3JWOH

Structure of hiv-1 gp120 with gp41-interactive region: layered architecture and basis of conformational mobility
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
220
structure length
220
Chain Sequence
b'EVQLVQSGAEVKKPGATVKISCKASGYTFSDFYMYWVRQAPGKGLEWMGLIDPEDADTMYAEKFRGRVTITADTSTDTGYLELSSLRSEDTAVYYCAADPWELNAFNVWGQGTLVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 GP120 ENVELOPE GLYCOPROTEIN
publication title Structure of HIV-1 gp120 with gp41-interactive region reveals layered envelope architecture and basis of conformational mobility.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein
total genus 29
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2009-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jwoH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jwoH01
1LD9B 1G7PA 2IGFL 4AL8H 1HQRA 1RUPL 1YDPA 4MJ6B 1T80A 1WUNT 5D72L 5F9OH 2X1XR 4DCQB 1KCVH 3P9MA 4FQHA 3G5YB 4PREB 3GSOB 3KPLB 4JFXA 2NTFB 2D03H 3L1OL 5KSBA 3B3IB 1LMKA 3BPOC 4TPRL 3TNNA 5MENB 3LHPH 3FFCE 1NCBL 5F6HJ 5DK0B 4NUGL 5GS0L 5HVHC 5F1KC 1WISA 2BY0A 2GUOB 5A2LH 4BSVB 3OR7B 4OAWB 1FZKA 3PP4L 5E2UL 1OSZB 4LCCC 4HUXB 4I0PB 1RAMA 4V1DD 1TCMA 2IH3A 3O11B 3T2NH 5D1XC 4NT6A 1FNGA 1CXKA 1QYGH 2C3XA 3AS3A 4OSUL 3RHWF 2IBGA 1OAKL 2NLJA 4YC2B 1I7TA 1AD0A 1JI2A 2JKXA 4Y2OA 3DWTA 4HPYH 4F15B 2IFGA 3WO3B 4Q9QH 1BOYA 4HF5H 2CXGA 1UWXK 3QUZB 1BVLB 1S9XB 4OZHF 1NCTA 3L3HB 1NBZB 3QNXB 5ID0B 3NGBC 3C5SA 1AJ7L 3IDXH 4LHUA 4ZD3L 1S7WA 3NCYS 2Y7QB 4I18B 3ZDXE 3T8XA 5JQ6L 3VD9A 4YAQB 2EDRA 1Q0XL 1QOKA 1FLRL 3PL6B 4L1HA 3RL2B 3FONA 5DJAA 5E7BA 4DW2L 1LO3H 2HFEA 4RAUB 2V2WB 2UVEA 4ZQKB 1BMGA 3SKMB 4BSWA 3U79A 2K1MA 3MX0A 5EWIL 4HC1H 3GSQB 3KJ6H 4WY7L 4O02L 1L6XA 2AXHA 1GC1C 5JLZB 2IG2L 5E6ID 4YGAB 3SDAB 5H37H 1XH3A 4NKIL 3WBDA 3AUVA 5I1DA 4NQTA 1U8QA 2QKIB 4UTBL 1W8OA 3CVIL 5EUOF 3QFJE 4LOUC 1FFPB 1FNSL 2IPKB 1T6VN 2X4QB 4YFEA 4XNMB 1GHFH 5HBBA 1OAZH 1F02I 1ADQA 4PGBA 2Q8BL 4X5LA 3GSRA 3KPSB 2Z35A 5HGDB 1Q9LB 1RQ5A 2ADIA 3T65B 2R69L 3PWNB 2O26U 4QNPF 3L95A 1WC7A 1A9EA 2R4SH 3EYFB 5IHUH 2X89A 2YK1L 3SKOA 3EO1B 1JPGB 4H5SA 2XY1A 1EPFA 2X4NA 2EIZB 1FL3A 1A0QL 3TBWA 1T2QL 4HH8A 3ARBC 4X6FB 4K2UH 5JW3H 2FWOA 1Z9MA 3EYVB 3F7QA 3HPLB 2FO4A 3MBEC 4OI7A 4NWTH 5F3BB 4OZIB 4PJ5E 3GMMB 1C08B 3D18A 2DL2A 4R6UA 5HYQA 1NC2A 5SWSA 3NCBB 1QSFA 5IVZB 3OKOA 4UT7L 5DD3L 5EFIB 1CCZA 4R9HA 4LRNH 5IGXL 5IFAL 4OV5A 3FO2B 4KDVA 1P9MA 1DBBH 2Q87A 2PYFA 2W1NA 2G5BB 4NNPH 4MJIB 5EU4A 4UIKL 1A2YA 1J1XH 5D1XD 2OCFD 4TSCL 2EDNA 3D3VB 4GRWF 1CFNA 4ONFH 4FFWC 1JGEB 3ZSSA 3ZT6A 1I3GL 1YPZF 5GGTL 1IAIH 3LRHA 3IU4H 5I8EA 4ZXBB 3RWGA 1JGVH 3FHAA 5I75C 1QFPA 4XRCB 1CICC 5F88B 4MZ3A 1TCRA 1E4XL 4HV8A 3RA7L 4LF3B 1V3KA 3W9EB 4JPVL 4FQCL 2ICWJ 4IIQC 1X3DA 3C60A 4HS6A 1G9MC 1BD2D 3P0VL 5GS1B 5EUKA 4GSDH 1Q94A 2X44D 1MIMH 4AH2B 1U3HA 2Q7NA 2XXMB 2HH0L 4NQDD 5D2NB 3PJSA 3TPUA 2DOCA 3KHQA 1ND0A 3OKDB 2HFGH 3DUSA 4FXKA 1DQJA 2PO6C 3TIEA 4Q9RH 3MRDB 4OF3A 1MCHA 4YHLL 5C86A 4XC3L 3RWFB 4ZODA 4CMHB 1G0XA 2CDEB 2UYLA 3OR6A 3RGHA 1MQKL 3DTXB 4M8QB 1PKQE 4M7ZC 2K3TA 2XZQH 2ENYA 1S9WA 4EI6B 3KXFE 2OYPA 5C0GB 2R8SH 4LOUD 3JTSA 2XXCB 5I18L 5M95B 2DQGH 4G9DB 2DM7A 2XRAH 3AREA 3VXQA 5IQ9B 3O3AB 2R0WL 3S96B 2BSTB 2BK8A 1EAPA 4BZ1H 4KKNA 1D9KB 4UQ2B 2XN9E 2OXHA 3ZDYE 4UNTA 4MD5A 2AJXH 4U1JA 3QHZH 5DJXA 5I1KL 3GDBA 2OZ4H 4TVPL 4F9PC 3KWWB 4G6FB 4XAWH 1CGVA 4RGMC 3T4YA 1UH2A 3HAEH 2ZJSL 5E5RB 4NO2B 3P30H 4X98A 2PYEB 3CXDL 5H35A 1CD1A 1LDSA 5DJDB 4UIMB 4F7EB 2OTUB 3RWIB 4PJ8A 5I0ZA 4LMQI 5FKAB 4GAYA 2EYRA 4YBLB 4IMLA 4LP5A 3MBED 4GRMA 1AR1C 3BMVA 1X5XA 2YKLL 3RVTD 3EO0A 4Z76A 3A6CH 4LKCB 2AKRA 2YD2A 4JGMA 4LSPH 4XP5L 4CVZB 5JIPA 4PLJC 1SJEA 4YX2L 5TDOB 2SEBA 4K7FA 1ITBB 4F7TA 3LKSB 5HVGB 3SY0B 4DN4L 4DKDC 4ERSH 3QEGL 4NBZB 4G80B 5IW1B 3GIZL 4DOHE 5F9WB 2F53D 4OLXL 2R39A 3OHXA 1UM6H 4PRPA 4G8GA 4ZPTB 1CTOA 2IFFH 1Q72H 4PY7A 4P3CH 3X12B 4FFWD 4UV7H 5C0FB 4PY8J 1AP2A 3DETC 4HZLA 3VXOB 5FIEA 5E1AB 4F3FB 4RIRA 1YEIH 1CICD 2GYSA 4LSTL 5F7DA 2YMXH 1CQKA 1BOGA 2VLLB 3DYMA 4OKVB 4HKJA 3WFDL 3R06B 4OFVA 2P45B 4EBQL 3MLUH 4KKBC 3OSKA 1VADA 5M7QA 1IGTA 4JRWA 3NA9L 2A83B 3MLSL 3BP4A 1JHLL 3U83A 2D7TH 3ARDA 1JI1A 4NHUB 2VDRH 3QAZB 4PJIE 4LSSL 3IAQA 4JY4A 5IEKB 1CD9B 3TO2A 2QQKH 3DIFB 3QEUA 5DUPL 1RZJL 2CKBA 2PW2A 5DF0A 4BJLA 1NMAL 3ULVF 3SO3C 2WWKO 2V2XB 1WIOA 3SQBA 4TUOB 4YFDB 1WF5A 4JRYD 2E9BA 1E4WH 4DJMA 5IMKB 2EO1A 4I2XE 5HVWA 1T22A 1EEZA 2NPLX 1NEZA 3CLFH 5DD0H 1ZLSL 4ZUWA 1YYMH 1SJVA 3UEZA 4WI4A 1HZHL 1C5BL 1YYLL 1K6QH 1YC8A 4TQEL 5J9PA 4OGXH 1N5YL 3QDMB 3RNKA 1IQWL 1DEEB 5CHNA 1SY6H 3HE6B 4NPYB 1XR8B 2HN7A 3AAZA 1DBMH 4XNXL 4OCRH 3VW3L 2APTA 4HLZG 5E94A 3VXME 2LVCA 4J1UB 1J11A 1BFSA 5E2WH 2FX9H 1RJYA 4Y16C 1NKOA 4PRDA 3F5WA 4FQLH 2DQCL 2VLRA 1MCDA 3BWUC 2UV3A 5D96C 3UTSA 2XG5A 2P5EE 1T3FB 3V0WL 5EA0H 5FDWA 4PG9A 2EIBA 2CO7B 1OWRM 1KV3A 1U8LA 5F7HA 3VWKB 1RUAH 1FZKB 5I0DA 4NZRL 4RMWA 3T1FB 1GZPB 4UDTB 1DBJL 5HDQH 4PLJD 4JREB 1GXEA 2VZ1A 2JJSA 3EOTH 3SDDB 1A5FL 2YWYA 4HWBH 4JFZL 3WNNA 1P7QA 3EDDA 2OM5A 4N8CH 3U7WH 3N1PC 3QSKB 5CS7A 3DXAB 3SGDH 4PJCA 