4LSRH

Crystal structure of broadly and potently neutralizing antibody vrc-ch31 in complex with hiv-1 clade a/e stran 93th057 gp120 with loop d and loop v5 from clade a strain ker_2018_11
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
231
structure length
217
Chain Sequence
QVQLVQSGAAVRKPGASVTVSCKFAEDDDAPEHFIHFLRQAPGQQLEWLAWMNPTNGAVNYAWYLNGRVTATRDRSMTTAFLEVKSLRSDDTAVYYCARAQKRGRSEWAYAHWGQGTPVVVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE GLYCOPROTEIN GP120 WITH LOOP D AND V5 FROM STRAIN k
publication title Multidonor Analysis Reveals Structural Elements, Genetic Determinants, and Maturation Pathway for HIV-1 Neutralization by VRC01-Class Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 43
structure length 217
sequence length 231
ec nomenclature
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lsrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lsrH01
3EBAA 4C83A 3H42L 5IQ9B 1KJ3H 2IFFH 2WIMA 5D8JL 1H3GA 2A6DB 4BJLA 1NDGB 5I73B 1IAIL 4WU5B 3T8XB 4Z7UA 2WUCL 5IEKA 2CIIA 2ADIA 2XA3A 4GKSB 7FABH 4LQFH 4OZHA 5I17B 3OR6A 1WWAX 5LCVL 4PS4L 5CHNB 1E4WH 2GSIB 5EU5B 3BKJL 2FJHA 3MO1A 2BY1A 1QA9A 3L3OA 1QNZH 1T66C 3RFZC 3HN3A 3BPCB 4LSUH 4EOWL 1P84J 1INDL 3UO1L 3S4SB 1PDKA 1U9KA 3C6LD 1KSRA 1WEJH 3V6OC 4X4XB 1IC4L 1U3HC 2YD6A 2HVJA 4QYOA 2LE9A 1EHLH 2VZVA 2GY5A 4ZUVA 3CLFL 4PGBA 4Y4KB 1I9IH 3PP4L 2VLKB 2V17H 1AR1C 3LV3B 3RPIA 4KQ4L 3V6FB 2PXYC 4LSTH 5EUKA 2A73A 2X1OA 4ZNEE 3HMXL 4BYHA 2X4PA 3DHJA 1WZLA 3QDJE 2LVEA 2BVPA 2V2WA 3V6OA 4OBRA 1U3HA 3I02A 3SPVB 3DSNA 1QR1A 1U8HB 5FM5M 2E5EA 2YD9A 3QIUB 2R2HA 4OZGE 3V0VB 4QNPF 1JWUB 3F7YB 4M7LT 4JO4H 2CLZB 3DRTB 2ITCA 3HI6L 1MFAL 1PX4A 4LCWD 3DGGB 2PXYA 3P4MA 1CBVH 3OR7B 3O3AB 2CUMA 5L9DH 2QTEA 1MCKA 5D5ME 3T0XA 2N1KA 2BVOA 2NCMA 3ILPA 2XIDA 4PJFF 4QXTA 5CBAA 5JOPD 3A6CL 2EDTA 3GMOA 4LGSB 3UXFA 1XAUA 1DBAL 3QWRD 3MNVA 5D2NB 2G5BB 1BQSA 5GGSB 4JHWH 3DX7B 5D1XD 15C8L 4Z77A 5DO2C 5JA8B 2VN7A 4W6WB 1IGCH 1IGIL 1A6VL 3VXNA 2YPLD 1LEGA 4MVBC 2CUHA 3S5LG 3MYJB 2WP3T 3HRPA 2B4CH 4WUUE 3RDTB 5KSBA 2HH0H 3L5JA 1QLRB 3AFLA 4ONGL 3AB0C 5IBTH 32C2A 3BDYL 4MLIA 4XVUD 5I1JL 4PJXB 2R9HD 4W4OA 1A7BA 1K5NB 3CPLA 4R96B 3WO4B 3LN9A 1RZ8B 2ID5A 2PO6B 3QZWB 4WHYG 2R4SL 4M6ML 2R2EB 2NY0B 4MA8H 1J5OH 4JFEE 3TFKD 3MYZA 4X0KB 2IBZX 3OJ2C 3FQXB 4H0IA 4ZS6C 3NACH 5C6TH 4P9MH 4DOHE 3QP3A 4QRPE 3CH1B 4ZQKB 3GGWA 2GJ6A 4R9HA 1NCBL 1ZAGA 3DUUB 3ULVH 3HNTH 3EO1B 3GSUA 4XVSH 3TPUA 2R2CA 4BQ6A 3ILQC 4DCQB 3FT3A 2WBWB 1PYWB 1QLEL 3EYOA 3JV5A 2EO1A 3H9HB 2K3TA 2VDQH 1YMHB 1P53A 4M7JH 4XNUH 2YN5A 3MLTB 2C3XA 3KPRB 1RZJL 3NCBB 4HKJB 4CMHC 2O93L 3SOBL 3MOBL 3LKQB 1S7TB 5M95B 3DV6A 7CGTA 1NMBL 2VDKL 3GIVA 3GMQB 3OKKB 1CQYA 2XWTB 4WO4A 4XP9L 5JZ7C 2BSTB 1AQKH 3M17A 2DTMH 4P99A 1JRHH 4AIZB 4YHNA 4KI1A 1A6ZA 1JPFA 1OLZA 1KN4H 2VMFA 1INQB 2EDHA 3R06B 4ETQB 1AC0A 3KGRA 4RCAA 1DQLH 4NZTL 4N0UB 3H7BA 3DO7B 4PB0H 3HAEG 4PRAB 4AM0B 3QB7C 3ZDYE 3OSKA 3AY4C 5EO9A 1UB5B 5HHVH 5J13B 3VGHA 5D7KD 2HAZA 4JY5L 5FYJH 1DBML 3RY4A 2AJUL 1JHLH 3OHXB 1QVOB 1IGML 2PUQT 4LCYA 1X44A 4NWTL 3SBWC 2ZG2A 3T1FB 3TA3C 3VE0B 3D18A 4LSPH 2J6EL 5E8NA 4ZXBB 3GM0A 4HWZA 3LKNA 1HHIA 2FCBA 3KPSD 2MHAA 1JNHB 1GAFL 1W72A 1FG2A 4ODSH 1FGVH 2Z0BA 5HVFB 4G6AC 1JPTH 4HGKC 3GNMH 5E56A 4D9RE 2G60L 2D0FA 3MFFA 4MA1B 3TYFA 4XMLL 5B3NA 2KUTA 4OJFH 5F7DA 1HZHH 4F57H 5LXGH 3OKLA 2J2ZA 5I76B 3TA3A 1ERNA 4YGVB 2EIDA 4H20H 3V6ZA 2OTWA 4MAYC 1XCQB 1FBIL 5EU7E 3TO4B 5F6IB 3N1FC 5FV2A 2AGJH 3QHZH 4V1DB 2ZUVA 4ZYKA 1A9EB 35C8H 4QHNB 2K1MA 2ZG1A 4GW1A 5CIPH 3L9RA 1U8OB 1NMCC 2EH8L 4U6HB 3SDAB 2AKRA 5FO9B 2E7MA 2Y07H 2BOCA 3D9AL 3V79C 3CDCA 1XF1A 2ZKHH 4Y19E 1MRDH 2KH2B 2XFXA 3BP4A 4YXLH 3VXUD 4OZIB 3FFDA 5C0BA 4EI5D 1ZWIA 4MXWH 2FLRT 2VLKD 1JZ3A 4M02A 1SEBB 3HUJE 3MRPB 3ET9F 4POZC 2X41A 4GKNB 2O5YH 3EDEA 2P5WD 2IADA 1KB5A 1XGTB 2IFGA 4PD4K 3O6ML 4XCEB 1C5CL 4IDLA 4K94H 1XZ0A 4OLUH 1I3GH 4G43B 5FK9A 4WUKL 3ZT7A 3UROR 4OCRH 1NL0L 1LE9B 3U7WH 5KG9A 1UM6H 3QIUD 2VQUA 4ONHA 4XAWL 2H3NA 2IG2H 3I75B 4AEHH 3QQ3B 5DJ6A 4K23H 1CS6A 3U2SA 1FJ1B 5FECB 4RISL 3GJFA 1ZVSB 3C2SA 3KR3L 5JUEL 1XEDA 3OKMA 5HI5C 1UM5H 5DHXB 4OGAD 1YUHA 4U7SA 2YA1A 2NTFB 5J6GB 2BNRB 4U1KB 1C5DB 1AFVH 2EC8A 5BZWA 3VXSA 1XR9B 2APTA 3VGDA 1OGAB 1A1OB 4OLVL 1CVRA 4F7MB 5EBWB 2EEDA 1T6WA 2EYTA 2FECL 1KXQE 4JKMA 1UWGL 4HHAB 2Z93A 1LO2H 4HGWA 3OV6A 4WY7H 1JJUA 1UM4L 4K2UL 3EYUH 1JF1A 43CAA 4J1UA 1ES0A 3QAZC 4FQIH 3IFNH 3DETD 5DUMH 4NZUH 1VFMA 2R23A 3C6LC 5JPMA 5JDSB 1IQDA 5FUOL 2DQDH 3WD5H 4RFEA 1E4XL 1QSED 1U95A 4D0BB 4OV5A 4GKOA 3LRSB 4XNQB 4W4NA 4YDVB 1XF4A 3RWFB 5DQ9A 3FOLA 3G5ZA 3S36X 2AABH 3Q6GH 5MENE 1B4JL 2NY3D 5HY9A 2IMNA 3TH4T 1PEZA 4D9QD 4JANB 3DTXB 3WFBH 2PO6D 1NAMB 2OK0H 2XN9D 4X4ZA 1KTDA 2NY0D 1DCLA 2X1WL 4U6XB 2VXQL 3C6LA 4NQTA 4WGWB 4YXHL 4LKCA 4J3UA 4X5XA 2VUOA 4XPHH 2BMKB 5T3XE 1MI5B 4FNLH 4GXUN 3OTTA 4LOUC 4YUEH 4NHUA 2B0SL 1KIRA 3IJHA 3U46B 3VFWA 2XZQH 3ULVD 4DAGH 3O6LL 4PGDA 3MRGB 3S98A 1JNNL 4HBQA 1S8DA 3HG1E 2DKUA 2FD6L 3NPZB 4HS3A 1IFHH 3HC3H 3IDYB 1YPZF 1MCFA 1YJDL 4A6YB 4KQ3L 1IARB 5F9JB 5EO1B 3DIFA 4O2FB 5L2JA 3UC0H 1EVTC 