1J1PL

Crystal structure of hyhel-10 fv mutant ls91a complexed with hen egg white lysozyme
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
b'DIVLTQSPATLSVTPGNSVSLSCRASQSIGNNLHWYQQKSHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQANSWPYTFGGGTKLEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lysozyme binding Ig kappa chain V23-J2 region
molecule tags Immune system/hydrolase
source organism Mus musculus
publication title The Role of Hydrogen Bonding via Interfacial Water Molecules in Antigen-Antibody Complexation. THE HyHEL-10-HEL INTERACTION
pubmed doi rcsb
total genus 24
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2002-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1j1pL00
4Z7NE 5C08A 3MV9E 5I0ZA 4XNZB 5HGBA 2VSDA 2YXFA 3F7YB 1N7MH 3K46A 3KYMB 1MRDH 4EUPH 4OCWL 1C5BL 1CL7I 1IGYA 3NACL 4L9LB 2X1PA 3BJ91 2HFEA 43C9B 3BEWB 1FLRH 1M05B 3L9RB 5CJQH 3TESA 1QSFA 1R5IB 2MTPA 1G9ML 3O81A 3MRFB 3OG6B 1EZVY 1F8TH 2XQBL 3FQTB 5F1IB 4L3EE 4L3AA 4NFDA 5IMOA 1EMTL 5ACZB 3BT2L 3NIFE 1IAIH 5IROA 3P77B 2MCG1 2FDBP 1RFDL 2EIZA 4LEOA 2WANA 1KEGH 5H37G 4HWEH 5C08B 4RDQG 4WV1C 3WIIH 1ZTXH 4XC1H 5J1TC 1T7WA 4U1JA 1TVHA 4EOWL 4OI7A 4WFHE 4QWWC 4F33B 3MRJA 4HULB 2EDBA 4M48H 5B4MC 1JIBA 1DBML 5SX5K 5L9DH 5IUSA 5ERWB 1N59B 3C6SB 4P3CL 4PBXA 1MJ7L 1RZ7H 3MJ9H 1SBSL 4JO4H 1DUYA 4N8VG 4WI3A 3TVMD 1ULVA 4FQLL 5ICYA 2P7TA 3MNVB 4G43A 3UPRA 2DMKA 1UACH 4L3ED 1FAIH 5IB5B 4OCNC 5T1DH 4IJ3B 1Q94B 5IVXB 4I9WE 2MQ0A 1AGBA 3ISWA 1MCBA 4X0KB 3WO4C 3RX5A 5ALBH 4Y4KA 1A6TB 4YDJB 3BQUB 1MEXL 2Z31C 3CXDH 2FO1A 1U91A 3LCYA 4ODXA 4N8CH 3VCLA 1T66D 5MEOA 1AJ7L 7FABH 3VA2C 4GAGH 1GGTA 4YXKH 3D25A 4N1HB 5CUSL 1INEH 1BFVL 5I30H 2KQNA 2BHZA 4X8JB 4NYLA 1NAKH 2CH8A 1P6FA 2UWEE 4XBPA 1HSAA 4HKJA 5JPMA 4IDJH 2VABB 4XCCL 5EN2B 1GSMA 4PJ9C 2O26U 1P1ZA 5CHNA 5ETUB 4UDTA 1W0VA 3O4LD 4RMVA 3CFKB 5CEXA 4GG8B 4QCIB 3T0WA 3BP4A 3BPOC 1G0DA 1CD1B 1MUJA 4O51B 5D7LE 5I15H 1ZKAA 4L29A 5I9QC 5E8OA 5I8OH 5L0QB 3QIBB 4KQ3L 5DJ0B 1K6QH 3IDGB 4TNWK 2AJVL 5F7WC 3CMOL 3U4EB 2E6PA 4C83B 5D1QC 5C09D 5DC9B 5HPMB 4PRIA 4FA8A 1PJ9A 5I75B 5C6TH 2AK4D 4PGDA 4GBXA 1JWMA 3I6KB 4E41A 1MI5A 5D7JD 1H3XA 1AQKL 3IDJA 2YD8A 4ORGA 3CH8A 3BIKA 3Q6FB 3QEHB 4P5TA 3TN0C 2CR6A 1D5ZB 1FNSL 4FRWA 1OM3L 4MJ6A 4NQDD 2A6DB 1I8MB 2XY2A 4NO0B 2NY4D 1QG3A 5J12C 4J3SA 3RVTD 1NAKL 4J1UB 3OXRB 4QHMA 4R7DB 1A0QH 4HDIA 2W1NA 5FUZL 1W0WA 3MLRH 2WMPA 2YPVL 4G8GD 2AK1L 5FECB 4X7EC 2VISB 1DTUA 1ZANH 4MXWL 3FN9A 4XRCA 1A3QA 5CFHA 4TOYH 1FNEA 3HLAA 4OIBA 3OPZH 3TPUB 4CBPA 5F9OH 5DVKA 3JV6B 4BQ6A 4EIGB 4Q9RL 4J4PD 3RP1A 1WWBX 1W72A 1BVKB 4O2FA 3DO7B 3QIWB 5I30L 4APQD 1RAMA 1U8MA 2Q7NA 4JY4A 4R2GD 5GGSY 1NGPH 2JJSA 3WXWL 3TO4C 3SKJL 5KVGH 4B50A 5ESAB 2YN3A 4XNYH 2W59A 5E7BA 4D9LL 4HIXH 4PRIB 2YSSB 4PTTB 4PJHB 4FZ8H 1EFXB 3K2MC 2NY1C 4TSCL 2FGWL 4YK4B 3KPPA 1UFUA 2AJVH 3NZHH 3OHXA 3LQAC 1MFDH 1GZPA 1F3JA 3HAEB 3CSBA 4J8RA 1BZ7B 4U1NB 1J05B 3MLSH 2E8YA 5C6TL 4A2MA 1VFBA 3D6GA 1NCDH 4W6WB 4YHIA 3LY6A 1T5XB 4PJ5E 2B4CH 2BVPA 3PWPD 5D7IF 1CE6B 1S3KL 4NUJB 5GRVK 2X4PB 3B43A 3UTZA 4WCYL 3WNLA 3NPSB 5A40E 4ZNEE 4XMPH 4ZSOE 5IMMB 4L5FL 5T1LD 1E6JL 5JDJA 1HKLH 3MLWH 4QNPF 4JVWA 4L4TA 1IC7H 2IPUK 4IBLT 3V6FB 3NA4A 3D39E 4FQ2H 1RZKC 1CGVA 5F9AC 2ZUVA 3Q48A 1RUPL 4OQTL 5IB5A 5A1AA 5INCA 4H20L 5DQDL 2XT1B 4DKAA 4EZMA 5ADOH 4WUUA 3VGFA 4N8VB 1M7XA 1B4JH 3VXUA 5DFWH 4HUUA 3HI6L 4IOIA 1F4YH 4DKFL 4AK1A 4WFGE 4YJZL 5C0ND 3ARTA 4ZFZA 4KVCL 3GIVA 5MEND 1BGXH 1S9WA 1T0MB 2OM5A 4KZEL 4CMHB 3RWIB 4GRWH 5J3HD 1MRCH 2KH2B 2YEZB 3DSFL 4HMCA 5INDB 5GJTL 2MKLC 4X9IA 3CNKA 1QP1A 4ZFOA 1BAFL 5SWZD 1FO0B 1D6EA 1NEZB 2BFVH 3O2VL 4LMQI 3QHFH 4N0UE 1P9MC 3MLZL 2JB6A 3UTSE 2RCSH 3LS4L 1JGVL 3RPKA 1MCEA 5I1DA 4M02A 4L3CA 2A6KA 4NQDA 5IB3A 2H41A 4PJ5D 3HCVA 2LE9A 5E00A 5L2KA 4AL8L 3QUZB 3HE6C 1WBXA 3O3UN 2IANE 3UCRA 1KTDA 2MPAL 1A7QH 4WVRA 3W39A 5I1JH 1IC5L 2F5BH 4E41D 4TSAH 4O5LH 4HPYH 1HDMA 1D7FA 1VGEL 1Z2KA 3W0WB 1F8TL 2XQBH 4CMMB 1E4XI 3N1PC 5IMKB 4J3WA 1DN2A 1RIUH 1NAMH 3GMOB 2Q7YB 4ETYA 5JPNB 1CXHA 5CGYD 3AAZB 5EG6C 4UTAH 3HI6H 3PXHA 3TCXA 5HHQB 3T4AA 1M1SA 43CAA 2BERA 3I84A 4R26L 1C1EL 1Q9WA 3GI9L 2A9ML 3THMH 3OL2A 4LLMA 1T1ZA 1F4AA 3WJJC 2PYEB 2H26A 4NQSA 4NZJA 1KB5L 1SBSH 2DM7A 3S8WA 1ORQB 2B0SH 4R2GC 1EAPB 3AU1B 2Q6WB 4M7ZC 4YO0B 4YHML 4LLVA 5F8QC 4I18A 4QTIH 1VFUA 4DUVA 1LO4L 1LK2A 3MRHA 3H0TA 2DQFB 5EOTA 4Y5YC 4GMTL 3RI5K 4ORZC 4RWYL 5F3HB 5DK0A 1NKOA 1S78C 1YEHH 2YD2A 1BIHA 1UG9A 4OLYH 1NDMA 5CD3A 4GKNA 2PO6B 1MEXH 3DSFH 1QFWM 1X4ZA 2OK0H 1E4WH 5DRNB 1IAKB 4Q0XL 5EU4B 3TV3L 3ZYZA 4FQXB 4UI2A 7FABL 4PRAA 3KDMA 4YDVA 1ZVSB 3B2UD 1AFVL 5IJVB 1D3CA 1W8NA 3O3AA 5I1HH 1YYLH 4GQ9L 4MAYD 3N50A 5CSBA 4DFIA 4YFEA 3RNKA 5D1XC 5J0BA 4G9DB 1FORL 2HLFC 1J1PH 3HFML 4XXCC 2J5LC 1AC6A 2XKUA 1BHGA 3BHBA 3HZMA 1KF9B 4DVBA 5T1MB 2W9EH 4ZFOL 3CFJB 2CJUH 1BQHG 3D69B 1CZ8L 1AHWC 5A2IH 3CFCL 3GKWH 1ZLVH 4PBWD 4OBRA 3O3DA 4Z5RA 3QEUA 4G3YL 3JUZA 3N85H 4O2CB 4MNQE 1WWAX 1L9MA 2X9XA 1MJUH 1RK0A 1WJ3A 2D0GA 3QULA 1TLKA 3DI3B 3OKMA 2NR6D 1L7TH 2Y7QB 3O2WL 4IMLB 5ESVA 3P4OA 4FQJL 