3JWOH

Structure of hiv-1 gp120 with gp41-interactive region: layered architecture and basis of conformational mobility
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
220
structure length
220
Chain Sequence
EVQLVQSGAEVKKPGATVKISCKASGYTFSDFYMYWVRQAPGKGLEWMGLIDPEDADTMYAEKFRGRVTITADTSTDTGYLELSSLRSEDTAVYYCAADPWELNAFNVWGQGTLVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 GP120 ENVELOPE GLYCOPROTEIN
publication title Structure of HIV-1 gp120 with gp41-interactive region reveals layered envelope architecture and basis of conformational mobility.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein
total genus 29
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2009-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jwoH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jwoH01
4NP4L 4E41E 4HGWB 5AG9A 2FGZA 4CJ1A 2N56A 4LSSL 4Z0XB 3P4OB 1QLEH 5FYKU 1I1YA 2G75A 4HKBA 2FWOA 4O9HL 1Q0XH 2BHYA 2DN7A 4Y5YA 2AK4A 5KJRH 2WQ8A 3QXDA 4YEEA 3JV6A 3BE1L 2AJVL 3PWJB 1G84A 4BK4A 5IW6A 4HWEH 3D85B 1WF5A 4Z78A 5JLZB 3C6LD 3HAEG 4UOW1 2J8UA 5HDLA 3JTTA 5LGJB 5I1AA 1BM3L 4NQXB 4ODHL 5IJKC 5TDNA 3WUWA 1N7MH 1YEEL 3MRHB 2OSLB 3WO3B 1YYLL 1JGEB 4LLAA 2AJZB 2DQDH 4PJEA 1WZLA 5D1QD 1AGFA 4N0YH 2WWMD 3BJ91 4H5SB 1AGEA 3C5SB 5JUEL 2VKWA 3GM8A 1MCOL 4TVPL 3MBXH 3OBAA 4HIXH 4BQ8A 1Q1JL 3QQ4A 1SBSH 3MLXL 3IF1A 2P4AB 3NTCL 4OCMC 5CCKH 3KNBB 3LRHA 4M7LH 1JPFA 4TPRL 2AXFA 5F72S 3MLZH 3QCVH 2VB5A 2DQIH 2Z8VC 35C8L 2JB6B 2FB4H 2A2QT 1TCRB 2NY1C 3C09B 4YHYC 1MCDA 4OZ4A 2GIYA 1FVDA 2EDFA 5CGYD 3ARYA 1BPVA 1QSEB 4YDIL 3EOYG 4Z7VE 1ZT1A 4HULB 3T04D 3PL6A 1TDQA 2DL9A 3AROA 4G6FB 4G7VH 3SOBH 5J9PB 1FCCA 1IC4H 1UCBH 2YRLA 3HE7D 3K80A 4NHCH 1IT9L 1FNSH 3HNTH 1ZVYA 1T2XA 3BPNC 3MZGB 5GGQH 5CMAA 1DBKL 3KPQB 5EN2B 4OF8A 2A6KB 5ETUA 1P2CA 4JGUA 4I0KA 1YJDC 2GITB 4DUXA 3ELAT 1G7MB 5BOZG 1VFAB 2ZUQC 3EJZD 5FHAH 1MI5A 2O5ZH 3T09A 2R2HA 4M00A 4WTXA 1FZKB 3GSOB 5C6PB 1OLLA 4K94C 3WNMA 3QUZC 3KPNA 1E28B 5FXCH 5BCAA 3W2DH 4KUCD 1P9MA 4JPVL 4P57B 3HZKB 4DOHE 1GGUA 2A6JA 1FNFA 1FYTB 4XRCB 2NY2B 3ZDZE 1BAFH 4P5KA 3O4OB 5DJDB 1Y18A 2XQYK 4XMPH 1BIIB 4U6YA 4X99B 2YZ8A 1Y0LA 3QIWA 1XEDA 5D2NC 3CSPA 2OR9H 5J11C 4BYHA 5DI8A 3CFCH 2UY6A 5KSUA 4UQ2A 5L88H 2BNRD 3P4MA 1R3HA 1FVCB 3IETA 4NKOB 3UTSB 3B2UC 1ZGLP 4TTGA 4NO0A 1LMKA 3VFWA 1VPOL 3QHFL 1FLRL 1H15B 5EFIA 3T0EA 3QEHA 1TVBB 2VLRA 3B6SA 1OSZB 4RX4D 3DUUB 4CVXB 1HSAA 5CLTA 1UH4A 1T3FA 1G0XA 5HGGS 3TN0A 4C83B 5GS2H 4MJ5A 4XP9L 2VLMD 4XCEB 3K4ZA 4GQ9L 1HI6B 4X5WB 4RZCB 3SCMC 2OL3A 1FFOA 4JGJA 3NGBC 4ZPTA 3IJSB 1GRWA 2Q6WB 3V4PL 3O3BA 4JRXD 5ESQB 3ARTA 1HEZA 2E7MA 4R96A 3VFNB 1MVFA 3U1SH 4PJHE 4LOUC 3OKDB 3UJJL 2IFFL 1IVLA 4XNYH 3DBXB 3KAAA 4I0CC 1EHLH 5HVFB 2OK0H 4ZFZA 2J3SA 4JHAL 7FABH 4QTHB 15C8L 3BPOC 2WMPA 4U1GC 5K9OA 1F45A 1TQBC 1T04A 4OQ1A 1VEMA 3BESR 5E2WL 1FHGA 3X11A 3OKKA 4P3WA 5ACLA 4KK8C 4OZGA 1T1WB 3P9MB 2W0LA 3A0OA 2ZUXA 5I76A 2FHFA 2F74B 4RDQF 1VEPA 3V0WH 2VL5B 4F80A 3N06B 2Z31A 1A1MB 3MR9A 1ZOXA 4OLZH 5E00B 3VD5A 4ZQKA 1AR1D 3RA7H 3EOAA 4XWGL 3I02B 3QDAA 2B39A 2VIRB 2R0LH 2EIZB 2NYYC 1IGIL 3BKJL 1P84K 4G6KH 1K4CB 1KB5B 1XIWB 3O2DA 3TCLA 1P53A 3HPLA 1MWAB 2X4SA 2MHAB 4L5FH 2XZAH 1VEOA 2VDPH 1AKJB 3OSKA 4HPYL 1BZ9B 1U8MA 2VN7A 4JDZB 1A7OL 3MRCB 1UH2A 3MRLB 1LEKA 3KR3H 4ZFOA 5IT2H 5LVEA 3HUJA 1MFBL 1N5AA 4OKVB 4AT6B 2H41A 2K1MA 3C6SB 4J4PA 5CJQL 2VXSL 3T3MF 3PIQA 4GQPH 4RFEB 1H3VA 1WAAF 4PD4K 3OF6A 4Y4FB 5SWZE 4YK4B 2ICWI 4QXGL 3QEGH 3BEWA 2DD8L 1HSBB 3H7BB 2HFGH 5C3LD 3NACH 1DQQA 4WV1C 3VFSB 4TOYH 4P2QE 3VG0L 3C08H 2AJXL 5D7IE 1HK6A 3MXVL 3MNZB 5INCA 2OJEB 1XGQA 3EO1A 3T3ME 4JDVB 4WI7A 4OBSA 3T3PF 4ZS7H 3D85D 2A73B 1I3VA 3PHOA 1TVDA 4NQVA 2BSSB 4JG1L 4F7PB 5DEGB 2V6HA 1A7NH 1CQYA 1NBYA 5C9JB 3C9NA 4E41A 1I7RB 3IAQA 5CZKA 1J8HE 5HD8C 1JZ7A 2Q86A 1S7RB 1B0GB 2AS5M 4BH8B 1FNLA 3T3PE 2AJUL 1Y6NR 4PGDA 1NGPH 3G5XA 5C07E 1I1AB 2WK2A 3NN8A 3G6DH 2L7UA 1Z9SA 5HGAB 1UVQA 1SJHA 1ZA3A 5FFLA 3H3PL 4IOIB 3PV7A 4RQQB 5FO7B 4GW5B 4YNYA 4YIQB 3QI9D 2Y25A 4ZS6D 2XZQL 2GFBA 1G7PB 4R7NA 5LGHL 2XKNB 4GAGL 1FN4A 2CO7B 3LKOA 4XX1E 4U1LB 3KDMA 4DGVH 2DLIA 1LP9F 4PJFE 4U49A 4YLQT 3RL2B 2M2DA 4CVZA 5KTEL 2NY7H 5TDOA 5FK9B 1QSED 4IIQC 5TQ0H 2H8PA 3RBSA 3SDCC 4H1LA 1PZUB 4WUKH 1J1OL 2NLJA 4GS7B 3TNNB 1RSFA 3LEXB 4YHZL 3WS3A 1YPZB 3K0WA 1YNTA 3IU3B 5BVPH 5CHNB 4OZFA 1P4LB 1XF5A 5DRZB 4L3CB 1AXTL 1J0JA 4O4YH 1LK2A 2PO6B 3CDGA 3Q5OA 3IGAA 3P0YL 4Y1AB 1UWXK 3ROLA 4P59H 3K81A 5B22A 3BXNB 2HFFA 4OGAC 1UEMA 3VXQA 1YY8B 3O2DL 2Y1VA 3JUZA 4XCNB 3IDNA 2JJVA 5BVJB 2FJHB 3KYNB 4RMWA 4JHWL 4WEMB 4Z7VA 5MHSE 1LO4H 1AD0B 3CX2A 4OGXL 5EU6B 4R0LC 3RGHA 4N9OB 4W6WB 3WIIH 5FOBA 4AK1A 4OCYL 3DX6B 4FG6D 1KJMB 3FQTA 1FYTD 1P7QA 2NY2D 4H0IA 1EJ6A 3BKMH 1S9XA 3KS0J 2EEDA 1LDPH 4ETQB 4HIHB 3OJDB 1J1XL 1HKLH 1KC5H 3DSFH 1M05A 2E6JA 4IRSA 1GVIA 4NNPL 5H8DA 5I8KL 4MAUL 3RTQB 5AYUL 3OB0K 4KGLA 3UTSD 3T0BA 1IKFH 2BXYA 4U1SB 2R69H 4M4RA 2Z4QA 4FFWC 5F1IB 4K2UH 1J05B 4DZ8B 1MHEB 3U2SA 5FUZL 1G0YR 1SMOA 3MOQA 2EECA 4ZYKA 2PTVA 3EZJB 4L4TB 5EDXA 3MJ9H 2BK8A 1RZGB 2P8PA 1A5FL 1OTSD 4G42A 4ZNEE 3JTSB 