5TQ0H

Crystal structure of amino terminal domains of the nmda receptor subunit glun1 and glun2a in the presence of edta
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
218
structure length
212
Chain Sequence
EVKLVESGPELKKPGETVKISCKASGFTFTNYGMNWVKQAPGKGLKWMGWINIYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARGYDYEGYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords NMDA glutamate receptor subunit
publication title Molecular Basis for Subtype Specificity and High-Affinity Zinc Inhibition in the GluN1-GluN2A NMDA Receptor Amino-Terminal Domain.
pubmed doi rcsb
source organism Xenopus laevis
total genus 36
structure length 212
sequence length 218
ec nomenclature
pdb deposition date 2016-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tq0H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tq0H02
2H3NA 3QAZB 2OZ4L 2V7NB 4N5UA 3BI9X 4M4PA 3M1BB 3WXVL 1P4LB 1G9MH 3MSPA 3GUTA 4FXGB 5ETUA 3ARPA 2YK1H 3UJTL 3EW3B 3EHBD 4XX1E 2HT4C 5DD6B 1KB5H 3MGOB 2WP3O 2QV2A 1AGEA 4HGMA 3BD3A 1CU4H 4LCUB 5D7JA 1BOYA 5JIPA 4MA1C 2NY5H 3CFKA 4R0LC 1TITA 4IRZL 4C58B 2VZ3A 3JVGC 2BSTA 4PFEA 1KFAH 2QADC 2G75A 5DJ2A 3LKPA 2BMKA 1MEXH 1YEGH 3KHOA 2GJ6D 5B4MD 4C54A 4P4KB 1DCLA 1FDLL 1M71B 1JGDA 5E0QA 3FQRB 1OARH 3LKNB 3AAZA 4P9HH 2PYEB 2XA8H 5E94B 3TH4T 4CAGA 4LSRH 4N0RA 4M1GH 4UNUA 3WMSA 3FZUC 3A6CL 3D1MC 3HZYB 3CFCL 1PJ9A 4HG4K 1DQMH 1I1AC 4Q9CA 3PWJA 1DSFL 5DJXA 3QHTC 1HHGB 4I3SL 1B0WA 5K33A 3I3EA 4IOFD 3MXVH 3Q5OA 3D6GA 1C08B 5BVPL 1ETZA 5D8JH 4FQHB 4H25A 2FEEI 4KTDH 4I0PA 4NNPL 1BFOB 1QSZA 1J8HE 3IRZA 1S78C 2YD2A 5DD0L 4JKPH 1LO5A 4KHTH 5BXFA 4XCYB 1NPUA 3DRQA 1T7ZA 3DPBA 5F89A 3SKJH 4DKEL 4ORZC 1YC8A 5GRVK 1OAZH 1DL7L 1W8OA 2FCBA 2B7DT 2XICA 3S34L 3QUXA 3VXME 1K3ZA 5DK2A 4TVSa 4YR6B 5JPNB 3IFLL 5SWQB 5KG9B 4ODWA 2V2XB 3C5ZA 2XZAH 2ZZUT 3WV0A 3RDTB 3BKCL 3O4LD 5L2KA 2UV3A 1PZ5B 1J0YA 3DGCR 2FX8H 4XPAH 3VJ6B 3KNBA 1LDPH 4IMKC 2C1PA 3F7VA 3PDDA 3D2UA 5IHUH 2VXQH 1WFNA 2NQCA 2IFFL 3HE6D 4XPFH 1RVFH 2JCCA 1XGPB 1X7QB 2HWZH 4XI5C 5BRZD 2YUXA 4PP2B 2W0FB 5ID0B 1F8TH 4N0FB 4I0KA 5SWSA 4TNWK 4U1GB 4XAKE 5H2BA 3KHQA 3CZFA 5T33H 5K59F 3FO1B 2J8UF 3BSZH 5FXCH 4ODXB 5C0AB 5IGXH 3SE3C 2ZCLH 1INEH 3QDMD 2BNQD 5C0FA 1VEOA 3T65B 2OXGA 4M8VA 4WY7H 2W91A 1RIHL 4J4PA 1BQHG 2VISB 5MEPB 4ZFGL 1H0DB 2JJSA 1INDL 1UXSA 4HDIB 6FABH 2CR3A 1I8IB 4PRIB 4NQEE 1AFVH 4HZLA 5DFWH 3M45A 5IEHB 5HHVL 3VXOB 2D7TL 3DX8B 5HDBF 3QA3B 3K8MA 3MV9E 3RNKA 3W9EA 3KR3L 2ICEB 4JG1L 2J88L 3QUMA 3VD5A 5D2LA 2B39A 1YY9D 3MLSL 1NCWL 4JJ5A 5ITBH 1E4JA 3I6GA 3PIQB 3J7HA 4PRPB 3S88H 2CDEA 3LB6C 2ORBH 5HHQB 1Z5LA 2B4CH 5F8RC 4LCCA 3MBXH 1A4JB 1KPRA 1U8HB 3NFPA 5E6IC 1X4ZA 2X4TB 2VLME 3BXNA 5DO2C 2YN5A 3VFPA 1AXTL 2UWEE 4XP4H 1J9CT 1FL5A 2O93L 3HUJA 1CVRA 1P7KB 4P59L 5IIEA 1A5FH 1T0MA 1FE8L 2WMPA 4X8JB 1FNGB 1J0KA 1Q0XL 3IFPA 3UJIL 2VIRA 2Q8AL 4XMLL 1VESA 3ARDC 3ARUA 4PJXA 5F7YC 2GFBA 3VFVA 2VXSH 1KJVB 5D5MB 1MAJA 3DBXA 4XXCA 5FOBB 2AJUH 4QF1A 1T6WA 4OUOA 5DD3L 3BEWB 1LD9A 3UPAA 1IGIH 3CX2A 1UACH 3GMMA 3BVNB 1R6VA 5F9WB 5J9PB 5DURB 1SY6L 4E9LA 2X4QA 2GQHA 3BP4A 4R97C 3ROLA 4Y5VC 3RU8H 2VXUL 5E00B 3IDMB 3ULSB 4QRRB 4LCYB 3U30B 5HHNB 1W0VB 3G6JF 1BWWA 3FHQA 2VR9A 4P5TC 5CLWA 2M8XA 1JHKH 1MH5B 4GT7A 1UKSA 4P46C 5EOCL 4RWHA 5C0NC 4CMMA 5ESAA 4JM2C 3FCTB 3IRPX 5BMFL 4P99A 3O6FC 2EIZA 4OI7A 3MLZL 3UX9B 3MRDB 4GSDL 5HGAA 3T3PF 1NBVL 1DBJL 1EGJH 4MQTB 5F88B 1ACZA 3QFDA 3EOYG 2ADGA 2JELL 4I4WB 3JWOH 3BH9B 4NRXA 2R0KL 4AG4L 1CFVL 2E6JA 4N90E 3HPLA 2ATKA 3MXWH 1Q0YH 4X98B 1QFWM 2G5BA 3QWQB 2MQ3A 3I2CL 5FYJE 4JRYE 1FVDA 3K46A 4O58L 2GJ6A 5GGTL 3ZHLA 1X5XA 4EQ2A 3BGFB 1A7RL 3SE8L 3IT8D 5IJKA 4Y5XA 3ZTNH 3BFOA 1FAIH 2A83B 4RA3A 2XKNB 4MNGB 4CW1A 5CILL 2V7HB 1XIWB 1ZGLB 2XTJC 4NQTA 3BIAX 5T1LA 1EIBA 3SDDD 3VH8A 1WFTA 4KUCF 5FUOH 2L4OA 3U48A 1FO0B 3O9WA 2EXWC 3VGFA 4U0RB 2LTQC 3EO9H 3MX0A 4LRNL 3LD8C 5GJTL 2N7BA 4XNMB 3BESR 4LSSL 4WFED 1FFNB 1A21A 4KWUA 1YPZA 2PTUA 2NY7H 3B8SA 4JZJB 1ZGLM 4WI7A 1I9IH 3OKLA 3BAEL 4FS0A 4HX1A 1G6RB 5D7JC 3GBML 3RJQB 1T20A 3MNVA 2A73B 4J8RA 3RZCB 1KPVA 4F8TA 5DRWA 5I75B 2DQEL 1HCFX 2Y06L 3DARA 4ENED 1JHLL 4KJQC 5KSBE 1MCCA 2VZTA 2AI0L 3WL9A 2VOTA 4W6XB 3X14B 3FAXA 1U93B 1HCVA 3IJYA 5E2VL 4M6OL 1JJUA 4KK9D 5FCUH 1Y6NR 4AIZB 4JKKA 4HMEA 3K81A 3EOAB 4LVEA 1MLBB 4JGJA 4PJCF 2PO6A 2G9HB 1C1EH 4PGEB 4YK4B 3SKUD 4O4YH 1C5CH 1T2XA 3O4LA 4M8QA 1E6OH 5I1JL 3GNMH 1QQDB 3HB3C 4ZOAA 3QNZA 3MA7A 1KLUB 4S1DD 1FSKC 2ED8A 3TBVB 4GXUN 5I1CL 2HFEB 1HE7A 2CKBB 4PRAA 4PRBA 1DFBL 1HIML 3OR6A 4HG4J 1IEBB 3HE6A 4HJJH 4L8BB 3P11L 2Z0BA 4LCWD 5BRZA 3T3MF 1JTOA 5J7CC 1T0NB 2WW8A 5FHBH 2AJYH 4I0PC 3RGHA 1WBXA 1NGWA 2UVFA 1Z3GH 1CICB 4ORGB 4K07A 4PJIA 2C3VA 2BNQA 3KLAB 4K8RL 4FQPA 4UZGA 4LEXH 4PBWD 5TPWH 1IGTB 2P5ED 1RULL 1AGCA 2EDRA 3U6RA 3QUXC 3VWKA 3F58H 3HRPA 1XR8A 3GJFA 4BK5A 3PABA 1IGMH 5IVZB 4LL9A 4GAGH 4Z78B 2BRRH 1PYWB 3N85L 4JFDB 1KIPB 2FJFA 1H3GA 1TQBB 2HP4A 2QKIA 5FKAB 5C0IA 3R06B 1EA9C 5JZ7D 1FN4B 2BY0A 4Y8DC 4KDWA 4P2RB 3TZVD 2VKXA 1QLFB 4QT5A 5CMAA 4JFXA 2OL3H 3UTSB 4G3YL 4FHBD 3JTSA 5CFHA 5J56B 1NUFA 4MX7B 4XCCH 