3THML 1EXUB 3RNQB 3SDYL 4N9GA 4NN5C 3T1FA 3MV8A 3TN0D 3SQBA 2DRUA 2X40A 2F8VA 3T0ED 3QUXD 3FB5B 4XP4H 4ZDHB 2ZCLH 5I1CH 3H0TB 1S7WA 1WUNT 3C60C 3QQ4A 1PG7W 1QA9A 1BX2A 3MGTA 4D9RE 1KT2B 1S7VA 2VLKB 3KPRB 1I8LA 4LSUH 2VITB 2VXQH 4GXUN 3MRBB 2D0FA 5GIRA 3ARWA 3GKWL 2I9LB 3L3JA 1FNGB 1OLZA 1R3HB 4KKAD 3H3BC 5EOCJ 3HI1B 4U6HB 4TUJA 4MXWH 4BFIA 3VGBA 2HRLA 4NSKA 3BH9B 2E9IA 2RB8A 1ZTXL 3LN9A 4U2YA 5EO0A 5BS0E 4AIZB 1NL0L 1KGCD 4OFDA 4WU7A 2EXWC 4M93B 4MAYA 1U8LA 4HCRL 1C5DB 4KTYA 1ED3A 3UBXI 3VFRB 1T89A 5BS0B 3HZVB 3WFBL 3ULSB 1BFTA 1JPSH 1P4LB 5D8JL 2ZSVA 3BEWA 2ZOKA 1DVFC 5C0BE 1OT1A 4OCXL 4YLQT 1MCWM 4FZ8L 2ZG1A 1IKFH 1JPFA 1MFBH 2AJZA 3VDBA 2L7JA 4AG4H 5JOFA 3PWNA 2VL5A 3X11B 5E2JA 5HHOA 2J4WL 3X3FL 1AO7D 4OV5A 5BO1H 2JKXA 5SWSB 2XRAL 5D7LB 1L7IL 1A1MA 4JPIA 3B9KC 5F96L 3D18A 1KENH 3CD4A 3W9EB 1NFIA 4LASL 1FDLL 3T2PA 4P2QE 3V6OE 1ZEAL 3MUY1 3UJJH 4ZFZB 4JZJA 3V6OA 1WISA 1JMXA 1IZKA 1UXSA 2YA0A 5TFSL 4HUWA 3SGKA 1Q0XL 4R0LB 2PW2B 1A6WH 1EV2E 3BDXA 2DAVA 4WW2B 4Q9CA 2AGJL 4PY8J 3OWEA 2XIDA 5KVDL 1YPZF 2P1YA 3IF1A 3DRTA 5E70A 3DGGB 5B22A 5CIPH 4Y2DC 1MHCA 4G5ZL 4JKPL 3FB6B 1M7IA 3DMMC 3WHXB 4GXVH 3BEVA 2I9TB 5ID1B 4NP4L 3L95A 4OGAC 1QYGH 4Y8AA 2EIBA 5I1AB 4TPRH 4WRLA 3RWCA 3HRZB 1F6LL 2G60H 2Q8AH 4U1SA 3G5VA 4OZGA 1BQHB 1CLOL 1FL6B 3DIFB 3MBED 5E2VH 2BRRL 2X4PA 4Y4HA 2BP3A 4RFEB 3AROA 4H20H 2FBOJ 5DQDH 5ADOL 1KLUB 1N3NB 2AEPL 4XNXL 1NGZB 2FZ3A 2J3SA 4POUB 4JGUA 2BNQD 1BLNA 1QRKA 1LO5A 2NW3B 2QHRL 1F3DJ 2JF1A 4RGND 2JK5A 2MQCA 2QQNH 3QFDA 3TBSB 2IEPA 3FT4B 3FQNA 2ORBH 4KH2A 4PRHD 5IWLC 4HWZB 4HPOH 3KLSA 1PKQB 1RHFA 2OLDA 3OZ9L 4OZHE 5J13B 4OCMC 3FONA 4S1DC 3F7VA 4LSPH 2K9UA 4ETQA 5D7IB 3QHFL 5JOPD 4Z77B 5SX4H 3S36H 3GSUA 3U2SB 5E8NB 5FYLH 2NY2B 2R1XB 5D71L 3VDAA 1LEGB 4EI5D 4Z7VE 1PQZB 2GSIA 5CBEA 2YS4A 5F9JB 2I5YH 1S8DA 2D03H 3UJTH 3OF6D 4H25A 1KTLB 3ZYOA 1V7NL 1P7KB 2GAZA 5D1QA 4F7PA 2MCPL 1IT9H 5SX4I 2NY6B 3S3PA 1XF2B 2KZWA 3KR3H 4L8SA 4RNRB 3RZWA 2R0WL 4AENB 5IGXL 5C70A 2Y06L 1EERB 3MRPA 3ZSSA 3HRPA 3U30C 4RAVB 4E9LA 3B9KA 4LDEB 4CVUA 3QUMH 4P3DA 3BN3B 4I3GA 4PD4K 4XAWH 1IKNA 3F5WA 4Q9RH 1LGVA 4ERSL 1U95B 5JQ6H 2E7MA 1FNEB 3EDEA 2X4UB 4AT6B 1OP9A 5HI5C 3TF7C 5GRUH 3ZL4H 2C1OB 4P2OD 3EFFA 4RAHA 4BH7A 1G6VK 1U6AH 4TPRL 3UAJD 4AY0A 4QHKI 4WI9A 1E4XL 1ZHBA 3AFLA 3F7PC 2YD5A 4MB5A 1H0DA 4P2QA 1AGCB 1PBYA 4JY5L 1XF3B 1ZLUH 2Y5TB 4KK8D 4X99B 5EOQL 4P3DB 2PNDA 3PABB 1LEIA 2XKNA 3H7BA 2FIRT 3RY4A 4FNLH 1QPPA 1BZ9B 5KANI 3QUZD 4PJGF 3GMQB 1MFDL 1RURH 3IDJB 1XF4A 1JF1A 3UROR 3W2DH 3OKNB 3QUMB 3I6KA 2BSTA 1SYSA 1J18A 5I74B 2EYTB 4FZEH 2DMBA 1I85C 4QHUA 1OB1A 3IDIB 4GS7B 3QXAB 3RHWF 4JY6A 4OF3A 4PLJC 1BZQK 3T3PF 2QADC 3ULUC 3IDGA 3GSNL 3RJQB 3SDAA 3CFBA 5DXWA 1A1NA 3CZFA 1OAQH 1QR1B 5EFIA 4X4ZA 3KPNA 4CADB 2ZWLT 3ESUF 5JHLL 4D8PA 3VFMB 1VPOL 2X1XR 4FQHB 3EYFA 5FDWB 4IRSD 4RISH 4JR9H 1JHKL 4PJEB 2R0WH 5C9JB 1CICB 3I6GA 3TZVC 2EE6A 3N1GC 1NGXB 1P69B 3K2UH 5E6ZA 2X4NB 4MD4A 3GMNA 2XA3A 4MCZB 2YD6A 1F58L 3DYPA 5CKGA 4MQXC 3T04D 1GOGA 4BH8A 1UZ8A 5IG7B 4G8IA 4ZTPH 4R97B 5DWUH 4HBQA 1AGEB 4L1DA 2UV3A 2HT2C 3TO2B 1NBZB 2VO5A 4Z7VA 4TNVF 5L8KB 3CLEH 2H2SD 4LCYB 3R4DA 2FO4B 2GUOA 4Y2OA 5DJXB 4LPVA 4TSBL 3ULVD 1SJEB 3QNXB 3MLTB 4S1DD 1NJ9A 2H8PB 2IMNA 1L6XA 2I27N 2FNBA 1DE4B 1YEDB 4MQSB 1A7PH 4PJ7B 1MLBA 3D2UA 2R4RH 1N59A 1MCKA 3P9LB 3SDCA 4QRRD 1HXMB 4AMKL 3FT2B 1KC5L 1UM5L 3FFDA 3IKCB 3F12A 4P23D 1DBJL 4EN3A 5D5MB 4NM4L 1GIGH 1T3FA 5FO7B 5L7XH 4MLIA 1MFNA 1ZVYA 1MCDA 5JDSB 1AR1C 4OF5A 5GSVA 1RIHH 4LCWA 3V9FA 4M62H 5GGSB 3UTPD 3BGMA 5LQBL 1ZLSH 3TZVD 2HFTA 1RJYB 3C8KA 4DGIL 1FGVL 3QXTA 4Y0GA 2UZIL 4LNRA 3O6MH 3QDJA 1E4JA 5BZDB 2V5YA 1R5VA 2EECA 2P5WE 4EN3B 5KG9A 2R1WA 4P2OB 4U7MA 4QHLA 4AG4L 3QISA 3IXTB 5CMAA 3KWWB 1QFUH 4TUJB 1OL0A 1UZ6F 3LD8B 4AQ1B 1YJDL 3RDTA 1ACYL 3GBML 2C4XA 2HT4D 4F3FB 4R4NC 4W81A 4K2UL 2YPLE 5IT2L 1KULA 3T2NH 1T1WA 2NY4C 3RVTC 3BZ4A 2A9NH 2AK4A 1JNLH 4W70A 1QFWL 1ZGLB 5TDNA 2NY2D 3V6OC 3VFVB 1EEQA 1CVSC 3U48A 4RX4A 4U0RC 3FZUD 4M7JH 5DVLA 4F15C 4PRPA 3C5SA 3MJ8A 3UZQA 2GT9A 5I1HL 2ZPKH 1A9EA 1LP9F 1BM3L 4U6YA 3EDKA 2V2XB 1J1PL 1V8HA 4XCEB 2VDML 3VA6A 5FB8B 2P8PA 2A74A 3I02A 1A7NL 1IQWH 2ESVE 3L1OL 2QBWA 4DOHE 4XZUA 1R3IL 1YQVL 4TVPL 4H1LB 4YEFA 3DX6A 4FFVC 1KJMB 2FJFB 5B38A 1TJGH 4CL7A 4TQEH 2GY5A 4HH8A 5ISZB 3GK8H 4W6XB 4LCWE 4WWKA 1CTOA 4G6AD 1XCTB 3DX9B 2DIJA 1L9NA 3WBDA 2BXZA 4LDOB 5BRZA 1U8PB 5GRWA 5T3XH 4NKMB 5CP7B 3QRGL 4XWGL 3NN8B 1B4RA 3JWDH 3U36B 3LEXB 2UZIH 3NA9L 2P4AB 4NZTL 4KGLA 3JWOC 1T21A 3BH8B 4M43L 1ZVSA 2WUBL 5I1KH 3UEZA 3TO4B 1CDHA 2A77H 4NQUA 1JN6A 4GAYA 1U9KA 3ARVA 3QZWA 5LAXA 1YJDH 3QDMD 4ELME 1Z6JT 2DKUA 5L8LB 3HG1D 3L3OA 1JZ6A 2XFXB 5DHVA 2FX8H 2C5DC 2BVYA 2DWDA 2AQ1A 4EI5B 1HHKA 3DXAA 4PRNB 3MV7D 1EHLL 3NVQA 4Q6YA 3DXAE 4G8EA 1D5IH 1SYVA 3O8XC 4U31A 5DMKB 1WCBA 3PP4L 4QTHB 1HH6B 3B8SA 2W0FB 1ORQA 5EPMB 3BDYL 3HI5H 5KN5A 4LLYA 3PF2A 4V1DE 3HZKB 1ZGLA 3RL1A 5ICXB 2E7CA 4G7VH 4P2RE 5FOBA 3LV3B 1M7DA 2XWBB 1U6AL 4QXGL 1ITBB 3RVWC 2A6JB 4PJCF 3KYNA 5IM7A 2ERJC 3SDCC 3K8KA 4YGVA 3KYOA 5HHQA 3U6RB 4HBCH 2EDOA 2C4FU 5DEGA 5KSVB 