1KIUA 2J6EL 5EORH 5FO9B 1P4IL 5DEFA 5GSRB 2QADB 1UGNA 5EZJB 3RPIA 1JWSA 1UA6L 3S36L 3CDCA 1EEZB 1U93A 4L8BA 1X3DA 3K2MC 2AERT 4KTDH 3KLAA 4PJDF 5C0CE 4LKXB 4XGZA 5CINL 5EU4A 1EX0A 5ICXB 3ZDXE 1KB9K 5JQHC 3LPFA 3DV6B 1HQRA 4L3EE 4PJHA 2E7HA 4Q58C 4QXUH 4KRLB 5DK3A 3WFEL 3F7YA 4BFIA 2C7UA 3D0VB 3MTRA 4K23L 4I77H 2GQHA 3BT2H 4GMSH 5KBNC 4XNUH 3V4UL 4F2MA 3QQ3A 4WW2B 4YEFA 4YO0A 1VGEH 3L3IB 1AKJD 5F7FA 4EN3C 1IRAY 4P5TC 1YUHA 5INDA 3LKQA 3WFBL 1I1YB 1INDH 1U92B 2CKBH 4HKBB 5J4MA 1E4XI 5BRZE 2BRRH 2AK4B 4YHLH 4ZFGL 3VD3A 3JV6B 4YBQD 5EIVA 4GUPB 3RKDD 3DSNA 1O0VA 2V5YA 2VDKL 3HZYA 5GGSY 4JN2A 1OGAB 3VXME 3GIVA 2XOTA 1OAUH 3P30H 1JHLH 3GSUA 3BP5A 2VZUA 2D31A 4Y4FD 3WIFA 1A6VL 4O2FA 3FFCE 3MUY1 5I1AB 1NC4B 3MJGX 4DQOL 3VFMB 4HUVA 1U8HB 4EIZC 5KVGL 4QHLA 5GRUL 4YFDB 3WUWB 2R29H 2ZOKA 3BJLA 5E6IA 3VWKA 1JHTA 3RP1A 4GG6B 2LTQC 4UOW0 3S37L 1UB6B 3H9HB 5JOPD 4JFPB 1OB1B 4O02H 3MCLH 4RWYH 4LVOC 1RUKL 5C7XH 3MA7A 4KKLD 4QRRB 3L7FA 3OAYH 1FNEB 5D2NB 4M5YH 5EA0L 4XBEL 3QULA 5K59E 5SWZA 4PJ9A 3FT4A 2YBRA 4YHIB 4N1HB 5DXWA 4UIMB 1S7WA 1JPFB 5HHPA 4CAGA 1FGVH 1XCQA 4P2QA 3Q6GL 1HWGB 4JFZH 5D7IA 1I1AD 1FVDB 3C5ZB 2ZCHL 3PWPE 2ZJSH 2Y72A 5KZCB 1FL5A 1EVUA 4UV4H 5HHME 4X6BB 1R3LA 5H2BA 1P7KB 5CMAB 4UINH 5IESL 3SCMB 2H32B 1PX3A 5EH1A 1P2CB 4U6XB 1J8HA 1GL4B 1DBBH 2X4OB 1FZJA 3LIZL 3LB6D 3MACL 5IVXE 4HFUL 3U7YH 2NY4B 3BPCA 1TIUA 3GIZH 2R2HB 5I1LA 1OT1A 4ENED 5AWNH 4YE4L 5I75C 4DAGL 4JY5H 2DQHL 3W39B 3JXAA 1OAYH 1G9NC 4FXGB 1NGWA 1SM3H 1S9KC 1IEAB 3RWJB 5HXMA 5FYJU 2DL2A 2PO6D 4JO1L 5DJAA 5C6TH 3TESA 1MF2H 1L4IA 4FFVD 3GSQA 4UDUA 5MEQA 1A6AB 3N50A 1KJ2A 3QG6A 1Y18B 2VTFA 4OGYL 3GMLA 4U6YB 1T0NA 4Z7WF 4OLUL 4ONHB 4PJFA 3JV5A 3Q3GA 3DGCR 4BKLB 4XVUD 5DFVC 1RJZA 4OCXL 1B4JL 1HNGA 5DVNA 5KSUB 3P4MB 3IETB 3JVGA 2EDRA 1OTUD 1DSFH 1OAZH 2GUOB 5EU6D 3CSYA 2DLGA 4UOJA 1HN1A 1XGTA 4EUPA 2VOTA 5EFIB 4F57L 1K85A 2PYEE 1T21B 3TJEH 4TSCL 3B6SB 4J2XA 4NN7B 1TITA 3O8XD 1LE5B 3DYOA 2WIIB 1MHPH 5D93C 1QFUL 5C0RH 3TA3B 1X4XA 1FZOA 4ODUA 4MJ5B 4TUOA 3JWDL 1YEIH 5JIIA 3ESVF 3RTQD 2QR0B 3SGDH 4ZPTB 4HUNB 2FECL 3KPOA 1UACH 4M1CC 3WEXB 2QHRH 4TVPD 4I3SH 4JR9H 1QQDB 3QUXC 1DBAH 4XB8A 1T5XA 4A2MA 5IFAH 4UT7L 1ROWA 2PXYA 1NEZG 2RJMA 4PV9B 4FQCL 3NCYP 3MUHL 2VXVH 4L4TD 5F9WC 4FQ2L 4JCLA 1A3LL 3THMH 3JZ7A 1EO5A 4OZIF 5DMIH 2J5LC 1A64A 2I9LA 4I9WD 4OZGB 3LAFA 4Z95L 4O2CA 4K3EL 4PB9H 1DVFC 3MRNB 4RMRA 1AHWC 1T03L 1HYSD 2FD6H 1Q9OA 2EDWA 2KQMA 4G6AD 1S9YA 2QADD 2Z31B 3CAFA 4HKXA 4OM1L 1KFAH 3MR9B 4ZQKB 2FZ3A 3EOAB 5HHQA 1IM9A 5DHVA 1GOHA 4ZFFB 2KH2B 5GIRB 1REIA 4XP5L 2OXHA 1UJ3C 3TCLB 1QFPA 2HN7B 2GW5A 4HUXA 5DTFA 1NH6A 4ZNEA 2XY2A 5DRWA 4L4JA 1U8MB 2CDEA 4WTZG 2BOCA 4NN6C 4P2OC 3P11H 3UYRH 3QG7L 5IMMA 4GSDH 2CRZA 1J5OL 1DN0B 1G6RH 1JTPA 5HDBE 1CXFA 5C0CA 1EO8L 2NY1D 3MCG1 2BVOA 3PIQB 4YHMH 5FYLE 1YN6A 1JUFA 4R26L 5K93A 1KJ2L 4KQ3L 3SQOL 3CXDH 2X1PA 1KT2B 1EGJA 3MFFA 3KS0H 4ZXBC 4P3CH 4NJ9H 5GRJH 5DLML 2AK4D 4L3EA 5AD0A 1JZ8A 5JXED 3CFKA 4KDTA 1XGQB 3EO1B 4E42B 2E9JA 1OGAD 1CGVA 2Y5TA 4YPJA 1TTGA 3MUJA 3DUSB 2YN5A 3V4VL 3LEVH 4GRWE 2RCSH 4WFFD 5JO5B 4NO2B 5CSBA 1NC4D 4UTBL 4D0BB 5I1CH 5D4QA 2QL1A 4LHJB 2IEPA 1WEJH 1DL7L 2HLAB 2MFNA 2Q86B 2FIKA 4DKAA 4G9FB 3FZUC 3V95A 4HUWB 1I9RH 3HFML 3VGDA 4N0CD 1MJ7H 3MV8A 4PGDB 3NCFB 4O2EA 3IFLL 2CQVA 3G5XB 3UZVB 3D9AH 2KBGA 4XXCC 1UVQB 3VXMA 1SJHB 2NY5C 4HJJL 4JN1H 4QRRD 5CP3H 4G6JL 4YNYB 2GFBB 4Y16B 2HWZH 3B2UD 4R7NB 2X89D 3BQUB 3T77A 1XR8B 5GS1A 1E0OB 1T2QL 1OPGH 3TVMC 3DECA 5EOQH 4DGIL 3C5ZD 2XRAL 1PLGL 4Q6IB 1NFIA 1NEUA 3QFDA 2H8PB 3DXAD 4NO5B 1DCLA 5KZCD 3BRFA 1KTDA 4JFDA 5HDQH 3QZWB 5GJTH 4OD3H 3WS3B 4JKPH 2I25N 3ZT7A 1XF5B 1C7TA 2CDFB 3SCMD 4Y4HB 2EE2A 1LK2B 3CDGB 4AM0A 3IGAB 5D7JA 4OF7A 3TZVB 5KSBF 1T7YA 4CNIB 3VXQB 1NSNH 2NY4D 4MXWH 3IDNB 4PRAA 5T1KA 2VLKB 3EUUA 3F6LA 2VDNH 3FB7B 4XH2B 4BFEA 2W65A 3I6GB 2B1AL 1JNNH 5FGCB 4LBEA 3PWPA 4ISVA 3EO0B 4QY8A 2AJ3A 5CKAA 4HCRA 2J88H 2R1XB 4KKBC 1CFVL 2EH8H 2ZUTA 4X6CE 4K55A 2A9NH 3REVB 1WZKA 2ITDB 4ODSL 4CMMA 2ZCKH 5SWQA 1S8DA 1X7QB 3R8BB 1XR9A 3D2UA 1NBVH 4XTRC 3IKKA 5IVXA 3FQXB 1RZFH 1IAOA 1HOCA 2C9AA 4IRSB 3KG5A 5DJZB 3ZTNH 5HHNA 1QBAA 5I0ZA 4J7RA 1IGCH 4OJFH 4ODTL 2NYYD 2BERA 3LN4A 1U3YA 4G9DA 2QSTA 1I7TA 3DURA 3O2VH 3QAZC 4ZMAT 6FABH 4HWZA 4K3HA 3CZFA 5KAQG 3OKOA 4EN3B 5DMGC 4P5TB 2EE6A 3SE3A 1A6ZA 1BBDL 3KYMA 2FLBT 5GGVH 2W92A 4GKNB 4NZRL 4ZYKB 4DN4H 3TA3D 4HXAH 2EXYC 4QRPE 3MRBA 1HHGA 3UBXI 3VFPA 3W9EA 3OTTA 2X9XA 3D0LA 4L8SC 4LQFH 5D9SA 1TJHL 2ZKHL 3L5IA 2Y9RT 3MLYH 5ACMA 1I9EA 1XF4A 3MA9H 1ZLWH 1IFHH 5LJYH 3H3BC 3T4YB 1JWUA 3ZTJH 4Z7WA 1I8LA 2PYEA 4UIKH 2Q3ZA 3MBEC 5IROC 2OJZH 3EZ8A 3KLAB 3HKFA 5IHUL 4OSUL 1OQXA 4JO2H 1MQKH 4YBLB 3RWHB 3QDME 4NWTL 2IH1A 3U46A 5EU4B 1ACZA 5C0BE 43CAA 2F19L 3FB8A 5T33H 4FQLH 4WWID 4G5ZL 4U1MB 4LDOB 4KTYA 4AQ1B 4FQHA 5C2UB 5JW4N 3B5GA 5IQ7H 5SV3A 1MCJA 5ISZE 4LRIC 2BY0A 1U3ZA 5GS0C 3MRFA 3FN0H 4OZHE 3UPRA 5HD8D 4K9EH 5BW7A 4LSRH 3F7YB 3BD5A 3GFUA 4NBXB 1K4DA 1KXTB 3GI8H 2BMKB 2P7TB 2BY2A 1UM5L 2ZSVA 2VH5L 3KYOA 3WNLA 4F2MB 3QQ3B 2E27L 3L3KB 4WW1A 2BDNH 4IS6A 3B9AA 4OLWL 4YO0B 5D5ME 3T4AA 