 2FO4B 3RAJL 5MEOB 4GMSL 4RFOL 1BAFH 1BQHA 1OTTC 1A6TB 3RVVD 4L3ED 3EKCA 3RPIA 2WLYA 2AJUH 5FYKH 4K71B 4NWUH 4WDIB 2CR3A 5DF0A 1U3ZA 3BP5A 4NM8L 3WSQL 3Q0HA 2FHCA 2E8YA 1HXYA 3BX7C 1DVFC 1XCQB 4JFDE 3T3MF 35C8L 4X8JA 5ALCH 4S11A 3BDYL 5ABDE 5BOPA 4G8EA 3GNML 4PJEA 1NC4D 4X0KA 2Q86A 5LBSL 2WM0A 5JW4M 4XVTL 2HJFA 1LDPL 5I73C 2ZNXA 1K5NB 1OF2A 4N8VG 3LKNA 3QDMB 4U6XB 3IU3B 3RWCB 3L5JA 1IC4H 1CWVA 2WANA 2QADC 3D9AL 2B1AL 1SBSH 2OMNA 1W0WB 4LSUL 4XXCA 3DWTA 3QXUA 2IBZY 2BK8A 4CMMB 5D7IF 1VB9A 1EGJH 3FHQA 1JNLH 4HKXB 4EI6A 1LO5B 1MH5A 2JF1A 1YEGL 5AAMA 1LGVA 4C54A 2C1PA 3LSOB 4P5TC 4LEOA 4PLNC 1GXEA 5EH1A 3IDNB 5DJ8A 1JPGA 2IALA 2BVQB 4G7VH 3DX6B 4WI9A 4X5WA 5H37G 4YJZL 1CBVH 2K7QA 4JRXE 4DUVA 2QHLA 4AG4H 1JGDB 5IOPA 2XT1B 3KPRD 4LAJH 1JN6B 3MRGA 4LHQB 1M71A 3BKMH 4FZ8L 4Y4KA 2G9HB 4PLKD 3S36X 4J7RA 3G08B 2GTWB 2CXGA 3LKOA 3QA3A 3ZE0E 1EVUA 4HDIB 1AO7A 3WIFB 3C60B 4CJ1A 2YEZB 4PGCB 2PF6A 2PW2B 1WQVT 4JPIB 2P5WD 4O51A 3HPJB 3AY4C 4LLMB 3SDDC 4M7JH 3ARXA 3GUTB 1DUYB 3OF6A 1K2DB 1ZV5A 4RMTA 5JXAL 4IDJL 1AGBA 2GITA 1WC7A 2E27H 4X5XB 3SDXA 5C6PB 1ZAGA 1G7MB 4P23A 4L5FL 4Z7WB 5F6HI 3P30H 1GGBH 5CUSH 4G80B 1SMOA 3GMOB 4TPRL 2QQNL 5JOFB 3ES6A 3VXMA 4OM0H 2F19H 4PJFB 3EOBA 1R3LA 1GZPB 3ZMRA 1S7QB 4OQTH 3LAFA 4DAGL 5I19L 4H26A 3SE3A 4ZOAA 2FO4A 1FNFA 5MEOA 4LEXL 4GAGH 3PGFH 2BNQD 1A6TA 4GXUM 4F33B 3QPQD 5JW4N 4WDIA 1MEXL 2MCPH 5FCUL 4UB0H 3QBTB 4LF3B 2B4CH 3RPKA 4NRXB 4LSQL 5T3XH 1XCQA 3D1MC 1UQSB 4I4WB 3ULVH 4N90E 3VDCA 4UTAL 1X5YA 4J3SA 1NUGA 1W72L 4QYOB 3V4VH 1F2QA 4PJGB 5D7IE 1P7HL 2EDYA 1SM3H 1GH7A 1K5NA 5DZNA 4H0GA 3QDMA 4U6XA 3IU3A 1CTNA 4OCNC 1IFHH 3RWCA 4KQ4L 2C3VB 2QTEA 1GIGL 1A7QH 3MODH 1MCOL 1W0WA 1SHMA 4NFCA 1AHWB 5TPWH 3WEXA 3LCYA 4CMMA 4BM7A 1FN4B 1CZ8L 2VXQH 2DDQH 4X98B 4HKXA 1FCCA 1LO5A 3PXJA 1S78D 1AXTL 2VXSL 3LSOA 4V2BA 3IDNA 3NMEA 2BVQA 2VQ1B 3DX6A 4UBDD 1HKLL 1OSZB 1S7XB 4AYFA 4YO0B 4Z18A 5D2NC 1YY8B 2OZ4H 5CWSA 3V6OE 4LCCB 5FOJA 1JGDA 3GMNB 2ZKHL 1EO8L 2J1KA 1UWXH 1JN6A 2NLJB 2NY6B 2G9HA 4HMDA 2VDPH 2JLLA 4M5YL 1UADC 3G08A 1CE1L 2GTWA 5GPRA 4HDIA 3JWOL 3WIFA 3C60A 2YEZA 4PGCA 4JHAH 2PW2A 4JPIA 4UT6H 3HPJA 5IVOA 4LLMA 3VXSB 1Q1JH 4KTDL 4ZFOL 2F54D 3FB5A 4IS6B 4PFEA 5T1DH 2BNRB 2BC4A 3GUTA 