4P48A 4NN6C 4DEPB 3MCG1 4B5EA 5KBNC 1I4FB 1DUZA 4K7PX 4TNVF 1TVBB 3R0NA 4ODUB 2R8SH 4DUXA 1U8LA 5HDQH 1G6RB 1PQZB 4KXZH 1IGJA 3H9SE 5IP4A 3VXTA 5D1XC 1CLYL 5F93C 5LWYL 4LCWA 1RHHB 4WHYH 3LN4B 4KUZH 3ARBB 2ENSA 3ZE2E 1M71B 2Y5EA 1TZIA 2HYMA 3EDKA 5EU6A 3F12B 2YWZA 1UYWH 1ACZA 1A47A 5ALBH 3WNOA 4HPOL 4XVUC 5FYJD 2IGFH 2R9HC 2JB6A 1CI5A 5D1XA 1JV5B 1OP5K 2EEAA 4PJ9C 5DZNA 4C56A 4NKQB 3DECA 3KS0H 2YPLA 1BP3B 4JO1L 2P8MB 1KPUA 2PW2A 5CBEA 3LZFL 2A6IB 2AEPH 2Q8BH 4AH2B 4JDTL 4ZXBD 3TFKC 3H9YA 4N5ED 2A74A 3CFEB 3RZWA 1MY7A 1GOGA 2VXTH 1S7XA 3LEYL 2I5YH 4Q58C 1JZ8A 4NP4H 4LKXA 5JR1L 4XCNA 2XNAA 1BLNB 5JOFA 3NZ8A 3IXTB 4TUKL 2FX7L 1IRAY 2M26A 3FO2A 1LEIB 1P6FA 4NFBA 2CJUH 2ZOLA 3HAEB 4TSBL 3NOIA 3CXDH 2O5XH 4DKEH 5E08L 4PY7A 3I2CH 2P5EB 1H3WM 3JV6B 3C5SA 4JE4B 3HAEH 4LEOB 4QKXB 4ENED 4PRID 4V1DD 1BGXH 3PWJB 2J3SA 4OBSA 2FL5B 1QHPA 1ZOXA 3U1SL 2HFFA 5E1AA 4YAQA 2VAAB 1V3MA 2F8XC 1GZPA 3DBXA 4Y4FB 4NRYA 2VLJB 4X4ME 1M05B 4XZUA 5HGHB 4KKCD 1FL6A 4X7TB 5HGDA 5DJAA 3L3JA 4G8EB 3MROA 1PEWA 1EFQA 4LPTA 4GBXD 5DK0A 3GJEB 1N7MH 4XWGH 1NFDA 3FO1A 1T1YB 4Z7QE 1T20B 4QF1B 1P7KB 1YPZA 4TQEH 3BUYB 1LK2A 3TVMB 5F88B 5IVXB 1T0NB 3PABB 4X83A 5IVZB 3CAFA 1UH2A 1J0KA 1ZGLA 1CFSA 3I84A 5JPNB 2WV3A 1KPRA 4KDTA 3SDXE 3WIFA 5HYQB 5JW5A 4OZGB 3ARWA 3L3GB 5FYJU 4LASL 5I73C 4PJBE 5T3ZH 5KW9H 2UVFA 2XQBL 1T22B 1GPOH 3VRJA 3VWJB 3I9GL 2GAZB 2FRGP 4NQUA 4JFFD 2PKDA 1BZ7B 2EE2A 3KPSA 4HH9A 5FKAA 2HFEB 2YA0A 1BEYH 4M61B 3ZDXE 1II4E 2WIIA 3SQBA 1XGYH 3ZDZE 2BFVH 6FABL 5IQ9A 3WNNA 4G6KH 2IBBA 2P24B 1I3UA 1NDGA 3G6DL 1UG9A 4WU5A 3I6GB 2MQ3A 3T8XA 3BRGC 2UZIH 3E8UH 4LCCC 4F3FB 4GKSA 3JBG7 4HAGA 2VXUH 3RJQB 5I17A 1P7QB 3HC0B 3ULVF 5CHNA 4EI5C 2GSIA 5EU5A 3ZKQD 1MCOH 4MDIB 3FB8B 3MOAH 1IJ9A 3LIZL 3VH8G 3QI9B 2VL5B 4WUUB 5CUSH 3BPCA 3SEPA 3S4SA 3PL6C 1KT2B 5ESAB 3MRJB 1JYVA 3V4PL 2P8PB 4X4XA 4X99B 1E4XI 3VXUA 2V9TA 5C08E 3ULSB 2DWEB 1WWWX 1D6VL 4Y4KA 2VR4A 4JFEB 4OGYL 3G6JB 2VLKA 4KK5D 4KJQD 5HYJB 3LV3A 5FYLH 1T7ZA 4OUUB 3V6FA 2DOCA 4QRPB 4F80A 1N4XL 4OGAC 4HKBA 1N5YH 3PV7A 2EDDA 3MRBB 3EOBB 2J4WL 1J1PL 5SWQB 3SPVA 3D25B 3MACH 1U8HA 3VGEA 4J7RA 3QIUA 3V0VA 1HOCA 4NJAH 1JWUA 3F7YA 2CLZA 3TT1H 3DRTA 4MXVE 3DGGA 3RAJH 3O3AA 4QOKE 3DETC 4HCRA 1EZVY 2B4CC 3ARBD 1OAQH 2CSPA 4PJ8D 2AI0L 1EEQA 4NZRH 3OBAA 3RWDB 4Y1AD 5ISZD 5D2NA 2G5BA 1I9JH 2JELL 2A1WH 2PTVA 3IDXL 5GGSA 4NCC1 3MLRL 3DX7A 2NY3C 1ZVHA 1MJ7L 2FHBA 2Z31C 3RI5F 2NY0C 1FH5H 1FYTE 4ODVL 1KCLA 3MYJA 2DYPD 3VMNA 1NBZB 3RDTA 3GUTB 1FC1A 2WUBH 1QLRA 2AW2A 3F65A 5BS0E 3ULVC 4NQCE 3SDDB 5ADPL 4PJXA 4KI5D 1OAKH 5IK3B 1K5NA 4R96A 1T2QL 4O9HL 4XBGB 2PO6A 3VFPB 3QZWA 5IJVB 2R2EA 4U1SB 3N1GC 1OWWA 1ZHNB 5B3JE 5DDHB 3TIDB 4AQOA 4X0KA 1DQTA 4OZIF 3FQXA 2P5ED 3F6LA 5I71C 2H1PL 1MJ8L 1B9ZA 1FL5B 3CH1A 4NYLB 4ZQKA 3MLVH 1S7RB 1U8IB 3DUUA 3EO1A 4OLYL 4KMTL 1BIHA 4MNQB 2DLFL 5HHMB 4DCQA 3NCYS 1I7TB 1GOHA 1U8PB 2E6QA 4Y4FD 1PYWA 5IF0B 3T4AB 2VLJD 3H9HA 3QDME 2NW3B 4X9IA 2DQGH 3BT2L 1YMHA 1T04B 1VPOL 3V0WL 4IRZH 5F21B 3MLTA 3KPRA 4LF3B 4M9OA 5TDOB 4HKJA 4WWID 1BBDH 2Z9TA 4LLUA 1BOGB 3RA7H 4WTZA 1VA9A 2CO6B 1S7TA 4UB0L 3CCHB 1D9KD 4FXKB 3GMQA 3MJ9H 3OKKA 1FAIL 2WLZA 1PLGL 2XWTA 4MJIE 4HFUL 3UJJH 4L8DB 5CZVH 5DRWB 2BSTA 5K93A 3TVMD 2PW1B 5MP6L 5C07B 4AIZA 2ORBH 3GBNH 4ZXBC 4FFYL 3LD8B 4N5EC 1INQA 3R06A 3JWNC 4ETQA 5ACZB 2Y36H 4N0UA 4X6CE 3DO7A 5L88H 3S36H 3VW3L 4PRAA 1OAZL 3OWEA 4FQLL 4AM0A 1DN0B 1UB5A 5DRXB 5I1CL 4R26H 5T3ZD 1WZKA 1N3NB 4PV9B 2ZWLT 3OHXA 1QVOA 3B2UC 5ETUB 4LPUA 1HXMB 1QFWI 1YEFL 2PN5A 3T1FA 3VWJD 3VE0A 1IC7H 3SE4C 4ZXBA 2AJ3B 1F11B 4MNGE 4XMPL 1A3RL 4PRNB 1JNHA 2J8UE 3O4OC 4I77L 3ULUL 3BYTA 1A4KB 4ENEC 2BSED 5HI4D 3IAPA 1E6OL 1FP5A 2VC2H 2AQ1A 3VD9A 5D2LF 2VDNH 1EMTH 1A3LL 5CLWA 4LLAA 1CFVL 1X5IA 5DK2B 4HIXL 4R97B 5I76A 3RWHB 2VH5H 4EXKA 4KKCC 4YGVA 2P8LB 3FN9A 4OB5L 1YEHH 1XCQA 2ZCHH 4K7PH 3TO4A 4F9LC 4GBXC 1OTTD 4Z8FL 4D8PB 1NKOA 2XKSA 4V1DA 5JTWA 1A9EA 4K94C 4QHNA 4OKDA 1GGBL 1U8OA 5DMKB 2LU3A 5DF0A 4U6HA 1TVHB 3SDAA 2ED7A 5FO9A 1GIGL 3TC9A 2PNDA 2YN3A 5F9WB 1RURH 5CJQH 4OZIA 4YWGH 1IGTB 4OCSL 2YEZB 5FYLD 1BVKB 4PG2A 5HYJD 1SEBA 4ERSH 2BSRB 3MRPA 2NX5B 4LVHC 1L4IA 4GKNA 3V0AC 4XNZB 1TQBC 2BHYA 3RPKA 1DVFB 1XGTA 2QSCH 5FM4A 4XCEA 3LVEA 2X1QA 4MJ6B 3T0EE 3ARDD 4G43A 2K7PA 2GCYB 1KN2L 2R2BB 7FABL 5GZOC 4JPVL 3MLXH 1LE9A 4G5ZL 1Z9SA 3RY5A 2YS4A 5E6ID 3I75A 5CD3B 2OTUB 3QQ3A 4PJIF 5E2TH 4G6JH 1FJ1A 5FECA 4LSUL 1ZVSA 2IAMC 4OFKA 2G9HB 4L8CB 4HDIB 2UZXB 3G04B 2NTFA 3RY6A 4HWUA 1WEJL 4UIMB 4YNYA 2BNRA 3M07A 4U1KA 5GS0H 5J6GA 1C5DA 1ZKAA 2P7TB 2X4RB 4I8DA 1ZVYA 4XXCC 5D7IF 4CN1A 3KAAA 1XR9A 1OGAA 3N85H 4FQPA 1A1OA 4JVUA 4F7MA 2PYED 3SE9H 5EBWA 3P4LA 2FX9H 4WFHD 4JKPH 2CXKA 4KI5F 4S2SB 4HHAA 3BZ4B 3ABZA 3P30H 4JPWL 2K7QA 2FLBT 2B39A 4LSTL 3RVTD 3WHE0 4NQDE 4ESKA 1JGLH 4XCCH 2HA1A 3MODH 3O4LE 1DJSA 3X3FH 2B1AL 5JDSA 4JJ5B 3CH8A 4QRUB 4D0BA 1UFUA 4XNQA 4YDVA 3RWFA 3NABH 3NBNA 1DQDH 4RWYH 1WIUA 3QCVL 4HK0B 1AY1H 4WGVB 1D5BB 3SDDD 4ODWB 4HMEA 4KK5C 4KJQC 1IEAB 1U3YA 4UNUA 1JZ7A 1CBVL 4JANA 3DTXA 4U3XA 4CDHA 1NAMA 2DBLH 5C0AE 1X7QB 1X5LA 4TVPH 4LRIC 1CLCA 5E4IA 3TJEH 4U6XA 3F6IA 