4LSRH

Crystal structure of broadly and potently neutralizing antibody vrc-ch31 in complex with hiv-1 clade a/e stran 93th057 gp120 with loop d and loop v5 from clade a strain ker_2018_11
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
231
structure length
217
Chain Sequence
QVQLVQSGAAVRKPGASVTVSCKFAEDDDAPEHFIHFLRQAPGQQLEWLAWMNPTNGAVNYAWYLNGRVTATRDRSMTTAFLEVKSLRSDDTAVYYCARAQKRGRSEWAYAHWGQGTPVVVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords ENVELOPE GLYCOPROTEIN GP120 WITH LOOP D AND V5 FROM STRAIN k
publication title Multidonor Analysis Reveals Structural Elements, Genetic Determinants, and Maturation Pathway for HIV-1 Neutralization by VRC01-Class Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 43
structure length 217
sequence length 231
ec nomenclature
pdb deposition date 2013-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lsrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lsrH01
1A9EB 5D71H 4FFZH 3GI9L 2NY3B 2YZ1A 2V2WB 3CSBA 5B38B 1XFPA 2DMCA 1VKXB 4KXZH 3OR6A 1KJVA 2W9DL 1FGVL 4FNLH 3JWDL 2HJFA 3ES6B 1MFAL 5ESQA 4KRNA 3CXDH 3CLFL 2C3GA 4U6VL 4HHAA 5HDBF 3O4LA 5CWSB 5ISZD 3S9DB 5GRUH 4N0YH 3JTTA 3O11A 1EDQA 4BFEA 3B2VL 3UTZA 4ISVA 4UBDC 3VCLA 4JRXA 1GGTA 4MD5B 1X5AA 2H3NB 4D3CL 3DBXA 4EJ1C 2OJEB 3F8UB 5CD5D 5JMOC 3IS0X 3GO1H 4AJ0A 3BPNB 1G6RB 1RUQH 2YD4A 4JO1L 2OLDA 1JK8B 4KKCD 1AGCA 1EEYA 2JCCE 4WFHE 1MFNA 1PSKH 4L4JA 1R5VA 3WXVL 4KKBC 2UWEE 1G6RH 3GBMH 3QO0B 3D39B 4L8DB 2BNQA 5DYOB 2A0LD 5L6YL 1N5YL 2NW2B 5TQ0L 4P23A 2R56H 4HSQA 2E27L 1HILA 5CBEA 3QFDA 4YH6A 4FXGB 3FO2B 3IDMA 3GHEH 2CUIA 1HKLL 1SJVA 5CKGA 4B0MM 4KDTC 1KXVC 4ZSOA 4OQTA 1IC7L 1H9VA 5C9KA 4JDTH 5H94B 2DYPD 4DN4H 1BQSA 4IRSA 4X6DA 5DUBB 2A9ML 3MLXL 4X6FB 4AEFA 4IMLA 4BJLA 5JHDE 4QXGH 5C0BB 1DBJL 1IM3A 2ID5A 3TJHD 5F7LB 1NC4D 3TLRA 4NT6B 3EHBC 1OP5H 3WEXB 1P69B 2Z91A 1ZV5A 1G7MA 3WFDH 2FSEB 3IFOB 3IDJB 5L8JB 1PKQB 4GAYA 1F02I 1MPAL 3B3IA 5IHZA 4JREB 2O26U 4G9FD 3ROLA 4NRYA 4N0FB 3HE6A 2LVCA 3K80A 2YN3A 3UCRA 1CLZL 3AY4C 3KYAA 5IJVB 2N1KA 1L0QA 2CSPA 2KZWA 1CGSL 3QFJA 3QNZA 1LILA 2IF7A 2NY4C 2WV3A 1ZA6B 4X4YA 1NGYA 4H88H 3TC9A 2CK0L 1QEWB 1G0YR 4YXLL 2XIDA 4OKVB 5CSZA 3MACH 4Z7WB 1IZJA 5KTEL 1BEYH 4XH2B 3QXUA 4NQXB 3SE4A 1TZIB 4OZGB 4MYWB 1QKZH 3PGFL 4LSTH 2R23A 4XPAL 4OFKA 3VRLE 1ITCA 4PS4L 3V6FA 3NH7L 3W11C 3DXAB 3NFNB 1IC5H 3ZT7A 2ZZUT 4EI5A 4PJFB 3QCTH 1BVZA 4WW2F 4H20H 2VDKL 3QIBC 1MFEL 3FN0L 4HS6B 5TQ2H 4JN1L 5I30L 2FJFA 3JV0A 4HV8B 4MZ2A 3GDBA 1Q9WB 3QUXC 4JQXC 4XPTH 1CFSB 5CUSL 3QQ9C 3E8UL 3PHOB 7CGTA 4HGKC 2R0WH 4MA7H 1J8HE 2NY4B 5I74C 1A7PH 4NWTL 5D9SB 1TETL 2N4IA 3HAEG 5HHXL 1PZ5B 1BVKA 4KROC 3QEUA 5M95B 1BZQK 3IKCB 5I1DB 2DM4A 2D4FA 15C8L 4Z7OF 5DD0L 1TTUA 3BUYA 4XZUA 4TUJB 2I24N 3EKCA 3FQTB 3V4UH 5C0EB 4LGPB 1YEHH 3TCLB 3MV11 4K3DL 4KK8D 4HUUA 1WITA 2X4NB 4NKMA 1T2XA 4M7ZC 4X9GA 1K3ZA 4KAQL 1JGEA 3UTTA 1TNMA 2R0ZH 3GI9H 2O93L 1HHKB 4JJHA 1ORSA 1G7JB 4B53A 4LEOB 5D5MB 3VXQB 4D0DA 1FGVH 5TF1L 3L3DA 1FHGA 2VISA 4XCEB 1G7PB 2EZ0D 2GY5A 1B6DA 1LNUB 2PXYD 3QIBB 1FL5A 2HFGL 4LLUA 2QR0A 1AI1H 5F1KC 4TNVK 1T2QL 4U6VH 3RY4A 1T20B 3PGCA 5CP3H 4NKOB 5GS0D 4XC3H 3PABA 1ZHBB 2F9BT 2JB5L 3DHMA 5I74B 3HI1A 5FUZL 2HKHL 1DQLL 3B2VH 1V5JA 3VI4E 1NLBL 4PTTB 4D3CH 5C09D 3C6LD 3SKOB 2YD2A 4LQ1A 5I1KL 4QOKE 1YJDL 1WJ3A 2H32B 3O6FC 1S9VB 3BWAB 5C07A 4JO1H 2ADJA 2HT4C 4JVWA 4NYLB 2OMNA 3CIQA 2VXVL 4M7ZB 3QQNA 2IPTH 4O2FA 3FB5B 5FK9A 5ITBL 1LP9E 3RZCB 1MWAB 4HCRL 1WWBX 4JCMA 2Z35A 2ZG3A 3TFKC 1NGPL 3AFLA 1CFTA 3IAPA 5T1MB 1ZLVK 3ILQC 2EXYD 5E2JA 1IJ9A 4KKLC 2OI9C 1CE1H 3EOBA 3IFPA 3D69B 5TQ0H 2FEDC 3VGHA 3I3EA 3O41B 2E27H 5EU5B 3CVHL 1UKTA 2VLRD 4JHAL 4C58B 3V7AG 4GKZB 1HKLH 3ME0A 1BQLH 1ZLWH 4F7EA 4X6CA 1IC7H 2FNBA 2HVKA 1GSMA 3N50A 3JV6B 3QDME 3LD8C 3MLXH 4N90E 2KL6A 4BUGA 1DBJH 4Z5RA 1RJZA 4U3XA 5B4MD 2YXFA 1MSPA 5ADOH 4LMQI 5F3HA 4O2CA 4LVHC 3O6FB 5T1DL 3ZKMC 3Q5TA 1MPAH 3OMZA 1S7UA 4X6BB 4MLIA 4TSBL 5AUMA 3C08L 4YX2L 4FXKB 5HPMA 3AM8C 3QH3A 4JDZB 4R0LA 1KPRA 2GITA 4E41E 2OI9B 5MENA 2DQCL 2FJHB 3HZKA 3NFPB 1DN0B 1B88A 3WS6C 1CGSH 1JWSA 2GSIA 1E28A 3MV7E 5F93C 4N8VG 4W6XB 2NX5D 1E6OL 5J1SC 5IG7A 3HLAA 4PRIA 2CK0H 1IL1A 3B9VA 1QBML 2JB6B 1RZIA 3H3BC 4MQTB 3OHXA 3DUHA 1YPZB 5KTEH 5TGBB 3V9FA 1AR1D 3LD8B 2CJUL 5DQJA 4ZUSA 1ZVYA 1GXEA 4WWKC 2I27N 3PGFH 4P2OA 3FOMA 5EUOA 3MJ9A 5KSAD 1L0YA 4PS4H 4LVHB 3CH8A 1D5IL 1S78C 3G08B 2ADFH 3I50L 1SMAA 3K4DA 3RX8A 3BRFA 4NHCL 4NO0D 3SDYL 1K9TA 2KKQA 3RTQC 2CIKA 4O58L 3W0WA 1CS6A 5ANMB 5HY9A 2VDKH 5DR5L 5FECB 1CFNA 5JIIA 1MFEH 5I30H 4JN1H 1ZT1B 1WBYA 2GEEA 3MLPA 2XTJC 1ZXQA 5IMKB 5ICZA 3UTSD 3LKQA 1OWRM 4LAQH 1TETH 1MVUA 5DD3L 4OLEA 5HHXH 1SYSB 1YUHB 5J4MA 5TE7L 3I6GA 3DURB 1BJ1H 15C8H 5DD0H 1QPXA 3IDNA 1IVLA 1ROWA 4KZDL 1F45A 3MR9B 1A4KA 3HNVL 1LDSA 4KJYA 3K8MA 4UTBH 1I9EA 3REVA 3RVTD 3BP7B 4PLJD 4U0RC 4PJCE 4JN2A 3LKOA 3THMH 3O4OC 4PUBL 2APWA 4FQIL 1XGYH 5L9DH 4RAUB 2PYFA 2DIAA 3RTQB 5EO9A 2ESVA 4PJDE 12E8L 2HFGH 5EPMB 1AY1L 4Z7NE 1T2QH 1AJ7L 5MEQB 1MIEL 4FQ2H 4PLKD 2CXKA 5JW3H 2XTJB 1G7IA 1QRNB 1U6AL 5CEXB 3MCG1 4W4OC 1A2YB 5I8OL 2HKHH 5EA0L 3VDBA 