5TQ0H

Crystal structure of amino terminal domains of the nmda receptor subunit glun1 and glun2a in the presence of edta
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
218
structure length
212
Chain Sequence
b'EVKLVESGPELKKPGETVKISCKASGFTFTNYGMNWVKQAPGKGLKWMGWINIYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKNEDTATYFCARGYDYEGYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NMDA glutamate receptor subunit
molecule tags Transport protein
source organism Xenopus laevis
publication title Molecular Basis for Subtype Specificity and High-Affinity Zinc Inhibition in the GluN1-GluN2A NMDA Receptor Amino-Terminal Domain.
pubmed doi rcsb
total genus 36
structure length 212
sequence length 218
ec nomenclature
pdb deposition date 2016-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tq0H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tq0H02
2R1WB 3K74B 4OCSL 4YHZH 4ZUTB 1SJHB 3QZWB 4D9QD 5IT2L 3O2DH 4ZUVB 3C09B 1UM4L 2HAZA 1Q38A 2P8PA 4JKPL 3O3DB 4ZFOL 4P2QD 4MXQD 1AFVL 3TO4B 3CVIL 3LRGA 4W6YB 3C60A 1IM3B 3FOMA 3NH7L 4LU5L 3FQNB 5T1KB 4XVUD 5IB2A 2PCPB 3ARFC 3FTGB 5IVXB 2P47B 1HK6A 1OPGL 4MJ6B 4OLUL 4NNPH 1CS6A 1HEZB 3O6FA 4OGYL 5IMLB 3TO4D 1QPXA 1V3JA 2PYFB 5C2UB 2VLMD 1IQWL 2PF6A 4Y8AA 2C3GA 3QEGL 5EO0B 2BHUA 4NQCD 4H25A 4O02L 1AXIB 5HI3D 4PRIE 1D9KD 4ZDHB 1DUYB 4NQEE 3QISA 4P2RD 2NYYD 2HVKA 5K33A 2EIEA 2QHRH 2WLZA 5IHUL 2GFBA 4P0DA 3MA7B 1G7HB 4LCWE 1X7QB 3V6OE 4MYWB 3S35H 3VWJA 4LSRH 4Y5YB 2J12B 1JVKA 4WFEE 4XCCL 2NLJB 1NLDH 3QUYB 5SWQB 4KUCD 1A14L 3G5VB 4S11A 3DXAD 1CE6A 1WCBA 3FAWA 4KJYA 1S78D 4OB5L 5EN2B 1CDIA 4O5LL 3BJ91 3QSKB 5C0AD 4DKAA 1FCGA 5GSVA 4OBRA 1KB5H 4FHBD 5GJSH 1UA6L 5DJAA 3DO7A 3W0WD 2VDKH 3IXTB 2PETA 1REIA 1SMOA 1TETL 3LD8B 1AO7A 3PWJB 5TDOB 1JZ7A 2VDPH 4RISL 3O11A 1J88A 3FT3B 3IKCB 1WWBX 4CU7A 4ACPA 2VXVH 2XKUA 4HWEH 3NCEB 3WUWG 3B8SA 2NY2B 3VFOA 4GKNA 1G7IB 4G9FB 1I85C 4C4KO 4JO2H 4PB9L 3H9HA 1YEIH 4ZG1A 3ARFD 1A14H 1A6TB 4I0PA 5AZ2H 3WHXB 3B5HA 1F90L 2XI9A 4YBQD 4JRXD 2DIBA 4NRZB 4Z7VA 1K5NA 4OJFL 2JKXA 4OF8A 5HHVH 2EDXA 4NQCB 2FEEL 1MCBA 3ZKXC 5AAMA 3O9WC 4X6CF 3QG7H 1NC4B 2OK0L 3NIGE 1MAKA 3UDWC 2V7NB 3QDJA 4M61B 2UVFA 4HBQA 3VXRA 4MNGE 1XFPA 4Y2DC 1NCNA 1I9JH 4GAFB 5DJZA 1P7QA 1V3KA 2H2SD 5J9PB 3TNNB 4TSBL 3WN5C 4RCAA 1EAPB 4WUUB 1V7ML 3PDOA 5CGTA 5C0GB 4QYOA 4OCRL 1DBBL 2Y06H 1FORL 1ZT1B 3FO2B 2CD0A 4LSTL 4WU5B 2MCPH 2V17L 2XACC 3RWGB 1UJTA 4PLJC 1MHCA 2K1MA 5DVNA 4J1UA 3ZYIA 2P8PB 1BVLB 1FVEA 5AD0A 3VGAB 3SKJL 3LY6A 5F1IB 1XGPB 3SDXB 3MRQA 3WUWA 3HNTH 3OKDA 4ZTPH 2XT1B 4HUMB 5DXWA 2E9IA 3QUMH 4Y5XC 2AEQH 3RTQB 1M6OB 5TE7L 3T0EA 1KPRB 3QFJD 4Y4FD 1U8QB 3TN0C 4QRTA 2GSGB 3GMQB 2CO7B 4HIIA 5KVGL 3KJ4B 3ZDYF 3CDGA 2YBRB 2QADC 2XXMB 4I0PC 5LBSH 5FOBA 5TGBB 4HWZB 1MFAH 4JFFE 1WFUA 4NSKA 2HMID 2FZ3B 4Z7VF 3EKCA 1U3ZA 5IQ9A 4P9HH 4P4KC 2GJJA 4OCXL 5JW4Q 3AXLB 4JM2F 3C60B 5BMFL 1JYVA 4RA3A 4XPHL 3MJ9A 1SY6A 3Q5OA 3U7WL 3D85B 1YMHB 4D0DB 4OCLC 4CJ0A 2X4NA 3OF6A 2LV4A 4WHCA 4KC3B 3QZWG 1FRGL 2ZSVA 3FQWB 1CBVH 1A7RL 4P2RB 3BKYH 5CEZD 4HWZA 4MQXD 4NKDA 1IT9L 2X4NB 5DA4A 5C0RH 3PGCB 3V7MA 2H2SC 1HWGB 4OGAC 3SEPA 5JA9A 3NTCL 3PXHA 2EYTB 5CLTA 3MV9E 1UYWH 3ZL4L 3AGVA 4HK3N 3PWVB 4JY4A 2J8UB 4X4YB 1M4KA 5IG7A 2H1PL 2ICCA 3ALWA 1ZT7B 2NMSA 3FO0L 3AM8A 4O2EB 2BRRH 4Q9CA 4LSQL 3LN5A 1TZGL 5F3BB 3JWDC 4Y89A 4EN3A 4RGMB 4JY5L 2YMXH 4G6AD 1T2QL 1OM3L 3WS3B 2PYEE 2QR0B 1DQQB 4TRPL 5I16A 4PRAA 1IZJA 3SKOB 3OXSB 4MD5A 1YZZA 3VXMD 2XWTB 3LZFL 4UIMA 3V4UH 2X4PA 3IAQA 5IB4B 6FABH 1EVUA 2Y06L 1YEKH 5KSBB 3I02A 1OPGH 3KPQB 1KJ2B 5DTFA 3OAZH 4DOHB 3HG1D 4HFUL 4M8QA 4WCYH 1ZLVK 1KIQB 1GOGA 3TO2A 3IFLL 2DKMA 1CFQB 1NMCC 5K9QI 4MSWA 5F9WB 1T89A 1EHLH 3TGXA 1TZGH 5I1EH 2YUWA 4L8BA 1JHKH 4N0UB 4NRZA 3L95B 4HKXB 1JPGA 4PLKD 1J0ZA 3JUYA 4UOJA 2DS4A 4NRXA 1MI5A 1T89C 5AWNL 5TE7H 2YS4A 2E6PA 1RZKC 2HA1A 4CMHB 2NY6C 4X5XA 4YXKL 3MLUH 3INUL 4H26B 3V4VH 1U0QA 4KVNH 2HFGL 4XB8A 2BMKA 4NN5B 4NQDE 4FP8H 3VMNA 2O61A 4LCUB 5CAYB 3V52L 2DMKA 3A67H 3ARGD 3PV6A 1GC1L 1QRNE 4NT6B 1UWEH 3IF1A 4KV5F 4XGZA 4HWEL 4P2CG 5FO8B 3GK8H 2R1XB 3VW3L 3GI8H 1I9RH 1XEDA 1O0VA 5GRVL 4BQBA 3I3BA 3MRLB 5TQ0L 4KI1A 3IS1X 3IF1B 1CLZL 5IBLC 2PR4H 2WSKA 3NFNA 3KPPA 3B9KD 3U83A 3VXOB 4P23B 4MX7A 1CGYA 3BH9B 1SVZA 3KYKL 1TETH 1KTKE 5L6YH 2FSEA 3UJTH 3P0YL 5GZOC 1BIIA 3BZ4B 3EO0A 4XPGL 3CLEH 1X4ZA 4GW1B 3VA6A 2ZJSH 3LS4H 5LQBL 3NA4A 4ZQKB 5FYLH 2DTSA 2FJHA 4QRRD 4FP8L 4XWGL 5D2NE 5JHDE 2EC9T 1QFWH 2R2HA 5D5ME 4J8RA 5E5MA 1KBGL 5I19H 4MCZA 2G5BB 3T1FB 3LPGA 3MRCB 2Q7YB 2ZSWA 1A64A 4XCYB 1U8HB 4JFPA 3EOBA 1N6QH 1UJ3B 1DEEA 3BUYB 5EZOL 2YPKB 3VCLA 4DTGL 3RAJH 2QEJA 3QEHA 2C3VA 2EZ0C 1CICB 3UBXG 3F7VB 3RVTC 4LRIC 1MAMH 1INQB 2AJUL 3CFIC 3TZVA 1NEUA 4PRIA 3UROR 1M71B 1AXTH 5DJ6A 1L0YA 3Q6GH 3RY6C 5H2BB 3RJDA 2QBWA 4NQVA 4U1MB 2VDRH 4JPKL 3TO2B 2OZ4L 3V4UL 1CU4L 3KAAA 3TFKC 5ISZD 1EH9A 3T0WA 1JNLH 2VLJB 2IANA 2VZVA 4NQDA 4NIKB 4LSTH 3K3QA 3MOAL 3K4DA 1QSFA 3H3BC 5DR5L 1MFDH 4KKBC 5E4IA 3CFKA 5GSRB 4YHOH 2EE3A 4K07A 2ORBH 1EK3A 3DMMB 3TCXA 3OXSA 3BKCH 4MD5B 3JV5A 1JPTH 4BSVB 2GK0A 1MCHA 4RFNB 2P5WB 