3IJHA 1RZKL 4G8FB 5CWSB 1YUHB 3BI9X 1IAKB 1YEKH 1OP3H 4PJIE 3LKQB 1OW0A 3DARA 3UZEA 1YEDA 2DQTH 3EO9L 3HNVH 1MFAH 1YYML 4H20L 2CIKB 4HCRL 5H37G 4OZIA 1I85A 4HH9A 3GIVB 3HC3L 2BVTA 4HLZG 3GSRB 4J4PD 1OSPL 3BP5B 1GHFH 1U2HA 3MLTA 3WIFB 4O2FB 4JRWA 5DZOA 5TF1L 3SDCD 3ME0A 4HUVB 1OM3H 1MHCA 1PEWA 2JELL 2Y6SC 1HDMB 4F7CA 4P9HH 3MJ7A 3R1GL 1KACB 4TNWK 3NPSC 1JHTB 5BOPA 2HVJA 3NCYS 3WS6C 2P5WE 1NMAL 1C5BH 1J0IA 3GJFA 4F9LC 5IJKA 3VE0A 3BN3B 4N9GA 2B4CH 2GAZA 4XCFL 4JZJC 4XMLH 3U6RB 1JRHH 5SWZB 4PJ9B 4S1RL 4M48H 1S7WB 5HHPB 2Y06H 1CICC 1YEFL 2GJZB 4G9FD 4HK0A 3CFIC 4Y4KB 3TFKC 1UFUA 4M6ML 4WCYL 3TNMA 1XCQB 4LSTL 4M1GH 5JW4M 1P1ZB 3H9SE 1QEWB 1OOAA 3U0PA 2XWBB 3NCEB 2ORBH 5MEND 4XP1L 2C1PA 1F6LL 5IVZA 5DRNA 1K9TA 2XI9A 2GJ6B 3MRDA 3WLBA 4Y16D 1NLBL 3B9KC 3WXWL 2H2SD 4KI5E 3BQUD 1A3RL 1X5GA 3DMMC 4FFWD 1T6VN 1FZJB 5C71A 2L4OA 1A4JB 3S96A 2Y36H 5DQ9B 1ITBB 1CR9L 1D6VH 1GC1L 5EWIH 4ORZC 2JIXB 1M7DB 5IHZB 3QPXH 5CJXA 4JREB 3QDJE 3WFHA 2AGJH 4XI5C 5I18L 2ADJA 4XPFH 3BN9C 4TSAL 1FC1A 3WKMH 1LO5A 1MRFH 4Y4HD 5ADPH 3PQYD 3D6GA 5JNYA 3QUZA 3UPCA 1U8NA 1DVFB 3GSQB 3TZVD 3VA2C 1KJ2B 3QG6B 3L3HA 3QFJE 3GRWH 4P9ML 1T0NB 4QRUB 5BXFB 3OAUL 3QWOA 2DKSA 2VLKD 2ZPKH 3FT2A 4LVHC 4Y2DA 1RJZB 4PY8J 1IAII 1GZPA 2EDOA 5EBWB 1PFCA 4L8DB 5HI5C 4OLYH 2B7DT 4Q9BA 1OAQL 4RRPG 5C70A 1U8LB 5EOCL 2R8SL 3G08A 4EUPB 3VXSB 3IDXH 3J7HA 1EERB 1AGBA 3MX0A 1LP9B 3STZA 4R90H 2EO9A 4BSVB 4PLJD 1LO3L 1U8PA 3EYQD 3CC5A 5EBGA 1B2WH 1MCWM 1LK3L 4IRSD 3HC0B 4JVPA 1FZOB 5I15H 2W38A 4U6VL 4P4KB 4ZD3L 4X9FA 2YPKA 3RNQB 1HWHB 3BD4A 1HHHA 1HIMH 1XAUA 1I7UA 1VDGA 3KPOB 1EMTH 3ULSA 1EH9A 1JGUH 3UMTA 1UM6H 1XGUB 3ZT5A 1NMCB 4O51B 2F53E 4X6CA 5E1HB 1TJIH 4EN3D 5BV7L 1T5XB 4P5TD 1WSST 4X7DC 4PJ5E 4QRQA 4J3OC 4YHNA 3OAYK 5FYKE 1WWWX 1FIGL 5BQ7A 4PUBL 5KN5A 2QQKL 5B4MD 4HUKB 3HMXA 3GSXA 3UTOA 5GZOC 4K7FA 3DX9A 2QBWA 2R9HD 2I9LB 2XG5A 2X4RB 2AJSH 5CP7A 4HWUA 2R56L 4MYWB 4UV7H 3UYPA 4X4YB 1Q9OB 1S9YB 1KN2L 1Z9OA 1UADC 5LWYL 2IJ0C 4YQXH 2FZ3B 5L8KB 3OR6B 1MCEA 1RVFL 4IRJC 5E7BA 3UC0H 1F3JB 4NZUL 5ILTL 5I74C 1KEML 1HZHH 4OD1H 1HHKB 2ARJB 5I1JH 1KIPB 3BP4A 3S34H 3N85L 4QRPA 1WLHA 4PB0L 3R0MA 5GGRA 3TBSB 5KW9L 4MXVF 1ZANH 5LQBH 2P24B 2Y7QA 3IDJA 3TT3L 5FO8A 3IFOB 2AKRB 4F7MA 4K3GA 1RUAL 4V1DE 3I6KB 3TBWA 4KVNH 4JM4L 5L6YL 2HFEA 1QR1B 3WDIA 4PGCB 2YC1A 4CVUA 2VRAA 1AQKH 1GGYA 4Y5XC 4R97C 3QDMA 4YHPB 3WUWG 4N5EC 5C0BA 5CJOL 2XA8H 1R3IH 4S1SL 4ODXA 1T83C 5DVKA 1IGYB 5C2BL 4BK5A 3CK0H 1B90A 3P9LB 4ERSL 4NPYA 5ISZA 4TSBL 2D9QB 4PJDB 4URTB 2NCMA 4OZHA 2XZCL 5H94A 3U4EA 2BY3A 3VXNA 3NABL 3VXOB 4N8CL 4WV1A 3MLUH 1SMAA 2RB8A 4M6OL 1QNZL 3VI4F 1B88A 4LPYA 2O61A 1JRHI 5AEAA 1EHAA 4XP4L 1ORQB 2IGFL 3S8WA 4KWUA 2WZPD 2MQ0A 1Q94B 2I07B 3STLA 5D5MA 3SE9H 2FBJH 2W9DL 1OAKL 3VWJA 2FIKB 4PJIA 4MMZC 5E2TH 4MLSA 3N1FC 5GRZA 2FX8H 4F33A 1RUPH 3MV8B 4O2EB 4LSPH 2WNGA 2QQNL 4N90D 3PXHA 5F6HJ 3VXMB 1S7VA 1C12B 3VFVB 1FVEA 3E3QE 2J7LA 5IFHH 3QPQC 4OQTH 3H8NA 4G43A 3DVNA 2R39A 5JDSA 1PG7H 1N26A 3DETC 1RUML 2I26N 2CDGB 3ILQC 3GMRA 4LLVB 1KB5H 5IFJA 1TNNA 3T77B 3OPZH 3HMXL 5F1SA 3T2OA 3V7MA 4Y4KD 2XNAB 2AV7A 1GAFH 3HI6L 2CR3A 4D94A 4MMXC 2QHLA 1QRKA 2P5WA 3SGKA 5TE4H 3WFDL 3PHQA 2YOCA 5C92A 4O58H 4JFDB 4YFLI 3CLFL 5KVEL 4Z18A 3V9FA 2GJ6D 3D25A 3FAWA 1NC2B 5HHXL 3FQNA 1FJ1A 5KVFL 1WK0A 4HDIA 3ES6B 4ZSOE 4AEHL 4LGRB 9CGTA 1FORL 3SDDA 4D9QE 4FMFA 4J8RA 3HTLX 3AY4C 4LDLB 5ALBH 3QUXD 4A6YA 3H9SA 4I18C 5T1KB 3HS0B 3MBEB 2JIXD 4LBEB 3BDYH 3FHQA 1U8OB 3X14B 2YPLB 4QY8B 2AJ3B 5HHMB 1NBQA 1V05A 2D4FA 3GMQB 3R06B 4YFEA 2Z8SA 2RFXB 1NANI 5H37H 3AS0A 1G7IA 3NCCB 3ZL4H 1H0DA 4P46A 4HXBL 1DVFD 4HLZH 4LQ1A 1W0VB 3NZ8A 1QLFA 1QACA 3V6BR 1FL3B 1IAOB 1HOCB 4LARH 1OCWH 4XPGH 1YNLH 5GRVL 2J4WH 3HLAB 1G1YA 2E9BA 2X10A 3C60C 5HYIA 1WC7A 3LN4B 3VDCA 4G9DB 3QDJA 4FZEL 2XQBH 5DFWH 5F1NA 3VXSD 5B8CC 3CIQA 4UTAH 3QXTA 2LABA 5MI0B 3I50H 5GHWL 5EC1B 3TO4A 4X7TB 3QFJA 4P2OD 4LVEA 2W0FA 4HGMA 1DLFH 3HI5L 4O00A 4WHTB 4P4KD 4PJBF 4AY0A 3LH2L 1HHGB 3RZCA 1FH5H 5DT1L 1T0MA 3D0LB 2MQCA 5E2JA 5C0ND 3PXJA 4UDTA 2ZZUT 3SBWA 4U3HA 1Z3GL 1AE6L 1XF4B 2BJMH 3IFNH 1E27B 3EIFA 4LU5H 1F6FB 3BAEL 3GDBA 2FL5B 4MA7L 5DUMH 4Z7WB 1T1ZA 2OQJA 2JCCE 4N0UB 2MOVA 2UV3A 1CZ8L 5C0IA 4I2XB 4Y2OA 2VLLA 2VZ1A 3WLWC 4NP4H 3U46B 1YNKL 2JJWA 1IAMA 4LSSH 4OTXL 4YWGL 5DJ0A 1N2RA 1Z0NA 3FB8B 5E99L 1QFHA 4O9HH 5CFHA 2W9LA 4MCYB 4IDLA 5IOPA 3BE1H 2AJVH 4QHMA 2P5EB 4WTWA 2F53A 4XC3L 5CEZE 5F9OL 2VL4A 3H0TA 4PJXE 3BGFB 5HHVL 3UPRB 5K9KB 4PJ5A 3WBDA 2OLDA 4MHHI 3UTQA 3GB7B 1M1SA 1TTUA 5KG9B 1K4DB 1BM3H 4ODHH 4E5XA 4RBPH 3ARZA 3KYOB 5DD5L 3A6BL 4FRWA 5JIHA 1SJXA 3X3FL 4IS6B 1YEEH 2YD8A 3IDMB 3IYLW 4U0RC 3IJHB 2A6IB 4HUUA 1J8KA 1X5JA 4HEME 1INEL 2EKSA 4WIQA 4JVWA 4NKDB 3GSWA 1C5DB 4JFFB 4JPIA 1Z2KA 5D1ZC 3B9KB 2P45B 1BFVL 1MCOH 4TVPH 3N1PC 2MKWA 1UYWL 4OZIB 1F4HA 3ZE1F 1Q1JH 2VDOL 4HH9B 4LNRB 3MLXH 3NTCH 3QH3B 4YAQB 2ED8A 2JJSA 4WU5A 4AZ8A 4TPRH 3FN3A 4OLZL 4UT9L 3ARUA 4M43L 1MHCB 3QEUA 4F7CB 5I8CB 35C8H 2YD6A 1YMHA 3B4NA 3MJ7B 5FGBA 4OIIL 3LD8C 2EIBA 3HCVB 4WEBL 4KRPB 3QA3A 4HIJB 4YDIH 3W0WE 4V1DA 3ARFA 5EIIB 2XN9D 3IJYA 