3JWOH

Structure of hiv-1 gp120 with gp41-interactive region: layered architecture and basis of conformational mobility
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
220
structure length
220
Chain Sequence
EVQLVQSGAEVKKPGATVKISCKASGYTFSDFYMYWVRQAPGKGLEWMGLIDPEDADTMYAEKFRGRVTITADTSTDTGYLELSSLRSEDTAVYYCAADPWELNAFNVWGQGTLVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords HIV-1 GP120 ENVELOPE GLYCOPROTEIN
publication title Structure of HIV-1 gp120 with gp41-interactive region reveals layered envelope architecture and basis of conformational mobility.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2009-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jwoH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3jwoH01
3O11B 3RU8H 2V2WA 5D2NE 4ALAH 1NGZB 2LU3A 1VDGA 3QXDA 5D1QC 3DVGB 2WIMA 3I6LD 4TSCL 3TCLB 2CRYA 2NY4C 3AREC 2HT3D 2H8PB 1OCWL 4YHML 2CH8A 1S9WB 2UYLB 5CZXD 4WFED 3HRZB 4UOW1 4H0HB 3U46B 1U36A 2ITDA 3PGCB 4POYA 2I60H 2XOTA 3VFTB 1YUHA 5GS1A 1JNLH 2WAHA 4OUUA 1I1RA 2I9TA 1MJJB 4Q74A 3CX5K 3UTZA 5HHQA 4UINL 5T3ZH 1XCQB 4DAGL 8FABB 5BZDA 2A83A 1NKOA 4QRPB 4HSQA 3VWKD 2X09A 2KQNA 3GSNH 4HZLA 4Z76B 3B5HA 4JPIA 4RQQA 2MTPA 4OZFG 3PWVB 3HPJA 3VRJB 1S5IL 2CJUL 4PB0H 2DQJH 3NIDE 5JW4N 3RDTD 2MPAH 2ADJB 1QSEA 5CEZD 2WW8A 5JOPE 4NQEA 4I4WB 4GXVL 3STZB 3V9FA 5L2JB 4XP4H 1K6QH 4K71B 3MUHL 4J3WA 4ZS6D 5IIEA 3QNXB 1IC1A 5T5NG 1G6RL 2F53E 3OHXA 4N0CC 5IQ7H 2A1WL 3QULA 4PRBB 1A7PL 4QHNB 3C8DA 3QIBD 5CIPA 1P7KA 1IGCL 3U4BH 3F58L 4MNGE 5GSRA 4MA3B 4LARH 3QG6A 3G5VA 3QISA 1CFVH 4F57L 2BNQA 1H3WM 1Q1JH 2R2CA 4WFGD 3K1KC 4QHUA 3PIQB 3MLZL 4Z7VF 4JM2D 1MFEH 1T5WA 5HYJB 2VLKD 1ZT4A 2CIKB 4OFKA 1MCIA 2E7BA 3P73B 1RZKH 2XWTA 5D7IE 5E6ZA 4DUWA 1QBLL 4XCEA 3MV01 1RIVL 4WO4B 3M07A 3D69A 5EOQL 3D3VB 1I1YB 4YWGL 3VI3E 4U1JA 1CL7H 3KG5A 4LVOC 1BBDH 3FN3A 5JXAL 5F96L 2FX7L 3V5HA 3WSQH 1A7NL 1F97A 3BJ91 4XRCA 4FABL 3WKML 5IHUH 1X5JA 2Z4QB 1RI8A 1FNFA 3OKKA 5EBLB 1BFSA 4TTDD 3JTTA 3BAEL 4NKDA 4IDJH 5DSCA 3HZKB 3RWEB 1HI6A 2HFEA 3QAZC 1KLGA 4FP8H 3BN3B 1HWGB 1O5DT 1DQQA 3QUYB 4RAVA 2W65A 5TF0A 3BN9C 2ZUQB 4GQ9L 1KG0A 1LEIA 1PLGL 2DI8A 2R2HB 1XH3A 4FQQB 2WBJA 2DOCA 2CXGA 3QEHB 3ARBB 3RTQB 1P2CA 5DDHB 4OCLC 3JV6B 3KLAB 4X0KA 2FBJL 5HGAA 1UM4L 2BVTA 5KSUB 4IM8A 1S5HB 1JE6A 2F8VA 5HHVH 2E9BA 1KLUB 1VESA 3MLUH 4JG0L 32C2A 3LDBB 1OB1A 3B2VL 1A3LH 1YJDL 1NCCH 1FVCA 5DRWB 1P4BH 5LGHL 5E56A 2AEQL 4GJTB 3HCVA 4Z0BL 3FQUB 4N1EA 5JUEH 3MRHB 4CMHB 4OZFH 2A9MH 3L6FB 3QJFB 2OX5A 2J88L 1A8JH 2F5BL 4QCIB 5BRZD 1EBPA 1D5MB 3P9LA 3WHE0 1I7RA 1K8IB 2YPVH 4PRPA 3W9DB 5K9QG 1KFAH 3I84A 2X4UA 4MQ7A 2D4FA 1IBGH 4ZPVB 5K9JL 3AS2A 3JV5A 3P40A 3BT2L 1GAFL 3UX9B 5HI4C 3R0NA 3ILQD 2F8OA 5HVGB 2OMNA 4FXKA 3L3OB 5IP4A 3QHTC 1OW0A 1GHFL 1L4IA 4RFOH 5A2JH 2MKWA 5CEZL 4ZOCA 3UJJL 5MHSD 2PXYD 5FYKD 1KCRH 5C0EB 1J0HA 3G5ZB 1EXUB 1WC7B 4HKXA 1CZ8H 1PEWA 1MIEL 3FT3B 4G5ZH 5GGUA 4Q9RL 4JQIL 5J89A 1KPUB 1QFPA 2OTPA 5DD5H 2CDGB 3RZCD 1U8JA 3T77A 4KXZI 2Z35A 3H9HA 3X12B 3ZDYE 3F7QA 4HIEA 3KXFB 1MHCB 4WUUE 5MEPB 3QZWG 3LRSB 3O2DL 5I0DA 3UTSE 4L1DA 2VMFA 1DQDL 5EU7C 4JFOA 3D0LA 4RMTA 4NQED 1JVKA 1QR1B 2X4SB 2XZZA 1S8DA 3QI9A 1QSFE 4OFVA 5IFHL 1Q0YL 1B4RA 5DJYA 5C3TA 1CQYA 1LDPH 1FGVL 1ZLUH 3RA7L 2XRAH 3WL9B 4F58H 1T1YA 1LK3H 5JPNA 3GSWB 4ZUTB 4PJBB 3BKML 2A74B 2VOTA 5IKCB 2E27H 5DD6A 1DANU 4O02L 5DHVH 1PQZB 4UQ3A 2H9GB 3IT8D 3QUYC 2JJSA 3MRNB 2ZUQC 1NJ9B 6FABL 1TLKA 3VFNA 4RDQG 5FECB 1J11A 4LIQH 3TBVA 5M7QA 4NP4H 3V7MA 1NLDL 3BQUD 5KVDH 1A7OH 1PYWA 4AH2A 4OT1H 4U1NA 1HKLH 3ULUC 2J7LA 4ODVL 4EI5B 3DROB 3SPVA 3W9EA 1WCBA 4H0IA 3LKRB 3PP3K 4OLVL 5GZND 2E7MA 1S3KH 4NUJA 3V4VH 2YSSA 3LDBC 4P4KB 3OKNB 5D70H 1UG9A 4Y5YB 2HJFB 4IJ3B 5GRZA 4OM1L 4HUKB 3GMRB 3T3MF 3HZMA 3GSRB 3I02A 4CMHC 1I85A 4XNYH 1G7PB 3O4LA 3RJQB 3VXMB 5LAXA 1H5BA 1N7MH 2OP4L 2VDLH 4FFYL 3VXNA 1JL8A 1RUML 3IGAA 5DEGA 1CF8L 5E03A 3S35X 4UDUB 5C2UB 4RIRA 1IQDA 1M6OA 3L7EB 5C2BH 2FX9H 2YC1A 1CDGA 1JYNA 1D5IL 1BOGA 2K7PA 1FBIL 2WBJD 3QJHB 1MCSA 5C09A 4N0UA 3UYRH 4F3FB 5FM5M 1I7ZB 4ZAKA 5IHZB 2PNDA 4ACPA 4HFUL 1OAXL 3SQOL 2HRPH 2YD7A 4QYOA 5I1DA 1P69B 4ZXBC 4HKZA 4LVNB 1VA9A 5DK2B 5I1LB 3ZKNC 3MRGB 5HVHB 4JG1L 2Y06H 2EKSB 4KJPD 3W82A 5IB5A 1JK8A 4LVEA 3IDIA 4ONFL 2YKLL 4F33A 5KSVB 2R2EB 4BSWA 4M48L 4O58H 4PRPD 4JFDA 4Y2DD 2G2RA 1DSFH 4Z5RB 4CVZA 1OVZA 3WFHB 3TH4T 3GIZL 3I3EA 4IIQA 4DVRH 1K5NB 1KTKE 5EUKB 4L5FH 1FPTL 3MRRA 3SJVA 3ABZA 1NMAH 2NQCA 2BNRA 4IOIB 2BXZA 4YJZL 3R06B 2VDQH 1S9KC 1KIRB 1MHPL 1Z3GL 4FFZH 1J12A 4L1HA 4ELME 3NFSH 3WEXB 5I8EB 3O6KH 4RZCA 3DXAA 3CIQA 1UJTA 5IBTL 3GK8L 2BRQA 4X98B 1RZ7L 4MS8C 1X7QB 4JKLA 2NYYC 4YBQC 3QFDA 1KJMA 5C0RH 2ADFL 1UM6L 2MQCA 2AJUL 2HJLB 3KJ6H 4KTDL 4Z7UA 4EI5C 4YHIB 5C0NC 4KDWA 1F11B 43CAA 3LIZL 3N85L 2VL5A 1GYAA 1BIIA 2P46B 3O3BA 5KSAB 4P4KC 4P9ML 3QI9D 5E1AB 4Y5YC 4NQUA 4WEBL 4GLRH 4IJ3C 4XCFH 1BLNA 3I6KB 5EU5A 3OKDA 4X9FA 2VRAA 4IMKA 5AAWA 2M26A 5HI3D 2V5RA 4XPTH 4K7PY 2VITB 1CFSA 1FLTX 3GRWA 3JXAA 4JHWH 4M4PA 4BQ9A 2EDOA 3EYOB 1FNGA 4XPGL 4YBHA 1B0WA 5HD8C 3PWPE 2XA8L 3CLEL 1MEXH 5FK9B 1HHJB 4J12A 