5BRZE 2J4WH 5LGJB 2FR4B 5BO1L 3FKUS 5JXAH 5IB1B 5EU7C 3PV6B 1HHGB 4PJDA 1MCQA 5T5NF 5E5UB 4Y2DD 5EBLB 2HJKB 1TJHH 3TCLB 4JFEB 4ZAKA 1LK3L 1DQDL 3W11C 5IESL 4FFZL 3SDAC 1NCTA 2FCBA 2HT4C 1O0VA 3ARFD 2A83B 3C2SA 5I8CA 3HUJE 3VMNA 2QR0A 3C6LD 3MV7B 1T2JA 3QQ9C 1MWAA 2GIYA 3SQOH 3LB6D 2A6IA 2ESVA 5KAQF 4XP5H 3U7AA 4X7TB 5EH1A 4HT1L 4HWZA 1PLGH 3VWJB 1SVZA 1NDGB 4X9GA 4ZFFB 1J12A 3K74B 5ENWA 1I7UA 4XVTH 4LVHC 2DQHH 2FIKA 4HGWB 5HYJE 2HAZA 3TZVA 3W0WE 4PYHA 5ENWB 3UTSD 4N5ED 3SGEI 3D0LA 2J8OA 3D3VA 1Z5LB 5TE6L 5LGKA 4MAUH 1MIMH 1FYTB 2R0LL 1JHKH 1X5GA 3L3HA 3PL6A 4JDTL 4YHPB 4G42B 2IMMA 3VXME 3HE7C 3GEWB 3VI4F 2H8PA 2UWEB 5MENE 4PV8A 1YUHB 4DGYL 6FABL 4JFEA 4Y4FD 5EBGA 4O02H 5KW9L 5EBLA 5C0AA 5DMIH 3VI3E 1LK3H 4KDTC 4ZUTA 5F7HA 2H2SC 4ZPVA 5LGJA 1DVFD 3SKUD 1BQSA 2EDDA 2HRPL 3ULVC 1HQ4B 4P9HC 3P11H 1CD8A 1SMAA 3AS3A 5D2LE 4ZUVB 4Z7VF 1H5BB 4HUWB 4M6OH 3U0WH 5C3TA 5BW7C 5FYLL 2F54E 4Y5XC 5D5MF 3DARA 3QHZL 1Z5LA 1N2RB 3V5HB 1J05A 2WIIA 3DV6A 5DYOA 2R15A 3UTPE 3I3DA 3HR5B 2H32H 5SWZB 3QDHA 1N5AA 2DJ4A 4G6KL 1C7SA 3VWJA 2FYYA 4S0TD 1H3VA 2ZNWA 5A2LH 1U3ZA 3Q5YA 1HSBB 6FABH 1CLYL 2HP4A 4JG0H 2ED9A 4WHDA 1AP2A 1SY6A 2A73B 4Y1AD 3SDAB 3V7AG 1RMFL 5IJKA 1CXEA 4JY6B 4KK8C 3CFEB 1QHPA 4U1HB 2M1KA 2AJYL 3I6LE 5J8OA 2P49B 3BIAX 4LMQE 4PJBB 1G9NL 3IJYA 3S5LA 3KLHD 2AI0H 4L8SC 1HHIB 3LKQB 4JM2A 3L5IA 4Z7WA 3VD5A 1T22A 4YQXL 2RAMA 2NR6C 2Q20A 4O2FB 3RVUC 1SM3L 1R24A 4XT1C 1T20B 1VCAA 3BH8A 4LSTH 5A3ID 1W2KT 4JFEE 2DQIL 1MPAH 4NHCL 4WTXA 1D6VH 4PS4H 1C16B 3GO1H 3T0EC 3SBWC 1Q9LA 4PLJD 1UJ3B 5KW9H 3O45A 3C60D 2GJJA 5HGDA 1EGJH 5J57B 3K1DA 5L88L 5DFVC 5DMJB 1K8DA 3PNWA 4Z0XB 1X6NA 2K1MA 3AUVA 1T1YA 5J6HB 3E8UL 2HYMA 1BP3B 2G5BB 3P73B 3Q2CA 1VHPA 3M07A 4NQCA 1VACA 4ZPTB 3P11L 4KK5C 1HIMH 4KDTA 4KUCF 3WNNA 1D9KC 3DMMB 3BP7B 3RU8L 1I9JL 3CUPB 4HLZH 4EI5C 5KVMC 3ELAT 3WSQL 2DIBA 4ZXBC 3TFKC 2M8XA 4AEIL 4J3VA 5IW1B 1FFRA 3QDAA 4CKVX 4I2XA 5MENB 1ZHKB 3ULUH 1KCLA 3JTSB 3O9WD 2AV1B 3FB7B 3QNYB 1JWMB 1UB5B 2ICWB 1MF2L 3CPLB 4PJ7F 3TH2T 2VDNH 4F7PB 4GSDH 3UO1L 4FFVD 1KIQB 2V7NB 3N1QC 3WIIL 4N9OB 2AXJA 1OTTC 2Z4QA 1KCRH 3RWDB 3FQUA 1TFHA 5CD5C 3K2UL 2DQIH 3G04A 1S5IH 4FTVD 3TO4A 4XBEL 3H2WA 3RVVC 3EYSL 3QIUC 1YEIL 2X10A 3GSUB 2NYYC 3QIWD 5CZKA 4HWUA 3BUYA 5C09E 4X4YA 4OJFL 4KMQA 4U33A 1I9EA 1LEKA 4PBVC 1P1ZB 4DGVH 1GGIH 3FQNB 5T3XL 1DVFB 1QD0A 3LVEA 1FVDB 3FQXA 1XR9B 5LVEA 1E6OH 1L0XA 4C56B 2OTWB 4YQXH 3TVMC 1J0HA 4UTBL 4KUZL 2EDKA 1JP5A 3I9GL 4XMKH 2IFFL 1U92A 1GAFL 2ZNXA 2A77L 3BOVA 3VXUD 2X4OB 3AVEA 1L0QA 4BK4A 5DA4A 4K7FB 3VJ6B 5EU6B 1BQUA 4QRRB 2Y07L 5FHBH 5EBMB 5DHYA 1Q0YH 1TQBC 2DLTA 2IG2L 5GSRA 1VFAB 3GNML 1WFUA 5E9DA 1JWUB 3RHWK 5E4EB 4I4WB 1KB5B 3PHQA 1FFPB 1OTUC 4IRJA 3U0TA 2Z35B 2QKIB 5T33L 1XZ0A 2H3NA 2OR9L 4PR5B 5AWNL 4M7KH 4R0LA 4NM8L 1IEAB 2E27L 2ZOLB 3BDYH 5DLMH 3TH3T 2P8MA 1AO7E 4HWBH 4S1RH 1FL5A 4M1GL 4HV8A 2OP4L 4TNWF 4HFWA 4OCRH 5TDPA 1FGVH 3RDTB 5D1ZC 43CAB 4WI7A 4ZUWB 1AIFB 2VDLH 3U0TB 4K9EL 1A9BA 2WK2A 4TUKL 4JFDD 3MBEC 2DWEB 3AB0B 5H37H 2ARJB 2YA1A 3BRDA 2CKBH 5FKPA 4HG4K 1NBZA 2PYEE 1JYWA 2OL3A 3GBLA 4YDIL 2RHEA 2CLRA 4OD2A 4CNIA 1EFQA 4I48B 3RX8A 3FQWB 4JFOB 3DVNA 1JNLL 3FJTA 3NFSH 2FH6A 5GZND 2VWEE 1HINL 3PWUA 1DEDA 1VB9A 2VQ1B 2IPKB 3N9GH 4NGHH 1UM6L 4Z18A 1ADQA 4MB4A 3SQOL 2NY3D 4M7LL 4GW5A 5IBLC 2CKNA 5B8CB 2G9HB 4MA8H 3K0WA 3ARYA 2CK0L 3HG1E 3CZJA 3AM8C 3QDME 1YMME 1R3HA 3D2UB 4MNGA 3BKJL 1A7NH 5DRWB 2PXYD 5JW5A 1EUUA 4C4KO 1YNLL 2VLKD 5ILTL 2B1HL 5FUOL 4DN4H 3O11B 3MMEB 4UOJA 3SGDH 3TJHD 5DC0A 5J9PB 1EGJA 1DZBA 3EJYC 1AXSB 5C2UB 1XGRA 3BW9B 4OD1L 4H88L 4FTVA 5AEAA 3TO4D 1QBAA 1AR1D 2HVJA 5DSCB 1XF5A 4G9FB 2LTQC 2FL5A 2VAAB 3WIFB 4P5KB 2XA8H 3CC5A 4M1CD 2LTQB 1RZGB 3RVVD 3VFWB 1GGCH 5FKAA 2NYYD 4R2GB 2ICWI 3X12B 3ZKND 4Q6IC 2VN7A 3TT3H 5BVJA 2JE8A 4K7PL 5DJ8A 1DBAL 3TT1H 3MBEB 3HC4H 4IRJC 2CD0A 5C08E 5I1GH 4Z7OF 1TQCC 5HHPA 5EC2B 4BSJA 1YEKH 2WZPD 3O6FA 1F42A 2IAMD 5C0BD 2NY5L 4I18C 5FGRA 1AJ7H 4D0CA 1IQDB 4G8GB 1TENA 3OG4B 3UXFA 3S34L 5F7FA 1UWGL 3R8BB 1LO3H 2EC9U 4QHKJ 3VWKD 3LHPL 2HFFB 4HKZA 3ZKXC 2EYSB 3KPSD 4GO6B 1NC2B 1MCJA 4HEME 3C6LA 4UQ2B 3ARFA 2OI9B 5HTSA 2AQ3A 2J6EL 4K8RC 1CLYH 4KTEH 1IM9A 2WBJA 1S7QB 2WBKA 1OB1B 3IDIA 2YR3A 5DF0A 3NCJL 1S9YA 5BCAA 1RUML 3QFJA 4BKLA 1NC2A 1S7TA 1F11B 3ZDXF 4K94L 3ULVL 3ZT7A 5C09A 1ZT1B 2HFFA 4M8QB 3RVUD 3O6LL 2YZ8A 3TJHC 3BZFB 2CDFB 1T21B 3K7UA 5IF0A 4KDWA 1QPXA 5EOTB 2BHUA 3MLUH 5CJOH 2HT3C 3OJ2C 4RGOL 3MRHB 1FH5L 5F7EH 2WW8A 3STZA 2NY5H 3NIGE 4OTXL 1OP5K 3VFPA 3O6FB 3AY4C 3GO1L 1X5LA 3CGTA 5JXAL 1XFPA 1MFCH 4HUVB 3HNTL 2NW3A 4MA1B 4K94C 5C08D 1F6AB 1FRGH 4UDUA 1IGFL 3JWOL 3TBWA 1YYMH 5CGMA 2AXGA 3UJIL 4U0QB 5HHPB 3MJ7A 4MJ6B 2ZUYA 1TQBB 2PR4L 4MHHG 3ORJA 4QRRE 4G8FB 1N6QH 4JRXA 3BZEB 1MLCB 5HDQH 3HRZA 3D39A 1S7SA 4E41B 3TIDA 3KVQA 1CI5A 5GRXG 3CVHL 3O11A 2VLJA 2YMXL 5L6YL 2I9TA 3EIFA 4BFBD 1MWAH 5CBEB 1MHCB 2VDNL 1FV1B 2NY5C 4FQCH 4M5YL 3MLUL 3BPCB 1BBJA 1YEGH 2XQYK 2VZSA 3EJZC 2EEBA 5CEZE 3M45A 1FE8H 1ES0A 2PXYC 4CU7A 3BWAA 2P8LA 5EIIA 1ZT4B 5IWLA 3IDXL 3O3EB 4F7CB 4H1LG 5DGQA 2DBLH 2X42A 4IMKC 2JB6B 