2BMKA 4DEPC 5FOJA 1MI5A 4TULL 5KVGH 3T08A 4C57C 3UBXG 3U46A 1CFTB 3GDBA 4PRHD 3MRGA 4JHWL 2OJEB 2BVQB 1OPGH 2IEPA 4MNQD 5HHMD 3ZYIA 1RZKH 4A6YA 5F9JA 5F89B 5EO1A 1BZ9A 2D7TL 4O2FA 5IVXF 4PJ8C 4BKLB 2P47B 2HH0L 2J12B 4HKXB 4K8RH 4PB9L 1I4FA 5J1SC 1TVBA 4ODUA 5IBTL 5HHXH 5IHBA 3MCKB 3LKRB 1G6RA 1PQZA 1VGEH 1Q9WB 5KS9E 2F53B 4R7NB 4YIQB 4OF0A 5EIQA 3V5KB 4ZAKB 3VG9C 1F4HA 5IESL 5F72S 3QEQB 1RHHA 2ZCKH 4EBQH 4MZ3A 3R8QA 3LN4A 3MGTB 3CU7A 2XWBB 3ARBA 2ADGB 5C07D 1M71A 4PRDA 5DUBB 3F12A 3NACL 5C6TL 4Y1AA 4F9PA 3BISA 3QCTL 3A6OA 4S1RH 5DHVB 4L4TE 3QEHB 4KI5C 1JV5A 1YNTB 4K9EH 4XVSL 4I48B 4Z5RB 1C1EL 3VD4A 1OTUC 3FQRB 2VDQL 4M5YL 2P8MA 3TYGH 1MFBH 2A6IA 4AH2A 3HE7B 4Z7VF 2PF6A 4XNUL 5IGXL 2RCSH 3CX5J 4I13B 4PJBB 3CFEA 1PSKL 3FJTA 3S9DB 2KKQA 1BAFH 1N26A 1BLNA 4BK5A 3FB6B 3IXTA 2YWYA 1FFNB 1LEIA 3MRLB 4PJHB 1RMFL 1HKLH 1JRHL 1A7QL 1NSNH 4W68A 1FO0B 2JCCF 3HAEA 4YFDB 4YHYC 1DQLL 2DQUL 2P5EA 1FO0H 3JV6A 4PB0L 4LEOA 5E2JA 5J06A 4MX7B 3O8XD 1FVDB 4LLVB 3PWJA 3QYCA 3MUGB 2FL5A 1D9KC 3HZVB 2L4OA 1LNUB 2VAAA 4XXDB 1Z6JT 3C08L 4Y4FA 1L0YA 2VLJA 3BUTA 1M05A 3TVMC 5HGHA 3CVIH 2Y9RT 4X7TA 5ESQB 1VFUA 4G8EA 4RMSA 1H8OA 1DTUA 1UZ8B 1H3VA 3GJEA 3BH9B 1JPTL 3GNML 3DWTA 4ZD3H 2NX5D 5C08B 1QSFE 1TMCB 4UT6L 1T1YA 2OP4L 3O2DA 1DVFD 4BZ1L 5BJTB 3EUUA 5GRUL 4F57L 3REWB 4QF1A 1P7KA 5LXGL 1KCUH 3BUYA 3IU3A 3JVGC 3TVMA 5F88A 4NKMB 5IVXA 5E8OB 1T0NA 3UTSB 4ZNEA 4PPTA 3PABA 1YYML 4OUOA 5IVZA 3U30C 4K3HA 4CAGA 2AGJL 1MCWM 2OCFD 5D9SA 5JPNA 3QHZL 3B43A 1EGJH 4WFFE 2XTJB 5A16B 5HI4C 35C8L 5HYQA 5GS0D 4OZGA 4JZJB 3L3GA 4M5ZH 2MNUA 5E95B 1QBML 1N6QL 1QEWB 3PWNB 1T22A 3VWJA 1MRDL 1ZLVH 3OJVC 4QOKB 2QADB 4YXLL 2GAZA 5JORB 1BZ7A 4X6DE 5IV2B 3HMWH 2HFEA 5FDYA 3TH3T 4MXWL 4M61A 3DYPA 3WFEH 1OTTC 2X1XR 4DZBB 5LJYH 4PLNC 1KTRL 43C9B 5EU4B 5J8OA 2P24A 3S3JA 2J1KA 1GC1L 1DSFH 3I6GA 1I3GL 4K71C 1KG0B 2UVEA 4B7LA 3QHFL 4F3FA 3QFDB 2GSGB 4L5FL 4RSVA 1UM6L 5L8JB 1V7ML 1P7QA 4LDOB 3HC0A 5TE4H 2XA8L 1GJIA 1FYTB 4K23L 3FB8A 4MDIA 4KTEL 4G42B 4Z7NE 2VL5A 5JLZB 4WUUA 4TVPD 4IS6B 1AXTH 3MLSL 4HWBH 2DQCH 4NQCB 1JPST 1KT2A 5ESAA 4LVEA 1VFOA 1T5WB 4YZFE 3MRJA 3ARDC 4JFYB 2P8PA 4X99A 1CDIA 1GHFH 4X7DC 1FGNH 3ULSA 2DWEA 3IRPX 1MWAB 5C0CB 4RX4A 5E6IC 3RUGF 1A3QA 4WY7L 4JFEA 4UOW0 3G6JA 1MWAH 1CU4H 1TTGA 5HYJA 3EYUL 3NAAL 4OUUA 3IFNL 4PJCF 1KJ2H 4QRPA 5DURD 1FSKC 5DUML 4M4RA 4NZUL 4BQ8A 2Y6SD 4K8RD 3MRBA 3EOBA 3VI3F 3LOWA 2B1HL 5SWQA 1SY6A 2F54E 4R8WH 2XZZA 1MVFA 3D25A 2X6MA 1WWCA 4N68A 2AABL 2CDEB 4OCWH 3QDMB 3QEGH 3HB3D 3Q6GL 2F53D 1MVUB 1UKTA 3QEQD 3RVTC 2OK0L 2CKBL 3LRGA 1IBGH 4QXUH 1SJEB 2VTFA 1EEUA 4BA8A 4TVSa 1NFKA 3O3DB 1OP3K 3CDFA 3RQ3A 4XPHL 4OM1L 4UUJB 3RWDA 4YUEL 2PCPB 3RJDA 2GHWB 2HWZH 2XZQL 4J6RH 4JHBA 3K4AA 1WCBB 4J3WA 4PUBH 1IFHL 2UYLB 1VERA 2YXMA 2WANA 1XIWB 3EZJB 2I24N 3HE7D 5DVNA 1NBZA 3GUTA 2R8SL 4U7KA 5J11C 2Q1EA 5HDQL 3U6RB 4PJ7E 4AY0A 3SDDA 5IK3A 1A8JH 1B0RB 4MNGB 3BPNB 4XBGA 5F7MC 1XCTB 3VFPA 5HYSG 1KCRH 5IJVA 3R4DA 5IT2H 4U1SA 1BFTA 1Y6NR 1ZHNA 4XCFH 5DDHA 3TIDA 3QNZB 4DUVA 3VRIB 2AXHA 1UYWL 5I1IL 5ALBL 3NFSH 1FL5A 3CZJA 4NYLA 4YEEA 4F15C 1OHQA 2IGFL 2ICCA 1S7RA 1U8IA 3KXFE 3C2AH 4X8XA 4MNQA 4XNYH 4UOJA 1E27B 1I7TA 1U8PA 5IF0A 1OSZB 3T4AA 1JRHI 2NW3A 3GMRB 3O0RH 1KXTB 1T04A 4YBQD 3LD8C 4JGMA 4AT6B 2EDKA 4KJYB 2EDQA 1TDQA 2ICWI 4Z18A 4LF3A 4NP4L 5I74B 5TDOA 1MCSA 3F7RA 3QG6B 1BOGA 3CCHA 1ZLUH 1NCDH 4FXKA 3K81A 3KJ4C 5CJ8A 3IDNB 4UV7H 4L8DA 3BO8B 3JWOL 1PY4A 5EO0B 3RVXD 5DRWA 1G6VK 2AJYL 2PW1A 5E6YA 5C07A 3CXDL 2O5XL 3UTSD 2ZOKB 2ATPB 1RZFH 5C92A 4NO2B 5ACZA 3T0EB 4QLRA 5D6DC 2QSTA 3DPBA 4RWHA 2XTJD 1ND0B 2YA2A 1DN0A 4IMKC 5DRXA 1OW0A 3MX0A 2W9EH 3MRHB 2AK4B 4PRPD 3WS3B 1N3NA 1MRCH 4PV9A 2GFBB 2OL3B 4MJ5B 4XBPB 2NW2B 5ETUA 3VFRB 5EDXA 1HXMA 5F71A 5EORH 2AJ3A 3K80A 1F11A 1T7WA 1WTGT 4PRNA 4Z78B 5D6DA 2D03H 3W5NA 5DD5H 1A4KA 3O8XC 4ZPVB 2EEBA 1FE8H 4IMKA 4XWGL 3S37X 1Z9MA 4C54A 2XICA 1BJMA 1JGUL 2IANB 5JHDE 4MNHB 5EBGA 4TQEL 4PJDF 3X11B 3C60B 1A2YB 3I3EA 5DK2A 2GK2A 1LD9B 3RWHA 1T7VA 2P8LA 4LHUG 1DQMH 1BIIB 3ALXA 4LCUB 1KJVB 4DQOL 1JF5A 3D85B 5BMFL 3AUVA 5DXWA 4D8PA 5D6CB 4MMXC 4NDMA 4XNZC 3UTQB 2AS5M 4FG6D 5DMKA 5KW9L 1TVHA 1E4KC 4OGXL 2C3WA 1R3IH 4RAUB 1PKQB 1LP9E 3T1WA 3PWPB 4YR6B 4OCYL 3BEVB 1T03H 5C0CD 3HI5H 4GXVL 2APFA 1XGYL 2YEZA 4LAQL 5BQ7B 1BVKA 3IYLW 5F7EH 2EDFA 1QKZL 1F13A 2BFVL 2X4SB 3VI4F 1EEYB 2BSRA 2NX5A 2DM7A 5TE6L 5F97E 1H3TA 5GS0C 3T0AA 5IWLC 2HVKB 1DVFA 3ECBB 5DRNB 4FZEH 4MJ6A 2DM4A 5TPWL 3PWLB 3SDCD 4RRPG 2YKLH 2BSSB 2GCYA 5IG7B 3K8MA 5I15L 2R2BA 4YXKH 2P1YA 1ZE3C 1IGYB 3FMGL 4LLQB 1R0AH 3NPSB 5CD3A 3MOAL 1BZQK 4I2XE 2HFTA 2OTUA 2DL2A 5GS2H 3FQNB 3EOTH 2D3VA 4GSDH 2APXA 5L7XH 1D5XA 1O5DT 2R4RL 4WVRA 2FSEB 4BSVA 2G9HA 4KKLD 5BV7B 5ITBH 1XGUB 4L8CA 1EAPB 1KULA 4HDIA 3G04A 4UIMA 2ESVE 2P7TA 2X4RA 5MHSD 3PDDA 1F4YH 1YEDB 3IDIB 4KRPB 3UPAA 3UTPD 3KJ6H 4S2SA 3BZ4A 2F9BT 4P2RE 3KWWA 3HRZB 1MFCH 3ZSSA 4PJHF 1ZLWK 5CP3A 1N5YL 3I50L 2VDPH 3BYYA 4KVNH 3MUZ1 4KV5F 1XIWD 4JJ5A 4DW2L 2EDYA 5L2KD 3AXLB 4QXWA 4QRUA 2CK0H 1EBPA 3MACL 4F33B 3OB0K 5DS8B 4HC1H 1IAKB 4NWUL 5J1AB 4X8JA 3GK8H 4H8WH 4HK0A 5FYKE 