1DUYA 1YQ2A 1K2DA 4OTXL 5A16B 5C0CD 5D96B 4X5XA 2R9HC 4AT6B 3RY5A 1L4IA 1G7MA 1T0MB 4Z7WA 4GXUN 4HCRA 1MCRA 1SVZA 4KTEL 4MA3B 1UZ6E 3TT1L 4G80A 2D4FA 5CEZD 2DQIH 1T3FB 3NCEB 3VFNB 5JOFA 1S7UB 3JWOC 1N5YL 5F7LB 1GZPA 1S7QA 2HT3D 4NT6B 4JFQB 1FBIL 3B9KB 4OKDA 3VXOA 2KUTA 4I18B 2DOCA 2XIDA 1F13A 4XNZC 4PGJA 4K55A 1N64H 2KQNA 2XKNB 4F33A 3B5HA 1JZ5A 1UCBL 4LVHB 5C0JB 1QQDB 2HP4A 1MVFA 3LS5L 1OTUC 5M7QA 2VIRB 3I6LE 4JO3H 2RGSA 2CKBH 4LF3A 2X4TB 1RFDL 4CADB 1OP3H 1UQSA 3RUGB 4I4WA 3ILQC 4P57B 3VA2C 1ZSDA 5BRZD 5I1LB 2BOBB 1Q9KB 3ZE2F 4YHLL 3TT3L 3FO1B 4X8XA 1OAKL 4R0LB 4QYOA 1S9KC 3SJVB 4O4YH 3RGVB 3EW3B 4PJGA 3WLWC 2ED7A 2E8ZA 4XCFH 1XEDA 4FRWA 8CGTA 4P46B 5JW4R 3O4LA 2WBWB 2ZG2A 2C3VA 1MAJA 4LRIC 4XMPL 2Y72A 5LCVL 2W1NA 3VJ6B 1EX0A 1NBVL 1SY6H 4WI3A 4K3GA 4LSRL 1XGYL 1GL4B 1AHWA 1SJEB 3LS4H 5FYLH 5EU5B 5T3ZH 1OAXH 4XCYB 1A1OB 1HHKB 5D1QC 4JZJA 2Z92B 5GHWL 3ARVA 4XPAL 5HHVH 4X98A 4BZ1L 2KZ1B 3E8UL 4Y4HD 4HWEH 1KC5H 1MJ8L 5TH2B 4OLEA 4POYA 2KZWA 3RY4A 3BKJH 1OSZA 1S7XA 4X83A 4Y2DA 4YO0A 3CLFH 1NC2B 1YY8A 2HWZH 4S1SH 2X2YA 3LD8B 4LCCA 4CJ0A 1C12B 4HT1L 3HI5L 1EHXA 5AYUL 4X6CB 4XP9L 2NLJA 4X4XB 2P7TB 3NN8B 4G6JH 3ULUH 5CHNB 4ODSH 2AJXL 1E4XH 4YDKL 1FYTD 3BQUB 1OPGH 3L95B 3OJDB 1WZ1L 4GO6B 4XAKD 3RHWF 6FABL 5GJTH 5F8QC 4DVRH 1NCAH 3FQWB 5BVPL 5MENE 4FS0A 3VXSA 5L88L 4IS6A 2BNRA 5CKAA 4JKPH 5A16A 2JTDA 3VWJB 1UACH 2EO9A 2MOVA 4I8DA 5HYJB 5DVNA 3VE0B 3BE1H 2P5WE 1T0MA 4AIXA 1JGVL 2FIKB 5J06A 4NYLB 5C0IB 4MA3A 1F42A 5C92A 4FQJL 1E4WL 1T3FA 2BVYA 3VFNA 3B5TA 4TSCL 5I1HH 4LLAA 3P0YL 1NLBH 5EBWB 3UJJH 5L0QC 5C0DB 4NT6A 4JFQA 3V7MA 4PJCF 5INDB 5JXED 2X40A 1OARH 5D7SL 3EYFB 4WNQB 4I18A 5IB4B 1U2CA 2RAMA 2UZYB 2NXYD 3LHPH 3JUYA 2XKNA 5I17B 2QEJA 1EIBA 1H9VA 1WTLA 3HAEB 4QEGA 4P2OC 4QXWA 5FYJH 3DYOA 4LCIL 2LU7A 4KVCL 1OQOA 1QQDA 5EOCJ 3SO3B 2BNQE 2EIZB 3BT2H 2X4TA 3MA7A 3T0EB 4HFWA 3M45A 3U46B 3QH3B 4CADA 3DROB 4M5ZH 4MJ4A 3RUGA 4P57A 2QSCL 3SY0B 5I1LA 4FMKA 2BOBA 3IYLW 4S1QH 2CIIA 3FO1A 4HG4K 4KZDL 4NQVB 5CBAB 2QV2A 4R0LA 2HG5B 3E6HB 3RRQA 3SJVA 3RGVA 2EEBA 3MRQB 3B8YA 3K1DA 4RRPG 1CGWA 5KZCB 1MIEH 4P46A 4YDLB 4PS4L 5C0AB 4LQFH 4O2CB 3H9YA 2LABA 4U0QB 2XZCH 2VC2H 5ICXB 4LFHG 2O5XH 1YEEL 3L3DB 3FZUC 4GKOA 