4PLOB 2EEDA 3BE1L 3NIFF 2GJZA 4YK4C 4TTDD 4RA3A 3FQRA 4UDTB 4X7TA 3T8XA 1ZA3A 3DRQB 5MERB 4QRPE 3KNBA 4DUXA 3UTSA 1PY9A 2PYFA 4OV5B 5I1LA 4WTZG 2A83A 2WAHA 5D2LF 5DGRA 4P9ML 4FQ1H 5E5MB 1IGJB 2R39A 2G2RB 4Z78A 3HMWL 5TE7H 1QBML 3MOAL 3B9DA 4NZRH 4K7PX 5D2NE 1J8HD 1IILE 4N68A 4OCSH 1NSNL 1HYSD 2NZ9C 1A6PA 5INCB 4OLYL 4BA8A 4OZGB 1RUAH 4K7PY 4OTXH 2FR4A 2VQTA 1CT8A 1NFDF 3WUWG 3IDYB 1P84J 5GSVB 4KJYA 4MAYB 2DLIA 4KKLD 3TV3H 4MA3B 3ALPA 1AY1L 3WDIA 3BEVB 1URLA 3ZE0F 1WV7T 2F58L 1J1OL 4PJIF 4YDKH 1KJ3H 4XP1H 1U8JB 3NCCB 4ZUUB 5HGHA 4BFIB 1MRFL 4G43B 3MLWL 4I2XE 2IADA 5CBAB 3HAEH 2ICES 4NRXA 3I2CL 5HDQL 3C6SA 2ZJSH 2P48B 1RPQA 5DLML 3VFPB 4MDJA 4YHIB 3D18B 1RZFL 2ICWJ 5D7SL 5FYLD 5D7LA 4MX7B 3IAGC 1JF6A 5D70L 4FQCL 2ADJB 1DQQA 1QO3A 4M5YH 4I3RH 5ALBL 5I16A 1JZ2A 3OAYK 3CU1A 1XF1A 2C26A 3L7FB 5JORA 4PUBH 1I3UA 1YZZA 3ALXA 5F1OB 5IMOB 4KZEH 4KMTL 4M6ML 2NMSA 3MRFA 1A6AB 2OL3H 5CJXC 5GGUB 3WFEL 5C0FB 4YDIH 1QSFE 2E7HA 1FIEA 4I0PC 4GMSH 1B0WA 1JGVH 4ZXBD 2GJ6A 4JO3L 2W9DH 5KOVC 3M1BB 1SJXA 1NCCL 3O9WC 3EOTH 4JN2A 3PGFH 4NJAH 3SJVB 35C8H 3AXLB 4K71C 2XY1A 1LO2L 1I9JH 5MI0B 4OCSL 1A3RH 1FVDA 1KCSH 1CGXA 5CJBA 1P4IH 4TSAL 3RUGA 3VXPB 2OZ4H 5E95B 5GHWL 5AZ2H 3G04B 1X5JA 4G6FB 4JN1L 4MB3A 1I1FB 5DQJB 2AJSL 1K6QL 4GRMA 4ONHA 3TNNB 4PGZA 2Z31B 1IFHH 4BQ8A 2BC4A 1AGDB 1CXFA 3F65A 5MENA 4PJEF 1S5IL 4Q7DA 5E99L 1QSEA 4HS8L 1IAKA 4LSVL 2LU4A 4YDLB 5D96B 1MRFH 2E9JA 1TTFA 4Z7UA 3MYZA 4IJ3C 3UPAA 1OOAA 3DMMA 4NN5B 1UB5A 2ICWA 4WDIA 4ZPTA 1FBIH 5ID0B 3O41B 2DICA 3OJMB 1S9XA 4JRYB 1V3MA 5HHMB 3VXRA 4PGDB 1YMMD 2Y5EA 3VFSB 2YWYA 4JHBA 1QRND 2Z31A 3MLYH 1MH5B 1EO5A 3NACH 5A3IC 5TJWK 3O45B 5EZOL 4U6VH 4YO0A 5DRWA 3SE4A 3VXOB 4O2CA 1K2DB 3VXPA 4HKBB 1WEJH 4V2BA 4WV1B 3UJJL 1JGEB 1T6VN 3V79C 3B5HA 4CN1A 3G6JA 1XGQA 5KVFH 2JCCF 2E9BA 2CUIA 4PJAA 5F6IC 5D1XB 2V17L 1LMKA 2IPKA 3GMMB 3WJLC 1AQDB 3ILPB 4HKJB 1A22B 4KK5D 3GMOA 2R69H 3T65A 2VXVH 3QO0A 2Q76A 4KY1H 4LIQL 1T20A 4WFEE 4MAYC 2E7BA 5DRXA 3QWOA 3IDYC 3P4LA 3MLRL 4X80L 2VXTL 1HXYA 4N0RA 2G60L 5C0FA 4XNZC 1JGUL 2ED7A 1OPGL 5DDHA 1A6ZB 2VLRD 3E3QC 1G9MH 1BQLH 4HC1L 4Z76B 4X6BB 5F7MC 5GHWH 5AZ2L 4BQCA 4WUUE 4X83A 1KEGL 4Y4FC 3VRJB 5DMYA 1JNHA 2CXKA 1HSBA 3SDCB 4HMEA 1N2RA 2VZVA 5KS9E 3T08A 3H9HA 1J87A 2PTVA 5AYUL 4EXPX 4OZIF 3HE7D 1FO0A 3MRCA 3F12B 4P23A 2X09A 2P8MB 4NWTH 2IAND 1JCKA 2YEZA 4G6MH 1DR9A 1S7RB 3SJVE 3E0GA 4L8CA 1XMWA 5I1CL 1BJMA 3U0PA 1KCUH 1TCMA 4BUGA 1FAIL 4HUUB 1CE1L 1H8OA 2F15A 3HC0A 4QXTB 1MQKL 3H9SE 4PJ8C 1I1AD 1NJ9B 1AE6H 5DK3A 1SJEA 4PB0H 3MOBH 4JPWL 1I7TA 1QVOB 1E0OB 1VADB 2XZQH 2RFXB 2NNAB 3P4MB 4EI6B 1OTSD 2UWEA 4X7SH 5C6PB 2Z91B 2Y06H 4QXTA 5FYJE 1YECH 4U1LA 2GK0B 3GSQB 2HVKA 1DANT 1WBXB 4LVNB 5IMMA 5HBBA 4GW4A 3TWCH 4D9RD 4Z0BL 2V5RA 5BQ7B 2VTFA 4F15B 5L2KB 2QSTA 4WI5A 1RY7B 1CFTB 4G6AC 3REWA 4NN6C 3MTRA 5HPOA 4C56A 4FG6D 1INEL 1BFVH 4RDQF 3VDCA 5C2BH 5A2FA 4ODWB 2EE9A 4W68A 3CX2A 1DVFA 1S9KC 2YKLL 1MFAH 3MRCB 2BVPB 4XNUL 2XWTA 4WHYH 1D5BB 4KC3B 1GH7A 4FHBD 4CJ1A 5H35A 4JKWA 5EFIB 2FJGA 1OPGH 4PP1D 2IQAB 5INDA 3V5DA 3CCHA 3OKLA 3QUXB 3BWAB 2QJDA 1T0MA 2CDFA 1YPZB 4D8PB 4JO2H 5EUOB 3CFIC 2X1OA 3QXAA 1LVEA 1K4CA 3BPCA 3UC0H 3NH7L 2WWMC 1GZQA 1JPFB 3U79A 1ZT1A 4NNPH 4Y7MA 2VH5L 4MCYB 2BSTB 4AL8H 3CZFB 4TVPD 3WEXA 5IB1A 5GGRB 5T3ZD 1I1CA 4HGKC 4PRDB 1U8KA 2Y25A 4LASH 2Y23A 2FHFA 1ED3B 3B9KD 3S37L 2XWJB 5DD6B 3CK0L 5E03A 2EH8L 2WBWB 3KYOB 3L3GB 4DFHA 1CIUA 4UTAL 2GTZA 3A0OA 1B9ZA 5HHXH 1E27A 3P0GB 2AXFB 3EYVA 3HPLA 4I8DA 4NO3A 4NSKB 1RULL 4R26H 1NUNB 3I50L 4M6NL 4ZXBA 1Q8MA 4IOFC 3RL1B 3CVHB 1AE6L 1JPTH 4GRWE 3PNWB 4LQ1A 3BYTA 3OKEA 2JIXD 3VXTA 3PV7A 2CR3A 4CVXA 2X7LB 2F54B 4OZFA 4YNYA 4CRPA 1CFSA 4PJ8B 3RGHA 1XGUB 4QTHA 1M7DB 2YD4A 5KS9B 4UT7L 4V1DB 2YPKB 4J4PC 3MRMB 3QWRD 1R3KA 3G08B 1VGEH 3GMPB 4YPGA 2ZCKH 4J2XA 3I6LD 3TWCL 3X12A 4PJCA 4YBQD 4HLJA 5C09B 1F11A 1QNZH 5IB2A 1T7XA 2VZTA 4NNYB 1N6VA 2XWJA 3DVGA 4GAJL 2VDRL 5DD6A 4JPVL 1WBYA 2XFXA 5DHVB 5K9JL 1ZMYA 2YSSA 4PTTA 3ARFC 5ESVB 2JJVA 3KYKH 3SKNB 2DQTL 5CINL 2DBJA 5F3BB 5HHNA 4PP2A 1GGYA 1AFVH 2EYSA 5E6IB 1EK3A 1JWSB 8FABA 3SGJC 4NKMA 4FQIH 3LKRB 4LVEA 4NPYB 2IQ9L 4PRIE 2P24A 4JEGB 1CICC 3EOTL 4ZSOA 1A7PL 3DV6B 3IETA 1WITA 4Y5VA 2VR5A 4R4FH 4WWKB 3PQYE 5ISZA 1IKNC 2Q87A 5CHNB 4OFVA 1YA5A 3FT4A 5HHME 2R0KL 3OR6A 4Z95L 2ZCKL 2AV7A 3QUML 2VLJD 1H5BA 4M03A 1JF5A 3OGCA 4PJIE 3WXVH 3BI9X 3G5VB 5LWYH 5ELIA 5L7XL 2YUZA 4LCCC 5IOPA 5CLWA 4QRPD 3TGXA 4U3XA 1XCQB 4N90D 4Y2DA 3DJ9A 5C0GB 5E6ID 3GJFB 5ID1A 1G9EA 2V5TA 5HGAB 1OTUD 2R8SL 2NXYC 3C5SB 3GBNL 1IC7L 3MJ8B 3BQUA 4QXUH 3A6BL 5C0DB 2YRLA 2ILLA 4FQ2L 3LS4H 4GBXB 4ODTL 1VEPA 4EBQL 3F58H 5LBSH 3S36X 1I75A 1PYWA 2GITB 5DJCA 4AEFA 4MWFB 1Q94A 2IQ9H 2VZ3A 1HHHA 4MMZC 3D0VB 4HUMB 3WIHL 3X14A 3JV0A 3TBTB 5I1JL 2XQYG 4FZEL 4WHYG 4ZUUA 4G80A 2BY3A 1QFWH 2VDQH 3DSNA 3CSPA 5DR5H 1NFIB 2CUMA 4XHJD 2X70B 3WXVL 4ELMA 3T4AB 4YHZH 1I8KB 3H3PH 1TVHB 5C9KA 1QLEH 1HOCB 1JNHB 1U8QB 5SV4A 3HNSL 2QR0B 1CDIA 3T4YB 2R2CA 2UUDK 3HZVA 5CJXA 5K9QI 3PWNB 3BGMB 1BREA 3JSSA 4J3OC 5DT1L 3VFRA 2HLAB 3HUJF 5IFJA 4ZO7A 1LILA 4JM2C 2OSLB 