1EUTA 2R0WL 3P0VL 4MJ4A 3H6JA 1VKXB 4HUXA 3BKJL 2AV7A 5I1IH 1JHKH 1RY7B 3NCYS 3QDGA 1CFTA 4M62L 2H2PC 4U7KA 3UTPE 5AD0B 4LLVB 4MXWL 2QL1A 3FT4B 1JPGA 4HK0B 1RULH 1ZMYA 4M61B 4POZC 3PJSB 4I5BB 5C07D 5MEOA 5LGKA 4HS6A 4UOJA 4LLQA 2EYSA 3MNWA 1EEZB 4KJWD 4XHQA 4MAUH 4ENED 3D0VB 3I9GL 3JZ7A 1U93B 3VI4F 1CTNA 4LVNC 2R23A 5HVHC 5C0IA 4O2CA 4WW2F 1KELH 4LU5H 5SV3A 2G75A 2NY2C 4L4TE 2QHRH 1W0YT 2BHUA 2O5YH 4M43L 5H94A 3VRLF 1S7WB 5CJBA 3RX8A 3GMQA 4R7DA 3GSVA 1AGEB 3B6SA 1HKFA 2G5RA 1ZGLB 4KKBD 4YFEA 3SGDI 2OL3B 4BFIA 1I1FA 2BMKA 1A6TB 4URTB 3I85A 5C08A 4G6AC 4DZBA 3EDFA 3OX8A 3P9MB 2A6KA 3NCMA 3CSBA 4K94L 4DOHB 3MROA 3QO1A 1MHHB 1RSFA 2ICWJ 1TZGH 5C6TL 4ETQA 3T1FA 3ALXA 4QHMA 4ZAKD 5J06A 4PTTB 1J1OL 3C08L 4M1GH 2H45A 5CCKL 2BP3A 2DWEB 4JRXE 1IEBA 3NACL 4Z7QE 2J8UB 4DKAA 2FH6A 4LGSB 1F4WL 2KUTA 2RB8A 1JNNH 4EN3B 3BPCB 3FT2B 2X70B 4H1LB 3ARDA 3N1MC 3QG7L 4NNXA 1P84K 3C5SA 1J18A 2JCCA 4JFDD 5KSAC 4M8QA 4WY7L 4GKSA 1A02N 4XXCC 3GBMH 4Q9BA 3BYTA 2IAMA 1S7TB 1AQDB 5SX5K 2OSLA 3QDAA 2I07A 2EE9A 4JFEB 4NWUL 3SJVD 1PZ5B 3X14A 1DBKH 2B0SL 2BNRD 3CDFA 2VNCA 4OD3H 1PY4A 4QOKE 2O5ZH 5D7LA 1IEHA 1GGBH 1FRGH 4FQXA 3D25B 4CU8A 1S78D 1JF6A 4OF8A 3DXAD 3U7YL 3ARUA 2YPKB 2W0LA 3NA4A 2FGZA 3CCHB 4U7MA 3BDYH 5GJTL 3RHWF 2OR9L 1J0KA 1NFDE 4KY1H 1I8KA 1U41A 3ARZA 1H3PL 2BSRA 4Y19B 5INDA 5J7CC 1U6AH 5KSBE 1J1XL 3MRIA 2C3VA 3A67L 2VAAA 1RIUH 1WWBX 4UU9B 3IS0X 1NBVL 4YZFE 5IW1B 2R69H 1NSNH 1C5DA 5E00A 4NO5A 5J3HC 4S1DC 3LQAC 5AYUH 2VZ3A 1BF8A 4QRSB 2H2SC 4U2YA 4CVWA 4GOSA 4XP6L 3E1F1 5J11C 5CD5C 4WJ5B 4MXQD 2XQBH 1W0VB 5L88L 1EDQA 4MAYA 3GMPA 4XCNA 3GDBA 1FL5B 4XNQA 2Z93B 4JPKL 4LLYB 4M7LT 3QDGD 4I0CC 4TSAL 3EO0B 3DARA 4WTZG 4TNWF 4LCIH 4ZD3H 4CJ0A 3H3PL 4ZOBA 1T6VN 1U8KA 4AEHL 4NFBA 1IAIM 4JPWH 4F15B 2APWA 4U1LB 5F70A 4OCXL 1AO7B 3RL2A 3OGOE 4D8PA 3O2WL 1X5AA 4ORGA 5CJOL 1Q0XH 4BSVB 3KWWB 4KK6D 4PBVC 3NA9H 3VFMB 2HTKC 3OKOA 3K7UA 4HH8A 1A5FH 3ARRA 5DJ2A 3GM0A 3MUGB 3NFNB 4O4YL 3SO3C 1OT1A 3DGGA 5H2BA 2J1KA 3UXFA 4EN3C 4ZFFA 1RUKL 3HMXL 2H1PH 4HWBA 2P5EE 4ZQKB 3Q6GL 5DZLA 4Y4FA 4X99B 1YMHB 4Z0XA 3SGEH 1QTYT 1EGJL 5EZJB 1ED3B 2PO6B 2OTUB 5F3HB 1UGNA 2QV2A 5J1TC 2Q1EA 4IS6B 4J6RH 3TH3T 1Y0LA 2VDRH 3U9PH 2DBLL 4KVCL 5E2UH 4XX1E 1DEEA 2IWGA 3MQIA 4YX2H 2ITCB 3VXUE 3ZKMC 5BO1H 4KI5C 4PLNC 5CJXC 2J4WL 4Q7DA 1I4FA 2VR5A 4WO4D 1A9BA 4V1DE 4WHTB 3D3VD 3TIDB 3LMJL 3EYQC 4JFYB 1F42A 4NO3B 1FC1A 2YD8A 4N0RA 2E7HA 3FO2B 3PHSA 1MY5A 4GRWB 3ZHDA 5EC1A 3RUGF 4XMPH 1OF2A 2VDNH 1WEJH 4LCYA 4LAQH 1BZ9A 1INDL 2H3NB 5HBBA 1J1PH 1N4XH 4YUEL 4YHKH 5J1AA 5ELIA 3KR3L 3C8KA 3ARDD 3HG1B 4UIKH 4WU5A 1RIHL 5ICXA 4G6JL 2RCSL 3RWJA 5KJRH 4NZDA 4P23A 3WLBB 2W38A 4AIZB 1G9MH 5GGTL 2X1PA 2BY2A 5C0AA 5EU4B 1U8LA 2IAMD 5E6YA 4XH2B 4QWWD 4PRHA 1MFBL 4ZTOH 3UBXG 3O3AA 3OGCB 1OGAE 3T2QA 4AENA 1LE5A 1NEZA 1HNFA 5HHMD 5SWSE 4OZHB 1OARL 3WNLA 3QO0A 4YR6A 4P2RA 3IKKA 2WUCL 4OI8A 3ARBD 3MUJA 2Q76A 4M7JH 3RTQD 3UTTB 4AY0A 1R5IB 4LOUD 5AUMA 4GW1B 1AC6A 4OCSH 1U3HB 2QQLL 5ACZB 3OKEB 1Y18A 2DLHA 1KCVL 4Z7VE 2GSGA 5E08L 3OJMB 1UWXH 1EFXB 3K46A 2DLIA 4QF1B 4XC3L 4K7PX 2WV3A 3KYKH 5JQHC 1A14H 4JFFB 2IBBA 3MLSL 4F15C 4WU7A 4XXDB 2IPKB 1MAJA 4HK3N 3VE0B 1RUQL 2Y5TB 3NCBB 1R3KA 4JZOB 5EZIL 1OCWH 3S5LA 3KPRE 3ZE2F 1WFTA 3WD5H 3CVHA 2NY6B 4RX4A 4OV6F 2M2DA 2HA1A 2KQMA 3DGCR 1CFNB 3D2UB 3LZFL 1K4DB 3BSZL 2PO6C 4M7KH 3RY6A 3TBWB 2GY7B 4XPHL 4MAYD 4GG8B 1KCUH 2VWEC 2CIIB 2YEZB 4Y0GA 4QTIH 2WSKA 3EOTL 4X5XA 3MV8B 2CJUH 3V6OA 3RFZC 1UM5L 4XBPA 5CAYB 1RUPL 4JO1H 4F9LA 1CFBA 2FECI 2LFGA 3HC0B 3C6SB 3LV3B 2V7HB 3ROLB 3BO8B 2PCPB 4CW1B 3L3IB 3ECBB 3RWCB 1T03L 4NQXB 4FN0A 1FN4B 2P5WA 2X44D 2A1WH 1A6WL 1AI1H 1R24B 3L5HA 4M6ML 2PW2A 3F58H 2NTFA 5JLZA 4AEIH 2MCPH 1MJUH 4RMSA 4ODXB 4UAOB 2ENYA 4F57H 3LD8B 1T2XA 1FNHA 4Y4FD 5KVGH 5DJXA 1BEYL 2RFXB 1FJ1A 3P0GB 3D39E 1RHHA 3WJJC 5IESL 4F7CB 5C71A 1JWMB 1IMHC 4JQVC 1RIVH 1ACYL 2CKBA 3MRFA 4NCC2 2IANA 2JB5L 5EOQH 4PJ7E 1MCWW 5HHXL 5GS2H 4FQHB 4MS8D 1WUNT 2NYYD 5DUPL 1RJZA 4FQJL 5EPMB 4X4XA 3T1WA 3BDXA 4FABH 4UQ2B 4MVBD 3U0TA 4EQ3A 3E6FB 5C0CB 5LQBH 2F15A 1PSKL 4NO2A 4P4KD 4GKNB 1ZANL 5ICZB 3ULUL 3D5OF 1QNZL 2AQ3A 4YDVA 3CFCH 4U1SB 2ZG3A 4DKFL 4MHHI 2OXHA 4PR5B 5ETUB 5DEZA 4P23D 4NQCE 2D9CA 4GQ9H 5EOCL 2Y36H 2BOCA 3MJ7A 3KLHC 1OPGL 4S11A 1YNKL 3UMTA 4PRHD 3TGXA 5I1AA 2NY6C 3IVKB 2VZVA 2R15A 4O51A 4PGZA 4U6VL 2QKIB 3C60A 3T65A 2FBJH 1UM4H 4NPYA 1RJYA 5B39B 4X8JB 3UTOA 2HJKA 3RL1A 1ZHBA 3HLAB 3PQYA 4I8DA 3DX8A 3MLTA 1YJDH 3OAYK 2X4QA 5LGHH 3ULUF 2UVEA 3MREA 4Z0BH 1QBMH 2DICA 3DMMB 3K3QA 2WIIA 3HE6A 3CDCA 4PJDB 3V4UH 5DJZB 3DI2B 2VLRE 3G04A 3OB8A 1B0RB 4PV8B 3SHSA 5CKAA 4G8IA 1MLBB 2E9JA 1AHWA 1NBQA 4LLWA 3VGHA 3ROOA 3DO7B 4HUNB 5ANMB 3U9UA 3BT2H 3MRDB 1I9EA 1K8DA 2FJFB 1AD0B 4HIHB 5IWLC 5F3BB 1GHFH 4RRPG 3AVEA 2OJZL 5CEZH 1KENH 2KDGA 5C0FB 3UJJH 3F65A 5BXFB 1KIPB 5L2KE 3T3ME 5F7LB 3FAXA 3NAAL 4RX4D 4OZIE 2AI0H 2P24B 1MIEH 3LD8C 4LKXB 4OLZL 4Q9RH 1NGYB 4G80A 3BP5B 4LKCA 2DJSA 2AW2A 4JB9L 4TOYL 2KZ1B 5F9OL 1BZ7B 4PRIE 2XACC 4PG2A 4MQXC 3SE3A 5HHOB 4U1GB 4QLRA 3FFDA 5FUOL 4RAHA 1MQ8A 3ISWA 1JWSA 4L8DA 3HUJA 