3VJ6A 4O9HL 5ICYB 3WXWH 2OJEB 1SJEA 5EU5A 4N0YL 4LGSB 1MLCB 2OK0H 4XCYA 4OBSA 2VH5H 5D9SB 1HHKA 1PAMA 1QNZL 1YYMH 2Z92A 5F9OH 1DANU 3U48A 3AM8C 3UC0L 2X70B 4DGYH 3FTGB 3VXQA 2RCSH 1IVLA 5C0BB 5TH2A 5IWLA 1N4XL 4GMTL 3ZLQC 3OJ2C 5L6YL 2OL3H 2YPLB 3SGDH 4XAWH 1NC2A 4RFEB 4KMLB 3VD5A 4Z5RB 3O2VL 4BUGA 1C12A 5KN5B 3HAEG 5IBTH 4X6CA 1H15B 4X4XA 2P7TA 3NN8A 1G1CA 5CHNA 2DYPB 3C5JB 1OAUL 4OZHB 2CKNA 5EN2A 3BQUA 1B3JA 3NCMA 1LEGA 2AAVA 3PP3K 4PJHF 3L95A 3OJDA 5DO2C 5J0BA 1FZMB 1H0DB 3GK8H 3O2DA 2YK1H 1IAKB 3TBWB 3GMPB 2DMKA 3FQWA 3B9EA 5EOQL 5J12C 1J8KA 4J3OC 1U58B 1FZKB 1C16B 3QI9D 5FO8B 1XGUB 3QEGL 1P69B 3VWJA 3VMOA 2Y7QB 4KH2A 5HYJA 1KB9K 3VE0A 2DQEL 1ZK9A 5B4MC 3H42L 1BQUA 2F54E 2FIKA 4XXCC 4BA8A 4NYLA 5C0IA 1MREH 1IAMA 5EU6E 3MO1B 5C0CE 1ORQA 1DFBL 3LKPB 3QQ9D 3R06B 1A1MB 1DBBL 2B20A 2F5AL 2VZSA 5EBWA 1P4BL 3MRIB 1PD6A 5C0DA 4F2MB 2W0LA 4HC1H 5INDA 4HAGA 4RGMB 4JPVH 2CDGA 4NC1E 3EYFA 3T2QA 4WNQA 3K46A 2A9MH 5IB4A 5ACLA 1UA6H 4PJ7B 3NGBB 3HE6B 4XWOD 3CX5K 5I17A 3BSZL 4HKZB 4Y1AD 4Q74A 4JB9H 3KPSD 4Y4KC 4K8RL 4WI5A 3D85B 5E9DB 1S9WB 2ADFL 2EIZA 1JNNH 1NGWB 1MRFL 1U3HD 4XCNB 3T0EA 1DN0B 3U46A 3DVNB 2VITB 3QH3A 1B4JL 4GH7B 2Y4SA 3DROA 3E2HB 1J0ZA 3SY0A 1HE7A 3OR6B 2IAND 1Q0YL 4NQVA 5CBAA 2HG5A 3E6HA 4D9QE 3MRQA 5JTWA 5BRZE 3ARBD 4JM4L 3GIZH 3ZKMD 4R4FH 4CN1A 4O2CA 5ICXA 5C09D 3L3DA 4I77H 4K8RC 4W6YB 2OR7A 1JYNA 4XZUB 2X89D 4I13B 3UBXB 4XPFH 5ICYA 2OJEA 1U95B 4OGXH 1MLCA 3LVEA 5AWNL 3RVXD 4N5ED 4MNHB 1BD2E 5D9SA 4MVBC 3U83A 4WIQA 4WU7B 2G5BB 1L7TL 5D71H 4Z0BL 2X70A 2J8UE 3FTGA 2EDDA 5CJOL 3MPCA 5C0BA 3WCYA 3U9PH 1BJMA 2Z8VC 3WIHL 1RJZB 4I2XB 4RMVA 3SCMC 4XP1L 1YPZB 2YPLA 1PY4A 1I8MB 4RFEA 2BY1A 4Z5RA 1KJMB 4ZPTB 1G7LB 5D72H 2PR4L 3JVGA 1Q9LB 5KN5A 2Z31D 5I8OL 2IQ9L 1H15A 5GRYA 1V7ML 4JJ5A 2DYPA 3C5JA 1KG0B 3IS1X 5TDPB 1BBDH 4OZHA 1CTOA 1MSPA 4HLJA 1I1FB 5DMYA 1QKZH 4X9IA 4HJJH 2Y07H 4Q9RH 1FZMA 1H0DA 3CDYA 3FN3A 3TBWA 1IAKA 3GMPA 4UIKL 2BRRH 3NAAH 3FFCA 1FYTE 2JELL 1FZKA 1SMAA 1C16A 3E0GA 5FO8A 1RJCA 1XGUA 4HULB 5F7FA 4XAKE 5JZ7C 3DO7B 4R2GB 3V0WL 2Y7QA 4Z7NE 4Q6YA 4D0DB 4JRYD 5HI3D 1HSBB 4UQ2A 1JWSB 4GAJL 4P2CG 4X7EC 1MRDL 4YDVB 2W9DH 3MV9E 2WSKA 3CZFA 3MO1A 2UWEB 2Q8AL 4HD9A 2B0SH 5E8DL 3LKPA 1ZEAH 