2ITDA 2BVOB 1J5OL 4XI5C 5C2BL 1YEFH 5DEFA 4CRPA 5KJRH 2XWJA 3NCYS 3TH2T 4HZLA 3MRGA 3FCTA 3SE8H 2XZCH 4J12A 5FKPA 1CXIA 1ZT4B 4Z78A 2O5ZL 3FJTA 5EC1B 2R29L 1TVBA 4TULL 1NL0H 5BS0E 5C0DB 1QFOA 1HOCB 4KY1H 1PG7X 1FGVL 4M6NL 2G2RA 1ODAA 2GQHA 5D9SA 2YPVL 2DWEB 3FFCA 3B2VL 1AD0B 3BESR 1GZQB 4L8SA 1NPUA 1FO0H 3QUXD 4XVTL 1BGXL 4JFZL 3K8MA 5KS9E 3FN0L 3MRJA 3ARBB 4EXPX 2VXSL 2NY0D 1RZ8A 2HH0L 3EZ8A 4FFWD 5HYJB 1J87A 3AFLA 1ITBB 2XA8H 4LSPL 3SY0A 4IM8A 1CTOA 5I17A 5IM7B 4GG6F 1FFPA 4I1NB 1I85A 3V6OA 3RVVD 3RVUD 1AE6L 2ED8A 1NEZB 5I6XB 1XF5B 2VMFA 5KSAD 5DHYA 1TVDA 2IBGA 4FXKB 4H5SA 3DIFA 2XXCB 3JTSB 3WEXB 5L8KB 5I1LA 4CDGC 2ADFH 4P3CL 1I8MB 4NQED 1QLFB 2Y36H 3GKWL 1KPVA 4JKLA 3DOSA 4H1LB 4OUUA 4CU6A 1FAIL 4P57A 5C6TH 5H94B 4R4BA 2PNDA 4LPUA 4J6RH 3T3ME 3HB3D 4LP4A 5DDHB 4Y4KB 4NBZB 1W0YT 3QDJB 4NQEB 2XZAL 3VI3F 4GKZA 1CLYH 1Z0MA 2OZ4H 5GGQH 5FM4A 1N0LA 4OM1H 3KXFD 1U58A 2FWOB 4JPVL 1JI2A 1IEBA 3G6AB 1I8LA 3QEHB 4DW2L 1KN2H 4F15B 3UP1A 2VISA 5TDNB 4KTEH 4RGNE 2XKNB 3MYZA 3VXMA 3P73B 4TTDC 4TSCH 1VESA 2VZOA 4R26H 4ODBD 2ZCHL 3QCVH 1WITA 4XCFL 3O41B 1GL4B 4EBQH 1ONQB 1BF2A 4OFKA 2G5BA 2R56L 1JHTA 3GMRB 5DMIL 5HI3C 1RK0B 4JO1H 3G9VA 4Y4FC 4JZJA 5AYQA 4M61A 3R0MA 3FT2A 1BF8A 3R1GH 3IGAB 3MLZL 1RJCA 4YGVB 1KIPB 2P5WE 1VFMA 1LO2L 3O6FC 1ZHNA 4DVBA 3BIKA 1K9TA 3DMMC 2HT4D 3HE7D 3QNYB 3BAEL 1HQ4A 4ZSOE 1T1WB 3OG6B 5C70A 1NCCL 3LQZA 3LS4L 1FN4B 1NQBA 1QNZH 1S7WA 3V4PL 4PJHA 2L7JA 3F7RA 4PFEA 2X1PA 5C07D 4KMTL 3ES6A 2ADGA 5MEPB 3QDJE 4KKCD 1MY5A 2A9ML 1JYNA 1NGZB 3IKCA 5DYOB 3OGCB 4NO2B 1NCBL 5SWZA 4X6CA 5MI0C 1EEQA 2XKNA 2Z91B 3HZKA 3FQUA 1INDH 2EEAA 4OFPA 2Q6WA 4OLZL 3PP4H 3H9SA 3GBML 5DK0B 1YEEH 1NLBH 4YX2L 4MQXC 5K9QG 3S5LB 2ADIA 4P2YA 4QF1A 3HE6B 2GK2A 3KPMA 4OZGF 1FIGL 3ZE1F 5JMRA 4GG8B 1U2HA 1W0WB 5DJDA 4QRUB 1A7PH 3HI6L 3FB6B 4KH2A 5CP7B 2YEZA 4YHKL 3GSVA 3IDMA 3LIZH 2R2EB 2AGJH 1ES0A 5TDNA 4YBQC 5D7JB 3VMOA 1HSBB 4LKXA 5GS0H 1EEYB 1N6QL 3HC0B 1CFTA 1QFHA 4FRWA 3AY4A 3JV4A 3LN4B 5C9KA 4X0KB 4OD2A 1WGOA 3OB0H 5KSVA 3SDCA 1JNHB 4OLZH 2HJLB 1UB6B 4PGBB 3BPCB 3D3VA 3MLRH 3LV3B 3SGKA 4N9OB 4AEIH 5JXEC 5C0EB 5EOCL 2V5RA 1N4XH 4PJBA 5AYUL 1F4WL 4PGCB 3TVMA 3GSRB 3MGTA 1QZ1A 2XY2A 4WW1B 4OD3H 3LH2H 3O6FD 5C6TL 5IB1A 4HW6A 2JJSA 5E8PB 1BD2E 1CCZA 4J6RL 4NUGL 2R2BA 3FAXA 1G84A 4KI5E 3RNKB 2AK4B 4Y7MA 4X5LA 4LCCA 2PW2A 5F89A 1ZTXH 2F58H 3QFDB 4F7TA 2W1NA 1JCKA 1Q0YH 4AIZA 2EH8L 4M5ZH 1BZ7A 3DX9B 5BJTB 3W9EA 2YC1B 3E6HB 3VWKC 4BSJA 1GGTA 5E00B 5I18H 1JPSH 1YMHA 2CO6B 4TNWK 3MNWB 3BE1H 4Y16C 4D0CA 1OQXA 4Q9QL 1AR2A 5E7FA 4ODSH 4Y16A 1JRHI 3ESVF 2C3XA 5I30L 1QBAA 1T3FB 5BVPL 2D0GA 1WFOA 4PJDB 3HC3L 1WBZB 3VXQA 2Q86A 5F9OL 3L3HB 5E56A 4ODTL 1N26A 1R5VA 3C6SB 2YXMA 4KK8D 5DC0A 3CMOH 3I75A 5IB5B 1S7RA 1M6OA 1NGPL 3T0EB 4PJHF 1UH3A 1SYSA 4WFGE 2DBLL 2D0HA 1FGNH 2NY7L 2ZCLL 2QLVB 3SDXE 2IH1A 4Z7UB 4QXTA 2HRPH 1HHHA 3IDGA 1A8JH 2AKRB 1JNNL 1OAQL 5IBLD 4NZRL 3X3FL 4P3CH 5KSAB 4D9QE 4NGHL 3GZKA 4OAWA 4DGVL 3FFDA 2I9TA 1GZPB 1B6UA 2Q76B 4I18C 3EYUH 1EO7A 4Y5VB 2OJZL 3ULVL 1LE5A 4YHMH 4K9EL 3CFEB 4A2LA 1MFCL 3WMSA 1S9WB 5E8EB 4LOUD 1T03H 4LLMA 5KANG 3OB8A 4GOSA 1OGAE 2AJYL 3GHEL 3HG1B 4JM4L 5B39G 2J2ZA 2WBWB 4ZO7A 1BVLA 4TUOA 2F53A 5T1LA 4PRDA 3LKNB 3STLA 1GJIA 4Z77B 1RZJL 5EU3A 3RWDA 1IAIM 4YHYC 4HMCA 3RRQA 3EYVA 4PBVC 3PNWB 4M48L 1A47A 2IH3B 3G04A 1IC5H 3KYMB 4GMSH 3W2DH 3I50L 3HHRB 3CSGA 1I7TA 3NZHL 4XMKH 3MMEB 1I3GL 3TC9A 4JFDB 4TSBH 1JHLH 4G6MH 4OCRH 4MA1B 2AJXL 2IG2L 1WTGT 4S2SB 1JWSB 4LCIL 1TPXB 3MREA 5JHDD 3ZDXF 1UXWA 4WRLA 3L3IB 4F7CB 1H3UA 1XF2B 1A4KA 1BECA 2R0ZH 3I2CL 3LN9A 4KKBD 1JWUA 4K94H 5TPWL 3GSNB 1KEGL 4GXUN 4GO6B 1LEGA 5GXBB 3DX6A 1FFOA 3QUMA 5IV2A 5FV1L 2IC2A 4YDIL 5IVNA 1CZ8L 5HGBB 5HYSA 5C09A 1V7NL 2IBZX 2ZCKL 4WWID 5HDLA 2ATKA 3MGOA 4RQQA 4GKSB 2BXYA 4XAWH 4HUKB 4EDXA 2X7LA 5J11C 4QWWC 3VGHA 1HDMA 4DZ8B 2L4OA 3BRFA 5ESVA 1MH5A 1BZ9A 1TJGL 3EOTL 1WBXA 5CJXC 3WKML 2DYPA 1AO7B 4JVPA 3ULUC 1UQSA 2ZUWA 3AMLA 3QJHB 4M7ZB 4UT7L 3WLWD 3V6FA 3GIZH 4LCIH 4POZC 3LKQB 4TVSa 4Y4FB 1ZVSB 4I2XB 3BD5A 1XCTB 1ND0B 5EUKB 1A1OA 3SDAD 4C56B 3ZHDA 1PZ5B 1NGWB 2CKBL 4X83A 1FYTA 3O2WL 3SE9L 3WE6B 4IDJL 5JHDA 4KZEH 5HHMB 1FZOB 5D1ZA 4H25B 1D9KA 1QSED 3F7YB 4UINH 4PJ5A 3TBSA 5D2LF 1B0WA 4YAQA 3IU3A 4XBEL 4R8WL 3GBMH 3AAZA 3P9LA 4OZFA 5E8OB 2P24A 2DLFL 5GZOD 5F9WC 4MJ6A 5I76B 1UH2A 5D7JD 4EQ2A 1YNKH 2VR9A 3FFCE 2AJVH 4MNQD 5E4EC 3I6LE 1QSEA 1KG0B 3VXTB 1S5HA 3UTSD 1IZKA 5GGRA 3KYAA 4OQTA 3QFJE 4HUUB 4D94A 1SVCP 3RVUC 2KUTA 1AGDB 1WZLA 4WI3A 3MCLH 2A6DB 1T03L 3V6OC 3ULVC 2DJUA 3WNNA 5F7HA 2QL1A 3WS6A 4X4XA 4RWHA 3QXAA 3ARZA 3BPLC 2GJ6B 1C5BL 4QCIB 3CDCA 4GW4B 4XXDA 5JR1H 3A6CL 1KFAH 4LRIA 1RU9H 3OAYK 3KYNA 1YC8A 5FKAB 4Y5VA 1MCOL 1EV2E 1T0PB 4KJPD 4R8WH 5I16B 3PGDB 1T04A 4PS4L 1F00I 4JFED 2XTJD 3H9SE 4LARH 1BFVL 5JORB 2BK8A 3MRDA 2E7HA 5IM7A 1R5IB 3O8XA 5C9JB 1CICD 2XNAA 4LVHB 4P4RB 3EDDA 3IFOB 2MPAH 4PTTA 1GIGH 3GGWB 1X6LA 1MFNA 1DVFB 4Y19E 4HG4K 4XCEA 4JM2C 3CAFA 4QXWA 3HNVL 4F9LA 1J8HE 4P49A 4TNVK 4LDEB 5F9OH 2Y9RT 2NXZC 2M2DA 1RZ7L 1C5DB 2HTLD 1GGBL 3D39E 3QO1A 2K9UA 5SWSA 3C6SA 4LBEB 4QRRB 4JO3H 