5CZXC 5IV2A 1KPVA 2F74A 1GHFH 3QUYD 3LKSA 1JHTB 2ARJA 1CGSH 4I0CC 4KZDH 4HPYL 2EDWA 4TUOA 5DJYB 2BNRA 5LBSL 5I1LB 1B2WH 1SEQH 2GI7A 4XTRD 5K9QG 4WU7B 1XIWD 3MLXH 4YGVB 2UY6A 5BOZG 1OARH 1CFNA 4WU5A 5FO9B 4GW1B 4KRNA 1OSZA 3ARPA 1EBPA 4LSSH 2C3VB 3BH9A 4F7CA 1V3LA 5GS2H 3NABH 2YBRB 4DW2L 1S7VB 2VLKA 1GYAA 2DL2A 4JFDB 3ROOB 4CU6A 1YQ2A 4QXUL 3L3JB 1A47A 2D9QB 1A6WL 3QQ4B 5J3HC 3MRBA 5GIRB 2V7HB 4ZO8A 1UB6B 5FHAL 1CVRA 1WCBB 1MH5A 3KS0H 4NC2B 3MRJB 1BJ8A 4P5TC 3X17A 5CEZD 5FIEA 3KPMB 3M17A 3MYJB 3VXRB 3UBXG 4I2XB 1FJ1A 1S9XB 1G7QB 1T0NA 4NQVA 4OD3H 3BZEA 5B3NA 4QRRA 4XC3L 4G8IB 3ARDA 4XCYB 3SPVB 1NCBH 3D2UD 2EO1A 4OLWH 3UPCA 3FQTA 5F1IA 2CRZA 2XTJD 3BP7A 3HNVL 4K23H 1N4XL 3MRIB 4FQQB 1U92B 4NQCB 1PZ5B 2KPNA 4EVNA 4K8RD 4LAJH 3P73A 3S5LG 5C07A 5C0BA 1RZKL 3BYYA 5FO8A 4KJWC 4OCLC 5IVNA 15C8H 3VWKC 2V2WA 5IQ7H 1MHHB 5DZNA 3WFHB 4J3UA 5I71B 1YNKH 3SHSA 1ZLSL 4M48L 1I1AB 3ZHDA 4K3EL 4I5BA 3KPNB 4G7VL 1DQJB 1WBZB 3RUGB 1U93A 4DGIH 3P40A 4AQOA 4FQHA 4XNYL 4AJ0A 4HIXL 3V4PH 3MR9B 5BV7H 1NANI 5TF0A 4ZTOL 1F13A 2AJXH 3VFGH 4PRAB 4G3YH 1CLOH 3QP3A 3RQ3A 1CD9B 2EE2A 2OQJB 4PJBA 3C09C 3EHBD 1CR9H 4O2EA 1T5WA 1LE9B 1MJUL 1BOYA 1BECA 1XF4B 2VXQL 2B7DT 3CPLA 3RI5F 3SDCD 4KPHL 5IK3B 4QHUB 3EOAB 4LSDA 4JDZB 4M6AA 2NY7H 4YAQB 5F70A 3MFFA 4PLKC 1FFNA 4YXLH 4MA7L 4AEHL 3QNZA 5B3JE 3WLBB 1AGCA 4XP4L 1N5AB 1EIBA 3AY4A 4CU8A 3FZUC 4OIAA 4XB7A 4HT1H 1P7HL 3PABA 5E8EA 5FF6A 1EAJA 1KOAA 4Z0XA 5TDNB 4CVZB 1G6RB 4IRZL 4Y5XA 3NAAH 5DUML 4OLVL 4JHWH 4MJ2A 2JJTC 1N0LA 2VDPH 3PGDA 3WKNA 1MAMH 4ALAL 1EHXA 3STLA 1U36A 3DURA 5EU6D 3GRWL 3FB8A 3V8OA 4WJ5B 2DF3A 1P4BL 3BFOA 1HQ4A 1MFBL 4NRYB 4C56E 4TQEL 3ZTJG 2P47B 2AXFA 4AT6A 4X4MA 2BOBA 4XAWL 4MXVE 4C56D 1RURL 2CDGB 3HUJB 5JPNA 3TNMB 1QSED 3G5YA 5AYUH 2GSIB 2IPTH 3BW9A 3ME0A 2WLYA 4C55A 2P45B 4PJFE 1X5HA 2R1XA 4UU9B 1MAJA 5E2UH 3ZKMD 3MSPA 1VEOA 3W39B 3ZE2F 5FK9B 4YC2C 1BAFH 1CGWA 2BFVL 4DOHB 4WFHD 4C58B 3MGAA 3KXFA 2NY3C 2E8ZA 1LEGA 3S35L 1D6EB 1NEZA 1HNFA 4EUPB 4HK3N 5HVGB 2YC1B 4AM0A 2X9WA 4L3CB 3W5NA 2FIKB 2J88H 1W72L 2WINB 3MOBL 4MJIE 5CGTA 1CLZH 1OQXA 1X5AA 3UBXB 2Z31D 5FYKU 4X7FC 2UY7A 3WKML 3IJSB 2NZIA 2R56H 2VABA 3W2DL 3G9AB 2NX5D 2OXGA 2VQ1A 3O3EA 4LIQE 2BRRH 4WUUB 5FYJD 1H3UA 1HI6B 3D1MC 4L1HA 3RZCD 2CRMA 1MVFA 3DMMD 5FYKH 4OKVA 4LQFL 2BY1A 3QYCA 4I48A 4P49A 2CLRB 2NTFA 2W0KA 2GK0A 3HI5L 1A7RH 1QLFA 3KLAB 2OS7A 3F7QA 3ABZA 4AEEA 3LQAL 2GHWB 4RFNB 1QRNA 2WWMD 3H42L 5CSZA 2D7PA 1FNHA 1YN7B 2EXWD 4RWHA 1JYXA 1UC6A 3GBNH 3MLVL 2F19L 3N0PB 4RISL 2PW2A 4F7MB 4X6CF 4Y5YB 4F7TA 4NUJA 3ZDXE 1DBBL 3HC0B 3WIHA 25C8L 2AJUH 3EOBA 2Z0BA 4JANB 3GHBL 1FL5B 1IC4H 3N06B 1CLZL 2UUDH 3EYQC 1BZ7A 1V7NH 4U1NA 5HHOD 5FEBA 1DUYB 1PG7H 2Z93B 2P5WB 1ND0B 3OAUH 3VFMA 2CKBB 2K3TA 4XHJC 5E2UL 2WINA 1MVUA 5A16B 1DBKH 4RQQA 3JTTB 3SDAD 4LQFH 3HAEA 1JBJA 3MUZ1 2RQ8A 4TSBH 2FSEA 2VXUH 4ODHH 3AC0A 3HC3L 1S7TB 3C2AH 3V4VH 1KTRL 4LARL 4KHTH 4LLUA 1OTSC 1SY6L 1XH3A 2ENYA 3MLVH 2F19H 3WKMH 2APBA 3QUYB 4JY5H 4YX2H 1R3JB 1Y6NR 4HKXB 4QWWD 4Y4KD 3VXUE 5DD3H 4G6FD 4LAQH 4OQTH 3FQXB 1WZMA 3ULVE 3TFKD 4MDIA 4KZDL 1MI5D 1DCLA 3HLAB 1UM5H 5TH2A 3NZ8A 5F1NA 1R5WB 2XN9E 1B0GB 4PJAB 1J1XL 1GCFA 4NO5A 2L4OA 3QXWA 4IEFB 1YY8A 4DK3A 1MIEH 2RIKA 3DBXB 1BX2B 3WCYA 3MRKA 4U6XA 1L0YA 3BVNA 4XVJL 3QUKB 4HX1A 1FSKB 4JRWA 4XCFH 4BZ1L 4U49A 4P9HL 3MRDB 4N5UA 2DQUH 1S7WB 1KBGL 3EFDL 3QO1B 1ACZA 3DX6B 4WI2A 3U0WL 2J8UA 5BV7B 2BRQA 3K4AA 3CDGB 3MBEA 4O4YH 5FYJL 3T3MF 3FB7A 3QNYA 2YD3A 2VIRB 4JRXD 1A2YA 2P5EB 3HC3H 4P59L 1IC4L 5C0AE 2O93L 5CILH 4ZDHA 2DQCH 2ZP0T 4EUPG 1DQTA 3Q6FA 3EJJX 3QEHA 3ZDZF 4HZLB 5E2TH 2ZUUA 3OKKA 4MLSA 4R96B 4WUKL 1LP9E 4L8BA 5IVOA 3MMEA 4XB8A 1AH1A 3LPFA 4H0IA 1IGTA 4JQXA 4PD4J 1P7QD 1FG9C 4FABH 5J06A 5DWUL 5AWNH 1MQ8A 2ATPB 2E27H 1J5OH 2FATH 2ZSWA 1YNKL 4C4KT 2CO7B 4Z5RB 3KJ6H 4PGEA 1KSRA 4LFHD 2W65A 2AI0L 4QHLB 5F7LB 3E6HB 4LHUD 3CLEL 1J7VR 4X8JA 3S3SA 4LNVA 5D1ZD 5T1MA 3WFHA 3KLHC 3L1OH 4P2OC 4DZBA 4PB9L 3F58L 3RNKB 4X6CB 2DS4A 1N64H 1WT5C 5D7JC 3RWJB 1FL6A 3DIFA 4LBEB 1Z9OA 2W0LA 3GHEL 2ATKB 4GRLA 4S10A 1UEYA 3RL2A 3FRUB 3I02B 3WIHH 4ZOAA 5E24E 2R2BA 2A73A 5DEFA 1L7IH 1CBVL 3CDFA 1CFVL 3EYQD 1G7QA 1T0NB 1FZKA 3SCMB 1DBJH 1H15A 4LLVB 3KPMA 3M17B 3FFDB 2ADJA 3DRTB 3PDDA 1UYWH 4PY8I 1NUGA 2WWKO 3K8MA 1UB6A 3OR7A 1J0YA 1PDKA 3OQ3B 1YNTA 2OR7A 3RY5A 5E8DL 1BWWA 5I8KH 5FGBC 1FORH 4IRZH 3VI4E 1EEYA 4KDVA 2VLME 3W9EA 3T2QA 1EHAA 2W9EL 3L3IA 3TC9A 3WS6A 1Y0LB 1CFNB 4WU5B 1U8JA 3NZ8B 3JV4B 3U9PH 1C5CH 3CSGA 5KG9B 4U3HA 2F54D 3SY0B 3P77A 1IVLA 2MHAA 2OTUA 4BELD 5ACZA 1B2WL 1SEQL 5JA9A 5E2VL 1PD6A 4KRPB 3E3QE 4H88H 3QB7C 4DZ8B 4DQOH 5H8DA 4D0DB 4TUOB 5DJYA 1KEMH 1ADQL 3QIUD 4WWKD 4XMLH 1J88A 1OAYH 2VXSL 4RGNE 4M1CC 5EORH 3UX9B 5SWQB 3S96A 5IV2B 1G84A 1YUHA 3ZKMC 4DGVL 1DN0B 1IGYB 4ZAKC 3KJ6L 1JK8A 1HILA 2IBGA 3QG7H 4ZFGH 4DW2H 5EUOE 4I0PA 3QDJD 1KLFA 3QCUL 2BY0A 2O61B 2ZCLL 2OJZH 3REVB 1HOCA 4E5XA 1GAFH 5ACMA 3TM6A 4OLZH 4RA0C 3TZVB 3O6FD 2PYFB 4PGBA 5DD1H 3QWRA 4JFZH 3VXSE 3HI1A 4U6HA 4ZQKB 3QDMA 3QDGE 5F88A 2I9LA 3DTXB 1M6OB 5ALCH 1KTKE 4K3HA 3EO1A 5IT2H 4NQEE 2IH3A 