4WW1B 1A1MA 3ET9F 4G3YH 1RY7B 1T1XA 3MRIA 5D93B 4YHOH 4F2MA 1XF4B 1DCLA 3NFPB 1IAII 3S35H 5FYKL 1UKTA 4NWUL 3K4DA 3ALXA 4JFZH 2XQBH 4PJ7A 2NXZD 5D7JB 3LV3B 1CXIA 4HKZA 1EFQA 5IFJA 2DBLH 5I1EH 2CMRH 3BYYA 2X4OA 4J1UA 4Z9KB 5ALCL 3D85A 5E9DA 1S9WA 1V3JA 4AEIH 1CE6B 1NGWA 4XCNA 1DN0A 3RZWA 2CQVA 3DVNA 2VITA 4OLXL 3ARTA 1CXKA 2NZIA 2P5ED 1QBAA 3OR6A 2CR6A 3D5OF 2DS4A 5T5FH 5FFLA 3NVQA 1VGEL 4F15B 3BXNB 2MMXA 1FL5B 1IKNA 1H3PH 1ZA3B 3WJLA 1IC4L 2WWMC 2GW5A 1RZGB 2ZWLT 3ZYIA 3C87A 1SBSL 2QQKH 2XTJB 2DJUA 4X4MA 3PP3H 4YC2B 4ZDHB 1EGJL 1TDQA 1JNLL 4XZUA 3IXAB 3UBXA 3O2WH 1IILE 4OCXH 1A4KB 3TVMD 1V3LA 3FKUS 4GG6E 1NMBH 4MNHA 7FABL 3WNNA 4WU7A 1AQKH 2G5BA 4G7VL 1Z6JT 4WI2A 1FFQA 1E6JH 1CBVL 4Y8AA 3NACH 1UZ8B 4M6MH 4AG4L 1RJZA 1I7UB 1K6QH 4I2XA 4G8GD 1YPZA 1CDBA 4KGJA 1I8MA 1DN2A 5CKGA 2BERA 1QVOB 3BKML 4ZPTA 1D5ZB 1G7LA 2AEQH 4KDWA 3QIUB 5EIIB 5CZXC 3FN9A 5GGRY 5TDPA 1KG0A 1QBBA 3DVFA 4IMLB 3SKUD 2HJLB 3MREB 5C0FB 2DQGH 4M7JL 5IVNA 4XH2B 4W4OA 2Z9TA 3N0PB 5H35B 2E27L 3ARWA 2GIYA 3QR2A 1CDYA 1ZHKB 3BDXA 1NAMH 4GRWB 2DM3A 1GGBL 5CUSL 3O0RH 1L9NA 1XAUA 3TNNB 4JDZB 3M8OH 4D0DA 2FEDD 3MRLB 1JWSA 1RHFA 2F19L 1AHWC 4YDVA 2Y5TB 3PL6D 2UWEA 3VRIB 2VDOH 2C1OB 4JZJC 3V5KB 3J7HA 2CRYA 4WW1A 1PBYA 1NH6A 2CIKB 4GAGL 3PGFL 4MXVF 4PGEB 1XF4A 3NFPA 5FDYA 1R3KB 1ADQA 3JWNC 4Y2DC 4N8PA 3P9WB 3VU2A 4MS8C 4S10A 2MCPL 2JIXB 4LU5H 2DD8H 3D2UD 3FOLB 3QSKB 4LCCC 4UB0L 5D7JA 3LV3A 1S7WB 1KLUB 1N3NA 2Z4QB 5F7NC 4CW1B 4GW5B 5D6DC 3TO4D 5GJSH 2OR9H 1AKJD 2NY6C 5T3XL 3VD4A 2AKRB 1Z9MA 1ND0B 1AGEB 3OV6A 4HWBH 4OFVA 1NGYB 1QFWI 1OTTD 4CMHB 3PHOB 32C2B 3OAUH 2HMIC 4Z8FH 1FLTX 1KN4H 2P4AB 4Y1AE 5AZEH 3KPSE 3MV01 3V4VL 3SQOH 2APXA 3ULVF 4QWWC 4HMCA 2ZOKB 1UYWL 1SM3L 1FL5A 1IFHL 4P2QD 1URLA 5D96C 4XC3H 1A7QL 1DVFD 2L4OA 1RZGA 3MODL 1AGCB 4OFYD 3WNPA 3PWJB 3KPLB 4PJAF 3QJHB 2XTLA 3V0AC 2AQ3A 4ZDHA 1KOAA 3JSSA 4ODTL 2VXQL 2DDQL 2X4RB 3IXAA 3N06B 2GJ6D 3GM8A 1A4KA 3UTSE 2A77H 1F3JB 2A1WL 2C4FT 4XWGL 1CI5A 1NCDH 4XPBH 5C09E 2YKLH 1Q0XL 4TN9A 1VGKB 4M8QB 5DJ6B 2YN5A 3ZDXE 4AJ0A 1UZ8A 1I7UA 3GI9H 1C1EH 4UT9H 2A83B 3KR3L 3HMWL 5FGCB 1AD9B 4PJXE 3CCHB 4WUUB 5FO9B 1QVOA 2FBOJ 3QEHB 1JHLH 1D5ZA 4OZFG 2VDPL 1EMTH 1PX3A 1FRGL 1BOGB 5HDBE 5EIIA 4P5TD 