1BIHA 5DMGD 5FM8A 2EDHA 2NW3B 3SGEI 2B39A 2EDJA 2VLKD 3ARXA 5E03A 3K80A 3SE4A 1ZE3C 2EYSA 4P2QA 5GRJL 3C2AH 3HRZA 2ORBL 1AI1L 1FDLL 4GBXA 1YPZF 1CLOH 4D0DA 1Q9OA 4UILL 3DURB 1H5BA 1OTSC 1XIWA 3ZMRA 3UTQA 2PYED 4K2UL 5DMKB 1IGCL 1BJ1J 4V1DA 1AR1D 4QNPE 3QHZL 5FV2A 3EO9L 4U1IA 6CGTA 2OYPA 2X05A 4M7LT 2IEPA 4P2OD 5JORA 5CD3B 5FAAA 2OI9C 2HT4C 3GRWL 3OJDB 4Q97A 3U9UB 5KSBF 2JTDA 1BD2D 5LGHL 5FUCE 1RUPH 3VH8A 4UOW0 2EYRA 2RIKA 1UKTA 3OSKA 3QEGH 4U3CA 4ZS7L 5F1IA 4ETYA 2C1OA 4ZFGH 4MXVE 5C0BA 4EEEA 5CINL 4GW4A 2ZUQB 3DX7B 1CGSL 3BKJH 3C9NA 1DLFL 4U1JA 2NR6D 4YDVB 3MCG1 5D8JL 5B8CB 2BOCB 4KK9D 2EDRA 4BKLA 1E6JL 4WEUD 2W9LA 3FOLA 3IDIA 4HWNA 4FQJH 2OL3B 4F7EA 5IK3B 1UB6A 1XGYH 4PGBA 2QV2A 5IKCA 4LIQL 4A6YA 3BP6A 3QEQD 3FB8A 4WGWB 3S5LA 4LL9A 4HPYL 4N8VA 5F72S 4ETQA 4A6YL 1IGYB 4KFZC 5IMOB 2QKIA 3QQ9D 4FFVC 4JREB 4ZS7H 3BUYA 4AQOA 3STBA 4JQXA 1F90H 4NO2A 5J13B 4L4JA 1F97A 4XC3L 5IESH 5J9PA 1UM5H 3B9KC 4AL8L 1YYML 3VFGL 3AM8C 2ADFL 1M05B 3UTTE 2CDGA 1AGEA 3GI9L 5GHWH 3P0VL 4JQXC 1X5FA 4JO4L 1YEJL 3GHBL 4NZTL 5IQ7L 1A4KB 4UZGA 5DEGB 4E41D 4YEFA 3EOTH 1J0IA 1KJMA 1OGAA 1WIPA 5DLMH 1YJDH 3RWCA 4FQXA 4FQ2H 3I6GA 1G6RH 2Y4SA 4MD4B 3QIBC 1W2KT 4N0UA 4XGZB 1DN0B 2ZCKH 2NY5H 1DQJB 4YUEH 1MFBH 1A7NH 3GMNB 1A2YB 1D5MA 4AENA 4XP4L 1CFSA 1D6VH 4QHLA 2DM2A 1OTTD 5B38G 5ETUA 1OVZA 4RFEB 5EIQA 5HYIA 2CDGB 1A6VH 5JIHA 4X8JB 3U30C 4DEPB 3MYJA 1BM3H 1K3IA 3MRNB 3DVGB 5DJAB 3DO7B 2PO6A 12E8L 1F8TH 4IRZH 3WFHB 3O45B 1F4AA 1L7IL 4O2CA 4JPIA 2R4SL 4LLVA 3L3OA 1SBSL 2BVUA 3SCMA 1HZHH 4HS8L 3RVWD 1RPQA 3PE9A 4NC2B 4ZUWA 5GGUB 2E9JA 2WWMD 3R8QA 4PJGE 3GBNL 4ZO6A 4XAKE 2I60L 2DQIL 5FK9B 2C3WA 4ZPTA 1FVCA 3RGVC 4E0RA 4UT6L 5DFTA 1N5AA 1WC7A 4G9FE 3CDFA 2H6PB 5FFLA 4L4VA 4PTUB 2JIXB 3PWPA 1K4DA 2GKIA 1S5IH 4WUUE 3HC4H 3MRRB 2OP4L 5LGKA 4YHPA 3Q2CA 1MCWW 3L5HA 5T1DL 2FB4H 3OJDA 3JV0A 3VGBA 2I27N 2J8UA 1BFOA 4DUVA 1ACZA 1UM4H 1BQHG 3TBWB 3VH8G 3AB0B 5GS0C 3SKOA 12E8H 1A9BA 3V6BR 1S7XB 5F1SA 3UZQA 4WU7B 2RAMA 1U8KA 1BVKB 4ONGL 3CSBA 1HEZA 3O6FB 4PB0H 3V0AC 4YO0A 43CAB 4P4KB 5BS0D 1FL5A 3ZHKA 4W6WB 5JO5A 2YA2A 3EDKA 5B21A 3WFDL 3E8UL 4M02A 4NQXA 3D3VE 5CCKL 1JZ5A 4IMKA 1P4IH 2A6JA 3L3DA 3SQBA 1N0XL 1WBYA 2HFFB 3DBXA 4OGZA 1MQ8A 2V5TA 5FF6A 4F33B 4K8RL 1NAKH 7CGTA 4Y4KD 1RUKL 3LQAC 3FKUS 4TVPD 1P2CB 4HHAB 4NP4H 3WKNA 3D25B 1BWMA 2A9NH 3U1SH 2XG4A 1HYSC 2E27L 3TA3B 4HC1L 4LVNB 2QHLA 1BX2A 2CLVA 1NBYA 2OTUA 3C2AL 3FFCD 5EOCH 5CGMA 5AG9A 2ATPA 2BFVL 4HHAA 5ACZA 2A38A 3VFVB 5D71H 4Y16B 1MVUB 3ARDB 4PJIF 3WHE1 3RIAF 4P5TA 4MCYA 5A2KH 3TNMA 1QKZL 3RBSA 1WAAE 2P45B 4D9RD 3O4OC 3DMMA 5FECA 3BI9X 1E28B 4N0RA 1C5CH 4QT5A 2DQTL 3PUCA 3X11B 5C0IB 4GRWH 4JO3L 4F3FB 2YWYA 1A6AA 1VERA 4UTAH 2YN3A 4RMWA 2X4TB 5EBLA 2A6IA 4JM2B 1HINH 2EH8H 4M5ZL 2XFXA 1K85A 4JB9L 1I3RB 3RNKA 2DKUA 2V9TA 3QUML 2HWZL 4UUJB 1B0GB 4CNIB 4HFWB 5MP6L 2A9NL 4L8DB 3U1SL 1SYVA 4X4ZA 4YFEA 2XWBB 3WFEH 5ABDE 3TT3H 2ZNXA 5GGTA 1CR9L 1HHIB 4BFIA 1ZLWH 4BA8A 3S37L 4Z7VE 3BDBA 4ELKB 1Y6KR 4U1HA 1QSEB 4DKEL 4UV4H 2EIDA 3HMWL 2JIXA 2DI8A 5BXFB 1S9YB 2GTZA 5DS8A 1VADA 5FYKU 1X5XA 4HXBL 5FHBL 5C0CA 3PHSA 3PF2A 5L0QB 1EPFA 4MHHI 9CGTA 2IAMD 3SKNA 1J0YA 2BHZA 5C08A 4D0BA 1IL1B 1B0RB 2B4CC 1MY7A 1A02N 1PEZA 4ZOEA 5BV7B 4NBYB 5IROA 1CFVH 3RIAK 1FRGH 4PRID 1UG9A 4I9WE 4MCZB 2NY7H 3MBEA 4X4ME 5BO1H 3TNNA 4NWTH 4M1CD 4O2CB 2NY3C 5AZEL 1MHHB 2RCSL 2R8SL 1CFTB 4YHKH 4HUWB 3V6FB 2D9QB 3IU3B 1MREL 1JTOA 5FK9A 3HPJB 3UO1H 5ID0A 4JQIL 2D03H 2OJZH 4GRMB 1J10A 4Z7UE 4NWUH 5JHDB 4YHLL 4R2GD 3VXRD 2JK5A 4Y0GA 4RGND 5TE4H 3VRIA 3IJHA 3QDHA 5E99H 5HGGS 2VSDA 4G6FD 4L4TD 3KPMB 4BQ6A 3BN3B 1IFHH 1CXKA 5F9JA 1EMTH 1S9XA 4OLVL 3KYKH 3O4LA 1EGJL 3GB7A 1QFUH 3FT4B 2DAVA 5CBAB 4JAMA 1KCVL 2OXHA 1WIOA 2NZIA 5DJCA 3VXUD 1R3KA 5EUOB 4HDIB 5DK2B 3VFGH 1MCNA 1OGTA 4H88H 5GS3A 3M1BB 4H0IA 3S88H 1YN6A 1DQJA 3GI9H 4N5UA 4PP1D 4F58H 3V95A 1QD0A 2COQA 2GSIB 3QQNA 3UO1L 5LBSL 2DJ4A 3TYFA 5SX4H 5F1NA 1CU4H 2YUXA 3LMJL 1OGAB 1KJVB 3MV7A 1DBAH 3OZ9L 5I1GL 1T1WA 2FO4B 3PJSB 5DVMA 5IGXL 3CVHL 4OGXH 3U79A 3BGAA 3LS5L 4O2FA 1U2CA 3L5WB 4GAGL 4FZ8H 1HI6A 4BUHA 3WIHA 1MPAL 2AK1L 4WI9A 4YGVA 4BZYA 2YZ1A 5ANMA 1C7TA 1XF3A 3BVNA 1PGRB 3JTTA 1IGYA 4W81A 2FHBA 1IAMA 1VHPA 3N0PB 4NUJA 4QXGL 1XMWA 2WUCL 1E4KC 1S5IL 4KJQD 5MEQB 5MEOB 2EDDA 5EH1A 1S7SA 3BP4B 4MDJB 3EAKA 2JB5L 3RX7A 3QUXA 1Z0NA 4WHDA 5IMMB 5CJ5A 1VEOA 3QP3A 1NMAL 2VC2L 3UEZA 2WAHA 1CR9H 4HLZH 1Z9SA 1CGXA 3TIEB 4S1QH 3GBNH 2PO6D 5FHBH 5DMKA 5I0DA 4ZS6C 2DQIH 3PP3K 3IJYB 5DDHA 4RGNC 3OJVC 1MWAA 2FBOJ 2IQ9L 4IOFD 4L9DA 4FZ8L 4YC2C 2BY0A 4GS7B 1HSAA 2VABA 4HLZG 5L2KD 4FFYH 1LK2A 4ZYKA 4WI5A 5C0AA 4MJID 1FFNA 2YMXL 3HUJA 5CHNA 2CKNA 3VG9C 4KK9C 1R5WB 4F7PA 4H5SB 4XBEH 3U4EB 3MV9A 5JW4N 3L9RA 4RDQG 5EB9A 1FJ1B 1KLGA 5T3ZL 3HFML 3MJ9L 1SJHA 3J7HA 5EU4B 3VH8B 4JRYE 1K6QH 4KKAC 3DUUB 3MODL 3LPWA 3NAAL 1QEWA 5CSZA 4JDTL 3VWJC 5D1XA 3BW9B 3QPQD 4S1RL 4LLDB 4XBGA 3MLTA 3HZVB 4PJ8C 3ZT6A 4XWOC 3ALPA 5JOPE 1EMTL 3FQTA 1RZ8B 4C4KT 2IPTL 1N0XH 4AIZB 5TDPA 5C0AB 5K9KA 3BW9A 5IQ9B 1L9NA 5IHZB 4XPFL 3T77A 4YWGH 3S9DB 2ICWI 4OZFG 4RFNC 5SWSD 1CDGA 5C0DA 5C0FA 3CFKB 1I3UA 