1D5BA 3TT1L 4ODWA 4NIKB 3P11H 4G9FE 1RZKC 2F8VA 1IEAA 3KPTA 1BREA 3RAJL 4HMDA 4EUPG 5C0FB 1X7QA 4M93B 3DI2B 1OAQL 2Y6SC 2DQHH 4K8RC 2P45B 3MBXL 4NZRL 4PP1D 3WFDH 5GGQH 5SWZE 1CFTA 4KXZI 4Z7WF 8FABB 3HB3C 5FOBB 1WJ3A 2HN7B 1MEXH 1PD6A 4NOBA 5GRJL 3EYSH 2OJEA 4ELME 3QWOB 5F89A 4PV8B 2KZWA 4X7SH 5GJTL 1FH5L 1QFWM 4UBDD 2ILLA 5LBSL 4BKLA 3P40A 4MWFB 4HKXA 2WUBL 3FB5A 3MCKA 3LKRA 1N59B 1RFDH 4IIQB 1Q9WA 4K9EC 2F53A 4JRXB 4R7NA 4YIQA 3V5KA 4ZAKA 5C6PB 3QEQA 5C0RH 3BIAX 5T5FH 1XMWA 3JUZA 4TYUA 2DKMA 2Q7NA 5IEHB 3MGTA 1ZT7B 2XWBA 1IE5A 1S3KH 3UCRA 2ADGA 1QSFB 4RMVA 3HE7C 3ZYJA 5DUBA 2ZUUA 5I6XB 3MLVL 3OKOB 5DHVA 5ALCH 4JDVB 5CEYB 5JW3H 3B8YA 3QEHA 1NBQA 2VQ1B 5HXMA 1YNTA 3IKCB 4I48A 2AK4D 4Z5RA 2E8ZA 3C8DA 4N0RA 3FQRA 1RIUH 4ODHH 5IBUG 2DQGL 3HE7A 4IRZL 1MF2H 4PJBA 1F58H 1NGXB 2JJVA 3EHBD 4XI5D 1BD2E 2AJZB 3DXAD 4K3DH 4Q9RL 2C26A 3FB6A 4X9BA 3MJ9L 4GW5B 1FFNA 4LAJH 2UY6A 2IAND 3MRLA 4PJHA 2Q3ZA 2D2OA 1O7VA 3WIHH 3QCUH 1QTYT 3TLRA 3RWEB 3C09B 4XVTH 1FO0A 3G5VA 4M4PA 1CWVA 5L0QB 2Y36L 4HS6B 2DL9A 4MX7A 1FVDA 4JB9H 3QUZD 4LLVA 2I9TB 1NC2D 4XRCB 1RJZB 3HZVA 3U7YH 1LNUA 1QSZA 3AM8C 4XXDA 1AHWB 4QGTA 2X40A 2EIBA 4Y5VC 3RVXC 1IC7L 1T3FB 2IALB 1G1YA 1Q0XL 4H25B 5F1SA 1Q9OB 3PWPD 2AQ2A 5ESQA 1B90A 2EYRB 2ATKB 4HEPG 2VO5A 4M1DH 1UZ8A 3BH9A 2FX8H 3AU1B 2XPGB 4Z95H 1N0LA 5C08A 3CSYA 2VDNL 1EMTL 2JTDA 2VYRE 1U3ZA 5BJTA 3REWA 4LHUB 1N0XL 3MA9H 2EXYD 1ONQB 3NIDE 4RFNB 1CR9H 4NKMA 3K46A 5E8OA 3BMVA 3UTSA 5GS2D 4DGIL 1EGJA 2ZCHL 1C7SA 1I7RB 2K9UA 3ARPA 4N0CC 3HPLB 4DVRL 5DZLA 3RZCB 4YHKH 2Q7YB 4CU6A 1C7TA 5A16A 3SE3A 2AEQH 2HRPH 2BVTA 4JZJA 4O00A 1YECH 4QRRB 2VDRH 3RWJB 3HZKB 1R3HB 4P49A 4P3CL 1QEWA 2NXYB 2X4NB 3PWNA 3TO2B 1HINH 4K7FB 3BKYH 4OZHE 3OG4B 1H3PL 2J5LB 4QOKA 2LVCA 3MV8B 3KLSA 3QPXH 4LEXH 5JORA 4YWGL 5J0BA 1YN6B 5IV2A 5B4MD 3PDGA 1U93B 2A0LD 4M8VA 2D9QB 2FHFA 4ERSL 4DZBA 2DMKA 4N0YL 3UMTA 5ID1B 1YEGH 5EU4A 1IC1A 2QSCL 4FG6C 4LNRB 1N6UA 4CN4A 2MWCA 1TJIL 1KG0A 2WQ8A 1K4DB 4XP1H 4WNQB 3MLXL 2GSGA 3QFDA 2RQ8A 2ZCLH 4Z7OE 1RVFL 3RGVB 3VWKD 1WSST 1FYTA 5E2TL 1JWSB 4G42A 4JG0L 5JLZA 1ETZB 4DK6A 4OZFG 3L3HB 4IS6A 4NO0D 2OJZH 5BOZG 4N8VG 1AE6L 3T77B 4NQCA 5EA0H 1CT8B 1B0WA 3U7AA 1T5WA 4HMCA 3SDCC 3V6OE 2IH1B 2YD8A 4L29B 4JFYA 3GI9H 5E94B 3BHBB 3T04D 1NC4B 2MKLC 5C0CA 1MWAA 4MS8D 2FX9L 3P30L 5DGRA 5LGHH 3K8LA 3AVEA 1QSVA 4HKZB 4HT1L 4KKLC 4J4PC 5HDBE 3S35H 1QD0A 3KXFB 4MMZC 3QRFM 2X4OB 1MAJA 1FNGB 4MZ2A 5D7LB 2C5DC 2QSQA 4E41B 2CDEA 4RWYL 1AY1L 3QDMA 3C5ZB 4EQ3A 4NO3B 4JRXD 5HI3C 4WEBH 5CCKH 4MCYB 4X6BB 4EUPH 4JHZA 2DBLL 1S9KC 1SJEA 3TJEL 2BY3A 2EDNA 2YXFA 1LO3H 4XP4L 3UYPA 1QBBA 3O3DA 1XIWC 5KVGL 4UUJA 5KSBE 1NCCH 4PJAF 2PCPA 1NGZB 5IBLC 1YEKH 3DI3B 1BVLB 3UTOA 4V2CB 1WCBA 4JQXC 2M8XA 5GZND 4L3AA 1T83A 1YMMD 3HS0B 2UYLA 1OPGL 5TDPB 4U3CA 1RZKL 1HWGB 1EPFA 4KZEH 3INUH 1LWRA 3GB7B 4I0KA 1XIWA 2CO7B 1KUMA 4O2CB 3UJTH 4OI8A 4NBYB 2FJGB 4UQ3B 5CKAA 4FQCL 1A6AB 5J57B 3U6RA 3WSQH 1VGEL 2GJ6E 4NRXB 2CPCA 1HSBB 1B0RA 3H9ZA 4MNGA 3LS5L 1CL7H 4O4YH 1YEEL 3B6SB 3VGFA 1XCTA 2R0ZH 2R0KL 5GQBA 3KVQA 3RIFF 5J7CC 3L7FB 2CRIA 5JXEC 3H3PH 1ZEAH 4FP8L 1CDGA 2NLJB 3QNZA 3ZKXC 3VRIA 3GMLB 4FZ8L 3OGCB 3CVHB 5I8OH 1VEPA 3B9KD 3N9GL 4ZOAA 1ADQH 3C6SB 5IBUB 5EBMB 4DUWA 1G84A 1E27A 3T2PA 1OSZA 3E2HB 3TCXA 3TYGL 3IJSB 5D8JH 5DD1L 3GMRA 1IAOA 4U2ZA 2RCSL 1F42A 2LAGB 3O6KH 1IAIH 3MUJA 4LMQI 4AT6A 4KJYA 3U0TA 2WUCH 4HJJL 4QNPE 1LP9B 3QG6A 3MRQB 1INEL 5EZJB 2AJXH 2E9WA 4Y5YB 4PS4H 1M4KA 1OSPH 1Q72H 3B9VA 1FORH 3IDNA 4LHUD 4HIIB 4GO6B 2FEEL 3BO8A 1NSNL 3EJJX 5EO0A 5LGKA 3T3MF 4PJFE 3UO1H 2ZOKA 2ATPA 4NO2A 1GGUA 4PRBB 4M03A 3WNMA 3EHBC 1I9EA 3RZCD 4XI5C 3RWCB 1J18A 1IC4H 3JTTB 1UEYA 3P9LB 1LILA 3RVWD 1FPTH 2EDOA 1P5UA 1WFOA 3MRHA 4Y8AA 3TNMB 2AK4A 3CLFH 3ARGD 4QRRD 2MOVA 3WS3A 4CVUA 2GFBA 2OL3A 4XBPA 2NW2A 1L0QA 3VFRA 1UWXK 1VEMA 1P6AB 5AAWA 4KQ4H 3CVIL 4LP4A 3MV8D 4JZOB 2VOTA 5MI0B 2E9JA 3JWDH 4IRSC 3T3PF 4Z78A 3U0WL 2JB5L 3SN6N 3K3QA 4ZPVA 4ZD3L 3QUYD 3QUZC 2NR6D 1X9QA 1CGTA 3BAEH 1MCPH 4OLEA 1LEKB 1HK6A 1UQSA 3KPPB 3BN9D 4CNIA 1A7OL 2IANA 3QDGB 4MNHA 3X11A 1BBJB 3C60A 1A2YA 3PF2A 4P2RB 1LD9A 1CFQB 1G9NH 1TXKA 5TE7H 4Q6IC 1F90L 1BIIA 3BD3A 4LCUA 5C0BE 1KJVA 2E7HA 3D85A 5I9QB 3SGDH 3A6CH 4HZLB 1MHPL 5CINL 3QUZA 1K2DB 4GG6F 3DX9B 5GS3A 5IMKB 1DBAH 1I8MB 2VWEC 3FT4B 3UTQA 3EKCA 4M5ZL 1EXUB 1Q94B 4GKZB 2EXYC 1A4JB 3RVVD 5M94B 2KPNA 1PKQA 2EDEA 5FUCC 5GRXG 2C4FT 3PWPA 1IGIH 4YR6A 3BEVA 3LKSB 1KGCE 2Q87A 3WFEL 2V2XB 5BQ7A 5LVEA 2UV3A 2OR8A 2X4SA 4NRZB 5CEZE 3U79A 1EEYA 1YC7A 1ZLUK 5SWZB 2HTKC 4X7FC 5DVKA 2HVKA 4U1GB 3ECBA 5I1JH 5DRNA 3PWLA 3GKWL 2BSSA 5D7LD 5IG7A 5TGBB 3TJHC 4ZPTB 1IGYA 1MELA 1A1NA 3V7AE 4LLQA 5DYOB 5CILL 3PHQB 2R4SH 4E41D 4JJHA 2HG5B 5B4MC 2A0LC 1H0DB 3WUZA 1U92B 5TF0A 3FQNA 4OZFH 1DLHB 3EYQC 2LU7A 1J0ZA 4HWBL 5FGCE 4ODXB 2FSEA 1XGUA 1EAPA 1V5JA 1NCBH 4W81A 4P2QD 1PGRB 1YEDA 3IDIA 4H8WC 1VENA 2ICEB 4MAUH 1J10A 1OAYH 3TBYB 3VWKC 4RFOH 1HYSD 4RMUA 1CU4L 3G08B 3HRZA 1JTTA 4GT7A 4OI9A 3SOBH 3WS6A 3C5JB 1D5ZB 4R8WL 3AXLA 4I3RH 5E7BA 4UDTB 4DN4L 1DEEB 5GIRB 4F33A 5DS8A 1IAKA 5J1AA 4OCWL 3QEGL 4MS8C 3EGSB 1UEMA 5EBLB 