3BD4A 3GMOB 4KWUA 3H7BB 3HI1A 3QUMB 4R4FH 1U2HA 4WUUA 1M7XA 1QRNB 2CR3A 5D6DC 4TSBH 2X5PA 3B43A 4XVTL 4M61B 4XWGH 3DETD 4JG0L 5TE4H 2OX5A 3MYJB 5T5NF 3SDCA 3BP6B 3L5HA 3QQNA 1DN0B 4BFIA 4P2RE 2IQ9H 3NIGF 4M7KH 5DI8B 4POZC 3D87B 4HFUH 4KKBD 2DTMH 3U1SH 1JGUH 1JTTA 4BSWB 2VDKL 4OT1H 4QRTB 5EZOL 1FFRA 4GQ9H 1NL0H 1H5BB 1HHKA 4NNYA 3RWEA 5F9JB 4LRIC 1MF2H 1IGCL 1CGXA 1NQBA 4N0FB 5IR1B 1QSEA 5FAAA 2F74B 2WBWB 5FOJA 1WWWX 4ISVA 5LWYH 1XH3B 4D0DA 4GBXB 4U6XB 5EOQH 1I7UA 5EU6B 5IIEB 1FAIL 1FN4B 4KAQH 4F57H 3ABZA 4LGPB 4JFEA 4L9LB 3VDBA 4PGBB 1OVZA 3L5XL 3RBSA 3N1MC 1J8HB 2VABA 5DFWH 1F4XL 1ETZB 4YGVA 3QUYB 1A9BB 5LVEA 4KUZL 1MFCH 1S7VA 3BE1H 1U36A 3H8NA 5HGHB 4M9PA 3C9NA 2NY0B 2QV2A 3TT3L 3VRJA 4G9FE 5IP4A 2J8UB 4HJJL 4O2FB 4KTEH 4NWUL 3E8UH 3KPNA 3EFFB 1BBDL 1GAFH 4WV1B 2CK0L 4YDVB 3IDYC 4D9QE 3FQTA 4NN6B 3TC9A 4Y16D 3RP1A 3SBWC 5ENWA 3FQXA 4X9FA 5MEQA 5FYKE 5JMOC 3K2MC 5D4QA 5DK2A 3TYFA 3DMMC 1YY8A 3K2UL 1B4JL 4GJTB 3GNML 3MLPA 5MEPB 2CR6A 1OCWH 3WNOA 4IRZL 4KJYA 4OCSH 3SQOH 4OZHE 5DJ2B 1ADQH 3SCMA 3RY6C 4P2QE 2EE9A 1E6JH 2VZUA 3L5WA 2HJKB 3BP5B 2EO9A 4XGZA 3W81A 2Z92A 5A2KH 1G84A 1OB1B 3BKMH 5T1DL 2YUWA 4P4RA 3PABA 1INQA 1FO0L 4KGLA 2EH7H 3NTCH 4RGNC 1OGAB 3CH1B 1KJ2A 2D31A 1C16A 4HV8B 1P53A 3VWJC 3O4LB 3NCFB 2PTVA 3O3DA 3C5ZC 1IM9D 2FB4L 1RFDL 3EOBA 4NHCH 1K3ZA 3QXWA 2WM0A 5IB2A 2EYTB 4X6EA 4POZD 5EUOE 4L8BA 4RBPK 4ZAKC 2ICES 5GGVL 2VTFA 1KCUH 2E7HA 1YY9C 3FB7A 4MMZC 3PJSB 1R5VB 5TFSL 5DFTA 1Y6MR 2A77L 2Y25A 5GSVA 1P4BH 1QTYT 3IF1A 5C8JA 1DQMH 4XVSH 1JUFA 4P57B 4MA1B 2UY7A 3T77A 3CDGB 2Q8AL 5JUEL 4QNPE 4LLYB 3VA6A 3Q2CA 3VXPA 5JHDB 4WI9A 4D0BA 4N1EA 1HH9B 4MNGB 4XC1H 3LH2H 4ZFFA 3CXHJ 1RZKL 3O2WL 5IBUG 1DQDL 1BQHG 2RR3A 4R4BB 4R7DB 1I1AD 3OB8A 1Q38A 3O45A 1MVFA 1CLCA 1LO4L 1NAKH 3VI4F 2CK2A 2E8YA 2IAND 3TV3L 2ATPA 2DLIA 4JZJB 3H9SE 1CDJA 4HBCH 2YUXA 2NY1B 5DQDH 4EN3C 4JFOA 3NAAL 4A6YL 2E9JA 2HVJA 5T3ZH 3BZEA 5KVGH 3WFCL 3AB0B 3KLSA 4U05A 1MIEL 3CVHL 3X3GH 4C56D 5B21A 4HIEB 5H2BA 3DGGB 2GT9A 3C6SB 1EEQA 3HCVA 1IL1B 4JKWA 4GAYB 1ZEAH 5L2KA 1L0XA 5FO7A 2ESVB 4QRRE 3BYYA 3O2DL 4OZGB 1MRCH 4V2BA 4GRWE 1URLA 2BVOB 1S7XB 1RD6A 1YPZE 3HRZA 4G6JL 3DMMD 4NNXB 3VGDA 4Q74A 3BDYL 3IAPA 3EDJA 3LY6A 4KI1A 4L5FH 1I7RA 3Q48A 1QBLH 4G5ZL 4LASH 3P4MA 5E24E 2ATKA 4M6NH 2QLVB 3TFKC 3V4VL 2AJUH 5IQ7H 3MV8B 5B39G 4Z78A 1BAFL 3QCUH 4LMQE 5C09E 3ULUF 3QISA 5ANMA 3E3QE 4NFBA 4LCIL 4PJXB 4Y1AE 2G2RA 3FQUA 1MEXL 4HZLB 4GMTH 2AI0H 4L8CB 3P77A 1QEWB 3GMRB 2YBRA 3ZL4L 2E7CA 4RGND 2BCKA 4NQCB 2QSCH 1CLOH 2P8PA 3VRIA 4OI9A 1OT1A 1C5DA 5IB5B 4FMFA 3C5ZD 1IGTB 3MRGA 1WWAX 3B8SA 4K7PL 1OAYH 3BKJH 5D1QB 1TQCB 1K4CA 5DS8A 2ZPKH 4OUUB 1ED3B 1CI5A 3MRNB 3SGJA 1WCBA 5C6PB 5C0EB 3HFMH 4ZAKD 4APQA 1M6OB 1OSPL 4IBLT 5F8QC 1CXHA 3QPXL 1YY9D 2I26N 5AZEL 1JNJA 4JGUA 5J56B 2Y06H 4MSWA 5D1ZC 3Q3GA 1QNZL 3CC5B 4LEXL 3PQYE 1CLZL 3QZWG 5GRUH 2QQLL 4YO0B 4AEHH 1CE1H 1PFCA 3RY5A 2OR8A 4MCYA 4LGRB 3S97C 1UQSA 1ZHKA 3AFLA 1EEZB 3BEWA 5JW5A 3NCYP 1S78D 1MWAL 5I8OL 3O2VH 4ZNEA 4PUBH 2BC4B 2XNAB 2QR0A 4KQ3L 1EHXA 5HHMD 1FDLL 4OCNC 3UTTE 2LU3A 2BX5A 4I9WD 2A6DB 5TE6H 4MWFB 4YHKH 5KVDL 3O0RH 3HC0B 2JB5H 3HE7A 2I9TB 2FR4A 1M4KA 1J9CT 3THML 3ES6A 1GGUA 4LLWB 4E9LA 5E94B 1MCFA 3VFWB 3SDYL 4EN3D 1OP9A 2GJ6B 2X4PB 1PD6A 5D9SA 3KLAB 3EJJX 4O2EB 1KC5H 5L2JB 2I25N 5DJ8A 2CDGB 3F5WB 1IGJB 1ORSA 4KRPC 4LNRA 1RK0A 2R1WA 3EYUL 4M62H 4N0CC 1PBYA 4F2MB 3RUGA 1R3HB 1QFWI 1AY1L 4K9EH 2HVKA 3TBSB 2FEDC 3WS3A 4EUPA 4NQEA 2C4XA 1PZ5B 2NY7H 3HR6A 3L3IB 3SJVB 2BNQA 1JF1A 4XB7A 5EPMB 2X4OB 2A74A 3H42H 4Z7QF 5FYKU 1UWEH 3SE4C 3PWPA 3H9HB 4JKLA 3CFBB 2UZIH 5ICXB 5EU5A 4CNIA 1FGVH 2LTQC 5I15H 3GI9H 2WP3T 5J6HB 3TFKD 1CZ8H 4JQVA 4PJEB 1HEZB 1I7ZA 4TSAH 3PGFL 4U1GB 1SMAA 3N06B 2ZOLA 3TVMC 1CFVL 3MRCA 4G42B 3LKPA 4KHXH 5IBLC 5C6TH 5FDYA 4OLWL 4Y4HC 3UO1L 4BQ8A 2LU4A 5GISL 7FABH 1LO5B 2Q7YA 5D7LE 2BVQA 3VXUE 1EK3A 1WFTA 4JJHA 5HI4C 3ULVE 4MNQD 5BW7A 1KEGH 4L29B 1ZGLM 2NNAB 4NC1E 1HHKB 4XP9L 2MMXA 4RMUA 3HTLX 4Z6AT 4U1HB 3C8KA 2FH8A 1AR2A 2OSLA 5E4IA 3LQAC 3RGVC 3U48A 5CILH 1DZBA 4F7CB 5D1ZD 4O51A 1I7UB 1V7ML 5K9JL 4IRJA 5HHOB 1G6RB 1U91B 3QUXA 4X6DB 3G6JB 1UXWB 2AEQL 2ITDA 1B4RA 3WHE0 1KELH 2V7NA 1JYNA 2AJZB 2W9LA 4R3SA 5FO9A 2R29L 4EXPX 4YFLI 5I66A 4HUVA 2QHRH 5I1LA 5E9DA 1W0VA 2JF1A 4P23C 1O0VA 1D5BA 4XVJH 3TGXA 3EYSL 4N0UB 1OTUC 4WTXA 3T2QA 1KYOJ 1CE6B 5B39A 2FHBA 3DVNA 3F8UB 1CL7H 4JFYA 4WUKL 3VRJB 2ERJC 4PJ9A 1N6QH 3W82A 3GSWA 2Y36L 5EO1A 5ESAB 5CMAB 4RX4A 3CFJB 3RPIB 5ISZB 3L3OB 4U7MA 2VUYA 4WU5B 1MHHA 1TZHA 5E8OB 5DJ6A 1CFQB 1R3IH 4F80A 3F6IA 1I1YA 4RMQA 1CG9A 3LB6C 4HQQH 4RMVA 3GIVB 3LV3B 1CQYA 2VXUH 4L4TA 3O6FC 1KB5L 4KRPD 1ZA3B 3U36B 4P49A 5MEQB 5K93A 2V5YA 2ZCKL 4N0CD 2NX5E 4ZSOB 1CK0L 4YK4C 1A14L 4GRLA 3TA3C 3VA2C 1A3LH 3ZYOA 2FEDD 3ET9F 1NC4A 4S11A 2CSPA 3CLEH 1MREH 1D5ZB 2EYSA 1UA6H 3IJHA 2X7LB 2EDLA 1TVBA 3QZWA 1S7QB 1GC1L 3FN0L 4NM4L 4TOYL 2PXYA 4I48B 5FCUH 2GITB 2XQYK 1I3RB 1ACYL 1YEEL 1U8PA 3NIGE 5D8JH 4X0KA 5IEHA 3BKYH 4K3EL 5BVJB 4U6VH 1F4YH 5EC1B 2FJFB 1U92B 1NBVL 1KIQA 1R3LB 2X9YA 2BRRH 3MRHA 4JLRB 2Y5TB 4HH9A 4FQJH 1EERB 1KJ2B 