3BMWA 4R7DA 1CLOH 1X4YA 3SEPA 4IMLA 4UT6L 3EYQC 5IFAH 1KFAH 4LCUB 5C0FA 1Q1JL 4BSWB 5KSUB 4PBXA 5T1DL 1ZTXH 4XH2A 2N4IA 5H35A 3P4MB 4R0LC 1MI5A 1P53A 2CUMA 4HFUH 4XCCH 3RGVC 4DZBB 1A3QA 2WLZA 1OP5K 4F37K 3T65B 3WDJA 4MXWH 1ZHKA 4JGJA 2DQIL 3TNNA 4JDZA 3GMRB 3MRLA 4PB0H 1EK3A 3SDDD 2UVEA 4QKXB 2GJZB 2Y5TA 2V2XB 3VRIA 2C1OA 3FOMB 3PGCB 2ZUVA 4JRYE 5IJKC 3V5KA 4EBQL 4A6YB 4K7PX 3LEYH 3QQNA 4XX1G 1FG9C 4R26H 5KS9E 1N64L 4PGEA 1EZVY 3VXRB 1R3KA 3DMMC 1NMAH 3FN0L 1RD6A 5FUCC 3FOLA 3LD8C 5T3XE 4QTIH 4JO3L 3HS0B 1S7WA 3D3VB 2CKBL 1OAYH 1KLUA 4CW1A 2Z4QA 3ULVE 1JFQH 1OL0A 3SE8H 2BSRB 2AKRA 5F93C 1TJHH 1ND0A 1AGEA 3SE4C 3WMSA 3KNBB 3TPUA 1A7NH 4F8TA 3BQUC 2BDNH 3PHOA 1LP9F 32C2A 2Q87A 3VA6A 1JGUH 5HGHB 1F8TH 1OGAE 4PJAE 4O4YL 2BOCB 3CH1B 4NC0B 2ZOKA 4XCFL 1BM3L 1DLFL 2VO5A 5IROA 2FRGP 5F3HB 4YX2H 4TSBL 5BV7H 4UV4H 3N1PC 4WTXA 3VWJC 4IOIB 2RIKA 1F97A 1AGCA 4LPCA 2AI0L 1UWEH 3TGXA 3LS4L 3KPLA 3QJHA 4L4VD 4N0RA 3N1MC 4TTDC 5FUOL 5T3ZL 2WW8A 4ZAKB 2OJZH 3KHQA 4DZ8B 1CR9L 1QYGH 5HHVL 1KIQB 4QLRA 3EDEA 5EC1B 4C55A 4HWEL 3Q3GB 4PJDF 1KC5L 1F3JA 3L7FB 3BKJL 1VGKA 2W38A 1ZLVH 4M8QA 3AAZB 4KHTL 5DJ6A 2HWZL 4P59H 1A0QH 3MRDA 4S1SL 2A9NH 1JMXA 5E99H 4WI8A 4KMTH 5ID0B 2QLVB 2A83A 4PJBB 1KF9B 3GSOB 4LDOB 4U0RC 1TMCB 4CDGC 3CCHA 4G6JL 4WUUA 5FO9A 3ULUL 3QFJD 3QEHA 1E4XL 1YNTB 1FAKT 4HBCH 3L5IA 4OF0A 2J5LC 1AP2B 1X6LA 4MMXC 1BOGA 5KTEL 1ED3B 3SO3C 1OPGL 5BS0E 4I48B 3TJHC 3T0EC 4WV1B 3K81A 3ULUF 4JM2B 5GJTL 4DVRL 3Q1SH 5DC0A 1NCAL 3GMMA 4LCUA 4BSWA 5KSUA 4LHUD 2ZUQB 4MCYB 2GKIA 2WV3A 3QNZB 4KJQC 4JKPL 1UACL 4B5EA 1IGCH 4DZBA 4X7TB 4HKJB 3DSFH 3W0WD 3ULUC 3WFCH 2W59A 4HQQH 3TEUA 4TVPH 5IMLB 3GMRA 4GOSA 4LMQI 1L0XA 1CQKA 2FNBA 5I1HL 1F5WA 2XRAH 5EPMB 2X41A 2GJZA 3UJJL 2V2XA 3BWAB 3C08L 2H1PH 3FOMA 4A2LA 1OARL 2R9HD 3PGCA 4XNYH 5ESQB 2X7LB 5LXGH 3LHPL 3VXRA 4OFKA 2DQCH 3RP1A 4ZO9A 1LP9E 4ZTPH 4MJIB 3QUYB 3HS0A 3JVGC 3D3VA 3BT2L 5EFIB 2R1WB 1TNNA 1T04A 4JDTH 4M4RA 5HYIA 2BSRA 4KY1L 4M5ZL 3KNBA 1DJSA 4S1QL 3QP3A 4BQ9A 5HGHA 3BN3B 3JWDL 5C9KA 4FFZL 2BOCA 2D3VA 4S2SB 3CH1A 3ZYZA 4OB5H 3ZDYF 3TA3B 1OTUD 1YEFH 1MIEL 1E4JA 3VXNB 5F3HA 2XZCL 3MBXH 5FYLE 1F00I 1CYGA 5F7WC 1QBMH 2O5XL 4IOIA 3CNKA 5IMKB 1WBZB 4P2YA 3WXWL 3ILQD 