4HX1B 1DE4B 5EOTB 3HKFA 5D5MF 1I1RA 5E24E 3LDBB 4JQVC 5DT1H 4QXUL 4NZTH 4RDQG 5C0FA 1BD2B 1CXKA 2FBJL 2JJTA 3WHXB 4OF7A 1SYVB 4M7ZC 2V9QA 2PTTB 3Q2CA 2ZJSH 4P5TB 1JWMB 1CE1H 3GSQB 3OMZA 1OAXH 3RIFK 4J6RL 2IQ9L 3QIWC 1IGMH 4M43H 4NWTH 4X5WB 3BDXA 8FABA 5FOBA 2HN7A 4PUBL 3QXDB 4LCWE 2VDLL 2H32B 3ZHLA 4JQVA 2JJSA 1WC7B 3QWOA 4HXAH 3GFUA 1PG7H 4ZNCD 1D5IL 3MLWH 4PV8A 4U33A 2HMID 4NNPL 3TPKA 5JOPE 3LEVL 4NN7B 5FO7B 2G60H 4XMLH 4MWFA 1V05A 4GAJL 3P4OB 5I6XC 1AGDB 1UWEL 4WFED 3G5YB 1N59A 4IIQA 2UWEF 1MHHB 4JRXA 1UADC 5GZNC 3FB7B 1T1WB 1ZLSH 3RL1B 3MV7B 1FBIH 5ECJE 2FGZA 5IR1B 5L8LB 1KCRL 4JFDB 4AG4H 5IEHA 5IT2L 2YPLE 1ZT7A 1TVDA 2D4DA 2BNQD 1QSFA 1SMAA 1VEOA 2WBKA 1MUJB 4RGND 2EH8H 3S97C 1EEZB 2HT2D 1DL7L 3KPQB 3P0YH 3D9AH 3OKOA 4FQXB 4JDVA 5CEYA 3QUMH 1ITCA 4FQ2L 2VQ1A 5A3ID 3ARFB 1WLHA 2AV7B 1KELL 3IKCA 4XNYL 4XPGH 2RBLA 4HUXB 4M1GH 4JG1L 1TPXB 1X5GA 5KZCB 1ED3B 1CE6B 1H3XA 2FEEI 3PGFH 4PJEF 4OCNC 4R2GB 5AWNH 3K7UA 5E5RB 1NGXA 3VFTB 4KWUA 1NL0H 2AJZA 3B9KC 3WIHA 4GW5A 4XAWH 1HWHB 3QDGD 5DRZB 5MEQB 5J12C 2V5TA 1IM9D 4RISH 1FL3B 5F3BB 1KC5L 3RWEA 5JUEH 3SJVD 2JKXA 1RZFL 3UTZB 5CGMA 3TH2T 4D2NA 4HS6A 5C0DB 3SDYL 4NPYB 4QYOB 4GRMB 3SCMD 2I9TA 3BPLC 4XRCA 2W9EL 4OLVH 5ACLA 1ZMYA 1RJZA 5IFJB 1U6AL 1MRCL 4X5LA 5ILTL 3FL7A 3S3SA 5FB8B 1YPZE 3DLQR 1AHWA 1UWGH 2DQIH 1UM4H 2VISB 1T3FA 2IALA 1AGEB 4H25A 1Q9OA 4TUOB 4UAOC 3DUSB 2YZ8A 2ATKA 1K9TA 4PYHA 5DD5L 1U8NB 1ZHBB 3RZCC 3I02B 5FUOH 1FE8L 3QSKB 3QXTA 4MXQC 3AU1A 1FVCB 2XPGA 3RVWC 5D7KE 2ERJC 1MCCA 3ARGC 4R4BB 4TNWF 1C8PA 4LHUA 2UY7A 3DX6B 3QUKB 4XGZB 2XZCH 1ONQA 3Q5YA 3DURB 4QHLB 3U83A 1DQML 4NZDA 1JVKA 3KPSE 1I7RA 1OL0A 1EERB 1ULVA 2VXQH 4DKFL 4HD9A 1G0YR 3HPLA 2L0DA 3RZCA 3ZMRA 2Q7YA 3QUYC 4EZMA 3HE6C 1U0QA 2NR6C 3GZKA 3GRWA 2XWJB 2B0SH 3PXJA 4FRWA 3BN9C 4KHXH 4QRRA 5AZ2L 2FB4H 3O6LH 5E2WL 5I1GH 3RWJA 3HZKA 1R3HA 1FNEB 3TO2A 2X4NA 1R3IL 3BX7C 2HFGL 2FD6H 2IBGA 1EH9A 4K7FA 5DD0L 5F3HB 2ZPKH 4LVNC 1T03L 1YJDH 3MV8A 4L3ED 4KQ3H 5FGRA 1YN6A 1JYXA 1U93A 1WZ1L 5F7EL 1J88A 2DI9A 3U0PB 5ID1A 5AYQA 3W0WD 4G7YL 4YHZH 4I9WD 4LNRA 4CKVX 2YRLA 1HHJB 1JFQH 3CU1A 3DX8B 4DN3H 4PTUB 1OLLA 1CLYH 2G2RB 4YXKL 5FGBA 3RVVC 4WNQA 3WXWL 5LWYH 1W0VB 4PIRF 5I75C 3VXUE 1R0AL 1VKXB 3QPQD 2GTWB 1FIEA 3RGVA 1NAML 2H9GB 2VLKE 1JWSA 5FHAL 3BW9B 1ETZA 4ZFFB 3L3HA 5ICXA 5ITBL 3AB0B 2P5WE 3T77A 1NFIB 1YYLH 2BOBB 1CT8A 4HPOH 5I66B 5JMOC 2H2PD 3JXAA 4Z0XB 2YUVA 1F4YL 3OJDB 2IH1A 5E94A 3VMOA 3BHBA 5HPMB 3RIAF 1MCLA 1NC4A 1X5ZA 1HXYB 5GGRY 4A6YL 2AQ3A 1MFCL 1ORQB 2HLAB 2HT4D 1TQCC 1JZ2A 2ZUSA 4XBEH 4HKZA 3QDAA 4YHPB 1P2CB 1FLRH 3B8SA 3SKNB 2E7BA 3KXFA 2X4OA 3WFZA 1G6RL 1FNGA 3NIFF 4D0CB 5D7LA 2CK0L 3UBXI 4LCIH 1R5WB 5EU7C 1WFNA 3SHSA 4HC1L 3SGJC 2HKHH 4E41A 3CJJA 3GK8L 3K8KA 3C5ZA 4XC3L 2VSCA 4NO3A 4BH8B 1R6VA 1HYSC 4MCYA 5IKCB 5E08H 4X6BA 3MV7D 5GXBB 4JFDD 5F8RC 5CSBA 3OAYK 3X12B 3W81A 4P2QA 4ZUUB 3U1SH 5DC0A 3VXOB 1QSEE 3STZA 3SGJA 1G0DA 4X80L 1NGZA 3V95A 1BVLA 4GAYB 4WI7A 4PJFB 1MEXL 3IJYB 2GEEA 1S7VB 1FC2D 5IJKC 5EWIL 3HS0A 4D9QE 5TDPA 3L1OL 3IU4H 4LQ1A 3K1KC 4X7SL 2XN9E 3L95A 2BNUB 2FDBP 3GB7A 4UTBH 1B88A 1YN7B 1FNHA 1I75A 5JQ6L 4O2CA 4R2GD 5KAQG 3OKLB 2GY7B 3GMMB 5ICYB 2FJGA 4UQ3A 1A6AA 3ULVE 3P2TA 1RFDL 4YDLC 1LE5B 1X5AA 4NRXA 3DGCR 4OD2B 1HSBA 5C0RL 1JUFB 2B7DT 1SM3L 5T5FL 1JIBA 2NY6B 3B6SA 1L6ZA 1KIUA 4KJPD 1L9MA 3L7FA 2HMIC 4CMMB 4BFIB 3OPZH 2NLJA 4ONOA 5DEZA 3VXRB 3GMLA 5AZEL 4EDXB 3OGCA 3CVHA 2XQBH 5ALCL 5A2KH 5JW3L 4A2MA 1DANU 4LFHG 4MAYB 3X17A 3LS4L 3C6SA 4Y5YC 3D48R 4TSAL 5EBMA 3HC4L 3L3IB 1RUQL 4OF3A 1RIUL 1RUMH 1PG7W 2OR7A 3ES6B 5IROA 4NSKB 3IJSA 5I30L 4ORZC 1NMCB 1MF2L 4RGNC 4K7PY 1LO4H 1EO7A 2VZUA 4RGMC 2HT2C 2F58H 5SX5K 1LP9A 2AJVH 4HH8A 4K3DL 3MRQA 5FYJE 1JTOA 5EZJA 1CIUA 4ONHB 4JR9H 3LMJL 1XF3B 4S1DD 4Y5YA 5A3IC 4LSQL 3TZVB 5GJSL 4KGLA 3LIZH 3MXWH 5DK3A 4HIIA 4HUKB 2EH7L 5HGAA 3JWDC 5DMJB 1NBVL 2Z8VC 1MRFH 3BD4A 3F58L 4CVZB 4PRBA 4OI7A 3RWCA 1EO8L 3JTTA 3P9LA 2DQFB 4KKAD 4WWKD 3U7YL 3TNMA 3UPCA 3PWUB 1F00I 1G9NC 2IPKB 4J3XA 5JW4N 4J1UB 3HMXA 4QXGH 4JZOA 4OCMC 4F8TA 1CZ8H 1NAKL 1J1PH 4PRIE 4YE4L 2FX8L 2BC4A 4V1DE 1S78D 4Z95L 3SCMC 1EV2E 1LEKA 3KPPA 3QNXB 3FRPA 3QDGA 1U8QB 3MA9L 1BBJA 4P2RA 4QRQB 1NCUA 1CR9L 3QAZB 4OZIE 1T5XB 2MKWA 4YHKL 3QJHB 2AI0H 4HZLA 3DX9A 5IMKA 3ZTJG 4X7CC 2HRPL 5AYUL 1I8MA 3FT4A 3G9VA 3ARSA 4G9DB 2VDRL 4U1GC 4XAKD 1EXUA 1Q94A 1JZ6A 5C09D 4R90H 3WUWG 1HINL 3MLRH 4GKZA 1A4JA 3BKYL 5EIVA 4WI6A 1MJ7H 1AGBB 2HJFB 4LEXL 4KDVA 2WNGA 1MFNA 2VXSH 3LKSA 3JTSB 1X5HA 2V2XA 1BM3L 1CTOA 4XT1C 2F19L 3D0VB 2WQRA 3ORJA 1T89A 4ZS6D 4NRZA 1AGFB 1YEGL 5SWZA 1PW3A 5ADPH 5FEBA 4KAQL 5TGBA 4ZPTA 4OIAA 2XKUA 3MCLL 4JFFE 4BZ2H 2DLIA 4OFDA 4I0PD 5DYOA 3PHQA 2HG5A 4YC2C 2CLVB 1DQQB 4P2YA 5FO8B 2R0WH 1U92A 5GS1C 1ORSA 2F74B 1DLHA 2OMNA 3MA7B 4ODXA 2H1PH 1RZ7H 2NNAB 4GJTB 3U4EB 1S7UB 1WK0A 4LIQH 2MCPL 5J89A 5DSCB 3GI9L 4OFVA 4WIQA 1KFAH 4OLYH 5CJ5A 5JZ7D 3AMLA 3QPQC 2ICEA 1AC6A 5CJXA 1T2XA 4HIHB 3S8WA 4D0DB 4ODTH 2FO4B 4PREB 3NH7H 5L8KB 4W6XB 4JM2D 3G08A 3V9FA 4ZO7A 5IMLB 2BP3A 2E8YA 5D2LE 3S35L 3ARRA 4POYA 4UB0H 3FRUB 5F96L 1RK1B 3C5JA 3JV0A 1D5ZA 4PJ9B 