3I2CH 3QDJD 2VE6B 4RWYH 3T0BA 4LCWD 3U46A 5TDNB 3TVMD 1U58B 5IBLD 4MQ7A 3HNSL 3KDMA 4KTYA 3EOBB 1MFEH 4Y4HD 3U7YL 3AC0A 3C8DA 5DMYA 3ELAT 3K46A 4Q2ZB 4JFFE 4FHBD 4GW4B 1VCAA 4J3WA 4TUJA 1XAUA 5HI4D 2MCG1 2W0PA 4OCYL 1KTRL 3N1GC 3FB7B 4D0CB 3VXSE 2IWGA 4AJ0A 2P49B 3L3KA 1NCAL 5IBTL 3VFSB 3KPRE 4K23H 3MRFB 4D9LL 4K3JH 1T1WB 1JUFB 1NDGA 3PDDA 1XF5B 2XZCH 3RGVD 4QGTA 4UINL 2V2TB 1HHHB 3VXPB 4GFTB 4FTVE 3QIUC 3WCYA 5CJOL 1JZ3A 2EDBA 4BFEA 5K9OA 5HYJE 4ZUSB 3GHEH 5DRNB 4PTUB 1FRGH 4X8XA 3O45B 1CBVH 3U0PA 3ME0A 4P23D 5T1KD 1DEDA 1KJ2H 2H3NA 2QBWA 2EXWC 4K8RL 3BD5A 1OTUD 4PJDB 4JFOB 4LLDA 3NZHH 2GTZA 4Z7UF 3E2HB 5CKGA 5F1IB 2AGJL 3LZFL 4RMSA 1FIGH 5GHWH 2VWEE 1RJLA 4RDQF 3KYNB 4RA0C 3AS0A 3WN5C 1KB9J 4JFHD 4GKSA 1RIHL 4HLZH 3QXUA 5EZJA 1TVHB 1IARB 5C7XL 3LB6D 1YMMA 1BLNB 3OXRA 4WI5A 1T03H 4Y19A 5GSRA 4K3DH 4ETQA 3O6FD 1HDMA 3FT4A 4UDUB 1T4KB 4PJAB 2R56H 3DX8B 3MACL 4UUJA 3HI6H 3MV7D 2Y07L 1BF2A 4JM4L 1ZANL 1JZ8A 5B8CB 4UV4H 3WD5H 4OZ4A 4H1LG 2A6KA 3KLHD 1AGFA 3BH9A 4O00A 4PJFB 2UZYB 2QQNL 3I84A 1FC2D 4V1DB 4F9LC 4QTHA 5CSGA 2VLKE 4FNLL 1NCDH 3P77B 3V5KB 3IT8D 4P46C 2FBJL 3UBXI 4L3EA 5FYJH 4LDLB 5E95B 2OI9C 3MSPA 1IKNA 3VRIB 4X7DC 4YHYB 4G7VH 1D6VH 3KPPB 2VAAB 3SPVA 2D7OA 1QBBA 1SJHA 1AXSB 1WT5A 4M48H 5C0AE 4JO2H 1BREA 3SE9H 4O2CB 4FABH 4FFVC 2N7AA 5L6YH 2HT3C 2HTKC 1ZHLA 1EO8L 3I02B 4UOJA 2CIKA 4APQB 1A7NH 3VG0L 4MJ4A 5F44A 1QVOB 2GKIA 3B9KA 1RZIA 5FK9A 4U1IA 1S7TA 4RGOL 1HINH 1NDMA 1WLHA 1T21B 4IMKA 1CWVA 2EDXA 4HK3N 1MRDH 2VQ1B 3DARA 4IS6A 4XNZC 3HB3D 5J1SC 3VI4E 4O9HL 2ZNWA 3JTTA 3HS0B 3DOSA 5IVOA 1BQLL 2O93L 2AJSL 5JW5B 1S7RB 1C1EL 5DRWB 1LO0H 5E6IB 3GZKA 4DKFH 2XKNA 4LSRL 3W9DB 4Z0XA 3ARFC 1FGNH 3MROB 2E7LC 4WFGE 3IGAB 1VB9A 4WDIB 1D5XB 5F7WC 3ORJA 4Y5VC 4HUKB 2VDNL 4R97B 5ID1B 2EXWD 3BAEH 3HE7B 4QXTA 4WFHD 1RHHA 3CX5K 1GRWA 5KVEH 2ED9A 1JYVA 2DLTA 4ODTL 5AZ2L 1HH6A 2NZ9C 3ZYZA 4B7IA 1AXTH 3IDMB 5DGRA 2C3HA 3D9AH 3V6OE 4HCRA 1AKJA 3HZMB 3IFLH 1G7LA 5KG9B 4PBXA 2H6PB 3MLZH 4XPHH 3W0WE 1BM3H 3ULUE 3IJYA 5GGTA 1JL8A 4G7YH 3ZT7A 5FYLE 5EIIA 4W4OC 5HPMB 3BPOB 1AHWA 4YDLC 3QO0A 4PR5B 3REWA 3RUGF 5HVHB 5CD5C 1MFBL 2CPCA 4M1GH 5CEXB 1I7ZB 3HZYB 4G8GE 2XQBH 4PB0H 4MAYA 1IC5L 5JR1H 4C55A 1INEL 1BJ1J 2ZOLB 1FHGA 1SYSA 1F00I 4LCCB 5KVFH 1CU4H 3AY4A 5JPMA 1NCCL 1BQHB 2RFXA 3V7MA 5D1XB 3FO0H 1J1PH 3OKNB 2ICEA 4P46D 3BRFA 3MOQA 5HGBA 3QO1A 5I1EH 5CWSB 3P4NA 2O5ZH 1IAMA 3BW9A 3QJHB 4U1NB 3N1QC 2FD6L 3WFZA 1VFBA 4L4VA 5SX5K 1A02N 3HC3L 5CZKA 1PG7L 5IHLB 4ZO7A 1A6PA 4K94L 1ZA6B 4PS4H 3NFSH 4FFVD 1M05A 2AJVH 4C59B 2HTKD 5L8KB 5F72S 4OZIF 4AY0A 1NGQH 4HSQA 2JK5A 3EGSB 4TRPH 3WE6A 4Q97A 5DFVC 4XPAH 5E8EA 1BD2B 3NCCB 4LAJH 1DE4B 3FOLA 4X7TA 3TO4C 4YLQT 3TWCH 4WCYL 5FF6B 3GB7B 1IAKA 1I8KA 2GQHA 5FO9B 3E6FB 4NQDB 4M43H 2Z31A 3REVB 2M8XA 2MCPH 1A4JB 4PPTA 2R1YB 3P9WB 5BMFL 4MJ2A 1JHTA 2GSIB 5DHVB 2H26A 1FFQA 2MHAA 4H1LA 4S1QL 4WU7A 1LEIB 4J2XA 3C6LA 3ARFD 3KJ4C 3S35L 5AYQA 2CRIA 3MRPA 4M7LH 5ITBL 2VIRB 5BO1L 2AS5M 4OM1L 4XWOC 4MLIA 1T20B 5EO1B 1R24B 5FA4B 1MCRA 5FFLA 3H3KA 1IKFL 2OP4H 2P24A 3L7EA 2KQNA 5J3HC 4X4XB 1QPXA 1I1YB 1CG9B 3WXVL 2NZ9D 4N8VB 4PJ5D 5FGCB 1UZ8A 4P59H 4L4TB 3ZKMC 5CEZE 1MI5E 4M5ZL 2CJUL 2NY5L 1LK3L 2IQAA 5SX4I 3X13A 5DJYA 1Y0LA 3VI3F 1ZVHA 4ONGL 3SEPA 2VXSL 4LPUA 4DWHA 3FB8B 1KJ3H 3S88H 1HILB 3QHFL 2KBGA 4PRIA 5I1HH 1CVRA 4H0IA 2DQJH 2V5RA 5ADPH 4DN3H 3OB0K 1S7SA 3OF6D 2V17L 5FUOH 1G7MA 1KT2B 3PHSA 2VLJD 3BZ4B 2AV7A 4LSQH 1WTLA 5CD5D 1ES0A 3LEYL 2ZUXA 1RV6X 5ESQB 1AI1L 3IFPA 1FZOA 3BPNC 1FAKT 5FYKL 4OLVH 4KZEL 1RZ8A 4NCC2 4U0RB 2F53B 3UX9B 2Y6SC 2J3SA 4EI5A 1QKZL 4OCXH 4U6YB 4BKLB 4OTXL 5ECJE 4JRXA 2GJZB 1U3YA 2BFVH 4G6ML 2MFNA 4JZNA 4UOW0 3T4AA 5I75B 4FMKA 4LIQH 5C2BH 4OKDA 4LCUA 4XMKH 1KFAL 1CICB 5F7YC 1QFWM 1VHPA 3L3KB 1DSFL 5EC2A 1QSEE 5LQBH 2XKSA 3L3DA 4KK5C 1F3RB 25C8L 3FKUS 2JCCA 3VDAA 1H8SA 3KXFD 1B2WL 4Z9KB 3TO4D 1L0QA 3HZVA 3ZO0A 1MCOH 4RFEB 1UKSA 1V3LA 5L9DH 2V7HA 5D7KD 1FCCA 2AJ3A 2XOTA 1KACB 5CFHA 3U0PB 3S34H 5C9JA 5E2VL 2GK0B 4R26L 3CSGA 5IVNA 2I5YH 4J4PA 1JNLH 4Z95L 1N4XL 3FOMA 3WJJC 4JR9H 1YNLH 4JRYB 1AD9B 1M7IA 3MGOB 3GM0A 3LIZL 1IM3B 5EOTA 3WEXA 3DURA 3BHBB 2HG5A 1XGRB 4XWOD 1J1OH 5ESVB 4PB9L 2AK1H 5E7FA 2OQJA 2X10A 1UFUA 2KDGA 4CJ1A 3WL9B 4GKSB 2VDQH 4R0LA 5J3HD 1KSRA 3HPJB 1RIUL 2ZG3A 1G0DA 3OXRB 1HKLH 2WQ8A 4OD1L 1NGWB 1T7WA 3BX7C 4A2LA 5IHZA 5HHXL 3ZKMD 5D70L 1J5OH 3AXLA 4I3GA 1MAJA 4RGMB 5IOPA 43CAB 3VGFA 5CBAB 3KPOA 5T1LD 4FQXC 3ILPB 4MS8D 3KHOA 3TCLB 3JXAA 3LQMA 2P8MB 4WW2C 3ULSB 3GJFK 4TPRH 2VJXA 5JW4M 3W5NA 1Q1JH 1N5AA 4L3EB 3WFEL 1NCBH 3RWJA 4G8IB 4NUGH 5GS0H 2UWEB 1TJGL 5ICYA 4JFDA 4OFPA 5HHPA 3V95A 5D6CA 2Y6SD 1SJHB 1W0WB 1Z6JT 1UXSA 2BOBB 3PP4H 4HMDA 4ZUUB 5C0DA 3UTZA 5IWLC 1ZHLB 1X5FA 3FQWB 3EYOB 1H3VA 2W0KA 1ZWIA 1EO5A 2D7NA 4OSUH 5J0BA 3OGCA 4ELKB 4U1IB 3P3YA 3U9PL 5HHVL 4M4RA 3R0NA 4XX1E 1J86A 4MXQC 5LG1A 5DEFB 4D9RE 4KK5D 4YEFA 3QIWA 1FZMB 1CFSB 5DUBB 1OW0A 1JGLL 4ZG1A 4ZD3H 5IMLA 3QQ4A 3UJJH 4FA8A 5JQ6H 1CT8B 1P6FA 4Z7UE 2VL5A 1Q0XH 3PWUA 5TF1H 2VR9A 5J1AB 4AEIL 1FORL 1FLRH 5JDSB 5MI0C 5JO5A 4DW2H 1CLYL 5JOFA 3LKNB 1GOGA 1C8PA 