2NX5E 4LQFH 1NCUA 3DV6B 2D2OA 2XN9E 3RVXD 4ZPTB 4NQSB 4N9GB 4HPYL 1UKQA 5IJVA 5IFHH 4OGYH 1Q0YH 5MERA 4LQ1A 2O93L 1LO0L 2I27N 1FGVH 2P5WD 2FRGP 5F1IA 1MVUA 5KSAD 4OGXH 3V0VA 1FVDA 4XCCL 2Z92B 5IVOA 5FM4A 1WT5C 1IGYA 4BH7B 2P1YA 3KYMB 4O02H 5GHWL 5ESVB 2HMID 1QEWB 3ZT7A 5IGXL 5DHXB 1ULVA 2CO6B 2EYTA 2NY1B 2IGFL 4FTVA 4XWOD 1I8IA 2HFFA 1KACB 4PYHA 4BFEA 3BH9B 4PJBF 5IB2A 1QLEL 3RWGB 5BCAA 1EFQA 4WFHD 4OLUH 2F54B 4F9PC 1U0QA 5IB3B 3TVMA 4L29B 4HIJA 1NLDH 2Z8WC 3QWOA 5EOCJ 3O8XB 3SBWC 4LEXL 1D3CA 2IAND 2GIYA 2VXTL 3EFFB 4MA7H 2OS7A 3GIVB 5A2KH 4U2ZA 4Y4HB 2CRIA 1X5GA 4PJ5A 3C9NB 1QFWM 3BESR 3O41B 3O6FA 3TM6A 4OM1H 1E6OL 1IRAY 3DMMC 1T5XB 3RIAF 2DJUA 2JELL 1EUUA 2QSVA 5DO2D 3HB3D 1NH6A 2X7LB 5C92A 3VFUA 1DEDA 1H8NA 3U7WL 4GG6A 3VW3H 4WHDA 3RVTD 2WBWB 1HHKA 4XZUB 2AXJA 1IC7L 4GAJL 3KDMB 3SGKA 1NDGA 3IETB 1MFDL 2Q7YB 3RBSA 1WBYB 2H2SD 2YPLA 4J3XA 3KPPB 4H25A 1T2JA 4OZGB 1D5IH 5CSGA 4XPAH 5KS9A 1CLZH 4M5YL 4V2BA 2NR6D 1FBIH 3O9WB 1ZHNB 3MJ9A 1PKQE 4HUVB 2Z31B 1JPST 1XGTB 5HPOA 3C60D 3VA6A 4JRWA 1TVBA 2XZQL 5FYKH 4HFUH 1OAXH 3PQYD 3SQOH 5EBMA 3OJ2C 1FL3A 3K8MA 4IOFD 4KPHL 4OQTA 4ZYKA 5EWIH 5IOPA 3WHXB 2HTKD 4U1GC 2YRLA 1KV3A 1F8TL 1UA6H 3G5YB 2DQGL 2GJ6A 5BQ7B 2YKLH 5SWZB 4M02A 4N8VB 1E4XI 2VXQL 4Y16A 4OLXL 3F7VA 1J9CT 3CVIL 2AXGA 3VH8B 2HT2D 5GGQL 2YBRB 1IQWL 1KJ3H 3IJYB 2ESVA 3FO9A 4BQCA 4BUGA 3VI4E 4LCCB 1YMMA 5FO7A 1GGCL 1S7RB 1JNHB 1OAYL 4JFED 3V6FA 4EDXB 4M7LH 2AK4E 1BVZA 3S35H 5TE6H 4PBXA 5CHNB 4LCWE 3LN5B 1YN6B 2NY1C 2X4OB 4ODSL 4KMLB 3ZKMD 5JR1L 4NRXA 1V7NL 5IBTH 1HHHB 1RFDL 3BKYL 3VFGL 3VRLE 2P47B 1RZ7H 3MRBB 4I48A 4UTBH 4HUMB 4Y4KB 3VXPB 1MAML 4YHPA 2FSEA 3O8XC 3N06B 4MJIB 2AJUH 3AY4C 2G5BB 3GJFB 1CFQA 2RQ8A 3WIHL 1TFHA 3LIZH 3RGHA 3IJHA 4ELKA 1WWWX 2HLFC 2ADIA 2XTJE 4WEBH 1CWVA 4GRMB 4ODUA 1CDJA 4NJAL 1OD9A 5L8JB 4A6YA 5I76A 4MJ6B 1MWAA 3UPRB 3LKNA 4YC2B 3T0EB 4JO2L 5DRNA 5ITFB 1KEGH 4RGNB 4XPGH 3P4NA 4OFYA 3PDOB 1INQA 3MJ8A 3NZHL 1LE9A 2LVEA 2R1WA 4Z77A 4YEEA 4FTVD 3BKJH 1F4YH 3PHQA 4X7TA 4Y5VB 2OK0H 3HR5B 3W0WA 4M62H 3LQAL 4MCYA 4NOBA 1G7HA 3WFZA 3O9WC 1B9ZA 1JPFB 5JOFB 4E0RB 2LU4A 3NZ8B 2E7LA 2Z31C 3V5KA 2ILLA 3NIFF 4QNPF 4P4RB 5E2WL 5CBEA 4AIOA 5IF0A 2OL3L 2XA3A 3I9GH 3O6FD 2OJEB 1Q9OB 3SOBL 3GB7B 2D7NA 4LASH 1A1MB 1BQUA 1MY7A 2ZUWA 1K9TA 3KPQA 4XHJC 1T04A 3PNWA 5GZOC 6CGTA 2N1KA 4JO4L 4M43H 5CP7A 1HK6A 5H37H 1LVEA 3HC4L 3RVWC 3EHBD 5FYLL 1BQSA 3C5ZA 3P11H 2BY0A 3QQ9C 3BIAX 1YC8A 4YBLB 4DCQB 2A9NL 4KJYB 4NNYA 3UO1H 5FHAL 1VFUA 4D0CA 4RMRA 4N90E 5IFAL 1OP5H 1TTUA 1HXMB 4LCCC 1MCQA 5C8JB 3KYOA 3LN4B 4I13B 3X11A 4PJHF 3AS1A 5A3ID 2ZNWA 3QNZA 2LQRA 5F9WB 1MI5E 5IMOA 1KYOK 3PUCA 3STLB 2YMXH 4M3JA 1NGPH 4N0FB 1E28A 3C08H 3T4YA 5HHNB 1OTSD 1T7YA 1WZKA 5AYQA 3VFRB 3IDMA 2QQNL 5CEXB 3HAEB 3O3EB 4LPTA 5HI5D 3IFNL 5C3LD 4Y4KC 2Z91B 2MSPA 1FLRH 2CUIA 3WN5A 4FQ1L 1U91A 3OAUL 2MCG1 1P1ZB 1PD6A 3S3JA 5IMMB 1YEHL 1A6AA 3IFPA 3GMLB 5DQ9B 3I2CH 4JAMB 2GJ6D 2NY0D 4C4KT 4TVPD 2J8UF 3P9WB 4YNYA 3UROR 4WY7H 4IDLA 3B8SA 4Y16D 1F5WA 1NCTA 3BRFA 4TQEL 3VFWA 1XR9A 4NWUH 2V9QA 2B0SH 5J1SC 1R3IH 2BY3A 2XPGA 3LKPB 4C59B 4YC2C 2EIEA 4WEMB 3T0EC 2W60A 1W72A 3MOBL 4OD1H 4RGNC 5MENA 3EYVB 2XICA 3QHZL 3MNVB 3FB8A 1QSZA 5D1XA 2BVOA 4DUXA 1YNTA 4Y5VC 2GUOA 4P5TA 1IL1A 3MLYH 4KI5F 5GJTH 3V8OA 2GTZB 1KT2B 2OR9H 4ODWB 3S96B 1EMTL 1U3HD 5MEQB 1H3PH 3I3DA 4B50A 5I8OL 1T7WA 4HJGB 1SY6L 3ARPA 1SJXA 3A67H 4WIQA 3WMSA 1HH9A 4JFFD 2D7TL 4P2OB 5F6HI 5BS0E 1NBVH 4U0QB 3PGFL 1JWUB 1GZPA 4FQXC 4KQ4L 1CGTA 1MCBA 3RVVC 4P3DA 4OCNC 4UUJA 1GGTA 5KVMC 4RA0C 4CAGA 1ZHLA 4M6OL 2EZ0C 2F53B 5LWYL 4LSSH 4GAFB 3IDYB 3RUGE 3T08A 2H32A 4XP6H 1R0AL 2OTWB 3NN8A 3FL7A 3WE6A 4C55A 3RHWK 3MGTB 2NLJB 3H9ZA 2LAAA 4JJHA 4LSRL 3KNBA 4YBLC 5IK3A 3PXHA 2FGWL 3D2UD 2V7NB 4JPKH 1WZMA 3VCLB 4PB9H 3SE9H 3BYYA 4NRZA 1NGWB 2DTML 3L1OL 2R1XA 4OF5A 4E42A 4ZFGL 3P0YL 4ZTPH 4OCXH 4DGIL 2OBGA 3RWFA 3O2WH 3GFUA 2OZ4L 2CDEB 4X6CB 3NCFB 4LSQH 4I2XB 1K2DB 1J8KA 3VGBA 4HG4K 4O4YH 4PY8I 3OF6A 4GS7B 4J3OC 2CO7B 1RUKH 1A47A 3HMXH 3QDHA 4R0LB 2P44B 1ZK9A 3Q6GH 3IXAA 5DURB 5F1NA 4ISVB 4LSVH 3BX7C 5L7XL 3VXSB 5IVXB 1BQHB 4P2QA 1ZVSA 5ESAB 4RAUA 3C87A 1FZKA 2DBLH 4KVCH 1EK3A 3T0AA 3ZL4L 3IRZA 2MHAB 4QT5B 4Z7WA 2FWOB 5LXGL 2DWDA 3REWB 3PL6B 4NNPL 3ZE2E 2J4WH 3B9EA 3FONA 5IB4B 3KS0J 1H0DA 1FFPA 3QDMA 5KVFH 1OHQA 5DI8A 3LMJH 4RWHA 2N7AA 3ARQA 2GI7A 1I3GL 1S7XA 3RNKA 4P2CG 1LEKB 3FFCE 2C1PA 1INDH 3D85B 3K1DA 4N5EC 1YC7A 1H3VA 4LHUA 3ZTNL 3TZVB 3KR3H 4KFZC 3GSQA 3G6AA 5JPMB 5DHYB 4O2FA 2HFGH 2DI7A 4P2OC 4QRPE 4FG6C 3VXRA 5GGTH 2CMRL 1CK0L 5E5MB 4JZJB 4HDIA 1M7XA 1MFBH 3U0PB 5DQJB 1QQDB 3IDYC 5D71H 5DRXA 3DUSA 2G60H 2AS5M 2VDMH 2A38A 1U8QA 1XCTB 3BZ4A 2WUCH 3V4PL 3WNOA 3M17A 4OD2B 1OT2A 2ZWLT 1AP2A 3SKOB 3E8UH 1P6FA 3K2MC 5D1XD 3CUPB 4WDIA 5T3XL 3GRWH 5E08H 4MZ3A 4MWFA 4OZHF 1IAIL 3VFSA 1GSMA 5CGMA 1BWMA 1JTPA 2V2XB 3EOAB 3T04D 2HVKB 1LNUA 3MLSH 1G0DA 4WUUB 2DLGA 5DQDL 3BW9A 1G7MA 5EZOL 5HYJE 4MSWB 1UB5A 3UTSB 1GGYA 3TJHD 1DE4A 1NAMA 3MCKA 1LO5B 5EZIH 3WUWB 1AGCB 3BP4A 2DM3A 1A6ZA 4GS7C 4R4NC 5AZ2L 2F8XC 1QSFB 3DVNB 2W9EL 4JR9L 5TE7L 1TJHL 2RAMA 