4X9GA 3HE7D 1KN4L 5CLTA 1IT9H 4YWGL 5CJQL 5EO9B 3GSUA 2YD4A 2WANA 1IC7L 3SHSA 4N8VA 1X6NA 2XG5A 4PRNA 1U92B 4LVNB 3DTXA 4UV4H 5ACZB 4H8WL 3K2UL 4WEBH 4CVWA 3V7AE 3DJ9A 3QIBD 2UZYB 3T0AA 1A6TA 2NY2C 5EFIB 5F6HI 5JA8B 1MWAL 2PNDA 4LDOB 5EWIH 2NXYC 3H42L 4I18B 5I9QB 4CADB 3QO0B 4Y16D 4NRZB 1S7UA 5B38B 2EH7L 1OTTC 1TLKA 1OY3B 4LCIL 3KYNA 1MHEB 4PJEB 1V5JA 4XRCB 4UUJB 4BK4A 4WW2A 2AJ3A 3DYOA 5HHPB 1WC7B 5EOCJ 4XCNA 3VFWA 4YHYB 5B22A 5AZEH 3ZKND 1LMKA 1S9WB 1BIHA 4PJAE 2MTPA 1BFVL 3KDMA 1RURH 1ULVA 3NCMA 4P9MH 1R3LA 4OKDA 5E95B 4B41A 5H35B 3LKQB 3FB7A 3IDJA 5DUPH 2XYCA 5HVHB 2QHRL 4MJ6A 1X5IA 5JXAH 4DVRL 2ADFL 1OM3L 3RL1A 1K8IA 4Q6IB 1F3JA 4NFDA 3VFMB 2P8PB 1Y18A 5GRWA 3WKML 4XNYL 1KCKA 5IQ7L 4MNQE 5JUEL 1XZ0B 1MFAL 2IH1A 3LKSB 4Y2DB 4OM1H 4OQTH 3R0NA 1JV5A 3VXRE 4XAWH 5EZJB 1KJ2L 5DA0B 5C08D 5KSVB 3GSXA 4TSCH 3EGSB 4L4VE 1QLRA 5AWNL 3D39A 2EYRB 2FJGB 2P24B 3TPUA 3BPOB 4U2YA 5HGDB 3O2WH 2JKXA 4L4TB 5FM4A 5GISH 1KCSH 2ZNWA 4HCRA 3SDDA 5E9DB 1RUQH 1WICA 4FP8L 3KG5A 2HN7A 3WFEH 2FBJL 5J1SC 5D96C 4YPJA 1T83A 3EHBC 5E03A 2BVUA 4KAQH 2R69H 3O8XA 3ULUE 2CK0H 4X9HA 3F5WA 1HH6A 4KDTA 3K8KA 4OLVH 3U2SA 2KL6A 3PP4H 1B3JA 3FFDA 2NZ9D 4M7KL 4P0DA 1S7RA 3ZKXC 1U58B 1AXSA 3HPJA 2JJVA 4E41D 1I1CA 2M2DA 4XTRC 1A6AA 1IQWH 1W2KT 1MCEA 4YBHA 3EDDA 2DMCA 2HJLB 3F62A 4K3GA 4RGND 4XP5H 5DJYA 2WWMD 4NO5A 5DVMA 1F3DH 3ZKSD 3T0ED 3KPOB 5EUOF 3VRLE 4UV7L 2F54D 5B4MC 4N1CA 1CE6A 4M7LL 1NLDH 3ZL4H 3C08H 3VI4F 2FATH 2FO4A 3OKKA 5C09E 2DQUL 1IC4H 2EDXA 4I9WD 4GG8B 1U8KB 5SX5H 5JDSB 4ONGL 2Q8BH 5I8KL 3Q6FB 5C2BL 2Q86B 3FFCB 3HCVA 2PXYD 1B2WH 5E5MB 4QLRA 5CZKA 1P9MC 2K9UA 5K9KA 4P49A 1WZKA 1LWRA 3NCJH 4IS6B 5FDWB 2AABL 1N7MH 3QUZB 1P4IH 1A9BA 4PD4K 5FA3B 1KF9B 2N1KA 1DLFL 4IOFC 4JFHE 4DZ8A 4DCQB 1I7RA 1RJCA 3G6JA 3RWDA 3DX7A 2YPKB 1ADQA 2F19L 5DJZA 4HJGB 1A47A 2ED7A 5HTSA 4MJID 2RQ8A 1GHFL 4S11A 2EE9A 4MNHA 3SQOL 4QRQB 4F7MA 5JW3H 1T1WA 3T1FB 3EAKA 2EDYA 5CEZD 2VQUA 1RU9L 3NAAL 3CVIL 1CTNA 4X6BA 5IW3A 4S0TD 5JHLL 1J18A 1CGSL 3UJJH 5HHXL 2DTMH 2WP3T 1CFQA 4YLQT 4K9EL 5T1MA 2Z31D 4POYA 3MV7B 2ITDA 1RHHB 4Z7VB 5D72L 4U6TA 1K8DA 4WU7A 1IGCL 4DUVA 1DEEA 3WFCL 1EJ6A 1IEAB 2IAND 2C1OB 4JFZH 4UDUB 5L8JB 4H1LA 2HFFB 2WINA 2EEAA 4J2XA 1J88A 1QRNA 2FECI 2DS4A 4KI5C 5C0CB 5IVNA 4E0RB 1G6RH 5D2NE 3P4NB 3B43A 3H2WA 1REIA 4G6ML 4XHQA 2DQJL 1ITBB 2UY6A 2X7LA 4M7JH 5FAAA 1YDPB 3NACL 4DGIH 1PLGH 3P4OB 4YQXH 4PP1D 4XPGH 4YDIL 3G6AA 3UXFA 4Z7QF 3KLDA 1JUFA 25C8H 1FYHB 2ENSA 3MJ7B 4IMLA 1BM3H 2IBGA 3I9GL 1DZBA 3CH8A 2YC1A 4X99B 1HH9A 4ZD3H 3MUJA 1C12A 1UXWA 2X42A 1UCBL 2ENYA 2MOVA 4OCXL 1MAKA 5EZOH 3UTTE 2P47B 5C9JA 5FYLH 3BO8A 2D0GA 3L3KB 5C0JA 4RX4D 3EOTL 1BJMA 1R5VB 1AQKH 2CKBH 2FWOA 3EYUL 4RRPA 1IGYB 4G6AD 4ELKA 1XGQA 4DQOL 3HZMB 1A7NH 4PY7B 3QEUA 4Z7OE 1YY9C 4JFOA 5TH2B 4JRXA 1I1YB 2JK5A 3O2VL 1CD0A 5ISZE 3X11B 3B8YA 5FGSA 2JLLA 4LVHC 1DQLH 3BD4A 3CVHL 3TJHD 3G04A 3HA0A 3GO1L 4ALAH 3GBNH 1HHJA 3EO0A 5DSCA 2YD1A 4QNPE 4ZAKB 2VLLA 1YNLH 4XCEB 2R15A 2X41A 3L5WB 3WE6B 3AUVA 4HGWA 3DO3A 3IYLW 3OPZH 1AKJB 1A0QH 1VPOH 3DMMA 2OJEA 4I77H 3BWUC 4M62L 2V2TA 5FF6A 4OLZL 4FQCH 1CGXA 1TZIA 4HBCH 2AV7A 3MLWL 3QCUH 1J8HD 5BS0B 1LO0L 4PLJD 3T2NH 2BFVL 1HSAA 3CNKA 1EHAA 4P57A 4MA7L 1TVHB 3RUGF 2BK8A 1MF2H 2A6DB 4RGMB 4F57L 1IM9B 1KCRL 4HKBA 3MO1A 5C08A 1B6UA 1YJDL 1SHMA 4YDJB 1CFNB 2BOCB 3VXMD 4OTXL 4LKCB 3D69B 4I0CC 4MQ7B 1YN7B 3LKRA 5IB5B 3ARXA 5I19L 3RP1A 3FT2A 1LK3L 4WW2C 4OZIF 4JFEE 4WRLA 3OKYA 2BOBA 3CLEL 3F7QA 4V2BA 4Z7WF 4H8WC 1UB5B 4JR9H 2DLFH 4OUUA 1OSZA 3UC0H 3MREA 1CQYA 4OFPA 1NCDH 4DKFL 5ALCH 1JWUA 4D9RE 5EO0B 5E08L 1CR9L 3NIFF 3L95A 3TVMD 1JNHB 4AQOA 4Z5RB 2HTLC 4Y19D 1A1MB 1I7UA 1UJ3B 4Q58C 3ZTJH 3HI5H 3ESUF 3NPZB 3NMEA 2VUOA 1D6EA 3OHXB 4XAKD 2DYPA 3QEQA 4KXZI 1A6VH 2NY4D 1NLBL 3EIFA 4N8VG 5T1KD 4G8GA 1NMBL 2XPGA 2Z92B 4MQSB 4AM0A 3T0EA 2IALB 5I30L 3RWIB 4FZ8H 1EO8H 3LPFA 1JN6A 2F54A 1FQ9C 4QXTA 1A3LH 3SCMD 1WBZB 2ARJB 2VITB 4NQED 2D2OA 5L9DH 4NN7B 2NY6C 1YEEL 3MV9D 3HLAB 4I2XA 1BBDH 5ADPL 3KPLA 5D9SA 5IJVA 2P5WB 3PXJA 4JPWL 3EBAA 5C0DB 4NKIH 4TSAH 1F3RB 3MLVH 4M93B 4XNUL 3RX7A 4UT9L 2J5LC 2YPVH 4K7PH 5JHDE 3QDJE 4R8WH 2XZCH 4KDTC 3D18B 1U6AL 4OCRL 3SGDH 2R1XA 2DN7A 3PL6A 1T03L 5HY9B 1N5AB 2UYLB 2FECL 1K3IA 5CJOH 3SGKC 1RZFH 3U0TA 3HZKA 4V1DE 4MJIA 2EIEA 5I1IL 3CFJA 4ENEC 1OAYH 1RMFL 3SDCB 3HN3A 3O11B 2H9GB 4KK9C 4HW6A 2Z31A 4NWTH 3WIFA 5F6HJ 4EXKA 4OLXL 1NUGA 4H0HB 2YKLH 1LO4H 1IARB 1T04B 5FDYA 5MP6H 1K2DA 5IB1A 5JLZB 3JTTA 3VRIB 2X1PA 3KYMA 3TT1L 5BVJB 1UM5H 2IANA 1N8ZA 5IM7A 4NZDA 4K2UH 1YEIL 3ARBA 3DHMA 1F90L 1DUZA 2LVCA 4GXVL 3W2DL 5IMOA 3MCLL 3G5YB 2Q7YA 5ANMB 5E6YA 1WZ1L 4JO2L 4FTVB 4B5EA 3MUGB 5D4QA 2R1YB 3CGTA 4UU9A 5A2JH 3THMH 1LE5A 4J1UB 1TZGL 1CD8A 1EFQA 4XMPL 2HKFL 5CZVL 1HWGB 2HRLA 4O02L 4GRLD 3O2DL 2GSGB 2HT3D 1S9VA 2C4XA 3BWAB 4OD2B 3UO1L 3ARQA 5IK3A 4FOMA 2AEQH 2AJVL 4B7LA 3IVKB 2GEEA 1KBGL 3GEWB 4PG9A 4ZO6A 3WS6C 1Q94B 4O51A 3RAJH 1FIEA 3C6LC 3DV4B 5IB3A 4YHKL 2VLRE 2XFXA 4N90D 4AEIL 4AEHL 5FKPA 4GKOA 2UUDK 4NQSB 1CDBA 1MIEL 4ETYA 1IAII 3H8NA 5FYJD 3LHPH 4XNQB 4JRYD 5F3HA 4ZUSB 4KKNA 3FONB 1AGDA 