4H0GA 3SO3B 5JA9A 3NACL 2P5WE 1A1MA 3LQZB 5EWIH 1XGPB 3SGDI 4ELMB 4YJZL 4ODWB 4O02H 4QXTB 3JVGA 4YDIL 1FCGA 2H32B 3L3JB 5BVPL 1RURH 4I0CC 1L4IA 1U93A 1KIRA 4M03A 3VD7A 4QRPE 4NKIH 3UYPA 3QG7H 4GG8B 4UTBH 3D39A 1QR4A 4HFWA 5IB1B 4C83B 4QYOB 4OM0L 2Q8BH 3WDHA 2W0LA 3C2AL 4N0YL 5F9AC 2PTTB 5F93C 3S4SA 1Y6NR 3V4PH 5EIIB 2AEIT 1V05A 3F7VA 2ZZUT 5E8PB 1CYGA 4JHAH 4Y16B 3V6FA 3QWQB 5B38G 2WLYA 1ZSDA 4XPTL 1FO0A 4I5BB 4FQXD 1Q9OA 4R7NB 4ENEC 4YC2C 1FG2A 5I8CA 4MHHI 4NZJA 2AVGA 5ALBL 4ZS7H 2WBKA 2XZAL 1GGCH 1TITA 3LPGA 4YHIB 5FV1L 4TULL 1L0YA 2VRAA 3IJSA 2B1HH 4FP8L 1I8LC 2F54A 2VO5A 1DTUA 4EDXA 4XP1L 1A7BA 3T0EA 2ICEB 4QTIH 1HQ4B 4WGWB 5DJCA 4NCC1 4WHDA 3RZCA 5E00A 2AXGA 2J8UF 3BW9B 5LCVH 3MRKA 1CXIA 2XIDA 5DD3H 3ESVF 1FVCA 2YPLA 4LFHD 5IGXH 5IFAH 4HCRH 4UB0L 4GUPA 4KJQC 3V5DA 4Z7VA 1IT9L 2NCMA 1UCBL 4UIKH 4BQBA 5E70A 2XI9A 3SDAC 3ARYA 4GMSL 1IM9B 4TSCH 3BRDA 3F58L 3RI5K 4ZO6A 4QHLA 2ADFL 2VERN 5LGJB 4PJBB 3PGCA 32C2B 4OF8A 4NSKA 1C5CL 1A6ZB 3FT2A 4MXQD 2NY3B 3VFRB 4BQCA 4WW1A 2ITCA 1KLUA 4K3HA 4JPVH 4FQCH 4A6YA 4M6AA 1LEKB 5GZNC 3MXWL 3GSNL 3CVHA 1X6LA 2BDNH 4UTAL 1U3ZA 1KEMH 2W92A 4Y2DC 3NFPB 2EH8L 4E41A 3TZVC 1AGCA 1PSKL 1MJUL 3TT1H 2R2BB 5DMKB 4WENB 3O2DA 4MX7A 3GMLA 1Y6KR 4IRSA 2XWTA 1I1AB 3RVWC 4YHLH 2PR4L 4QEGA 3MNZB 4XC3H 4F7PA 1IGIL 5IG7A 4YHPB 2OS7A 1E4XI 5I73C 5JOEA 2IANB 2E6JA 3D69A 5GJSH 2F9BT 4XNUL 1MFDH 3QUKB 3U2SA 5L7XL 3TEUA 3WS6A 3X13B 3LN4B 2H41A 3H0TA 4UQ3B 3RUGE 1NFDA 3KPSE 1A6WL 2BMKA 4C56B 2ARJA 3RIAK 4NQEE 1LE5B 1ODAA 3C5JB 1MELA 3AU1B 3LKRA 4NO5A 4PRIB 2GAZB 3ARGC 4MA7H 4WI2A 3ZHLA 3E1F1 1DFBL 1G7MB 4ENED 5T1MA 3PWPE 2I07A 2ZJSH 3LQAL 4KROC 1JTOA 3CXDH 6FABL 4H1LH 1B3JA 3FFDA 3DMMB 4MNHB 3FB5A 3LS5L 3BDBA 3MV9A 4HUUB 3MRLB 2BOCA 4QWWC 1SVZA 2YKLH 4YXKL 4OZIE 4NRZA 1MAMH 2WWKT 4ODUA 1BEYL 1MCBA 4XP5H 1A1NB 2NW3B 1T0MA 1E27B 1T1XB 1YEGH 1U8JA 4CN4A 5HD8C 4P5TC 4QY8B 2CGRL 4RZCA 1UADC 4KVCL 3WHXB 2W0FB 2XWBB 4KJQD 4RGNB 4MJIE 1WBXA 2YR3A 3K0WA 5DD5L 3BO8B 4NQVA 1LNUA 4OZGF 4HIJB 2APXA 3RDTD 3C5ZB 1MWAA 3L3DB 2ZUUA 4X7FC 5DQJB 5AAWA 2MKLC 1H8NA 1XF2A 1MFNA 3OZ9L 4L8SA 2WSKA 1JNNH 4FQPA 1RK1B 1J12A 3OL2A 2Y5EA 1AO7D 2X1PA 4LSTH 1H15A 4OQTL 1HOCA 5INCA 1LHZA 4G43B 4JDZB 3F12A 4JB9L 4YDJB 3HR5B 3MLSH 1N2RA 4PJXF 4LBEA 2JCCF 3FOMB 3FRUB 2P8LB 3GK8H 4MCZA 3UPRA 2JJUA 1BP3B 1Q0YH 2IALA 2XA8H 5GZND 4LSSH 2VZSA 5HJ3B 3GRWL 1QLEL 2B4CH 4Y2DD 3OXSA 4DUVA 5D2NE 1RZJH 3TZVD 1FZJB 4HIXH 3VI3E 5TQ2L 4EOWL 5HHMB 3UYRL 3F7YB 1JPTL 3VCLA 3CAFA 4HGMA 4NJ9L 1J18A 1PEZA 1PQZA 4GKNA 3W39B 5I16A 3BUTA 3RVWD 1J0HA 4P9HH 1WICA 2CDFB 3U4EB 1J0YA 4HUWB 3PIQA 1SYVA 4O5LH 1H0DA 3PWLA 1ZLSH 1GJIA 1T7YA 2EDHA 1F58H 3FFCA 1F11B 3KPOB 5EIQA 4PRHD 4KY1L 3QR2A 4TQEH 2BNRD 3SE3C 4C4KO 5HXMA 3ARGD 4LEOB 2Q1EA 5C09D 5JXEA 1T5WA 3I75B 4CVWA 2R2EB 3VGEA 2DN7A 3G5XB 3VW3H 3QG6B 1MH5B 1NAML 3CFCL 3MRIB 4AYFA 4KROD 3VRLF 3LEVL 1UZ6F 4M9OA 5D5MA 3I3EA 4F33A 1R3KA 3ULVC 5A2JH 3GMQA 3R1GL 3QEHA 3IB4A 4QWWD 3G08A 1DQQA 5EULV 3GFUA 5F7MC 3QAZC 2MNUA 4NZRH 1LVEA 4DTGL 4LLMB 5IF0B 2EE2A 2H9GA 4Y4KA 4PRNB 5HD8D 2MJWA 3Q6FB 4P5TD 4KXZH 4BH7A 1ZLUH 3CFIC 1PX4A 2MTPA 1AQKL 3ZKSD 5CD3A 4W81A 3I6LD 3DHJA 3T2OA 1N8ZA 3MNVA 1YEJL 3QT2A 3CH8A 4MNQB 4WNQB 5DD6A 5J6GB 2LE9A 2HJLA 4NO0A 3HUJA 4X8JA 4XVTH 1M7DA 4X4ME 2DLFH 2XWJB 4JG0H 3SGEH 4BZ2L 4Q6IA 1NGPL 3IXAA 4NZUL 4JHZA 4LDEB 3VG9C 1MCWM 3STLB 2C9AA 4DVBA 1K5NB 3QFJA 3TH4T 1D5MB 4PJEF 3U0WH 5D1ZB 1OTSC 2DKSA 4NBXB 1BBJB 4XT1C 1S5HB 5EZOH 5T3XE 2G9HB 2VDPL 3VGHA 3JWNC 3LEXB 4UAOC 1GZQA 2WK2A 5HDBF 5CCKL 5E5MB 4PTTA 4PRAB 3VXNB 4JM2A 3IVKA 1KB5A 1UWGH 3BGAA 1MCPH 5I1GL 4HDIB 2VN4A 1R5WA 4J3TA 5FO8A 1FYTD 4YUEH 3MFFB 1UKQA 2HT2C 5ETUB 1SEBB 1TETL 4B41A 4IEFB 4KDTA 1YMME 4FZ8L 3L5XH 4OV6F 1KJMA 5TGBA 4KPHL 5CBEB 4HKBB 1F4XH 4JREC 5KTEL 5C08D 2ICWA 4JHWL 1MVUB 4WFFE 2OLDA 2ZCHL 5C0JB 4NZTL 3F7VB 3V6FB 4KKCC 4X6DF 1NCNA 1JPSL 3TT3H 4R96B 4PJHA 4KRPB 3QDME 1UM5H 3KS0H 4JAMB 4ALAH 3SKNB 3CMOL 1BBDH 3VE0A 2CK0H 3LMJL 3FRPG 3PV6A 3A67L 2AV1A 3GBNL 4H26A 1KXQE 2ADJB 4U1KA 1NSNH 3ULUL 4QHNA 1FFNB 2C5DC 4E42B 3HZKB 5E00B 2AXGB 4HIIA 1TVDA 2B0SH 5FYLL 3MRKB 3ULVD 1Q8MA 5EU7C 3DO7A 3RRQA 3M1BA 2LTQB 5HSFA 1YEHL 1BIIA 1CL7I 1H5BC 1ZLWH 1FBIH 2R2HA 4PP2A 3ARBA 4Z7VB 4IRZH 3RL1A 4Q9CA 3QDJB 1XR9B 4YPJA 1YNTA 3DV6A 4LCWB 1OHQA 2EKSB 2NR6C 4CL7A 2HFFA 1QFWL 1ZAGA 1A7PL 4Y4HB 1NUFA 1NBYA 3ILQC 4FQ2L 3RWHA 3FO9B 1JPFB 1QRNE 1CGUA 2C3VA 1EVTC 4NDMB 1RVFL 4ODHH 12E8L 4QHUA 5MERA 4AEFA 5DLML 1RFDH 2J1KA 4XZUB 4U1SA 1OP3H 2OTPA 2X4SB 2DM4A 4MD0A 1PKQA 3RGVB 3LD8B 2H2PC 4Z0BL 3QNZA 2R0LL 3EAKA 4X7SL 5HHQB 2DMBA 2BSRB 1OTSD 1WCQA 1LP9B 4ZFOB 3LRGA 1JYWA 2ZUYA 1J88A 4G3YL 1SHMA 5TFSH 4PGCA 1F4WL 4KZDL 2XN9A 2A77H 1KPUA 4NN6C 3P0GB 5EO0B 4XCFL 5DD1L 2NMSA 2OL3A 2EDDA 1AFVL 4IIQA 4P23B 3TP4A 5T1KB 1JNHB 2Q8AH 5JUEH 1FC1A 5FKPA 5EU6E 3P11L 4AZ8A 4RFNC 3R8QA 3BUYB 5DMJB 1CGSL 3P40A 2HT2D 1PAMA 1NLBH 5EORL 1TIUA 4YDKL 5DO2C 4LLAA 1J8HE 2VXQH 1P9MC 1NUGA 2YSSA 1QFHA 4YNYA 4NO5B 1LO4H 1NMBH 4NQSA 4OF0A 3RU8L 1IGFL 1R3JA 5IB3B 2H8PA 3PHQB 4XBEL 4ZFZB 4KKCD 2JIXA 1WFOA 3NAAH 3O6FB 1NFIB 