2IAND 1JPGB 1MLBB 1S7TB 1NLBH 5F96L 1PBYA 3MA9H 3KPSD 3OGCA 2Z93B 4WVRA 1QSFB 1RJLB 2E9JA 4R7NA 1QLEH 1KB9K 4CNIB 3L95A 3BH9A 2P45B 4JANB 1MFCL 1Q9LA 2AAVA 5IVZA 2FWOB 4LLQB 2VXVH 3ARGD 4LSRL 5I73B 2FL5B 4L4TE 5ITBH 3GSUA 2J1KA 4U0RB 3IU4L 4J3TA 5IUSA 4QCIA 3O4OB 5JHLL 3ZDYE 4I4WA 3LKRA 1QVOB 4G43A 3VXTA 3HG1E 4WDIB 4ZAKD 1BWMA 3CVHH 4PJ8C 2R0KL 5DEGA 2SEBB 1MCRA 1DQML 4JHAH 4PJXB 2ICEA 4H1LB 1VFBA 2ADIB 1G1CA 2H2PC 1U3HD 32C2B 4S1RL 1FYHB 2EDDA 2CDEB 2FLRT 1CDCA 2J8UE 1QACA 3LSOA 2F74A 4P5TC 4KKAD 1VGEL 3IFLL 5JIPA 1S9KC 3FONA 1HKFA 4MS8C 2BVQB 1ZE3C 2QHRH 3ZKND 3SDCD 3D87B 4DN3L 4XP4L 3MLTA 2P8MA 3SY0B 1F6FB 5D7SL 5JDJA 1EXUB 1EEUA 3UYPA 2DTSA 4LHUD 5T1DH 3D3VB 4MMZC 1TIUA 5E0QA 3C5ZC 2C3VA 4XCCH 4HUXA 3PHSA 3HPLB 4TSBH 3C08H 3IJHB 3I6KA 3MRRA 4JFQB 1U92B 5A2IH 2P4AB 4YDLB 1I1AD 2YD7A 2XYCA 1XGUA 3QISA 1IQDA 2HFEB 4XGZB 3G5YB 3TYGL 2D7NA 2DQCH 2IPKA 4M5YL 2VE6A 3HR5B 3P4MB 4PJ8B 5J8OA 5HGGS 1UYWL 2YPLD 5E24E 1BD2D 1Q9KA 2ICES 3BZ4A 3DPBA 2DI9A 1IEAB 5JLZA 1FL3B 2P48B 3VDAA 4S1SL 1LE9B 1J18A 2NY1C 5ID0A 1WCBA 3HAEA 2VUYA 2DBLH 3B2UD 4HWNA 2D0FA 4NQDD 5ICYB 4UNVA 2GKIA 2NW3A 5K9QG 1C7SA 4FOMA 1MFBH 3V0AC 4K94L 1U8QB 3MRBB 2ZCLL 3HPJB 4GKSB 5B22A 4AQOA 1D5IH 3TBWA 4JKWA 5HI4D 5D1ZD 3I50H 1YMMB 4NHCH 1DLHB 1M6OA 4PTUA 3C5ZB 3SDYH 3KGRA 1CICB 4NO2B 5F7DA 4O58H 4YAQB 3K8LA 4P3DA 1P84J 4AMKL 4LSVL 2WP3O 2E9WA 5L2KA 2OSLB 2VDRL 1T0NA 4U1JA 2G2RB 1MCOL 3PWJA 1F3JB 4KKNA 5KW9L 4BQ8A 3ARYA 3NABL 4F7MB 4PJHE 1RPQA 5TE7H 1ZHKA 1LD9A 2UY6A 2FIRT 4Q9RL 4KZDH 2NY1B 4DEPC 4XMPL 5C09E 5ECJE 4YHNB 1QFUL 5JNYB 1J0HA 3HNVH 5C08B 4NNYA 2X1OA 1DE4A 4ZDHB 3TO2A 2BVYA 4GG6A 1VESA 1J7VR 3QUZC 3QAZC 3ECBA 3CFEA 1FLRH 3D2UB 4PUBH 3R06B 3IU3B 1IAMA 1OOAA 5FYJU 2EYSB 4RA0C 4QRRB 1CGVA 1JZ7A 1EUTA 3MLVL 4XNQB 1NAMA 5J3HD 4OZIB 4ODUB 12E8H 1HIML 2DMKA 3EFFA 1AY1H 4L9LC 3T1FA 3UZVB 4BSVB 2VLRE 1R3JB 2FIKA 4NQUA 4DQOL 1ORQA 1MIEH 3BVNB 1OF2B 3G6JB 4G6JH 4KI1A 1U6AH 4HS8H 4MDIB 5KSUB 3T0EB 2XI9A 3WLWC 5I8OH 1YEIH 5EA0H 3PWVB 3L7FA 3O6LL 5F96H 5EZIL 5D1QD 1V3MA 5CFHA 4Z9KB 4LKCA 1NUNB 3Q1SL 4LLWB 5FEBA 4K3JL 2I9LA 2X4RB 3V5DA 1H5BA 1MFCH 2IH3B 2PCPB 2K7QA 4LSRH 3PWUA 1KJ2B 2XQBL 5BS0D 2D9QB 2XICA 3MRCA 4J3VA 3QZWA 3QUZB 4N1EA 2F53E 4XI5C 3EYUL 1OQOA 2IJ0C 3ARBD 4OLUL 4S0TD 5I2IA 2CRYA 5CEYB 1KN4L 1XIWC 5IB3B 5JHLH 4PJGA 1K85A 1I9JL 3BQUC 4OZ4A 2H26A 5T1KA 3GMLB 1KJ2H 4GH7B 4WUUA 2R0KH 1DQMH 2EDRA 4D9QE 3BZFA 4RX4A 3VFMB 1KF9B 4L9LB 4MB5A 3X13B 3RWEB 4L8BB 3GKWH 2NX5E 1EMTH 5E4EC 2WBJB 2CLVB 1VGEH 2B8OT 3SGEH 2W0FB 5IB1B 3ZDZF 4GRWB 4CVXA 4Q6IC 4M1CD 2I60L 4P2QD 3DX8B 3MRNA 4DN3H 4XP4H 2HYMA 3RJQB 1B0RB 3EFDH 5D7SH 2IC2A 2AERT 2VMFA 4GRWH 5GGSB 3UJIL 4J2XA 2CUHA 4S1DD 3IJSB 1VSCA 4PJEF 3TH2T 4FMFA 1DP0A 4XVUD 4YK4C 5B38G 4Y1AA 4V1DD 1S5IH 4YFEA 4HIHA 4JE4B 4OCYH 1XIWB 3MX0A 4X7CC 3BQUB 1FV1B 1UGNA 3B5GA 3TYGH 2F54B 4KU1A 4PGBB 1D5MA 2Q7YA 1QNZH 4NZRL 4UILH 5DMGD 1TJHL 1UZ6F 2FBOJ 4EBQL 4XP9L 2JLLA 5I66A 1UYWH 3V79C 3VXPA 1NGXB 4L9DA 4LPCA 5F1SA 3UTSE 5DJCB 3S5LA 1CR9L 4U4BA 2OR7A 1C08A 1HHHB 4PRPE 2EO1A 5JOPD 3RGVC 5E4EB 2AV7B 1DEEA 2VR4A 1MUJA 5IESL 4Z78B 1CDBA 3I75A 3RVUD 2CLZA 4PRHD 4NFCA 1A47A 1S3KL 5ADPL 4HUVA 3WNPA 4MXVE 5TDNB 5DRXB 1RZKC 3ARUA 3GJFA 1X4ZA 5LGJB 3ARXA 1S7WB 2A38A 1DANT 3H3PL 4MVBC 2H8PB 1I9RH 4ELKB 1J11A 5DUML 2XKNA 4IIQA 2G9HA 4G6KL 2DWEA 3O8XD 4LSVH 2F8XC 4ZSOE 1AXIB 5I18L 3FT3A 1U3JA 2VDOL 3MV8B 3RPIB 4EDWL 1X5JA 3FTGA 1I8MB 5JIHA 2G5RA 1MCOH 5FV1L 4X6DE 5EZJB 1S7SA 2P5WA 4JQVA 5KW9H 3W9EA 4BZ2L 2JCCB 1LVEA 2PKDA 5FOBA 2BNRD 3BPOC 3V5KB 4N5EC 2A6JA 2QQLL 2Z4QA 4ZUVB 3RGVB 4POUB 2UWEB 2ITDB 2IANE 1RSFA 2VL5A 2DS4A 5DJ6A 3CH1A 1QFUH 3RU8L 1YNTA 5EBWB 4FHBD 5DZLA 4G9DA 5E8PA 5HDLA 2ADGB 4UMGA 4D0CB 4G6FD 5JPNB 4LPWA 4Z8FL 2E7LA 3DGCR 4LRNL 1A6WL 3LPFA 8FABA 4PPTA 4Q7DA 3SEPA 5EU6A 3WO4C 4NN5C 5B3JE 3C9NB 3GSNB 3HR6A 1G7LB 3MLVH 4GW5A 3OTTA 3FO9B 4YHYC 1HIMH 3TBTB 1I85C 4YJZL 1BFSA 2EXWC 1RZ8A 4WEBL 1Z6JT 1SEBA 1NCBH 4NQEE 4PJ7E 1S7XB 5A2KH 3GSNH 1RURL 2X1XR 3OKLB 3GKZA 3KYNB 4TN9A 3BN9D 2YWZA 5DK2A 5C8JA 1WEJL 1JZ5A 1P7QD 3FFDA 4Y19E 5CS7A 3O6LH 3BPOB 4O9HL 3NTCL 5EZIH 3K46A 3V6BR 3UBXA 1M05A 2YMXL 1MCCA 3Q1SH 2FECL 2W65B 4K3JH 3WV0A 3NGBC 1FFNA 4A6YB 4RFEB 1K4DB 1UM6L 4CJ0A 4JDVB 3P73B 1R3HB 3BEWB 2XQBH 1W0VA 1ZVSA 2M26A 1WWWX 2Z8VC 3RFZC 4JFED 5L88H 3HFML 1K5NA 5SWZB 5C0DA 5JPMB 4OLUH 5KVDL 1QFWH 1S7QA 1I9JH 5C0ND 1FZOA 4KUZL 1JWUA 4IEFB 3WO4B 4NN5B 3G04B 2PYEB 1AIFB 5EWIL 4YHYB 3SKMB 1F11B 2G5BA 1R3LA 4NZJA 1I7TA 4G5ZL 2OQJB 5H37G 3S4SA 2YPLE 4MNQD 1BD2E 1L6ZA 2AJVL 2KQNA 3CJJA 4B5EA 1N6QL 5CZXD 4PJ9A 3FFCA 3KHOA 4JZJB 2NYYC 5FM4A 3WKML 2ZP0T 4Q6YA 1GAFL 1QLRA 2CPCA 5F3BA 5GJSL 2I60H 4OFYD 4U31A 4WHYG 1IEBB 3A6OA 4JY5L 4NQDE 1CQKA 2D0HA 1A21A 2H2SD 3MRQB 3SKNB 3BKML 3NGBB 4O00A 4OIIL 5B8CC 3HCVB 3U0PA 4YDKL 3K2MC 1J8HB 4YEEA 5EU4B 4MQ7A 5IJKA 2QSCH 4UQ3B 4OCWH 4QRSA 3WJJA 4M7JL 1FZMA 4ZTPL 3GUTA 4ZNCD 3GMRB 5ACZB 4U1LA 1W0WA 1KC5L 5HD8D 5D7JC 1ZLSH 3BO8A 3PP3H 1XR9A 1TJHH 4Q97A 4GLRI 4XP9H 3KHQA 3LRSA 3V95A 1M7IB 3EW3B 3VWJD 1ZLVH 1FIEA 3OKMB 4PREA 1MCSA 3ZHDA 1S7RA 3TBYB 4UU9B 