4YGVA 1ED3B 1CLZL 1B9ZA 4MCZA 5E5RB 1IT9H 5BV7B 3H9ZA 1DBKH 2GAZB 1UXWA 4LFHD 2HJKA 3EYOA 1ZHBB 4OFIA 4HIIA 3AREB 4B53A 3RNKB 3QXWA 4KKBD 4UQ3B 4HK0B 1Q72L 1AQDA 4HSQA 3MV8D 2EIDA 4X6DE 3U0PB 3QZWG 5GXBB 1QVOB 1K6QL 5CUSL 5JW5A 1ZLWK 1KJ3H 4JPVH 3N9GL 1F90L 1WZ1L 3OMZA 2IAMC 3MRDB 1JF6A 3G6AA 3WLBB 1E4XL 1F02I 3KXFE 4JCMA 5D1XA 1KIRA 1D5ZB 1Q9LA 4NNYB 1NLDL 1KG0A 1CF8L 3S96B 3FRUA 1VGKA 3KHOA 1R3JA 5DMGD 3QXVA 5CEXB 1ZE3C 3LS4L 3TO2A 2V7HB 3K3QA 4JFDD 1VPOH 3O2WL 4PGEA 3QHFH 1FLRH 1PYWB 4KFZC 2EXYD 5J0BA 1F13A 5F1KC 2R4SL 1NC2D 1PSKL 1F6AA 3V7AE 1LO5B 2E9IA 4PRIE 5JNYB 3S5LA 3BUYB 3UPAA 1MY5A 4KV5E 1TPXC 3O11A 4QOKE 3L3HB 2AV1B 3UJTL 5EIQA 4XP9H 5C6WH 4GQ9H 1FDLL 1MRCL 3MBED 4GBXC 2I60L 4XBGB 1OP3K 3V4PH 2YXFA 3EDDA 1GZPB 3Q5TA 4U1JB 2YPLD 4Z9KB 3VGAB 1R3KA 3QWQB 3S97C 3FTGB 5TFSL 3UJJH 2IFFH 1FRGL 4F58L 2BZDA 3GJEA 4S1QL 2W9EL 5FM5O 1WCBA 3GGWA 4HF5L 1G9EA 1AGBB 4ZSOA 3STZB 1UWGL 4JHAH 5CLWA 15C8H 3ARGB 2PW2B 1U8PB 1IC1A 5E2WH 3R8QA 5JIKA 1BQSA 1WWBX 3UXFA 1ULVA 2DOCA 3OZ9L 4DVBA 3TPUA 2HTKC 4JZNA 4I8DA 5F3HA 4H8WL 4HW6A 3Q5YA 2G9HA 5KSBB 4XWGH 1MFDL 4YDJA 2E7LC 2PW1B 3EFDL 1VFBA 3T2PA 4CN4A 3RUGF 1IGIH 3BKJH 3GSNA 3M17A 4KRMB 3RL1A 1XFPA 5BQ7B 5EO0A 5KN5B 1TZIA 3WL9B 3GSXB 2X4TA 3DX9B 1JFQL 4OI9A 4HPYH 5HYJE 1A7OH 2DICA 3T0VA 2ITCA 3GMPA 3MOAL 4U1KA 1VADB 1OY3B 5AZEL 2FR4A 2LQRA 1MFBH 2ICWB 3VFGL 4PLOB 5HYQB 1FNGA 2AJYL 4JHBA 1MCHA 1JBJA 4JRYE 1V3MA 2VXSH 1AHWA 4RNRB 2H6PA 5F7KC 3RVWC 4QXGH 1J10A 2XKSA 1JGDA 2DD8H 4J1UB 3IU4L 3WDJA 5F9JA 5GGRB 2X44D 1BJ8A 3PGDB 1R5VA 2CH8A 3GO1L 3RWGA 4AEEA 3EYFA 2R2BB 3VG0H 2AJXH 1CE1L 2H26A 3OXRA 3OB8A 4CN6A 3MXVH 2P5ED 4N1EA 4WFED 4HWBL 3TBWB 3U7AA 5J1SC 2JCCA 2YRZA 1K8IB 4JG1H 4HC1A 4RDQG 1RUQL 4K71B 1KCUH 5AYQA 2R0KL 3HZVA 3DHMA 3ULVC 4LLWA 3D39B 3QDMB 4MAYA 4HHAB 3CXHJ 1CGUA 5C0BB 4H26A 4YDKL 2AJUH 4WWKA 3CH1A 5F7UA 4YUEL 2CRIA 2QQQA 4JFFD 5E6ZA 3MZTA 3RVXD 5LAXA 1MUJA 1QRNE 2ATPB 3B9KD 3ILPB 3LZFL 3MRKB 3SJVB 1QOKA 3QXAA 4PJXA 4OZHB 5H94B 3H3PH 3U4EB 3DMMD 4ZXBA 2N7AA 4O5LL 4WI4A 3ARWA 2NTSP 4I18B 2XZQH 4RAVA 3S3SA 5LGHH 3P77A 4GAGH 4KJWD 5GGVY 5DZLA 5T5FH 5HVGB 1U8QA 4OF6A 2P49B 4JFXA 4XI5D 2C4FT 3BN9D 5CS7A 5FM5M 4KRPD 5KTEH 2ADIB 2VISA 4HJGB 2P47B 4GW4B 3B2VL 4QRSB 5D7KD 5FYJE 4F7TB 4Y19D 1J1OH 3VRIA 3S4SA 2APXA 4HZLB 4YHZH 4ODWA 5LXGL 2ZOLA 2R23A 1NCAL 1S7VB 2CLZA 3L3GA 3PP3H 4OCSL 3RWDA 1FVEB 3KPRE 4PJ8A 1H9VA 3HA0A 4XNMA 5DD6B 3REWA 3P0YH 3EJYD 1U95A 3GSNL 3QIUB 3ARED 2F5BL 3LKSB 1YECL 3O2DH 1WWCA 1H5BC 3CFDA 4MJIE 5IQ9A 4NKIL 4GH7B 5B8CB 3D3VE 3GNML 1BQHA 4QHKI 5E4EB 3AB0C 3NFSL 3QB7C 4JHWH 2EH7L 2EYRA 1CLYL 2W91A 2ARWA 4OGXH 2CR6A 4RGNC 4PREA 4OCYH 3FO9A 3PHSA 3RDTB 1EFXA 3KLDA 5EPMB 3TVMA 4XNZB 2HP4A 3PGFL 1FJ1B 3UP1A 1J1XH 3ROOA 2X05A 3FRPA 1VACA 3SDDB 3KYKL 3V6FA 2NXZC 3V5KB 1J12A 3RIFK 4MA3B 4NNPH 5I8KH 4E0RA 4MAUH 5AYUH 4X6DA 1X5FA 3CX5J 5T1LA 5BO1L 4AEIL 3ET9F 5JOFB 5GZOD 5I1HL 3UBXA 1FAKT 5FUZH 3OAZH 4WHCA 1MCIA 1AO7D 1BD2B 4U7SA 4HC1L 4APQC 1KPRB 1H0DB 4P46B 3Q6FA 4JEGB 2ICCA 3KXFA 3U79A 1KCLA 4NUJA 2YHGA 1SBBA 1A5FH 4IRZL 3U0TA 4HIEB 2XQYG 3B8YA 2J6EH 4IRJD 3DROA 1P4IH 2ZNXA 1WC7B 1NL0L 5B3NA 4HWNA 5CEZL 1UA6H 3S36H 5IBTL 3CFBA 2CLRA 4QWWC 3V6ZA 1QFWI 3WJJC 4PRNA 2PTUA 3K1DA 4PRIA 4M8QA 5M94B 2R2CA 2M26A 5GGSA 3ARGD 3U4AA 4ZO8A 4LLMA 4QOKA 3L3DB 3QFJB 3ARDB 4JKMA 3BMVA 4CU6A 4W70A 1ZHNA 5CINH 2HJLB 1BGXL 3WJLC 4PJGF 5IGXL 5E1AA 3PP4L 1U3HB 2HFTA 3CFJB 4DW2L 4LHUB 5B38B 1FFPA 1M71B 1XF3A 4CJ0A 3UCRA 4H1LH 3OXSA 5HGBB 32C2B 4YXLL 1A7BA 4EDXB 3WFEH 4L8SA 2VUYA 3ZZ1A 5C3TA 1BIHA 2OQJB 3MNVA 4K23H 4M9OA 5DJ2A 3WN5C 1N3NB 3V4UH 4MDIA 3P4LA 5DD1L 4D8PB 4W4OC 3RWFA 3IB4A 5EO9A 3PGCA 5IMOA 3WFBH 5ID1B 3EHBC 3JV0A 3ZSTA 1Z9MA 5EUOE 5TDPA 2BNUA 4CW1B 3M45A 4ZFGH 4UBDC 5IOPB 5JHDB 4YFLF 3PWNA 3HZMB 2VDKH 5DYOA 43C9A 1I9JL 5CBAB 2BNQB 4LLUA 3UTQB 5HSFA 1BLNB 1A6VH 1UWEL 2DQGL 1HXMB 1RMFL 4DQOH 4I1NB 4LRIA 1N64L 5I17A 3BGMA 5KVGH 5GRUH 5D8JL 1V3LA 5HYJA 4IJ3C 4QHNB 1E4KA 1AC6A 2FATL 2QQLL 2EKSB 3O0RL 5J06A 4G8IA 3ARBC 1GYAA 3I75A 3S37H 4IBLT 3SDAC 3BO8A 5D2LF 3FQUA 1ITCA 2M8XA 1D9KC 5B39A 1RUKH 4JRYA 3BX7C 4EOWL 1LWRA 4LFHG 5EA0H 4AIZA 3TIEA 5EB9A 2F54E 3E2HC 4XBEH 4KXZI 3OKLA 3D39D 4BH7B 4NQEE 3AU1A 1CL7L 1J86A 4BSJA 2BOBA 3QEUB 5D2LE 3TYGL 3Q6GH 4R3SB 5ELIA 3STBA 4CGTA 5GSVB 3SJVD 2ZCHH 4WUUB 1IGFL 2VDML 4V1DB 3ARFB 3AC0A 3IJYB 4YGVB 1A7PL 3IAPA 1R5WB 4KKAD 4S1DC 1R24B 1MJUL 3MV7E 3MLWL 5IESH 2GTWA 1MCFA 4KTEL 1CLOL 2X1WL 3EYOB 3JV4B 5E8PB 1BWMA 3MLRL 1QD0A 2DJSA 4HIIB 2IF7A 1O7VA 3LIZH 3MACH 4EBQL 4HFUH 2QLVB 4NRXA 3WO4B 5AZ2L 4EKXA 1AQDB 4JZJA 3BKCL 4YE4H 1QRNA 5C1MB 4DAGH 3O45A 4JJ5A 5T3XE 1NQBA 2DQHH 4Z8FL 5C0AB 4I5BB 2XICA 1A7RL 3CU7A 3D48R 4ONGL 4UZGA 5EULV 3BH8B 2GHWB 1S5IL 1ZEAL 5GGTL 2WP3T 4ZUTA 4JO1H 1D3CA 3G6AB 4MD5A 3QIUD 3C60D 4TTDD 4AH2B 4JY6B 3FCTA 5DO2C 5ACZB 3RIFF 4OGYH 5D1XB 2EC9T 1SJEB 1KIRB 2NX5E 4OLUH 3RY5A 1FNHA 1WBZA 1EXUA 1KG0B 4KZDL 1CU4L 1VGKB 4OCXH 1B4JH 1EUUA 1I9IL 4AG4L 5E8OB 3TO2B 3KPRA 4PGEB 3RDTD 4JPWL 1ORSA 3HC4L 4F57H 3C6LC 3QO1B 4Q6YA 2VQ1B 4TSCH 4XCYA 3TT1L 3LQAL 5IV2A 5IEHA 