3QXDB 2FIRT 2J8UE 4A6YH 4V2CB 3WFCH 3FTGB 4BH8A 1MIEH 1FL6A 5CEZL 4YK4B 1ZHNB 4U1LA 3KG5A 3MV7B 3FB5B 3MV9B 3QRGL 4LHUD 4QRSA 3KR3L 5IMOB 3C60C 1G9NL 3O2DH 4PJDF 1W72A 4QRUA 1RSFA 5EZLA 3KYOA 4KVNH 1P84J 4HAFA 5FUCE 4D8PA 1XGQB 5TH2B 1AGDB 3S36L 4ORGB 3BDYH 4N9GA 4ZTOH 1YN7A 3I6GB 3KPRD 1HYRC 4M6ML 3ALPA 1J05A 3HLAB 4DFHA 2NR6D 4XXDA 2OTWB 3V6BR 2GSGB 2P7TB 2YA0A 4PJIA 1A7RL 4LCIH 5AG8A 2OXGA 4PJAF 5HI5D 3ILQD 1S8DA 1U8HA 4ZOBA 4KRMB 3AREC 4BK4A 3NFNB 4BQ9A 1B0WA 3MNWB 1DL7L 5LXGL 3O4OC 3CZFA 3O4LE 3MREB 1JRHI 1A1OB 3MXVH 4TVPE 5B38B 1CF8L 2B1AL 5EOCJ 2XFXA 4QF1B 1N2RB 3HG1A 3OKMA 4X5WB 2DQFB 4K7PH 2DIBA 5F96L 2X89D 1ZS8A 3QNYB 3MA9L 4I2XA 1KPVA 1PGRB 4W6WB 4PGZA 4LVNC 4I3SL 1CVSC 2X4UA 1OSPH 1YEDB 4JQXA 3GKWH 3CCHA 3HNTL 4LARH 5I71C 1X5JA 4HG4K 4PJ8C 3CUPA 1VFAA 1MRFL 1QNZH 1CLZH 1P2CB 2P42B 2QQLH 2DD8L 4PJGF 1IEBB 1OLZA 1Z3GL 2IAMA 4IDJH 3VJ6A 1CGYA 5E8NB 5JHDE 1NC2D 3BIAX 5SWSD 3U4BL 3VXMA 1QSFD 3TNMA 1S5IL 1MWAH 2Z93B 3BVNB 5I8OH 1SEQH 2E8ZA 4MNGE 4BK5A 4ODXB 2FJGA 4KQ3H 5DO2D 3MJ7A 4GOSA 2DLEA 5F7EL 2P5EA 3WN5B 5AWNL 1VPOL 3IDUA 1L9MA 4NJAH 1E28B 2JJVA 2W65A 1WZMA 4OCLC 4NM8L 3SDYH 3CMGA 2KL6A 4NRYB 4HX1A 2WNGA 4OLYL 1CDBA 1K3IA 1HSBA 5I30H 4YIQB 1VA9A 3KNBB 2FX8L 1YEKL 2CMRL 1XGUA 1I4FB 2AP2A 2YA1A 3EYUH 4G8FB 3V7AG 1H3PL 2ESVE 1U41A 1N0XL 2APWA 3I85A 4NYLA 3C60D 3H3PH 1AY1H 4GXVL 3ARDC 4OZGE 5T3ZD 4PJ7B 4CUCA 1V7NL 3GJFB 5IFHL 2J6EL 1U3HD 2M2DA 4XCYB 4JCLA 4K9EC 5D5MF 4MXVF 4P46B 4P2RA 2RCSL 3U82B 3QFDA 2OI9B 4GG6A 3WNLA 1RY7B 5AAMA 1N64H 4GLRH 3MV8E 1HXMA 3D85D 1Z5LB 1MJ7H 1PLGL 3SOBL 5JPNA 5C07E 3RVUC 3PGFH 5DA4A 2RIKA 3IFOA 3WUWB 5HY9A 4PJXE 3ROOB 2JCCE 4LCYB 4X8JB 1I9RL 4QXGL 5F97E 1CFVH 3BPLB 3LVEA 2JJTA 3K80A 3ARED 5DEGB 4OLWH 3SDXA 5AD0B 1JWSB 3UO1H 4M5YL 3KPMA 4NQCE 5CIPB 3P0YL 4J8RB 1MCCA 4KC3B 5GIRA 1HHIB 2O61A 3QI9A 1UB5A 1TZIB 4P2YA 1DCLA 3HUJF 4XNZB 4XP9H 2BSSA 4RAVA 4LQFH 1ACZA 3VFVA 5K9QG 1NANH 2EDWA 4U49A 1RUML 4CKVX 4IOFC 3NA4A 2ZUQC 3V8OA 5FO8B 1Y18A 3GMNB 4AL8L 3H6JA 4PJ8D 3ARFB 2GTWA 1V7MH 2GJJA 5DDHA 1OAQH 5F9OL 2C1PA 4G9FA 2AEQH 2IADB 3MUGB 2NY2C 1WVZA 2R29H 1EEYB 4Y5VB 5TGBB 4KDWA 4PGDB 1DBKL 2HP4A 4PLNC 1S3KH 2D03L 5IVXB 2JJSC 5F1NB 3RVXC 3LHPL 1CTNA 2FECI 5ALCH 3DVGB 5MHSD 1CIUA 3EYSH 5IV2A 5KOVC 4PJ5B 3VRLE 1RZGA 1UZ6E 3ALXA 4S1RH 4PBWD 3RNQA 2WINA 4PRPD 4G8GD 3FCTB 3O81A 4S1DC 5CIPH 2Y36H 4MQSB 1K2DA 2WBJA 3N0PB 3KYMA 2GJ6E 3OKKA 4OZHA 5DSCB 3QWRA 1QZ1A 5JNYA 1G6VK 4MAUH 1ZT4A 5C3LD 3DBXB 2VDOL 2YPKB 2YN3A 5BXFA 4P2QA 1EGJA 2NXYB 4P5MA 2AK4A 3IXTB 3CFDB 3WIIH 2AQ2A 4I13B 4PJHF 1KB5H 4YDLB 4P3DB 4JVWA 4FRWA 2A73A 4HPYL 4JDVA 2VLJB 4PRBA 4TNWK 4JFDE 4HF5L 1CK0H 2VSDA 3GSUA 1BZ7A 4HWEL 3ARDD 4NQXB 4G8EA 2R2HB 3EHBC 4RISH 2HRPL 1EVUA 3SJVE 4KQ4H 5LKNA 2FYYA 2VN7A 4HS3A 1WBZA 2HFFB 3FN0H 4U4BA 2CKNA 4WJ5A 4XBGB 3SBWA 4TOYH 4Z5RB 3ECBB 1LO3L 1NBYB 1ACYH 5EUOA 5ACZB 4NP4H 4UILH 4KK8C 3JUZA 4PJEE 5ICZA 1NBVH 4EZMA 4F8QA 2X4TA 4XPGL 2FJHB 1WZKA 5JOPE 3RVUD 2E7BA 4JDTL 1JZ6A 4CW1A 4QHKI 1PW3A 3CFEB 4QHUB 5I76B 4YPGA 3V0VB 4U0QB 3IFNH 3ZZ1A 1MFAH 2Z91A 3HNSH 4JPWL 3RDTA 1TNNA 5INDA 4FQQB 2NYYC 4YQXH 3QNZB 3U7YH 3KXFB 4IDLA 2DQUL 2CRMA 3TO4B 5F3HB 1A6VH 4OCYH 4OFYA 3UTQA 4PGCB 3OKEB 1F90L 2V5TA 3VWJA 1NCAH 5IBTH 1WBYA 3O41B 5MEOA 1RJZA 3ETBF 3OAZH 1EV2E 5IB4B 3AM8A 3MRRB 1CS6A 4IOFD 4C57C 4NQUA 4UINH 5IHUL 3H9SA 2EDFA 2VLRD 3X11B 4X6DE 3UTSD 4NKOA 5CJOH 4KV5F 4JZOA 4HKXA 1XF4B 5CGYC 2NY2D 5LGHL 4HK0B 4NQSB 3SCMC 1B6UA 2JLLA 4QRRA 4N0UE 1P7QD 1AC0A 4K8RH 1LGVA 5FECA 1I9EA 1YPZA 3KYKL 1IC7L 2DYPA 4GXUM 4EQ3A 1CDIA 4S1DD 5JXAL 3U9UA 1FL6B 3QQ3B 4WUUD 5ISZE 4U1LB 5GGRA 1A7OL 5T1LB 3TBYB 5DTFA 4YXHL 3DX9A 1RIHH 1S9VA 2VUOA 2F54E 3SDCD 2ILLA 4ONFL 3MJ6A 1KG0A 1W72B 1OF2B 3IU4L 1C12A 3UXFA 1ZGLA 1OGTA 3BQUD 4Y1AA 1K4DA 3KPTA 2OL3H 4S10A 4WFED 1ZT1A 4ZSOE 5IROA 1T66C 5EO9A 4AIZB 1YN7B 3EHBD 3BPNB 4YHNB 1ZANH 1U95A 3MLWL 1QSED 1WGOA 5A1AA 1R0AH 2YEZA 4U6TA 2VISA 3BT2H 4EVNA 3OQ3B 3T0VA 1MIML 1DDHA 5GRXG 5HI3C 4JFED 4KK8D 1KTLB 4XTRC 4PV8B 4Z77B 4RNRA 2FBJH 1MJJB 4G6KL 4DK6A 1QLRA 1SQ2N 3PQYA 2A6JA 1B0GB 5LBSL 3GMPB 5T5NG 5DRZB 3DX6B 1M1SA 3BKCL 2Q86A 4XH2A 2XZQL 4HGWA 5D2LB 1K8IA 3JV6B 2NYYD 5AEAA 3RTQA 2R8SL 4U6HB 2DQGL 3DHMA 1OD7A 3D25A 1EO8H 3FB6B 1H3XA 4AMKL 2BHYA 4E41E 4H25B 1W72H 3VG0H 1ZGLP 4BZ1L 1CN4A 2Q3ZA 1FVDB 1G7QB 1QHOA 5EH1A 1JBJA 3WFHA 4LHUG 1UJTA 3UTTA 1WK0A 4RGOH 3LKOA 1JV5A 2PW1B 2BVYA 3QHZL 1I3UA 1WWCA 2GEEA 3SKUD 4WHTA 4DGVL 4O9HH 4XAWL 2OMNA 3JBG7 1L7TL 5DGQA 4MJ5B 1BQLH 3VXMB 2AJSH 5BQ7B 4DZBB 4NUJB 1WJ3A 4NFCA 3EOAB 2ZG1A 5CJBA 2FJGB 2W60A 4LSRH 3O6ML 5FB8B 3SCMD 3A6BL 4HZAA 4LPYA 2WIIA 2D2OA 3M8OH 2VDNH 4RSVA 2D3VA 4P0DA 3EUUA 4UT6H 1ZKAA 4PJDE 4UU9B 4P5KB 4OCMC 4ODTH 5AZ2H 2HWZL 1X5KA 1E6OL 3VH8A 3MO1B 2DKUA 1N3NA 5DHYA 1KTDA 1CDHA 4QT5B 2PCPA 4JO4H 4ERSL 43C9B 2OR9L 2FIKB 2YRLA 4ELMF 4KJPC 3MLTB 1WZ1H 4NYLB 2IFFL 5CSZA 4UV7L 2AQ3A 3SGJC 5CLWA 4WW2B 4NO3A 3L7FA 4APQC 4PJAE 1JWUA 3PDOA 2YMXL 1NKRA 1EBAA 1T66D 4CAGA 3OAUH 4XBPB 5D7LA 3VXUA 1KTKE 4HAGA 4TTDC 4JFPA 3ROLA 3ARQA 3IU3B 1MFBH 4D9RD 1E0OB 3UDWA 2VDRL 2R0ZL 1IC5H 