2CKBB 1TVBB 3ARFB 4MZ3A 4OF5A 1NCWH 3N1PC 4MXVF 3ZTJG 4QRRA 1KLGB 4YDJB 4LARL 3CDGB 3HR5A 2HJFA 5EBWB 1LO5B 4PREB 3ROOB 3O8XB 4JFFA 5C9JA 4MJ4A 4L9LC 1SM3L 3KYNB 5DMYA 1FVDB 2OLDA 2NXZD 3W81A 3SDDA 4EXKA 4LRNH 4LSRL 4PJAF 5FKPB 5J6GB 1JPTL 2FX9L 2DQJL 2VITB 5T5NF 3ZKXB 1NH6A 3C6LC 3IFOA 5BZDA 4PYHA 1QPPA 3DGCR 4YXLL 1CXEA 4DVRH 2EDLA 3LS5H 5KSUA 3MRIB 1RFDH 1FFNB 4LF3A 2GY5A 4XMLL 4CADB 1P5VA 4PJXE 1EAPA 3C8HA 4WUUA 3QRGL 2J1KA 3CH8A 1EFXB 3RTQA 4N0CC 2XN9B 5FO9B 3BGMB 1OTTC 4R7NA 4PJIB 1MRDH 5CD5C 1BAFL 3PJSA 5BV7H 1IQDB 5ICXA 1NUGA 2XOTA 1NSNL 1DBMH 3UJJH 5HGDB 3P9LB 4OZFB 3G9AB 1IGCH 4HXBH 2E7LA 1OGAD 3KPLB 3LVEA 4XNQB 5D1ZB 1UWGL 4JZNA 1OF2A 5DJXB 4M1DH 3P4LA 1MH5B 4X6EA 4ZUSA 4FN0A 3BP5B 3CX5J 4JQVC 1OCWL 3OKKB 1RZGB 5EZOH 1ZXQA 5CP7A 5GJSL 4K8RC 3WDJA 4YXLH 4JDVA 5B38B 5I76A 4Y4FA 3QDMB 1MI5E 4JG1H 2C3VB 2XA8L 1ND0A 4LSPH 4A2MA 1EA9C 1T7ZA 4LDLB 4N68A 4YK4B 4NO5A 4RGNB 1S9XB 4PJ9B 4FQQB 4NQCE 3T65B 3WIIL 3RGVA 3V4VL 4GS7C 1B2WH 1Q9KB 4M3JA 1U3JA 2Q7YA 1FFQA 5ALBH 5T3ZH 4AIOA 1W8OA 1KNOB 1LK3H 3S88L 2HKHL 1HHGA 2P4AB 5F8QC 4F58L 4PB9H 2CMRH 4LCWD 1NUFA 2HLAA 1Q1JH 4KXZH 2Z8WC 3MTRA 4ZFFB 1AHWC 2YD5A 5JDJA 5C0JB 1LEGB 1N8ZB 1OP5H 4C59B 4YFLF 4OD1H 4DGYL 1EDQA 4PJ7B 4G6AC 1S7TB 2QQKL 4XC3H 3PNWA 3LB6C 3I9GL 2BVEA 1MLCB 1INEH 3DHMA 1C08B 3PWUA 3UTZB 4BFBD 1DJSA 1JRHH 4N0CD 2YK1L 1CXHA 3BXNB 1P7KA 2FH8A 1U3HB 1TTGA 4DN3L 1JF6A 4MNQE 2NY5C 3VFMA 4EI5B 2DQCH 4NN6B 4LPCA 2KDGA 1MCDA 2ZKHH 1KCSL 1T0MB 3EYVB 3Q3GA 4LF3B 1ZTXL 1GZPA 2P42B 1BBDH 4JO1L 2GJZA 2EO9A 3JVGA 2R69H 1TCMA 3QRFM 4HUWA 3DIFB 1SHMA 3OAUH 4GQPH 4JN1L 3U2SB 5LWYL 3D5OF 4HKBA 1QLEL 2M8XA 5HYQB 1A5FL 1NFDF 4IRSD 3UTTB 4DGIH 2VQ1A 4BSWA 2IMMA 3GMMA 1NANI 1MRDL 2EH7H 4UUJA 4EUPG 1K8IA 2AJ3B 3SQOL 2EO1A 3QRGH 4YDVA 2OZ4A 2DLTA 1BM3L 1NMAH 2VC2H 3ARDA 4LU5H 5CIPB 5D7LD 3JTSA 2VLLA 1KIRB 1QBLH 1ZANH 1KACB 5C0BB 4CMHC 2VDQH 2HTLC 3QI9C 5LXGH 4TPRH 4D9RE 1BBDL 3BIAX 1NEZA 1CI5A 1KB9K 2HN7B 3IU4L 1XAUA 5FGCE 3MODH 4K7FA 2X1XR 4X9FA 5EO1B 3QEQA 4GG6B 4MWFB 1CVRA 1T1YB 1GPOL 4HFWA 1EEZB 2CXGA 4KKNA 4UT6H 1NFKA 1M7IB 5FA4A 2LAGB 4ZUVA 4R2GB 5CEYB 3RWHA 1BQSA 1X5IA 1ZT7A 3IXAB 4WW2F 1TJIH 1U8LB 4P9ML 3LKSA 3S3JA 1NBYB 4MJ5B 4U7KA 1IT9H 1S9VA 3D18B 1DL7H 4P23C 4LKCA 5IMKB 3WIFA 3DETD 3WIIH 4PJEA 3GEWB 2BNRA 1C1EL 4XCNA 1KN2L 1YEDB 1ZGLB 2JCCE 3W9EB 5D7SL 3QA3B 5TFSH 4DWHA 5KW9L 3DXAE 1QSVA 5T5FH 2LAAA 3W9DA 1BX2B 2CLVB 4ZXBB 4XCFH 2K7PA 3NMEA 1KB5L 4GAYA 1DQDL 5CILL 4N8CL 5ICYB 1KIUA 4ZAKD 4NOBA 1NANH 2YD9A 3WFDH 5TH2B 1FVEB 3MNVB 2HG5A 1Q72H 4APQD 4AEIL 4NFBA 5IJKA 1R5WA 5HJ3A 4F7PB 4Z7WA 5AYUH 3TJHD 3B8YA 4PJ9D 4MWFA 5EU6E 1AXTL 1F6AA 5JIPA 3M17A 4LDOB 4NBXB 1FNGA 2JJUA 2VXVL 3FQRA 3LSOB 3QDMD 4DKDC 1LO3L 2YRPA 1LO0L 2ICEA 1WAAA 1WF5A 1LDPH 1DQLL 2VABB 3BPCA 2JCCA 1H15B 3D3VB 5DUPL 4TSAL 1MCLA 3L3JA 4IDLA 1N5AB 1WC7B 1H8NA 1Q0YL 1JK8A 4IMLA 2FX9H 5IB1B 3PWUB 5C0ND 4PV9A 5F7EH 2GW5A 3LQAL 2A6DA 2J6EH 3FO2A 3VXUE 3UX9B 2ZSWB 4PJ5E 1IBGH 1NUDA 1FAIH 3VFRA 2MSPA 2PO6B 1IQWH 4RNRB 3S98A 3IAGC 5AD0B 5CJOH 1J9CT 4U49A 2N56A 1SJEB 1MELA 5F1NB 4WV1C 4RRPA 5GGSY 1XF3B 1DE4A 3KXFE 4S0TD 43C9A 4HF5L 5MP6H 3M8OH 4HKJA 2YPLB 3NN8A 1ZT1A 2DQHH 3ZT7A 2XN9D 1D5MB 4XP1H 4Y4HA 5ETUB 1TZHB 3VXME 5JQHC 3MV11 3G6JB 3S37H 1T21A 1VKXB 2BSTB 1Q9KA 3TLRA 3OR6A 1U8PB 4ONOA 4X9GA 5GS0L 4NQTA 1R0AH 1EJ6A 4WI6A 1QR1A 3WFHA 5E0QA 5D2LE 2DQFA 3GNML 4PRNB 4V2BA 4OLYH 4G5ZL 3ARDD 1MCFA 4CN1A 4WENB 2AXGA 2V7NA 3P11L 3MROB 1A4JB 2QADD 4YH6A 1VFUA 1IKNA 2NQCA 4G9FA 1FZJA 4YPJA 2FEEI 2DLHA 5I1AB 1BIIB 3BZ4A 4X7CC 5L88L 3LKPB 1I1AA 4HAFA 3OGCA 3UTTD 3L3IA 3ZKND 4F7CA 4Z7VB 3WSQH 1X5GA 1FZJB 1FYHB 4PRPE 4ERSH 2RCSH 1AGEB 5H37G 3BYTA 1LDSA 3RVWC 2H3NB 3Q5YA 5HPOA 1HHKA 5EWIH 5CJQL 4FG6C 4B53A 1CFBA 3ARBD 2ERJC 2C7UA 3FB8B 3TBVA 3DYOA 5I9QB 1UKQA 3QXUA 5JZ7C 3GMLA 4ZUSB 4CU8A 1WICA 4QHMA 1TTUA 1HIML 1KLFA 3A6CH 1NAKL 1OD9A 3DROA 3X13A 5DR5H 1JGLH 3U6RA 5HGDA 5I6XC 4MJIA 5LKNA 3V2AR 2BDNH 4DN4L 1OTUC 1LE9B 3L3JB 1BZQK 1X7QA 3FN9A 1SJEA 1MCQA 3KHQA 4XHJC 3MV7D 1XF5A 4XMPH 4KK5C 4DGIL 5JW5A 3VXPB 4BQ8A 1H3PL 2A77L 2E7LC 2X4RB 1E4XL 1R3HB 1P84J 2DQCL 2NY6D 5CS7A 4XVUC 1JGVH 2D7NA 1KCUH 3MJ7B 3EJYC 3HR5B 1LDPL 2FIRT 5I1IH 1GYAA 1CYGA 4G8GA 2WZPD 5IVZB 3QUZD 2PYEA 4X7EC 4PRPB 1JPST 4I2XE 5HHME 3VU2A 1VEPA 3K8KA 5IW6A 1X5YA 1DUYA 3QYCA 3ILQD 3T77B 1CK0L 1YY8B 1NCAH 2N1KA 4K94C 2ICEB 5D5MB 1MEXL 2AS5M 5EZLB 4I4WB 3G5YA 1J8HB 5BCAA 3CMGA 1A6WL 3QCUL 4KAQH 4N8VG 3N1MC 3HMWH 5LJYH 4PJFF 4LEXH 3EIFA 1FSKB 3VGGA 1EX0A 2UWEA 1RURL 2DMCA 3D39B 1H5BB 1XIWB 1T7XA 2HG5B 3JUZA 1EGJA 2CK0H 2OX5A 1JV5B 2X5PA 4U6YB 3SDDC 3ZTNH 2FBJL 1E4XH 1KN4H 4QGTA 5HHPB 3MUGB 4KRLB 1NFIA 1MCRA 4JY4B 3IDUA 2DQUL 3RWIA 3B2VH 5HHNB 4OFVA 3ARED 4ZO9A 4PJXA 3EUUA 3O3DA 3C8KB 2ENSA 1N64L 1AE6H 3MRDB 5B3JF 4YHIA 4M93B 2NY2D 3P77A 4U1KB 3DI3B 1FL3B 4CJ1A 1TXKA 4M62L 4Q9QH 1U8JB 5BW7C 1U93B 2G2RB 2Z8RA 3EO1B 3MRFB 2W65B 5I1KH 4M43H 3F6LA 1CFNA 1RUAL 3LKSB 3RTQD 2MMXA 2X4UB 3D2UA 4YXKH 3P11H 5A2LH 5FDYA 1ZT4A 5FHAH 3FQTB 1YYLH 4XB7A 4D0CB 4WHYH 3N9GL 2UZIH 4R7DA 2A1WH 4GAJH 2GSGA 4KKAD 4Z95H 4TN9A 