3S5LB 3I3DA 3MUZ1 4RBPK 1G7JA 1QFUH 4L9LA 4DK6A 3JWDH 1MOEA 2C3HA 3RX7A 5JHLL 4MJIA 2GCYA 4Y7MA 4NQUA 1PW3A 3D3VA 5SX4I 5D1QC 2WBJA 1DR9A 4ELME 2HWZL 3QQ9C 1R3KB 3QUMA 4U1NA 3K1KC 4X6EA 3G6JF 2A38A 2GYSA 3N1QC 4FFYL 1YN7A 4UT7H 4X9HA 1BD2D 3DX8A 3GJEB 3WNNA 4P46D 1WCBB 3C2AL 4FQCH 3T1FA 1ZK9A 5DF0A 5D7LB 3W11D 4FQ2H 4LNVA 4YHOL 1A3LH 3FN9A 1NUDA 1L0XA 4NC1C 4L29A 2X7LB 4AIXA 5A40E 4EQ3A 1FNAA 4Z95H 4K3EH 3TPUB 2EDBA 3VXUE 1T03H 3QWRD 1OF2A 5F3HB 4OM1H 2HG5B 5EBLB 3PWVA 5BZWA 2EYSB 4HPOL 2G9HB 1BOYA 2Z93A 4YDJB 3OX8B 1CK0L 2BSRA 1VFBB 3QEQE 4WDIA 3M17B 1A6WL 3RL1B 4XP5H 3F12A 3ARDD 4XPAL 1C8PA 4KMQA 5EO0B 5HY9B 4NKMA 2D7OA 3KJ4C 4UAOC 4Z7UF 2AEQL 1EAJA 4ZO9A 4EDWL 3D18A 1U3HD 3QBTB 4BZ2L 2HRPL 4HBCL 2BSTB 4LHUD 2OMNA 2R15A 4WO4B 2ITCB 3GMPB 4M93B 4U1KB 3QG7H 1BECA 2G60L 3L5JA 1J5OH 1SEBA 1RZ7L 1IZJA 4Z7UE 5TE6L 1EO8H 4WJ5B 2Z35B 4R26H 3ZYIA 1KJ2H 1IAIL 4KQ3H 1PKQE 3TBVB 2GSGA 3FOLA 5HDOA 3SKOB 3SQOH 1JGDB 1K3ZA 5FKPB 1D5BB 1JPTL 1ZSDA 5F9JB 4P48A 1LO0L 2YUXA 3AGVA 5DLMH 5EOCJ 5JXAL 3RWGB 1EIBA 3EYFB 1X44A 5F89B 3OXRB 2H26B 4MNGB 1WFOA 2X4NB 2YD1A 5JHDD 1NCNA 4K9EC 1KUMA 3BYTA 1KPVB 3BWAB 2IQAA 4EUPH 2BNQD 3TJHD 4PJBB 4LQFL 4GXUN 3TEUA 3V4VH 5CD3B 1D5MB 3MMEA 4UTBH 3WD5L 4NCDA 2NY3B 3HZVB 2X1XR 1RJYB 1I1CA 4QTIL 4MAYB 1TETL 1DL7H 4LP5A 3EYVA 3H2WA 1WVZA 3IT8D 4RMTA 4YDLC 1F4XL 3SGJC 4LPXA 2AP2A 5EUOA 2IG2L 3HFMH 3VCLA 4F3FB 3CH1B 4BM7A 4FZ8L 3VXTB 3IFLH 2R1YA 4JPKL 5HVHB 4Y5XA 5I71C 3MYJA 1ES0A 3PV6A 4Q9CA 1SYSB 3QUML 4NZDA 4HJJH 3GBNL 1T83A 4RISL 1URLA 4PLKC 2ESVE 4Y5VB 5EOTA 4G80A 3L5HA 1ZHLB 4G6JH 3WHE1 3L9RA 3RGVC 3HE6B 4FTVB 3VFOA 3P77B 4WNQB 4P9HC 1T2QH 1DP0A 1XF2B 2JB5L 4UUJB 3WNPA 4NQSA 5KSAB 5HBBA 4DGIH 3GMNB 3S7GA 2W1NA 4WUUD 1PLGH 5CSZA 1NCWL 3ARFD 1YPZF 3VRIB 3S4SB 1QA9B 2V2XB 1AR1C 5E94A 4ODWB 3V52H 1N59B 2B4CC 5BJTB 2CLZB 3L3GB 4JM2F 4X5XA 3RWDB 4ESKA 2F54A 4NRYA 3T2QA 5DC4B 1XCTB 4PRHE 4KHTL 1L0QA 1T7WA 1KXVC 4P49A 3MJ8B 4XAKE 5D2LA 1JZ5A 4OLEA 2BVPA 1E6OL 1A2YB 1AI1L 3CFDB 5MEPB 2B1AH 3JBG7 1YEGL 4M61A 3LRGA 3G5ZA 2EYRB 2V5TA 4LEOA 5C0AD 2A77L 1FG2B 3KLHC 1I3UA 1T1XA 4PREB 4GXUM 4KU1A 4TULL 2VE6B 3DV4B 1N6UA 3FO9B 3MV7A 1JYXA 1BQUA 4KROB 4ODSH 2ZG1A 3O41A 1RK0A 4XAWL 2HTKD 2MKLC 1A9BA 1FZMA 5FA4B 4MVBC 4JANA 3ZYZA 2VR4A 3LKPA 2XIDA 5HPMB 3L95A 2APTA 1B6DA 3OL2A 5A2KH 1LEIA 4BZ1L 4E0RB 4ODTH 4LCUB 5DD0L 2BFVL 5T1LB 1JRHL 3WN5B 1LD9A 3AY4A 5IEKB 4R4BA 4IEFB 5ESVA 3UBXB 1FE8L 3VD4A 4LIQE 1A7QL 5C09E 4DZBA 4GO6B 1BBDH 1CD1A 4NZRH 1AGDB 2NY0C 3GUTB 2BVUA 3KPPA 3P0GB 1A6UL 3KPSB 1ZHKB 5IB3B 1QO3A 3MODL 3U0TB 4D3CL 4X8XA 5EZIL 1TJHH 2ZKHH 5DUBA 3QQNA 2Z91B 2APVA 2NY6B 3EFFA 1JJUA 1VERA 3TIDA 5TF0A 1QBML 2CLRB 3LQZA 5JW4R 1SHMA 1V7NL 4P23A 4ZS6C 4M8QB 1U8IA 1NJ9A 3QUYB 5IHUH 4OSUH 3GK8L 4PR5A 3EBAA 3HG1E 5D7LD 4LLMB 1ONQA 3ARBB 4NWTH 3VFUA 4MD4B 1G6RB 2F19H 3C09C 3TH2T 3FQRA 5I30L 5E1AB 4G5ZH 3RJDA 5I73B 2V2WA 4ELMA 2AVGA 1FFPB 1HILA 1QKZL 3QSKB 2VDLL 1HYRC 1CWVA 1HXYA 2CLVA 2X4QA 3PP3K 1DZBA 1IGTA 4DCQB 1L9MA 3HMWL 1U36A 1UM5H 4XVJL 2VH5H 2A9ML 4WFGD 1XZ0A 2ZUUA 4LPUA 4AENB 1KGCD 2E27H 4ZOEA 1KTLB 4FHBD 4OLWH 1RZKH 3QNZB 3VI3F 3BP6B 1NCCL 4FQPA 3RWFB 5HYSB 4BZYA 1M4KA 5EO9B 3RVTC 3PGCB 4WO4D 3VXUA 2BNUB 1YMME 3EO9H 4K8RL 1YYMH 4H20H 3ULVE 4Y88A 5FF6B 2H1PL 3L5WB 4DFIA 3ALXA 5SWSE 4HCRH 4QT5A 2HVKA 4FG6C 4EI6A 3HC3H 4I0PA 4PTUB 4RFNB 4ZO7A 2J8UF 3QEQA 5IF0B 1CT8B 3MV9E 4Z6AT 3FQWA 3QDGB 1OSPH 5TGBA 3VI3E 4L4VE 4F8TA 2E9WA 5TF1H 5IB1A 5IMKA 5C0GB 4JFOB 3BGMB 4JQXC 2JELH 2N1KA 12E8L 5HYJB 4LSDA 3CUPA 3R1GH 3O6FA 4PJEF 4ZAKB 1A6TA 2EDHA 3TBYA 3NA4A 1F11B 2C1OA 1FCGA 5T3XL 2IH3B 1NMAH 4LSQL 3RUGB 2YSSB 3BO8B 3SDYL 1OHQA 1KF9B 4IHOA 2X4UA 3FQUB 1U8KA 3O9WA 4Z7UA 5B39B 4RMUA 2A1WL 2W0KA 3BEVB 4XCFH 4AIZB 4JFQA 1KNOA 2NY3D 1PKQA 5D1ZA 4PGZA 1NFKA 4S1RH 2KUTA 1CGSL 3U83A 2WAHA 4ZDHA 4RGND 5C08B 2NTFB 1NAMA 1YEFH 1KLGA 3G04B 4M6MH 1D7FA 3QISA 4WCYH 4LSTH 5IWLC 2BRQA 1CDJA 4LRNL 1JI1A 3W5MA 4NNXA 2APFA 5EBMA 4XP1H 5ALCL 5CEZD 4X9BA 1T0PB 1DQJA 2GEEA 5T3ZL 4BA8A 4QNPF 4M6AA 5DJCA 3Q2CA 1BMGA 1NUNB 5DJ8A 2DQUL 5KSVB 4N5UA 2NXZD 2YZ1A 3RZWA 3HE6D 4FTVD 1NLBH 1UENA 1PDKA 3WXWH 1JTOA 5D96C 1A3RH 2DYPB 1ZVSA 1WT5C 2WQRA 2ADFL 3U9UA 1Q38A 4NHUA 5C0FA 1S9VA 4IOSD 5KSAD 3DO3A 1R5IB 5F88A 4FABH 4NRXB 3RU8L 5JPNB 1X9QA 1INQB 1CR9H 1IM3A 1T22A 1GC1H 1QSFE 2BHUA 3W9DA 4XZUA 1BZQK 5KS9E 3ALPA 1YEHL 2OTWA 5DD3L 2ESVA 1E6JL 2VLJB 4LPWA 5I18H 1CG9A 2WV3A 4P2RD 4GOSA 4TSAH 3LRSB 2PF6A 1A4KA 3GSVB 3UDWA 2AEIT 4MD5B 1XIWC 1DQML 2IANB 2H9GB 1SYVB 1BVLB 4P9MH 4PG9A 2DBLL 3BW9A 1O5DT 3OAUH 4B7LA 4QWWD 2IAMA 3NIFF 3OKEA 3LHPL 2GTZA 4NRZA 2P8MA 4JAMA 2Z0BA 3RKDC 3PDGA 3QNYA 4MDJA 5ICYA 5JOEA 1OAQH 5BS0D 3VXRB 5EOCH 3MCKB 3I6LD 3MRQB 5L2KE 3SO3B 2R8SH 3KJ4B 1ZAGA 2X40A 4PRHA 1T7VA 4Y4FC 3E6HA 3FOMA 4J3SA 4YK4C 5FB8A 3P9WB 5IV2B 1LO3H 2IMMA 2E8YA 1G7JB 2D0FA 1LK3H 4L9LB 2RAMA 1YDPA 4LGSB 1LILA 4U6VH 4ZD3H 4PRDB 4MJIB 2GCYB 2PETA 4LSVH 3WXVL 2IBZY 2OX5A 3D3VB 2V7NB 3B3IB 4W6XB 3CVHA 3H42L 2XPGB 1OLZA 2VZ3A 1WZMA 3GJFH 1GSMA 4MNQE 3QUMB 1VFUA 1N8ZB 3ZE2F 1VB9A 3N1GC 5BV7H 4KKLC 4LF3B 5H35A 