4M1CC 4DVRL 1FNAA 1H3WM 3P4OA 3IS0X 3GSNA 1MLBA 2QQKL 1XIWA 5T5FL 2CLZA 5E6IC 1NCCH 2CQVA 3BZFA 3VMOA 1X7QA 4X4YA 1BX2B 1BZ9A 3GSVB 2OK0L 3L6FA 4GW1B 5HHNB 2KUTA 1DUZB 1PG7H 3AS1A 3INUL 5GGUB 3H3BC 3HE7C 1E4WL 4K94H 4LPVA 4PJGE 4WI7A 3S5LG 4XCEA 5FYJD 3O3BB 3EJYC 1J0JA 3GUTB 1KCKA 3BIBX 1YYML 3SDXF 2BNUB 3CU1A 5IW6A 1KIPB 4LK4A 1QLFA 1VKXB 2YOCA 2GTWB 5MI0B 3NZ8A 4OGXL 3BESR 5L2KD 5I1JL 3NN8B 3OAYH 1A6AA 5JTWA 1PZUB 1LEGB 1FLTX 4G9FB 1IC4H 2BVPA 1QR1B 1D3CA 4WI6A 1DBML 4KI5C 5HGAB 3VFTB 1T0NB 4OCRL 3VXTA 1I85A 3V2AR 5FOBB 1KGCD 5FM8A 5T3XL 2EXYC 5KSVA 5IT2H 4PJBF 5IV2B 4FQLL 4IOIA 1KNOB 2X70B 3O8XA 1DUYA 3S35H 4GXUN 4XMLL 3NCJH 3IDIB 5ITBH 1MCIA 3RNQB 1XGYH 2I9LB 3CSBA 2NX5A 3QXVA 4JQVC 4OM1H 5BO1H 1RUAL 3X17A 4O58H 3ARRA 4MDIB 2YXMA 2XV6B 4JQIL 1REIA 2J4WL 5BZWB 4HWBL 3MLYL 3WXVH 4N8CL 1VGKB 5EBMA 5L88H 3G6AA 1JF5A 3NPSC 2FSEA 4M5ZH 5D5ME 4MXVE 2NY5H 5BV7B 1BIHA 5BW7C 4KJPD 1G7HA 1HKFA 1MLCB 3P73B 2W91A 4ONGH 4GKZA 4G8EB 4KKAC 4TSBL 3B6SA 2NW2B 2E5EA 5E2JA 3TF7C 5TE4L 1MCNA 2N7BA 4P4KD 4Z7WF 5F21B 3DYOA 4APQD 1N7MH 2GIYA 4WJ5B 1UYWH 2V17H 4HFUL 1NGXA 4OQTA 3G5ZA 4IRJC 3RX5A 3W2DL 3QUXC 3U1SL 4TTDD 4JFFA 2HRLA 1JGUL 4OT1L 2ZSVA 3ARUA 3LEYH 2X1QA 2FBOJ 2O5YH 1D6EA 3VXSA 2X09A 2VC2H 4I3RL 4M1CD 1MF2L 3BXNB 2IPUG 5FYKH 3OJDA 3DI3B 3HUJE 4N68A 4QRQB 5A16B 1SBBA 3KPRA 5HTSA 4AT6A 4HJ0C 4DKEH 5HYSG 4KZEH 3GRWA 5LWYL 3QPQC 4HD9A 5LAXB 3RDTB 5IJKA 5INDB 4JN1H 5ITFB 3OX8A 5GRVK 1A3RL 4OTXH 2LV4A 4KAQL 4FTVA 4F57L 4PJ9C 4G6MH 1EGJH 3RY4A 4YEEA 5HYJA 1KFAH 5CEYB 4WWKA 1AO7B 3HE7D 3UTQB 5BV7H 1RZ7H 3LDBC 3QUML 4JCMA 2B7DT 3EJYD 3RWCA 1TPXC 1MFCL 3H9ZA 3BE1L 4KTDL 1UB6A 2DLGA 1BD2E 1X5LA 2Q20A 25C8H 4QCIA 5CJ8A 5CJXA 4Y2DB 2A9MH 2VLMD 2JJWA 3E8UL 1ZVYA 4OZFG 4GRLC 1A8JH 4WO4A 1JVKA 1K8DB 4NQDE 3TZVB 4KI5D 1HXYB 4NQED 4I8DA 1P5UA 3ZTNL 5C0BA 1GYAA 1BQUA 2BNQD 1IGYA 2WUCH 1NAMA 2EXYD 3SE8H 4Z95H 1QHPA 1SBSH 3RVTC 1NCUA 2PXYC 3BISA 5FECB 5I73B 3PWPD 4Y5YA 3LIZH 3QDHA 5I17A 1DANT 4OCWL 2XACC 4URTB 4PJHE 3QIUA 1IFHH 3D2UA 4ONHA 3U0TB 2L7UA 3EOYG 3DVIA 4Y4FA 4PB9H 5GGRB 3QIBA 1S9YB 4OCSL 1NEZG 3SQOL 5EN2A 4PRHB 2YRZA 1S9VB 4U0RC 4HPOL 1ADQL 2BNRB 5I1CL 3QXAB 3RWDA 1RIUH 4I4WB 3ARGB 1B0RA 2B5IC 5C09B 2YUVA 2X4RA 5E99H 2VKXA 1C12B 5HHXH 3BKML 1KBGL 4U1MA 4S2SA 3S5LA 1PYWB 2OJEB 2VLKA 4LVHC 4EJ1C 1F6AA 1XZ0A 3NTCL 5EO9B 4KROB 1TZGH 1FG9C 3O3EA 4KKAD 1I8IA 1I1FB 1BGXL 3DNKA 5D7IB 5I1AB 2DWEB 2J7LA 1UEMA 5E4EC 1XEDA 1CFTB 4NHCL 1HSAB 4PGEA 2Q76A 1CXLA 3HAEB 1LWRA 4X6BB 5EOCL 5C0AA 4ZYKA 4U7KA 2AABL 4AENA 1TJIL 2J8OA 1NJ9A 2PF6A 4IRJD 1Q9WB 3QUXD 1KCUL 5LJYH 4P2OD 3DROB 4P5TB 4DZ8A 4LLVB 5CJ5A 4GRWH 2HFTA 1F3DJ 2PNDA 3MMEA 5FHAL 2YC1B 1KLGB 2D0FA 5J12B 2VXTH 1JK8A 5E9DD 3PQYB 4HJ0D 3IDJA 1MHCB 3K8KA 3MRBA 3QPQD 3D85A 4XH2B 1F3JB 1OM3L 3VFGL 3IS1X 1ZVSA 5DJ0A 2ORBH 1QO3B 3CZJA 5KW9H 5GS0C 4PJ9D 1F45A 3MZGB 1P1ZB 4XC1L 3LH2L 5L0QC 1T7VA 4KV5E 2VITB 4RX4D 3WFHB 1AIFA 3U9PH 5JORA 3LKOB 5L8JB 1QQDA 1XCTB 4RRPA 1VEOA 3VFOB 2GI7A 3IKCB 4ODVH 4LPTA 4L4TD 5GS2H 5KSUA 1Z0MA 2VYRE 4HUNB 3X3GL 4GRLD 4AEIH 1FORH 1DLFL 1CFBA 5D7JA 3V52L 1NC4D 1FYTB 1ZEAL 4Y88A 4CVXB 2VH5H 3V6OA 3PGDB 1CLYH 3MRJB 1CDCA 5DJZB 2HLAA 5SWZA 3BGMA 3W0WA 4JRYE 1MRCL 2EC9T 2YD5A 3D0LA 2PXYD 4Y5XA 4YDIH 3DUUB 5BVPH 5IMMA 3HA0A 4LVOB 3QDGA 3VMPA 3M17A 5C08B 5HYSA 4NRXB 3TBVB 1N3NB 5GRWA 3WNPA 2ADGB 3L3GB 5JIHA 3SGEI 4X5XB 1QBLL 1IKNC 4LASL 1PVHA 4FZEL 1YEFL 4M6NL 1HNFA 4RQQB 2OBGA 1XCQA 4NCDA 5IQ7L 3MCG1 5KS9F 4OM0H 3QCUL 5MP6L 1GSMA 1WT5C 1A4KA 3BEVA 3UTPD 3K3QA 3H7LA 3DSFH 5H94B 4WHCA 3HN3A 3JWDH 4E0RA 1BVKA 2R0KL 3DX7A 3B9KC 3VFNA 1CLOL 4IMKC 3I6KB 2R1XA 4LLUA 4KHTL 2XICA 2AEPL 3MODL 4L4JA 5TE7L 1OAYL 4FFZH 2ZPKL 4JG1L 2ZSWA 4TULH 2EDQA 3VFPB 4OZFA 3ZKQD 4FP8H 1KPRB 1U8KA 1X7QB 1MY7A 1ZTXH 1Z9OA 3WNMA 2Y06L 1YUHA 3VFMB 2X05A 3QCVH 1FJ1A 1JGDB 1J8KA 2UVFA 4X9GA 3MOBL 1FVEB 5GRUL 1LE9B 1T04A 3L6FB 5EDXA 4K7PX 4AEHL 1CE1L 1T83A 4H8WH 4ZUTB 1MHEA 3HG1E 2AXFA 3EFDH 4L8DA 4UB0H 3BZDA 5DRXB 5DQ9A 1R5IA 1UCBH 3LPWA 4RA3A 4IOSD 2D7PA 3MJ8A 3QYCA 5GS0D 1MOEA 3IDNB 4PUBL 5IM7B 5C0RL 4DGIL 1EHLH 2ADFH 3V8CA 3VG9B 3BPCB 5KN5A 1G7PB 4J3OC 1HQRB 1HNGA 3FAXA 1YDPB 3MA7A 2EDOA 4HKZA 1L7IL 4AG4L 3Q6GH 1YMMD 2JB5L 3HC4L 3P9MB 4FQHB 4Y19D 4DAGH 1ZHBA 1KJVA 5IFJA 4JFXB 3ULVH 4UAOB 1UEYA 2DJSA 4NBYB 5KSBB 1KC5L 3TNNB 1OLLA 1AHWC 2QEJA 4B50A 1IEAA 2DQTL 4R8WH 1WAAF 1DUYB 4XX1G 1NMCC 1MI5A 1IAOA 2EH8H 3B4NA 1RULL 1KUMA 4J3VA 4ELME 1J0IA 4CVUA 1X9QA 4K9EL 2J88H 2YZ1A 3JZ7A 1MJUH 4MAYC 2YD6A 3NABL 1VACA 4M02A 4RCAA 1ORQA 2NY7L 3NMEA 2CLRA 3AY4C 5L8LB 2IH3B 1XFPA 2ZOKA 3D0VA 3H42L 1GVIA 4NT6B 1FNGB 4OI8A 4L3ED 4RDQG 4XNUH 3DRTA 2UZIL 1UVQA 2Z4QA 1CD8A 1YJDH 3GI9L 2NLJB 5FA3A 1I7TB 1AD0B 4TSAL 1OP5H 4NKMA 1F97A 3EBAA 3FQRA 5DHXB 5FCSH 4KHXL 5C6TL 3C5SB 4LHUB 1S7WB 3T8XB 3MCKA 3PNWA 3B9KD 2APVA 3MC0A 4ZPVA 1DFBH 5KSAA 3FONB 4XNQA 5DJAB 4ODSL 1EXUA 3TN0A 3BQUA 4PV9A 1YQ2A 2V9QA 4GG6E 2HFEB 1QG3A 5CUSL 3A6OA 1GGIH 2ZSVB 1JN6A 5CP3A 2NY3C 1S7UA 4WWID 2Z31C 4HEPG 5E08L 3JWOL 2GK2A 2R15A 3KPRB 3N85L 4E5XA 2W38A 2DMKA 3PWJA 4LGSB 2BY3A 3IYLW 4HWZA 3SDXE 