35C8L 3LB6C 3C60C 5CSGA 1XCQA 5IESH 3TGXA 2YRPA 2CH8A 4NUJB 3WNLA 4HFWB 3T0VA 2X4OA 1S3KH 5ADPH 4QF1B 1PLGL 2BSED 1T7ZA 1RU9L 4XX1G 4JFPB 2XQYG 4HJ0D 4LLMA 3LN5A 1I7ZA 4LF3B 4PY8I 1M71A 4NO5B 43CAA 1FN4B 3H3PH 3I9GH 3RGHA 2Q86B 3RVVD 4QHLB 2YEZA 5E00B 4ZO6A 3WHE1 3F7RA 4NJ9L 1PX3A 4X9IA 3G5XA 5CBAB 1ES0B 3A0OA 5I18H 5J11B 4O4YH 4QOKB 3WN5A 4MXQD 2VDOH 4CW1B 5D7JB 4EDWH 5K9KB 2HT3C 4LP5A 2DBJA 4XNYL 2ERJB 4XPBH 1CD8A 1LEKA 1UJ3B 4OLZL 4BZ2H 4MAYC 4RA3A 3F6IA 1JYVA 5MERB 3KPOB 2FX8L 2DF3A 2UVFA 5MHSE 4OZGF 3VXSA 5HGHB 1N3NA 3TP4A 3CFKB 3PE9A 3RU8H 2XZAL 3W81A 3TN0D 4QGTA 5DEFB 1XGPA 4I5BB 4JZNB 2LTQC 2HN7A 3WLBB 1JHLL 4JO3L 3LV3B 4PJFF 1JZ3A 1ODAA 5HHOD 4Z8FH 4JFFD 4ZODA 5F9OL 2BSRA 1A6WH 1WAAA 4H8WC 4HX1A 4Y4KC 5D70H 2AV1A 1BFOB 4PJ5B 1YYLL 1MAJA 1LEIB 1QBAA 3DUSA 3QHFL 5GGVH 4F7TB 4MX7A 2C4FU 3B9KB 4QKXB 1IKNA 2GJ6A 2XZCL 2XG5A 1FO0L 4WEBH 1IGCH 4PRIE 5E5MA 3VXRD 4F9LC 5GS1A 5LXGL 3CMOH 2AP2A 4HMDA 1RURH 3QIUC 3V0VA 4ZFFB 3LKPB 1WEJH 3OKYA 5KS9A 4MAYB 4WJ5A 1IGIL 2VERN 3NMEA 5E99L 2JJTA 4WFFD 2B1HL 4LIQL 3S37X 4EKXA 1V3KA 2GQHA 2YMXH 2Y6SD 4MDJB 4RZCA 2ZOKB 1N4XL 4E5XA 5INCA 2JTDA 1I7RA 2LU7A 1YY9D 3FT2B 3BP6A 3FB7A 1Q0XL 3MOQA 4FZEL 4WI7A 1UM6H 1KEGL 2BY1A 1FNSH 3MV7B 2LTQB 5JW4Q 3GSRA 3KJ4C 2GTWB 4TQEL 1XGTB 1RHHA 3HFMH 2AXFB 4QRPA 2A6IA 5KVDH 3K2UL 4Y4KB 5E7FA 4KUZH 4HK3N 3HMXH 4QEGA 4UQ2A 5JXAL 4MJ2A 2VO5A 3BYYA 4J4PC 4K3GA 5I0ZA 5EWIH 2ZG1A 4J7RA 3X14A 1TZHB 1FAIH 3Q6GL 3KPSA 4G5ZH 4RGND 4TVSa 1UB6A 1UB5A 4LQFL 4BQCA 4PYHA 1A0QL 3KPQB 3QIUB 3MRGB 4J3OC 3VJ6A 3WKMH 5JOPE 5DA0B 1GAFH 5ICXA 3U0WL 5GJSH 5MEPA 1U8NB 5EOQL 3VFTA 2OZ4L 1PX4A 2P8PA 3TO4D 2X4TB 4PRHE 4Z7OE 3TA3C 3GGWA 1ZGLM 2HT2C 1H8OA 4OIIH 2VXSL 3LN9A 4JM4L 3OX8A 3U6RB 3GSXA 5CILL 5SWSD 43C9B 4YDKH 2AJXL 1KXTB 4ZS6D 3KJ4B 2R2EA 2DM2A 2UYLB 4M7JH 5F21B 1U3HA 5DMIL 4MCZA 4O51A 4UT6L 3ZMRA 1HQRA 3U2SB 1W2KT 3D6GA 5GS0L 1U42A 5D96C 3SDAC 4HDIA 3BE1H 1P1ZA 1HHJB 1BQHG 4JFDE 4CU8A 1TJIH 5LGHL 3QULA 5ENWB 3WUZA 1MFDL 2VYRE 5ESVA 4ZO9A 3MLRL 2DQFB 4PJCB 3MUHL 1K3IA 4JFOA 35C8H 1A6TA 1KNOB 5FDYA 2BNRE 1T7XA 2CO7B 4LHUA 4E0RA 3ZSTA 1Q94B 3O3EB 3AS1A 4Y7MA 4CU7A 1EGJA 2AKRA 3DX9A 1KIPB 1TCRB 2VJXA 1AQKL 2P5EA 4AG4H 4ZO8A 3U36A 4PJDB 4Y89A 4CKVX 2Z92B 4M1DL 3OF6A 4B41A 4XBEL 1FPTL 2RFXA 1V7NL 3TA3B 2Y07L 3GSVA 1KYOJ 2VSDA 4KMQA 4L8CA 3FQUA 1NBZA 3VFSB 2HVJB 2IADA 3QJHA 5FGBC 2XWTB 1JF5A 3JSSA 1H8SA 3NVQA 4Z0XA 3TBVB 3MGOA 1P7KB 4KI5C 4RAHA 3H9SB 1KUMA 3Q48A 2DYPB 3F7YA 1XF4B 4NJ9H 4A2LA 3MROA 5LVEA 4Y4HD 3SDXB 1OTUD 1JYWA 2YHGA 2HG5A 3PHQA 2B5IC 1MHPL 4IS6B 5BVJA 1AGFA 5D96B 3SDAB 5DD1L 2VXTL 1CLYH 4H1LG 1OPGL 3WUWB 1JNHB 4OLZH 5DJ0A 2G60H 4P5KA 1YPZF 3WHE0 5IMOB 1BZ7A 4L4TB 1KIQB 5DS8A 4LSDA 2CR6A 2FX8H 3K4AA 3KLAA 4EDXA 1RZFL 1IM9D 2YC1A 3HZYA 2EYTB 3MXWL 1V8HA 3TYFA 1K2DA 4PR5B 3FZUC 3PGDA 1AXSA 2J88L 3KPMA 3HG1B 2ZPKL 5CKAA 2Y5TB 1D3CA 1A1NA 1JHLH 5DJAB 2X4UA 4JO3H 5IF0A 3TNNA 4HKBB 3TZVC 3BKJL 4PGEB 1MCKA 3MCLL 1AHWC 4JFEE 1FO0B 4K07A 4XNMA 5CHNB 4XVJL 1CBVH 2Y36L 5I1LA 2VXQH 4DUVA 1NDGB 1MCNA 3LQAL 5JMRA 3O3DB 1YYLH 3QHFH 2EH7H 4YHOL 5DMKB 2GUOA 5FCUL 2CDGB 4TSAL 3QJFB 5AZ2L 1FO0H 3L5WA 4PV9B 1WT5C 1VFAB 4U7MA 2B5IB 4MA3B 4X7SL 4HZLB 5LXGH 1L7TL 4OF6A 1I8KA 1MCFA 3T65B 5DT1H 4M61B 1DQDL 5D7IF 2IAMC 1ZANL 4H0GA 1H0DA 1FC1A 2V5RA 1GGBL 1IGIH 4HEME 1BLNB 5E99H 4JO4L 1G1YA 5A2JH 4LFHD 2B1HH 1JI2A 4QY8B 1N4XH 4OGYH 4LLYA 2FATL 2VABA 3SCMA 5IBLD 5HI3C 4FZEH 1KEGH 1N2RA 3BIKA 4TQEH 2V6HA 3TZVB 2D03H 4FTVA 4GFTB 4PP1C 3NCEB 5I16A 1AQDA 3REWB 4MSWA 2ZUUA 4P46D 4EEEA 1QSED 3RBSA 5JXAH 1DQJB 1U93A 5JR1H 1J86A 4XB8A 5HYJE 5I8EB 4XCYB 3VWKD 4BFIB 2APBA 3ZTJG 3Q6GH 1YN6A 3QPQC 4P5MA 3S6CA 4EUPB 2F8OA 3BW9A 3IVKB 4PRNA 3V6OE 4LCIL 2DD8H 2GSGB 2BJMH 1DUYA 2MOVA 4LQFH 3TBSA 2R29H 1A0QH 2GJZA 3UX9B 1YY8A 2IAMB 2E6PA 1J5OL 3DRTA 5EZLB 3U0WH 1KXQE 1FQ9C 4NRZA 2OZ4H 4D8PA 4IOIB 3GIZL 1GJIA 5GZND 3NPSC 3ARFC 1UXWA 2DM7A 2OS7A 1E4XL 4NO3B 2CQVA 2MJWA 3GNML 2VXSH 4JM4H 1KPUB 5CILH 3K3QA 4ONHA 2AJXH 2R2CA 2BHYA 2OL3L 3DMMC 1OP3K 3S34L 3QQ4A 3HC0B 3HE7A 4F57H 2VLJD 1NGZA 3WIHL 3ULVE 4UT6H 5I76B 5C9JA 5GS0H 1MCJA 4YGVB 3V7AE 4KRPD 5B4MC 3PXHA 4KDWA 4ZUUB 3DJ9A 2JK5A 1MFDH 3BHBA 2VQ1B 5ALBL 5E9DD 4BK4A 3JTSA 4MA8L 5C6WH 2YSSA 4MD4A 3LKSB 1IGJA 5IB4A 5JW4M 4FS0A 1VFMA 2CO6B 2F5AL 4K2UL 4NC1C 1UCTA 3ARDD 4G8GD 4M1DH 1HQ4A 3NPSB 4XBEH 4KTEH 1FPTH 4V1DA 3ARFB 4HPYL 2Y07H 3PG2A 4W4NA 3BYTA 5HVWA 1FE8L 1ZS8B 4RMVA 1GHFH 4KJQD 1U8MB 4L4VB 4QT5A 4XPGL 1F4HA 3FQNB 1YEEH 2J4WL 5CJXA 4NGHL 1CGWA 2D3VA 4WUUE 3DMMB 1DLFH 1FVCA 3RL2A 1T03L 2F5BH 1IILE 5HVHC 4R4ND 1G7QA 1ETZB 4B50A 3FO1A 4YNYA 1MHPH 3OJMB 5BJTA 2GTZA 3FN3A 3LS4L 4J1UA 5EIVA 5DD1H 2VXTH 1AR2A 3OAZK 5DK0B 1R24B 3CCHB 1OPGH 5C0IA 3F6LA 4G7YH 4XVSL 2O61B 4OIBA 1X7QA 2EIZA 5LGKA 5SX4I 5BRZB 2F53B 3S36X 4ZG1A 2QSQA 3MXWH 5L0QB 4XXDA 4YZFF 3QO1B 1J0IA 1S9XB 3FB6A 1XZ0A 4XBGA 2A6KA 2J88H 2KZ1B 4RWYL 4FXLA 4ODTH 2ZPKH 5MEOB 3HI6H 5D7KE 2V7HA 3PIQA 3MRFA 4A2MA 3BPCA 2AK4A 2AI0L 2D7MA 5KSBF 3QWOA 3BKJH 4JZOA 4X8XA 5FO9A 3MCLH 5DJ2A 2M1KA 2AXHA 1BX2B 2ARJB 3NAAH 5D2NA 1VGKA 3BGMA 4YHOH 2ICCA 4PJAA 