2Z8RA 1F00I 5J13B 1JNLL 5CZVL 3NPZB 5ICZA 4FQQB 3SKMB 1AP2A 4G6ML 1FIGH 1Q0YL 4XBPA 1PD6A 3MROB 4UBDD 4PUBH 3GMOA 4POUB 1ZXQA 3QJFB 2QQKH 3DYMA 1GZQA 3KPSD 1C16B 4NQCE 4PRPE 4Q97A 3F7VB 1NAML 3C8KA 1ZMYA 4QXWA 4LHUG 5B38G 1UC6A 3HAEA 1I1AC 2CUHA 3S37X 4OV5A 1WBXB 2R56H 3L3JA 3OJ2C 1RQ5A 1KN2H 4NQDB 3X12A 5LWYH 3BZ4A 3AVEA 4LLQB 4DK3A 3NIGF 1RVFH 3DUHA 5C09A 2Z93B 5DDHA 2BSRB 3QUYD 3U9PL 4NZUH 5ILTH 1KEMH 5EU3A 4WDIB 3ARBD 3F12B 3E0GA 3N85H 4WU7A 1DDHA 4OF5A 2B20A 3SDAD 5I71B 3LB6C 4PB0H 4NKMB 5KW9H 3ULUF 1D9KD 2WLZA 4XXDB 4Z7NF 3D18B 2BP3A 2UZYB 5CSGA 3EDEA 4GS7C 3UTTE 1RZ8A 3RGVB 4JZOA 3HUJF 5D70L 2YD9A 1RUAH 1K5NB 4JM4H 5L6YH 2XTLA 1SEBB 3VFRA 5T5NF 4FFVC 2KZWA 5IB5A 1MHHA 2XZZA 4YC2C 3HG1A 1BQLL 2LE9A 3LPGA 5F7DA 4RFOL 1X4YA 1MNUL 4MB5A 5DK0B 5CIPB 4OI7A 5CJOH 4S1SH 4YZFF 1ZSDB 4PJCF 1RZJL 5C2BH 4XVUC 4S1DD 4Z7QF 1HH9A 3LOWA 2ED7A 4ERSH 4TSBH 5ID0A 5HJ3A 2XZCH 4HAFA 2G2RA 4N8CH 4TUJB 2LAGB 2IQAB 4F7EB 3TYFB 3ZHLA 3QDGD 1CFSB 4M6OH 1QNZH 2Q87A 3AM8C 1JZ4A 4XP4H 2I9TB 2IGFH 2YKLL 3MMEB 5A43C 4OT1H 3T8XB 4LCWA 3MQIA 2W9DH 2VKXA 1F2XK 1OAKH 2QV2A 5HYJD 4RGOL 1PBYA 4ZAKD 3M1BB 3QJHB 5EUOB 1A1OA 3VCLB 4HX1B 1YMMA 4MS8D 2DQJL 3CVHL 3MYJB 1ES0B 2YD4A 4PRBA 5EC2A 2QQNH 3PNWA 3CXHK 2BXZA 5SWSA 5DO2D 5J1AA 1AFVL 3OKNA 2CKBA 5DMJB 3FO1B 3MV9A 5EOTB 1DLHB 2QKIA 3RVVD 3GMMB 3L9RB 1A21A 4HV8A 1YC7A 1RUMH 4TYUA 4PJ7E 5KANI 5EZLA 5C08D 3VFOB 5TH2B 3O4LE 1RJCA 3HMXH 1W72L 5HYEA 4LASL 3HI6H 4M3KB 1GPOL 4QGYA 4NQSB 2FLRT 3GHBL 2DI7A 4XP6L 3GBML 2YS4A 1HYSC 2BY1A 4G6AC 4W4NA 3WFDH 2QADC 3WHE0 1ND0A 2W60A 4FQXB 2NY0B 3CLFH 3W81A 4KZEL 5DJ6A 4IMKC 5E94B 5KVEH 2NXYB 3MUGA 4JY4A 1CDUA 2VC2L 5HHXH 1ZT7A 1CFBA 4LIQL 4ZUUB 2X70B 2PTTB 3MGAA 5KVFH 2HAZA 3KVQA 4KPHL 2DYPD 1K8DA 3MO1A 4AEHH 4UB0L 1LDSA 1NBZA 3P2TA 1FORH 3QQ9D 4ZPVA 4PJAE 5D2LB 3TBTA 4WI6A 4RAUB 3IAGC 2G5RA 4Z7VF 2ZSWB 3IFPB 1RJLB 4QXTA 3DGGB 2OTUB 4MX7A 5J57B 4LEOB 5J89A 4WFHD 2GSIA 2DM7A 4MWFA 1H5BA 2VLJD 3U36A 1T1XB 3ABZA 4GG8B 1RFDL 5ERWA 4NYLA 1YC8A 4HXBH 4WW2C 5FA3A 2CRYA 2IAND 2XTJB 1S7SA 5JQ6L 1IGJA 1WTLA 3O3AA 1A9BB 1TQCB 4GAYB 4XNQA 3LKPB 3L95B 4RWHA 1NGXA 2DDQL 1LEIB 3ISWA 1KULA 1AJ7L 4HQQL 3E6FA 5JXEC 5L2JA 4KVCL 3FJTA 4FZEH 1VHPA 1LD9B 3L6FA 3VXRD 1DUYB 1OL0A 5DHYB 4X5LA 5C0EA 3ZDZF 4R4BB 5GISL 5ESVB 2NNAA 1A14L 3MRRA 3CX5K 1RD6A 2DQFA 1G0DA 5GHWH 2CPCA 2ZG3A 2YEZA 3MPCA 1GOGA 3HI5H 3RX5A 1CE6A 1I1FB 1KJ3L 4L1HA 3V8CA 1PQZB 3LH2H 3QCTL 2DKMA 4S10A 5DT1H 4N0CC 4APQA 3QIBB 3Q48A 5DUBB 1Z3GH 1AE6H 3SY0A 3ULVL 2C3VA 5FGRA 1TVHB 3EFFB 4J6RL 1I4FB 2XFXB 3BAEH 3TIDB 4MA7H 3U82B 3LQZB 4MJ2A 2YD2A 4PLNC 1G7HA 1CZ8H 5JPMA 1OD7A 1U8IB 1NJ9B 3BH9A 5FUCC 2NW3A 2AI0L 3OR7B 4HK3N 4QRTA 5IVOA 5IKCA 2JF1A 5K9QI 1YNKH 5FKAA 4OTXH 4YWGH 3S9DB 1QPXA 5DMKA 3O6KL 4JB9L 5E99H 3FB6B 4LEXL 3C5ZC 4IMLB 2UVEA 2V2WB 4PJHF 4QGTA 2Q8BL 4AYFA 1HILB 2WUBL 4MNQA 4NQDD 4LLYA 4XC3H 1W0WB 5F9OH 3BSZL 1HXYB 1T1YA 3WJLA 4EJ1C 5HHVH 1I7ZB 1TZHA 3JWOL 3L5XL 3WDHA 1NKRA 1ODAA 1J87A 2BNRE 1FL6A 4K7PY 4WHYG 1BFTA 5DD5H 3A6BH 1KN4L 4NQCA 4PRPA 2NY4C 3X3FH 3PJSA 5E08L 1QUNA 5DS8B 3G6JB 4LCCA 3BDXA 4PLKD 3VW3L 1EJOL 1INEH 1ZLVH 1VKXB 2F15A 1NGYA 3RGVD 1DFBL 3NFPB 3PDOB 1WBYA 1BFVH 5D96B 5ENWA 2VLME 4W4OA 1UYWH 4TRPL 4C56B 2VDOH 1MCQA 1NFDE 4I0PB 4ONFL 3QEQB 4AMKL 3FQWB 5DC0A 4JRXE 2ILLA 3OKYA 4Q2ZA 4ZUWA 4P5MA 5IB1B 4UT9H 2AEPL 5IMKB 4M43H 1L7IL 1BX2B 3CUPB 4FXKA 3O6FB 1QFWL 4OIIH 3UTTA 4WEBH 2C1OB 2K9UA 5J12B 3LDBB 2VERN 3EGSA 2JTDA 1UQSB 4LSUL 5IK3A 1CLZH 4IHOB 3UJIL 2X4UB 1QHPA 3O9WB 4Z7UB 4NN7C 4X4ME 4X7EC 3O3EA 1ZLUK 4NM4H 2DBJA 3TN0C 1KNOB 1PKQB 3TA3C 4XWOC 3D69A 3I85A 3RHWF 3LSOA 3KLHD 1NAMB 5CILL 1KLGB 1BJ1J 1Q72H 4KAQL 1AXSA 5D7IF 4W68A 3UEZA 4NDMA 1IJ9A 1GIGL 1KYOK 1I8MA 1K6QH 5CUSH 3DVGA 1DQJB 3PABA 4OUUA 3T0DA 4MVBD 3N9GH 5SV4A 4FQJL 1F90H 1W2KT 2CK0L 5DJ8B 4C58B 1WZ1H 4PJCA 4OM0L 1S7TA 4ORGA 1LNUA 1DEEA 1GGIL 1UZ6E 4C55A 1E4XH 3MRPB 1RHHB 2E5EA 2VJXA 3EW3B 2IQ9L 3U9UB 1NLDH 4NHUB 1CF8H 1S9VB 3Q1SL 4HGKC 5F88B 1PZ5B 1YY9C 3IDYB 1IM3B 2Z31C 3LS4H 1KCUL 2Q7YB 4FQXD 2NY0D 3AXLA 3O2WH 4BFGA 2NXYD 3B8SA 3ZE0F 3V0VA 2Q8AL 5HGDA 2R4SH 1PSKH 4YHKL 4ZTOL 2PCPA 1A4KB 2OL3L 2FIRT 4PJ7A 3O4LA 3UJTH 4PG9B 2ZCLL 4S0SD 4PJFF 4Z76B 4XPBL 4Z5RA 1IEBA 1FDLH 4WI5A 1MRCH 5HGHA 3ZE0E 2I60H 4PPTA 2DWEA 2P8MB 1XGRA 1KLUA 1IKNC 3BHBA 2AQ3A 5T5FL 5TFSH 3QNYB 1FRGH 3MV01 4QF1B 1EEYB 4F58H 1P5UA 4S1QH 2W9EH 4J4PC 5F9DC 4MSWA 4ALAL 1CN4A 4HF5H 2DS4A 1BEYL 5B21A 3E6HB 1UWGH 2XTJD 2BVQA 4PP2A 3V79C 1G7QB 4G6FD 4PJAA 4U1IA 5I8EA 4X6FA 2YUWA 1TZGL 3C6LA 1OTTD 4OAWA 3OZ9H 2VABB 5DJXA 3B5TA 2BCKA 4UMGA 4JM2B 4M62L 4JFYB 4H8WH 5ANME 4YC2B 1L0YA 3KHQA 4KK6D 3UTPD 1II4E 4JFEB 3QRFM 1MFDH 3JWNC 1ZS8A 1MREL 4HS3B 3EFDH 5H35B 3EAKA 2G5BB 3RVTD 3ULUL 1QYGL 5IHBA 1QSEE 1XGYL 1AP2B 4XBPB 4ZFOL 2BC4A 5DRXA 1W72B 5HHOB 4HK3J 1W0YT 1JFQH 3C8KB 4GT7A 3HI1B 1M6OB 3P4NA 3QIBD 2WBWB 4U2YA 3CGTA 3MOAH 1IAIM 4GW1B 1U91A 3AAZA 5DWUL 4OV5B 5E9DB 3L3JB 1EEUA 5AZEH 1NMBL 3NH7L 5T3ZD 3FL7A 1OP9A 3X12B 1A0QL 3VFGH 5LCVL 1A02N 2AJYH 4U4BA 5C09B 3EOBB 4Y16C 2H2SC 2J8OA 3BQUC 8CGTA 1X5HA 3HE7A 5HYSG 