3A6BL 1FZJB 3UZVB 4R0LC 5D6DA 1VADB 5EU7E 4OCWL 1U8HB 1T0PB 4YPJA 3CSYA 3OKMA 4HQQL 4XPHH 1G9NH 5TDNB 4XVJL 4LP4A 4WHYG 1I8MA 3OG6B 3GBNH 3R1GL 1AGDA 1OTUD 1MLCA 3EOTH 3UJIH 4IRZL 5GGSA 3K4DA 3BVNB 1UM5H 3GMOA 4CN4A 4N8CL 1KJVA 1CGVA 3PL6C 3DX6A 4HGMA 1IGMH 5HYQB 1S7QA 5HHOD 3X3FH 5CBAB 4PGEA 2MOVA 4FZ8L 1DBML 1VEMA 2AXFA 3MYJA 5FUZL 4D0DB 2JJVA 1NCWH 1SEBB 3KVQA 3O6ML 4JY6B 4K7PH 4PJXA 3OF6D 5JHDB 5BW7A 4ZUUA 1RJLA 2IH1B 3ULUE 5IJKA 4MMZC 1Z9MA 1KPRA 4G9FE 3TZVC 3EOBA 3VDBA 3WNPA 3FQNB 1FO0B 5ID0A 2X4NB 3SKJH 2Y23A 2YK1H 2MFNA 3QXVA 1VHPA 4MA8L 5HYEA 4NYLA 4LNRA 4WUKH 4IRJB 4F37K 4NCDA 4JZJC 4P2QD 1FAKT 3JWOH 2HN7B 1JPSH 1KB5B 2NY1D 4XAKE 4QXTB 1ACYH 1UQSB 4W4OA 5F7DB 1UYWH 1AR1D 3ULVC 1V3LA 1OM3H 3RX7A 3L3HA 4RISH 4LSTL 2GCYB 4PRDB 5DJ0A 1Z9LA 1MJ7H 2VQ1A 4BELD 1SMOA 4AJ0A 3TIEB 1QLRB 4XMKL 4Y4HD 4HKBA 1LP9A 2HLFD 1WISA 3MRCA 1KB9K 1EO8L 1PSKH 5C6WH 3AXLA 1IZJA 1QNZH 1CE6B 3K2UL 1NDMA 1KIQA 5E0QA 4U6HB 1FFOA 4LHUD 4ZDHB 1KPVA 4DN3L 3BKCL 5IG7A 2IH3B 3O3DB 1ZS8B 2OQJB 1N5YL 1AKJA 1P4LA 3KXFE 5EOCH 4ZFOA 4EUPA 4GUPB 1HXYB 4AMKH 4ZUSB 4X6DB 1N59B 1OPGH 1YNKH 3RWHB 1EO5A 5FF6A 2VZ1A 1Z9OA 1XGPA 4P49A 3QPXH 3LY6A 4X4ME 2YD1A 3DBXA 2KZWA 3OPZL 5CLWA 1F3DJ 5D7SL 1F90L 2Q86B 4YGVB 3O45A 2JKXA 1NEZG 2AK1H 3F12A 1DBJL 5D93B 3QUXB 2BRRL 3QXWA 4BSJA 1DLFL 5DJ8B 5SV4A 1QP1A 4OSUL 4P9HC 1O7SA 2FO4B 4XAWL 1GOHA 1AXIB 1LGVA 4MJ5A 1A7RH 1KTLB 5IVZA 3GSNA 1WF5A 5I74B 5T5FL 3CK0L 5TE4H 5D1ZB 1PJ9A 3HZVA 5ID1A 1ERNA 1ZSDA 1IAKA 1ZT7A 5FB8A 1JHTB 4HHAB 4R8WL 1YN7A 4E41A 4L9LB 4YQXH 3K8KA 4KK9D 3JTSB 2VL4A 5D2NA 5IMLB 3U79A 5I1KL 4OLZH 3GGWA 4OIAA 4CDHA 5F1OB 3OR6A 4JPVH 4PYGA 4IRJC 4TOYH 4NUGH 3WO4B 5BVJA 2FHBA 1EVUA 4YGAB 1IEAB 2Y7QB 2EDYA 3MA7A 4L4VE 3V0WL 4JFXB 3RJDA 1CDBA 1HQ4A 4KZDH 2IPTH 1MJ8L 1ZA6B 4GMSH 4CADA 3ZDXF 3SY0A 5DFVC 4XPFL 2VXUL 4YDKL 4P59H 4HPYH 4FA8A 3FB5B 1ZA3B 4L3EE 3MBEB 1T22B 3VFPA 1CXKA 5HVFB 3OG4B 4B53A 5JIIA 1J05A 1HHIA 3ARYA 4XCCH 3TBYB 5FYKU 4PG2C 4NHCL 4WWID 2ADGA 1CXLA 1R3HA 5GHWH 4KRPB 2WINA 1SVZA 4KVNL 4R4BB 2HTLD 4N8PA 3SGJC 4OZ4B 5E9DB 2NXYB 4IRSB 1MCFA 4HJ0D 3TP4A 4MNGA 3D9AL 2YD9A 5TDOA 4GT7A 2BC4A 3QXAA 1VENA 2FIKB 4HJJL 1AGBA 4HKJB 4XNMA 5J56B 1WAAA 4LEXH 2VXTH 3IDGB 5GRWA 2CQVA 4E5XA 3DURA 4EEEA 1GGIH 2E7CA 1CDYA 3FOMB 4U1HA 1U95A 5D7IA 3PWUB 1N64L 4O5LL 5DD3L 4WWKB 4TUOB 5T1MB 5JTWA 1E6JL 3CSPA 2VERN 4JKPH 1D6EB 5I1CL 5A2LH 3QUXC 2JELH 5ALCH 1VB9A 5K9QI 1H3TA 4PJIB 4JRXB 4TVSa 2DM2A 4OCYH 3ZT5A 2I5YL 3IKCB 2AJZA 3CFEB 3ZKSD 4UBDD 1QRNB 4CL7A 4ZUWA 1MFDH 2DMKA 3BD4A 1DQLH 1SEQL 5D1ZC 4BZ1H 4OZFA 1D5BB 2ZSWA 2EIZB 1AKJD 8CGTA 1SJHB 2R1YA 4G42A 3IF1B 1M71B 3H7LA 2GAZA 5TDPB 3WFCL 3VU2A 2XKNB 3BPNB 3S4SA 3QHFL 3QIUB 2D7MA 4RBPH 3CMOL 3VFOA 4OZGF 1TMCB 2XZQH 2LVCA 2UZIH 1QFUL 1AGFA 3JSSA 1CICB 3RIAK 3TN0A 1P53A 3WO4C 1Q9LA 4JCMA 1J8HA 3CVHH 4K3EL 1WK0A 4KPHH 2IADB 3QQ3A 1KLFA 2D0HA 4XVUC 1BX2B 1G7QA 3ORJA 1JFQH 2FL5B 4K7FA 4U05A 1QACA 5JOEA 5FKAB 1NFDB 1ROWA 4PUBH 2VXQH 4PJEB 4MMXC 4WHCA 1OWWA 4UT6L 1XIWA 2Y9RT 4L8BA 4OFDA 5T1KB 5I17B 4D0BA 3MBEC 5E8PB 3X3GL 3UZEA 3PXJA 4QNPE 1IQWH 1ZTXH 3EYUL 1XF5A 4H1LG 2VLME 3BI9X 5CUSL 4HBQA 4NN6C 3U48A 2A73A 4JANA 3MLRH 3CC5A 4YFLI 5IEHA 1HYRC 5DMIL 3A6CH 4KRPC 3OKLA 1Q9KB 4GAGH 4S2SB 1XZ0A 3MLXH 5JR1H 1V7NH 2NXYC 1H8OA 3MRKA 4IRSC 3VFGH 3BKYH 2R0KH 4BH8A 2WUBH 3OJDA 4G6KL 2JTDA 4KK5D 3QCUL 1I9IL 3VJ6B 2AJSH 5IT2H 3MODL 2VABA 4QXUL 1X44A 2B1HL 2ZUVA 1YYLL 1QFWL 5EU3A 1C12A 2CUHA 3C2SA 4KDVA 3WIHH 3WLWC 4UIMB 5E6IA 4OLYL 2IQ9L 2XFXA 1AR2A 3HPLB 2VSDA 2IALB 4YDJA 4GLRI 4J8RA 4PRNA 3RWDA 1VEPA 4PJHE 3KPLA 3NPSB 4PP1D 4U1MB 5T1LB 5KW9H 3CFDB 2PYEB 4K55A 3ET9F 5ESQB 4ZUVA 2FJGA 5D5MB 2CGRL 4H26A 1UWGH 4KDTA 4OIIL 1JV5B 5DUBB 1BD2A 5C9JA 3CAFA 3TBTA 1WTGT 1OP3H 2AKRB 5JOPD 3OMZA 3RI5K 1A22B 4M9OA 2X4PB 5HGDA 1IGTB 3MCLL 4BQBA 4UILL 1HSAB 5DWUH 5FYLE 3FHAA 3IAPA 3NZHH 1YEEH 4LLUA 2F53D 2WK2A 4IMLB 2D4DA 2CSPA 5FUCC 1S9VA 3P77A 1HHGB 4KJQC 5JO5A 2P42B 4YAQA 2J8UE 2Y1VA 3WUZA 2CDFB 4Y8AA 3QQNA 1EHNA 3BP6A 4KHXL 4G8GB 3QRFM 3BPNC 3CJJA 3QIUC 2DKMA 4U3HA 3IFOB 1Q9WA 2DJ4A 1Q8MA 1QRKA 5GGVY 4J4PA 5BVPL 4DN4L 3HI5L 4CN6A 3VXUB 4PRAB 1CICC 2OL3H 2C3HA 1WFUA 5GRYA 4OF7A 3EYSH 4V1DB 1FNLA 1I1AB 4HUUB 3MRPB 2UWEB 2BVEA 3PP4L 3TO4A 4Z8FL 4KI5E 3CDGA 4JO4H 5C0BB 2Q7NA 1NCNA 3NCJH 4P5MA 5IW6B 1EJ6A 2DQEL 4JQXC 1P7QA 1PAMA 3OB0H 1AE6L 3CLFL 5J6GB 2A9NH 2YD6A 3B9KA 5DURD 3SE8L 1HILA 3CXDH 5IFAH 3EZ8A 1QA9A 5HY9B 3BGMA 1G1CA 4KZEH 4P46B 2VLLB 4YXLL 4N1HB 4X7EC 2VKXA 3LPWA 4Y19E 3GNML 4H1LH 3DX7B 3PV6A 1JF5A 1A4KB 5LGJB 5I0ZA 1BREA 3V52H 4HX1A 1J0IA 3BHBB 4PJGB 5EOTB 2Y6SC 5SWSB 2RBLA 3PL6D 5K33A 3TN0D 4KKLC 3IFNH 3C5ZC 3MV7A 4R4FL 2QADB 1CU4L 3EYFB 2HAZA 2JJTC 1XGRA 2P8LB 3QUZB 4FQ1H 3IS1X 3WCYA 4EI6A 4YHZL 3OAUH 4HD9A 3S6CA 2HWZH 2EH8L 1YEDB 4Q6YA 3W2DH 3CD4A 2BSTB 3PWJB 3QEQE 3D85D 3V6BR 4UT7H 4NZRL 3NPSC 3H9SA 2HT4C 5CMAB 4HV8A 1BOYA 3TZVD 1SBBA 3JVGA 2FEEL 2EDRA 1XIWD 1N6VA 4YO0A 2EECA 3CX5J 1RZ8A 5HPMA 3QCTL 3FQXA 4I3RH 4P5KA 2AAVA 1G6RB 1I7UA 2C9AA 1ZT1B 3P2TA 3KS0H 3STBA 1XF2A 2XZCL 5E2TL 1AO7E 3KPRB 4NJ9L 