5IW6B 1FH5L 4TSAH 5HVHB 1EPFA 4U1IA 3MJ6A 3MFFA 1F90H 4X7SH 1Z2KA 1L7TH 1KB5L 2EE2A 4PLJC 3UAJC 1ZANH 3OR6B 1KJVB 2MKWA 3BESR 2HJFB 1GGBH 2QQKL 2NXYC 1E4JA 1O7VA 1YYML 4JO4H 3ILPA 5ESQB 1Z9SA 4GUPB 3ABZA 2VLKA 4WIQA 2FATH 2X6MA 1JF6A 1BZ9A 3JTTB 2H9GA 3O11B 4IRSC 3VMOA 1I8LA 3UTZB 4CUCA 5DURB 3VCLB 4JRXB 4IM8A 1ZTXH 3DBXB 4PRPB 3D39D 2YOCA 4OZIF 1AH1A 1ZKAA 1AD9A 3RVWD 3WFEL 3G6JF 3FT4A 5KVEL 1Y0LA 1AGCB 2P5WE 1DFBL 4N8CL 3RIAF 4OZFA 5J0BA 1R5VB 5T3XD 4LCIH 1IQWL 5GQBA 5F7FA 2V17H 3UPRA 4LHQB 5J9PB 4E42A 5EN2A 5BCAA 4Z7QF 3B6SA 1J05A 5IFAL 1J5OH 2R8SH 4UBDD 1J0YA 1HILB 4LCYB 2NXYB 4JG0H 2C1PB 3QFDB 4Y2DA 4DW2L 3GIZH 3FN9A 3EDEA 5C0BD 3LQMA 4F7PA 2DLEA 1SYVA 3IDMB 2HLFD 4ZAKC 5E8DL 4PY8J 4TULL 5DJZB 3GNMH 4ZSOB 1AO7A 1PG7X 3ZKSD 1HYRC 4IRSB 1VPOL 4X6DB 4KH2A 2XXCB 5E8NB 3MXVL 4X7EC 3S34H 1AP2A 1UM5L 4KKBD 3WIHH 4IMLB 2D9CA 1T1ZA 1DVFC 4OQTH 1NCUA 4LVOB 1IM3B 3F7VB 3H3KA 1JRHI 3EZJB 3IAGC 2YRLA 4KK9D 1P5VA 3GJFK 3DX7A 2EKSA 4LASH 2Z91B 5ID1B 1JCKA 1GZPB 2AJ3A 3SE3C 3KNBA 5GHWL 4EI5C 5IHZB 1MI5A 2RCSL 4Y8AA 4GRLA 1INQA 3MO1A 3WDIA 1NC2A 1FYTA 5ALBH 4MD0A 3ROLB 4JKMA 1MF2L 3UJTH 4AM0B 3UYRL 3VFRA 4NRYB 3RIFF 3NACL 4I0PA 5ALCL 4AY0A 1FC2D 3E3QE 4P2CG 4JM2A 5IHLB 1DR9A 5KVMC 3QNZB 4K2UH 2R2HA 3V4PH 1ZWIA 2UZIL 3F62A 4XNUH 4X4YB 3AS2A 3HC4L 4DKFL 4HPYH 3DO7A 1FE8H 3EHBD 2DWDA 3FKUS 3WIIH 4NQEB 1MJ8L 4PJ7B 3DXAD 1U3ZA 4J23A 3IETB 4PRAA 5CSZB 4F58L 2AEWA 2Z8WC 2EECA 3F65A 5E6ZA 4QWWC 1T03H 4OLWL 3LQZB 1JGVL 4Y19B 5JUEL 3VD4A 4MJ5A 5J1AA 1DVFB 2R23B 3FO0L 3B2UC 1A4JB 4Q9QL 5BMFH 4NCDA 2BHUA 4JR9L 3V6FB 2B4CL 3PWLA 2NZ9D 2FYYB 2VXUL 2B1AL 5C2UB 2NY4D 4IDJL 2AQ1A 4EI5B 3F58L 5GPRA 1RY7B 1B0GA 4KK5D 5HGDA 1IFHL 2K1MA 4UV4L 1BBDL 2FHBA 3SQOL 2APTA 2MCG1 1U9KA 4RWYH 3ZDZE 1WCQA 5FB8A 2MQ0A 3W39A 3BH8A 2AI0H 4GMTL 1T5XA 3EDFA 5JA8B 3EJYD 1BVKB 1GCFA 3QEUB 1FFPA 3PV7A 1BD2B 1VHPA 2X9XA 3BUYB 1CDUA 4FQXC 3GZKA 3GBNL 5DGQA 3DNKA 3K1DA 3UP1A 1KB5B 4L3EE 1MCQA 4HUUB 4PJEE 3AAZA 3QIBD 1FH5H 1L4IA 3V0WL 2LE9A 4NKMB 3IAQA 1ZT7A 3CFJB 4YPGB 3U46B 1JPTL 5I1EL 1KB5H 3UO1L 1IGML 4X6EA 4L5FL 2UWEF 4D0DB 4JPIB 5TE6L 2Y7QB 1SMOA 1UZ6E 2VISB 4X98A 2EIDA 3MLYL 4X99A 3C5JA 2BXYA 5IT2L 1YYMH 4JCLA 1OARL 2BRRL 4HWBA 1FL5B 1X6LA 4LLUB 2QR0B 3HRPA 2Z31A 5HHOA 1UM4L 3VMNA 4JFFA 4ZXBA 4CVUA 5HYSA 3MODH 5IMMB 5A3ID 3HI1B 4M62L 3RZCD 5IQ9A 5J12C 4U6XB 3ARZA 3NCFB 4GW4A 1DEDA 5F7MC 5KVFH 1FL6A 5EIQA 4FP8L 4FQXB 5D1QC 5E95B 3V6ZA 4I48A 5C07B 2AEQL 5BXFA 4OJFH 1C5CH 5KVEH 2ADJB 3ZSSA 4QRQA 3ARRA 4FFWD 1NANI 2HRPL 1DFBH 3MJ7A 5HJ3A 4O2FB 2IBBA 4N8CH 2A83A 3IT8D 3S98A 2Z35B 1HDMB 2BMKA 1HN1A 2DQTL 2FX7L 3MBEA 4ODWA 3EOBB 3IFPB 5D4QA 5AAWA 3S37L 4MCYA 1DQQA 5GGRA 4WO4A 4ODVL 3VFUA 4UNUA 5CLWA 1GGYA 1QQDA 3KPRA 1WUNT 5E8DH 3GJEA 3W82A 4NFBA 4F7EB 4P3WA 4N0UE 2HVKB 2HT4D 4BA8A 3PWPA 3BP4B 1X5YA 4IHOA 4XAKE 2B4CC 3MXVH 5J12B 4YO0B 4U1NA 3CFCL 4HIXH 3MCKB 3OB8A 3TFKD 3VGAC 5A43C 2GJ6E 3ILQD 4P2OC 1P84K 4Z5RB 4KKLD 3ZO0A 1F3DJ 4LGSB 3RA7L 4O2CB 1S8DA 4LCCA 2FEDD 2EYRA 2X4QA 4TNVF 3RJDA 4U7SA 3IKKA 4BELD 5DD6A 4H5SA 1S7UB 2RCSH 1JNJA 1F4WL 3X12A 2VITB 5AUMB 1D5XB 3MRDB 4DZ8A 2FR4B 3MQIA 2W0PA 3QH3B 4R0LB 1KPRB 4Y5XC 2GITB 3RY5A 2CGRL 4XVUC 4E9LA 2WINA 5MENB 3HZKB 3QDGA 4ETYA 5AZEH 5GGTL 4Z95L 5IHBA 1JWSB 2GSIB 2WSKA 3LKNA 2UZIH 4WW2C 3HC4H 4DKFH 5DMGC 4QRPE 2HKFL 3HLAB 4JRYE 3LPGA 4PRIB 5K9JL 2CUMA 1MJ8H 3ZKMD 4BZ1L 1Q72L 2YPVL 1BP3B 4LU5L 1BIIA 4K23L 3IDYC 1HH6B 3OHXB 3PDGA 3D0VA 2G75A 1BJ8A 3VGGA 4X4ME 4ZUSB 1BHGA 4OLWH 4Q9BA 5JUEH 1JGUH 3VGAB 1WBZA 1HSBA 4N8PA 4P2OB 2XWBA 4WU5A 3FOMB 3QA3A 2EICA 1AXTH 3GI8L 5EUOB 3B9EA 4Q9QH 3QG6A 4OV5A 4JR9H 2J3SA 1UA6H 2B4CH 2Q8BL 4YWGH 2VXUH 2B1AH 1MCDA 3UTQB 5KBNC 4OF7A 3F58H 5EZOL 1YDPA 2ZKHL 3MJ9H 1OCWL 5B39G 2CIKB 1IFHH 1OY3B 3A6BL 3W0WB 1FVDB 3P0VL 1U8KA 1CFNB 2WZPD 3NZ8A 4UV4H 1BBDH 1Z3GL 3SQOH 2DLIA 4Y5XB 1WBYB 2FB4L 1B90A 1CCZA 3PQYA 5ICZB 5J13C 3LKQB 5IVXA 5C3LD 3QUYA 4GAFB 4WW2B 3OG6B 1LO2L 3MREA 2NTSP 3WJLC 1NCCH 2R1WA 1EEZA 3I6GB 3MGTA 4NM8L 2B39A 1KCUL 3QWRD 5KVGL 5DJ8B 5H2BA 4HT1H 3E6FA 3IDNB 2VDML 3IDYB 3HZMA 3GBNH 4WU7A 3D39E 25C8L 1JVKA 3RTQD 1A4KB 1HI6A 4KRLB 4KJYB 3T2NL 2VN7A 1X5FA 2DQDH 4ELMA 2QKIB 1NJ9B 2HWZL 1LDPL 4XHJC 4PRHB 1NAKL 4NQCA 1T6WA 4C56A 1B4JL 2XTJD 3LKOB 4JN2B 3P4NA 1QRND 5ETUA 3RPKA 5I1EH 4M02A 3UO1H 5IHUL 4L5FH 5T3XE 2PYFB 4UOW1 5TE6H 1N0XL 4R2GD 1CIUA 3MLYH 5IT2H 5EO9B 2ESVB 3O9WA 1OARH 2BRRH 3VH8A 5D1XA 5EULV 3WL9A 3AXLB 3BIAX 2P24A 1V7ML 1UM4H 1PW3A 4DK6A 2WBWB 2XXMB 3Q3GA 4ENED 5C0BE 2JJUA 1R5IA 3WE6B 1G7IB 1NLDL 2V5TA 5DRNA 5J13B 1E0OB 5ACMA 4DVBA 4M62H 3GMMB 4JFDB 2VDLL 5GRVL 1PKQE 4WFEE 2DTML 1NFDF 1RZJC 3O6ML 3BN9C 4OUUB 3OGCB 4DZBB 4FP8H 4LLVB 3VD3A 4RDQF 3KYMB 2AEQH 3L95B 3BH9B 4F9PA 2EDNA 3U4EA 5EBGA 3U83A 5IVZB 1Q9LB 5GJTL 4YXHL 1P9MC 3U9PL 5K9OB 3DVGA 2AJZA 2VZVA 3TT1L 3HS0A 4QCIB 5JO5B 3I3BA 2DQTH 2FX7H 1IAKA 1W72L 1C16A 3IGAA 1MREH 1ED3A 1U2HA 2YRZA 3LKRB 3QWQB 2VLMD 1NCAL 5C0FA 3T4YA 1FZJA 3VXTB 3WFHA 3WYRA 1UZ8A 3RDTA 2JIXB 5DEGB 3S97C 4ODVH 1NQBA 5C0NC 4LPVA 3TESA 4OZGE 1CK0H 1NMAH 1BGXL 1ZVHA 1KCVL 5DJYA 1A6UL 2E8YA 3EYVA 3D3VD 3LSOB 