5I1DB 3C6LC 5CILL 1U8QB 3FAWA 4JFQA 3G04A 5IKCA 3O9WA 1KELL 5F7KC 5HYJB 1P4LA 2CGRH 3TBTA 1UG9A 1A3QA 5EBGA 2QHRL 3GSRB 5GGSA 2UUDH 1T6WA 3KVQA 2Z35B 4K55A 4LLQA 4QXUL 1I1AC 2ADIB 5DD5H 5TDPA 1RZFL 5KAQG 1UB6B 4ZS6D 4XVJL 3PWVA 3L95B 1WC7B 4C4KT 1A9EB 4PJBE 2ZP0T 3DVFA 1CL7L 3OZ9H 3SKOB 1AKJD 1MCKA 1VDGA 3CSYA 4H5SB 1N6QL 2A0LC 2MPAH 2X4NB 5AUMA 3WMSA 1FL3B 4OQTH 3I9GL 3TBWB 1DVFA 3BH8A 4MD4A 2FWOB 3MRQA 2MQ0A 1YN6A 4JB9H 2FO4B 4LQ1A 5BRZE 1IMHC 2VXUL 1MY5A 3GRWH 3D18B 1QLEH 3P9LA 3QEQA 3TH2T 3BIKA 5HYQB 1NC2B 4FXGA 5SWSB 1QSFB 4RFNB 3OKOB 1EFXA 3C2SA 2FL5A 3BJ91 1W2KT 3MUJA 1A3LL 5K9KA 4Y4FB 4MAYD 2E9IA 5TQ2H 1G6RL 5DVOA 4EOWH 4OV5B 3UYRH 1JPTH 2PYFB 1MREL 2B4CC 1I8MA 5EU4B 1A2YB 1U8OA 1VENA 3G9AB 2J6EA 1YECH 4Z7WE 5EU3A 3RWDB 2O5XH 4WTZG 3TCXA 1KN4H 1RZJC 5FCUL 3CFKA 1ITCA 1CFNB 2AK4E 2E9WA 3IETA 3TIDA 3BKYL 5I8EB 1SVCP 3RWGB 4M6OL 4L4VD 3S5LB 4DUWA 2VLKB 3LS4H 4YHOL 5C0CA 3FT3A 1XZ0B 2V9RA 1YNKH 4C56E 4P9HC 5EBLA 3QCTL 1TCRB 3NPZB 3O3EB 4RWYL 1I8IB 4BZYA 4J23A 3U6RA 4KY1H 2VDLH 3BYTA 2COQA 2X9WA 1HYSC 4XAKD 4NN7C 2Q76B 3TM6A 3C60B 4HHAA 4HS6B 1V5JA 5F7UA 4XP6H 1FH5L 4OLUL 5EUKB 1NJ9B 2G75A 1NAMH 1Q94B 4C58B 3CFCH 1U3HB 1X6NA 3AVEA 4EUPG 2NY3D 5C6WH 2WUBH 3GGWA 3M45A 3TPUB 2Z31D 1ND0B 1T5XA 5J1TC 3DUSB 4FXKB 4K23L 1DQJB 4MA3A 3TIEB 3R1GH 3UBXA 4K3JL 5BZDA 4J4PC 3BD3A 4JY6A 2XZCL 2CLVA 5GGQL 3RKDC 8CGTA 3D85B 2UYLB 3OR6B 1ZLVH 3C6LD 4DTGH 5F1OB 1S9WB 2ZCLL 5KBNC 3JTSB 2FATL 1S78C 4Z7UA 3AREB 1N59A 3IKKA 3GHEL 3UAJC 3VXQB 5BOZG 5F1SA 5I9QC 4RGNE 1EAPB 4NC2B 3GHBH 3O4OB 1CBVL 3ARXA 4X6CA 5BS0A 1XF3A 1YEJH 1QQDB 4R0LC 4MD5B 4PJ7F 3V6ZA 4U1JB 1KJ2L 2P5WA 5DJXB 4R4NC 3GEWB 1HI6A 2GY7B 3NH7H 1KCSL 2ZUTA 4X99A 2H1PL 5KSUB 3QH3A 4MA8L 4MQTB 3T4YB 4BZ2H 5CGTA 1NGPH 2HJFA 2A0LD 4QRPA 4WVRA 4LVNB 4NZUH 4X98B 5H35B 1CD1B 2DQEH 4OLZH 2ICCA 1IZJA 4XHJC 2IF7A 5I71B 2DQIH 4Z8FH 4PJ8B 2EYRB 4PRID 3LN5A 3S3PA 3VXRA 4MDJA 4IMLB 2XTLA 4GRMB 1T03L 4AM0A 2F19H 4DEPB 4K3DL 3EO0B 4Z76B 2AKRB 2PKDA 1TTGA 1SJEB 4NKDA 1U8NA 1JRHL 2SEBB 4K7FB 2V6HA 4BA8A 3HI6L 5HHME 1LD9A 4F7TB 1P69B 1EJ6A 2J5LC 4JPKL 4MJ6A 4I9WE 1TETH 3WKMH 5DVNA 4DCQA 2P43B 3G5YA 3OHXB 3KPLA 4PRPB 4G8GB 4EI5D 4FZ8H 2NTFA 2X40A 4PY7B 3WSQL 4GS7B 4JRXD 3B3IA 4J3XA 1AP2B 4JHWH 1NCDL 5MENA 1YMHA 4E0RB 1BJ1H 2ZCHH 4RIRB 2GCYA 5E8DH 5F7DB 1BOGB 4HKJB 5DK0A 1NANI 3W11D 2GUOA 1D6VL 4BSVA 3OR7A 1KF9B 1H3TA 1VADB 2ZKHL 5C07D 1HYSD 2NQCA 4OAWA 4JO2L 1TTUA 3QIWC 1OSZA 3BP4B 5IVXF 4FABL 4HUXA 3ARDB 3LMJH 1OW0C 4I0PA 1OARL 3O11A 3A67H 3GBNH 2YN5A 4HXBH 4JY4B 1IBGL 2VL4A 3TO2B 4P4KA 3QEUB 2DBLL 4PD4J 2CKBB 3ULUH 2PW2B 4FQ1H 5TJWK 1J7VR 5FYLH 1I1CA 1JCKA 2WZPD 3CPLA 3QUZA 1YEHH 4J4PD 1BVLA 1S9XA 3RKDD 3L3HA 4N1CA 2C4FU 3JVGC 4W70A 5ID0A 1R5IB 5T33H 3OKYA 2Y7QA 4I18A 1T22B 1LO0L 1TQBC 1NEZB 4DKFL 2G60L 3QQ9C 2LFGA 4ZUWB 3PL6A 3RL2A 3UAJD 1FGNL 4ZUVA 1UENA 4RAUA 4ZQKA 2V2WA 4A2MA 4WTZA 3TESA 3DUHA 3SKMA 4FQ2H 5J9PB 4MNQE 4LSUH 3RNKB 3O6KH 5CHNB 4R4ND 4HWNA 2R23A 4JO1H 6CGTA 1ZHBB 2HN7B 1KJVB 5KVEL 3AAZB 5JLZA 12E8H 3OV6A 2QSQA 1PG7W 2DQHL 1FNLA 1MJ8H 2P46B 2PETA 3SDAA 2QKIA 1RJYB 1AXTL 4OZFH 3D9AL 4N90D 3TYGL 2ZUQB 4PRDB 4Z0BH 1FFPA 2R0LH 5SV3A 4XHJD 2X4QA 2VLRB 4X7SH 3IFLL 2F58H 4XNMA 3DO3A 3H9YA 1AXIB 3UTSB 2CKBH 3MLZL 4PG9B 4XPHL 5FDWB 4G3YH 4GAGH 1U8LB 3KPSA 5KS9E 3H2WA 1BM3L 5HGDA 1Q9LA 4KZDH 2NY2B 1ORQB 3K81A 4G7YL 3RI5F 3PWNA 3I3DA 5CJQH 4YFLF 4XCFH 1FNHA 5DD1H 5CZVH 1AFVH 4P9ML 3T0EC 3EYFA 1P7QB 3RZCC 5HDLA 2IC2A 4L3CA 3EO1A 4Y0GA 3P11H 4JFDD 1CGSH 2EIZA 2HKHH 2VDMH 3C09B 4PJCB 5F8RC 5EORH 3UJIL 4YE4H 4M1GL 3GI8L 4YDKH 3HI1B 3MUY1 1TTFA 4HXAH 5JR1L 2K9UA 4WUUB 4X6FA 1JIBA 3EYVA 4XB8A 2L0DA 3HPLA 3WIHL 5J13C 1IGFH 5F3BA 4JY5L 4OZIA 3SDCB 4BFIB 2O5ZL 4XBEH 4XPFL 5KSAB 3GJEA 3BQUB 4PV9B 4K7PY 1AQDA 4RMRA 2V5SA 5CEZH 1BPVA 3QIWD 4XNYL 1PKOA 3FO2A 2BRQA 2FECL 3EO9L 5F70A 2WWMC 2G5BA 4NNYB 2AJVL 3RWEB 4MJIA 3QRGH 1QSEB 2FZ3A 1NGQL 1EAJA 4ISVB 1G9NH 2ZUSA 4D0DB 1JGEA 4XPAL 3LD8C 1K9TA 5TPWL 3G04B 5EBWA 4ZXBA 2FX7L 3VD5A 5F89A 1IGMH 2YHGA 1BJMA 1PG7X 4XRCA 3RIAF 4CDHA 3S36H 4P2OA 4JFEB 3TBTB 1IC1A 1JFQH 4M43L 3CX5J 3QDJE 3PE9A 1SMOA 2UY6A 4LF3A 4IRSC 2VABB 4GAJH 4LCWE 3W9EA 5TDPB 4YGVB 1FE8L 3QQ9D 2FO1A 1S7VB 5GS1A 3D39D 5DXWA 5DMGC 3C9NB 4AH2A 1WAAE 3WS6C 3X14A 4HS8H 3RVVC 3CSYB 1G0YR 4MHHG 5D2NA 5AUMB 3KPNB 3OKDA 5LXGH 4PY8I 3HI5H 3MRDA 2D9CA 2B1AH 4MD4B 5CP3H 3FQTB 2CDEA 1CDUA 1FNFA 3S35X 1HIMH 4M8QA 3RX7A 4EI6A 5F96H 4FG6C 5C0GA 5ENWB 3FQXB 1GCFA 3MA9H 1E4KC 5DR5H 2B39A 4LU5H 4G9DA 3CDFA 1CXEA 5IQ9A 5DK2B 3O3AA 1EFXB 3TYFB 2BSTA 3OMZA 1YY8B 1D9KA 4YHZL 4UQ2A 1KJ3L 3S88L 3DGCR 4F8TA 4PYGA 4KJYB 4O4YH 2F5BH 2F54D 2DQJL 2DD8H 5D2LF 3KLHC 3T0ED 3SCMB 5EU3B 1KENL 2VOTA 4U33A 3KWWA 2Q6WA 3RZCD 3L5WB 4XGZB 3U4BH 3ZSTA 3UTOA 2Z92B 4LSQL 4NO2A 1S5IH 2PYEA 1ZE3C 3U30C 5DJDA 4UIMA 3EIFA 2WQRA 2YPLD 5E2TH 4P4RB 3PABB 1INQB 4F7EA 4LP4A 2OTUA 3RWIA 4OLVL 5FKAA 3U6RB 2D31B 1C16B 4JFHE 3O3DB 5AWNH 3ZKXC 1VPOH 2XT1B 4LKCA 4W68A 3L9RA 4CVZA 3W5MA 4L8SC 5JIKA 3C08L 5TDOA 5IB2B 4X6EB 2BFVL 4L8BB 5C2BL 4OLYH 1NCWL 3S98A 3LKSA 3SY0A 3N9GL 2FX8H 3MV7E 