1MHCB 5KW9H 3CC5B 1HDMB 4BM7A 2R0LL 4NZJA 3TZVC 5EUOA 2BVPB 3GSNL 1X6LA 4JDTL 5I1KL 3I6KB 2CH8A 3S3SA 2OI9C 4NHUB 3RKPA 2W1NA 1KB5A 1X5AA 4BELD 1XGYH 3HE7C 2D4FA 2Z93A 1JGEA 3RIAK 5I1HL 3K74B 3UYOD 5IB2A 1G7LA 5CD3A 3ES6A 4X9IA 3WXWH 3L7FA 3RBGA 4UT6H 4EEEA 3V4VH 4JHBA 3IAPA 4PJ8B 4ZSOE 1GYAA 4KHXL 5KVGH 1BJ1H 3RY5A 5KS9B 1G7QB 1J8HA 5CGYD 4M1DH 1D5BB 5DRNB 2ICWI 1JPGA 1ZVSA 1UT9A 4KJWD 5IQ9A 3QIBC 3D3VB 5I6XC 3O6ML 3V5DA 3SY0B 2W59A 5HGHA 4GW4B 1J1OH 4AMKH 2VB5A 1KTDB 1KV3A 3SPVA 3P9MA 4JN2A 4Y16C 1IAKA 4LNRB 5E8DL 4LLMA 3NOIA 1A6UH 2BNRB 5CWSB 1XF3B 2RR3A 4OT1H 3P0GB 3INUH 1T4KA 4PJBB 1TJHH 2A1WL 3MRMB 1RZJL 3L3JA 4F7CB 1E4XI 4YX2L 5C3LD 3SQBA 3ZKNC 2OSLA 4MA1B 1WEJH 1NFIB 1ZLSL 5J11C 4PR5A 3RWEB 2Q87A 4TUJA 1K5NA 1VERA 4D3CL 1EMTH 3TVMA 5DDHB 4H1LG 3FN9A 4Y19A 4K23L 3T0VA 1KIQB 4ZTOL 2OK0L 2BDNL 5DMKA 2X44D 1LEKA 4OGXL 5E2UH 5HYSA 3WDHA 3KVQA 1YYMH 3V6OE 3NN8B 2ESVE 1A1OA 3QDGB 3LV3A 5GXBB 1BOGB 3PWVA 3LEVL 5KZCB 2FR4B 2X09A 2CR6A 2D31A 4GAJH 4ZFOB 4IOSD 4MWFB 2YRPA 2AXGB 2DLGA 3FT3B 4JRWA 4PB0H 1ZLWK 5L2JB 4NQEA 5D7SL 2IH3A 3D25A 1C16B 2VDML 4Q9QL 4EUPH 3MV9A 4KKCC 1MJ7H 5IT2L 43C9B 2RGSA 5BQ7A 1SJEA 4HKXA 4NUJB 1KPUA 1BQHB 1G0YR 3U9PH 4F33A 1QYGL 1NC4B 3WIIH 3RPIB 4P23D 3TYFA 3BEVB 3MBED 1W8NA 3JV5A 4PLKC 3CCHB 2XN9E 3U36B 1FNSL 3QZWA 4OZ4A 4YHMH 2W9DH 1CXEA 1Q9KA 2V17L 4TUOB 4R4BA 1KC5L 2NZ9C 3V6ZB 5GQBA 5IMLA 3CFBA 2Y9RT 1E6JL 2XKUA 3TYGL 3BIBX 3GIZL 1PDKA 3BMWA 3ZDXE 3QXVA 4LMQE 1GAFH 1MFDL 4Z77A 5I8OH 3H9SD 1N64H 3PWPE 1P7QB 1A3RH 4RGNC 5DUBB 1SQ2N 2A38A 3VFUB 2Y6SD 3QWRA 2H26B 3RWGA 1RUMH 3T0EC 1TCRB 3OKEB 1KYOJ 4NO3B 3G5ZA 1SVZA 5F9OL 1I7TA 2KDGA 3LVEA 1UQSB 1QSEE 4PREA 3HNSH 4ZXBD 5AAMA 1MRFL 5HDOA 4OBRA 3SGJA 1UVQB 1SMAA 1INQA 2RB8A 3V9FA 3WFHB 5ESQA 1S3KL 1OGAE 7FABL 3U4EA 2BSSB 2FIRT 1MJJA 5D5MF 1Q1JL 3B5TA 5D1ZB 4CBPA 2PXYC 2OR9H 1VACA 4ZPVB 4X4YB 1HWHB 1KELL 5GS0H 4L9LA 1G9NH 5JIHA 2FIKB 2F53B 4MXVF 1P69B 5EU6B 4Z7WA 2VR5A 3ISWA 5MEQB 4QHKI 2DMKA 4KRLB 3ULVH 4WUKL 5DHYB 3BT2H 2IPUG 1QFUL 3OKNA 5IOPB 2IBZY 1H3VA 5CS7A 3MOAL 2B1AL 1CDCA 3IF1B 5B3JE 4HPYH 1U8OB 3BN9D 1N2RB 2ZOLB 4ETQB 1KLGB 2E9IA 5TJWK 2JF1A 3TCLB 5HYIA 4XVSL 1GGYA 4MNQD 3GHEH 2Z31C 3S96B 4ZNEE 3VXRD 5DWUH 3CLFH 1HXMA 2EXYD 2IADA 5HVFB 4L4VD 5GRUL 3BPNC 5HHOE 1QSFB 3KJ6L 3X13B 4LLUB 1S8DA 1TCMA 4Q2ZB 4N0UA 2CUMA 4Z6AT 1DVFB 1XF5B 4OKVB 4ELMB 4QOKE 4NBXB 1UWXK 1QEWB 5FECA 2AK4B 4G6FD 5EA0L 1OT2A 2DQHH 1V8HA 3B2VH 1QBAA 3GI9L 1H8NA 3ULVE 1E4XL 1D3CA 4NNYA 1EGJA 2H8PB 4NQXB 3V6FA 3GMNA 4PP1C 1PG7H 1EO7A 2HVKB 2ICWA 3BGMA 5T5NG 2WUBH 1JYVA 4RMQA 3BPCA 4HUWB 1QHOA 1F45A 1R5IA 4Z18A 5FFLA 4GS7C 4Z0XA 4QRTB 1FVCB 5EC2A 5J13C 1S7WB 4Y5VB 1P5UA 3TO2B 1YECL 2YPLB 1FL3B 5E1AB 3FB6B 3VCLA 2YWZA 3H6JA 4GMSH 1TNNA 5D1XB 4KTYA 4PYHA 4ZS7L 5KSBA 4PJDF 4HFWB 5AG8A 5HGBB 5JR1L 4JDZB 4P46B 1I85A 2MHAB 1ZOXA 3O6FB 2GTZB 4HUKB 1I9JL 4G6AC 1E4WL 4OB5L 4OGAC 5C09D 3VRJA 4U1SA 1G9MC 2MMXA 3DUHA 3MRRA 4F80A 4TUKL 4UTBL 4BZYA 5KVFH 1I9RH 3BP6B 3TJHC 3MUY1 2VDOL 1Q38A 2I60H 3F6LA 1YNKH 4Y4FA 2APVA 4KUZL 1JGVL 4M5ZL 4TQEL 5TDPA 1NBQA 3MRQB 5KSUA 2H1PL 2YSSB 5ITFB 1B0RA 2EYSA 5CIPH 1QBML 3LS5L 4KI1A 2FSEB 4OD3L 2GKIA 3IAGC 4XNZC 5E6ZA 4CMHC 1KEMH 4JFHD 2WNGA 1KG0B 1P53A 4XX1G 1QFOA 3EFFA 2H3NB 1G7IA 2XTJB 4PLJC 1RK1A 4U6VH 4U6YA 3ARZA 1WLHA 4H20L 3FQWA 3TH3T 5IG7A 5ESVA 2FGZA 4Z9KB 3GUTB 3KS0J 5ETUB 1NAMH 3LD8B 1P4LA 4LIQH 5J1AB 3BQUC 3QCTL 3TV3H 3I75A 2R9HD 1L0XA 4ZUWA 4HWNA 3NA9H 1EHNA 1VSCA 5D7JB 3DIFB 2Y72A 1JYXA 4KZDL 5C70A 4DKAA 1A7PL 4LCUA 4P23A 3MBEA 3CFKB 1AY1H 2AXFA 2D9CA 2BSTB 3GJFK 3FOLA 1I7ZA 1JPTL 2G75B 4HEPG 5DJ2B 2XWJB 3LKPB 2BMKB 5DQ9A 4NC2B 4UMGA 1EHXA 5DZLA 1JHTB 2A77L 5B39G 1P5VA 1UENA 4UQ3A 3MJ6A 3H9SA 4BSVA 4P4KA 4Q7DA 1RI8A 5IVXE 5KJRL 1JGDB 1PY4A 1RZJC 3AAZB 3WSQH 1FSKB 2HG5A 4M48L 5E8EA 1NAKL 5IV2B 1I1FA 4QXGH 2PYEA 3UTTD 5DFVD 1X3DA 1AE6L 3SCMC 3QNYA 5BOPA 1MCQA 2GJZB 5HHMB 5DJXB 5FGCE 3E6FA 1WAAF 2IC2A 1ETZB 3TLRA 4H25B 4I0PB 2OL3A 5FYJU 2RBLA 1ZT4B 5EC1B 4HIXH 3W39B 3BKML 4BQCA 1LO5B 5BXFB 4GMTH 4ZFFA 2NY1D 4M4RA 5ISZD 3DRQB 4PJAA 3E0GA 3M8OL 2VH5H 4QKXB 3V4UL 1U8QB 3D48R 3NPSC 1AI1H 4PJEF 1YYLL 3QUXB 1EFXD 3VGGA 1D5MA 5J3HD 4PBVC 2K7PA 4P2OD 5DK2B 4ODWB 3MV8A 3EDEA 2QQLL 5SWQA 1TPXB 2NY3D 5L2KB 2P8MA 1FC2D 4HWEL 4XVUD 5I66A 1GGCH 3O6KH 5HYSG 3I02A 3SOBH 4X9BA 2LAAA 2C1PB 3KPSE 3F7VB 3ULUL 3D2UB 2VAJA 2YA2A 3VXRA 1NCCH 1NFDE 1UYWL 4UIKL 4CVXA 2JCCB 4HQQH 3SGJC 4CDHA 1B4JH 3WYRA 4KQ3L 5MI0C 4TNWF 5SWSB 5I1AB 3BN3B 2W0FA 5H2BB 2DIAA 4FQJH 3CZFB 4N0FA 4KROD 1CK0H 3MRHA 4JFED 1T0PB 2R56L 5C0FB 5DMGD 3BJLA 3EFDH 4WI6A 1CZ8L 1HKLL 2NY2B 4CN1A 5DYOA 1NC2A 3SGEH 1UXSB 2DJUA 4D9RD 1FGVL 3H9ZA 1NGQH 1H0DA 1MIMH 1EEUA 5DC0A 4HZLB 1LE9B 2XRAH 1G0XA 3TO4D 1GXEA 5BV7C 2ZG3A 4NT6A 4PRIA 3G6DH 3AS0A 1J0ZA 2F58L 2VC2L 4GRLC 4YGAB 2HT3C 3RNKB 3QZWG 3TWCH 2XXMB 3DX8A 5D1QD 1AR1D 3L9RA 3QUMB 2M26A 4OQTA 1JYWA 2DD8H 5I8EB 4JJ5B 3MUZ1 3I6GB 1ZGLP 3MLUL 2FX9H 4KGLA 2YUZA 1T89C 2CDEB 4MAYD 3WN5C 3D0LA 4K7FA 1FL6A 1Z5LB 1R24A 2BVEA 3WNMA 1ZLUK 1TJIH 4PRPA 3DSFL 1OWWA 4LCCB 5HHQA 1KPRB 3MLXL 3NFPB 1FG2A 4P4RA 