1MWAB 4N8VA 1T7YA 3HNVH 2P8LB 5IHZA 4EDXA 2HTLC 1TJHL 2CMRL 3I3EA 4ZUSA 3F62A 2VLJE 5CSGA 1HKFA 4X8XA 5CP3H 4ZAKB 4PFEA 3QG6A 1ADQH 4XMLL 2EDYA 4FFWC 4M7KL 2YA2A 1XAUA 1T1XA 1D9KA 1F3DH 4JZNA 4ISVB 3TBYB 3V0WH 1OGAB 1K3IA 5GGVL 2D7NA 2A1WH 3PWJB 4M5ZL 3ULUF 2PTTB 2NX5E 4QRUB 4MNQD 1RHHA 3G5ZA 4YBQC 5JW4N 3FMGH 2D31B 3V4PL 4S1QH 3V95A 5C0NC 4MAUL 3RL2B 5I1KL 2LFGA 2OJEB 1CK0H 2KZ1B 2DLHA 1NGXA 1HN1A 3VI3F 2HWZL 3VFUB 1BD2E 1K9TA 2C3WA 5DS8B 4Y16A 5FDWA 5JNYA 3S37X 5IHUH 1KEML 3UTQA 1E4KC 1A1OB 4KPHH 3GSWB 5C0CB 3VWKA 4X7DC 4PJ9B 4BK5A 5M94B 4WY7H 3AREB 1EZVX 1HINH 4LHJB 1JUFB 3PWLB 5T1LA 3FL7A 4K3GA 3CFBB 2P5EE 2HRPH 1R24B 2IPUG 2I25N 5KVDH 1J9CT 2WUBH 3WNKA 5F7NC 3UDWA 4UV4L 5E4IA 1KTLA 4JFZL 2NY6C 1S8DB 1I8IA 2B2XH 3NAAL 4JY4B 1MCSA 2QL1A 4Y88A 4Q58C 1QBBA 3VXNA 4KK9D 5IB2B 4I77H 1B0RA 4MS8C 1EO8H 3RAJH 1LNUB 1FE8L 5EC1A 3FOLA 3RZCA 5GGTL 4J3TA 2CIKB 4CN6A 1XGTA 1A6UL 5J13C 2EDLA 1KJ2H 2BXYA 4OKDA 4UIMB 5SWZA 5K9OB 4JFFB 5TPWH 3K8LA 1FZMB 1VGKB 1N8ZB 1Z0NA 3MRRA 5C0CA 4OZIA 5L88H 4JKLA 5JO5B 5AAWA 4Z7WE 4OZIB 4HQQH 2D0HA 3OZ9H 4HPOL 3MV9A 2XPGA 2A0LC 3QEQE 4ZUVA 4E41E 3WHE1 2L7UA 5FOJA 4HDIB 3FOLB 1ZLUK 4NQEA 1JE6A 3T0VA 4UV4H 1JFQH 3V0VA 1HYSC 1TZGH 4NRZB 5EUKB 3SCMC 1Q38A 4X5XA 2DI7A 4AENA 1I8MA 4XVTL 2A6DA 4Y19B 2GJ6E 5EULV 3NCYP 3WNOA 1M7IB 3GJEA 3WIFA 3NTCH 1G6RH 5DUPL 4QRQA 1EO8L 5GGRA 1UQSB 2CXGA 1I8IB 3MQIA 3EDFA 5E2TL 4FG6C 5HHVL 3TJEH 4MNGE 4PREB 1UXSB 5HI3D 4PLNC 2BSSB 2HN7A 4HSQA 2F5AL 5F7KC 3LS5L 2HTLD 4JQXC 3RGVA 4QEGA 4MGXA 3C5ZA 4W6YB 2FEEL 4LKCA 4JHZA 3FTGA 3KPOB 5ANMA 3JTTA 4OLXH 5E8OB 1T80A 1FZOA 3Q5OA 4KK9C 1IE5A 3DETC 4G7YL 1A3LL 4HUNB 4NYLB 1MJJA 4P57B 2JJWA 3ULUL 1VENA 1MCRA 3CDYA 4C57C 2MJWA 1VEMA 5JNYB 2R0LH 3CMGA 2XZAL 4JDTH 1TZIB 1G7LB 2LAGB 3P3YA 1RJYA 3C8KB 3FFCA 2AJUL 5ESQB 5I8EA 4XBGA 1VKXB 4X9BA 2YZ1A 1YEIH 4WO4C 4F7TB 4OD2B 5JW3L 1CL7H 3P0YH 2AJ3B 5D7KE 4HXBH 2PUQT 4KROB 4IHOB 4X6FA 4I1NB 1QR4A 2DMCA 2A9NL 2W9DL 1QRNB 4HQQL 3O8XA 1WFTA 5E2WH 1BOGA 4ODVL 2EDEA 2JCCE 1A5FL 4DTGL 1AIFA 3IRZA 5ICYB 2EIDA 3WUWB 4F57L 1CE6A 1AGBB 2A6JA 4MXQD 1I8LC 4XMKL 5I1EL 1FGNH 1MCFA 1FQ9C 5E1AA 3LPWA 3RY6C 1T5XA 1YMMA 3MCKA 3V4VL 2C3XA 1E28B 4NT6B 3IXAA 1VPOH 2H32A 4U0RB 5KN5B 2N1KA 3IJSA 3B9EA 3PHQB 5HI3C 4I4WA 4MXVF 1T83C 2C1PB 1UA6L 4LCYA 1R3IH 1D5XB 1YQVH 4TVPH 4BQ9A 1MCOL 3QDJE 2PKDA 4N5EC 2EDTA 1VSCA 3ECBB 3O2DL 4LSVH 4U1JB 5ANME 2ITCA 1EFXA 1P6AB 4H5SA 1HHKB 4PRNA 5E08H 3BE1H 4ODUA 4LEXL 4PJHA 2OTPA 4BZ2H 3TA3B 1H3WM 2ZUWA 4NJ9L 3KHOA 4HWBA 2NXZC 1RK0B 3QZWB 5LAXB 1JNNL 1UM4H 3WUZA 5I2IA 4W4OC 4ZFGL 5DVMA 5EO0B 1NCAL 5L2JA 4FQ1L 3MLYL 1UH2A 4JPKH 1CICD 5EZOH 1ZWIB 2HMID 1BFSA 2QV2A 1Y18A 4WO4A 1WC7A 1H3PH 4YGAB 5MEQB 1S7XB 3CXDL 5DRZA 2BJML 2DJUA 2VE6B 5LGHH 2BNUB 4WI4A 1GOFA 3BKJH 4O9HL 1A4KB 4XX1E 4MSWA 4U1IB 3D0VA 4YC2B 4HXBL 1U8HA 4MWFA 1J10A 1FVCB 1RZIA 3HPJB 2EXYC 4L8BB 3Q3GB 3FO2A 5AG8A 1QTYT 5ICZA 4PRHE 3T2OA 4H1LH 4H1LA 3LSOB 3VXQA 1K3ZA 2QEJA 3BO8A 2PO6C 3WSQH 3KPRD 5HGAA 2A74B 4GAFB 5AZEH 1I4FB 3SDXE 3VXMA 1TTUA 2CDEA 2VUYA 3FO9A 1QFHA 4GKSB 3OKMB 4OB5H 5I8OL 1NCAH 4JAMA 2X4QB 5C0IB 2GT9B 5IOPB 4JPKL 5IK3A 1LE5B 4XAKE 2HH0L 3MA9L 3DETD 1AO7B 3BO8B 3G6DH 5FYJU 2R29L 4QRTB 1YNLH 2AEQH 3QEUB 2HKFL 1LO0H 1AGFB 3S3JA 2VE6A 1KN2H 3VFVA 3L3KB 1RU9H 5BW7A 4NQSB 8CGTA 3MRLB 4HX1B 3GHEH 5GRZA 3MRKB 4BZ2L 5CEXB 2GJ6D 1Q9WB 2Y07H 4OM0L 3U46A 4FFYL 4ONOA 3IFLL 5GS1B 5F7UA 3KWWA 1CQYA 4N1CA 5F21B 1X7QB 4DN3H 3VD4A 2HMIC 3LIZH 2NCMA 5FA3B 4P2YA 5JIKA 4PJDE 1A0QL 4WO4B 3JVGA 4JREC 4YZFF 2QQLL 2GJ6B 2YUWA 1CD0A 1J8HA 1QBLL 1RD6A 1FLRL 1HHIA 2RR3A 1LHZA 3LKQA 1JV5A 5GS0D 3WYRA 1UGNA 1FYTE 3MZTA 5SWSE 3S98A 1U91B 4Z7QE 1PZ5A 4YR6B 5I0DA 5DK0B 4GS7C 1XIWC 1QSVA 1KLGB 1NAMB 4XP6L 1EUTA 4LLWA 1LK2B 3TN0A 4X0KA 1C5CL 1F2XK 1NMCC 1PW3A 4N0UB 1FH5H 5F7EL 3HMXA 1R3KB 4KJQC 5KSBB 1RIVL 5EO1B 3RPIB 4DQOL 3GSNA 3WJJA 1MFCL 1P7QA 4HC1A 4UILH 2VXSH 3IU3B 3LKOA 1ZGLP 4YNYB 3QUKA 5EUOF 2QTEA 1FAKT 4IOIB 1YEDA 5ERWA 1YEFL 4HWBL 4JFXB 5HSFA 3LDBB 3VFOA 3NPZB 3I75B 5IB4B 3MRQA 3KPQA 5F89A 2IBZY 3V4UL 4OGYL 1CFBA 2BOCB 2QQLH 4TVPE 4GW1A 1F4WH 3N1MC 4N0CC 5F1NB 4U6VL 3MV8E 5IMKA 2PR4H 1YMHA 3GZKA 1G7HB 1N6UA 1LO0L 4Z7NF 2CK0H 4ZUTB 2Y36H 5SWZE 3S97C 5ISZD 5E0QA 5F6HI 5DEZA 1EO7A 2MNUA 1I9IL 3K3QA 3MODH 4YE4H 3UYOD 3LPGA 4P4KB 1JHTA 2GFBA 3ULUD 2GQHA 3DUUA 4OM0H 4PJFB 1S3KH 2NW2A 2Y4SA 4KI5F 3KLAA 4L9LA 4OCYL 3ET9F 4MD0A 3SDXF 5DUPH 5JMRA 1IMHC 3U1SL 4KRPD 1ETZB 2H2PC 5HGBB 3UJIH 4QOKE 5ESQA 1RJLA 5DURD 3QUXA 3OKLB 3PP4H 3G5XA 1TCRA 3PGCB 1ZLWH 5AUMB 1H3TA 4J8RB 5D7KD 3GSRA 4OZGF 1GZPB 2UWEF 3GGWA 1KIUA 1RUPH 3MV11 5K9KB 2AJZB 2YK1H 5JLZB 3ES6A 1NC2D 4MQXD 1DDHB 1RUKL 2A6IB 4MD0B 2BVTA 5ANMB 4P9MH 1VESA 4CN4A 3BPNB 3QZWG 4QOKD 2WLZA 3VXRE 3UYRH 2VLKE 4MYWB 4WO4D 3TCLA 1HILB 3GSOA 1UH4A 3DHJA 5LXGH 3RA7L 4AIZA 5HGGS 1MLCA 3VXSD 4NQEB 3MO1A 5E5RB 1BVKA 3BP6A 1HEZA 1EJOH 1NMAH 1YEFH 1U2CA 4TYUA 3MUGB 4FFZH 4OZHF 1LEIB 4KJPD 4LSRL 1G7HA 2DYPA 3QPXH 3VRLE 4YHYC 4XRCB 3JV4A 1JGLH 4NCC2 3U7YL 2Y5TA 2XTLA 1KXQE 4KTEL 5I1GL 3RWGA 1QBMH 1Y0LA 3KYAA 3BSZL 3FB8B 