1T6VN 3HI1B 3IFPB 1HILB 1I1AD 4K7PH 4EI6B 3N85H 1RULL 5I1HL 4H8WC 4R97B 1UWXK 1MWAH 2NXZB 4TQEL 2YOCA 3CZFA 1DVFA 1K4DB 4FOMA 5DGRA 5IVZA 3VXSE 3T0AA 4LFHD 5MI0B 2W60A 5TE6L 1MCOH 1X5JA 3MBED 4X4XB 4WHTA 3VD3A 5B3JE 1HCFX 3EOBB 4RFOH 3SDCD 4HPYH 4ZYKB 2EECA 2HT3C 3VFPB 3OAYH 4U3HA 2YD2A 2E7MA 1J18A 4L4VE 4QTHA 1NC2B 1DBJL 1KT2A 4HAGA 1FYTB 4X6DB 2R23B 2AEQL 3P2TA 3F12A 4P9HC 4WFHE 4JANB 1H3PH 2A77H 2AW2A 1IGML 4MAUH 1GHFH 3UTZA 4LP5A 1ZS8A 5GJTL 2DMBA 4YAQB 1UKSA 4ELMA 3L5WA 1NCDL 1PG7W 4HD9A 4U0RC 1UJ3A 3WE6A 4R96A 4XP9H 5KOMC 3SDYL 3TVMC 2D7PA 4MXWL 4HMEA 2P8LA 2VXUH 5GS1A 3T0DA 1WT5A 4LIQE 2APVA 2D7QA 5DHVB 4KQ3L 3SO3B 1I1CA 4U1NB 3PABB 5FUOH 5CFHA 1MAML 1YECL 3BXNA 2JB5H 4JFQA 4RSVA 3WO3B 4I2XA 4MAYA 3QHZH 1X4YA 1GAFL 3ZYJA 1VFOA 1T22B 2ITCB 5FCUL 2C4FU 1JMXA 5ERWB 1A1MA 3QNYA 2Q6WB 5IEKB 1PJ9A 4O2FB 5A2JH 2W91A 2VZUA 2VERN 3ZTNL 4PJFA 5L2KA 4OCXH 4TYUA 5MERB 5C6PB 4UDTB 3WFBH 2GCYB 3I3DA 2G75A 2DLEA 3C5ZB 3N06B 5JNYB 4KV5E 3FMGH 3D2UD 3K8LA 1C16A 1T80A 3LKQA 4M5YL 5DVKA 1CTNA 1UWEL 3O3EA 3F6IA 4RMQA 1S3KL 4ZFOB 3V8CA 1HQ4B 4XAWL 3BP5A 1DUZA 3WL9A 2I07B 3TEUA 1U36A 5DJ2A 5DJCB 2NX5B 1IEBB 3G08B 3EFDL 4WTXA 3SCMD 1JWSA 4AH2B 4BH8B 3ULVH 1QLRA 2VSCA 4U6TA 5ENWB 4XPBH 4KZDL 2O5XH 4GRLA 1H3WM 3IJHB 4UQ3B 5IVOA 1ONQA 3DGGA 4JFHD 4OD3L 4U6VL 1OWWA 2YZ8A 5F97E 1Q94B 1NMCB 3NFSL 3WIHH 2EE9A 1MCSA 3RKDD 1EXUB 4LCWA 5IOPA 3F7QA 2WBKA 2XKSA 3STLB 2VISB 2UY7A 3S97C 4XNQA 5IMLA 3LEVH 1KCUL 3IRPX 2BNQD 2D4FA 3AMKA 4N0YH 5DHYB 4G6JL 3SGKC 1MHHA 3EOAB 4KWUA 2XFXB 5IVXA 3MLRL 1ORQA 2GAZB 2H2PD 5GZND 1CLOL 4UOW1 2OL3A 1YQ2A 3ZKMC 2BNQA 4P57B 1IM9A 15C8L 4G43B 2R0KH 2DRUA 4Z77A 4CVUA 5KSAA 4X7TA 1I3RA 3WS3A 4KTDH 3OXRB 3C87A 4Z7UA 1VADB 4WI4A 2Q86B 3DLQR 1MRFH 3TJEH 3FTGA 5FECB 3ARUA 3QDJD 4OAWB 3BZEB 1KEMH 2MJWA 5H37H 3CC5A 1UZ8B 2E27H 3EYOA 3CU7A 1CE1L 4HEPG 3V5HA 2VUYA 1WBZA 3WNPA 4GJTB 2F53E 4FTVA 4NCDA 2BNUB 3QIUC 4XNXL 2AXJA 1RURH 4ZFZB 4K23L 5DO2D 2EXWC 1MHEA 3EO1A 2NW2A 2P1YA 4P4KA 4QT5B 3VG0L 4Z6AT 4DOHE 1RUAH 2VZ1A 3SO3C 4FQXD 5F8RC 4XX1E 3MNWA 2DQTH 1FL6B 3QA3A 4JRXB 5IB3A 3BRGC 3HMXA 1NL0L 2BSSB 4XPTH 4JY6A 3ULUL 2YD3A 1FGVH 4M6NH 4HT1H 5DRWA 2AXFB 1A6ZB 2CDEA 5KZCB 4OZGE 4KKLC 5A2IH 3SKMA 3DSFH 2BSRA 5D6DA 3VRJB 5DRNA 1C7SA 3JV4B 3V5HB 1J1PH 2DYPD 1JPFA 3L9RB 3MACH 4Q6YA 4OCWH 1MHCB 4L4TA 2AJVL 4MLIA 32C2A 2Z92B 3DUSB 4W6XB 5E2UL 4ZTOL 2IWGA 3CD4A 2APBA 3N1FC 4DQOH 4QRSA 4S1DD 4RGOL 3DETC 1BFSA 1Q9WA 4GT7A 1I3GH 4OFIA 2WIIB 1QSFE 5FGCB 4ONFL 5GRZA 4KI5D 5ADPH 3AS3A 4LASH 4NWUL 5DJDB 4HH8A 5E6ID 3D0VA 3ARYA 5CCKH 2VDRL 4JPKH 3AAZB 2VLLB 2CLRB 1KYOJ 3S4SB 4MB4A 3S4SG 3UAJD 1U3HD 4X8JA 5HHXH 3KLDA 4JCLA 5EULV 4NQSA 1HI6B 4J3OC 5IJKC 4G6FB 2R8SH 2GITA 3MXVH 3UZVB 4IIQC 4N0FB 4M3KB 2CQVA 5A2FA 4UQ3A 1VA9A 3FN3A 4U2ZA 1JTPA 4RFOL 1C12B 4GXVH 4NN7B 4HUNB 1U3HA 4E5XB 1DQMH 3BEVB 1XCTA 3RDTB 4NYLA 4QLRA 4RAUA 3MYJB 4POYA 1HHKB 2ZKHL 2JJVA 2IAND 1PKQA 1QKZH 1A7PL 3ZE0F 3KG5A 1VDGA 3VD4A 3S8WA 1D9KB 4NO3B 5HY9B 1DDHA 4UTAL 1UZ6E 2VDML 5DQJB 5DT1H 1PG7H 5D2NA 2CDFB 3TN0B 3U46A 4ISVB 1C5CL 4PD4J 4GRLB 2CJUH 1PQZB 1ZEAL 4H88L 1XT5A 5EUKA 3MUZ1 3MRLA 4CL7A 4JZOB 1Q9LB 1JP5A 5JW4R 1YPZB 4JRWA 1HKLL 3GSNA 3VFOB 3OTTA 5D7KD 4MVBC 2J4WH 1DVFC 1ZANL 4NNXA 3SBWC 2KKQA 3GIZL 2J8OA 3GJEA 4NUGH 1KELL 1AD9A 4L3ED 2Z31C 3AS0A 3MROA 3JWDH 3EOYG 3MPCA 2X1QA 3A6OA 4CN4A 3OR7B 1D6EB 1D5ZA 5TF1L 5JNYA 1FIEA 3P40A 5EN2A 3BUTA 1G6RL 1RZGA 1FFOB 5IV2B 5GSVB 1PQZA 1F2QA 2MQ3A 3T1WA 3OV6A 1LEKA 3FN0H 2UWEE 1FAKT 1JI1A 3U0WL 3QXDA 3CFDB 5IEKA 4OQTL 4FFYL 3L5XL 4YE4H 3CX5K 4Z0BL 4PV9B 4HKJB 4IRSA 5BO1L 3W39A 4JFQB 4LAJH 4FQCL 5IFAH 2WP3T 4FQJL 4KK8C 4X7DC 4OZIF 3QDGE 4RAUB 2F9BT 4NYLB 2C1OB 4FFWC 2D7TL 4S1QL 3BSZL 7FABH 3VFPA 5DGQA 3OPZH 4MZ2A 3RL2B 3KYOB 3ROLA 4FG6D 1SBSH 2EC9U 3UYOD 5HYJD 3O3AB 1G0XA 1CG9B 1U92B 2KZWA 2Q8AH 5HVHB 3BQUB 2XQBH 4KQ4H 5CJQH 2YKLL 1FGNL 4B41A 5ICXB 4BM7A 3EZJB 3ZDXE 1X5LA 2X4PB 3TZVC 5ANME 1H15A 2NY4C 2F5AH 3PWPD 4UQ2A 1ADQL 3TO4A 4JPWL 2G9HA 4Z7QE 2I9TB 3EJJX 4WEMB 3LHPL 4U7SA 1NAML 1CGWA 2ZWLT 3T2NH 4ZXBC 1IEHA 5DUPH 4KJWD 3RPKA 3Q6FA 3OG4B 2V2XA 2F8XC 3I6LD 3IVKA 5T33L 3FZUC 4XMPL 1F4XH 1NUNB 1HOCA 2ZOKA 5DURB 4NZUH 4EI6A 2J8HA 5DC4B 1F3RB 4YHNB 5F93C 4JFHE 5D5MF 5E6IA 2XNAB 4P4RA 1R24B 3HPLA 4RZCB 4MCYB 1RUPL 1U8MA 2VLRB 5IB3B 4HQQL 1WFNA 3QEQB 4CVWA 3DX9A 2K7QA 4N90D 3HRZB 5DA0B 3QBTB 3MUGA 4C56D 3B9KA 3U4BL 5ITBL 3M8OL 3TIDA 4F57H 1U3YA 2F5BH 3G5XA 4UILH 4RGMC 1WUNT 4QCIA 1KIRA 1H0DA 4EUPB 5CEYA 4LSVH 3RWHB 2NZ9C 3D6GA 5HHOB 1B4RA 2ZUQC 4HWUA 4MNQA 5I73B 2RQ8A 4B5EA 4HC1A 1XR9B 2BVQA 3GJFH 1ZLSH 1CXFA 1SJVA 5F6HI 3MX0A 2XQYK 4WV1B 5EU4A 5F96H 4X4MA 3GGWA 1UM6H 1XGUA 3TPUA 2UWEB 2FL5A 3C5SB 3MLSL 4PJBE 1FNHA 3TM6A 4JLRB 1H3VA 1J1PL 4L4VD 5KS9A 4G3YL 5E08H 1IJ9A 4QYOB 1U8HA 5I15L 1N5YH 4OF7A 3V52H 2YEZB 2J5LC 4FNLH 4QY8A 2YPLD 3MCKA 3H3PH 3ILPB 1UWGH 5J06A 2XZQH 5DQDH 2P24B 4LQFH 5EA0L 4HV8A 4HKBB 1CICA 2OJEB 3ECBA 1F4WH 3F5WA 1HQRA 3CLFH 1CICC 2H6PA 3T2PA 1KJ2H 3TIEA 2F54D 5DK0A 2BOBB 3REVA 1FZOA 3NCYP 1A1NA 3D39D 4JM4H 4FQHB 1KV3A 1R6VA 3WL9B 5J0BA 4GAGH 4K7PL 1MJ8L 