2GFBA 3BXNA 4WHCA 1T89C 1QSEA 4NHUA 3FONB 5F7YC 4NZDA 1PDKA 5CZXC 5GS3A 1INDH 1H3TA 5HYQA 4WRLA 3CFCH 1X5LA 4PJBF 4PJFE 4LMQE 4JFZH 4P2RE 1R5WB 3OAUL 1BFVH 1KEML 3QCUL 3PUCA 4HMCA 3RA7H 3RBGA 1T04A 4RMSA 1KN2L 4HLZG 4K55A 4PJ8D 2RJMA 5LJYH 3KJ6L 3SJVD 1RZJH 2C3VB 4NNPL 3G6AA 2H2PD 3OZ9H 4HUXB 2HFFA 2HJLA 4G8FB 4EN3C 4U49A 4U1HA 1S9YA 3P3YA 1QD0A 2EKJA 1MCPL 5ERWB 2K7PA 3FOLA 2IG2L 1IQDB 2CGRH 4ZFZA 4EIGB 4MS8D 1CG9A 2IPKB 4MMXC 3ZHKA 5MP6L 3LPWA 2VE6B 4Z95H 4I3GA 3D9AL 1ZGLA 4P57A 1UACL 5CCKL 1Q9KB 1T6VN 3BZ4B 3DOSA 1JYXA 4ZQKA 3ZTNL 1IAIL 1UADC 2NY0C 5K9JH 3V6OC 4BZ1H 5JLZB 1Q72H 2OR9L 1YMMD 1HHGA 4K23H 5IB5B 1WCBB 3C5ZD 3HAEB 7FABL 4X0KA 1CICD 1XGRB 4U2YA 4AH2A 1H15A 4U2ZA 2BERA 1QUNA 3PWNB 2IFFL 3PL6A 1FSKC 3GI8H 4MNGA 4B7LA 3VRIA 1I3GH 3MC0A 3MLUL 3CU1A 1YEJL 2Q8BH 3TBWB 2AEPL 4NBXB 1OP3H 4PJCF 4I8DA 1P6AB 1T21A 4PTUB 1M6OB 5JW5A 4GBXA 3QUML 3VFPA 5EZOH 4EUPG 5JXEA 2ZKHH 5F7DB 1J9CT 1OCWH 2P47B 4G8GA 3A6BH 4EN3B 5HYIA 1UG9A 1SJXA 2EDYA 3ULVC 3EO9L 1Z3GH 1MRCH 4XP5H 4JO2H 3RVVC 3KPPB 4Q2ZB 4B7IA 3R8BB 5CAYB 5FYKE 2X7LA 1T0NB 4U3HA 3T4AA 5C08D 2P43B 3RNQA 2HTLD 3SGJA 3PWJB 4NM4H 4L29A 5FGCB 1LO2H 3TV3H 1UEMA 5HYJB 1IGTB 3CGTA 4K3EH 3ZE2F 4I2XE 2NY0B 5F71A 3D2UD 4NM8H 1KCUH 3BZEB 1ZHKB 3T77A 1LD9B 4GKNA 3ZYOA 4PB9H 2VDMH 2MHAB 4OGAC 3SDXF 4HWZA 4QRRD 3GMPA 2M2DA 4OCRH 3TJEH 3WD5L 5I17B 3T2NH 3PJSB 4XP6H 1FZKA 3TN0C 1FSKB 1II4E 2HWZH 4UI2A 5FA3A 1NAKH 3ECBB 3CFEB 4X5WA 3B8YA 4HBQA 4U7KA 1PEWA 5IHUH 4EQ2A 1T1YA 3IDIA 3T0ED 1X44A 4YHLL 1B4RA 4XVTH 4LEXL 3S36L 5B3NA 1T3FB 1EJ6A 3ALWA 1NAMB 1A9EA 1NGWA 4X9FA 4FQHA 3H0TA 3T1FB 1JN6B 3OAZH 2FIKB 4Y8DC 1ORQB 1NGQL 1TJGH 3CK0L 3M8OH 1HXMB 4UOW0 1OTSC 1NMCB 1NLDH 3INUL 3ES6A 3ULVH 2VDLH 3NCYP 1AD0A 2Q87A 5CEZE 3QUZD 3L7FB 4KI5F 3O6MH 3FQRA 2XN9A 3CVIH 2YKLL 4OCSL 3N85H 3QPXH 3JVGA 3V5DB 5EIIA 4X80L 2Y6SC 1EO5A 1MCLA 4APQC 4YXHH 2VZ3A 2PW1B 2XQYK 4HXAH 3PWUB 2DIBA 2H3NA 3U9PH 4NFDA 3QZWB 2X89A 5IBTL 5FO7A 1RULH 2WBJD 1OTTC 4KPHL 1W72H 1NCWL 1N0LA 3WLWD 3WIFA 4PRDA 4OZ4B 1JK8A 1ZHLB 3MBXH 2H26B 3VFVA 4QHNA 4WUUB 1YPZE 2E7CA 2HTKC 3BZFB 1JHTA 1BGXH 1N26A 3LCYA 3QXAA 4L8DA 4M6ML 4KWUA 3WXWH 2DN7A 1WICA 4N8VB 5T1LD 5JOEA 4LBEB 1PFCA 4FXGA 4CVXB 5I75C 2MCPL 1TVBA 4XAWH 3MRNB 4XI5D 4ZFOA 1KEMH 4LPXA 1K4CB 1RFDL 1XIWD 1CE6A 5ANME 3BQUD 4UTAL 1L0XA 2F54D 1KN2H 4UDUA 3RZWA 5DUBA 3KJ6H 4APQB 4X6FA 5K59F 4M8VA 1SM3L 1QP1A 1QO3B 1J12A 4Y1AB 1K8IA 4HIHB 3P0YL 1MCPH 4NT6A 1XT5A 1AFVL 2IG2H 2FSEA 3IFOA 5B39A 1P6FA 5D7IE 1EHXA 3NIDF 1D5MB 3D9AH 2Q7YB 2FECI 5I66B 1UACH 4I18C 5CCKH 1AC6A 1PG7L 4JKPL 5E2TL 3VXPB 4N0FA 1OB1A 1P4BL 3S5LB 1IAIH 1UCBL 3UDWC 2OR9H 1PZUB 1DEEB 1T1XB 5HBBA 4QNPF 7FABH 1HNGA 2I07A 5I75B 3I75B 4GMSL 4XC1H 2DB8A 3TNMB 4RWHA 3TH3T 1DQTA 1MRFL 3MLUH 3P30L 4KGLA 1YEJH 2C4FT 3BN3B 3MV8D 5I71B 3GJFB 3RY6A 4Z7WA 2E7LC 5IK3A 3ZYJA 3L1OH 1FNAA 2R4RL 3QQ3B 4NQXA 5TE4H 5I1AB 4AEHL 5B21A 3LZFL 2ZUYA 3QUMH 1R3IL 3FB8A 1NUGA 1F6AA 5EBMA 4OD1L 2XKNB 1S7VA 1RAMA 2OCFD 3GJFH 3RGVD 4LDOB 3EO9H 5HHMB 5E2UL 2W9EL 2DWEB 1AO7E 4X4XB 5F7EL 3T8XA 4U6YA 3FTGB 1OTUC 4RQQB 5JOFA 1Z9LA 1S7SB 2P5WB 4I18B 2VLLA 3ZHLA 5FOBB 3EUUA 3ALXA 5LWYH 3ARSA 2Z4QB 1Q9WA 4I3SL 2PETA 4N0CC 1CFSA 1EAPA 4MVBD 1CL7L 1EJOL 5DJ6B 4XCNA 3CH1B 1YNTB 1WFNA 4TSCL 3E3QC 4UT7L 1NCDL 4G9DB 5E8PB 4ZO7A 5DXWA 3O6KH 3IFNL 1W0YT 4TVPE 1NEZG 2NCMA 4P49A 5F7KC 2OR8A 3JV4A 5F1NA 5BOZG 4L1DA 1D9KA 4UIKL 5DWUL 3RUGF 1EEQA 2DKMA 8FABB 5D2LA 4YHLH 2AS5M 1BECA 3Q6FA 1T2JA 3F7PC 5EU6B 4Y16A 5CMAA 3L5JA 4PFEA 2VR5A 4GW5B 2VLME 4MA1C 1KACB 2ORBL 5AG8A 1RZ8B 4G7VL 5C0AD 1SEBB 1G7JA 1NGQH 2PTUA 3CK0H 3O45B 5CP3A 5DJDB 4C83A 4FRWA 4PJ9C 4R26L 3QP3A 1G7PA 3FRPA 2CXGA 5C8JB 1GOHA 3QIBA 2VDNH 3FFDB 5SWZD 6FABH 5F1OB 3OQ3B 1YECH 4CADA 1M05B 3QUXA 4JQXA 4NKOA 4XWGL 2YKLH 1A3LL 2XACC 2BVPA 3TVMA 5FGSA 5IWLA 1UQSA 1A9BA 2JE8A 5D7LA 3B9DA 3V4VL 1E27A 4G6AC 1FORL 3HZVA 1FFNB 2PYED 4X80H 5IJKC 2EXWD 5IBLC 1W0VB 1ZVSB 4PTTA 3WJJC 3SJVE 3WNMA 4PGCA 3SKOA 5IBTH 5C0DB 1A6VL 2HAZA 4MJIA 1EBAA 4PIRF 1S9VA 3BWAA 5HTSA 4OZHA 1S7QB 3V8CA 1FZOB 1JWUB 1ACYL 2OM5A 1RK0A 5IIEA 4M48L 3TT3L 5F89B 4P46C 2G5BB 1R3LB 1I7TB 1KYOK 3S4SB 4YZFE 2Q3ZA 3CXDL 3VWKC 5E94B 1NDMB 4PJ9B 3FFCB 3O41A 4N68A 3SDDA 5FV2A 4LRIC 5I1CL 2APXA 4JEGB 1YMME 1XAUA 1QLRB 5F3BB 2MCPH 3QDJA 1JUFA 2FEEI 2J6EH 5GRUL 4N0YL 1MVFA 5KSBE 3L3HB 1RFDH 2B0SL 4GOSA 5EH1A 4UTAH 1JTTA 2GYSA 3AB0C 3CUPA 1DBML 3VA2C 1U2CA 3U0PB 4RIRA 4NP4L 3GSOA 5EBLA 4MQ7B 4NQSA 3T0XA 3ZL4L 1SM3H 2LFGA 3HUJA 1FZMB 1XGQA 3GUTB 3OB0K 3P0YH 3H7BA 3O6FA 2WWKT 1AFVH 2YK1H 2A77H 3WN5C 1G6RL 2V2TA 3BO8B 1OGAA 1FNHA 4L3EB 5E5UB 5BW7A 1I4FA 1TPXC 3LRSB 2R56L 1PG7H 4JKPH 5C08E 5SV3A 3KXFA 4KRPC 4X6DF 3P4OB 4PREB 3ESVF 3DIFB 1S7RB 4FFYL 4HUWA 5KANI 1XMWA 4AIZA 2FJHA 2C1OB 1U8JA 1WC7A 5FF6B 1DN0A 2CKNA 3N06B 1YEKL 1LK2A 1I8IA 3DYPA 5EU7C 4RMWA 4JDTL 5FHBL 4GMSH 2X4OB 5DDHA 2KDGA 2VOTA 1Q9OB 1O7SA 3P30H 4OZIE 4LLMB 4YFLI 2N7BA 5T3XL 4QXGL 3AB0B 3O2DL 5D7JD 3ARDC 4QTHA 1M71B 2R4RH 43CAB 2GAZA 4AEHH 4JQIL 1VACA 3VXME 3G6JE 3LZFH 4UAOB 2D7OA 1R3IH 5BVPL 4H26A 2FJGB 4M4PA 3WFDL 1OVZA 1KGCD 3T0EE 