1P7KA

Crystal structure of an anti-ssdna antigen-binding fragment (fab) bound to 4-(2-hydroxyethyl)piperazine-1-ethanesulfonic acid (hepes)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
b'ELQMTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYNAKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYYCQHHYGTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody light chain FAB
publication title Structure of an anti-DNA fab complexed with a non-DNA ligand provides insights into cross-reactivity and molecular mimicry.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2003-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p7kA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p7kA01
3IF1A 4TQEL 3OZ9H 2QV2A 2XWTA 1G0YR 1RK1A 1UXWA 3ZSSA 1FNSL 5DVNA 1KEGL 5GRUL 2VXVL 3NIGE 4GG8A 4JAMB 3C5SB 1GGTA 3BSZH 3EO0B 2H26A 1LDPL 4OLVL 5HVWA 1RJLB 4RMWA 4MA1B 5AG9A 3GJFA 1NGYA 2ZOLB 4MA7H 3C8KA 3HE7C 2CRYA 4PREA 4UUJA 1UA6L 1V8HA 5EOCH 1S8DB 2R0ZH 2JB5L 1R5WB 2NZ9D 4Z7QF 2HVKA 4IJ3B 1QACA 5IHZB 3CJJA 4P99A 2DM7A 1WLHA 2B0SH 4L8SA 3RNQB 4I18C 2QQKL 4Y5XA 4KJWC 2F54A 4LSDA 2J8UE 1LO4H 2WQRA 1YA5A 1UZ6E 1BECA 5AYUL 5JHDB 4FQJH 3OWEA 5CEZL 1AD9B 1QHOA 5F89A 4W4OA 1TJIH 2F19H 5E1HB 5EWIL 4XPGH 5GGQH 4LASH 4YHNA 4XPHH 2OK0L 2A6IB 1I3RA 3QFJB 5T5NF 1ZSDA 1MFBH 3IFPB 4K3EL 2X4OB 5D93C 4R96A 4PRHE 1DJSA 2OTPA 2FEDD 1AQDA 2VLME 5GZOD 3L5XL 4PRHD 3P2TA 1TVBB 3WIIH 1CR9H 5D7JD 1RY7B 2VLMD 1ZHKA 1YJDC 3NCBB 4JO3L 2XN9B 2FIKB 4X7DC 1FPTL 4FQXC 3BFOA 3OR6B 4ZODA 4QT5A 3TIDA 3IDJA 1SEBA 3TZVC 1U8IB 1KJ3H 5E00B 2R1XA 4IOFC 3QDME 4EI5C 3QUXD 4HKZA 5BOPA 3QDMD 3N9GH 4MD4B 4JDZB 4B7LA 3Q5OA 3HE7B 1HHKA 2W9DH 1I4FB 3QIBD 3X3FL 4EXKA 3QNYA 1Q9WB 3HMWH 2QBWA 4JFOB 1HK6A 4H1LH 5C0RH 5F3BB 5EIVA 1U3HA 2DMCA 1CIUA 2X4SA 3GBMH 2C26A 1CQKA 2HJFB 2MHAB 3FQRA 1QYGL 2NQCA 4FFWD 4J4PD 2G9HB 1JGEA 4I18B 3TBYB 2FX8L 3TVMA 1XR9A 1F00I 2FIRT 1T1ZB 1YN6B 3PP3H 1BP3B 5ABDE 1I1FA 4G6JH 2XT1B 5IHUH 3BO8B 3OX8A 3QQNA 5SWSB 3QEQA 2E3VA 3FB7A 4Z0BH 5GGTH 2G5RA 1MHEB 2IH3B 3WFHA 1MFAH 2BX5A 3QG6A 1H0DB 2KDGA 3QRGH 2W60A 5F7DB 3BVNB 3OTTA 2AXJA 3CDYA 3ZE0F 5CUSH 4M7LL 1KCVH 5D93B 3MLZL 4K8RL 4P4RA 2JTDA 2CKNA 4PJGA 1WZLA 3MOQA 4NPYA 5AG8A 1CD0A 2A74A 1MIML 3EOYG 4JCLA 4N8CH 3FQUA 3UCRA 5DJZA 1HXYB 1U3JA 2GI7A 15C8H 4S1DD 5IFJB 3MUZ1 4QRRB 1R3LB 3V2AR 4PG9A 4G8EA 3TZVB 4KKCC 1EHLL 2CKBB 3F58L 2EKSB 3T3PF 4EI5B 2AI0H 1ZVHA 3UJTL 3MLWL 2WBJC 5INCB 3U46A 1FFNB 3VXOB 1RUML 4C58B 4DN3H 3UTTE 1AH1A 4Z7OF 4HZLA 1K8IB 3NCYP 3HUJB 3UTTD 3IGAA 3H0TA 4BSWA 1ZVYA 1E27B 5IESL 