1DLHA 3EDEA 3GSVB 3T0EC 2VDLH 4X7SH 4XT1C 4TRPH 2R0WL 1F5WA 1H3XA 1I75A 5IIEA 3SDCC 3F7VA 5ALBL 4PJEF 2IFFH 4RBPH 5CMAB 2CUMA 3JTTB 1QLRB 1IC7L 1MFBL 1A7NL 2FIKA 1CIDA 4Y4HD 4F7MB 1BLNA 1RY7B 2A83A 3T8XA 3QUMB 2DICA 4GQ9H 2OCFD 4HZAA 3RHWF 2XZQL 5MERA 1TENA 1TDQA 2BP3A 1XZ0A 3HC3H 4X6CB 2NNAA 3P4OB 1WLHA 3CGTA 5JXAL 4PRPD 3MREB 5DQ9B 1Z5LB 2B7DT 3NFNB 3BN9C 3BE1L 4I3SH 2QQKH 3QUKB 1JHKL 3HZYB 2NY6B 1U8PA 4MAYD 4GKNB 1CVSC 1KCVH 4LCUA 3HLAA 4L1HA 2ZPKL 2V7HB 3REWB 3WNKA 1WTLA 1XF2A 3S96A 1HKLH 5CJBA 3VXSA 5J4MA 5BV7L 2SEBB 5LVEA 2OMNA 1A4JA 2WANA 1MJUL 3TYGH 3VI3E 4KROB 4YQXL 3AREA 4G6KH 1P6AB 3GJFK 4Y19D 4LPYA 5CWSA 4MAYB 3KPRE 2BVPA 4LPVA 3EBAA 3SQOH 1N2RB 4MD0A 3MV7E 4ODVH 3T3MF 2EDQA 3W11D 4OSUL 4X6DA 5HDQL 4OLWL 5FM5M 1MJJB 4YHOL 3BSZH 1A3RH 1G9EA 4XC1L 4G7VL 1V3MA 4TPRL 1PAMA 3HI5L 5BRZB 3ZYOA 3QUZC 1BBJA 4H20H 1TZIB 3WLBA 1YMMB 4XVSH 1DFBH 2QSVA 3SKNB 2BVYA 2RHEA 1KIQA 4IOSD 4MQSB 5J1TC 4NZDA 1XGTA 5CZXC 5I1LB 5BZDB 3NCBB 4UBDD 1RK1B 1OP3H 5IB4A 3FQNA 1SYSB 3B9AA 3DV4B 1ZSDA 2XN9A 1KC5L 3MV8B 2D7TH 1A1NB 1F6AB 1MF2L 4JVUA 4U1IB 3KPSB 4XMKL 1B9ZA 5D2LA 5I17B 3LZFH 4ODVL 3TV3H 1KPVB 1HH6B 3IFNL 1LO5A 4PREA 3ROOA 1N5YL 3IS0X 4P3DA 1AC6A 1I8LC 5FA3B 3PQYD 5KVDL 3ARDC 3D0LB 3BWAB 5D7IF 1JE6A 2O5XL 3DI2B 1FO0A 5T5FL 5FYJE 1F11B 2ESVA 3ZE2F 2BSRB 3MNZB 4P48A 3H42H 3LDBC 3FQRB 3LSOA 3WO4C 2NW3A 5BV7C 2E7BA 4XNUL 3U7WH 5DVLA 4PBXA 1DTUA 3ZKNC 4EN3C 3OHXA 2VLKA 1JRHL 4G6ML 1W72L 32C2B 4MGXA 1NC2D 3LEVL 2AVGA 4NM8L 4PLOB 2A2QT 4PJGB 1Q0XH 4LLWA 5E2TH 3THMH 4PJDA 4RAHA 1ZWIA 1JFQL 5C0RL 4LCCB 3U7YH 2BFVH 4ZSOA 3W9DB 1JV5A 4AEEA 5C71A 1OSZA 3LMJH 5M94B 4BZ2H 5BS0A 4FQ1H 4JY6B 1WIUA 2VR5A 3GMPB 1LD9A 2F15A 1TFHA 3BGFC 3NFPB 3HPLB 4RZCA 2V5SA 1OSZB 3NACL 3M45A 4WFGD 5JLZB 5T1MB 1ZV5A 3BT2L 5CZXD 5E4EB 4O02H 4U05A 2E5EA 1U8LA 5IBUB 4OB5H 4LLQA 2X4OB 2ESVE 3MLWL 1SEQL 3WYRA 4TULH 2KBGA 5LCVL 3NCFB 4I4WA 4NFCA 5J89A 2QQQA 3PDGA 4OZHB 4NQVB 5FDWB 4P46A 4BSVA 1OP5K 4M4PA 3ZKSD 1G1CA 4AK1A 4JGJA 4Z7QF 2FGWL 3WD5L 2V2WA 1XGPA 2WBJB 5J1AB 5F7KC 2DQDH 1MIML 1FP5A 5LAXA 3BWAA 3MCLL 1KPUB 1QSFB 2JJWA 3OXRA 4QF1B 3U7AA 3LD8C 3VMPA 2V9QA 1VPOH 5JXEA 4W4OA 3BP7A 2FX7H 5D2LB 3X13B 5F9DC 5L2JB 4EN3D 3C5ZC 4EI5A 1PZ5A 4ZOCA 1L7TH 3G6JE 3O3BA 1GGIH 4X9IA 5K9OB 1M7XA 4K3DL 3OR7A 5EA0H 3CVIH 4J4PA 4KMTH 5T3XH 3ZYZA 4UAOB 4PJ5B 4ZTOH 4HS8H 1QRND 1T5XB 1RMFL 3QPQC 2Z31A 3TBYA 3T3PF 4HXAH 3J8F7 3IETA 4O58L 1F2XK 2J8UE 3AC0A 1X5AA 4XXCA 3KLAB 1KIPA 5L7XL 3ORJA 1G9MH 1G9NH 1UCTA 3GSOB 4OGXL 2Q87A 3MR9B 3WSQL 1ED3B 4XH2B 3QHFH 1ZHLB 5I8KL 5TF0A 3W0WB 4MXQC 1IC7H 5KAQG 2C3HA 1ZVYA 2DM4A 4IMKC 3BFOA 1U91A 2Y5EA 4IHOA 1CQKA 3P4MB 4L3EE 2F8VA 2OQJB 3ZSSA 5LQBH 3G5VA 4AQ1B 1T21B 4I0CC 1UYWL 2QHRL 1UEMA 3EYFA 4IRJB 3D9AL 4R0LA 1KF9B 4Q9RL 4Q74A 1T20B 4NO5B 3P0VH 4ODUB 3ALXA 3D85D 3V5DA 3H9HB 3GSWA 4K2UH 1HXMA 2FD6L 5HGBA 2WLYA 5JUEL 2JCCF 3CU1A 3H9ZA 4R0LB 4I3SL 4EOWH 2GUOA 3KLAA 4BZ2L 3KYMA 1IC4H 3VXRE 1RZFH 3QQ3B 1MHPH 5D2NB 3TN0A 5E8NB 1MCPL 4EI5D 1CD8A 4L4TE 5HI4C 4ZTPL 3RWFA 2FHFA 5C07A 1Z9LA 1ZHLA 2AI0H 3CXHJ 3HRPA 5F6IB 3WXVL 3TT1L 1T22A 2ITCA 4NOFA 3UC0L 4QHNB 3HPJA 4PJ9A 3SJVE 4MQTB 4N0UE 4LFHG 3VXUB 4OZGA 5CJOL 3SGEH 3O3BB 5HYEA 4ELME 1AKJB 1WEJH 1RZJC 2ZUUA 3OF6D 2VXQH 1AFVH 4I5BA 3QR2A 3H6JA 2CIKB 5ADOH 2RJMA 3OKEA 3PDDA 1FH5H 5GRUH 4PRAB 4OCYH 1I8KA 2DQDL 2ERJB 5IVXF 3BH8B 4OV5B 1BJ1H 3VWJB 3WD5H 1YQVL 4ORZC 2Y23A 5KN5A 2ARJB 3GSQB 1MEXH 1MLBA 2IFGA 3RNQA 3SHSA 3CSYA 5C0CB 3SGJA 1HHJB 5F21B 1BFTA 2IMNA 1DQTA 5F1KC 1BJMA 5A3ID 5ICZA 3HI1A 3IFPA 4ALAH 1FZKA 2W0PA 2G60L 5D93B 3BZFB 4ONFH 1ZGLA 2E9BA 1UADC 4TNWF 1D3CA 3DX7A 2Q20A 1KPUA 2FATH 4LSUL 4PJ8B 5IFAL 3ULUE 5JOFB 3L7FB 5MENE 3WNLA 3A6BL 4PG9B 1JF1B 1NBVL 3WXWH 3FO1B 5GGSB 3FRPG 4JO4H 4TUJA 1EVTC 2Z9TA 1B4JL 1AXSB 1FL3A 4JFFD 5IG7B 3NZ8B 4OZHA 4PYGA 5J56B 3V5KB 1J0KA 1ZHKB 1RV6X 3QULA 2GI7A 5EPMA 3FO0H 3GM0A 5J6HB 4S1SL 4NJ9L 4LRNL 1NGXA 3OHXB 3QG6A 1JGLL 4PIRF 4JE4B 4NQXB 5CJ8A 5ACZB 2GK0B 5HI4D 5HGAA 4RIRB 1MRCL 5T3ZE 3BPNC 4IEFB 5I8KH 4M93C 5AZEH 2FZ3A 3SKUD 5FCSH 2PTTB 1KXQE 4YBLB 1FO0B 1N59A 3NGBC 1EHNA 4HBCL 1ADQH 3MRGB 5GQBA 4YPGA 4PJ8A 4FTVB 2MFNA 1H8OA 1MSPA 5EBGA 4RWYL 5AWNH 4ZAKB 5FA4B 5D4QA 3S7GA 5EZLA 3QNXB 4Y2DD 4PJXB 1U8OB 1C5DA 4F2MA 3TESA 4JN2A 4WWKD 4PUBH 5HHNA 5D9SB 4AG4H 2CJUL 4J4PD 4FQLH 5BJTA 3ULVE 2Z35A 2EDFA 1IKFH 4U1GB 3E1F1 4DCQA 5E1AA 3VFUA 3GJFB 2HN7A 5HHPA 4FMFA 3A67L 5F9AC 3NZHH 3RY4A 5EIVA 4Z7NF 4WO4B 1NCAL 4J1UB 4F8QA 2IPUG 1NDGA 3DNKA 3KPOA 3OKLB 4KQ3H 5INCA 3U36B 1Q72L 2IADA 5INDA 5DRZA 3MRHA 3MJ6A 5IF0B 4FABH 2QSCL 3JWOL 4KVCH 4LCWB 4G43A 3FB5A 2ADJA 2NY0C 3RL2A 4PJBB 3QJFA 1OSPH 3MJGX 1UC6A 1YMMD 2NZ9D 3B3IB 5TPWH 3VE0B 1QVOB 4HKZA 1LO0H 1NCDH 4ERSL 1I1YA 4H1LG 5ADOL 1HHJA 4PJAB 4V2CB 4WDIB 4BQCA 3KDMB 3RVVC 3VCLB 3QFJB 1QTYT 1MIEH 1BOYA 2W9DH 1XR8A 1WWCA 4BYHA 4JHBA 4CVZA 5FYLD 2OP4H 3VFSA 4QHMB 3SKJH 3IDYB 3KYOA 4LNRB 4CBPA 1BBJB 1T0MA 4UTBH 2V7HA 2IPUK 1R3JA 3QIWA 3SCMB 4MX7B 2FO1A 4ODXB 4JFZH 2D7OA 2XZCL 1A7QH 4B50A 5J3HC 1D6EA 4HMDA 5E2JA 1A9EB 2CXKA 3P0YH 2H3NA 3MLSH 4D9LH 3HZMB 1HE7A 1UENA 1LVEA 