4OD1H 1PVHA 2DJ4A 2YEZB 1WGOA 4J8RA 5B3JF 3JUYA 3KPRE 3LB6D 4OD3L 3G5XB 5E2UH 3C8KA 2OYPA 1HSAA 1N6VA 1A7NH 3OG4B 3WS3A 5F7EH 5E5RB 1EZVY 3WN5B 2BY2A 4Z7QE 2YD1A 3L3KA 3UBXI 1MCHA 3L6FA 1QBLH 3B4NA 2ZOLA 4KRPB 1F00I 1ZT1A 3RKDD 3BP5B 2AK1H 3LEYH 3VXSB 4MJ6A 4I3SH 1N3NB 3WS6A 3H2WA 5IMKA 3IF1B 5IB2B 1F2QA 1EJOH 5D72H 1G7HA 4PJ5D 1NCDH 3MACL 4S2SA 3PXJA 1XGPB 3B9KD 2R2BA 2HN7B 3DURA 5FYJD 2QEJA 3CDGA 4AEIL 1QKZL 3O2VL 2HT3D 2XY2A 1KCRL 4UIKH 5DWUH 2BSRB 1SBSH 4R6UA 5GZOC 3MFGB 4WWKA 2AV1B 4MAYD 2VDPH 3ZKXC 2X42A 3BRGC 3N9GH 3DUSB 3L9RB 2ZUXA 3BP7A 1WFTA 3QCTL 2ORBH 3H9ZA 2GJ6B 5DRWA 4AYFA 4G7VH 3KG5A 1LEGA 4H20L 2V2XA 5GS1B 3QEHA 3A67L 3H6JA 3LY6A 4R26H 3V0VB 5JQHC 5K33A 5DC0A 3IS1X 4MA7L 5MEQA 4Z7UA 4GG8A 1A3LH 1CXKA 5FUCE 4RZCB 4JGJA 4Y4KD 4E5XB 5IEKA 1I7RB 1A2YA 2ICWJ 1WQVT 3BP6B 1FORH 3FB7B 4RSVA 3W9DA 2F54E 3GRWL 1CGUA 2DMBA 1MEXL 3GSRB 3ETBF 3PV6B 2Z93A 5BZDB 1QSFA 1RHHB 3QYCA 4QRPB 1A6VH 4JRYB 1BOGA 2A6IB 3VU2A 1GYAA 4P4KA 3GSWA 3QIUD 3BGAA 5I19L 2R0ZL 4LSPL 5HGBA 1ACYH 3ZKXB 4OAWA 5ITFB 4M48H 3CVHA 3TT3H 1C5DA 2Y4SA 3MOAL 4X8JB 3SBWA 4D9RD 3RVWC 1JPST 1U91A 3X14B 5FO8B 5C0GA 2V9QA 1UB6B 1AI1L 1UB5B 3DHJA 5TDOB 1OAYH 3VJ6B 5I1CH 4XC3L 3VG0H 4PRBA 4PJXA 5GSRB 4X7DC 5ICXB 1S9WB 2YD5A 2EDHA 1FJ1B 3IB4A 5MEPB 4ELME 1SEQL 32C2A 4M8QA 5EG6C 3VFTB 5EU3A 2CDEA 5F97E 4BQ6A 4YR6A 2B0SH 3RIFK 2DQEH 4RRPA 1DBMH 2HLFC 3OX8B 4J4PD 1WZLA 2BVQA 3MV8E 4NP4H 1KELH 2R2EB 3ZL4H 4U1KB 1VEOA 3V52H 3U7WL 3VA6A 4JREC 5IKCA 1TCMA 2IPTL 5FYKL 4YFDB 3EOAA 4MCZB 4O51B 1HQRB 3JWOL 5DVKA 2A74A 2FO4A 3MRHB 1P1ZB 4X6CF 4WV1A 4WUKL 1CE1L 4KK9C 4ZPVA 3QULB 3TA3D 1MWAL 2FRGP 2HT2D 1T83C 3N0PB 3KR3L 2HRLA 4FFYH 4HULB 2HFEA 4JFOB 1A6TB 1YEKH 5CZVH 3X11A 4E0RB 1BQLL 2UY7A 1SJEB 4KGJA 1PGRB 3EDDA 4FABL 3DX9B 2EDLA 3H9SD 3R0NA 5FHBH 2P5EB 1YQ2A 3U36B 5SX5H 1A14L 2LU3A 1P4LA 4TTDD 4K71C 2BFVH 4P5TA 5T3XH 1LE9A 2FBJH 3SDAD 3HRZA 3O2DH 1UVQA 1EGJH 2J12B 1UJTA 4L8CB 3VG9B 4Y4FA 3FQUB 5ADOL 4JQIH 5KAQG 4LDEB 2IADB 1NEZA 5BVPH 3I3DA 4Z0XB 4L4TD 2N7AA 4ZYKB 3OXSB 4AL8H 1Z9OA 3P4LA 2B2XL 5DI8A 4HJGA 5ESAA 3HPJA 4OD3H 1MHEA 3E1F1 3PHQB 4I0KA 5ABDE 5BVJB 3NIGE 3HG1D 5C0AE 2XPGA 3VGDA 4KFZC 2X4SA 1E4XI 2C7UA 1FVEB 4JPVL 5DJ0B 4P5KB 4XMLL 2NZ9C 1BZ7B 3VD5A 5DS8B 4EDXB 1BOYA 3VW3L 2GK2A 5I6XC 4QHUA 2N56A 3HZYB 5SWZE 4JAMA 4KK5C 1LE5B 1K2DB 5EUOF 2XY1A 2YR3A 1AXSB 3PGDB 3SCMC 3KPMB 4KI5D 2VKWA 5C70A 4F7MA 2WLYA 1UXSA 1A1NB 2PYEE 2X4UB 4XNZC 5IF0B 4URTB 4K71B 3AREA 3TNNB 4AEIH 2D7TL 1URLA 3L3IA 3O2VH 4LSQH 1KCRH 4WI9A 4XNMB 3B5HA 3EJYC 1F4YL 1A3RL 2DQGH 1TQBB 2GK0B 2ADFL 3WHXA 1OSZA 1KT2A 3JUZA 5JTWA 2GUOB 2YBRB 4P2RB 2BVOA 3S7GA 2XWJB 2KUTA 3C6SA 2GCYB 2WBKA 3G9AB 3IU3A 2GJJA 3FZUD 2EYSA 4XWOD 1I8KB 3DV4A 4QRRA 1X5GA 3A67H 4HK0A 3QUKA 5CSBA 4D0BA 3TZVD 4BSVA 4MNHA 3SPVB 5SWQA 4LAQL 3QSKB 5I6XB 1OF2A 1REIA 4MNGE 2VWEE 2BVUA 4NIKB 4MDIA 3GK8H 5H37H 2VABB 1KJ3L 3SCMB 3GRWH 1T5WA 3QI9D 4JFXB 3JWOC 1MEXH 1QFOA 1N2RB 4XBPB 4XNZB 2LAGB 3U48A 4UDTA 3RWIA 5A3IC 4OM1H 4UTBL 4WHYH 3RZCC 2RGSA 5GGUB 5I16B 1CN4A 2IAMD 1AQDB 5I19H 4LSPH 3THML 4OQ1A 3JV5A 5L9DL 1XGYL 3BDXA 1QR4A 3MOAH 1I1FA 5AEAA 2C26A 3HNSL 1WFUA 2AQ2A 1YN6B 4P5MB 1FRGL 3BW9B 5IB3A 4PRNB 4FFWC 2AVGA 5I1IH 1YMHA 4HW6A 5HI3D 1GH7A 3TBSB 2GJZB 1YY8B 4FQ2L 4ZOBA 5JW3L 1ULVA 3DRTB 3G5ZA 3VFMA 4HC1L 1SEQH 4NRZB 3LS5H 4PP1D 4J6RL 2BY0A 5IBUG 2Y72A 5INDB 5KAQF 4WFGD 1UXWB 3MA9L 4WGWB 5E70A 3DVIA 2HJKB 4ONHB 1U8PA 1QLEL 4YDIH 5CJXC 3DX8A 3HC3H 3QPQD 3QQ4B 3VXUE 3U7WH 1NGZB 5C0CA 4I2XB 5FYKH 4KQ4L 1KGCE 2H32H 2LV4A 4TYUA 5C9JB 3JWOH 2DICA 3MLWH 2C3HA 4WUKH 1LO3L 2XZZA 5EFIA 2JK5B 4U1MA 2DLTA 5A2FA 1I9IL 3ARFD 5KZCB 3BHBB 1MWAH 3RWCB 3JTSB 3KR3H 2XN9E 1JWMA 2IH1A 2YSSB 1FV1A 4L4VD 2DI7A 2ZSWA 5IB4B 4FA8A 1YN7A 5T5NG 3DMMD 4FABH 4F37K 5IROA 2LABA 1NGXA 1A14H 3MUGA 2ZUVA 4PJ5E 4HH9A 1NFDE 2EDEA 4LP4A 2QHRL 2F19L 3TPUA 1CGTA 4ZOCA 1N5AB 5KJRH 4I77L 5FYJE 4C4KT 1R0AL 4GW1A 4QT5B 4Q6IA 1BPVA 1KBGL 3QXDA 3QZWG 3RL2B 5BRZD 2EE3A 2B2XH 1I3UA 5TDNA 1KLGB 1NH6A 2F53D 2BOCA 3F7QA 4XCCL 5I1JH 2EDFA 2L7UA 5TH2A 1G7QB 3L5IA 3FO1B 4YNYB 3WNNA 4JFHE 4J1UB 1U58A 5HGAA 5CEZH 1CU4L 3GIVB 2BC4A 4D9QD 4JPVH 4RGOH 1X7QB 4XMLH 2EIZB 5GSVA 3D18B 2P46B 3VW3H 5L8KB 3MNWB 2QLVB 4GAJL 5CGMA 3LMJH 5F72S 3W5MA 5E8OB 2BOBA 1I8MA 4XBGB 5EZJA 2A6KB 4DK3A 1FFOB 2JCCA 4KVNH 2V7HB 3MRFB 4G42A 4PJBE 2DBLL 5FOJA 4G6MH 3BPCB 2AK4B 4ZUVA 3RGVA 1R3KA 2D7TH 2VIRA 3QWOB 3N1PC 1F6LL 4JZOB 1JPFA 4CAGA 4OD2A 3ZE1F 5FO9B 3U7AA 1MFBL 4YHPA 1K6QL 5DJ2B 5EBWA 1F4YH 3ARQA 1A3RH 1EUUA 2XKUA 3MSPA 1ADQL 2ADGA 5D2NB 4IRZH 1VGKB 2RHEA 1FDLH 3BGMB 1A02N 1YC7A 4BM7A 2GT9A 4JY6A 5JPNA 5EC1B 3T0DA 4J3SA 4U1IB 3PNWB 4D9RE 3MFFB 2ICWA 4ZTOL 5C0RL 1U8IB 4MQXD 2Q3AA 3S5LG 3TBTA 5JHDA 2X41A 5DURD 4JRXD 4Y2DC 4JVUA 1EH9A 4PRPD 4R2GC 2VLKB 4NRXA 2WIIA 3H9YA 4Q9CA 4GG6F 2Y23A 1KJ3H 5D7IB 4ZS7H 4ENEC 1ZLUK 1NSNL 2H9GB 1WLHA 3D85A 4XPHL 4F2MA 4NZTH 5DK3A 1GIGL 5I73C 3SN6N 2BNQD 3UAJD 3ULVF 4LCWA 1EFXA 3CDFA 1FLRL 4PG9A 4BH7A 1R3HA 2OP4H 1OP5K 2X1PA 2NXYD 1Y0LB 2NY6C 3HNSH 4HWUA 4GRLC 1FRGH 1RZGA 1F8TL 1TZGH 5T5NF 2FGWL 3VFGH 1BQHB 3UPRB 2J7LA 