5HI4C 2OK0L 1RUPH 2VH5L 4ZAKA 1NPUA 3BD3A 4P2QE 2DLFH 3PABB 4DZ8A 1BVKB 1YYML 5F9OL 4M7KH 1KIQA 2W91A 5L2JB 3FRPG 3WLWD 5JOEA 5EC1A 3Q3GA 2RCSL 3QUZD 3TFKC 2NQCA 3JWDC 5HJ3B 4JO1H 2FB4H 2OL3L 3AAZA 4XAWL 5CZVH 5IMMB 1C5CH 4FABH 2GJ6E 2F5BH 3EDJA 5DQDH 4WTWA 3TBTB 1EUTA 1AIFB 5ID0A 3CGTA 3NGBC 5IBTL 3T08A 1MIMH 4PJBA 2GY5A 3GSOA 5D1QD 3TZVC 3DI3B 1DQTA 1YNTA 2VLRD 1AP2A 2FEEL 2EKSB 1ED3A 2YBRB 3K2UL 4NGHH 1A9EB 4I48A 3H9SB 1S9YB 2XN9B 3MLTB 4WV1A 3I85A 4JM2A 3GK8L 1P7QA 2VR9A 1C5BH 2YK1L 3V0VB 4YHML 3RIAK 3E2HC 4MCYA 4M1DH 3O3BB 3QNZA 2ICWJ 1IKNC 4PY7B 3KPNB 2E6PA 4GT7A 4H5SB 4X7TA 3WJLC 2DJSA 3WNLA 1TZIB 4HKJA 3MLRH 4NKMB 2ZG1A 3WBDA 4ZNEE 1RAMA 1MREL 2NYYC 1A6ZB 1T2XA 5EC2B 5IMLA 2J7LA 4XB8A 5DFTA 1XGQB 1V3KA 3C8DA 5EPMA 1KPRB 1JRHH 2WNGA 3BWAA 3FB6B 3P73A 4HC1L 5ESQA 2X7LA 1D5BB 1UA6L 5DR5H 5FYJE 2YXMA 2FECI 2IADB 5EIVA 5IB2B 4J3XA 1AXSB 1CICB 2YPVH 4M3JA 3NPZB 4JB9L 3A6BH 1ZLWK 5GRWA 4OAWB 4MJIA 4TUKH 3KPRB 4X7CC 5BO1H 4K2UL 4CNIA 1LMKA 5EFIA 1JNNL 5EBGA 5D1ZB 2AK4D 3HZMB 4QXGH 5TE4H 5FA4B 1AE6H 1B90A 2AQ1A 2A73B 2GQHA 1IM3B 1TTGA 2YRLA 5DUMH 2EE6A 4JZNB 3AMKA 5C07E 4EN3C 4P2RE 1DTUA 4K3EH 2CXKA 4MYWB 4P2OD 3VXTB 4NQEB 4S2SA 3FB7B 2A6IB 4WTZG 3TA3A 3IDUA 2OXHA 2DQHH 1U41A 2NZ9C 4R4FL 3VXNA 2XOTA 2WK2A 1OSPH 4NQCE 4QHNB 4JFEE 1WISA 4I77L 4R2GC 5IMKA 4EUPG 1WBZA 4K23H 2ZG3A 1Q9WB 3BGFB 5JA9A 4OGXL 1TCRB 2CK2A 3VGFA 4X6DE 3PABA 1DANT 1BVKA 4Z7QF 5D71L 3QG6B 5L2JA 1AFVH 2EO1A 5CEXB 1X6NA 3AVEA 4RBPH 3GHEH 4O58L 5D93C 4OT1H 5HJ3A 2XNAB 3T0XA 4L8BB 2FX8H 2B5IC 3FZUD 5IMMA 4ERSL 1MAMH 5D72L 4LPUA 3O3UN 5DEZA 3TBTA 2IC2A 1AIFA 5D7JC 1VERA 2EEDA 2IPKB 3DSNA 3L7EB 3L5HA 4S1DC 1BBDL 1K8IB 1A3LH 5DD1H 2EKSA 3QEQE 4QRTB 5HGBB 2YBRA 5E2UH 5E2TL 5HHOB 4LK4A 5TDNB 1A9EA 1OWRM 2FX9H 3EUUA 3H9SA 1S9YA 2XN9A 2Y07L 3MLTA 4HJJL 4Q9RL 3BP4B 4ZS7H 4EI5C 2RHEA 3V0VA 4RDQF 3NAAL 3RNKB 5HTSA 4S1RL 3B6SA 2MHAB 3O3BA 3O41B 4WI7A 3OG4B 4U3HA 3ZL4H 4F15C 3H9HB 4PY7A 2D4DA 3KPNA 3WV0A 2R4SH 2J6EA 1MFEH 4H5SA 1Z0MA 2V9RA 1C5DB 3T2PA 1TZIA 5AEAA 2O5ZH 1FNAA 3DECA 1IL1B 1RSFA 2XTJC 5A3IC 1RZKL 2I07B 4X9BA 5DO2D 2W9DL 4YC2C 3K8LA 1A6ZA 4WFFD 1F4XH 5EC2A 1YEKH 1X5GA 5J11B 4OFPA 4UUJB 1XGQA 2P8LB 4G3YL 1KPRA 3W0WE 5E6YA 1BMGA 