5T1DL 1FAIH 1PLGH 1EJ6A 4UDTA 1DEEA 5GIRA 3EGSA 4LRNL 1HIMH 4MXVF 5EBLA 4WEBL 5MP6H 4HX1A 1DE4A 4U1HB 5CCKL 5EOTA 4FFYH 1CIDA 2HT4C 2Z91A 1XF5B 2NY6D 3QG7H 1BD2A 4FQLH 3WHXA 5DFVC 1SYVA 3BPOC 1R24B 4Z6AT 2QL1A 2MMXA 2KBGA 4NN7C 2PTTA 5E9DB 4AEIL 1X4ZA 3VXRD 4P5TA 1BF8A 1FQ9C 1JWMA 3SKJH 2J6EA 1YEFH 3AMKA 4X5WA 4JGUA 4KVCH 3QXDA 4MAYD 4X9FA 1A3RH 2H32A 3O9WC 4KZEL 1WC7A 4HPYL 3INUL 3IS0X 1NGPH 1WUNT 4ZO8A 4KPHH 5FO7A 3UJTL 5DJZB 1NLDL 5FGSA 4GAGL 4R3SB 4Y1AE 1A3LH 5ISZE 5K9OB 1WITA 3P4OA 1AGDA 2V5YA 4HIXH 3OKDB 3G5YA 5A1AA 5IUSA 4MGXA 2O61B 1MHHA 3QBTB 4PJIE 4F2MB 5K9JH 1B4RA 1ZTXH 1FV1B 3FB7A 1CL7L 1T1WA 4O4YL 3RL1A 3MV7A 3TZVD 2R0ZL 1CXFA 3BVNB 2C4FU 5IR1A 1I1FB 4WW1B 3RGHA 4JFDA 4XCYB 1EUTA 2EO9A 1GGBH 5D7IE 1MUJA 1FNFA 4X9GA 1EEZA 3VRJB 2L7UA 4PP2B 4GRWH 1GIGH 4JQIL 3KPQA 1WBXB 4NQED 4FQXA 1BQHB 4WI5A 4KI5E 1ADQL 4U6YB 4PLJC 1IM3B 3ARFA 2AV7A 4HUXA 4R4ND 1ED3A 1CE6A 4KJPC 5HI5D 5J4MA 4RIRB 1NPUA 3O6KL 1CICD 2P5EE 2UZYB 3BP7B 3KYKH 2D0GA 2DQJL 1S5IL 3VFTA 1KN2H 4JPVH 2AJXL 1FVEB 1NUGA 4WRLA 4XX1E 4G5ZH 5D93B 3MUHL 1OSPL 1Q72L 1FORL 2A77H 4UQ2B 5DRZA 5BOPA 3WLWD 5MEQA 5EN2B 1HE7A 3EYFB 2VLJE 3M8OL 3OX8B 1FL3A 5F3BA 1X6LA 4L4VD 3FONB 4X6CF 1KLFA 3FFCB 2APVA 3FTGB 3UTZA 4LCCB 5C0DA 5FKPB 1MCDA 4FTVB 4NPYA 4GRMA 3VXUB 2F5AH 1FPTL 1YEIH 3DSFL 4EI5B 4KY1H 5IFJA 4S1DC 5CJOH 3RWGA 1AXIB 5FB8A 3WMSA 3N1MC 4OQTH 2O26U 4JPWH 2OR9L 2VISA 3AS0A 1OM3H 5IVXE 1AGEA 1P69B 1I8IA 4TUOA 3PL6B 2P5WB 3JWDL 4BUHA 4HKBB 1YDPB 3DUSA 2D9CA 4RDQF 2B1AH 1U8NA 1ZHBA 2W92A 4KRNA 4B0MM 1JF6A 4LOUD 2BY2A 3BAEL 1FVCA 1MCPL 4KKAC 5T3ZE 4JN1H 4WWKC 4JPKL 5DJCB 1MCIA 1HOCB 4IHOB 3NMEA 1RJLB 4I3SH 3QCVH 4R4BA 4PGJA 3RTQC 3QUKA 3DX6A 4XGZA 1YJDC 1G9NL 5TE7L 1HI6B 3DURA 4QHLA 3S34H 3SO5A 3IDMB 4HV8B 2VQTA 1OWRM 3ARVA 2UUDH 4EI6B 4JKKA 4JM2F 2WBJC 4TULH 5H2BB 1S78C 3ZTJH 5CGYC 1NGWB 2XWJA 2YUWA 1GGTA 2R0LH 3FAWA 1OT2A 2BERA 1JI1A 4U7MA 1FNEA 1RZGB 5E70A 1MCBA 5F3HA 1R5IB 4Z7VE 4JRYD 2D7TH 2H6PB 1P1ZB 1JN6B 1QSEB 5EIIB 4RAVB 4NKIL 3DVFA 4PB9H 3U0PA 1EDQA 3DYOA 2VZOA 1Z5LB 2B2XL 2NY5H 5FIEA 2DI8A 1EVUA 1C08B 5EU3B 1HHJA 2NY3B 3DX8A 4PTUA 1JMZA 5IESH 2G2RA 4PJ9D 2JCCE 2Z31B 1W0VA 1VKXA 3S88L 2GTWA 2XN9B 1I3VA 3STLB 3LKPB 5DJYB 5FYLE 4ODBD 5IB1B 3G6JE 2H9GA 3MNWA 5HYJE 5HGGS 3BW9A 1N2RB 4ZFFA 3PP3K 3RVUD 4HAFA 4MQSB 1QPPA 3QCTH 4I0CC 1NFIA 2BOBA 4FXGB 5I66A 4Z0XA 1UB6B 5E9DD 3OJDA 2IH3B 4HUUA 5HPMA 1C1EH 4MAUL 2LTQC 4I0PC 1OAYL 5BRZB 4RFOL 1KENH 4DJMA 4M5YH 1HXYA 3V2AR 3ULUD 1ORQA 2HLAA 2P4AB 5I71B 5IGXH 1PSKH 4YX2L 1UVQB 3TCLB 2FJFB 5GRYA 2ADFL 3MLZH 3QQNA 1OVZA 4LLUB 4YHPA 4LBEB 1P2CA 3SKNA 4I3RL 4D0CA 4NFDA 1R5WA 1RMFH 3MTRA 1J86A 4I0PA 1L7IL 2PYEE 1A7QH 3QQ9D 4WFHE 5DQDH 3VJ6B 4BH8A 1RJYB 2ICWB 4JM2C 3ZYOA 5IKCA 3RX8A 5DT1L 2DQUH 3V5DB 1PX3A 2DI7A 3X12A 2ZJSL 2QQKL 4ZUUA 1CE1L 4ONFL 1A6WL 5D1ZC 1OAXL 3IDJB 3VXOA 3CX5K 3MBED 4U3HA 4UIKL 4M43L 1A6UH 3C08H 3UYOD 4GAYA 4PJFA 3IJYA 1S7VA 5DFTA 3OKNA 5KSAD 4WU7B 4Q74A 1CL7I 3MRCB 2ARWA 2NY6C 4HXAL 4XP5H 4Q6YA 1PG7L 2FH6A 3MLWL 4JDZB 4Y8DC 3VXMD 3AY4A 2BNUA 4YK4C 5IQ7L 1YN7A 4UMGA 4KKBC 4Y5XC 5JW4R 2FATH 4UT6H 2OP4H 4BZ1H 5GRUH 3GMMA 5ICYA 4ZODA 2EDJA 3SBWA 4N9OB 4PRHE 3U82B 1LE5A 2FIRT 4OD2A 5HHNB 1ZLSL 1JUFA 1YYMH 2R1XB 3O4OB 3MV01 2BXZA 4QRTB 1R3JB 4MNQE 5HHME 1VGKB 2GJJA 4PRIB 4AG4L 5CIPB 5I18L 4CMMA 3BIKB 3VXQB 4BFIA 1MHCB 4M9PA 2D7OA 4RMWA 1SMOA 3FFCD 1IAII 3VXRA 1QBMH 1UH4A 1G7LB 4EDXA 2BCKB 3KPMB 4PY8J 3P0YL 1N6QH 4FTVD 3RUGE 1S7WB 3QUML 4IJ3C 5KVMC 3GEWB 4MAYA 4WTXA 2OBGA 4XPGL 2M1KA 4M1GL 4GBXB 3TZVC 4PJCE 3L3IA 4RA0C 3WE6B 5F7WC 1RQ5A 3PGFL 3ES6A 3EJYD 5C07E 1N64H 4IRJD 4LMQE 3VI3E 4NSKA 3ZT5A 4FN0A 2NY7L 4BFEA 3PL6D 5AWNL 1GC1H 2E6JA 3QHFH 4D94A 4L5FH 4ZTPL 2GUOB 2MQ0A 3ROLB 1V7MH 1X3DA 2J88L 1XF3A 2FGWH 2XA8H 3TZVA 4EDWL 4KTEH 3MLUL 4R4NC 4AL8H 4LVHB 4N0FB 3MLSH 1HSAA 1TQBB 4EIZC 4BELD 3MLYH 1CICC 5TDNA 4K3JL 4CVZA 4YNYB 2DICA 5IHZB 3BKCH 2IC2A 5FYKH 4X6FB 3NFPB 4JFFB 2DQFA 3BGMB 4XP6H 2Z4QB 4G7VH 3UYRL 2C3HA 3PWUA 1S7QB 2DQIL 1VFAB 2IPKA 4P4RA 3WLWC 2IAMB 3NAAH 5FHBL 4ZFOL 3OAZH 4G6FB 1W8OA 1MQKL 3SGDI 3TF7C 2DJUA 2B1HH 5JO5B 1HHKB 1CFBA 4L8SC 4RBPH 3T09A 2VE6B 3KPOB 3ZLQC 2N7BA 5FUZH 3QNXA 2I9LB 4PBXA 2XZCL 1U8QA 3R0MA 4NUGH 2Y23A 4QRQA 4F7TB 1RD6A 4L4VA 4XHQA 2Z31D 2CKBH 4G8FB 5D2LB 1T5XA 4GMSH 3IVKA 3QJHA 4OM1H 3ULUF 2E7CA 5TQ0H 2NX5E 1KCKA 4IOIB 2D7QA 4Y16B 2CUIA 4KHXL 4G9DA 5KAQF 2FB4L 2Q3AA 5I1GL 3WKNA 3MRNB 3NGBB 2ZPKL 3S5LB 1AGBA 2HJFA 1I3RB 1OF2B 2N7AA 1BZ9B 5BRZD 3JTSA 1FZOB 1CGXA 3D0VA 1H3UA 4TTDD 1AGFA 1CD9B 1FFPB 1I1AB 2Z8SA 2XXCB 5IW1B 4YHZL 3PWVB 1JFQL 1GOFA 4DN3L 1Y0LA 4OM0L 4MYWB 3NA9L 4GRWF 3K0WA 4LU5L 3T2QA 2OZ4H 4LARH 1WTLA 1MH5B 3WNLA 2CLVA 5FFLA 1DQQA 4PJ8B 5FO8A 3AROA 4PRDB 2F74A 1YNKH 1PZ5B 3MA7A 4Y1AB 1C16B 5ISZB 3QWRA 5I1IH 1I7ZB 1X5YA 3BE1H 1ZT4B 5A2IH 2NNAA 1YYLL 3OG6B 4NO5B 3U4EA 1S7UA 4HZAA 2AV1A 4PJIB 3VG9B 1V7NH 1A22B 1NQBA 2VB5A 5DQJB 5DSCA 4S1SH 1WT5C 3O45B 3OB8A 2FR4B 3O2WL 4HIHA 4D0DA 2V7HB 2FO4A 4PREA 2DYPB 1SBBA 5D7IB 4TVPE 5IMLA 1WQVT 3QRGL 3RVUC 4XBEL 3N1QC 1ZSDB 1FLRL 4PJDE 1J1OL 1JZ4A 3J7HA 3FRUA 1RK1A 