4WU7B 1WCQA 2XACC 1S78C 3IU4H 5A16B 4UT6L 4BUGA 1FYTE 4OCWL 3P73B 3GO1H 4Q6IC 1CE1H 3G5YA 3VRLE 1K2DA 2NW2B 4JZOB 2I5YL 4KK5D 3U4BL 4HWBH 2Y4SA 3SKNA 4LPTA 1NDMA 2ADGA 3BVNA 3QHZL 2VWEC 1ZLSL 1CLCA 3KJ6L 4Y4HC 3MRJA 2FO4A 1RUQH 3UTSE 3TZVC 2R0KH 4G8GB 1H8OA 1Q9KA 1BHGA 3L1OL 1G9ML 1QPPA 3ZDXF 3T08A 1UB5A 1Z9LA 1B6UA 4TVSa 4YDKH 4RMVA 2CIIA 1C1EL 4YUEH 1MVUA 1HH9B 4X8JA 1FV1B 1PY9A 5E0QA 1ERNA 3AMKA 3LZFH 1ZWIA 1WV7T 4YPGA 4PGBA 5IR1A 2G2RB 4C56D 5F97E 3WE6A 4I0PD 4D0CB 2BNRA 4P3DA 4O5LH 3PWUB 4PLJC 3VH8B 3EYQC 4KJYA 1I75A 2VYRE 4IRSC 4LCWB 5E56A 4HFWB 2YPVL 1Q9WA 3DLQR 4RX4A 5AAMA 4PBWD 2ZUYA 1XGPA 2FX9L 2ED9A 3MGTB 3DTXA 3B2VH 4KGJA 4FS0A 4OFYD 1XIWD 2R2EA 5AG8A 4PRBB 3MXWL 5LXGH 3GJFK 5J1AB 1NCAH 3SGJA 4OCSH 3OKNB 2ICEA 1NFDA 4XHJD 1HHIA 2G75B 2QKIB 4JRXA 2FWOB 4NSKA 4Y5YB 4NFDA 3QXDB 3GSNH 2Q76A 3A67L 4BJLA 2F5BH 5B4MC 1YECH 3BP7A 1EV2E 3IDIA 5IW6B 2R9HC 3NIDE 4Z78B 4NKIH 3GNMH 3NFSH 2J8UB 1J1PL 5CAYB 3JTTB 4NZJA 2EH7H 4J23A 2A0LC 1CLYH 1MJJA 3HR6A 1TMCB 1WIOA 1LE9A 1ND0B 2W60B 3RRQA 4NIKB 5TDNB 5DJ6B 5E24E 4MJ6A 5DK2A 4X4MA 4JY4B 5K59F 3B83A 4WY7L 3PGFH 4PJEB 2A6DA 3HN3A 3GZKA 4RIRA 1AGFB 4YBLC 4UNTA 5I0DA 1SJVA 1AGEB 3MO1B 4WHYH 1OGTA 2Y07L 1EHNA 4XVTL 3FT3A 3KYKH 4S0TD 3I9GL 2DJUA 3TBTB 4XHQA 1NEZA 3QQ4B 4JFHD 3IF1B 4U7MA 3AFLA 2JK5A 2MCPL 2NPLX 2OZ4A 4MX7B 5BO1H 2FYYA 4I3RL 4AEIH 2GSIB 2AXFB 2D2OA 5L8JB 4MWFB 1YA5A 5I1HH 4GJTB 4N8VG 4HC1H 1RIVL 1ZGLA 4GLRI 4OZ4B 3A6CL 5FA3B 4JLRA 1YQVL 4HKJA 4X80L 5IVXF 3ZTJG 4R2GB 3O3AB 1ZT1B 5JOPE 3PL6B 4DFHA 5L0QB 4X0KA 2VO5A 4IRZH 3SE8L 3DIFA 4NBZB 5F6IB 1FBIL 4NC2B 5ETUB 1G7LA 3E6FB 1NL0H 5L2JB 5CEZH 4Z0XA 5DJYA 5IBTH 1ZTXL 5C0EB 1MI5B 1JF1A 2O26U 1MSPA 3MRRB 5C07A 4WTZA 2AQ2A 3KPNB 3D85A 1GGCL 3JWDC 3WFCL 4HMCA 2CGRL 1BGXH 5LGJA 5IGXH 4JM2D 3PP4H 4NQXA 2YK1L 2A6JB 4Y1AD 4DW2H 4HMDA 3MSPA 4P5KB 1LEGA 3MRHA 4JQIL 1BJ1H 1MCSA 4LPCA 2Y23A 1A1NA 4JFED 1JCKA 2D7NA 4YXLH 5K9JL 2AJZA 5DUPH 1Y0LB 3QIWB 5I66A 3NAAL 5DI8B 3C5SA 4PJ9C 2FBOJ 4UQ2B 5JPMB 1R3HB 3ZKMC 3KPLA 2NW3B 4NO0B 5DD1H 3VFWB 5HHOD 4QRTB 4GMTL 4Y4KC 5IKCB 2QSCL 4R4NC 5FKAB 3T0EB 3KNBA 3QEHB 3QI9A 2VLRB 1KCVL 4FNLL 1C08A 5ANMA 1HSAB 5E9DD 2WWKT 3SDXE 1DQDL 1T3FB 4MNQB 1MFNA 3TN0B 2JB6A 3BDBA 1TCRA 4MD0A 4EI5A 5C09D 5IBUB 1UH3A 3SE4A 1I9JH 1QSEA 1FFOB 2OL3B 2V9TA 4HT1L 1UWEH 2DQGH 1RMFH 4MXQC 3O3BB 5EU6E 3RX8A 1HEZB 1N64H 4R96B 5JR1L 5D8JH 4PRPB 5ITFA 3KPQA 5EN2A 2HT3D 4LCCB 2FATH 2QQLH 2GITA 3O0RH 4ZFZB 1G7MA 1MCNA 1VFAA 4JREC 2OZ4L 5K9OB 3AS2A 1T04B 1QZ1A 1FGNL 3X11B 4B0MM 3OKKB 1IL1A 4F37F 5M95B 4EOWH 3NOIA 5I76B 1E28A 2OS7A 4JKKA 4ZUVA 4G8GD 4ZUWB 1CDCA 1CL7H 4P57A 4TVPE 3HZKA 1FYTA 2X41A 5I1GL 2BHZA 3TYGH 2X1OA 5GRVK 3JVGC 3NA9L 1BIIA 4PBXA 4L4TE 1IGFH 2VDMH 4OIBA 3ZDYE 5J3HC 5HDBF 3HPLB 5IK3B 1A7PH 2X4SB 3T1WA 2VR5A 4I9WE 3P40A 1MJUH 4NKOA 3UTSA 3MLWH 4JDTL 4KTEH 3O3EB 1CLOH 1LEKB 2IBZX 4ZFOB 3MLRH 4LCWD 4P4KC 2DF3A 4GRLA 3HUJB 1N5AB 4EBQH 4J12A 3LSOB 4CVXA 3DUUA 1RURL 2H45A 5AZ2H 5C0NC 1MAML 3BKCH 5HI3C 3VGFA 4Y89A 2P48B 1NMCC 3FB5A 4XCEA 4Z8FH 2YD7A 1A7RH 4ONGH 3DVGB 4RZCA 3BEWB 3PABB 1S5IH 1ZEAH 5GGTH 4EZMA 5I1EL 3IJSA 4GRWF 4TNVK 5IWLA 5ESQA 1DQQB 2GK0A 4NGHL 4PJCB 3BD3A 4ORGB 3VFNA 1LNUB 1DEEB 2LV4A 1T66D 1DANT 3OKDA 5INCB 1JI2A 1T89C 3PHOB 4KZDH 4NQVB 1CU4H 4QTHA 1MH5A 2YMXL 1I9IH 4AG4H 1NBYB 3C9NB 1WT5A 2PR4L 1JMZA 1T1WA 4E41B 5A2JH 2FHCA 1TFHA 4JPWH 2F74A 3HC4H 2VL5A 2FJFA 1RULL 5BRZA 3TT1H 3LQAH 5E00A 2C3GA 2R1WA 3NN8B 1OGAE 3QT2A 1ZA3B 3I02A 4QEGA 5JHLH 3QYCA 2RQ8A 1IEBB 1K4CA 4WFFE 1ZLVK 3FFCA 4CL7A 1MWAA 2MHAA 2DQCL 3LMJL 2UWEF 3OKMA 1AKJA 1KLUB 1FN4B 3BHBB 3UYOD 4DVRL 1L6XA 3S98A 3LKOB 1BZ9A 4FFYH 3QUKA 3ZKND 3KDMB 3MRLA 3MRCA 4KK9D 2D0HA 3C2AH 2C4FU 3CCHA 4GG6E 4CVZB 3OQ3B 5TDOB 3ARSA 3V2AR 3U30B 4R2GD 1CGTA 4H1LB 4YHOH 2AQ1A 2NLJB 1CS6A 3PL6D 3M07A 5I8EB 4X6FB 3V52L 2D7PA 3C6SA 2UWEE 4QRRE 1YNTB 2AEWA 4OZFB 3FO0L 4RFEA 5D2NE 4Y4FA 3PG2A 5I1IL 4KDTC 1IBGL 3ROLB 1HSBA 5D7SL 3RI5K 3WFZA 2HFFB 2GT9A 3NVQA 3H7BA 4X6CF 4HPOH 3VFSA 1L7TL 1GXEA 4D0DA 1MI5D 1ZS8B 4W81A 2FEDC 1CK0H 2Y5EA 3NCJL 2OJEA 4JDVA 3RJQB 1A6WH 1X6LA 2A73A 3DXAE 4XPAH 2DIAA 2IMNA 4Z7VB 2BC4B 4U33A 1Y6KR 4F7PA 2AEQH 2F9BT 1H3XA 5DEGA 5GS3A 4EDWH 5FOBB 4MHHG 4BZ2H 1IC7L 3F7PC 5E2VL 2HRPH 5C9JA 4HBCH 3FQTB 3P4NB 1P7QB 4HLJA 1KPUA 1I7RA 1S9XB 3AAZB 1S7RA 2L7JA 1B0GA 2G60H 4YDVA 4BH8A 5I9QB 1M05B 3QIWD 1RZ7H 1EGJL 5IJVA 1I1AA 5TE6H 3DVFA 5HGAA 5F1OB 4M7JL 3ZYJA 1F3DJ 1IAIH 5CKGA 4IOIA 4NO0D 2Z4QB 3HE7B 4RQQA 1JPTH 4FP8L 1RPQA 4YIQA 5FO7A 3T0ED 2VLRD 3U2SB 4DOHB 1LO0H 1CGYA 5IBLD 3AS3A 5JXAH 5E7FA 2XKNA 3L7EA 4L1DA 3G5YB 5E5UB 3IXTA 4U1LA 3TN0D 5MERA 3BZDA 1LO2L 1LGVA 4XWOD 3RL2A 3SKNB 2W0PA 4OIAA 2JJTA 1NDMB 2ADGB 2P8PB 4D9RD 4RMQA 5FK9A 4G42B 25C8L 2PN5A 1OWRM 4C4KO 4MQXC 1TNMA 1FAIL 3LEXA 3WD5H 3QP3A 3S3JA 1CL7I 2E6QA 3IU3A 4QTIH 5DEFB 1TETH 1RZKC 1P4LA 2DLHA 4L3CA 3RPIB 1F4XH 1JWSB 2PO6A 2IG2H 1U93B 2CSPA 4L8BB 4FZ8H 3BXNA 3ZKQD 3RIAK 1MVUB 4JPKH 4HZAA 3SDXA 1IILE 1YY8A 2A83A 4OZHF 4XCNA 1MWAL 4FN0A 3L3OA 4LMQI 3QUMH 3GBNH 4RISH 5BVJA 4XGZB 5IR1B 5J8OA 5E4IA 2FJHA 1PJ9A 5I6XB 