1CQKA 3BXNB 2KH2B 1XF2A 2FD6H 1NEZA 2BVOA 1NUDA 3O4OC 3BDXA 1UKQA 1FL5B 5KANI 4EJ1C 5IIEB 1T0MB 35C8H 2L7UA 2YEZA 4YUEL 5GGRA 4PJFE 2ERJC 4HUVA 1X44A 3IFPB 2VIRB 4LEOA 4PJXB 2GFBB 3VFVB 3QHFL 2GT9A 2A9NL 3DBXB 1MFBH 4HXBL 1TQCC 4LOUD 4QF1B 4JY6B 1LD9B 3QDJD 3RX5A 3RVUD 4PJHE 3GMMB 3H3KA 1DBAH 2QQKL 3ECBA 4QWWC 4UILL 4OCWH 2X4QB 5BJTA 3BP4B 4IRSC 5CGYC 3ROLB 2B1HL 2F74A 4V1DD 3BP7A 5HDQL 1BGXL 1AO7E 1RIVL 3N0PB 1V7NL 3B2UD 5D96B 5E00A 1NCAL 3IDMA 4X6DF 1H15A 5EBLA 1MY5A 1EVUA 4LDLB 3T08A 5ECJE 5F7UA 1LDSA 1I85C 1NGZA 1T1XA 1OTUC 1R0AH 2CJUL 4AYFA 4HFUH 2WUCH 2EIZB 4OSUL 3F6IA 2IPTL 1FYTE 5HGAB 3VA2C 1CDIA 1FNFA 2I26N 3DWTA 3QH3A 4DW2H 3QFDB 2ADGB 1MCWW 3IKKA 4IHOA 1HSBB 5SWZE 5F88A 5ALBL 2ITCA 2JB5H 2DLHA 2H45A 5JQ6L 5BCAA 2G5BB 1CLZH 1U8MB 3SBWA 1FVDB 2GJ6B 1MCDA 4BFIA 3QHZH 2E3VA 4P3CH 2XNAA 2R29L 4JO4L 3UROR 2J8OA 5AZ2H 3MOBL 4XT1C 1D5ZA 5T3ZL 2ZUYA 4CW1B 3DVGA 3WD5H 2I07A 2A83A 4HD9A 3K2MC 3VMPA 5TFSH 4MNGA 1XIWA 1ZGLA 3N9GH 2IAMD 4XC1L 3ZKQD 2HRPL 1DLHA 1IL1A 4FQ1L 3OB0K 4X4ME 3UTTA 3HFML 5H37G 4AK1A 4OFDA 2VLRD 5L0QB 4G6KH 1YPZB 1BP3B 4XNMA 3EUUA 4KTEH 5IFAH 1FFNA 2BXYA 4OF6A 3OKLB 5L6YH 4PJDA 4HX1B 4IDJH 5I71B 3S5LA 1T20B 3MNVB 4J8RB 4ODUA 2ZJSL 1KPVB 3O0RH 5ADOH 1F11A 5ICXB 3MBEC 2A9MH 1BREA 5ISZA 1XT5A 4RFNC 2CLZB 3T4YA 2F15A 3WL9B 3GRWH 2HA1A 4S1RL 2IQ9H 3IJYB 1N3NA 5DMIH 4OM0H 3U0WL 5GIRA 3C6SA 2ZKHL 4P2OA 4ZYKB 1PEZA 5E99L 3P0YL 2PO6B 2RJMA 4LKXB 1UEYA 3S37H 4AIZA 1YUHA 3VXQA 3UBXI 1I3UA 5BO1L 3GMOA 4AL8H 3O4LB 4PGEA 3H9HA 5EBMA 1UA6H 4M8QB 1CL7I 3JBG7 4U7SA 4FQ2L 3QNZB 2BSRA 3MA7B 2FB4L 2Y6SC 1K4CA 3H7LA 3C5SA 3OR6B 3HE6B 2CKBA 4ZXBC 3TNMA 3L3HB 1ACYH 1C5DA 1IEBA 5BRZB 1Q9LA 3ALPA 3EOBB 4ESKA 3WXVH 4JM4L 5CBEA 3FL7A 3AROA 1WBXB 1NGWB 1P2CA 1B4RA 4LQFH 2OJZH 2VDNL 3NTCL 4GRWB 4IRJD 4JFEA 2UZIL 2MFNA 3QDMB 1JNLL 4PJIB 1KEGL 4ONFL 3GSOA 2C3VB 2BNQB 2QR0B 5D7IB 4DGYL 1P84J 1II4E 3L5HA 4YDVA 3ARGD 4JHWL 1AGCB 5F7WC 3U6RB 4BSWA 3MRPA 4DAGL 4M9OA 3VWKB 4M03A 4OAWB 1XR8B 3TO4A 5IWLA 3GJFB 1JFQL 2X1OA 1IC1A 1UWEL 3DGGA 4IRZH 2FJFB 5D1QA 1EVTC 2QKIB 5B8CC 1NDGA 2XT1B 3BH8A 5E8NA 4J3XA 3BN9C 4N1HB 3MV01 5FKAA 2ESVD 3BZEB 1OP5H 4W70A 4QT5B 5CMAB 4JFXB 4U3HA 4MAYA 2IPUK 4LVHB 3GIVB 4P2RA 4S1QL 4BYHA 4HKZA 4ODBD 3OL2A 3FN0H 1FDLH 5TQ2L 1YNTA 3GSUB 1MY7A 1ZLVH 1T2JA 1IVLA 4L3AA 4N8VB 2DWDA 4PGDA 3RWJA 3ULVF 3DTXB 5ACMA 3B9KD 3A6CH 1XH3A 3CFCH 4KZEL 4MHHI 3QUYC 1DSFH 3RY6A 4I3SH 1A6TB 5FUCE 2R4SL 1WAAA 2DF3A 3ULUC 5BVPH 3QDJA 4NNPH 3OXSA 1BZ7B 1LEIA 3WNOA 4MXWL 5T3XL 4LDEB 5DD0H 1EBAA 1S7UB 4CADA 3QO0A 4UT7H 3KYNB 4L5FL 3LSOA 4DKEH 1WCBA 4JFYA 4WW2B 2AJ3B 1DL7H 1WBYB 2ARWA 2V9TA 4PJEA 4XCNB 3VFWB 4PBXA 3P30L 3PWPD 2YMXH 4YZFE 5HGGS 5HHPA 1WC7A 5DS8A 1HOCA 4N9GB 4G6JL 3IFLH 4LMQI 5JORB 5B3NA 3EYFA 2F8OA 4JKLA 3GMQA 1BQLL 3MC0A 1R3LB 1D5IL 3GM0A 1QSED 2MNUA 1CXHA 2LFGA 1JL8A 3VG0L 1MCOL 3IDJB 4GKZA 3TC9A 3QUKA 2H2SD 5KBNC 1UKTA 4URTB 4MJ6B 5DD5L 5EZIH 5J12C 4Z7UF 1OGAD 3RL1B 1K8IB 2O5XL 5JW4R 2IFFH 1F3JB 1MRCL 3VFTA 1Y18B 5JNYA 2R8SL 3MMEA 2XZQL 2IH1B 5A16B 3P0VL 4GQPH 2FNBA 3IAQA 5L8KB 3CDGA 3PQYE 3MRKA 3LKSA 3DO7B 4NIKB 3GSXB 1QLRB 2BVTA 4RDQF 4ZODA 1ZKAA 3HNTL 1N5YL 3AB0C 4LQ1A 5KSVA 3EGSA 5LGHH 4JO1L 3TPUB 4Q0XL 3CSYA 4AQ1B 1QKZH 3LPWA 2W0LA 5J6HB 1RIHH 3OXRB 3ILPA 3SDDB 3U7AA 1NGXA 4WEMB 1OQOA 1UM6L 1A8JH 3AFLA 2CMRL 5C86A 2IAMA 4OV6F 1KXVC 1T2QL 1HQ4B 2KKQA 5HHVH 4NC1E 2D7TH 1AC6A 1I8LA 2R0WL 2J5LB 3UTSE 2VLRA 4Y5YA 5CSZA 3F5WB 4G7YL 1HH6B 1CL7L 3KR3H 4JG1H 4YEFA 3C09C 2X89D 4YFLF 4Z8FL 3U2SB 4LF3A 3MLSH 1NCWH 3FFDB 4JFPA 1CD9B 3KPNA 2Z8SA 1S7RB 3LKOB 4XBEL 5HHOD 1RZIB 3HPJB 1AXSB 2VQ1A 3PWNA 1A6AB 2YZ8A 1MI5E 1NEZG 1LNUA 5GS0D 5DJYB 4QOKD 4NO5B 4KMTL 5D2NC 3UBXA 1AXTH 2CXKA 3FHAA 4N0YL 1UH4A 4OGYL 3ARTA 4P59H 3ULVD 1CE6B 1FE8H 3FOMA 2P43B 2J8HA 3ABZA 2FO4B 3LDBC 3OKKB 2Q8AH 5CEXB 4XMLH 2X4SA 1D7FA 3JV4A 4NNXA 4EN3D 3TFKD 1U8KA 5DQJA 5C6PB 2VSDA 1EPFA 4TULH 3HCVB 3ZE0F 5DFVC 1JRHI 3FFCA 1PAMA 1SY6H 1WFUA 1CFSA 1S5IL 3MRFA 4LCWB 1A9BB 5KVDL 4M43L 5KS9F 3NH7L 2VXUH 1F4XL 3P9WB 4DZ8B 4WUUE 1I7RB 1BVLB 2PR4L 3G6JB 2DM3A 4HSQA 4OBSA 3RWDB 3DX7B 4X6DA 4IRJA 4DZBA 2GK0A 4MNHB 3RZWA 4F7MB 3QDHA 3QXAA 1ZV5A 1V3JA 3QIWC 2R1WA 5BMFH 4EI6B 2DDQL 4X6BB 2DLEA 1QRKA 3ARGA 3MLZH 4HF5L 4GSDH 1FGNL 2P5EB 4YXKL 1NBVH 1DBJH 2WQRA 1FPTL 1CFQB 4X5XB 2JELH 5T1MB 4DVBA 4PJBF 4P2OC 4BQ6A 2V9QA 4AG4H 2R0KH 1LO3L 4WU7B 3DRTA 1DEEB 4WI2A 1V7MH 4BQBA 1G7MA 2R2BA 4XVUC 3TZVB 4L4TE 1DBKL 5DK0A 4H1LB 2XKSA 5GGTH 1IEAA 3V79C 1QRNB 3VXNA 3B83A 3U1SL 5DI8A 1P4BL 1N6QH 3MUHL 1QBLL 3IDUA 1AJ7L 5CILH 2X7LB 3BUTA 3OJ2C 3T0BA 2HTKD 2NY5L 2P1YA 2KUTA 5EU5A 4KPHL 2Y07L 3G6AB 1H5BC 1JUFB 4KROC 4LRNH 3B9KA 3HC0A 3B6SA 4I13B 2YC1B 1HH9B 2DJSA 4PY8I 3ZKMD 3MJ7A 1NEUA 1C12B 1UXWB 2VLKE 3FAWA 5DHXB 3QIBB 5DMGC 4Z7NE 1L6ZA 1KIUA 2VNCA 3S5LG 3FTGA 4HUMB 2Q76A 4UOJA 5C1MB 1CLYH 2APTA 3BAEH 4QTHB 2ZSWB 3BO8B 5GJSL 3GBMH 3NABH 1RIUH 2O61B 3QR2A 1DN2A 2BY1A 3MJ9L 1EX0A 3QEGL 2PYFA 3K7UA 5C0JB 5IWLC 1CGUA 4Y4HC 4P9HL 1EUTA 2DQEH 2FWOB 3CUPA 1JHLH 2OQJB 4ELKB 4M1GL 4RMSA 5H94B 2AI0H 2UZXB 1AR1C 1R5VA 4YGVA 5JIIA 