5CEYB 4F7MA 2WWKO 1YZZA 4G6MH 4KK8C 2DIJA 4ZSOE 5IEKB 1NUNB 1BFOA 3BGFB 1A2YA 1II4E 4DTGL 5BJTA 3KPNB 1CD1B 1JUFB 4Q6IA 4ELMA 1DQTA 1SYVB 2GITB 1JGVL 5E6ID 4H88L 2ED9A 3VWJB 1NGQL 2D7TH 2P49B 1GZQA 4PLKD 3GMNB 3PGFH 2VWEE 4WUUD 4O9HH 2EDHA 2AJ3A 1I1AC 2HKFL 3UTSD 4M6OH 4D9RE 3NIDF 1TVHA 4PY7A 3IDNA 4FXGB 1SHMA 3Q3GA 1QSFD 4MNQA 1KJ2B 3B4NA 3SDAB 3FOLB 1AIFA 3EDDA 4LSRH 2D0GA 5C7XL 2HG5A 2GQHA 5E8EB 2FGWH 4HUWA 5L9DL 3I6GB 3L3DB 1QKZL 3C6LB 1DUYB 4P46C 4PJCB 4GRLA 5HGHA 3D39B 4XGZA 2DTMH 4PJ9B 1NC4A 1UACH 3PWPA 5EIIB 5DS8B 5B3JE 2R4SH 4NKMB 3ULSA 1IKNC 3HG1E 4DGIH 5FKPA 4J4PD 5EFIB 1QSEE 5I18L 4PJ7B 3REVA 3TWCL 1MREL 3L9RA 2QADC 5B8CB 4G6FD 3MXWL 1WGOA 3QUZC 1EV2E 4GBXA 5FYJL 2F74A 4Q0XL 4GW4A 5KN5A 1U8IA 3ARFA 4BK4A 1XF3B 1KOAA 3FO1A 2YHGA 3SGEI 3IFLH 4GW5A 4X6CF 4OZHE 3TO4D 4LDLB 4CVXB 1IGJB 3UTTE 5AZEL 2ZPKL 5CS7A 5L7XH 5K9OB 1P7QD 4OQTH 5A16B 3VRIB 2BNQE 3ARGA 4GRWH 4L4TA 3HNVL 4EJ1C 3B9KD 3SKNB 1B6UA 3MPCA 5TF1L 3WS3B 2B2XL 3ZL4H 2X9YA 1S9XA 3F7YA 5HJ3A 5LXGH 4NQCB 2IJ0C 2YRZA 3FQRB 1FVEB 5IVXF 5KAQF 4NNPH 2DMCA 2K3TA 3QPQD 3I75B 1DQJA 3SKMB 1OAUH 1U8MA 4Q9CA 4AM0B 2Y25A 3VXQA 4GSDH 4JN2A 3MFFB 5T3XE 5B3NA 5EUOB 1H9VA 1I3GH 5JXEC 5HYSB 5K59E 2QSCL 1ORSB 2XQYK 3ZYZA 2VLJB 2AV1B 2ZSVA 3ZTNH 4BYHA 3TH2T 5DJCB 3ULVL 3AU1A 4LLDB 3RAJL 1CGXA 2VLRB 3THML 4M6AA 4HIXL 1M7IA 3W39B 3VWJC 1UVQB 4X4YA 3DHJA 4R90H 1ZLWH 1Z9SA 2CMRH 2Q8AH 3OR7A 1NGXA 2ICEA 3MV8E 4OF3A 5EIVA 3WS6C 4L8SA 5EN2B 4FZEH 2VISA 4AL8H 4PGBB 3MNZB 2CKBL 1EERB 3BP7A 1XGQA 2D0FA 2QQQA 3U82B 5I1HH 4RGOL 3SDAC 1B0GA 3AAZB 3EO1A 5TH2B 4A6YH 1D6VL 1VFBA 3FB7A 3RKDD 5JW4R 1YPZA 3DV4B 4OZIB 1NLBH 3D87B 1JRHI 3S7GA 1IKFL 3C6LC 1H15B 4OAWB 3HC3H 3ULVF 4RMUA 4QOKA 4FQ2H 4LGRB 4PJ9C 5EULV 2BVQA 3TBSA 2NZ9C 4TULH 1DUZB 5J4MA 1LILA 1XR8B 3E6HB 4LGPB 5B38B 5DQDH 1MNUL 5EG6C 4Q2ZA 1I3VA 5K93A 2GFBA 2NX5B 5DJ6A 5I2IA 5FOJA 3U2SB 2HFTA 2DYPB 2XN9B 4PJFA 1BPVA 1EAJA 5GISL 1R5WA 5KSBA 1TJHH 1HIML 1T1ZB 3A6BH 2R39A 3KPMA 4P9HL 2DB8A 1D5XB 3PABA 1HSBB 3T0DA 5TGBB 1F3DH 5IBUG 4FS0A 5I71B 1KN2H 3FCTB 1UB6B 2FEDD 3IU3A 4QY8A 4XP9H 4KU1A 4U49A 5C0CE 5FOBB 1JZ6A 3GI9H 2FD6L 5E8OB 1A64A 3K8LA 5FGSA 4GRLD 2NY7H 5I66B 4K9EC 3E2HB 4LL9A 1NC4D 3PWPD 1PVHA 1FO0L 3QQ4A 4NQVB 2IPUK 1JHLH 4R2GB 3GJEA 1FFNA 3H0TA 3E0GA 1FZMA 4MX7A 5ALBL 4FZ8H 3MRJA 4FFWC 3GHBH 1WWAX 1RZIA 2JIXB 3SDDA 3UTPD 3NBNA 4NDMB 5B21A 2APXA 3T2OA 5GXBB 1I9JL 1IAOA 4GBXD 1BP3B 3ARFD 3GSOB 4LVHC 3MRMB 1LEGA 4XVTH 4F7TA 4QRRB 3QDJA 3WIFB 5BV7H 1T83C 3GKWL 4R3SA 2XWJB 1MUJA 2P7TB 5T33L 2X6MA 2FECL 3Q1SH 5IFJB 1ETZB 2DRUA 5DMYA 3ARGD 1BFTA 4S1SL 3UBXI 1DVFB 4M93B 2P5EA 4L4TD 5FDWA 1SJEB 1VGKB 3AM8C 1P4IL 2E8YA 2H26A 3CFIC 4I9WE 3BEWA 1K3ZA 2YA1A 1LO3L 4LRNH 4J3VA 4NT6A 3G6JB 3QR2A 2WNGA 2V9RA 4P3CL 5SWQB 5D9SA 4NKIH 5ANME 3W5NA 1JIBA 3L5WA 2FYYB 1AH1A 1TCMA 1PKQB 1UJ3A 2J8HA 1FCGA 5E5RB 2NY5C 3DRTA 1LO2L 1W72H 3BUYA 1N2RA 4IBLT 4WWKD 2C4FU 1CLOH 3FHQA 3K2UH 2LTQB 3HE7A 5BMFL 1IT9H 3O4LE 2EYRA 4F8QA 4M1DL 4NKOB 4YHYB 2ICES 4NM8L 1T2QL 4R26L 5DJAB 1EEYA 2AJXH 4Y1AB 4TN9A 3ZDXE 1F6AB 4JRXD 4WW1B 1N5YH 4MD4B 5E94B 1RZJH 3L7FA 1WWCA 4XI5C 4HWZA 1L9NA 1SBSH 3FQTA 4LHUG 1OP5K 3EUUA 5J8OA 5DTFB 5C0GA 4NN7B 4O2EA 1RMFH 4CJ1A 5ERWA 2VE6B 2YXMA 3MO1B 4LFHD 5DK0B 5ECJE 4KJQD 3EO9L 1RPQA 2D7OA 5JW4M 2P8MB 3CPLA 4N0UE 5C09E 5I71C 1D9KB 4X6DF 3QIUD 3OPZH 4X6FB 3H7BA 5D7SH 5AEAA 1F90H 1B4JL 5JMOC 1T4KB 3PWNA 5DVLA 1OGAA 4PREB 1JGEB 1H3UA 1DBJH 4M8VA 1TZHB 3D1MC 2H32H 5A40E 2BRRH 1C16A 4QOKD 1A1NA 4LCUA 3E2HC 3JV4A 5F89B 2GYSA 3LS5H 5F9JB 3QFJB 4HCRL 4R2GC 1EBAA 2GKIA 4ESKA 4JDZB 4Z7VA 4HS3B 3H3BC 3MACL 3CK0H 4TUJA 3CXHK 2I9LA 3KPOA 5DVNA 1G7IB 2F54E 3M8OL 5JNYA 3OBAA 4PTUA 4JJ5B 1S7VB 4WNQB 1ZLVH 2R0LH 2CXKA 2DI9A 4NGHL 5DVKA 4G7VL 1PFCA 4KQ3H 5I1KH 1TZIB 25C8L 5IQ9A 2GSIA 1FC2D 3MJ9L 3NFPA 1BAFH 4EZMA 4DKDC 3QEUA 3VG0L 1VERA 1DVFC 1RK0B 4M93C 43C9A 4MD5B 2W07A 2DQFB 1F3RB 1FL6A 4ERSH 1MJ8H 3V6ZA 5FO9A 1CVRA 1ND0B 2AJYL 5LCVL 5J6HB 5CD3A 4KKLD 2GTWA 2A6JB 2VXUH 4P57B 3U6RB 1YY8B 1CDCA 4JM4H 3CH1B 4FXLA 3RPIA 3DOSA 1U3ZA 2FZ3A 3QIWA 1HQRA 4JRYA 3SDDD 3IYLW 1V7MH 4KXZH 4ZS7L 2OCFD 4HLZG 4M6NL 3TCXA 4MDIB 2A77L 1FYHB 4PV9A 2LTQC 1X4YA 3CZFA 4YHYC 1BHGA 5B4MC 3BXNA 3TYFB 2KPNA 2BDNH 3DX9B 4KVNH 3DRQB 3S34L 2FNBA 1CLYH 1RZKC 5I1JL 3D9AH 4G7YL 2V5SA 1P6AB 4FQLL 4NN7C 2P5ED 1GIGL 2HH0L 4S10A 1DLHA 1IC4L 2R9HD 3KYAA 3LEXB 5GJSL 4R97B 1JZ7A 4XWGH 2RR3A 1XMWA 4JFZL 5SWZE 4OV5B 1XF4A 4DZ8B 3KHQA 1M7DA 4CNIB 5JA9A 3FB6A 1DBBL 3U4EA 2Y07H 1T7VA 1ONQA 1FYTB 3JUZA 1D9KC 2GK0B 3UAJC 5DD3H 1NC2B 3VD3A 5JDSB 1P84J 3L5XL 1E6JH 4HFWA 5I1CH 3VXUD 5LBSL 2FB4L 4G9DA 1E27B 1QVOA 4XVSH 4XC1L 4Q9QL 1JF1A 2VUYA 4D3CH 3QCVL 3HE7D 4V1DD 4WV1A 3FRPA 4OI9A 5DHVB 3ZHKA 4IHOB 1K4CB 4G43B 2YUZA 4N1CA 5E8NB 2O61B 3F5WA 4ONHB 4WCYL 1SEQH 1C5BL 1CG9A 2HVJB 4I18B 4PJIF 2VDOH 3DIFB 5INCB 3RVUD 5FA3A 2G9HA 1HEZB 2R0ZL 4MJIE 5C08E 3QHFH 5DLML 4N0YL 2ARJQ 3RDTA 2VIRA 3IXTA 5IM7A 1HYSD 5EU6B 5HDQL 2ATKB 4QEGA 2C7UA 1ZWIB 15C8L 4PGDA 1YDPB 3NTCH 4K3EH 3UTQA 3BZFB 1NQBA 1OGAD 5IMKB 2A6IA 3CFJA 5EO1A 5SWSD 4HIIA 3T0EE 