5IHLB 4OZIE 2AJYH 1RHFA 4OI7A 1NCCH 2BCKB 1MJJA 1NBVH 3NBNA 3VFWA 1JN6B 3V4PH 3RIFF 1OHQA 5EUOA 3DO3A 3I6KA 3D9AH 5HPMB 4U1SA 2AABL 4QNPF 1BLNB 2B5IB 5FUCC 1M7DA 1IC5L 2APWA 2FIKB 3HZYA 3PABA 1NBZB 3LKOA 4YHLH 3I6GB 4MB3A 2NX5A 3G08A 3RI5K 5I18L 1JWMB 1I7ZA 5F3HA 4JDVB 5AZ2L 2Z93B 5GGTH 3P9MA 4R4NC 1RJYA 2BSTA 1JWUB 1BZ9B 3VXSB 1CE6B 3T04D 4X99A 4R96B 3P0GB 3MLPA 3QCTL 3N1QC 1U91B 4IHOB 2VDLL 1ZHNB 4DVBB 5DK2A 4ODWB 5D71L 5D1XC 3I2CH 1M05A 1HYSD 1UVQA 4NKOA 2HVJB 4UV7H 4NQDD 5L0QC 4I13B 2GTWA 2L0DA 2DIJA 4PJAA 4WDIA 4X6BB 4QRPD 4JDTH 4M1GL 5I8OL 1H3TA 5IK3A 3DX8A 2X4SA 2XWTA 4YDKH 1RIUL 1PX4A 3CNKA 4M8VA 4OUUB 1A1MB 3VW3H 5IFHH 1QBLL 4QHUA 4WTWA 3TZVD 3VFSB 4F37F 3KPQA 3HAEG 2VAAB 2PUQT 4PLKC 4JN1H 5KSBA 4KKCC 4Z7NE 4F15C 5I2IA 1FE8L 4XHQA 4EZMA 4QOKE 2AI0L 5EOCJ 4M00A 1ITCA 4NQEA 1A5FH 3SPVB 2VITA 2JCCB 1GGUA 4QY8B 3MV8D 4NO0D 3W5NA 5J3HD 4ZPVB 4K3EL 4RMUA 2DF3A 4JCMA 4OLXH 4RMVA 2Z35B 3MV9D 3GO1L 5I66B 4YHML 4UV7L 2GITB 5HDBE 4V1DB 1OSPL 3R4DA 4CW1A 2Q7NA 1FNAA 2FDBP 4J3TA 4NHUB 3T09A 2WINA 4P2OB 5C3TA 3O9WB 1XGUB 3TPUB 3TIDB 4UIMB 3IT8D 3KR3L 4Y1AB 4YBHA 2WBJA 2YSSA 5DD5L 3DHJA 1UCBH 1JPSL 3QJFB 5BVJB 3LKRB 3KVQA 2ADJB 1J05B 4PBWD 4ODHH 3ARWA 1FE8H 4MNQB 4AEHH 1P1ZA 1Y18B 4YFLI 2JE8A 4H0HB 4G8IB 1YEEL 3JWNC 4O9HL 1QFUL 4LHUA 1GOHA 5HYJA 4HWBL 3VJ6B 3AXLA 3IDJB 4QRPA 4WO4D 2CK0L 5FYJL 1KCKA 1A6AB 4ODTH 4WWKB 3FO1A 5ISZA 4GRWB 3VGFA 5HVWA 5F71A 1FJ1A 4HBCH 1C1EH 3CZJA 3GKZA 2Z8SA 1G0YR 1KFAL 5JZ7D 2BVOA 5DWUH 5GGQL 5DZNA 1K6QL 5IW1A 2P5WA 2VDNL 1YNLL 4K7FB 5EO1A 2O5YL 3CVHA 1J05A 5E6IB 4NDMB 4CN6A 1A22B 4NJ9H 3D18A 5FUZH 3C5JB 1R3IH 5ICZB 4C57C 4EUPH 3S36H 4R26L 4XVJL 3MOBL 1UXSB 4PR5B 1T3FA 3PG2A 5DF0A 5BRZE 1EUUA 4YHIB 5ESQB 5B8CC 1EUTA 5CUSL 3TFKD 4PGCA 1G7PA 1HN1A 2GT9B 3L6FB 2XPGB 5CHNB 5I66A 1MFEH 2RBLA 3CFCL 4Z8FH 4GG6E 5H2BA 3HE7A 3UJIL 5JO5B 5I9QC 2FLRT 3NIDF 3OKNA 1JTTA 4AM0B 3ULUD 3EYSL 4OD2B 1TLKA 3DVNA 3EGSB 4HF5H 4P2OA 3KLHC 1LE9A 1YYMH 2AXHA 5GRVK 6FABL 4Y2DB 5IFHL 1MI5D 3U9PH 3OJ2C 2CLZA 3E3QE 3ILQC 1NFDA 1IAKB 1K2DB 2WNGA 3HE6D 3MGTB 1LP9F 2MNUA 4Q7DA 1U92A 3MOQA 3PDOB 5C0GA 5CGYD 5E8NA 2FR4B 4DKFH 4KMQA 4PJCA 3FB6A 5C1MB 4OZHE 1XGRB 2A0LC 1RFDL 5KSBE 2QQLH 4G42B 5HDQH 3SDDD 2YPLE 4PRHE 4AH2A 3DMMD 4DN3H 1L4IA 2A73B 5JOEA 3K2MC 5ECJE 4FQPA 4V1DE 1ZA3B 3QQ4B 3WN5A 3KPRA 1U8IB 3F7YA 3BN9D 1YMMA 3EYSH 4OLEA 3CSPA 3CIQA 1G0DA 1DUZB 3B5GA 5JW5B 4XCYA 4O4YL 1Q94A 2X10A 1D5XA 3KWWA 5F7YC 2AEWA 3RIFK 4YFDB 3SN6N 1OAKL 3DSFL 3ULVD 4I0PB 1N64H 4GW5B 3ZL4H 4HIHA 4C56A 1DBKL 2AABH 2X70A 3G6DH 1N2RA 2Y36L 3GB7B 3VXUA 3C6LB 2DI7A 1F8TL 4IRZL 5ACMA 3VXNA 1F4YL 1UH4A 5DEGA 2JIXD 4GW5A 2PR4L 1VGEL 3DROB 1T1ZA 2BRRL 4UDUB 4AEHL 3DYPA 2YRZA 3LRSA 4I0PD 1N6VA 4WY7L 2EKSA 1UXWB 4O9HH 4OZHF 3VXNB 4D3CL 2A1WL 1L7TL 4GAJL 2MCG1 4LHUG 4HWBH 1QFWI 4H26A 3GSOA 4YNYA 3U82B 1HXMB 2VL5B 3LH2L 1YA5A 4KUZL 4OKDA 1FZMB 2BHYA 2Q8AL 2FYYA 2YA0A 1WWAX 4WI8A 1KLUA 3FONA 5DWUL 4OUOA 1GGBH 4XTRC 1RZJH 1ZLUK 1BPVA 2I9LA 4UB0L 4L8BB 4EBQL 3DVFA 3V6ZA 3S36X 1DANU 3TO4C 4HXAL 5C6WH 2MOVA 4XVTH 3MBEC 5DMIH 2YRLA 4Y5YA 5IMOA 2P7TA 3RZCC 5IEHB 4NO0B 4OFDA 1YEJH 4JJ5B 5L7XH 4JPWH 4GXVL 5C0NC 1VGEH 1CE1H 4L8SC 4G42A 5D96C 5GIRB 1KB5B 2X70B 3HG1A 5IIEB 2VIRB 2O93L 1WFTA 4CDHA 1KT2B 2BY2A 1NMBL 4Z7UF 5J1AA 3H3KA 4U1HB 1BQLL 3PGFL 3Q6GL 5K59E 5EC2A 3O4LD 4HJ0C 1OT2A 2Q76A 4U6VH 4HS6A 5I8OH 3SDAA 1J1XH 4WHTB 4L8DA 1QSEE 1M1SA 1NSNH 4M8QB 1R3LB 1PY4A 3FQXA 3MFGB 1U58B 3VRLF 1GGYA 3HAEA 3MLVH 3QFJA 5J12C 1CL7H 4BZ1H 3MJ8A 4QXUL 3RJQB 2C1PA 1A6VL 3GKWH 2FRGP 1NGPH 3GJFA 1P9MA 3BGMA 3H9SD 1RZFL 2UUDK 1AY1L 2D31A 3H0TA 3MACL 4U0RB 3SE3A 2XG5A 3MRPB 4HJJH 4RDQF 1ZHBB 2FGWH 4XNZB 5INDB 4WW2C 4UMGA 3DUSA 3CUPB 3OKLA 2OL3H 5INCB 2ZOLB 5I1KL 3C09C 2H26A 4NGHH 5GRYA 1FLRH 2RGSA 2EIZB 1QP1A 3EYUL 1KTDB 1FPTL 3UYPA 3L1OH 4GRLD 4MNHB 3ZDZE 3V9FA 3VFUB 3RVXD 2MHAB 1QYGL 3HN3A 4M7ZC 4IDJH 1I4FA 4ZXBA 5CD3A 1OT1A 4WJ5B 4NCC1 3X3GL 3MXWH 3HZVA 3CH1A 2DWEA 1RIHL 4L4TB 2HRPL 2CGRH 1XH3A 3MLTB 4EDWL 4FFVD 5I1HH 2F5BL 5J11B 2DM7A 5CZVH 3BYYA 4WTZG 1F42A 3W11C 2Y7QB 2OTUB 3QDME 3MC0A 5D1QB 3QB7C 2NXYB 4PJGA 2KZ1B 3I50H 1A6UL 4XVJH 1UEYA 1BQUA 3G6JF 3T3PE 5FGSA 4LLWB 1I9EA 1F3JB 3DECA 1FC1A 1OTUD 4CW1B 4NZJA 3H7BA 3B2UC 4L9LA 2AJ3A 1EEZA 4XPTL 4HJ0D 4TOYL 1AP2B 5DSCA 4HT1L 1OARH 1CGTA 1TJHH 3BISA 2DQGH 1G7QA 3LPFA 1AXSA 4I48A 1ACYH 4JGUA 4P5TD 4U6HA 2ZOKB 3QHFL 5E08L 4M48H 4G8GB 2QQNH 3EJYD 1MFDL 5E5UB 2H8PB 5JOFA 5DVOA 3HC0A 1E6JH 3DWTA 4U0QB 1UZ8A 2O26U 2RB8A 3QPXL 1MQKL 2W0FB 1T1YA 5MHSD 4Z0XA 1V8HA 3SDAB 2A74A 4U1MA 1EIBA 2DI9A 1UJ3C 2MPAL 3E6FB 3U0TB 1B90A 2GJ6E 4J3VA 4S0SD 2F8OA 1RIVH 3O45A 4XXDB 1BQLH 3PGFH 5DUML 1CQYA 4WNQB 4PY8I 3KJ6L 3S35X 1RQ5A 4PTUA 4K3HA 3MQIA 3WUZA 3IB4A 1MCPH 2EDYA 4LPTA 5LWYH 3QO0A 4XX1G 3RWFB 1QUNA 3ISWA 4HS3B 2DBLH 4IRJC 2X4SB 3QUXB 5DJ8B 2DD8H 4NHCH 1U95B 2VQ1B 4OQTH 2QQNL 3NPSC 4RAVA 4K3JL 5CBEB 3TT3L 3K1KC 5DFVC 1AY1H 5E2VL 4DGVH 3QJHA 3QXWA 1TITA 1Z5LA 3PHQB 4PY7A 1X5HA 4FQXC 3IDYC 3PP3H 4RFEA 2W0LA 5C07B 4OM0L 1RIVL 3WLWC 1XGQA 4J2XA 2DQEL 5F6IC 1FYTD 3IYLW 4OSUH 1IAOB 2Z91A 5EBMB 3WFBL 