1F97A 3ZE1F 3QEUB 4JFOB 4M6OH 4GKNA 4PY7A 1SEQL 4WHDA 2JK5B 4CUCA 3W0WE 2HKHH 2NY0D 2NYYD 4GW5A 4CU8A 1MJUL 1UZ8B 3G04B 1PX4A 43CAA 2YXFA 5CHNA 5DEFB 5DSCB 1HHJB 3EO0B 2EE2A 3ARSA 4Q74A 1QSEA 4EUPA 1J0JA 3SN6N 3CMOL 5I1JH 3W81A 4HGWB 1ERNA 4JKPL 5IR1B 4KHTL 1L0QA 4ZAKA 1O5DT 1FNHA 4ODHL 2OJEB 5I1CH 3WIHH 2R2EA 2YN3A 2V2TB 5FF6B 2OTWA 1OGAA 3QDAA 1DANU 5ICZA 1TZIB 3GBLA 1FG9C 2AV7B 3P11H 3MRJB 1HSAB 1JWMA 4P57B 3RY6C 3TT3H 3AU1A 4D0CA 2X2YA 4LOUC 3OKMA 4PG2C 3BHBA 4PV9A 3MO1B 5C08B 4RCAA 3RVUC 3STBA 3WUZA 2A6DA 4C59B 1IM9A 1X5HA 3Q48A 5C92A 1DUYB 5GRXG 2OBGA 1MPAL 3LKRB 2GTWA 4TTDD 2YD6A 3FT2B 1RULH 4XPFL 3B2UC 2BOBB 3WJLC 4DOHE 1J87A 1M7DB 1UJTA 4OUUB 1OSZB 5F1SA 3LOWA 1F8TL 5JW5B 3MREB 3CFIC 2DRUA 3QWOA 2C3WA 2BNUA 1JWUB 1ZHBA 3KPSD 3N85H 2P7TA 4RGOL 1HI6A 2X70A 3L95B 3S98A 2X89A 4ZNEA 3LQMA 2YRLA 4O2FA 5EO0A 1I7UB 4X0KA 2VN7A 5INDA 1OPGL 5IB4A 5HHOA 5ID1B 4JLRA 2EDQA 1JRHL 5KANG 3GFUA 4G3YH 1D6EB 5F44A 1AR2A 4YHZL 1KN4H 3WBDA 4YWGH 3UPRA 4QOKA 5CJQH 3OHXA 4G8GB 1OSPH 1OW0A 4P2YA 4NKOA 3T0EB 4HWBL 1IC7H 2X4OA 1X5YA 4YHPA 5HYJE 3S6CA 1JN6B 2F54B 5LQBL 1PKQE 4R2GD 1SEBA 4KVNL 4QXTB 3JWDC 4H8WH 3K2UH 4GKSA 4P2QE 3U7YL 4M6ML 2ARJA 2ORBL 1I1AD 3ZTJG 3S35X 1MWAH 4I2XB 3KPLB 3O3AA 5D9SB 5IJVB 3H42H 2IAMC 2PXYB 1X5ZA 1JZ3A 1I8LC 3EYOA 5K9QG 2EH7H 1L9MA 4Y5YC 4LCIH 4TSBH 4FN0A 4WU5A 1R5WA 4ZNCD 1QP1A 4MAUL 5BW7A 2R1XB 2I9TA 5F21B 4RMTA 5C0RL 4J3UA 4XMKL 4MD4A 3J8F7 3U0TB 3HZKB 3PHSA 1BFVH 2ZUSA 4MJIB 4WI8A 1SMOA 3WJJA 3CFJB 2GSIA 3D5OF 4Y2OA 4FQIH 4JM2F 3OBAA 1HNFA 2QHRH 1CCZA 2Z31B 3WIFB 4DVRH 3S35L 4Z7UA 1I1RA 3BE1L 1OM3H 3SO3B 1JI2A 4O9HL 2QHLA 1K2DB 5IB1B 3WKMH 3JTTB 4XNYH 1TETL 1MQ8A 3BPNB 3RRQA 5IQ7H 2DJ4A 3KYMB 1T04A 1XMWA 5JUEH 1MFAH 4HULB 3AY4A 3I84A 4XI5D 1YMME 2DQTL 1N8ZB 2IANB 1VFAA 4GAYA 2H6PA 4JB9L 1KJ2H 2LVEA 1DUZB 1AO7D 5BVJA 5IMOB 2Q7YB 4KDVA 4G7VL 3MGAA 4JQIL 5ANMA 1EGJL 4MA3A 5DRXA 4H0GA 4FTVA 4HHAA 3MODH 3JWOL 3VGAB 4IEFB 4PGBB 4Y1AA 4FP8H 2HT2C 2BJML 2FBJH 2MJWA 3SKOB 5FO8A 5IESL 1FYTD 3QO1A 3MXWL 2QLVB 4IRJC 1Q0YL 5KSAD 2J4WL 1S9VB 2ZUQB 4R6UA 2VE6B 3DXAE 3OQ3B 2HYMA 3I3BA 5IK3B 3KXFE 1BFSA 1JTPA 5SWZD 4BUGA 2AJXL 2UVEA 2R2CA 3BWAA 4BH8A 4PG9B 2VR4A 2GCYA 4O51B 1AH1A 4GQ9L 3RFZC 5CIPA 1XAUA 2XFXB 5FKPB 4U2ZA 3U4BL 5F3HB 3TIEA 4JGMA 1JK8A 5FUZL 3GSQB 1AGDB 3UBXG 2Q20A 2B5IC 2VL5A 1ZA3A 4ZUSA 3EO9L 5E6ID 5IMMA 3V6OC 2EDBA 5IVXA 5DO2D 1HDMA 1NAMA 4UV7H 4M7LH 1NSNL 1KB5B 5E56A 3GGWA 4YHOL 3I6KA 3OAYK 4F2MA 5MERA 2Y5TB 2DQUH 1R3KA 5F6IC 5B39B 3GK8L 3RIAF 3ZE2E 5J6GA 3ARDD 2Z93B 1JGEB 4ONGH 2FLBT 1YA5A 1RAMA 3TN0C 2DLTA 5IB2B 1G7LB 1J11A 1TJGL 5CD3B 5I8KH 1CLCA 3ES6B 1ZHKA 3L7FB 1BAFL 4XNZB 1FIGL 5C2BH 2OCFD 3T1WA 4CMHB 4LLQA 3VD4A 1DBBL 2AABH 1J8HB 5FCUL 1JPGB 1IM3A 1ZVSB 5IQ9B 5KS9A 1BEYH 3V5DB 3LQAL 5HGHB 3ZSSA 1SBSL 1D5BA 5DRNA 5FB8B 1DLFH 3PGDA 1DBML 2VRAA 3SPVB 3O6LL 3P9MB 3TBTA 4JN2B 2L7JA 3LMJL 4OF3A 3GNML 4LLMB 1GHFH 2IG2H 4P5TD 3FRUA 4C4KO 1Y6MR 1OD9A 1RU9H 3WLWD 2AEIT 1JTTA 4JM2D 4TYUA 5IVOA 4JZOA 1T4KB 2VXTL 2YD5A 5JHLH 4HJJL 1CGSH 3L3JB 5HHXH 3WO3B 4J3WA 4K9EH 4PJBA 2OSLB 5KTEH 4F7CA 1CGWA 5D72H 3KPSA 5HYEA 4TUJB 4R0LA 1NFIA 4QRPE 5FHBL 3TVMB 3RWEA 1NFDA 1DQDL 3JVGA 3WFCH 4Y19B 1EZVX 1OP3H 3ZDYF 5DMKB 4GBXC 1OP9A 2H2SC 1LEKB 2CUHA 1KIQA 5HYSB 1OCWL 4L3CA 1L7IH 1S7SA 1J0IA 1A1OB 3BZFA 3SJVD 3LV3B 4XP6L 2NY4B 4F8QA 2DQJH 3PWVB 1FFPA 2JCCF 3C87A 2D31B 3NACH 1IGML 4L8SC 3KLHC 3L1OL 5TE4L 4GG6E 2FR4A 4YDIH 3QQ3A 3C5JA 4PJ7E 1K9TA 4MWFA 3EJZD 2CLVA 4NQEB 1B0GA 2IH3B 3D25B 3QJFA 5LG1A 1UCBH 3WDIA 3MV9B 1I1AA 1W0WA 4OCXH 5L8LB 4QY8A 2MKLC 4LSQL 1SJEB 4HKXB 1KPUB 3VDAA 3VWJC 4F33B 5KN5A 3CSBA 4YDLC 3B9EA 3TYFB 1BQHA 3EOTH 4LVOB 4JG0L 3S7GA 3HG1A 3FO9A 3EYUH 2IF7A 4I48B 3U4AA 4AENA 5CP3H 1FAKT 3FQTA 3RPIA 4D9QE 3LY6A 4DQOH 1VCAA 3QZWB 1J05A 4OZ4B 3NPSB 3IJHB 4UV4L 1IKFL 3RVWD 4R4BB 3U36A 5KAQG 3CFBB 3O2VH 3S4SA 3UTZA 3MYJA 3V6ZA 1P6FA 1CDJA 2UWEB 4EUPG 5EIIB 4Z77B 1WSST 3GO1H 3H7BA 5GS0C 1FNEA 3AVEA 3AXLA 1EDQA 1Z9SA 3RZCD 3RWGB 1B88A 3HB3D 3G5ZB 3VFUA 1I7TB 5FYKE 4M62H 1RJYA 4KJPD 4IMKA 4PREB 2O5ZL 1E27A 4YIQA 2MWCA 3MLWH 4GOSA 5AZEL 4MQXD 1LO0H 4PJHA 1FRGL 2BFVH 2DI8A 1QFHA 1INQB 4MA7H 4AH2A 5DK3A 4EN3C 5ESQB 1RUAL 4PJXF 3VXSA 4HUNB 3TFKC 1TNMA 4F57H 3U4EB 3KGRA 1KCRH 3MLTA 2FH8A 1S7XB 3E6HB 3CXDL 1YJDH 5FO7A 5HBBA 4ZOCA 2EDWA 1IAOA 3HI1A 4OTXH 2BX5A 5I1LA 1VACB 4JVPA 4OZHE 4E5XA 4G8EA 1VHPA 1LK3H 4X4YA 2QQNL 2PKDA 1GGIL 5BW7C 1AHWA 3CLEH 4JVUA 2YBRB 5BV7B 1FYTA 1GOFA 5EDXA 3BP5A 4GRLB 2WSKA 5EU6A 5KSAA 2VTFA 2AVGA 5MEQA 3OKNB 4DKFH 4K3HA 4ERSL 4XAWL 1CR9H 5CEYB 5E08H 5SWZA 3A6OA 4YHLH 4JEGB 5SX5K 4YE4L 2WBJD 5FOJA 4LLWA 5F7KC 1HINL 3O2WL 4LP4A 3TCLA 1I3VA 4EIGB 3PQYD 4DN3L 1MSPA 1HXMB 1RUQL 2VN4A 2IADB 4M7LT 3S96A 2JJWA 2FHFA 2K1MA 2VKWA 3V6BR 4LHUD 3E8UL 4M9PA 3RIFF 5E6IA 1EEZA 3O4OB 4NO0D 3AY4C 3HAEB 5JW4N 2R69L 1IAIM 3L7EA 4LBEA 1S8DB 5I30H 4LHQB 1IAMA 1Q8MA 2CRZA 4XPBL 2VABA 2ERJB 4OLVL 1I8KA 4WWID 3X13A 5DJ0A 2PCPA 5EIVA 4OKVA 2AK1L 4JJHA 4X4MA 2Y5EA 1YEEH 3ARDA 3V4PL 4J12A 4NNYB 3MRBA 2HTKC 5ADPH 4L29A 2EDTA 3CDYA 3GMNB 1IQWL 4NJAH 4YHNA 2ICWB 