4I0PB 5L6YL 4RGNE 3MUY1 1F3JB 5KG9A 1AJ7H 3B2UD 4OKVA 4MDJB 3M1BA 3HAEG 2B1AH 3SE4A 5EBWA 3W11D 1MCPL 3QA3B 3SDXB 4BKLB 2NW3A 2A6DB 3MOAL 1EAPA 3RGVA 4N5UA 4QRUA 5BS0B 1URLA 1MFAH 3VFVB 3T8XB 1ES0B 4PJEF 3GJFH 3ZLQC 1YEJL 1CT8B 2ARJB 4L8CA 1LK2A 2Q6WB 3GO1H 2BSSA 3P4OB 1KN4L 3K4ZA 2D9QB 5IHBA 4PPTA 2PF6A 5D7LE 1HOCA 4WGWB 1E4XL 2YUXA 3ARWA 4G6KH 5ADPL 3KPRD 1NCBH 4JY4B 1T1WB 5L2KA 4PIRF 4H5SB 3WFDH 3C2AH 1RZFH 3QZWB 3LKOA 4HAGA 4QXUH 1T0MA 3LSOB 5JORB 4R97C 4XTRD 1I3RB 1QZ1A 1J0JA 2V2TB 5JW5B 2XNAB 1C08A 4ONGL 4U1IA 2DIBA 3SDCA 4PRIA 4RNRA 1WBZB 1DJSA 2PUQT 5FCSH 2N7BA 4PP2A 1TTGA 1J86A 3RNQA 4ZG1A 1ZVYA 5I8CB 3N0PB 1BZQK 2CGRH 4OIIH 4PG9B 3WIIL 35C8L 2M8XA 3FRUB 3BH8A 1IM3A 4PJAB 5CWSA 3U4AA 5HGGS 2CLVB 3VXOB 1CD8A 3BRDA 3MR9A 3MCLH 2EH7L 5D5MF 3QUKB 1DN0B 4ZNCD 4KUZL 4I18C 4RCAA 3SDAD 3GMMA 4YHNB 4K8RC 2E6QA 2PTTA 4KHXH 5EC2B 4FMKA 1SYSA 7FABH 4AG4L 4CMMB 5BVPH 5BRZA 3D39D 4DN4H 4RRPA 4KC3B 3T4AB 1X5IA 5SX4I 2YN3A 4JFPA 3QAZB 2PR4L 3Q2CA 5DEFA 4R96B 4JGUA 3QNYA 2W91A 1HZHL 1OAQH 2CD0A 4HS8L 2QLVB 3TA3B 1F4HA 3PP4H 1ZV5A 4I0PC 1JN6B 2HLAA 2PXYA 4X5WB 1DQMH 4APQA 1TCRB 2DQEH 1JGLL 3FFCB 2SEBA 2E6PA 3LKQA 2UWEF 4JDVB 3HAEH 5HTSA 1Z5LB 3RZCA 2AP2A 5AWNL 4C83B 2E9WA 3T2PA 4EBQL 5H8DA 4WI4A 3GNMH 1IM9B 2XYCA 1BMGA 4EIZC 3HMWL 2YA0A 1UCBL 4DVBB 1U8OA 2X4RA 1N8ZB 4Y8DC 2JF1A 4LF3B 4LLMA 5DYOA 1PEZA 4NQCD 3IRPX 2ICWA 1EHLL 4LBEA 4RMQA 2I24N 1HINL 4HT1L 3IDJB 4R4FH 3S4SG 1PG7L 3SGDH 2ZOKB 1I7TB 1QYGL 2GT9B 3JWNC 1I8LC 4FFWD 1M05A 5T1DL 1R3JB 1T0NA 4HH9A 4PJGF 1NBZA 5IR1A 3PHOB 5C0JA 4QHLA 5DMKA 3L3GA 1T89C 4NZRH 3TJEL 5F97E 4L4JA 4MD0A 5J9PA 3GUTB 2VN4A 5EZLA 3B9VA 4X6BB 4HAFA 2P8PA 2VLRD 3GSUB 3G5XA 3QCTH 5ISZB 4PJ8B 1ZAGA 4KAQH 1JZ8A 5C0AE 3RGVD 1A6UH 4X6EA 3RRQA 3QUMB 4G8EB 5I8KL 3BQUA 3L3JB 2XZCH 5E2TH 1S7UA 3BIKB 3DWTA 4PGCA 4NJ9H 1S7SA 4YHOH 4LEOA 3S36L 2VDKL 3HI6L 4X6CE 5ICYB 4I2XE 4NM4L 3HI1A 4ODTL 4P2RE 5D2LB 1DDHB 2C3WA 5L2KD 3WXVL 5FCUL 3INUL 4WW2A 2AK4A 2BVPA 3A6OA 4LCWA 1N3NB 3MGOA 4GKZB 2AJVL 3HTLX 4XP5H 2X4TA 1AXSA 5BZWB 1UKTA 1JGVH 3DI3B 1KJ2L 3HS0A 3VXSE 4DGVL 3SDCD 5ILTL 4PRID 4NRYA 5GRVL 5IVXE 1F58L 4S1RH 4Y5XB 1FAIL 2PTVA 4YDIL 1A3QA 1EPFA 4HGWB 1FGNL 3T2NH 1VGEH 4YE4L 1U8NB 2V17L 1A4JA 5FYJE 2V5YA 3FQWB 3AB0B 1JZ2A 2HKFH 4LHJB 1UXWA 3TA3C 5JZ7C 2NX5D 2FR4B 3BEVA 1HDMB 2XN9D 4B7LA 2Q8BH 4F7EA 1DANT 2J6EL 4UZGA 1AQKH 1YEGL 3MGAA 3BMVA 2H41A 4G9FB 4RFEA 3PWLA 5C7XH 4J3UA 3TPUB 4YPGB 1FORH 3VGEA 3WUWG 3BZEB 1QKZH 1JGUL 3TNMB 1A0QH 3BRGC 2FBOJ 1FNAA 2AVGA 1RZGB 1XGYL 4X7FC 4BQ6A 1FNEB 3EGSA 2R8SL 5FA4A 4KKCD 5CILL 4GO6B 5I18H 1UWEH 4PJCF 4Y2DA 5FO8B 1FV1A 2EEDA 1B2WL 4DKEH 3TWCH 1MREH 2XWBB 1MRCH 2EDBA 3MXWH 1MHEB 3P4MA 5FYJH 4Q0XH 2ED7A 5MP6H 3UYPA 3MTRA 1N0LA 4PLJD 4R7NB 5H35A 3UC0L 1RK1B 4K9EL 4PJ7F 1BJ8A 4OTXH 2IMNA 4KROB 5CGYD 2C1OB 2IFFL 3ULVE 4JFQA 2EXWC 4APQD 2WWMD 3MRQA 1SJVA 5AZEH 3PP3H 1AD9B 1UADC 5CSZB 3FTGB 1T3FA 1VACB 3ILPA 4AEFA 5I1EL 3LVEA 1CGUA 2NW2B 4D94A 5I1GH 3HNVH 4PJ8C 1I75A 3U36A 4KKAC 5DZOA 3OXSA 2ZKHH 4DQOL 3DETD 2B2XH 3IU4H 1GPOH 1U58B 1XEDA 4ZXBB 1A9EA 2FATL 4BUHA 2DQIH 2ZCHH 4F2MB 5DRZA 1OD7A 5DD1H 4KUCF 4W68A 1FZOA 4HLJA 4ODHH 1T20A 2IG2H 1BBJA 3KYNA 1OQXA 1VFAA 1MI5A 1QLFA 2QSCH 4Z78B 5IBLC 3VGGA 3CFKA 3LS4L 4GAYA 2FH8A 2Z8SA 2HKHL 3THMH 3GHEH 3TNNB 3O6LL 3QH3B 5EUOF 4HIXH 3WXWH 5I30L 4FNLL 4Y5XC 1S9YB 2FHFA 3O2VH 3GSXB 2V9TA 3BDBA 1WV7T 3TFKC 2NY5L 3AB0C 3NABL 4ZFZB 2JK5A 5A1AA 2VR4A 5GRJH 1X5FA 2MKLC 2BOBA 1JPTL 2CLRB 4QRTA 3K81A 1BQLH 1WBXB 2F5AH 4RGOH 1RURL 5KVEH 1KTDA 5C07A 2A0LC 2EEBA 2R29H 2XKSA 1IKFH 2HYMA 4DK6A 4OGZA 3OZ9H 5JHDE 3X13B 1NBYB 1D9KD 2VXVL 1BVKB 3UAJD 3MMEA 4Q58C 1QO3B 4XPBL 2PW1B 1KC5H 2AK4D 5F6HJ 4YXKL 4L4VB 1T21A 4LCWD 5D1QA 2DQHL 3TO2B 4MQSB 4OZIF 5D7JB 4LSPL 5GSVB 3HFML 3ES6B 2EKJA 3AREA 1MNUH 1RUAH 5CINH 2D03L 4X9GA 2MQ3A 3KAAA 4NT6B 3RWIA 2N4IA 2VZOA 5M94B 1MVFA 1HIMH 4L3EB 1Z0MA 4P9HH 4ZNEE 4KROC 5DJDA 2AEPL 1NFIA 4G8FB 2FX8L 4K3JH 3QEGH 3DUUB 3C5JB 2XTJD 1TQCB 4ALAL 4JGJA 3G08A 2JJWA 3PGDB 3HMXA 1LP9F 2PYFB 3V5DB 3RUGA 2FD6H 4B7IA 1KNOB 1JYVA 1MRFH 3L5IA 1EGJA 4XNXL 2NY3B 1FO0H 2R2BB 4MA1B 4PY8J 5EO9A 2NY2B 1IGFL 5ALBH 2VAJA 5T3ZL 2Q87A 4XCYA 1LD9B 4MCZB 3D18A 1AY1L 4NO0B 1KB5H 1OGTB 2IQAA 4NSKA 4X6DE 4AK1A 1JGDA 4YIQA 4PB0L 4AZ8A 1WSST 4JZNB 3QYCA 4AT6A 2BNUA 2QR0B 1QFWI 5DXWA 2ATPB 3BPOB 4XP4L 1GOFA 5T33H 2EC9U 1ORQA 4MNHB 4OJFL 2Y72A 4FFVD 4C56B 5IQ7L 4PD4K 1U92A 2J3SA 2ZZUT 1OAKH 3EW3B 3Q6FB 1Q94A 4RWYH 1P4IH 5GGVH 3NCEB 4UDTA 2N56A 4LARL 1OSZA 1LO3H 3LQZB 5GIRA 5GGTA 3GM8A 1Q1JL 3QSKB 4J23A 3SCMB 3BWAA 3MV9B 3UDWC 1MFEL 2CLZA 5FGCE 4OGAC 2BCKB 4N90D 4QRQA 3MFGB 1RZKL 1EH9A 4PJ5E 1R3LB 2FJHA 4KV5E 1N5AA 3G6JF 3N9GH 4KRMB 4L3CB 1BVLB 4XBGB 3L95B 4HXBL 1MI5D 1NC2D 3O11A 1T1XB 5BMFH 1NGZA 3DVGA 2CRZA 2D31B 5D7JC 4NM8H 3TCLA 1PX3A 5F88B 1BBDL 2H8PA 1E4KC 1S9WA 2UYLA 4YHLL 3HRZA 4WI2A 1G9MC 2YN5A 3U46A 2K1MA 1G7JB 3D6GA 3PGCA 3WDJA 1UXSB 2YPLE 3VFTA 4D9QE 4HC1H 4NQDB 1OAZL 3UBXB 1MJJA 4IDJL 4MB5A 1KBGH 2LV4A 1XCQA 4LPWA 3MRLB 4U1KB 8FABA 4FP8L 4QRPA 5HHPB 3TT3H 4I3SL 1TQCC 4Z76A 4UV4L 