4GG6B 2Y36L 5FECA 2ICCA 3RUGE 1EEYB 1FGNL 3EO9H 4P23B 1G7JA 4K94H 1XGTB 5JW4M 4HJ0C 4UIKL 4QHMB 1CF8L 2H2PD 5HXMA 4J1UA 1MF2H 3DX7A 5JTWA 1IGML 5D70H 3VGDA 4JFFA 3LH2H 3T0EB 1MREH 5FAAA 5FGCB 4P5MA 3SKJH 4PGCB 5KVGL 3B3IA 4JQIH 1B0RB 4XPBH 5F7DA 5TPWL 2EDRA 1HHJA 3FRUA 3S6CA 5DRXB 5F9JA 3NCJH 3BD4A 3SCMD 3MA7A 3MACL 3IDNA 4OFIA 1W72B 1WQVT 1JL8A 1JGLL 1ZSDB 5E8NA 3ZDYF 4R4ND 3QIBC 3DYMA 2KL6A 4ETQB 4PJ9A 2LU3A 3F7VB 5CJQL 1A1OA 4UUJA 5K59F 3GMRB 5D6CA 5DZOA 3IFOA 3PWLA 4Y16B 3G6JE 1Z9SA 1VA9A 2MFNA 4EN3D 3KPRE 2I07A 2BJMH 1MWAL 3BT2H 5HYQA 4AZ8A 1TPXB 2B1AL 1W0WB 4JE4B 4U7SA 3O4OC 1FG2B 4NBYB 5EU3A 2M26A 1HQRB 3GI8H 3LH2L 4FQXD 5AYQA 2DYPB 1FFOA 4OT1H 3RDTD 2MQ3A 1BEYH 1CDYA 5L9DL 4E0RA 3T1WA 4XZUB 4OCWH 1EH9A 4NKDA 3EDJA 1V3KA 2GTZB 4HJ0D 2NY6D 5DJZA 5B38G 1F4XL 1U8OA 2KBGA 3G5ZB 1DQLH 4OZIE 2V5SA 1XF5B 3SPVA 4QRUA 1P2CA 1PSKH 4HHAB 4JDZA 4NO0D 1XGRB 4NQVB 2J1KA 3SO3B 2DQDH 5CIPB 3L5JA 1VDGA 2GCYB 5CZXD 4S2SB 1SVCP 1OARL 2XG5A 3G6AA 4FTVE 2XZAH 4MCYA 3O6KL 3WD5L 4JFQA 5TQ0H 5I19L 2AEQL 3BRGC 1V05A 4FQJH 4PG2A 2AK4B 4U6XB 1U8HB 3V6ZA 2E7LA 2P5WD 4XTRC 3TPKA 5HYSB 5ITFA 2W07A 1X44A 2FJGB 5GRJH 4GAGL 1Z9MA 2F9BT 2V17H 4R90H 5CCKH 3V5KA 1I1AA 4OT1L 5TH2B 3NFSL 2VLRB 3BGFC 3BPLC 2VQUA 2DYPD 4RFOL 1GPOH 3OF6A 4ESKA 4LNRB 5FO8B 4OI8A 1K5NA 3BXNB 3N9GL 5B3JF 3VD9A 4YHOL 4JFOA 5EZJA 5JZ7D 4NQED 3ZMRA 4R4FL 4BFGA 2DLFH 1YC8A 4YHKL 2X89A 3GMLA 4JLRA 1RUAL 1K85A 3HCVB 1BQLL 4HC1H 3MRGB 3GFUA 4HH9B 3PG2A 1FCGA 3PWPA 1MHPH 4Y4KB 3BP5A 1CLCA 1DN0A 4JM2F 3TA3A 4GSDL 1IL1B 4I3RL 1S7UB 4PYGA 4HGMA 3OJDB 3GI9H 1E28A 4DN4L 5DTFA 5DHXB 3V52L 2NX5A 4K3DH 1OWWA 5LKNA 5KS9F 3V0AC 1S9WB 1V3JA 2V7HA 2AABH 4WEBH 4LEXH 1MLBB 5DO2D 5TF1L 3RY6A 2C4FT 4FQPA 2GY7B 3SOBL 4U1MA 4JFQB 4KJWD 3I2CH 1T03L 3V2AR 3VFGL 4Y1AA 1YDPB 3DV4B 2D7TH 4LPUA 2L0DA 3UTOA 2LABA 3MGTB 2Q3ZA 3RBGA 4NFCA 1TNNA 1NGQL 1MCIA 5M7QA 2VDOH 2ZG2A 1U3YA 1EEZB 3RWHA 2D2OA 5D7IE 4WEUD 1RUQH 1O7VA 3GUTB 4XPFH 5TQ0L 2XZQL 4HH9A 3VRJA 5EBMA 3HS0A 1QSZA 1IAMA 4X4XA 4P4KD 4GLRI 5I17A 5C6WH 4GRLB 1YEJL 1FZKB 1UZ6E 3C6LC 4WTWA 1YEEL 1EXUA 3GM0A 3OB0K 3UTZB 4MA7H 1P84K 1JV5B 5GRJL 4GXUM 1HXYB 4GMSL 2JJSC 3JWNC 1ORSB 1KCUL 1GGUA 3BWUC 4LBEA 5AG9A 2HFGH 5DFTA 2OZ4A 2EDQA 5IR1A 4IMKA 5TE4L 1R0AL 1XR9A 3P2TA 5MP6L 1NCCH 5I6XB 2W65B 1RQ5A 1MFAL 3EW3B 2HKHH 4B41A 4JO1L 5BMFL 1F90H 3HZYB 4JPWH 4QYOB 3DHMA 4LCUB 3B9AA 3PWPE 3QRFM 3OJVC 4P57A 1FBIL 4DVBB 3PWVB 1ERNA 4G80B 1XGQB 3MGOB 3FRPA 5EIIB 4RAUB 3DVFA 3L7EA 1AGFA 3QPQD 1NPUA 3NH7H 1OTTD 3L3DA 4GUPA 4QF1B 3FO0H 3OKDB 1RV6X 5D7LD 3KDMB 4MS8D 3GJEB 4CMHC 5C3LD 4HJGB 5CS7A 2GITA 5DJCB 2O5ZH 5DO2C 4ZOCA 4PRID 6CGTA 1B6DA 5DMGD 3PIQA 4HS8H 3NGBC 4L3EB 3MNWB 3MUJA 1IAOB 4P3CH 2IALA 4BSWB 2B4CL 1DL7H 1OGAE 1WBYB 1AXTH 2SEBB 4XHQA 3OSKA 4JFED 4D94A 2GK2A 4LSQH 3HNTH 3ILQC 3KAAA 1HH9A 2R2HB 3GJFA 4HEPG 3C60A 4MNHB 4NUGL 2DQFA 2VLLA 1P5UA 1FFOB 1EA9C 3EO0B 1FVCA 2AXGB 1G1YA 5A2JH 2FECL 5EU5B 4DVRH 3RTQA 3CDGA 4NGHL 3D3VD 3MRMA 1DUZB 4H0HB 4LPTA 4OZHA 3DURB 2ADGA 2XPGB 2BNUA 1WCQA 4HUVA 2R56L 4BH7B 4HMDA 2QSVA 2F54A 4OZFB 2PTUA 4G6JL 4KTDL 4N8CL 3RBSA 3S37H 1FL3B 3IETB 4I9WD 4MDIB 5DC4B 4CGTA 4XGZB 1LDSA 1CDJA 5BZWA 1TVBB 1FNAA 4OF0A 4EDWH 5E6IA 4BSWA 1XGYL 2E5EA 2HFGL 4RCAA 1IAOA 5EU6E 5MP6H 4ZAKD 4N1EA 1S9YB 4LP4A 4NWTL 1FVEB 1U0QA 3U9UA 2PO6D 4XNMA 1CU4L 3TVMA 1P7KA 3FT3B 5IEKA 3VWJD 3QHTC 3SKNA 5C07E 4XPBL 1IM9B 2WBJB 4IOSD 4L4JA 3X3GH 4K55A 5FYKE 5HYJB 1XH3B 4PRDA 1IM9D 2WBJD 4P5MB 5IQ9A 2EO9A 3MJ9A 4GUPB 3L3DB 4P0DA 4ODSL 4QF1A 3C6LB 4UQ2A 5JXEC 3NMEA 3TT3L 3BMVA 2NY0C 4RZCA 5C8JA 4P2CG 3A6OA 5JUEL 2OCFD 3DXAD 3GSWA 2YD1A 5ETUA 4NZRL 2FB4H 2NY7L 3AREC 5BXFB 5DS8A 4TTGA 3ILQD 1DQMH 1DQJA 4OSUL 3QXDB 1WWCA 1VFOA 2R0KH 4TOYL 3GSVA 3O4LE 2X7LA 3SKMB 3CX5J 4JKKA 4D0BA 5GZNC 4I3SH 3S34H 1FNSH 1OM3H 1IGIH 2RJMA 2XNAB 4FFWD 5IKCB 2X4SB 1OCWL 4YFDB 3MUGA 1CYGA 2D7OA 1UKSA 3DUUB 3W0WD 2YKLH 3PWJA 1JZ5A 3ZLQC 5T3XD 1QYGL 2AP2A 4ISVA 4PB0L 4NIKB 2YWZA 3EUUA 3JZ7A 4YDJA 1IARB 3CC5B 2BY2A 4Y4KC 2WQRA 2BNRE 4RIRA 3FB6A 1B90A 1YECL 3S4SB 4ZOBA 5D7SH 5F93C 3NFNA 1JNJA 5F9OL 3UPRB 2DD8H 3R06B 3IS1X 1E4KA 3PL6B 1KB9J 4NZUH 3ARGC 3QG6B 1IGJA 5EIVA 4U7KA 2APXA 4MQ7A 3RGVC 5K9KA 1YEHL 3QDMB 4Z7UF 5C0JA 4Z8FL 3BISA 3FHQA 2DQGH 1PG7X 3ROLA 1IEBB 2NX5B 1VFBB 1I7UB 2OL3L 1Z9LA 3U7WH 1OSZB 3LN5B 3X3GL 1ZVHA 5F88B 5FCSH 2YPLB 5IVZA 5KSUB 1KPRA 3DROB 4WCYH 4PRPD 3DGCR 4W4NA 3HNSH 3BPOB 1ZT4A 5IVXF 1NLBH 5EO9B 4HD9A 4NKIL 2WNGA 1JPTL 3QEQA 4G9FE 4JFDE 4L4VD 4KROD 3SKOB 1AKJD 3R0MA 4V1DD 1M05A 3L9RA 2F8XC 4GMTH 3TNMA 3MPCA 5BS0A 4PJ8D 1NFDE 2CDGA 3HUJA 4UT7H 4D0DA 4U1GB 3MLSL 2UVFA 5IGXH 5C7XL 3T0XA 3U9UB 3ZSTA 3VGAB 2NTSP 1NFDB 4WGVB 3TYGH 1I7TB 3STBA 4NM4H 32C2A 4KRPC 4S1SL 1T2QH 1IFHL 2X70A 4XC1L 1L7TL 2XKSA 3O2WH 1YYLL 3D3VE 1IEHA 3HE7A 4M9OA 4K9EC 1E6JH 4PV9B 3TP4A 4D9QE 3RRQA 3IT8D 3O4OB 1QSEE 3MROA 1KB5A 2RCSL 3MNZB 5E9DB 4ZS6D 1V7ML 4HHAA 4BZYA 2JLLA 1U8IB 5DVNA 4KWUA 5MEPA 3O41A 4GG6E 1X9QA 3CSYA 2XZCH 4KMLB 4WFED 3VXQB 1FFNB 1UWEL 2CQVA 3MNWA 1SJVA 3ZKQD 3TYGL 3HHRB 3ARED 4Y4HC 4OUUB 3EOAA 3OX8B 