2WWMD 1T5XB 9CGTA 1YEKH 4G80A 5KJRL 5IW1A 5GSVB 3BOVA 3WFBL 1H3PH 4ZPTA 4Q0XL 3IF1B 4LNVA 5C8JB 1MCEA 1RPQA 3HB3C 2BVUA 3T77B 2VR5A 5E1AA 4X4MA 4F3FA 2J6EH 3E6HA 3RIFK 4E41D 1MCOL 4D0BB 1MCSA 2VLLA 1N59B 4OKVA 4KU1A 3R06A 1QFUL 2EC8A 4ZFFB 4IRSD 3MFGB 2CUIA 2A83A 4D3CL 1JNLL 1PLGH 4JR9L 4NHUA 5JW4R 2ATPB 1I9RH 5IEKA 5DMGD 4QXGH 4X99B 3DIFA 3RVVD 1ZLUK 4GKOA 2HVJB 4FXLA 1J1OL 4W6YB 1EUTA 3BZEB 4CN1A 15C8H 2AK1L 2DMCA 4XCCH 4M5YH 4X6CF 5H2BB 2GT9B 3ESUF 3HCVB 2V2XA 3F6LA 5C0BE 5L2KB 2A38A 4TUOA 4MDJB 1MAKA 2B2XL 5JXEC 5FO7B 1JZ2A 1HKLL 3DRQA 4LAQL 3S8WA 3K1KC 4YBHA 5IMKA 5ERWA 4FG6D 1J5OL 1KXVC 3VD3A 4M7LT 4R2GC 1U8NB 3HRZB 1G9ML 1RUMH 4CGTA 4M3JA 2IPTL 3MV9D 1KCLA 1I7RB 1B90A 4H20H 3QDMA 3P4MB 1NLDH 1DEEA 2ATKB 3HE6A 4NPYA 1XR8A 4OBRA 4Q6YA 2FGWH 4Z78B 4EIZC 4WFHE 1DBKH 1CIDA 2F8VA 5ANMB 4WHYG 2G2RB 3FQUB 4J1UA 4Y4KC 1YMHB 1Q1JL 35C8H 2GCYB 1MSPA 3ZYIA 2YBRB 1I9JL 2DDQL 4XCNA 2BCKB 1T3FA 2P8PB 1ULVA 3FMGL 3QJFA 1C5DB 5CINL 3VWKA 3MRGB 1HN1A 1N26A 3BRGC 3T1FA 3UROR 1GZPA 4UDTA 1K4CB 5DS8B 3BPLC 1WCBB 4MVBD 4Q6IC 4TNVK 3SDDA 3LKQA 5BCAA 4P4KB 2VDOH 2JE8A 1D5IH 5DT1H 5HGGS 3DXAA 5KOMC 3BI9X 4HT1L 1EMTH 1ZXQA 5JHLL 4MSWB 3Q3GB 3GMOA 1A6UL 3H7BA 3QUMA 4PLKC 5FM5M 4FFYL 1BF8A 3CPLB 1QRNA 4PJ7E 4OIAA 5FUZL 4HWEH 3CSPA 2HRPH 4M3KB 4M61A 4MCYB 1RI8A 4JM2C 1UQSB 1ZHKB 4LDOB 3UJJL 3BEWB 3MYJA 5TF1L 3BP6A 1DN0A 2QR0B 2AQ1A 5DI8A 4ZUVB 1VEMA 4TUKH 1L6ZA 1MNUL 4M00A 2X2YA 1ZLWK 4QRTA 4KDTC 4XPGH 1H5BA 2NY4C 2R23B 1INDL 7CGTA 5F9JA 1NGYA 4JDTH 2FR4B 2FRGP 4N0FA 1RURL 3MLXH 5IR1A 2F74A 3ES6B 1RIVH 2E27L 1Q9KA 3OGOE 3MGAA 4GBXA 4U6XA 3QG7L 1JMXA 4JPWH 5D9SB 2RAMA 1IQDA 3FFCD 5DJ8B 2N4IA 1G9EA 4KUCD 5EU6A 5IIEA 1ORSB 1FYHB 1FN4A 4JN2A 2DQUH 4GH7B 1RK0B 2R1WB 4LNRB 4L9LA 1VESA 1OAUH 3RUGB 1W8NA 5JXED 1AE6L 5SWZE 1J8HA 4FQIH 1F90H 1QACA 2HVKB 3I3BA 4DUXA 3WS3B 4EUPB 1ETZA 4NQEB 3V4PL 4PG2A 3QUYA 3T09A 1A9BA 1PX3A 1OP3K 1U2CA 4QGYA 3QDGE 4R2GD 2BNQB 1JF1B 3EW3B 2NXYC 2A74B 4JHAL 1DJSA 5HGHA 3RAJH 2CUMA 2YS4A 4L3CB 4NOBA 4MLSA 4OF7A 1Z2KA 3PWPB 3KPQA 4CNIB 1X5AA 5EU5B 2J8UA 4O2FA 4ZS7L 3EFFA 1GGCL 1I3VA 5EIVA 2RGSA 4WV1A 2D4DA 1RMFH 5LGHH 4YDVA 5IVXE 2B1HL 2RQ8A 4Y4KD 5E0QA 5C3TA 5JQHC 3MRCB 3LKPB 5IBUB 4QTIL 1UM4L 4U7SA 4Z7NF 5LCVL 2FH6A 4RAHA 2Y23A 2Q7YB 3NPSB 3GJEB 3KYKH 2BVQB 3PXHA 1IC7H 1AQDB 3CK0H 5JXAH 5MEPA 4HCRL 4NO0D 1U0QA 4K8RC 1A7OH 1FPTH 4YXHH 2CRZA 5DJ2A 2FZ3B 4R90L 3ARPA 3C8KB 2HJKA 2OSLB 3BP5A 4EUPH 4EEEA 3QHTC 5EBWB 3QFJD 1OB1A 2VLJE 5F89B 4O51B 3OJMB 4IRJB 1QBMH 2I27N 3QUXB 4PLKD 2ITDB 4OD2A 3LCYA 4P2OB 1FSKC 2V7NB 1OGAA 3CH1A 4R3SB 4XXCC 2MKWA 3O4LA 5I66B 4CU7A 3NCEB 5GRJH 3MLWH 4HUVB 4JM2D 5I1LB 5E9DB 4KMTH 1X4YA 1W0VB 3AMLA 5SX4H 1FP5A 2A1WL 1D5BB 2BDNL 1KEML 2EYTA 1GH7A 5B39B 3DVNB 3X14B 1MHPL 2A9NH 4JFYB 1AC6A 2DI7A 4PJ9B 1IAII 3STBA 3TT1L 1R5VA 5D7IF 2NY4D 3GSWB 4G6KH 3MBXL 2APFA 3TPKA 1MHHB 1TZHB 3LDBB 4F58H 5DJ6B 5LBSH 3E0GA 4P57A 1TPXB 2BXZA 3BKCH 5GJSL 3CDGA 3DECA 3MPCA 2F8XC 1MFDL 4LLYA 5JHDA 4Z7QE 1NUDA 4AMKH 5C0NC 1HH9A 2AERT 4MNGA 5D7KE 4YXLH 4GRLB 3MOAL 1P4IH 4R4BA 3EYQC 4R7DA 1OPGL 1NC4B 3MV11 4MS8C 4MA7L 2EYSB 3IJHB 5AG9A 2NXYD 4OFIA 2BXYA 2ZUVA 4DGVH 1TVBB 3QZWB 4JZJA 1EIBA 4WGVB 2Q6WB 1L7TH 2PXYB 1U8PB 2WANA 3EZ8A 4X0KB 5IEHB 5FM4A 1KIQB 3WJLA 4HIEA 3DGGA 3MRHB 3C6SA 3O6MH 4HH9B 4UT9L 1IL1A 5E6ZA 3ARBD 5D7SL 1YC7A 4IJ3B 4HIHA 1EDQA 3U46B 2ESVA 3A6BH 4P3WA 4MQ7B 1MAML 1X5HA 3KDMB 3IDGA 4OZGA 2YPVL 4J6RH 2BVOA 3L9RB 2B5IB 1S7XA 2RHEA 4KK6C 5K9QI 1YEGL 3OG6B 2LVEA 4TUJB 2HWZH 1V8HA 4NNXA 1E6OH 4LVHB 2V5MA 3S4SG 1F4HA 4K8RD 2OR9H 2IH1A 4XP4H 4OD3H 4F37K 3MV8A 1F8TL 2EEAA 5E4EB 1NDGB 3BFOA 5C07A 4PJXA 1JNNL 4JJ5A 4L8CA 3SGKA 3E6HB 1QEWA 3HMWL 3GMRA 4JQXC 4JKPL 5K9OB 2DM2A 1KOAA 4JO3H 3S37L 1A7QL 1EUUA 2OJZH 4NQCA 1MUJA 2XN9D 4GT7A 5IB5A 2V9TA 2RBLA 1ONQA 2IAMC 3GK8L 5D1QA 2H3NB 4OUUA 1ED3A 1Q0YL 2R0ZH 2XA8L 3MRNA 4X80H 3G6DL 4U2ZA 1RUQL 4DVRH 2B4CL 5C0EA 1I1RA 1U6AL 5T5FH 4LLDB 1M6OA 2GTZB 2HKFL 1WEJL 4HIXL 3HMXL 3FZUC 5L0QB 3O6LL 1RJLB 3X3FL 2PO6D 3CC5A 1PY4A 4XPBL 3FN3A 2OK0H 1OT2A 2MQCA 4YO0A 4FOMA 4P9HL 3B5GA 5EZJB 3INUH 3DRQB 1YMMB 5D2LE 5J57B 3T2PA 4QOKE 4Y19B 5GSRB 5ERWB 2JIXD 5GS3A 4ETQB 5IUSA 3QEQE 1UH3A 4O5LL 1HDMB 1HK6A 1GPOL 3FT4B 5FHBL 5C0ND 1F58L 2BC4A 2XNAA 5GRYA 5TQ0L 2ZWLT 2VR4A 3M07A 4UUJB 4K94C 3T0AA 3EYQD 1LQSR 2IGFH 5I1JH 2A6DA 1RUPH 1IJ9A 2FNBA 3OPZL 1UJ3A 4MWFA 4DFIA 4OZ4B 5D72H 2A6KB 3HC0A 2I9TA 1AGFB 2XTJE 3BH9B 3ZHKA 5FGBA 1DQTA 4LLWA 5DURD 5DC9B 3VFWA 2GJ6A 2X4PA 3KLAA 4O2EA 3L1OH 5T3XH 4QTHB 5I6XC 3RQ3A 5L2JA 2CDGA 5C0CE 4FN0A 1IGJA 4M8VA 3L5IA 1UCTA 3PDGA 5ILTL 4DGYL 5B3JF 4XCNB 4XMLH 2BY1A 3QJFB 4F2MA 1R3HA 1AR1D 4ZTPL 1A47A 2YXFA 3TBSA 3SPVB 2M1KA 5E2UH 1PZ5A 4JQIH 1CDGA 5KSBF 2J4WH 3L3IA 3SJVA 4KK6D 4HWUA 2JJTC 5EPMA 2X4OA 4D2NA 3CX2A 3LKQB 3MLYH 2CIKB 3B9KB 3H9HA 3CFBA 1RZIB 3DLQR 5FK9B 5ICXA 1OAKH 1S7TB 5J6HA 1NDMB 3QI9C 2JELL 1QPPA 3FQNA 4GW5A 2WW8A 2X1WL 2ARJQ 4PJEA 1HEZA 1MQ8A 3HG1D 4IS6B 1JE6A 4CADA 1JHKL 4B7LA 4J7RA 3JTTB 2DLFL 4G42A 1AJ7H 2NY5C 3G9VA 1DN2A 1F2QA 2P44B 5D71L 4OJFL 2XKNB 2DKMA 3WUZA 1LO5A 5IK3A