5E00B 4YHOL 3FB6A 5DHYA 5L8LB 1OLZA 3V5DB 3JV4B 3S35L 3IDXL 1ZANH 3OAZK 4OZIB 5HPOA 1D5BA 5B4MD 4JFZL 2XQBL 2IADA 4ZSOB 3NBNA 4TUJA 5IB2A 1AXSA 1CICA 4LQ1A 2R8SH 2DBLL 2CMRL 1JF5A 4OAWA 1RZKC 3HG1E 4YFDB 1RK0B 2OI9B 5BW7A 1N6UA 1UM6H 1QSEB 4AEIL 5D1ZA 3MLXH 3HZMA 4JFFB 2VZ1A 1CD9B 2FJGB 4BZ2H 5FA4A 4OM1H 5F1IB 2A73A 1IM3A 4Y19B 4JZNA 3WXVL 1SJXA 2DRUA 1CLZH 2K3TA 1RURL 1F3DJ 1IAIH 5F7EH 4Q6IB 5T5FL 5I2IB 1NEZB 4YH6A 5E70A 5SX5H 3AB0B 4FFYH 5DK3A 3VXTA 4YPJA 4NQEA 3KS0J 5TE6L 3FB7A 2A6IA 5IHBA 2DQUH 3V4UH 4Y4KD 2QQKL 2MQ3A 1NKRA 4RISH 4LVOC 4IBLT 4J8RB 4F7TB 4YAQB 4QHNA 1AO7D 1P6FA 3PUCA 5LQBH 3RJQB 4NWTH 4PJ5B 1Q9WA 4TQEH 3CFBB 4OCXL 1PFCA 2VQUA 1NMBL 4PTTA 3SKJH 1TCRA 5GS0C 3FAWA 3L3GB 3MJ6A 4Z7VE 1AQKL 3GZKA 1G7JB 3OF6D 3QG6A 1E6JL 5CEXA 3T1FB 1CG9B 4PG2A 4P23D 1NUNB 3NACL 5DVMA 5DQJA 2J88H 4OZGE 1RJLB 2X05A 1K6QL 1LDSA 1CD0A 2Y9RT 4L8BA 2IAMB 4JFOB 4HBQA 2ZNWA 2MKLC 3VXMD 4NZJA 4GJTB 2NW3B 4KV5F 1F6AB 2IPKA 4MVBD 3L7EA 1NSNH 1EERB 4DW2H 4M61B 1J1PH 1LO4H 3S34H 2FGWH 4C56B 1K8IA 4MXQD 4QF1A 1LVEA 4QRTA 5HGBA 4YDJB 5HHOA 5SV4A 5TDNA 4L3AA 4CMHC 3LEVL 4BELD 3SCMD 4WHTB 3DX9B 5I16A 4EIGB 3BISA 3BP4A 1NANI 4NNPL 1HI6B 5EWIL 4GS7C 5EO0B 4CAGA 3RNKA 1NEZG 4ONGH 4JFXB 3W5NA 1T22B 2DLGA 2MHAA 1NAML 3O41A 5JQ6L 3O0RL 3LQAL 4FP8H 4KKLC 3HC0A 1ZS8B 1C5DA 1Z2KA 1V8HA 2P46B 1IL1A 2I07A 2GSGB 2DBJA 1LK3H 2I9TA 2VDOL 2BY3A 3T4AB 1T83A 4ACPA 3MV11 3X12B 4UUJA 1M6OB 5I74B 2P8LA 5F9WB 2UV3A 5EULV 3CH8A 1VADB 5E00A 1TQCC 2HKHH 5B39G 4QRRB 5JZ7D 3ARDA 3V5DA 3JV4A 2DQFB 4OZIA 4FXLA 4OZ4B 2MSPA 4ALAH 4MD5B 4LU5L 2DD8L 1U8PB 4TNVF 2N56A 3LQAC 4ZSOA 5IEKB 5LGJB 1PGRB 4Y5XA 2AEWA 4E41B 1KB5H 1T80A 5GJSL 3C6SB 4N0UE 3CXHJ 1RK0A 1QSEA 2JJSA 4HK3N 2OQJB 3OAUL 4JFFA 4YXKH 4Z8FL 2FJGA 1S5IH 3CFIC 5AZEL 5F1IA 5C6TH 4Y19A 4ONHB 1MQ8A 3SQOL 4DKFH 5I2IA 4E0RB 4FNLH 1NEZA 3S3SA 2HH0H 2P47B 4EEEA 1IEHA 5AZ2H 3TYFB 4PY8J 3R0MA 1LD9B 4NQDE 2DIAA 3F5WB 1UGNA 1XMWA 1Y6NR 4J8RA 4F7TA 4NO0B 3U4EB 3U7WH 4YAQA 2EZ0C 2X4QB 3C60D 3SDCB 4JY5L 1L0QA 4JN2B 3PQYE 4PJ5A 2XZZA 2MNUA 3CFBA 2A77L 4OGAC 3L3GA 3KPTA 1NCDL 4XPBL 5I66B 1G7JA 1IE5A 4OLZH 3SDYH 3O11B 1YNKH 2WWMD 3T1FA 1CG9A 4WI4A 1NJ9B 1RJLA 3GI9L 4QOKE 4MA1C 1E4KA 1C1EL 2IAMA 4UT9L 