4BSJA 1SEQH 4LCIL 4PJ9A 3UTTB 2HKHL 4OF6A 1JGDA 1WT5A 1PJ9A 3B2UD 3VGAC 3JWOH 3MGAA 2AJYH 3ARYA 1E6JL 4U1HA 3ULUC 1QOKA 4PTTB 1XF5A 2D7NA 5KTEH 2MQCA 4UTAH 1A5FL 1TITA 4JVWA 2PR4L 1R24A 5E5MB 3V4UL 5E9DA 1U58B 1KACB 3LQMA 4O02L 1Q38A 5ADOL 4KRMB 3QQ9C 2F53E 4WI4A 2CRMA 4NUJB 1IGFL 4YHYB 3QEQE 1B2WH 4E5XB 1ZXQA 3ZKMC 3VI4E 1MREH 1CFNB 1GSMA 1XR8B 3IU4L 5B21A 5KJRL 3DO3A 4UTBL 3F7VB 1D9KB 1H8NA 4OGZA 5DJZA 4PJ7F 1JGUH 3OZ9L 2X2YA 4R3SA 5DA0B 4MCZB 3MBEC 5K9OA 3IU3B 4I4WB 3MR9B 5D71L 3OKDA 2O61A 4F2MA 5T1KD 5IFAH 4H88L 1G9EA 1FV1A 1BJ8A 4DQOH 5KSAC 5D9SB 5BMFH 4GS7C 3BVNA 4NN5B 1I1FA 1AKJB 4WW1A 1E4JA 2VKWA 4XCYA 3OPZL 2BDNH 4L8BB 1X4YA 2W9LA 3OXRB 3HZYB 1OP3H 4OGXH 4PP2A 3VDAA 4OCXL 5GZOD 2C1OB 1WBXA 4GQPH 1BQHA 3TP4A 1ZANL 4U6YA 4OCYH 1IM3A 4IOFD 5D93C 5TJWK 3U30B 4GXVH 4PJHE 5DEFB 4LAQH 1RUML 2P46B 2X05A 2IAMD 1QKZH 5C2BH 3MOQA 1EJOH 4KV5E 5TE6H 4RIRA 4G6FD 1NEUA 5J6HB 5JOEA 3N1PC 1LO4L 2RIKA 4CW1B 1NMAH 3BP7A 3WNKA 3V4VH 4P4KB 5TPWH 2F58L 2DJ4A 5JNYB 1CGSL 2AJVL 4JPIB 4AENB 5I15H 2IPTH 1FVEA 4JR9L 4Z7VB 3BGFC 1RU9H 3FMGH 4MDJB 1RULL 2VRAA 1EFXB 2FECI 5GGVL 1I9RH 3MXWL 4UQ2A 2VABB 2CDFB 1Y6MR 5EN2A 1ZGLP 3EYFA 4YLQT 3OX8A 3EJYC 4AEEA 4IRJC 1V3LA 4J8RB 3FONA 2R4RH 3NN8B 5HVHB 1MRFL 5E8EB 3FFCA 3FTGA 4K71B 4LCCA 5FKPA 4Z7WE 4FTVA 2JCCB 1QRND 3JZ7A 3KLAB 1TIUA 1GCFA 4U6TA 3NCYP 4P9HL 4PBVC 3RNQB 4Y16D 1F4AA 4EI5A 2WWKT 4QHKJ 5SWSD 5I0DA 2XKNB 1U8MB 4QXGL 3UTSE 3PL6A 2P5WA 3A6BL 4B53A 5F7YC 1HQ4B 1AJ7L 1KEMH 1YDPA 1CZ8L 2Y06H 3HZMB 3I50H 3O3EB 4MQXD 4YPGB 3ARDB 2XTLA 2E27L 4DW2H 1J12A 1T80A 2XTJE 1BQUA 1KCVL 2CH8A 1I1AD 4NWUH 5ANME 3OAUH 5D70L 5DJCA 4IHOA 5E6IB 4PRPE 5F9AC 1RJLA 4MB4A 4HULB 2EZ0D 4JCLA 4F7EB 1P4LB 4E0RB 1HI6A 3IDMA 1DBBL 5DC4B 1FSKB 4HV8A 3SE8H 4JO3H 2BK8A 1MCWW 1NCTA 5D4QA 4EI6A 2A9NH 3MBXH 5FYKU 3DARA 5IB4B 2NY5C 5H2BA 3DRQB 1IQWL 1NGWA 3W11D 2PYEB 4XNXL 4ZO9A 1CGVA 4R90L 3CFCH 4QEGA 5LKNA 5GRJH 2CIKB 5D7JC 1FRGH 1RZGA 1KCSH 2VXSL 2C3GA 1R5IA 3B9DA 5GJTH 3AAZB 25C8H 1K8DB 3EO9L 1A7NH 2GI7A 5HHOD 2H6PA 2DIJA 1P1ZA 2VN4A 5LBSH 1JN6A 1QSEA 5EIIA 4RAVA 2IQAB 5GGRB 1Z5LA 1WWBX 3W39B 5I0ZA 1C08A 5EU3A 2HP4A 3GMPB 4NZJA 3HPJB 3D69B 1J0YA 3CMGA 4OIIH 3UTTD 4BZ2L 1OTUD 2Z31A 3BJ91 4JM4L 2XN9A 3STLA 5C0CE 3ARXA 3CFKB 3LKPA 5DJYA 5IB1A 2R0WL 1B3JA 3A67L 5BCAA 1N2RA 4TTDC 2Q8AL 2IMMA 1RZ7L 5J11B 4PRHB 4LIQL 2H8PB 4NC1E 3GSNL 4FXGA 4QRSB 3D39B 4MHHG 1UB6A 4CUCA 1KFAL 2IH3A 5BRZA 4ODTL 1W72H 3NH7L 2DM2A 1ZA3B 1OARH 1UVQA 3TCLA 2FJFA 3F62A 4U31A 4F15B 3PNWB 2BHZA 3RUGB 1LO5B 2YD2A 4LBEA 5HSFA 4Q9RH 5MHSE 1Y18A 4P0DA 1SYSB 4PJCB 3I6LD 2OTPA 5ERWB 3UTPE 1LK3H 1HIML 3BEWB 2UUDK 3VJ6A 1RJYA 2ICWA 4Y2OA 4OSUL 1XGPB 1CVSC 4NOFA 5F7FA 3QG7L 1AKJD 3V5DA 2R1WB 4F37K 4K07A 4LSSH 4M00A 5L2KE 3KJ4B 4OF5A 3IDJA 3SKJL 1HDMB 4J3TA 1BMGA 3LH2H 4O2EB 2OSLB 1DLFH 1Q0XH 4KVCL 4Q9QH 1HILB 1K8IB 4GLRH 4R0LB 4GMTH 4WU7A 1EIBA 1CDCA 3MRCA 5BVPH 4NBXB 5EFIA 4OZ4B 4M6NL 2W07A 1KB5H 12E8L 1NGPL 4JDZA 2XXMB 1CLOL 2YC1B 4KPHL 1GYAA 3IB4A 3FZUC 3E1F1 1A14L 1ZLWH 3IDGB 4FQQB 2ZSVB 4BQ9A 4UNTA 2R1YB 3WDHA 4P4KD 5F1NB 1N0XH 4YBHA 1DZBA 3SE4A 1RK0B 1UKQA 5K9JL 1ZTXL 3OB0H 4J2XA 5HHNA 3GJFH 4DGIH 2R1XA 1EFXD 5EOQH 4QRTA 1R3JA 4LHJB 2C4XA 3O8XB 1VGKA 4DVRH 4PRIA 5CIPA 3CNKA 3S4SG 5BW7C 4NDMB 1GC1C 3BIKA 4HW6A 3VXQA 5T5NG 1MHCA 5TQ2H 2LU4A 1OAUL 1H15B 1W8NA 4G6MH 1J8HB 3RWIB 3B5TA 1G7LA 4P3CH 4S0TD 2BCKA 2D4FA 3KPMA 4HUVB 4KROC 1S7WA 1H3PH 1ZV5A 3HLAB 3NA4A 3D6GA 4F9LA 3JV4B 4GBXA 3WE6A 4ZFGH 4OLZL 3MV9B 4JREC 4N0YH 5BW7A 3GSOB 5B39G 1O7SA 3KYKL 1TJIH 4FA8A 3VH8B 2GUOA 4LPCA 3ROLA 4IOFC 1RVFH 2A77L 2AK4E 4FFZL 1VB9A 4LSRH 3Q5OA 4JG0H 2FBOJ 4N0FA 4YDKL 3T65B 1D5XB 4BSVB 1A02N 1AE6H 2Y5TB 4KK6D 5F9DC 1KLUB 1REIA 1OOAA 4G8GB 5IHZA 4M6AA 1JK8B 2F5AL 4X6FA 2ZNXA 3DXAE 3D3VB 3NFPA 1YEIL 4JFFA 3BGMA 4KY1L 1Y6KR 2Z4QA 3MJ8B 5CJOL 3V8OA 1F3DJ 2IANE 3B3IA 3BWAA 4OQTL 2QR0B 1S7QA 2J8OA 1VFAA 3KWWB 1MAML 1CDHA 2IAMA 1OM3L 3G9AB 5GRZA 3CDYA 4HT1H 4B7IA 3RL2B 1YY9C 2KQMA 3VMPA 2ARJQ 4XXCA 5JO5A 2EICA 1CTNA 1HHKA 4WO4D 4JN1L 2VE6A 3KPOA 1CD0A 4X8JB 4Y16C 4I3SL 5CP7B 2QV2A 2I9LA 2Z92B 4U1MB 4HLZG 3NGBC 2DDQL 3S34L 1PKQE 5HJ3B 4F7TA 2NMSA 3PWPE 5HVWA 4G8FA 5D2LA 4PJDB 1GRWA 4MQXC 1KEGH 4XP4H 2G75B 5EUOB 3GSWB 3P4NB 2R0LL 1JZ5A 2VWEE 4Z7UF 1I1AC 4IOIA 4Y16A 1W0WB 4DGVL 5IIEB 4WV1B 2FWOB 1F4WH 3D39D 2IPUG 2EZ0C 3ETBF 5SWSA 3MRNA 1G0XA 4G80B 3S5LA 3IETB 1I3RA 3GSXA 5DURB 3OXSB 1OF2A 1ROWA 4LRIA 2AXFB 4P46C 4D9LH 4JHAH 1FZOA 4LGRB 3ALWA 3ZKNC 4C59B 3FB5B 3HNSH 4KHTL 1P4BL 1FFPA 1I1AA 2ADJB 2NY5L 4FQCH 4RAHA 3W11C 5IW1A 3PWVA 4NC2B 3PG2A 2BJML 1L9NA 4QT5B 5ENWB 4BM7A 3LS5H 3BXNB 3T3ME 1CLZH 1YEEH 3DUHA 3N0PB 3MXVH 2R0KH 3IT8D 1AXSB 3MMEB 1MH5A 1OGTB 4PJ8A 1X5JA 4POUB 2D7MA 4FP8H 3OF6D 1MJUL 2W0FB 1PZ5A 3RX7A 1C16A 5ISZA 1I7ZA 4FZ8H 1HQRB 1ZT4A 5DUPL 4NO5A 2VL4A 4PJIA 1OP9A 4CDGC 3N9GH 5DQJA 1OCWL 4C58B 3JWOC 3OAZK 2LAAA 1IAIM 3O45A 4MJ4A 1WZMA 1KENL 2FR4A 2AJSH 4LPXA 1JHTA 3T3PE 4CN6A 2V7HA 1AD0B 5DD1H 2DYPA 3UPRB 5D7IA 3DOSA 3QH3B 4RBPK 1Z9OA 3MLZL 5HDLA 4HJJH 1ZSDA 2X9XA 4GW4A 1INEH 5F1KC 4PLKD 3U36B 1A6PA 2HJLB 1AP2B 3NIGF 