3MRNA 4MXQD 3BGMB 4JPWH 1T7XA 3BPCB 4CRPA 5FV2A 4XP5L 2NXYD 1CDGA 1R5IB 1F4YH 4XNUH 3BISA 3UEZA 4JQVA 4UT9H 4QHNA 4DJMA 5EU4A 5EC2B 3VDCA 3RI5F 1U6AH 1MUJA 4OCRH 4NWUL 1FVCA 4PTUA 1ZMYA 1J7VR 1MI5D 1YPZF 4XC3L 3ZYOA 4DTGL 5KSBB 1T03H 4O2EA 2IPKA 4OF0A 1JGUH 1JPSL 1T6VN 3ARED 5I1IH 4EZMA 4P5TA 3BDYL 1QFWL 1RMFH 1G1YA 4U49A 3WFZA 5GRJL 3DUSA 3NBNA 2OR8A 4JM2A 1Q9OB 3ALXA 3VRJB 1OT1A 4U1SB 2WIMA 2OS7A 4QHMA 3MRRB 4RFEA 4XZUA 2EYTA 4KKBD 1U8IA 2NYYC 3PV6B 2ATPA 3CPLB 2EC9U 4YNYB 1UWGL 3H3PL 1LQSR 5F7NC 2EH8L 4LARL 3BKJH 4KJYA 1WQVT 5TDPB 1FZMB 2EDKA 3NCFB 5E4EB 3TT1H 2CDFA 1B0RB 1GJIA 4RDQG 2EYSB 1YEIH 3ZO0A 2ICCA 1F90H 5JW3L 4FQXD 4GXVH 3W2DH 5ENWA 2XOTA 4GXUM 3N1PC 3V5HA 2FSEA 4WUUD 4JPKL 3EFFB 2RCSL 3SJVA 4RMRA 4KI5F 1G7IB 3GRWA 4U6YB 1RK1B 4LU5L 2EEDA 5DR5L 3FQWB 1KCVH 1ZANL 5IG7B 5ESVB 1RHFA 1BIIA 1TZGH 2VAAA 1FO0L 3NGBB 4XMPH 5K9OA 3F8UB 4X6FA 1WWBX 5CZVH 4PJGE 1S9YA 5GRZA 4O02H 3O2DH 5F93C 1LEGB 1JI1A 4QRUA 1UC6A 5I74C 3MPCA 3O3UN 3TBSA 5H8DA 3UO1H 3I75B 5F9JA 5J1AA 3RVXC 4GRWF 4XVTH 2AJVH 4KGJA 4ZUWB 1KBGH 2Q1EA 4PJIF 4IIQC 5D7IF 4TTDC 1UFUA 4UOW1 1F02I 1G6RL 4YHKH 5I0ZA 4AEIH 4AEHH 3HI6L 1OF2B 1HNGA 1MIEH 1FORL 2EKJA 4P23B 1JNJA 3DIFA 3MBEB 4KV5F 4RFNB 4ELME 2AXFB 3N06B 4XTRD 3FOLB 1I7ZB 1JZ8A 2R0LH 5DQ9B 1Z2KA 2CQVA 4HMDA 3GSNH 4ZD3L 4JDTH 2ZCHL 2XWJA 4U1LA 2PW1A 4FFWD 3STLA 4UQ3B 3H9SB 1QTYT 1HXYA 4BSVB 1JHTA 5FYLL 1IQDA 3RY4A 4U1JA 2Q7NA 4JKWA 4KKLD 5EG6C 5I1HH 3MRLA 2HG5B 2VLKD 5E8EB 4NKMA 1I1FB 4HGKC 4R2GC 1A7NL 4ZXBB 3QNYB 2CLRA 3QPQD 5CKGA 5IV2A 5FM5M 4CJ1A 2W9EL 1ZA6A 4KC3B 3E6FB 2V2WA 3W9DA 3O6MH 2GJZA 4WI4A 1JVKA 2OL3B 4L3EE 5IF0B 4LFHG 3QIUD 4RA0C 4X6CE 5E8DH 4KXZH 4ZFFB 4YBLB 5DGRA 3W0WD 3O45A 1ZT4A 5EC1A 4PJAB 3W39A 2E7LC 2FZ3A 3RWFB 1FLTX 3FQNB 4TNVF 1SBBA 5D7LE 5E5UB 5IFHL 1RQ5A 3ZYIA 2A6JB 1RZJH 1D5MB 4YX2H 1U8QA 3QQ9D 5C0BE 4WW2F 3T2NL 2E7CA 4HUUB 3C9NA 4UIMA 3MV8B 3PNWA 1MCIA 5DFTA 5JOPE 4NM8L 1EZVY 4NSKA 1A7OL 4D3CH 1SYSB 4APQD 2P8MB 3P77B 5I66B 4QHLA 4K23H 3ZSTA 3I02B 2I27N 4ZTOH 2OK0H 2BDNH 1OLZA 2WBJA 3K4ZA 4MNQB 3BRDA 1U3ZA 3VXRB 5F7EL 3PQYA 4CVXB 3ALWA 4KI5D 3MTRA 4L4VB 3JUZA 4LHUA 3LEVH 1AD0B 2DLFL 3U79A 4F15C 3VMOA 4NO0A 3VGBA 1X5GA 2VDLL 4OCMC 1VENA 4S1SL 3UDWC 5I1AA 4F3FA 3MRHB 4XCFH 5GHWL 4OZGE 1XGRA 2IWGA 4G6FB 1QSVA 1GC1L 3KS0H 4HLJA 2VDMH 1RJZB 5DYOB 1NC2B 4Q9QH 5C2UB 4GLRH 3E2HB 1F3DJ 4LAQL 2AEWA 1AHWC 1MCNA 3UZVB 5GRVL 3PF2A 1QYGH 4NT6B 3E3QE 5KSAC 1LE9A 5C0GB 3L9RB 1EO8L 3EYSL 4U1GC 5D70L 3S4SG 3DUUA 3ZT6A 4UNVA 5T1DL 1KC5H 1RZ8A 1T80A 2X4NA 5I8EA 1E6JH 3D0LB 4K7FB 1FL6B 4G42A 2HFGH 1R24B 2YD3A 4MLIA 5HYJD 1CIDA 1MFDH 3CX5J 4WV1A 4K8RD 5J06A 2NCMA 2F5AH 1FG2B 4P4RB 3GKZA 4D94A 1XF2B 4TSAL 1H3PH 5C09B 1NEZB 2BVOB 1E4KC 3LIZH 4P2QD 1PQZA 1U3JA 5F9OH 2XZCL 2YEZB 5GGRB 5FA4A 3R8QA 4HUVB 12E8L 1MRFH 1OTSC 4LEOB 5BV7H 4L1HA 3X3GH 2E7BA 1KTLA 1Z9MA 2GT9B 4GH7B 1OOAA 4U1IA 5CJOL 3RHWF 4JQXA 1S3KH 1KJMA 3ZYJA 7FABH 2FHCA 1CD1A 1OAYL 4FQXA 1IAIH 1Q1JH 1DQQA 2V9RA 4JY6A 3AB0B 4D8PA 4WUUA 3ECBB 4JQVC 3KPRE 5BJTB 4PUBH 2F74B 3BP7B 4KU1A 5FYJH 2FH6A 4BKLA 3OZ9L 4U1HA 2YKLL 2I9LB 4HIEA 5MP6L 3MROB 4D9LL 3NIDE 1H15B 3HAEH 5EBLB 2VWEE 3QXDA 1QFUH 1NGZB 1T1XB 4YJZL 3C09B 3MOAH 1A02N 1NBYA 2B1AH 4M3KB 3KAAA 3P2TA 2ZSVA 2DM7A 3WLWC 2OP4L 3GMPB 2X9WA 5KVEH 2HTLD 3QH3B 2E9WA 3EKCA 4IHOB 4MD0B 1YMMD 4OI9A 3TPKA 1SY6A 1HSBA 4FNLL 2DQIH 2ITCB 2HH0L 3U30C 4OIBA 3QFJE 1QO3A 4WO4D 4X7EC 4F7TB 3M17B 5H37H 3OR7A 4BFIB 3SDXE 2XA3A 1U8MA 2AEQL 2XNAB 3BKYL 2A2QT 3LDBB 1D5ZB 1MCHA 2ED9A 5EA0H 4JREC 3RAJL 2WLZA 4G9FE 3NIGF 3DVGB 1A7BA 4PB9L 3GI9H 2I07B 2H2PD 2G60L 1E4XH 4LGRB 1G1CA 2NY6D 3DXAD 3UP1A 5D2LE 5LGKA 3KXFD 4R4ND 3LHPL 3GSWA 3PE9A 1DLHB 5IFJA 1IL1B 4LLVA 3UTTB 5CCKH 5KW9L 3LH2H 1LP9E 3EJZC 5LJYH 5GGQL 2Y36H 1P9MA 4KMLB 4MA8L 1YECH 1EERB 3I3DA 1D9KD 3R1GL 4ZS7H 4PJDB 2VLJE 3S5LB 5GGTA 1GZQA 3T09A 2D7MA 5I2IA 4ODUB 5JR1H 3HUJE 1F11B 2NY1B 5ISZB 2MSPA 3W0WA 4NZUL 3T4YB 5A40E 1A6PA 1E4WH 1IZKA 4QHUA 3D9AL 1JP5A 5ICXA 4U0RC 2DLIA 1YMHA 4OB5H 4RNRA 2CLZA 1N3NB 2X1QA 3RVWC 1EFXB 5GIRB 4C4KT 3C6SB 4TUKH 4B53A 4P2OB 4UTBH 1JGLL 1YUHB 3VXQB 4ZYKA 4M5YL 4XXDA 4M6AA 3GMOB 4TPRL 2RAMA 4LKXA 2D03L 4EI5D 1T7WA 2NY3B 3H9HB 4KUZH 5EBMB 4M5ZH 4TQEH 4APQA 2H1PH 1UZ6E 2BSRB 4JHAH 3RZCC 2WBKA 2YD7A 1A6UL 1K4CB 1QBMH 3LS5H 3RWHA 4OD3H 5I75C 3C5SB 5FUCC 1UH2A 5JO5A 4KJPC 4O00A 3TNMB 3WFDL 2XZZA 1C5DB 2YWYA 3NFSH 4NC0B 4R96B 4MQXC 4ZDHA 3L3HA 1HZHL 1MRDL 1Q9LB 5A2IH 4H20H 5EN2A 2GJJA 4OZHF 3MLYH 1H3TA 3EOBA 5CBEB 1GVIA 4OIIL 4KROB 2DMBA 1P2CB 1EMTL 1O7SA 2WM0A 4JFEB 5CUSL 3QCTH 4OD1H 1G6VK 2DM4A 3OAYH 2ZUTA 1KXTB 1X4XA 3GSOB 1U3YA 1KENH 3VMNA 1GL4B 1XCQA 2DOCA 3QDMA 3MRCA 4MJ2A 4YDVB 5E2UL 5D7IA 2QR0A 3STZA 4JCMA 3VI3F 1ED3A 5HSFA 3LRHA 3G5VB 4QRPD 3WIHA 4BSWB 3MRPB 3C6LD 3TO4B 4KZDH 5DZOA 1BMGA 5I1DA 5KVMC 4MZ3A 4DUWA 3DGGB 2IGFL 4HS3B 4N9OB 4OAWA 5F72S 1U8JA 5D1QB 2R23A 1NDGB 3WNKA 3BH8B 5E8NB 4WWKD 2E6QA 1CICC 5FO9A 1X5LA 4MAYB 2WBJC 3BZEA 2IQAA 4QGYA 4HKZB 2A77H 1EAPA 5HYJA 1QOKA 3GIVA 4NOBA 1MVUB 1PKQA 1AGFA 1CGTA 1YNTB 5KJRH 5LAXA 2Y23A 3QI9D 1QACA 3SE4C 3H9YA 