4XH2A 5GS0C 2VOTA 5HYSG 4M7JL 3GB7A 1AY1H 1P53A 3QR2A 2EDFA 3MUHL 4YHLH 1LE9A 5KBNC 4PJAF 1C1EH 1UXWA 1DEEA 3BKYH 1N26A 5T1LB 1BM3H 4L29B 5IW3A 3U36A 1U93B 3GIZL 2VXVL 5D6CB 4PJ5A 4U6TA 3OAZH 3ARBC 4YFLI 4GG8A 5BRZB 1JPSL 4X4YB 4IOFD 5EN2A 4XWOD 2ITDA 2UYLA 3VG9B 5JPMB 3VGHA 3IDNB 4AH2B 2QQQA 2E9WA 2Y1VA 5C0RH 5B38B 1MSPA 4NNXA 4XXDA 3A6CL 3X3FH 3HE6A 4LRIC 1KJVB 3ZHKA 1OAZH 3BJLA 2BK8A 2ADFL 4PGCA 4ODXB 1UWEH 2CPCA 4FMFA 4QY8B 4XWGH 1RK1B 1JVKA 5F3HA 3MX0A 4IRJD 3EFDH 2R1YA 1U8NA 4JCMA 4PJGE 3NFPA 2B5IC 3KLDA 4ZTOH 4DWHA 5BV7C 1OHQA 4QTIL 4G5ZH 2VZOA 4I18B 4JKPH 3QIBD 1KFAH 1G7MB 1IRAY 1TITA 2GEEA 1HWGB 1YDPA 3DV4A 4HUXA 4OLVH 3D9AL 4MDJB 1NQBA 2W9LA 4Q9QL 2P7TB 1B0GA 1T1WB 3O4LB 3VXTB 2FX8L 1KC5H 1ZEAH 3CVHA 4KKLC 1EHLH 5C1MB 5B39G 5EOCL 1MHEB 4Y16D 1KG0B 2JCCB 4OM1L 2G9HA 2PW1A 3DUSB 4PTUB 4IM8A 1UCBL 5FUCC 1MY7A 1Q9OB 4CMMA 4UT6H 2AJ3A 3MC0A 4NKOB 1J5OL 3IJYB 3S5LB 1CTNA 4HAGA 1EX0A 3QUYC 1JK8B 3V6BR 3HN3A 5DUMH 4XNUH 4I0KA 4CUCA 1RZ7L 3MJ9L 3ZDYE 4X6DB 4HIHB 2CJUL 1MAML 4LLUB 4ODUB 5IBTH 5KSAB 5JDSA 1U8QA 4D9QD 4KHXL 2OL3B 1YC7A 3D48R 4M00A 1I8KA 4P4KC 2D7TL 2BMKB 1N64L 4IS6A 5EWIL 3SGDI 1A4JB 1NGQH 1ZOXA 4LGSB 5CKAA 1KELH 1RZ8A 3FT2A 4NNPL 2Z8VC 2IQAA 3V5DB 4RGMB 3PDOA 5J6GA 1OAZL 3TBVB 1CXKA 3T77B 1PAMA 2XWTB 4NQXA 1N4XH 3OKOB 4KXZI 3V6ZB 3LDBC 5D2NC 5KVFL 1F2QA 4NRXB 2LAAA 5IMLA 1A6VL 4D2NA 2JELL 5F72S 4P5TD 4HCRA 3T0AA 5K93A 2X05A 4IRJB 2BNQB 4UT6L 4XP5L 1IGIL 1JWUA 1QEWB 3VD7A 5IBUB 5CIPA 3LKNB 3L6FB 3S35H 3OKYA 4X4ME 2LU7A 3SCMA 5GRUL 1R0AH 5HDBE 4KY1L 3CFDB 5I18L 3KJ4B 4JO1H 4IDJL 4F7MA 4HJJH 5BMFH 4XC3H 4X5XB 4F58H 5DHYB 4RFNC 4MJID 5DD5L 4HK0B 1OP5H 2F53B 5D1ZB 4K23L 5EU6A 2DI9A 4O58H 1OF2A 4YXHL 1X6LA 5I15L 4B5EA 2FD6H 1QLFB 4X6CA 4YHPA 3BKCH 2J7LA 4DZBB 2XN9A 4ZYKB 12E8H 3B9VA 1UWXK 3IU3A 3LKOB 3UBXA 4ERSH 4NZUL 3IDMA 2OTWA 4JREB 4L8CB 2FX9L 1MY5A 1O7SA 1WZ1L 4WWKC 5KSBA 1KJ2B 1NDGA 3FTGB 3LKRA 4HIIA 3GMRA 1EPFA 4G6ML 3SE8H 5K9JH 2Q8BL 2YHGA 5F9WB 3STZB 4LLWB 4Y5VB 2HJFA 2X5PA 3EHBC 4U1KB 1YY9C 2J8UE 2AJXL 3B6SA 4P46B 1IKFL 2IANB 2J5LB 3GRWA 3F7RA 5E94A 3U82B 1I7ZB 1FIGH 4YR6A 4PRHB 1JWSA 2LVCA 1RJCA 5GGRY 1UT9A 1GXEA 2K7QA 5D93C 2MSPA 3WL9A 3DVGB 4PLKD 2YPVH 3BD5A 5HHNB 4KAQH 1SY6H 3TA3C 4FQXC 4MHHI 4UMGA 2XV6B 1P4BH 1ZANL 1QFPA 5DD3L 1QLRA 2ENSA 2F5BL 1A2YB 1OW0A 2BVOB 2VNCA 4X98B 3G08A 1FYHB 3GMPA 2XTJC 5DJ2B 1JYVA 2FH8A 2D4FA 5GS1A 3AREA 3U46B 4WHTA 2YOCA 3RDTC 4CJ0A 1K4DA 2VXUL 4IIQB 3VE0B 4EXKA 4UDUB 2QQNL 1VFMA 1WZKA 3HZKA 3FO1B 3QQNA 4P2RA 1YN6A 1CU4H 1K2DA 5EPMA 4QLRA 4V1DA 4QRTA 4D9LH 5GZOD 4GLRH 1ZLVK 4WHTB 1SM3H 3QNZB 1KN4L 1KGCE 7CGTA 4FXKA 4JAMB 4ZS7L 5C0IA 3EO0A 5FYJH 5GGQH 4ODTH 5GS0H 3MZGB 2FGWH 4YBHA 1RHHB 4RAVA 5D9SA 5EA0L 3V8CA 4NBXB 5BVJB 1ZA6A 1GGBL 2B4CC 1JMZA 1IT9L 3HG1A 1D9KB 2FX9H 2DQEL 3LEYH 2X44D 2QHRH 3QFJB 4BKLB 4CDHA 3FO2B 4EQ3A 2VAAA 4G9FA 3QDGA 3VG9C 3AMKA 4A6YH 4R7NB 4DK6A 4R3SA 5E94B 3C09B 4M3KB 5L2KE 1ITCA 5IVXE 4EDXB 1AP2B 2M2DA 1D9KD 2C7UB 3BGAA 4JM4L 4HIEB 3QIUA 4AIOA 1X5ZA 3WE6A 2B2XL 1XEDA 4JDVB 3MGOA 3U83A 1NLDL 3GSXA 1S7XA 1U8PA 1YPZA 1V5JA 4ODWA 2CLVA 3UTQB 2XI9A 5FXCH 4JHAH 5BVPL 3DECA 2W60B 4ZS7H 1D5BA 3CU7A 4PG9A 4NN6B 3LEVL 4ZO6A 4MZ2A 1RJLB 4XCNA 4AMKH 3GHBH 2OJEA 3ULUE 4H0GA 2HVKB 4ONGL 4UOW1 4PJCE 5FYKL 4OUOA 4X6EA 1BQHA 1UVQA 1Q9KB 1ACYH 4QRPA 1NFKA 3FOMA 3S96B 1QNZL 1T7VA 2DDQH 5BJTA 1L4IA 2GFBB 4YBLC 3BZDA 1OGAA 4M62L 4ZPVB 3SDYH 2Z91A 2BVUA 1E4XH 4KROC 3KYKL 2NNAA 2ESVD 3ARDB 2HVJB 5DSCA 3DGGA 2GTWB 2WSKA 4OKVB 4OLUH 1EBAA 1WF5A 4PV8B 1DBBH 2BCKA 2BOCA 1ZS8B 4LLDB 2EKJA 2YBRA 5HD8C 1Y6KR 2EC8A 3KPQB 5F89B 4G42A 4NQCE 3MNVA 4KHTL 1G0YR 4OD3L 3NTCL 4O9HH 4QT5A 2ZUSA 5D2LB 5CBAA 1Q0YL 4NC0B 2IH1A 3TBVA 3GSNB 1NC4A 2BVQA 3CLFL 2ARWA 4XPGH 1T83A 4A2LA 3IXTA 1JJUA 2VDKH 2VLMD 2QSQA 5KVEH 3H9SD 4JCLA 4X6DF 2FWOB 2O5XL 4OM1H 3D87B 1J1XH 3VG0H 4MD5B 1L6ZA 3OB8A 5H94A 5IFJB 4ODHL 5JHLH 5E8DH 5H2BA 3C5JB 3LKSB 4HCRH 2IAMB 3TIEA 1IC1A 1C5DA 3JWDL 43C9A 2R8SH 1C7TA 3ILPA 4R6UA 4NKOA 4LGRB 4ELMB 4FP8L 1FO0L 2HLAA 1JRHI 3LEVH 2OTUB 3T0EE 5MI0C 3QO0B 3ARBA 1A7BA 4WUUD 3U6RA 3SBWA 4PJFF 2UVEA 1OD9A 4PJHF 5FA4A 2AKRA 1TTGA 3O0RH 4LKCB 1BD2A 2R4RL 1FNGA 4FFYH 1EGJL 1BIIA 4HWNA 4J6RH 3CLFH 2EZ0C 2D3VA 1U3HA 4EKXA 1QOKA 2W92A 2ZOLA 4Y5XB 4P4RB 5D2NA 1ES0B 3LIZL 3EYOA 4K3JL 2BCKB 3UZEA 1A6VH 4N0FB 1FLTX 4X9FA 1OP3K 3VG0L 1EEUA 3RU8H 5ID0A 4M7LH 2XXMB 2R23B 2I24N 2PETA 2FATL 4P59H 2R1YB 2Q1EA 4Y19A 1WIPA 1WVZA 3FO9B 4YAQA 2EDXA 5HVHB 2R2BB 4N9GB 1QSEB 4PY7B 1GC1L 4HFUL 4QRPB 3WN5C 4ALAH 2LVEA 2Q8AL 1T4KA 2J8UB 3R0NA 4X6EB 5GJSH 4JG1H 3QA3A 4OZ4A 1CGSL 4XAKD 4ZODA 3TNNA 3CJJA 3OR6B 2JIXB 1I1FA 5DQJA 3EYSH 2O5XH 4M61A 5JHDA 3I6GB 3ARGA 5B39B 3CX5K 2F53D 1K8DB 5TDOA 1KPUB 2GKIA 1T04A 5C92A 4LSSL 3CFJA 5D6DC 3E6FB 2WM0A 5DUBB 2R0ZH 5IEHA 4OF6A 2NY0D 2ID5A 4PJ5B 5EC1B 1ODAA 3VWJC 2AW2A 2Q8BH 3WS3A 1UYWL 1BF2A 4MJIB 1T89C 3DX8A 4YHNB 5TDOB 4LSPL 2XXCB 1WSST 3KXFD 5T1KA 5B39A 5JXED 4H8WC 1AD9A 5J1AB 4DKEL 4NO2A 4PJGA 4Z7WB 2RGSA 4OIIL 3WNMA 5GGUA 2R2EA 4Q2ZB 2VDMH 4NNYA 3MRIA 3Q1SL 3D9AH 4QRSA 2FLRT 2DKM