5JA8B 3TCXA 5EU6A 5FAAA 1YY9D 1HQRB 2Z31D 5D5MF 4KJYB 4PJHB 2DMBA 1KJMA 3MLVL 5B3JE 1RIHL 4PJIF 2JB5H 1Q9WB 4BFIB 1H3GA 2C7UB 3O8XA 4ETQA 1NCWH 5FHBL 4TNVF 4X4XA 5EZOL 3RTQA 5MI0C 5INDB 3ULUD 4U1SA 4DKDC 3GKZA 3WNOA 2V2TA 4BFBD 2FO1A 4KHTH 1T6WA 5F1IA 1J05A 2EEAA 4NUGL 2HT4C 5DA0B 2Q76B 3CSBA 3RPKA 1MHEA 5DSCA 2YA2A 3BP7B 4RRPA 3HZYB 3B9DA 3U0WL 1E6OH 2WWKO 3IDIB 4JN2B 2B0SL 1AI1H 1OD9A 1S7XA 4PYHA 4WI2A 4F9PC 3GSUB 4NKQB 4L4TA 1YEGH 3OF6D 2D31B 2A77H 1RZGA 1QFOA 2DAVA 2B5IB 5GZNC 3RY4A 4N0RA 4ZUSA 4QHLB 4CBPA 1I8LC 1FFNA 2ZUSA 4TULH 4BQBA 2ZOKB 4PBVC 5E6IB 3VWKB 5GSRA 4XAWH 3MLPA 5CIPH 1OGTB 1OT2A 2EDDA 4WI3A 4FA8A 4BZ1H 4HUMB 3MA7B 3L7FB 4WGWB 5EU7C 5DD0H 3QULB 2BFVH 4X7SL 4E41D 2MQ3A 1S5HA 2YBRB 3BGFC 3FT4B 4K7PX 2XV6B 1HINL 1Z6JT 4JO4L 1MFCL 5BW7C 2EDEA 3D1MC 1BP3B 3DV6A 1FE8H 3D5OF 4P2QB 1A7QH 4KI5F 3BIBX 1ZGLB 5D7IB 1AGCA 1A6UH 2F5AL 3D0VA 3D87B 1WITA 4YXHL 1FL5B 3MODH 3RY6C 4D3CH 1R3LB 5EZIH 3RI5F 3DIFB 5H2BB 4WW2A 3RVXC 2ZG2A 1J0ZA 4J3UA 3L3IA 5IW1A 1J8HB 2KL6A 5DJYB 3TWCL 4G9FE 1I85C 1QBMH 1U92A 1S78D 2ATKA 2EE3A 4FABL 3BPCB 1V7NH 5C8JA 3LS5L 1JF1B 5I1LB 5JXEA 4N68A 4GUPA 5C07B 2FH6A 3GK8H 5MENE 4KJWC 4G3YL 1OGAA 3CVIL 3RAJL 2RR3A 2VUOA 1NGWB 2V5RA 4LPVA 5I30H 4KRPC 1NC4A 5DJAB 3VFMA 3BZEA 1U8HA 1QKZH 4UDUB 5MEQB 2VDLH 1HH6A 1UG9A 1LEGB 1X5ZA 5BV7C 1A1NB 3GMLB 1JYNA 1KEGH 2EC9U 2VDQL 4PJFB 5I66B 3Q3GB 4GG6A 3HMWH 3EJYC 4XVJH 1UB6A 3KYAA 3AREC 3H9HA 2A9MH 4JFPA 1OB1A 4NM8L 3KPLB 2UZIL 2UWEA 3CSYB 4QRRA 1KCSL 1XGTB 1FNEA 1J0KA 1NCCH 5D2NA 5JORA 2VWEE 3DHJA 1P7QD 2K3TA 3QI9B 4NQTA 3PQYE 1X6NA 1C08B 1NANH 4YHIA 5C0JA 4UIMA 1BF2A 5ANMB 4K8RH 1AIFA 2X89A 1MRDL 2H1PH 2X9WA 2AK1L 5DGRA 1JYWA 2VR9A 3LQMA 1IGML 4ODUB 3VGEA 1QFWM 3ZT6A 2VLKE 4TUOB 4MD0B 4EI5B 1NGZA 4LSVL 3LN5A 3C5ZA 4IM8A 5FGCE 2CRMA 3DXAA 3F5WA 1UM4H 5IIEA 3AMLA 4X6BA 1ZVHA 1P7KA 12E8H 3MOBL 5ITFB 3RIAF 2X6MA 3SCMA 2H32A 2PXYB 3H9YA 4U6XA 3CPLA 3SN6N 5FYLL 5T3XH 4LSQH 3DYPA 2FGWL 2X4OA 5CJXC 4M5ZL 3SDYH 5DA4A 1RI8A 1IL1B 2A1WH 2DM2A 5HI4C 2AXJA 4M03A 4O2CB 3VH8G 3W39A 4ZUVB 4ZOBA 4FXGA 2A0LD 1CGSH 1N6VA 1I3GL 4HKXB 2V17L 1IEAA 3RWJA 4K3JL 4HS8L 3O6ML 3S35X 3LCYA 4Y2DC 1A6AA 5HHQB 1IM9B 5DHVB 3ZSSA 4LRNH 4V2CB 3VGAC 3DWTA 4CMHC 5ALCH 2OM5A 5ADOL 4TUKL 4ONHA 4QHKJ 5T3ZH 4LKCA 4BKLA 4PG2C 4HUXB 5DTFB 2DQUH 4A2LA 1P4BL 5DRWB 2GUOA 4OD2A 5E5MA 3ARGC 2ERJB 4YGAB 1JNHA 2CDEB 2BOCB 1IC5L 1YJDL 3HRZA 3NCMA 4U6TA 2ADFH 5IMMB 2VN4A 2VITA 4GRLB 1MCCA 1T21A 2E7BA 2GI7A 2B2XL 3RU8H 1LE5A 1TENA 1BFOA 3TH3T 2WIIA 2EDTA 1N4XL 2NZIA 4K94L 5C0CB 2BVOB 3TA3A 1YN6B 1JUFB 1YEHH 3FB5B 1I8IA 5DD3H 4QO1A 2QR0A 5T1DL 1E6JH 3MFFB 4KY1L 1EZVY 4LAQL 5E8DL 2CUMA 2GK0B 3WEXA 4L3EB 5AD0B 1JGLL 1DQMH 1CBVL 3CFKB 1QQDA 1YQ2A 2DBLH 4PV9A 1FP5A 2Y5TB 3ARRA 1F3DH 2IPKA 1MH5B 1MJ8H 3LHPH 4L3AA 4MJ4A 1FPTL 1E4WL 4OT1L 2CO6B 4JKWA 1MFEL 4CRPA 2DKUA 1DBML 3DO7A 4UI2A 2JKXA 3MRNA 1CTNA 1CGXA 5E6ID 3VWKD 2DI9A 1VA9A 5MP6L 5ABDE 2FJFB 5BRZB 2R1WB 5F21B 5C0DA 2O5YL 1IMHC 1JZ2A 1C7SA 4ZFFA 1MAKA 3BGAA 3WXVH 3EYUL 5GIRA 1F8TL 1T80A 2DIJA 2EDNA 4PY7A 3H42H 3A6OA 3FFCB 5SWZD 2OYPA 4PJ9D 1A47A 2HN7A 3ZKMD 3OKMB 2OBGA 1A3QA 5GS1B 1UKSA 3QUKB 4R4ND 4P2QD 5LBSL 4WVRA 4K71C 1JNLH 5CZVH 3CCHB 5I19L 4G6MH 1Q0YH 1IKNA 1NFIB 3QFDB 1DN0A 4N90E 1KTDB 1NAMH 1KSRA 4IIQA 3SDCA 4AM0B 5D7JB 2EIEA 4I4WA 4MXQD 1J8HD 1KT2A 1RY7B 2EICA 1UJTA 2GT9B 4KKAC 2EXWC 2EE9A 4D0DB 4PRAB 3U9PH 5C07D 2W65B 1I3RA 1ZV5A 2XT1B 4GXVL 4E42A 4Z77A 1WAAE 3PWPB 1F3RB 4ISVB 4AIOA 1TJGL 3K7UA 3VWJC 4MA1B 2GJ6E 3DUSA 4Q7DA 5JO5A 2D7TL 4PP1D 4NO2A 3EYSL 4D0BA 3K46A 1GOFA 4CMMB 5SWQB 1S8DB 1XR9B 4OF3A 1KPUB 2HLAA 3D2UB 1UT9A 2MPAL 5F3BA 5D70H 4YDVB 4R0LA 4G9FA 5IB4A 5IVXB 4HUWA 5IBUG 1KENL 2J6EA 5HHNB 5FGSA 5IJVB 3QIUC 5MENA 4TTDC 1BQLH 4RFOH 5JZ7D 1N0LA 4M1DL 1I7TB 1MNUH 3DURB 5D71L 5J3HD 4HWZB 1RZJH 3CZFB 3OKOB 4CDGC 5E4EC 1D5IL 4Y16A 3SGKC 2AABL 2VXQL 3L7EB 3BQUA 5E70A 3IXTB 1A6ZB 1XR8A 3KYMB 5MERB 4I48A 1U6AL 3RDTC 2JCCF 4EI5D 4XNZC 3MRBB 1JIBA 3TV3L 3VFPB 3W9EB 4QLRA 1EBPA 2DLFL 5LG1A 4Q6IA 5D9SB 5SX5H 4NO5A 5MHSD 2YKLH 3QZWA 4XMKL 5HI3D 1R0AL 3SDDC 3U7WL 3ESUF 2CDFA 1JWUB 3VXSE 5JW4Q 4RGOH 4Y4HA 2PXYD 3PQYA 1MQ8A 2PYEB 1LP9E 3TZVA 1MLBA 3O3DA 2DQJH 3CVHH 3SDXB 1OP5H 4CNIA 2A83B 4PJXF 3L3OB 2NZ9D 2LFGA 1V7ML 4FMKA 1AFVH 2VLKA 2IH1B 5T1MA 3FB7A 4XH2A 3S6CA 1EDQA 3I6GA 1S3KL 1WWAX 43CAB 4P46C 3CLEL 3PE9A 4KI5C 5C86A 1NGQL 3EO0A 1N6QL 3W11C 4FQHB 2R1XA 5EG6C 5F93C 3BKYL 3REVA 5I1DA 2ITDA 1W72H 1HCFX 3MRFB 4LASH 1X7QA 2DI8A 5T5NG 1GPOH 3CZJA 1IQWL 1IM9D 3GHBH 5F96L 3UTZA 4XP6H 2KKQA 3GBMH 3O8XB 3HAEH 3HB3D 4LL9A 2ZSVB 3FQXA 1CVRA 5DJZA 4KZEH 4X4XB 1T2JA 4LAJH 4WW1B 1IEHA 3T4AB 2VC2H 2NR6C 4A6YL 2B1HL 4LIQH 3H6JA 3TO4C 2V2TB 4KPHH 1YEDB 3X13A 3ARDC 2XXCB 2VXUL 4UB0H 1DTUA 5DSCB 3IRPX 4GRLD 4EN3A 4P5TA 3RZCC 1MELA 2ICES 1U3HC 2HMID 4OLVL 1S7XB 3SBWC 4YR6A 4GKNA 5C0CD 3MLTB 1I1RA 2OP4L 5F7EL 2DQEL 1YEJL 1JPSL 1F58L 4ZUSB 4NFCA 1N0XL 4DKFL 1FFNB 1MCPL 3M8OL 1CFTA 1RFDH 3LKRA 2OMBA 1J7VR 4L3ED 3T4YA 2HVJB 5JQ6H 3GJFB 2CXKA 3VE0B 4KJQD 1HKFA 5CJ8A 4N9GB 2DDQH 4X6DF 5EUKA 4MA8L 2FEDD 1WIUA