4HPOH 4M48H 4P2QA 2GW5A 1NAKH 2DWDB 3F7PC 3IJSA 3WFBL 3X3FL 4W6YB 4PGDB 3RVVD 3RWJB 5HVGB 2WZPD 5EORH 1TQBC 1YQVH 3FB8B 5EBWA 1XH3B 4YHML 1MREL 1AE6H 4NN5C 1Q72H 1PFCA 1UADC 5DT1L 5EPMB 5I76A 4A2LA 3HNVL 4NC1C 1ZTXL 3HMWH 2X1XR 1JPFA 4X4XA 4D9QD 4GAFB 3QDJB 4HS8L 4NRYA 3OXSB 2YXMA 1LEIB 2YUVA 2AJSL 4MXQC 3AC0A 3Q6GL 5BZDB 3TM6A 3BKMH 1BZ7A 4HIHA 1G7HA 2XWBA 3DVFA 4X7SH 3LSOB 3RL2B 4V1DB 3M8OH 1WCBB 4W68A 4JFYB 4MSWA 3V4UH 1HHIA 1P1ZA 5T5NF 1OL0A 3O4LE 1I3RA 4LVNC 1YYLH 1CS6A 3JV6B 1WBYA 5DS8B 1HOCB 1GC1C 4M6NL 4DEPB 4B50A 1RK0A 3AREC 3EYFB 3IFOA 1BD2E 3GMQB 2QQLH 4N9GA 4WV1C 2K3TA 2C4FT 5JORA 1DQJA 4HWEH 1OAXL 1MWAA 4GKZB 2DKMA 3QUKB 3FT4A 2OR9L 4BZ2L 1XFPA 1S7VA 4PJ5E 5LBSL 2X10A 3ULUH 1G7PB 1YMMA 3L5IA 3GSVA 3PGCA 1G9NL 4XGZA 2IEPA 4KKBC 4UIKH 1UYWH 2VL4A 2D0HA 4LHUG 4ZTPL 4AT6B 3VFTB 5JNYB 4YHYC 3MMEB 4KQ3H 4OCLC 4HKJA 2CDGA 1W0YT 1TDQA 2WK2A 3CDGB 4JQXC 3MRKB 5C7XL 5A16A 4DGVH 4FQXC 2A6KB 4PRHD 1URLA 3DO7A 5GSVA 1ORQA 2R56H 3GHBH 5TGBA 1V05A 2X9XA 4PJGF 3CSYB 1CZ8H 1HKLH 3PDOA 3C8DA 3BZDA 3ILPB 1QNZL 3U83A 1NGXB 3DXAA 1FGVH 3KXFA 5J6HA 2IAMB 4KKCD 3OXRA 4Q6IC 1CDUA 3I50L 4XP1H 3OWEA 5AEAA 5KZCD 4JPVL 4WNQA 2F58H 2VC2H 2NMSA 2VLRB 2VZVA 4Y5YB 1NCNA 5CSZB 1HQ4A 2FDBP 4PLKD 2R0ZL 1KXQE 1WFOA 1EH9A 4LF3B 3NCYS 1D9KA 1XGTB 4JFPB 3KPNB 1J5OL 1KJ2A 4XBPA 3PHQA 2DQHL 3BPOC 3VW3L 5DJ8A 4ZO8A 2VQ1B 5JXED 3LKOA 5HVWA 3PWNB 3SGKA 3DSFH 1RZIA 3MLXH 1LNUB 4Y0GA 1PG7L 4H0IA 4O5LL 4UTAL 1NCBH 2WUBL 2EO1A 1A6ZB 3UBXB 5E2TH 4WGWB 5ILTH 2APFA 4EDWH 2N4IA 3FOMB 1A9EA 4FFWC 5HDLA 4PJ9D 1CYGA 2X4SB 3JV4B 4ZSOB 3QHFH 3CH1A 2A9NH 3LRGA 1F6LL 4NNXB 4U6XA 5CEXA 4KKLC 4HXBH 2NNAB 3PJSA 4HK3J 1MLCA 5DQJB 3QPXL 1OAKL 3FQUA 4YHIA 1WTLA 4ONHB 1IFHL 4XH2A 3QPQC 4HT1L 1CFSB 4YBQD 3T4AA 3MRFB 3V0WL 1FNAA 5FV1L 2B1HH 2VERN 1L7TL 3MOQA 5HDQH 3GSRA 4ZG1A 3JZ7A 4LCWA 1RIVH 1V7NH 1TZHA 1NANI 1QR4A 1MCWM 4X6DB 1L9NA 3IFNL 3K4DA 2MKWA 4IRJB 1BVLA 3QIUC 4DZBB 2FGWL 2GK0B 5C8JB 3QXAB 2DQFA 5IP4A 2R1WB 3SDAD 2DKSA 2CJUH 4OSUH 2IPTH 3ARGB 5L88H 2D0FA 5DGQA 4KRMB 4EI6A 3FMGL 4NZTL 4QRPA 2N56A 3WS6A 4FG6D 1T21A 2P5EA 3C6LA 3QQ9C 5T5FL 3V7MA 5DLML 4DVBB 5K59E 4GW1A 5ALBH 4X5XA 2J8UE 5IMKA 3D39E 1F58H 2OTUA 3DRTB 3C2AL 5TQ0H 2BHZA 3IS1X 3ROOA 5JQ6H 4LIQL 4N8CL 1YEJL 4APQC 1G7MB 2R2BB 2ESVB 1MHPL 1ZVHA 1A4KA 3X12B 3L5JA 5DK0B 3ET9F 3GI8L 3TZVA 4JO4H 2R29H 2W60B 3VXNB 1GGTA 2QBWA 5DI8B 5HDBE 2H41A 4GRMA 5F6IB 3LZFL 2DBLH 2P44B 5I1EL 3DYMA 3HE7A 3QI9A 5J8OA 1RUPL 1BF8A 5EU5B 3T77A 4XC1H 2HRPH 3DURA 4FQ1H 3B9KB 3AM8C 4PTTB 3HC0B 3B6SB 3HFMH 5DHVH 1J12A 3W5NA 3LAFA 3RA7L 3FTGB 2Q76B 5FYKL 3QIBA 1DDHA 2FX7L 2VDQL 1VGEL 4K71C 4ZFZA 3LRSA 3BIKB 4GUPA 2P8LA 2PYFB 4QTHA 4WVRA 2ZJSH 2ZSWA 3IDNA 3VGHA 3WSQL 4LLDA 2O61A 3CUPB 4Y16A 4ISVB 4YGVB 4YEEA 4QXGL 4S1RH 1AP2A 1NGPL 5EU3A 2OQJA 3SO5A 5H94A 4HIJB 3U0WH 4GKNB 1PD6A 3PWPB 5DD1L 4OGAD 2ZKHH 3LCYA 5T3ZE 5E99H 3P0YH 1CG9A 3ILQD 3PHOA 4GW5B 43CAB 1DR9A 5BO1H 3CZJA 5CHNB 4K8RC 4EUPB 1QSEB 1UZ8A 2UWEF 2YUWA 2ZCKL 3D85D 4FQ2H 1D5XA 5DEFA 1JNNH 4JDVA 3VXTA 2FB4H 4LASH 2VMFA 4C56E 3QG6A 2HJFB 2R2EB 5IR1A 2OTWB 3G6JE 4WFGE 1U2CA 1OGAB 4WHTA 5ICZB 1NDMA 4UINL 1JF1A 4ODSL 5DQDL 1AI1L 5CP3A 4L3ED 4FA8A 4WEUD 1I75A 1XGUA 4LPVA 4XVJL 1JWMB 3MLRL 4ZFOL 3KYKH 3AU1B 4PV8A 4D0CB 4OJFL 3MRJA 5FK9A 3P73A 3LS4L 4OZHA 3OKMB 4PV9B 3BHBB 3T3PE 4OV5A 4JM4H 4JANA 5D7LD 3CK0H 2JB6A 3CVHA 1VGKA 4PRHA 2UZIH 1YEKL 1JNLH 1GGCL 3UYPA 4ONFH 3BQUD 1KEGH 4DGYH 4OLUL 5C0BD 5CD5D 4QRSA 2GTWB 2HJKB 1MJ8L 1DUYA 1Z0NA 5JOPD 1ES0A 4JHWH 4ODTH 1U8LA 4MVBD 4FZEL 1JFQH 15C8L 3MNZA 1F4WL 1HEZA 3QWOB 1UWEH 2BNUB 3U0PA 1QRNE 1ZHBB 4LLAA 1M7DA 2CPCA 2P7TB 4DWHA 1HI6B 2Z9TA 2X70B 4DFHA 5I8CA 1ZEAL 3FKUS 5JW5A 2XXCB 4MJ5A 2D7PA 1UG9A 4O2FB 4X0KB 1VADA 5LXGL 5GSRA 5INDB 4WJ5A 5IB4B 5HHOB 4QXWA 4FQLL 3BRGC 4JLRB 3EFDL 4S1QH 3MGTA 3B3IA 5JXEA 5IW1A 5ID1A 5DEGA 4XNXH 1BX2A 3VGEA 3SDXF 5TQ2H 3UPRB 4E41A 1NGQL 4QOKB 4O2CA 1ZVYA 2VXVL 2C3GA 3RNQA 5J1TC 4NKOB 1FV1A 4WO4C 2X4OB 4YHPB 1SJXA 3HKFA 4BQ8A 5MEOA 4X6EA 2NX5E 3TWCL 4CDGC 1SEBB 5LVEA 1A14L 4HC1L 4P3DB 5JMOC 3QRFM 1JIBA 4KZEH 4PJ9A 4GKSB 3R8BB 2Y7QA 3KWWB 4U7KA 4UB0L 1LP9F 2H2PC 4W81A 5SX4I 5E8OA 4XWGL 3O3AB 3RVTD 4R4NC 4EQ3A 4JRXE 3VD3A 1SYVA 4MXWH 5T3XH 4U33A 3IDYB 4PJCE 2I5YH 3EYOB 2C7UB 1RFDL 5CSBA 1YEFL 2PXYA 4L5FH 1T5WA 4YXHL 4WU5B 1LHZA 3NCEB 5C3TA 2BVQA 3TESA 1R5WB 2YA1A 1WCQA 1D9KC 3P30H 2I9TB 2X4UA 1ZT7A 4LSPH 4MD4B 1N4XH 3PWLA 4G6JH 5KSBF 2VLMD 4HS6A 5F9DC 1U95A 3WEXA 1BQLH 3WLBA 1D5IH 3JWDH 2GSIB 1I9EA 4WW1B 1MCOH 5JQHC 4M93C 3O41A 4D0BA 3TIDA 5DD5H 1OLLA 1F4AA 5KOVC 4GLRI 4Z7UB 3ZLQC 4MCZA 3REWB 1ZS8A 2DQDL 4EI5C 4Q6YA 2XZQH 4NJ9L 1MFCL 5T3XE 3KPRD 3P0VH 1QR1A 4X8XA 1NBZA 1VFAB 4GAYB 3VFOA 2H6PB 2GITA 3C5ZD 2ZPKL 5HI4D 4MDIA 1ZSDA 2CRYA 3HNTH 2A0LC 1N5YH 4PJGA 4JO1H 4K3EL 4Q0XH 4MA3B 5DRXB 3HMXL 3P4LA 4HHAB 3O3DA 4PD4J 3VG9B 1IGJA 3D2UD 1CXKA 3HZVA 4KY1L 4Y1AB 2CMRH 1T2QH 5FO8B 2JB5L 3S8WA 4PGBA 3REVA 3QO1B 3EO1B 1M4KA 5FYKU 3HC3L 3U9UB 1HK6A 2R4RL 3SKOA 5DJAA 4G7YH 1CL7H 1S9XB 3QEQE 3WDJA 2VE6A 4UAOB 4BH8B 2OM5A 2WAHA 3MFFA 4Z8FH 2CGRH 1A3QA 2GCYB 