1J0JA 5DLML 1YJDL 4KDVA 3LOWA 5JPNB 3QQ9C 4J8RB 5ENWA 3ULUH 2V9RA 2H41A 4JRYB 3O81A 1TCRB 3IAPA 3T0VA 4PY8J 4RX4A 5HBBA 1TTFA 5D6CB 2E3VA 4JZJC 3VFWB 3GRWA 3EO0B 4K55A 3U46B 3CCHB 2VQTA 8FABA 4K8RH 4M7JH 1TZHA 1DL7L 4LSUH 3D48R 4NP4L 3S34H 2BMKB 4RX4D 2PN5A 4M6MH 3EFDH 3TH3T 5HHOD 5KTEL 1X4XA 1PKQB 5L88H 3E2HB 1EO8H 3TBTA 5C09B 3MA7A 1HWHB 5K9OA 1JPGB 5IFJA 4A6YH 25C8H 2PXYD 2P8LB 5GS1B 5JPNA 3HCVA 1L0QA 15C8H 1KNOA 8CGTA 2IGFH 5GGVY 5HDBF 1NGYA 3OKKA 4MMXC 4R90L 1IAIH 2AJZB 3LEYL 1BD2A 3VDBA 2J7LA 3G6JA 4KHTH 4G9FD 3QO0B 5FOJA 1IL1A 4NPYA 1U9KA 3RTQC 3LKNA 2AEPL 5SV3A 5DRZB 4G6JH 3F5WB 2R0WH 3QDAA 1T7WA 4KXZI 1EFXD 2ZCHH 3QCVL 3PL6B 2FECL 1BFVH 1E0OB 2QADB 3CFBA 2XTJC 3IFNH 4BH7B 1LE5B 1OAYH 3S3PA 4R7NB 1WSST 2AK4E 4MSWB 2BDNL 1DQQA 1T1XA 3WJLA 2I5YH 4HPOL 4JR9L 4IJ3B 2VAJA 3PHOA 3OKYA 2HJFB 5EBWA 3HKFA 2F53B 1PY9A 1HQRB 3DURA 5T1LB 3MNVA 4QTIL 2D9CA 4CGTA 5DC9B 3CZFB 3F12B 4YZFE 4MQ7B 1T2QH 5J6GA 2FX8H 5F96L 3B9KB 3C5JA 4NN5C 2FEDD 4QXGH 5DUBA 3OGOE 4JN2B 1TQBB 3QNXA 1A7OH 3VI4E 1JFQH 1J86A 2HYMA 1H8SA 1G7PB 4G8EB 3U7YL 5D1ZC 1JGEB 4EN3B 1MJUH 4FXGA 2Z4QA 4L5FH 1QEWB 5T3ZD 2Q3ZA 4R9HA 3VRJA 2P43B 3R06A 3IDNA 5MEND 5DD1L 3ARRA 4JHWL 1FV1B 4PRBA 1P5UA 3L7FA 4L3EA 5DRXB 1YEIL 4ZMAT 4G8IA 2NY0B 1BOGA 2D0FA 5HHOA 3ARQA 5GGRY 4XCNB 5CJXA 1T0NB 3DRTA 1ULVA 5IJVB 2CKBA 3NCMA 3QFDA 4F7TB 3QG7L 4YHNA 4NSKB 5TQ2H 3BEWA 4Q6IB 5D6DC 2HFTA 2VLKE 1GAFH 3U0PB 4M62H 4GMTH 1HZHL 3VWKA 2FJGB 4GLRI 3BZFA 1I9JL 1MJ7H 3PWLA 5EOTB 5CSZB 2BNQB 4UV4L 4UU9A 1MNUL 4P3WA 4PB0L 4ZNEE 2FGZA 2BSED 3B5TA 4HCRH 4R3SB 4XPAL 1J8HD 4IIQB 1NLDL 2XRAH 3QWQB 1MFCH 3GSQA 4PG9A 3D87B 1OAUL 5DK3A 3MV9B 4NN7C 4MHHG 1N6UA 4JY5H 5HHXL 5T1DH 4XNUH 2FLBT 2HKFH 4MJIB 1CD1A 3LEYH 4Q58C 2F5AL 2FEDC 5HYSG 3IDMB 4DAGL 2DLFH 5I8CA 3O9WD 4PJCF 3L7EB 4IBLT 5FYLL 4XXCC 1P7QB 4YHYB 4ZNCD 1AIFA 3CK0H 1QRNA 3WV0A 3MRRA 1MLBB 4G6KL 3RNQB 4C58B 5F7LB 1SEBA 1PFCA 1MJ7L 4NZTH 4NQUA 1ZVSA 5IQ7H 4HPOH 5E8OA 4OZFH 2D2OA 4XBPB 5CUSH 4E0RB 1KTRL 1LEIB 3HS0B 2IJ0C 2EXYD 4KJQC 3WNOA 3RX5A 2KPNA 4OD1L 4DGYH 4JM2D 1C5BH 2D7MA 3RDTC 5EC2B 2PW1B 3UJIH 5BRZA 1I1AB 4XVSL 3IDXL 5J1SC 3ZE2E 3QT2A 4R4ND 4X9HA 2HFEB 3RU8L 1AQDA 1NJ9B 3UXFA 3K81A 1D6VL 1X3DA 3GUTB 1T4KA 4HH9A 5AUMA 4W4OC 1TCRA 3C2SA 1DEDA 3U9PL 4ELMF 3UTSE 1PDKA 5FO8A 2GCYA 2HFGH 2NYYC 4HIXL 1PBYA 2WBJC 1KGCD 4EIZC 5F88A 5I0ZA 3BD3A 4WWKC 1BQHA 2NY3D 1NDMA 1I7UA 1A7OL 1CDHA 4ISVA 4CVXB 1K4CA 4NKIH 5ESVB 3CPLA 3ARPA 8FABB 1LO4L 1TMCB 3JWDL 3ES6B 2DTML 4NRYA 1CL7I 5KVDH 1RZ7H 2UZIL 5HGHB 5BOPA 1CLZH 4JB9H 4JHWH 4QRPE 3Q0HA 2G75B 4WW2A 4ODXA 3SJVA 1H5BC 1XIWC 3DX6B 2NNAB 3P4OA 1PVHA 4NJAL 1VACB 3OR6B 1KEML 2Z31B 3NIGF 1AH1A 4JFXA 3P4MA 1UA6H 5K59F 4KQ4L 2VDKL 1PSKL 3KPLA 5EORL 2R29H 4PJ8D 1KJ3L 3WCYA 3PWNB 2G60H 3BOVA 1P7HL 5SX4I 1LK3L 4F80A 5KVGH 1CDCA 3VDAA 1SEBB 1QRNB 4AJ0A 2IANE 3MCKB 3RDTA 4OI8A 4TNVF 4GSDH 1JGDA 2H9GB 3BPOB 3RP1A 4O58H 2B4CL 1DBJH 2NY4B 2J8UF 4XC1H 4XPBL 1AGCB 2EXYC 5KS9B 3RAJL 5GPRA 3REVB 1DFBL 3RDTD 4HIEB 4ETQB 4M4RA 3DSNA 3NIFE 5HHMD 1QACA 1DLFH 2AEPH 3OBAA 2OTWB 1JJUA 2EYRB 3OKNB 4OLUH 3VD5A 4OGYH 4P46B 1RU9L 1N7MH 4UU9B 1W8NA 5D7IA 4CADA 2IPKB 4NQSB 5E1HB 3CFCH 2CSPA 3FB5B 3NIDE 5HJ3B 1S9KC 2EE2A 1JNLL 3ZE0E 5E6IC 4LLUB 1IAKA 1FG2B 4HUVA 1Z3GH 4Z7WB 2YUZA 1OAZH 3U4BH 1NDGB 3ARFA 1UXSA 4PR5A 4PUBL 5B22A 5KZCD 4P2QB 4Q9BA 1NMBH 4K9EC 3HNSH 1U93A 5JUEH 4U6HB 1E4XI 4S1RH 4ELKA 3CVHH 2PO6C 2BRQA 3P30L 5FEBA 5C0IA 2CRMA 3RY6A 2VLRE 5JPMB 5ESAB 1IGFH 2FHCA 1JL8A 2BVQB 2Z0BA 3NA9L 1YECH 3C8KA 3QO1B 4PG2A 1MPAH 2AK1H 2EYTA 2XV6B 4N1HB 5E9DE 2P48B 1X6NA 1S9VB 5SWSE 4JG1L 1HCVA 4MDIB 2MHAA 4OBSA 3KS0J 3L3HA 2EDNA 3T2QA 1MVFA 1NCWL 2NX5E 3TA3A 1W72B 5D7LB 2GJ6D 1DBAL 3JZ7A 3ET9F 4HUXA 3Q6FB 5TDPB 4YXHL 2EE6A 4WHYG 4Y19A 4XNMB 4MMZC 4XNXH 3FFCB 2F54B 5FF6B 4UIKH 5J6HA 1WBYB 1E6OH 3QULB 4W68A 4LLDA 1G7JA 4XBGB 3ZLQC 5E00A 3UYRL 4GG6A 2AV1A 2WWMC 4GBXC 2WWKO 4XPHH 3D25A 4YUEL 1ORQB 1IMHC 3H7LA 1QYGH 2VZ3A 4X6CE 4P9MH 2H26B 2ICWB 3MJ7A 1CGSH 5DHXB 1MOEA 3BO8A 1JUFB 2ITDB 1HSBA 3OL2A 4LKXB 1WT5C 5D7KE 3F65A 5B4MC 5CEZL 1P1ZB 1WWWX 2AERT 4HUUA 2G9HB 3Q3GB 4PJHE 3H3PL 2JELH 3T4AA 1P4BH 3EYQD 1G1YA 4QRUA 2Y6SC 5JTWA 4LEOA 4ZXBD 2GJ6A 1U8KB 3MJ8B 3K0WA 3C60C 4HGWA 3PWNA 4NKMA 1PYWB 1GOFA 3RKDC 3BMWA 2QTEA 3O3AA 4YIQA 3C6LD 3DV4A 2MCPL 5DI8B 5DJYB 3UBXI 1S7SB 2Y07H 4WO4C 3X12B 1OB1B 1FIGH 2CIKA 4N90E 5SWZD 4ONHB 4WW2B 5J13C 3PIQB 1N8ZA 3SPVA 4J3WA 3VFMB 4QEGA 2FYYB 2VKXA 4ORGA 5DEZA 2DWDA 4OF6A 4U1GC 2I26N 4X98B 2VO5A 4HWBA 2VAAA 3ZKMD 1AD9B 5F7WC 1UFUA 1T5WB 3F7PC 4IOIA 3VA2C 1TZIA 4OF3A 3WLBB 4C55A 2P7TB 4ZUWB 5GGUA 3BH9A 2WW8A 4PJFB 2AJZA 2CMRL 5L2KB 4BFEA 4QHLB 4RMRA 4PP2B 1TNMA 4CVXA 2I07A 4FQLL 4WFED 2VDQL 2C9AA 2ATKB 3RQ3A 1A1OB 4MD0B 3MRMB 1JMZA 1C16B 3FB7B 3MRNA 3O4LB 4M6OH 2M1KA 3MLZH 4YC2B 3ULUF 3QDMA 1FN4A 3K1DA 1LO2H 3MO1A 1U41A 1IGFL 3CJJA 5E95B 4GRMA 5GISL 3QIBB 3PQYB 4BQ9A 2A83B 3T8XB 3MRKB 2Q1EA 1T1ZB 4UDUA 4XI5D 4RISH 1A0QH 1ED3A 1ZK9A 2AXGB 2R0LH 4XH2A 1RD6A 4GRWF 2Q3AA 4HGMA 3BZDA 2DN7A 4GKZB 3FT2B 1OY3B 4WCYL 1XGYL 2HLAB 2WUBL 3IFLH 3X3GH 1B4JH 1VEMA