2ZOLB 5JHLH 4KRNA 3PWVA 3VRJA 1HH6B 5EO0B 4LFHG 1B4JH 3WV0A 5SX5H 1CXFA 2ADJA 5EIQA 3KPSB 4I4WA 1PX4A 3IJSB 3STZA 5L2JA 2NY3C 4PGJA 2WLZA 4J1UB 3QNXA 4FMFA 4MA1C 4HCRH 1MCOL 5D1QD 1QFHA 4F7PB 2NY4D 3ARED 5CJQL 4PRBA 3B3IB 4QHNA 3MLUL 5E9DE 1J5OL 4XMLH 2EDQA 3WFEH 4JY5H 5J11B 1P4BL 3DNKA 1A1OB 2DQTH 1MF2H 4LLAA 4MA3A 2B4CH 1F6LL 4PJHB 4LMQI 4JLRB 1V3KA 1WAAF 3PIQA 4NGHH 4G7VH 2COQA 2ESVE 3I50L 5HYJA 2YPVL 2CIKA 5KZCD 4QHKI 3LB6C 1KFAL 3BPOC 3P73A 5D6CB 1YMME 1RVFH 1FG2B 4U6YB 1C5CL 2W0PA 2R56L 3BPLB 1NCDH 5DMGC 4WO4A 2FEEI 2IBGA 3VG0H 3D3VA 1KEMH 1I1YA 3DTXB 1UCTA 4M1CC 1T80A 1KCRL 4PJIE 2AJYH 5LCVH 5JDJA 4EVNB 1R5VB 1PG7W 1XGUB 3SO3B 3VWKB 1QRNE 4G5ZL 3SCMC 5GS0C 2E5EA 2Z4QA 1CE1L 4N0CD 3LKSB 5CFHA 2NNAB 3OXRB 5EBLA 2BK8A 5FUCE 1MIMH 1G7LB 4HZAA 3L3KB 3HZKA 3RWEA 5EA0H 4U6XB 2AABL 5ENWB 4QTHB 3WNKA 1AC0A 2WQ8A 1F02I 2RGSA 1DN2A 3CFBB 1G1YA 2A77H 3QUYA 2EO1A 5T5NF 4I3GA 5DD0H 1TPXB 2R2HA 4A2MA 3QIBB 1VSCA 4FQQA 5D8JH 1KYOJ 1GC1H 3QEHA 3ARBA 3RTQA 5DDHA 3FZUC 1L9MA 3JV6A 2XRAL 3KLAA 4F58L 3DVIA 4G7YH 4ZO7A 5DC4B 4MXVF 5KSUA 2HH0H 1S5HA 2WM0A 3QIWC 3W0WE 4JM2B 1KLUA 4JFZH 2E27L 2VLKB 4OLWH 1NUGA 1YECL 5DRWA 1NUDA 2OYPA 4BJLA 4PJEE 5K9KB 5I16B 3FQUA 3GKZA 5E2VH 3AMLA 3MRHA 1FG9C 3HZYB 1I1CA 3L6FA 3QJFA 2BSSB 4QCIA 1D5MA 5LBSH 1K8IA 3W9DA 1UZ8B 4K8RL 5KVDL 1A7OL 4LSDA 5HGBB 3VMOA 2V5MA 3MV11 4OT1L 4ZPVA 1HKLL 5EBGA 4XC1H 4Q9QH 1RU9L 1DP0A 1MCWM 3QCVH 4X7SH 4XX1G 3JUYA 3L3OA 3ZYJA 3BN9D 1FNSL 2YA2A 3V4VL 4WCYH 5D70L 5DA0B 5C0EA 3QT2A 1MH5B 3G5ZA 1ZHKB 3QEQB 1EXUA 3FFCD 1WC7A 5HYIA 3FT3A 3H42H 5BOPA 5C0DB 1KPUA 4MLSA 3AGVA 5DLMH 2CDGA 2VDLL 1L7TL 4HMCA 3UCRA 5GPRA 3X12A 5E99L 2HT3C 2GJZB 3KXFA 1MHCA 4QRPD 3VXTB 2H6PB 2J5LB 4LRIC 5CZXC 2JB6B 2CKNA 5MEPA 3BPLC 1FH5L 3DO3A 2PYEE 3LRSA 3ZE1F 15C8H 5D5ME 5C2BL 2FX9L 4ZSOB 2F58L 1QR1A 2X4SA 3OWEA 1W0WB 3UYRL 4FQCL 5L6YH 3MSPA 4X4MA 2BFVH 3VWKC 4N68A 5HI4D 3WL9A 3V8CA 1HWHB 3GSWA 3FMGL 1U8PB 4ZUTA 1D5ZB 4PJBA 4M7ZB 4G3YL 2EXWD 2A74A 5IKCA 3MOAH 3WJLC 3CNKA 1PQZA 5GGRB 4G8GE 2H9GA 5IV2B 3NH7L 4ZS6C 4Y7MA 4MYWB 2V2WB 3MRNA 3QXDB 1NJ9A 5HYJD 1DSFL 4OLEA 3SDXF 1TPXC 5FECA 3QIBC 2UUDK 1E4XH 5MENE 2O5XH 3X17A 1NMAL 4FOMA 2ITDB 4EI5A 3DROA 3Q5OA 2GY5A 2UWEE 1OWRM 1YUHB 3LKRA 5DGQA 5GS1B 4OUUB 4OKDA 4JM2C 4HG4J 2I9TB 2VDQL 5C0BE 3UTZB 4P4KA 3OKNA 5HHQB 4Y5YA 4ONGH 2HJFA 2AGJH 5BZDB 2A83B 5F7NC 3NFSL 3GMRA 4HF5H 3HA0A 3GSRA 4HZLB 1G7PA 4JPIB 4H20L 4RQQB 3VXMA 3HPJB 4LSUH 4CGTA 5D7KE 3WIIH 35C8H 4NBZB 1QSEB 4DFIA 4Z7NF 4NQEB 5C0RL 4C57C 5ITBH 1C7SA 3QUYD 1HCVA 2JLLA 5IIEB 1P9MC 4UDUA 3RY5A 3TFKD 5KTEL 2EH7H 3PF2A 3L7EA 3OHXB 1CCZA 2MMXA 3QULB 4PJGE 4PJAF 4TTDC 4DFHA 3N1GC 4KUZH 5CIPB 3JWDH 1CVSC 1P7KB 5C0JB 3QJHA 4UT9L 2HP4A 4F3FA 3QXUA 5TFSL 5GSRB 4X5LA 3ULUD 3QG6B 3G5VB 4CRPA 1I7ZA 5IHZA 1ZEAH 2BNQB 2UVFA 4XPTL 5TQ0H 2VN7A 4JHWL 4QHUB 3K74B 4YFLF 4UB0L 4AG4H 1T5WB 1ZT4B 4LPCA 4RDQF 5IB1A 1YYMH 2J5LC 2XWTB 4MB4A 5DK2A 5I1LA 2FLRT 4XCEB 3MRGA 4XAKD 2EKSA 3CSGA 5I1IL 1JZ5A 3D69B 4KKNA 5KSVA 3OKYA 2R2EA 4U1JB 3VA2C 4TSCH 5FXCH 4Z5RA 2L7UA 3WFHA 4YHMH 3V5HB 1OLLA 1K5NA 1RULL 2ZUUA 4XRCB 1F13A 5EUKA 1JGLH 3T0VA 4MAUL 3OKKB 4IOIA 3FJTA 4M7ZC 3JTTB 3R06A 4NKDB 5DSCB 1KIRA 1HI6B 4UINH 2HFEB 4DAGH 1KLGB 1V3JA 1KELL 3FRPG 1DQQB 2QHRL 3WEXA 5I8EA 4RAVB 3ILQC 2O5YL 2YUVA 2W65B 4F37F 1S5IH 4X98A 4UNUA 1KG0B 1X7QA 3KXFD 1LEIB 4ZXBD 1XH3B 2MJWA 2WBJB 1HINH 4GXVH 3ZKND 3QDME 3KPTA 1P2CB 4AQ1B 2HJLA 3ZE0F 4X0KB 1PG7H 4YHIA 1F11A 5HGAB 5GS1C 1G6RH 3QUML 3RZCC 5KSAA 5E1AA 1A7PH 1TZGL 1X4XA 32C2B 3S9DB 1OB1B 4XXCA 5DF0A 1IGCH 3I6KA 1RAMA 1FVCB 3U1SL 2UZXB 3HCVB 4M1GL 3VDCA 2VITA 3HHRB 3OAYH 2ZG2A 3MLZH 3IB4A 3QWQB 3WIHA 3EYOA 3P9LB 4PJCE 3VXRE 1I7RB 1NPUA 4PRPB 3VD9A 2X4UB 4MQ7B 5FK9A 1HHJA 5I8KH 1QBLH 1UKSA 5E4IA 1VKXA 3BJLA 4FXKB 2B8OT 1MCLA 4NM4H 4YWGH 4YBQD 4I77L 5AD0A 4LLVA 1PY9A 4EQ2A 5JXAH 5F96H 2FX7H 3FT4A 1A7NH 4HK0A 2EICA 4HKXB 3UPCA 4EI5D 3WKMH 4M61A 3PJSA 5C0ND 3INUH 4I5BA 5GGUB 3WNMA 1EEZA 2AJVH 5D2LF 1U8JB 3D0VA 3T77B 1GGBL 1U93A 2Z35B 1FRGL 3H9HB 2GW5A 4QKXB 4HIEB 3BAEH 3WDHA 1B3JA 3BQUC 1F58H 3MXVL 4IOSD 4L4VD 4HWNA 2ZCKL 4YE4H 3VXMD 3BDYL 4JFHE 3KLDA 5FDYA 4JFOB 3D0LB 1S7WA 5HDLA 4CU6A 1S8DB 1AGEA 1PLGH 3QI9B 5HD8D 5M95B 1ZGLA 4LHQB 2OL3A 4U4BA 2J6EH 5DJYB 1QG3A 1A6TA 5MI0B 5B38G 4DUVA 1BWWA 1RIUL 1YEGH 3P9MA 4L3ED 1T1YB 5JPNB 4I1NB 1Q72L 2H2PD 1NSNL 1NFKA 2BSED 1P5VA 1MHHA 5EUOE 5DD6B 4JG0H 1JGUH 3B2VH 4UQ3B 5DR5L 2AEQH 2OM5A 2VLJE 4PTTA 1XGYH 4POZD 1KB9J 2DWEA 2R8SH 3VFNB 1NANH 2J88H 2F5BH 2ZG1A 2J8UA 3TBVB 3FN9A 2WBJC 4EN3A 3F7RA 1PYWB 3BPCA 4AH2B 3FT2A 4U1NB 2X70A 1NAKL 4H1LA 5K9JH 3WYRA 2NY2D 5JQ6L 1GAFH 2BVYA 3OAZH 3SPVB 3W9EB 5CKGA 1Z6JT 1WCBB 4LCIL 2WP3T 5EORL 4NUJB 4PJXE 2YSSB 2VZUA 4JPWL 1S7TA 1AQDA 1PDKA 1HNGA 4HXAL 4JFEA 3HZMB 1PZ5A 1CXHA 3I02B 3NA9L 4G6AD 3F8UB 3O4LB 2QSTA 2QTEA 3LB6D 4JQIH 5LAXB 1H5BB 1A5FL 5GRVK 4R6UA 5CJXA 3VXNB 4RA3A 3IGAB 3D25A 1GCFA 5DMGD 5CZVL 5DEGB 1UC6A 3EJYC 3O2DH 2YPKA 1OW0C 4RIRB 1IQDB 3CCHA 1M6OB 1BGXL 2YC1B 1DQDH 1MCRA 1BOGB 2ZCLL 1B88A 3S3PA 4Y19A 5GS0D 4J6RL 4N0UB 5C09B 1G0XA 