4POZC 1U8OB 5E6IA 4E42B 5EN2B 4IRSD 4DGVH 1J05B 3B6SB 4G6JL 3MV9E 4HS8L 1I85A 4JM2C 3U9UB 4HC1H 4M00A 1KIUA 1U8HA 4Y2DB 3V5HB 4ZNEE 1YEIL 4J6RH 4HG4J 4R2GB 4F7PB 3ZE2E 3H9SE 1SYVB 1EVUA 1MQKH 4ALAL 4ETQA 3MRLA 4X5LA 2KPNA 4Z0BL 4F15C 5KANG 1AO7B 3SDXE 4WCYL 4WI3A 1WIUA 1CDIA 5DO2C 4PJGF 4DKDC 3WDJA 1AP2B 4GAGL 2A73A 4F33B 1T1ZB 4KQ4H 4M5ZH 2BXZA 3HE6D 1J1PL 3HB3C 1UWEL 3HCVA 5CJOH 1MH5A 2EKSB 4YDLC 1J8HA 5EU4A 4TNWK 5E2VL 3QFJD 4CDHA 1LO3H 2AJ3B 4BYHA 3KNBB 2NY6B 1KJ2L 1I9IH 4GRLB 1INQB 3MO1B 1NC2B 1FYTB 4MD0B 4NQED 3VFRB 1CDGA 1SJHA 4H0HB 3GKWL 4FMKA 1EMTL 5EUKB 1M7IA 4JM2B 4KVCL 4TVPH 3UBXG 4Y19D 4H1LH 3QDAA 1ZWIB 1DVFD 4KI5E 4M3KB 1TMCB 3OKKA 4UU9A 2F19H 2YPKA 3DO7B 3FHQA 4FN0A 4F15B 4I77H 2DWDB 1UH3A 1R0AH 4PRAB 3VXOB 3EFDL 1KBGH 4EI5D 1A7BA 1R6VA 3E6HB 3UJJL 4U3CA 4GXVL 4O2EA 1NPUA 3WFBL 1F3RB 4MJ5B 5J1AB 1CICC 2FH6A 1NKOA 5B8CA 1RZ7L 4NO5A 1S5IL 4OCYL 3PWLB 2Q86A 3SKJL 4Q74A 1BMGA 1CU4H 4LLDA 2VSCA 4QHLA 2PTTA 1IEHA 3S4SG 4YE4L 1N8ZB 3OB0H 4UILL 1QNZL 1G9ML 3P9LB 1CXEA 4NPYB 5HGDB 5E7BA 3SJVB 4FZ8L 4GAJH 3JBG7 4HKJA 3DX6A 4QOKA 4P9MH 4CW1A 1D6EA 3OKEA 3H42H 3VFWA 4ZXBC 4QWWD 1E4WH 2JJWA 1LP9A 2RIKA 5FHAL 1NUDA 2ZUWA 3ELAT 3DYMA 3OJDA 2X1QA 5HGHA 4MGXA 3UTTD 2E7HA 4W6YB 4XP1H 2HTLC 3C60A 1FFPB 4CGTA 3WCYA 1K6QH 1CXIA 4M9PA 3CD4A 1AGEB 4QHMA 1ADQH 4I5BA 5K59E 1D7FA 3BGFB 4XTRD 3LV3A 3AAZB 1K8DA 5GRZA 5KSBB 1I9RL 4MZ3A 2E6QA 2EIBA 1VB9A 3UROR 4ZTOH 5C0RH 3MBEC 2YZ8A 3EYQC 3NIDE 3QDMA 5F8QC 2NY5C 1CXFA 3RNKB 3RWHB 4X99B 3C5JB 3NN8A 3DWTA 3T0EC 4WO4C 4JHWL 2Z31B 1UKQA 4FQXD 3ZTJH 4ODXA 4G8EB 4ZXBB 5C07D 3S8WA 1ZLWK 4QNPE 5HYSB 2PW2B 4WFGE 3GBLA 4P4RA 5DMYA 2CKBL 2FZ3B 1NSNH 4XPHH 5AYUL 5IQ9B 4YFLF 1OAQH 1GIGH 4MDJA 4RBPH 4E41A 5I1HL 4UINL 3N1QC 3I02B 1FL6B 3VRJA 3QIWC 2OXHA 4LCCC 1KPVA 3V6ZB 4R3SB 3OR7A 4I48B 3MV7A 3WMSA 3ORJA 2XOTA 5BXFB 1XCTA 2GTWA 2D2OA 4Z7VA 1RZKL 2A83B 2Y1VA 1F8TH 1JV5A 4LARH 3CX5J 4X5XB 2FGWH 4OLYH 4WENB 3MBEB 3LHPH 1NCBL 1ITBB 1F42A 3VXMB 1RMFL 1KCSL 4L4VE 2WBJC 3GSNL 5T5FL 2VDQL 5GGRB 4WO4B 4M6NH 3VFUB 5MHSD 3STLA 1X5HA 1RK1A 1CFQA 3KPRB 4ALAH 1RUAL 3GJEB 4MWFB 4Z0BH 4ZD3H 4HKXB 1WSST 2NY5H 3AS0A 4WCYH 5FA4A 4PLOB 3PWPB 1U8NA 3O3UN 4GAGH 5A40E 2UUDH 1BM3L 4RCAA 3CNKA 3HKFA 5BRZE 1J1PH 3QIWB 1UWEH 1G9MC 2OXGA 3RUGE 3QEQE 5L88L 5FUCC 1S8DB 4LCCB 5MEND 43C9A 5I0DA 5E2VH 2NLJA 4A6YL 1BBJB 1QFWL 5ISZA 2UYLA 5KG9A 4H5SB 5J6HA 4KJWC 5DFVD 3HMWL 3X12B 5DFWH 3IXTA 4NC1E 1UENA 4PRID 2ZG2A 1WIPA 4DZ8B 1MHCA 2CK2A 3G5VB 4HEPG 1TITA 4YHZH 1OD7A 2WINB 3MRIA 3QDGB 4HFUL 3A6CH 4KVCH 3MA7A 5ENWA 3KPNB 3LKNB 5GISH 3M07A 1QA9B 2DJUA 4P2OD 2E9BA 3QUYC 3F12B 2V5MA 3SO3C 1BIIB 1KIPA 1PEZA 1OAUL 1N59A 1KG0B 3D0VB 4L8SA 4PJDA 2VH5L 2G75B 2Z92A 4YQXH 2E8ZA 2D7PA 5T1LB 3UJJH 1A6PA 3W0WD 4GXVH 1FNEB 3WFBH 1HSBB 2QSCL 2XWBB 4WU5B 4QO1A 4OCWL 4KUCF 3QA3B 4V2CB 1CI5A 2IQ9H 3DSFL 3MYJA 1RZ7H 1IE5A 3QG6B 4OV5B 4DFIA 3SKJH 4GS7C 4CVZB 3O4LE 4ERSH 3IJYA 1CIDA 2DYPA 1ZLSL 1XF4A 4YE4H 3TEUA 3P9MB 1F58H 1G9MH 5C86A 1XF5A 2W1NA 1U8KB 2BSSB 2IBGA 4FZ8H 4I9WE 4IS6A 4QHKI 3SDAA 4JRXE 3CLEL 1AGBB 3WUWA 1CGXA 1WV7T 3PQYB 1NC4A 2X44D 5HSFA 5IVXB 1MJ7L 1TNNA 2R1YB 5FHAH 3QUYB 3RI5F 5D93C 3NIFE 3MREB 4JHZA 1MQ8A 4G9FA 3RL1A 1EEZB 3MGTB 3MJ8B 2EC9U 3SO3B 1RIHL 2AW2A 5CGTA 4YHKL 5H2BB 3E6FB 3HG1A 2OBGA 5DTFA 1KJMA 3B83A 4WU7B 2BNQE 4NQVB 1HI6B 1RQ5A 2ESVD 3I9GL 1Z5LA 4ELMB 2QADC 3MNVB 5LAXA 2J8UA 2PO6C 1JNNL 1FO0A 4NZUH 1D5ZB 4NQCB 4C56B 1I3RB 3MZTA 2X70A 5FGBA 4LNRA 4GS7B 2R0LH 4R7DA 1JIBA 4O4YL 1GOGA 4G8IB 4JFDD 3CFIC 5F8RC 5IVOA 1I7UA 4L3CA 5A16A 3QJFA 4XPBL 3O9WB 2CKBB 4JHWH 3VH8B 3WL9B 4DCQB 5J6GA 4LHUG 1WBXA 3I2CL 3Q3GB 2BVEA 1F5WA 1R5IB 4R96B 4KJPD 5J7CC 3S88H 2CKBH 1WAAF 5AYUH 5D93B 1A1OA 2CR3A 4XHJD 2EE9A 2IQAA 4LGRB 1ZT4A 1DSFL 4KMLB 4BK5A 4GLRH 4WHTA 5DHYA 4UINH 5I1HH 5D8JL 1M7DA 4N9GA 4YHIA 2JIXD 1RUPL 5D70L 5BZWA 2QADB 4JRWA 3TZVA 4JG1L 3DETC 5EO0B 2Q1EA 3QFJE 3C5SB 1RZKH 2IWGA 2PO6B 5KS9F 1HCFX 1AHWA 5GGVL 1O5DT 2AJZB 3HS0B 5IW3A 3CDYA 4J3WA 4OGZA 5JZ7C 4BQ9A 1IGCL 1C16B 3IGAB 3BEVA 1ED3B 1RMFH 3CMOL 1KCSH 2NY2B 4WTXA 3T4YB 1FZJB 3WFHB 4CMHC 5C0FB 1UZ8B 2O5YH 5I8EA 5T5FH 2VDQH 4JZJC 3RDTB 2H6PA 1WT5A 2EEDA 1HWGB 3HI5L 4OFIA 5I8KL 2OZ4A 3P2TA 1JI1A 5FYJL 4LNVA 1RUAH 4FQQB 4BH8A 1PY4A 4K3HA 4XPFL 5JQ6H 3EYVB 3IXAA 3KYOA 2GFBB 3P40A 3BXNB 4KY1L 5FUOL 5C0AB 1EK3A 4NHUB 3R4DA 3EYOB 4IMKA 3QCVH 1IAIM 5HYQB 2VNCA 2XNAA 1FNSL 5CLTA 1BM3H 3KWWA 3VXNB 4NO3A 4W68A 3SGKC 2PXYA 2Y25A 2VWEC 1KPUA 1NBYA 4JFYA 4A6YH 4PJIA 4JGUA 4GBXC 3HMXL 3G6AB 2HFFB 4PJHA 4PGZA 5JXEC 3HMWH 3GFUA 1PYWB 4U1HB 1S9YB 3GMNA 1PJ9A 1FAIL 5C09A 3C6LA 3CSYA 4H8WL 4YGVA 5DHXB 5IEHA 4ZFZB 3MRPB 3ZZ1A 1CG9B 3Q5YA 4HFUH 4CMHB 4HIJA 3ULUF 1ZGLB 2VQ1A 4AT6B 1WVZA 3V8OA 4M7LT 4ZQKB 4MB4A 4OBRA 2PNDA 2DL9A 4R8WL 3UTTE 3QNXA 1OAUH 4X0KB 1DBBH 2VH5H 1G6VK 4AH2B 3RWGA 3MRKA 3S3JA 4QRUA 4EN3D 4OGXL 3ZYZA 3ARFA 1GPOH 2VLRA 1MJJA 3OXRA 1SVZA 3PL6B 1LO5B 4MNGB 5AG9A 3VRIB 5L7XH 3DSFH 5L2KD 5M94B 3FQNA 3ZYIA 3FJTA 3T3MF 1UH4A 1KLFA 1KCKA 3MRJA 5J11C 1T21B 1BIHA 5JW5B 4GBXB 4HGMA 3VFPB 5HYJD 3BE1L 3OKNA 5EB9A 3K7UA 1CDYA 2ERJC 2ZUSA 3D25A 