1BQSA 5CIPB 4G8GE 2NLJB 1MCPL 4XBEH 2P42B 4LPYA 3QFJD 1CXIA 5GGUA 2SEBA 2DWEA 4J4PD 4IJ3C 5CBAA 3TIEB 1JK8B 4RX4A 2VL5B 1ZA3B 4B0MM 4DUXA 3RPKA 5IMMB 3GSQA 4KMTH 4TVPE 4L9DA 4WWKC 5IVXB 4G9FD 1FVEA 3QQNA 4N0YH 1KIRA 4OGYH 1NAMB 3EYQD 4LSTL 3TP4A 2NY0B 3O2DA 4KTEL 1DE4A 2J6EL 3NVQA 3GGWB 4F2MB 5MERB 3T0WA 1R3KB 1E28A 1G84A 5DUML 1X5KA 5J6GB 4IOIA 2Y5TA 1GH7A 4KK8C 1BVKB 4JFFE 3QI9C 5B39A 4RAUA 1FZOA 1VA9A 3IS0X 5FGCB 2QJDA 1ZHKB 4K9EC 4EOWH 2G5RA 2ADIA 4LLQB 3RVVC 3OAUH 2AQ1A 4R26L 4XPTL 4H88L 2VLJD 4RMVA 4L3EA 5E7FA 1S5IH 1IM3B 4QWWD 4X6CA 5KVDH 3M07A 4X83A 3NH7H 4IRSD 4G8FA 1F4XH 3PGDB 3GSNA 2PR4H 4NDMA 1K4DA 2W9LA 1NCTA 5D7LA 3TBTB 5FB8A 4NBYB 1A2YA 5DJCA 5I74B 1OP5K 3BQUA 4A6YB 5C0BA 4WIQA 3FRUB 2MCPL 3VFSA 1CFBA 2DDQH 3VXMA 3AGVA 4JZOB 1OTUD 1V3MA 4HF5H 8FABB 1FGNH 1NL0L 4PJ8C 4PJAF 2DM2A 3RX8A 3AS1A 1FPTH 1UGNA 2LAGB 1ZLVK 4AY0A 2OTPA 2GAZA 2JTDA 4YDKL 4OZFH 1CLOH 1N0XL 3KPSB 1LO3H 1ZK9A 4R0LB 4RAVA 3RGVD 1NFDB 3K3QA 4Q9RL 4LQFL 2OJZL 2JE8A 3DETD 2BY2A 2QADB 3B9AA 1DBKH 4JO3L 3QCVL 2LU3A 1HQRA 5K9JL 4L3CB 1S7SB 3U1SH 1KCUH 1P4BH 4U6HA 2APXA 3BZFB 5HJ3A 1QBLH 1AJ7H 4U1MA 1N26A 1TTUA 2VDPL 2CD0A 3PP3H 1FFPB 4OZGA 1N0LA 5I15L 3U7WH 1UEMA 1U42A 2X40A 5T1KA 4KPHH 2Y07H 3B9VA 3QQ3B 3C5JB 4R2GB 4F9PA 3ORJA 3V8CA 2NTSP 2CLVB 3IU3A 4XP9L 1B0GB 2MCG1 2YS4A 4P2CG 2GUOA 4G5ZL 3QJFB 3SCMA 5HI3D 1RZ7L 3EYVA 4FFYL 1IGFL 1I1AB 4M1CD 1W0WB 3NCCB 5C6WH 4NBZB 4QY8B 1S5HA 4S10A 2ZUUA 4K55A 4OFYD 3WHE0 1HILB 2GY7B 5C0EA 3EZ8A 3FN0L 1SJHA 5GJSH 2DL2A 5KN5B 3ULUF 5EUOE 5GS1C 3MJ9H 3QEGH 3OKDA 5T1LD 4TN9A 2AEPL 3HG1B 3FO9B 2Q3AA 4AENB 3S36X 4J3VA 3VI4E 4K94L 3FQTB 3O9WD 1J05B 4I48A 4X80H 1FBIL 3IETA 3IXTA 1LILA 2APWA 3LN4A 1SEQH 3S4SB 3UTZB 3IJHA 3MYJB 3DI3B 4PGCA 4FMFA 3QISA 1YJDC 4S2SA 4FABL 1MHHA 1MJUH 2BVYA 5ERWA 5JXEC 3PXHA 2UWEA 3H7BB 5EIIA 4PJFB 3CMOH 1FNEB 3VRLF 3VXPB 4YO0A 4UI2A 4NPYA 3AXLB 1ND0B 5D93C 4NQDE 4ODHH 4UT7L 4OCSH 1DANT 3TA3D 1J1XL 1RJYB 1H3XA 1E27B 4YIQB 1D6VH 4WTXA 4PJ9C 4PJHB 2YMXL 1CXFA 3HR5A 3KJ4C 4F15B 2B0SL 4AH2B 2PO6D 3KPRA 3S36L 3VXSB 3IXAA 3MLTB 1BQUA 1AO7B 3GJEB 3DVNA 4LK4A 1MFEL 5FO7B 1KLFA 1IAOB 1MVFA 3HI1B 5I1LB 4U05A 1S7XA 4YBQC 3E6HA 4E5XB 1MPAH 5EZIL 1IEHA 4G8EB 3TNNA 4JE4B 1BD2D 2X4RB 1BLNA 1AHWB 4Y19E 4POZC 1NMCC 1BBJB 4MS8D 5D6CA 1FYTB 3BP5B 5A1AA 5KSAB 5GGVL 2YBRA 4PJ5D 3VFNA 4GRLA 4RGOH 3QUML 5SWZB 1ZWIA 2LV4A 3SDAC 5D1ZC 5CEYA 4JVWA 5EH1A 4ZOEA 4CNIA 1OPGH 5LGHL 3QXUA 4LLWB 1QKZL 1CVSC 4FG6C 5IUSA 1JRHH 3QFJA 2EKSA 1T89A 4Z7QE 3WN5A 2XWTA 2Z8VC 5LCVL 1PSKL 4YHZH 3SDXA 3EDJA 1MCBA 3MRIA 3NCBB 1Z9OA 4JRYA 3VWKD 3ARFD 5E6IB 1EEZB 4G9FA 4HWBH 3RWCA 3L7EB 4LBEB 1NCUA 3RIFK 5F96H 5LQBH 3B5HA 3HAEA 2VABB 1I8KB 4KVNH 4JAMA 2HLAB 1XF4A 5DJ0B 2PCPB 5CZXD 3U7YH 4M6MH 1KNOB 3UAJD 1KT2B 1PW3A 1LP9A 3QUYD 5C07E 3ARDB 3S3PA 4NQCE 4HXAH 3V52L 3MRBB 3MJ8A 4RMUA 4MDJA 4L29B 4YHNB 1JMXA 3MRNB 3ULUD 2ZG1A 1W72B 4ODVH 2VLJA 4QHNB 5EU4B 4MB5A 3DX6A 3LEYH 1VFBA 3GM8A 4NHCL 1MUJB 5BZWB 4IRSA 4R97B 3OAZH 4PTUB 1NGYB 1DVFC 4NUGL 4MAUH 4XBGA 3RI5K 5C0RH 4XMKH 4O2EB 2IPKB 1DQTA 4R3SA 4P5TB 4Z7OF 4H26B 4CGTA 4M3JA 3DUSB 1H3WM 4TULL 1QLEL 4JM2B 4HLZH 4QHMB 3RUGE 4RFEB 5F1IA 1LO2H 1Q9OA 4XZUB 4RQQA 3S35H 2EYTB 1TXKA 2XV6B 4W4OC 1U8IB 3BE1H 3ILQC 4QNPF 2ATPB 1NJ9A 3GMRA 2ZUXA 4I3GA 4O9HH 3L3IA 5D1XC 5M7QA 1TETH 3PV6A 3RGVA 3CPLA 4KJYB 2F5BL 4RFOL 4YNYA 5MENE 4WTZA 4WI3A 4ZPTA 4P5MA 2CDFB 4KVCH 2DQTH 4WHCA 4N1EA 3ZT7A 1FZMA 4JB9H 4OZIE 1GOGA 5ENWB 3QP3A 1ZXQA 5TF1L 1QVOA 4Z7WE 2BP3A 4R7DA 5LKNA 3V5HB 4G7VH 4JREB 2D4DA 4POUB 4JQIH 3SJVB 1DJSA 3BUYB 1MQKL 3NIFE 4OI8A 3L3GA 5J4MA 1BIIB 1IBGL 2VAAB 4NN6C 1FFQA 2DIJA 5E8PA 5K9OB 4X6FB 2BJMH 1JZ5A 1S9YB 5IESH 5GS2D 2J7LA 2LTQB 1V7ML 4R4FL 2J4WH 4QRUB 2FEEL 2QTEA 4NGHL 1F13A 3IGAB 3TBSB 3U46A 5F9JB 2NPLX 5CD5C 1JZ6A 1LEGA 2AJXH 3SE9L 3GKWL 1CE1L 3D39D 4JKMA 4GQ9H 4OFYA 1C8PA 3A6BH 4ZUUB 1N6QL 3FO0L 4BH7A 4MVBC 4N0UE 3U4BH 4NQVA 1OF2A 5FUZH 5A3ID 4I3RL 3LPGA 4FFVD 5HYFA 3KPMA 2CIKA 4LSVL 4QEGA 3O8XD 1HN1A 2P48B 4U1LB 3TBWA 1WZMA 2PW1B 1NSNH 1ZT1A 4Q9BA 3STLB 2VZSA 4YHOH 1CLYL 3BZ4B 4QYOA 4WDIA 1HXYB 1IQDB 3GK8H 3NABL 4U1JB 1FFOA 1RIUL 4ZOBA 4A6YH 3MRLB 1TJGH 2OR7A 5D71L 1BAFH 4NKMB 1FIGH 5ABDE 5GZOD 3TA3A 2V5YA 1YEHL 2Q3ZA 2CO6B 4F9PC 1F2XK 2CLRB 1DBBH 2PETA 4J3OC 1ZA6B 3F7RA 4ZXBA 5IEKA 2V2WB 3F7YB 3W9DB 3PUCA 2Z8WC 2HKHL 2RIKA 3E3QC 3LQAH 1SBSH 1EXUA 4FMKA 4YXLL 1DBMH 4R90L 1KJ3H 3RVTC 3O6LH 4RWYH 4FQQA 3LMJH 3IU4L 5IF0A 2PW2A 3DHJA 1TVBB 2AXHA 3O45B 5AYUL 4F58L 5T3ZD 2FZ3B 4JHZA 3FQXA 3WIHL 5IKCA 4OCYL 3AMKA 2FJHA 4C83A 3QIWD 2D7NA 1BD2A 1NMAH 2V6HA 3VXUE 1F6FB 2VXTH 3RWFA 3FQNA 1F6AA 4TNVK 4DFIA 2A6JA 1JF5A 1MAMH 5TE7H 3D0VA 3TT3L 3C9NB 4UIMB 3UTQA 3PNWB 1AXIB 2E9BA 4C56D 4PJ5A 4NSKB 4HUUA 1FH5L 2VZOA 4WFGD 5INCA 2AGJL 5B8CA 1DQDH 4QHLB 4ZS6C 3L5XL 2A6IA 1SYSA 2WBJB 3P77A 4OLYL 3SDYL 2C4FU 4KRNA 1OCWH 4K94C 4MNQA 1K6QL 3PQYB 2YD8A 4LSUL 4XP6H 1M7IA 5JOFA 4LHUB 1OAUL 3ARFA 2X6MA 4NO0B 4L4VA 3ZHKA 2MPAH 3L1OH 5TE4H 1AD0A 1MOEA 3Q1SH 3C5ZC 2QSTA 5HI4C 5I16A 2XQBL 4F3FB 1X9QA 1TPXC 1U36A 5A2FA 1XGRB 4NN5B 1KCLA 2LE9A 3OX8A 1U8NA