5E2UL 4EDWL 4ZAKB 1CI5A 3IAQA 5JA8B 2W9DL 1LP9E 3RA7H 4JHAL 5GGRY 4KHTL 4UU9A 5IW1A 2HKHH 3O6LH 3BKMH 4QYOB 5I1DB 1JYWA 3B8YA 1KUMA 4AIXA 4HKZB 2EE2A 1SM3L 1QBAA 4WTXA 4QRSA 2NY5H 3NABH 5IB5B 3ZKQD 1JK8B 3IDIB 2VDNL 4F33B 6FABH 4LAQL 4BSWB 4WJ5A 4JFDB 2G2RB 1J1PL 1W0VA 1N4XL 4CVZB 3QI9C 4ETYA 4YHKL 1J0YA 3ZKXB 4IIQB 1FL5A 1KXVC 5MI0C 1YQ2A 2Z93A 4LLYA 3SJVB 3MRRB 4ODVH 5HI3C 5DT1L 2BNRB 3MLWL 2W1NA 3EO0A 1G9ML 1QOKA 4OLVH 4Y88A 2VLMD 4U1LA 3IDXL 4ZTOL 4ZO6A 1AO7A 4QRRE 2JJSC 3KWWA 4YXKH 1AXTL 3VFMA 1ZOXA 4RZCB 3DXAB 3ESUF 4M7JL 3MUGA 3NFNA 2OP4H 2D03H 5T3ZE 4FFYH 3QFDB 1KJMB 5J3HD 1RUMH 4S1DD 4HULB 4OCMC 4ZQKA 1TVDA 1CF8H 4Z7UB 4X99A 1YMHA 43CAB 1JRHL 4NZTL 1ZLSL 5EZJA 5CD5D 1ED3A 3KYKL 4KJWC 2PO6A 2OTUA 2VL5B 1A14L 5F3HA 1BIIB 2AEPH 3G6JE 3O3BB 5CJ5A 4E41E 4CVUA 3QP3A 1BLNB 4IS6A 5EU5B 3OKDB 1I85C 2ZJSL 2ITCA 4NN5B 1H5BC 1CFSB 3C09B 4GXUN 1FNGB 1Y6KR 3WD5L 4XNXH 4KKBC 2YWYA 5FYLD 1CGSL 4WHTA 2IC2A 3TIDA 4JFYA 3MZTA 4JG1H 2EDLA 4NO3A 4HUXB 5I73B 2AV7B 3FO2A 4M00A 4Y1AE 3QDGB 1IGFH 4M7KL 1CFTB 4ONFH 5H37G 4M48H 2H3NA 1N6QL 1KCUL 1AY1H 4EN3D 2F19L 4QTIL 3GIZH 1JPGB 4ZAKC 1HCFX 3HG1A 1OTTC 3UP1A 1FPTH 3FAWA 5MEOB 4HS6B 1GGUA 4JO1L 3WLBA 4LLQB 2EYSB 3MNWB 4AIZA 4HEPG 2UV3A 3WJJA 5GS0L 5EU4A 3SEPA 2FCBA 2MWCA 4XH2A 2R23B 1MHPH 4OJFH 1Z3GH 4JQVA 1T66C 5C0IB 3DUHA 4O2CB 3OGCA 2G75B 3RI5F 1AI1L 1MELA 3V2AR 4OZHA 4KI5D 3GK8H 3DJ9A 5H94B 1M4KA 1AFVL 3UTTA 3GMQB 4AEIL 1CDUA 1R5IA 4R7DB 2MCPL 1MJUL 3GSVB 4GW1A 3QFJE 3ZKXC 3B6SB 4IIQC 1U3HA 3V7AE 3OKEA 5ACZA 2J12B 2E8ZA 4BFIB 1I1FB 3TV3L 1WAAE 2ADFH 1UM6H 2BMKB 3EYQD 4BA8A 5KVGL 5C08B 1EFXA 2CR3A 4KTDH 4DZBB 3OX8B 2XZAL 4QF1A 2A6KB 2LAGB 4K3GA 4ZO8A 3N85H 3PV7A 1DCLA 3MROB 3QO1B 4JFFA 1F4XL 4Y19D 4P9MH 4ETQB 3T1FB 4XXDA 4HXBH 2IPKA 4QHMB 1EJOL 2AQ2A 2VYRE 3VE0A 1S78C 2Y5TA 3F62A 4JZOA 3RY4A 1IEBB 4K3HA 4C4KO 4YHLH 5F7FA 2XA8H 3CLEH 3R0MA 2R0WH 5LQBL 1CFNA 3ARDB 3P0VH 3WO3B 3D2UA 1UH3A 4NNXB 1OAZH 1K4DA 3C5SB 4CKVX 2W9LA 2JCCB 3TBWA 4S0TD 3QEQD 3IAGC 4M8QB 4GKSB 3CFCL 4GG8A 4I3SH 2CIIA 2IAMB 2YEZA 2OSLB 4MXWH 4BZYA 2I07B 4UV4H 4WI5A 4IMKC 1BM3L 3MV8A 3X14B 4NN5C 3C09C 5HHMB 2Y36L 5F7KC 3HC0A 2QHLA 4MXQC 5D7LB 3C6SA 3LV3A 2V7HA 3ROLA 1J8HE 3BO8A 2PCPA 4FQXB 4CN1A 2F9BT 3L3IA 3ECBA 1AO7D 4CW1A 4I0KA 3RWCA 2ARWA 4MXVE 4NQXA 1MCOH 1FN4A 4TPRL 1BFVL 5I73C 5IWLA 1R24A 4TNVK 5CJQH 1J5OH 2DN7A 2NXZB 1I8KB 1X6LA 2B5IB 1QBML 3RIFK 1KCLA 2BSRB 5INDB 4ODXA 2QJDA 3RKPA 3V4UL 3QB7C 3MRIB 1CD0A 2C3VB 2RFXA 1ZKAA 2VAAB 4KK6C 3I50H 2PO6D 5EH1A 1NMCB 4K94H 4WI9A 1FYTE 1C5DB 4LDEB 4F7CA 5E00B 3G6DL 1C5CH 4K71C 1JWMA 2R56H 3DYMA 4NO5B 1G9NC 5E7FA 5C6TH 2EDNA 4X83A 4D9RD 1J1OH 1KENL 4FQHA 5CCKH 3RX5A 4KWUA 2X42A 3NACH 5EPMA 2DD8L 4MAYB 3GMPB 4XCNB 2AI0L 4UQ2A 3R8BB 2DIAA 4XNQB 1F4WH 1FIEA 1CE1H 3E6FA 1PGRB 2UY7A 5C0CA 3FKUS 3QG7H 2YD5A 4GKNA 5ICZA 2C3XA 5HXMA 4LIQE 1WT5A 1U8KB 2DLTA 2AABH 4U1SA 1DL7L 4WO4C 3ZE1E 4Q97A 3NGBB 3RL2B 4U0RB 4D8PB 1DFBL 1INEL 3HG1D 1BD2E 4ORGB 4PR5A 5B22A 1GL4B 4LQFL 5ETUA 5HDBF 1QSED 1FFQA 3OKOB 5EU6E 2BERA 1YY9C 4MLIA 5DJ2B 4F9PA 1WTLA 4OGYL 2WMPA 3DGGB 5H2BB 4ZFFB 5F44A 3SBWA 1TXKA 3IVKA 3JWOC 2Z8VC 2QKIA 3ARDC 4OGXL 5B39A 4KMTL 4Y4FB 4X8JA 3U7YH 1YNLL 3TC9A 2ZUSA 4Z0XB 1ADQL 1EEUA 1MCHA 3HLAA 3UTTD 2ERJB 1YECH 1NL0L 2YS4A 5FM5O 2IAMC 1C7TA 2BNQD 1J87A 4QWWC 3DMMA 4PJDA 1Y0LB 5DJZA 3T0BA 1EFXD 1CIDA 1J1XH 1B0RA 3OV6A 1TDQA 4PV8A 4WFFE 1DEEB 4JM2F 3SDXE 4OLUL 2EIDA 5JW3L 1MLBA 4F80A 4KGJA 4K8RH 2X9WA 3ARBC 3RTQC 3DO7A 1I4FB 4LOUC 1U3JA 1A9BB 5F7EL 5ANMA 1OY3B 4MA7L 1RU9H 3MRDA 4F8TA 2FJFA 1AD0A 4HIHA 5F3BA 1FNSH 3PDDA 4L3AA 5T3XD 5C0FA 5EC1B 4JREB 3AMKA 5BXFA 1OF2B 4LCYB 2NXZC 5GS3A 1OLZA 1BZ9B 2B5IC 1KIPA 3KLHD 1GXEA 5L88H 3VGAB 5J1AB 2NY6D 5TPWL 5E8DL 2P24A 4LKXA 3C8KB 1NGYA 4WU5B 3BP5A 3NIGF 5ICXB 1L7TH 3RWJB 4P23B 1NMCC 4TSAH 3MZGB 4Z7NE 5E99H 3VW3L 5C0AB 1BZ7A 1UEYA 3H3PH 1U8LB 1FH5H 4AEHH 4JVPA 4PRHB 3MV8D 5HHOA 3O3AB 3QXTA 4AENB 1LE5B 5CJOH 1NEZB 1V5JA 4PJAE 3DV6A 4XPAL 1CLZL 3QO0B 4YR6B 2F58H 4NQSA 4P2RB 4ZPTA 1ZLUK 3MV7E 4N9GA 4WEUD 2Q76B 4FQCH 4MAYC 3ZT6A 5AUMB 3NCCB 1MOEA 1Y18B 4JKWA 2GSGB 1CQKA 1MCJA 2BHZA 4D2NA 5E95B 5FYKL 3FMGH 4HK3J 3BD5A 1IAMA 2Z92A 3BIBX 5IVNA 4G3YH 3MJGX 5IB1B 1EGJH 4FQIL 3H9SE 5EWIL 1N0XL 4BH7A 1ZGLM 3KYMA 4PS4L 4WU7B 4NIKB 3NGBC 1QEWA 5ESVA 4U0RC 1UA6L 3NH7H 1J88A 1ACZA 3BH9A 1R3KB 3RWGA 2F54A 1K85A 5IB3A 4L29A 3S5LB 5FV1L 4MQXD 4MJ2A 3O8XA 3EJYD 3AY4A 3CVHB 3EFFA 3GIVA 1KJ3L 2I26N 4Y4FC 4Y4HA 4WI7A 1QSVA 1KF9B 2PETA 3FO0L 3C9NA 2ERJC 3O41A 1MRDL 4M7LL 3S35L 5TE6L 3SKUD 4YUEH 5F6IB 3BE1L 1T5XA 3TYGL 4X5XB 4EXKA 5C0CD 5LKNA 4H20H 4JDTL 3B9DA 5D96B 2X7LA 1RIHH 4UTBL 1WLHA 4G6JH 2RCSH 4XBPB 3HNTL 4XZUA 2GJJA 3KDMA 3ZE0E 3IETA 5B3JF 2Q7YA 1WBYA 4MVBC 5KTEH 5LJYH 2P5WB 4NZUL 3KPPA 4OZGA 2PTUA 5ADOL 2EXYC 2YZ1A 1TNNA 4JREC 1OARH 1GOGA 4MNQE 5DC0A 4UT9H 3O9WA 2PW2B 4RMVA 2NTFB 1ZHNA 5TFSH 5JLZB 3VGAC 3HN3A 4HUVA 2Z31A 1XGTA 2QQLH 1KCVH 5DJXB 3K80A 4UB0H 1FJ1B 3DSFL 4P23C 1KEGL 4XC3H 1RHHB 4LAJH 2X1XR 3VMNA 4Z95L 3H2WA 3DMMD 3WHXA 2CKBB 3MRFB 1F4YL 2OK0L 2IANB 5ISZE 3G5YA 1RUQH