3IDUA 2BCKA 1A8JH 1UJ3C 2NY0D 2DLHA 1TJIL 3JWNC 4QXTA 4TUOB 3CLEH 2X7LB 2R1XB 2O61A 1DUZA 3T4AB 3TM6A 3MTRA 3P77B 5TPWL 3RNQB 5C07E 5TJWK 1MJ7H 2UZYB 2DKUA 3M17A 4L29B 4U0QB 3SKUD 4HBCH 2F53A 4AG4L 2X2YA 4Q0XH 4UB0L 2NR6C 2ENSA 3T77B 1RIHH 4GKNB 4YHKH 4RFNC 3RKDC 1B3JA 3MUZ1 4HWZB 3GMPB 2AGJL 1TVHB 3SGDI 1NFIB 4AIXA 3BPLC 2A9NH 1U8LA 2OTPA 2L0DA 3ULVD 4P0DA 4XXCC 4PD4J 2NX5A 2ZJSL 1JNNH 5HVGB 3RX7A 3B9KC 3OKOA 4X5WB 2ARJA 1T1YB 3IDIB 4X6CE 4RAVB 3BT2H 5FCSH 5T33L 5M7QA 3MOBL 1CLYL 1OAKL 5TDPA 4M6OH 3VXUB 1NGWB 2G60L 2MFNA 3HA0A 4FQHB 3H0TB 4W81A 2Z9TA 3I2CH 4OGAD 3K74B 5KSAA 2XZQH 1KIRA 2ZCHH 2RB8A 1A1MB 1JBJA 4NO0A 4GUPA 5EC2A 1AD0B 3IDXH 2ED7A 1A7QL 1DBKH 4WW1A 1DSFH 3FQRB 2XN9B 5D8JH 4RFNB 1ERNA 3EJZC 4OB5L 3I6LE 3BOVA 5T1KD 3NCCB 5EIIB 4WUUD 3BPLB 1RUPH 1CBVL 3VGFA 5MENE 2R4SH 2VXQL 4JG1H 4RX4D 3UTSA 1VFOA 1MIMH 1NFDB 4PRPA 3MZGB 2EH7L 5GRJL 2AXJA 2Y9RT 3IDGA 5FO7B 4BQBA 1OTSD 5GGRY 2AXGA 5IR1B 1WZMA 3WIFB 4PRDB 1J0JA 2J2ZA 5AD0B 1RUMH 5DT1L 3VFVB 3SOBH 4QHNB 4J3UA 4JY4B 2F58L 1CL7I 1T4KB 4X9BA 3HI5H 5I8KH 1JHTB 4XRCA 5FYJH 4M1GL 1UFUA 4GQ9H 4XPFH 3QXAB 5J9PA 3NBNA 5EUOE 3L7EB 4C54A 2FX9L 2I9TA 5FUOH 4KY1H 1RJYA 4OGYL 4APQD 5D7KD 4LCYA 2OTUA 3GSQA 2C1PA 1A6AB 3C87A 2OL3A 5CJ8A 1F3DH 1TVBB 5F9JA 3U1SH 3AVEA 4LHJB 1JZ6A 4Y1AD 4ZFOB 1OTTD 5DJZA 3WIHA 4K7PY 4MAUH 1CE6B 3W0WE 3OJVC 1JF1B 2Z0BA 2D03L 2Q6WA 5C3TA 3VI3E 4LPYA 4BSWA 1ZLUH 3KDMA 4LCUA 3RY6C 4UDUB 4RFOL 2EDTA 2HTKD 5E8NA 4RISH 4NBYB 1KFAL 1HZHH 4PJBB 3Q5OA 4HGWA 5JR1L 4NJAL 3BWUC 3GEWB 2IANA 3F7VA 4EVNA 1K8IB 1PQZA 3RHWF 2WUBH 4H8WH 1HK6A 3PDOA 3CPLB 3UPAA 5ID1A 3OKDA 5B39B 2DD8L 1JMZA 1GZPA 2BJML 1AGDA 2QBWA 2R29L 4U1SA 1YEDB 4OF8A 3QG7L 5HHPB 3FAXA 4R4FH 1BVLB 5FKAB 3ARGA 3M1BA 4AM0A 1NCTA 4HUNB 1Q1JL 1OB1B 1C12B 1SY6L 2VAAA 4ZUWA 4R8WH 3FQWB 4LCWE 1CZ8L 3RWDB 4NKDB 2I07B 1HYSC 3O3AB 4ZAKA 4OGXH 5DZOA 5F9WC 2DOCA 1I1YA 1F13A 5HHMD 2ESVE 4NQEA 4PJ7A 4KXZI 5TFSL 4F57L 3IETA 5EOCJ 5KOVC 4I1NB 2X9YA 4TTDC 1D9KC 5IK3B 4OIAA 5E8EB 1ZHNB 3UZQA 4HS3A 1HE7A 3BMVA 1GZQB 1CDJA 2P5WD 3LQZA 4OZFG 4Y19A 4R4BA 3FB8B 4Y16C 3JWDC 1DVFA 1F6AB 5EBMB 3L3GA 4HZAA 1QLFB 1A4JA 1S7VB 2D31A 4S0SD 3SDCA 4OCLC 2WWKO 3KS0J 2MNUA 2FYYA 4L1HA 1CXLA 3T2OA 4IBLT 3T8XB 3SE3A 5A1AA 4U6YB 5TPWH 3MNZB 5JOFB 1CYGA 4Q58C 4U6HA 2VLLB 4YLQT 4HKZA 4AZ8A 4UB0H 4KTDL 4KTEL 1EAPB 1I1AA 3TVMC 3FRUB 5IWLC 4XCNB 5EU6D 2AGJH 2E6JA 1GHFL 4P99A 2K9UA 1CT8A 3MV9B 2FHCA 1MHHB 5F9WB 1YEEL 4NWUL 4UZGA 3T04D 5C92A 1DLFL 1WZ1H 2YPLA 3WO3B 2IBZX 1BD2A 2ZJSH 3BX7C 4U05A 4OF3A 3JV4B 5F1NB 2C3WA 1F4AA 2F5BL 3CXHJ 1EZVX 3QXWA 5DRZA 2ATPA 1D9KB 3WDHA 4LKXA 5KN5B 1KB5A 4IRJC 5D2LB 3Q6FB 1DN2A 3C2AL 5T33H 4Y16B 5CMAB 3MOBH 1OAKH 3CFJA 4NQDA 3GMQA 4G7YL 5E4IA 1BFTA 5JDSA 4YPGA 3U46A 3NCMA 4N0CD 3MUJA 4F3FA 1S5HB 4ORGA 4JPIA 4AEEA 2W9DH 2Y7QA 4C83B 3JWDH 3R8QA 2CIIB 5D1ZA 3SDDC 4Z77A 1JRHL 1MFAH 4XWOC 4ODTL 4NNXB 3HI6L 1IGYA 3CLFH 1A7QH 4CADB 2JF1A 3QUXB 4PJAF 5D6DC 2BVPB 2APFA 3TVMB 5IMMA 4OB5H 1UQSB 1A9BB 5D7LB 1E27B 1I1RA 2QSVA 2ZSVA 2DKSA 3HZVB 4QYOB 4U6XA 3NAAL 3D0LB 4KROB 3J7HA 3ZT5A 5GRJH 3GHBL 1J8KA 1GL4B 4PGCB 2EDXA 3QI9C 4FQXA 1KTLA 3P11L 4MJIB 4PJ9D 3NCJL 3FFCD 3U0TA 4HIEB 4IRJB 4OZHB 1T0MA 4P2YA 1F90L 3LN4A 1RK0B 2Z8SA 4HLZH 3H9HA 5IIEB 1FG9C 2F58H 3PP3K 5BW7C 3WXVH 1HDMA 1D5BB 4M1GH 4GSDL 4G6AD 1G0XA 5L6YH 2FX9H 1RD6A 4KHTL 1N5YH 3OPZL 3SDDB 3QDJB 1IRAY 1JUFB 5IM7B 2ITCA 1Z0NA 2I25N 2A6DA 3STZB 1F4XL 3ZE1E 5DVMA 2KBGA 1ZTXL 5SX4H 4P3CL 3CUPB 3BP4A 3T09A 1X5ZA 4RFOH 4L3ED 2A9MH 5JORA 5L2KE 4RIRB 4KUCD 4YO0A 2F8VA 3MMEA 3GSOB 5EBLB 1KFAH 3MCKA 4NQSB 2H45A 3HUJB 4NJAH 4QHKJ 5FGCE 3L3OB 1XGQB 3QI9B 4R97C 2YXMA 5D1QA 2NY7L 3H7BB 5E1AA 1ZSDA 2P8LB 4YIQA 8CGTA 3V7MA 4PBXA 2V17L 2V2TB 1OGAB 3EZ8A 3QG7H 4GQPH 1I4FB 2VITA 2D0GA 2R8SL 1D5XA 3MRDA 1OLZA 4EUPH 2FR4A 1Q1JH 3KXFB 1SY6H 4JG0L 5BS0A 5HYSG 1CLZH 4GG6E 1HOCA 4HUWB 5IFJB 2BSTA 4AIZB 1U8JB 1WC7B 5KSVA 3ARBA 1LK2B 1CZ8H 4XCFL 1I8IB 1JTPA 4MB3A 4G80A 4OF0A 2FCBA 4K7FB 1T22B 5DDHB 4PY7A 4Z7VE 1INEL 4HUMB 4YXLH 2W9LA 4NBZB 5TFSH 3SQBA 5D6CA 1HH6A 2GW5A 2GY7B 4OQTL 4EI6A 3EO0A 4QTHB 1AKJB 3M45A 2GAZB 1VACB 4Y5VA 2EDBA 3DV6A 4H26B 4LASL 4M03A 2NNAA 3TIEB 4XPAH 1J0ZA 4J8RB 1ONQA 4JM2F 3VXSD 1EV2E 4DOHE 4P2QA 4R97B 4BUHA 3NH7H 3C8KB 5KOMC 4UV7L 1HSAB 3WS3B 3UJTL 3UTQA 1CLOL 3L3KB 5L0QC 2DAVA 4YDVB 3L6FB 3R0MA 4UOJA 1X6NA 3EDKA 1FVDA 4TOYL 2BY3A 1HNFA 3BI9X 2ZOLB 4ZOEA 3FN0H 3MLZL 3OWEA 4KTDH 5F7UA 4Y5XA 3V4PL 4XNUL 4MJ6B 5IOPA 3RWJB 5CUSH 3E8UH 2E7MA 3WIIL 1G7HB 1YJDC 4XAKD 4ONGL 4NWTH 2VZUA 4PJGE 2W60A 4WW2A 5F7NC 5ISZE 3WSQL 4S2SB 3BD3A 3D48R 4NWUH 2R2BB 2GJ6D 4LAJH 3KVQA 5DJ8A 3CDGB 1QR1A 3BFOA 4YBLC 2LQRA 2IFGA 4YEFA 4GRMA 4P4KC 4RNRB 5BMFL 4K3DH 3PP4L 1VA9A 3C2AH 4WWKB 3PDDA 4H25B 4HIIA 2QKIA 1NJ9A 3V2AR 5FKPA 1OHQA 4KAQH 4PRHA 3SBWC 4D94A 4YXKL 4HLJA 5DRWB 1H3XA 1LEGB 2V2XB 3RUGB 3QEQB 5TF1H 1QHPA 3QEHB 4OLXL 1LQSR 1JRHH 2ENYA 3MJGX 2VZOA 3AXLA 4MQXC 1XF2B 4QRPD 4JRYD 4Z7UB 4X7FC 5JW4R 4GG8B 3VFOB 1G0DA 3LIZL 4QXUL 5DQ9A 5GZOD 3WE6A 4X7TA 4Y1AE 5IEKB 2JB5H 5JA9A 5CIPA 3O8XA 3GMMA 5FUZH 1DQLH 4JFDA 3W9DB 3WJLA 4I3RL