4JFOA 4FFWC 1RIUH 1N2RB 2BXZA 1RU9H 3GSRB 5L2KE 2XPGB 5EZOH 1V7NL 3H3BC 1EMTL 4U1GB 1EO5A 2NW3A 2QL1A 1F6AA 2BFVL 1V3MA 4C56A 1CLOL 1KFAL 4YDJA 1ZTXL 4WHTA 3DX9A 3UTPE 1EA9C 2CRMA 1HI6A 4HFUL 4XCCL 4U1KB 5F9JB 1T22A 4KFZC 4KK9C 5CZXD 1NCNA 1D7FA 1M4KA 3KYMB 3F7PC 2PKDA 3ME0A 1ZS8A 25C8H 2Q7YA 2IPUG 1PYWB 2DMCA 2X9WA 3IDIB 3IT8D 4FQCH 2GSGA 3D0LB 3FCTB 5TF1H 4ZUSB 1BFVL 4ZAKC 3RFZC 5ECJE 3T4AA 3HR5B 3X12A 3NPSB 1M6OA 3HKFA 4YGVB 3QUMB 1KPUA 4R26L 1VADA 2R0ZH 1CF8H 4PJEE 3O4LD 4QRRA 2YD5A 3FO0H 4WFFE 2DQFA 3S96A 2X4UB 3BDBA 5FHAH 2VAJA 1BEYH 1U8PA 4Z95L 4QTIL 5IEKA 1B0WA 2OP4H 5JHDB 4MA7H 5LGJA 1OAYL 5F9DC 4E41A 4DEPB 1JNHB 1JFQL 4PRHA 3C6SA 3EHBC 1TJHL 3QHFH 4KK6C 2Y06H 2ARJB 1N8ZB 2BDNL 1B4RA 3UJIH 1JGUL 3S36H 4QHUA 5EORH 4Y2DD 4ONHA 4PUBH 5GGQH 3W2DL 4E0RA 5DI8B 2JE8A 1NAKH 2AJ3B 4YX2L 3TYFA 4UV4L 5BV7L 4KU1A 2NY6D 3JV6B 2ZCHH 1U8LB 1LD9A 3QI9B 1UWEL 3MUZ1 5D7KE 1WWAX 3DV4B 3F5WA 5F1SA 1YMME 4NO0A 3U4EA 1WAAF 2VDML 2HMID 4UV7L 2OJZL 2X4QA 3L5WB 3SDCA 4JN2A 1QYGL 4L9DA 2FLBT 4QWWD 2X1OA 4Q2ZB 2FBJH 1MJ7H 5KOMC 4NJ9H 3BGMB 3OAYK 3MFGB 3VGHA 3EOTL 1ZVSB 2BNRD 5I66A 1AO7E 2K7PA 2XYCA 3O11A 4FQXB 4CU7A 2VXVH 1Z5LB 2VZTA 1A0QL 4P59L 4AH2B 5E99L 1NJ9A 5BV7C 2PYEB 4LGPB 5HY9B 5DZLA 1N2RA 3GSRA 4HWZB 3SDXE 1FNSL 2XPGA 3I50H 1JZ4A 4LPXA 2VOTA 4QT5B 4NZRL 4X7FC 1I85A 1S9XA 1J18A 2AVGA 4DKAA 4XVSH 4LLYB 4ZXBB 3F6IA 3MOBL 2IG2L 2MJWA 1XGRB 3Q1SL 4XC1H 3BKCH 4GRMB 1LO0H 1NBQA 5I8EB 4LBEA 4LSPH 3BJLA 4L8CB 4JG0H 1IGCL 4PGZA 1EHAA 4U1KA 3TA3C 5F9JA 5I1CH 1IJ9A 2DIJA 4ZOCA 3WFCL 1JHTB 4HQQL 5GS2H 3DHJA 1MWAB 4TVPL 4I0CC 2N7AA 2P24B 2GI7A 5H8DA 3S97C 1PYWA 3IDIA 3LRGA 3EYQD 4LDLB 5HYEA 3OB0H 3D0LA 4QRPB 2XA3A 3FCTA 4ZUSA 2H1PL 3ROOB 5C8JB 4OZFH 3HR5A 4XNYL 3SJVD 3RGVD 4DK3A 5EOTA 3DTXA 4YGVA 3MLWH 1HOCB 3QUMA 4D8PB 4ELMB 3DARA 4U05A 5DT1H 2YSSB 3HTLX 4HXAH 5EUKB 2DQCL 2HLAB 2FH8A 2NX5E 2X4UA 4ZTPL 1KPVB 1WLHA 1DE4B 2NY1B 3CLEL 4IIQB 4PYGA 5DVKA 4LHJB 5JHDA 3CDGB 5I76B 3QDME 3OPZH 4EIZC 1JNHA 4JDTL 1VKXB 4M48H 2YUZA 3L5XH 3B8SA 3PP4L 2ARJA 3MGOB 1N8ZA 5K93A 4QO1A 4TUOB 3CAFA 5AG9A 3DMMD 1IARB 3T2NH 4CGTA 1QFUH 3WS3B 2PXYB 1U8MA 5DI8A 5JDSB 2AJ3A 4MSWB 3MBXL 4U7SA 3KPMB 1QBML 3JV6A 1U8LA 1YQVH 3CD4A 3DV4A 5CIP