3UTTA 3IRZA 2XRAL 4GRLD 1PVHA 2KDGA 5DQDL 2CRZA 4OKVB 3G5VB 5F44A 3L3KB 1MNUL 3MJ6A 4GG6E 5GGUB 4PTTA 1R3KB 2EKSB 1JYNA 4JFQB 1AO7B 5I16B 3VXSD 5D96C 4OTXL 1DEDA 5E5MA 8CGTA 5DLML 1TJHL 1U58A 1FCCA 1A6UL 1J8HD 1NJ9B 4KKNA 4H0HB 1D6EB 4EJ1C 5F7KC 3CC5B 4JRXE 2VLRB 4NUJA 1RIVL 4O58H 6CGTA 4E5XA 1X4XA 3GIZL 1CFNA 1XR8A 4XP5L 3U0WH 4J3OC 4M7KH 2JB5H 3MV9D 4NN5C 4Z7WB 4HJ0C 3CSBA 2C3VB 3F7VA 3F7PC 1D9KA 3CSYB 2FATL 1A7OH 3VDCA 4MCZA 4I4WA 4Y5VB 3MR9A 3LQAL 2JK5B 3KG5A 2CQVA 1F90H 3X14B 1YMME 5HHPB 4F58H 4YQXL 4OIBA 5E0QA 1AKJA 2RGSA 1MHPH 5CINH 1DUYB 5KN5B 2EDBA 2Z8WC 4L8BA 4XNMB 5ANMB 4K3EL 3D0LB 4DVBB 3W9DB 4PRPB 2OI9C 3O81A 4OLXH 1QYGL 3OXRA 3HZYA 3JVGA 4P4KC 4LDLB 4G8GD 3NCMA 4L1HA 3KDMB 2C1OA 3BDBA 3D3VD 4L3CB 2VXVL 3NCJH 4WHCA 5DEFA 5B39B 3MRRB 4AEFA 5GGTL 1N64L 1QPXA 3WFCH 4AMKL 5HVHC 5J6HA 3FHQA 1Z3GH 4CW1A 2DTSA 5HGBB 3V52H 4P4KA 5JNYA 1CDUA 3GKWH 4JPIA 4AENA 4Z7VA 4MDJA 3ZE0F 2FGWL 5CILH 1MCQA 5FAAA 1EFXA 4XH2B 4AL8L 2VABA 4HCRH 2CDFA 1F6AB 5EU6D 1KIPB 4HJGB 5DMYA 4KGJA 3SQOL 3I85A 1SBSH 4J8RA 3NN8A 5CS7A 3MLYL 5E8EA 5E99L 3LHPL 1IEBB 2W0PA 4LK4A 4JRWA 4W4OC 3BKCL 3MLPA 4ZG1A 2QLVB 5FYKL 1VADB 4CU7A 2JCCA 4XP6L 4C56D 3KLAA 4G7VL 4KJWD 1X6NA 4PLOB 3RNQA 3IFLH 5E4EC 3U9UB 1KJ2B 1Q9KB 3CGTA 2XKNA 1ZA6B 3G6AB 1U8MA 4ZUWB 3RX5A 5CMAB 5DR5H 1G7MB 1HQ4A 5C3LD 3HZMA 4KK6C 1QFOA 2YPVL 5I1HL 3O3EA 2W65B 3LSOB 1T7YA 4YPGA 1K3IA 3ARDA 3SDCB 5C7XH 2A38A 2UWEE 5E7FA 4LL9A 4DN4H 3WYRA 4HFWB 5FUZL 3R1GH 4GG8B 1N5AB 5E6IA 5DC9B 3W2DH 4QRRE 2WINB 4NUGL 4GXUM 4HLZH 1I8KB 4F7EA 1P4LA 4E0RA 4DGYH 3CFBB 3MV8E 3SGEH 4GMSL 2FBJH 3S3PA 4HQQH 3UBXB 3N50A 3GO1H 5TQ0L 5IB4A 5I2IB 3TIEB 1P5VA 4WO4C 5ELIA 3DRQA 3T0DA 2IQ9H 2YBRB 2PYEA 4JZNB 3EIFA 2Q76B 5DJXB 3K2UL 5DJ8A 2CIKA 2VDLH 1JNJA 4PJEE 5IW6A 4JAMB 1D5IH 2IF7A 1UWXH 3AAZA 1K8DA 3C8KB 4NNPH 5FA3B 1F2QA 3LEVH 4YBLC 5L2KB 2NXZD 4NKOB 4I18B 1NCWL 2IQAA 4GQ9L 5GGRA 2CXGA 4GAJH 1UWEH 3W39A 1RHFA 1T1ZB 4KU1A 3GMPA 3HPJA 3D69A 3TWCH 1GGIL 3VRLF 3O2VL 4KMLB 2OZ4L 4U1NB 4ALAL 4LARL 3AGVA 3CMOL 3CFKA 4UT7L 1YNKL 5F6HI 1F4XH 2YD3A 1HHGB 3BZEB 3BE1L 1L7TL 4XX1G 4PRHA 1DL7H 1AO7D 1SJXA 2H8PA 4MQ7B 1V7NL 2BXYA 4QRSA 3D39A 3I6KB 4M48H 1QBAA 4FQ2H 1MLCB 2AXJA 4S1SL 5D7LE 1XFPA 1KELH 1F02I 4JG1H 2A6JB 2QQLH 4E41E 1FYHB 2B20A 1S9XB 5CKGA 2XV6B 3BSZL 5I1AB 1IAOB 2VLRD 1ZA3A 4C4KT 3ZKXB 4BQCA 3U0TB 4GFTB 4JO2L 1UZ6F 2VLMD 4TRPH 3PNWA 3MJ9A 3RUGA 5E03A 1LO5A 5JQHC 4X98B 4P2QE 1SEQL 3TN0B 3J8F7 2YSSB 2Z8RA 1FNSH 2H45A 4ZOCA 1SYSA 1M6OB 4PJCA 3VG0L 3B5HA 1A64A 1DBJL 5ERWA 3BEWA 2DLGA 1KC5H 4WW2B 4Y88A 5KVDL 3OF6A 4R0LC 4PJ5B 5I1DB 1XGPA 5KTEL 1H8SA 3VD3A 3ISWA 2B5IC 3PQYB 3SDYH 1XF2B 1U36A 4UTAL 4PGCA 1WV7T 4RZCB 2R1WA 5C70A 1JBJA 3BOVA 2DD8H 3WIIH 4MD5B 4PLKC 4UINH 1U6AH 4U0RB 5ILTH 4Y4KD 4NGHL 3S35X 1HDMA 1IC5H 4O2EA 3Q6FB 4GRLC 4ZS7H 2OSLA 1YQVL 1HILA 1K8IA 1B2WL 3VGGA 1J87A 1MREL 2Y1VA 4PJAB 4N0CD 3MQIA 4R0LA 2XYCA 5GGVY 1FIGH 5GRVK 4OT1H 1KPVB 4OZ4A 3E3QE 3DXAB 2YC1A 4JY6B 1UQSB 4CNIB 2QQNH 3IDGA 4HXBL 1B6UA 4FQQA 5IHUL 4Y2DB 2ZSVA 1Z9LA 5MEPB 2R1YA 5F1NA 4R7DB 4GRLA 5EUOF 4E9LA 1RK0A 5IFAL 3NTCL 5IB3B 1AIFB 4IRSB 4LPWA 3F5WB 1GL4B 4DKFH 2MFNA 3O8XA 3QUZB 3ZE1F 2BDNL 1NC2B 2PYFB 1H15A 4HF5L 3L5XH 5C0JB 5AZ2H 4IMLB 5E2WH 1J8HA 3RWIA 4WFEE 5CZKA 3B2VL 5J56B 4HUVA 2HFGH 4Q6IB 4M62H 4BH7B 2ZUYA 5DD0H 3HNVL 3ELAT 1XGRB 3OKYA 2XY1A 3TBSB 4FHBD 1QFPA 3HLAA 4P57B 1TZGL 1WZ1H 2OM5A 3JV4A 4N90D 1QRKA 4E42B 3MV9A 5C2BL 1EJOL 2YK1H 4XC1H 3RDTD 2CKNA 2ZUWA 2YZ1A 2BNQE 2ITDB 4V2BA 3GSOA 3NIFE 3RKDD 4RGNE 1NMAL 3FQWB 2XY2A 4G7YH 1JPGB 3VFOB 4XPFH 1E4KA 4GH7B 1UGNA 3V4VL 1RUPL 2JLLA 4HWNA 3QJFB 3WXWH 2IPTL 2J7LA 1A1NB 1TLKA 3VH8A 1RU9L 3GM8A 3KHOA 1QBLL 3UDWC 3TBTB 2DJSA 1I9RL 1NAMH 1A21A 1CK0L 5FHAH 1AR2A 1IMHC 2ZUXA 3QO1B 3T65A 3GHBL 1T2JA 5IWLA 4J4PD 2N56A 2Y5TA 3BP5B 1BJ1J 1A7PH 5L6YH 1KLUA 3IKKA 3VXPB 1NFDF 3UZVB 4G8GA 1LDPL 4U49A 4U0QB 1JK8A 3D3VA 5E8DH 3MJ8A 1E28B 1U8JB 3UDWA 3QDGE 5HI3D 2QR0A 3UX9B 4A6YH 1RUKL 4EN3B 3SJVE 3KPRD 1KEML 4DWHA 3D5OF 2Y06L 2W0KA 3RL2A 1G6RH 2WSKA 5IBLD 3GJFK 3OAUL 4KJWC 4UILL 3VWKB 4WENB 5TF1H 5CP7A 4OD3H 4XC3H 5I8EB 1D5MB 4X4YB 4WV1C 1BPVA 1RJCA 3THMH 4WTWA 2Z92A 4NO0B 1MCRA 4U1MA 1AI1H 2NZ9D 5HJ3A 1ZK9A 3SE8L 4JO3L 4WFGD 3P0VH 4PJDA 2A9NL 2XQYG 1ACYL 4NM8H 2G75A 5DGQA 5EUOA 2VZSA 3GSWA 3P4NA 3QXWA 4X80H 3BP6B 5LQBL 1QFHA 1DDHB 5IM7B 1YZZA 1I7UB 1NDMB 1W0WA 2BVEA 3CFCL 2EIZB 2FWOA 4WV1A 5IIEA 2O5ZL 4L9LB 3QFJB 4M7LH 4GG6B 1FRGL 5EWIH 4G80A 1KCSL 3IETA 3L1OH 1JGVH 5ITFB 3OXSA 4KC3B 25C8L 4OD1H 4M7ZB 1A7NL 2AXFA 4PJGB 5JXED 4OFIA 2JF1A 1LQSR 1BFVL 5JQ6H 4LPVA 5DZOA 3QIWB 2BVYA 5T5NF 5GRVL 2ADJA 3WDIA 4YHOH 3CZFB 1WAAF 4WDIB 1JNLL 5HYSB 1NCAH 4QT5A 3TN0D 1SM3H 5ENWA 4OIIL 2Y25A 3TO4D 3BXNA 3FOMB 2VLLB 3M1BA 4L3EE 1JP5A 1AXSA 3MMEA 1X5XA 2AAVA 1OGTA 1M7IB 3MC0A 3S6CA 4ZMAT 2NXZC 4BFBD 2W0FA 4PJ5D 2F5BH 3SDAD 1MIEH 5AZEH 1HQRA 3W0WE 3PQYD 1JHKH 3IFPB 4I9WE 3OKEB 3BZFB 3WKMH 5CLTA 3QXAB 1F97A 1YMMB 3LS4H 4TSAH 3HC4H 1QFUH 1RUQH 3BMWA 4NCDA 3LEXB 5EZIH 2EE9A 1W72L 1G7IB 1A1MB 4KDTC 3W5MA 1AD0A 5I30H 3UPRA 3QH3A 1OARL 3TM6A 1MFDL 3GHEH 5T33