1U41A 4Z7VA 4KROB 1EGJA 1FNFA 1MI5A 4Z95L 1R3IL 1WTLA 2NXYC 3LS5H 2CGRL 2DF3A 3AREA 1BVLB 3NA9L 5IB4A 4MJ6A 1WWWX 3B9DA 5SWZE 5J13B 5EO9A 3HE6C 1FFRA 5SWZD 3RI5F 4YHIB 5EH1A 2HT2D 2QADD 4EI6A 1CGYA 4P2RB 5MI0B 2PYEE 2GFBB 1BVKA 3GSQB 2YHGA 5MEPB 1PZ5B 2PYED 4OCXL 4D3CH 1S7RA 5I18H 5LGHL 1BD2E 5TF0A 5BXFB 3GNMH 4GG6F 4NQCE 5J06A 1LMKA 2DS4A 1BD2D 3OKYA 1U95A 2IANE 5EN2A 4GH7B 4NQCD 1S9XB 4XZUB 2IAND 4XVSH 2LU7A 2Q7YB 4F9PA 1X5LA 3TNNB 4OF3A 2ED7A 1CL7L 4G6KH 4MYWB 3LKSA 1JZ5A 1NCCH 4U49A 1U58B 43C9B 2Y07L 3DIFA 1RUAH 1MOEA 2VZSA 5GS3A 1OARH 2ATKA 3P4NB 4PJIB 4UT9L 1BQHB 2CK0L 4K55A 4U6YB 4XWOD 5F8RC 4QY8B 4LLMB 4XP1L 5GGTA 1G7JA 1D3CA 3WFCH 1I7RB 5D2NB 3MRMA 1EDQA 3K0WA 5KOMC 3U7YL 2NY3D 1DQJB 4WNQB 2EDXA 4HPYL 4OD3H 4ODXB 4KXZI 4YGVA 1O7SA 2DQJH 2EEDA 1J12A 4BKLA 2ID5A 3GMOA 3VD3A 2ENSA 1JGLH 2NR6C 3VH8A 3ZHLA 1TTGA 2NXYB 5EZLA 3MLXL 5F3HB 3ZKXC 2JCCA 4YPJA 3I02B 2J6EH 1BZ9A 1A4KA 4KUZH 3HZKB 4OCYH 1T83A 5JXEC 1C16A 3HE6B 4X8JA 4E42B 4FFZL 3VD5A 3L3HA 4AEEA 3FT3B 2X4TA 3NPSC 1CU4H 1MCEA 4O51B 2YK1L 5DD1L 5DR5L 3V79C 3DV6A 1FAIH 5C09B 1FFQA 2I25N 3ULVF 1YNKH 2F54E 3CMGA 3G6AA 1NBVH 5C0EB 5I8CA 1R3KA 5E2WH 2F54D 2UZIH 5DJ0B 4G42B 1NBYA 5ITFB 5EORH 1E4XH 3CH8A 1BFVH 4GAJL 1U8PB 4X7SL 3IAGC 1ND0B 4S1SL 1QO3B 1X44A 4WWKA 1S7WB 3ZTNL 2AK1H 4HMCA 3IDXL 4XVTL 4O2CB 5GGVL 5HI4D 1J8KA 5DC4B 3SDYH 1G7IB 3HMXH 3QDGB 3U0PA 2PTTA 1Z9MA 5IK3A 3N06B 3BKCH 4QHLA 5IW1B 2UZYB 3VGEA 2IPKA 2X9YA 3V5KA 2GAZA 3FAXA 3IRZA 3VFGL 5AZ2H 5DD3L 4XP9L 3VRLE 3SPVA 1X5XA 2WANA 1M7DA 4ZYKB 3SQOH 1N7ML 3CFBB 1CBVH 2D03L 4DKEL 2BY0A 5I1LB 4P4KD 1P7QD 4K23L 5E94B 1UM4H 1AO7B 4PLNC 1ED3B 3RNKB 4L29A 2Y06H 1RU9H 3ZKXB 2BVQA 2X4RA 4RAHA 1RVFL 1B2WH 3T2NH 4P5TA 4B7IA 4F7CA 1DQQB 1HIMH 1T4KB 1U3HD 2Z31C 2H32H 3W9DA 3HPJA 3NPSB 4DWHA 4JRXB 1KIPB 4HJ0C 3IXTB 3RDTA 5FECB 3DRQB 3KDMB 3WN5A 5BV7C 1AGBA 4HMEA 5J6GA 2H8PB 2YPLB 1DBBH 4LVNC 2C3WA 3QEQE 2MQ0A 1O0VA 5IBTH 4PIRF 5F21B 1DBML 3QEQD 4H20H 1T0MB 5AYQA 5IOPA 3KAAA 4F2MB 1OB1B 1A6UL 5E4EC 2R0LL 1M71A 3NFSL 2PR4L 2OZ4H 2E6JA 3ZHDA 4UNVA 4PJGE 3U0WH 1DQML 1ZGLM 4GT7A 1HSAB 2J6EA 3N85L 4UV7H 5E1AA 3I6KB 4ETYA 1QHPA 1G1YA 3RL2B 3IJYA 1J18A 3I9GL 4N8PA 1IGCH 3GRWL 2BK8A 2R2BB 4HUXB 3RWEB 4LIQH 4X9GA 2CDFA 4BFIB 1KNOA 3PV6B 4PGDB 2LVCA 3LKPA 4OGXH 4E5XA 3NN8B 3MLSH 2LFGA 1R3JA 5CSZB 3KXFA 4WHYH 4X80H 5B38G 4Y16B 4OZHE 1FO0B 1NJ9B 2GKIA 4Z7VE 5CD5D 3HMXA 1QBML 4TTGA 5HGAB 2ITDB 3BH8B 1IM3B 3DBXA 3V4UL 1ORSA 4LLDA 1IC5H 3EDDA 2F53A 3KLAA 4PJCA 3VI4F 2DWDA 2FO4B 4F7TB 3ARED 5BRZA 2XG4A 1BOYA 4JKMA 5T1LA 4PJ5B 3C60A 5GRZA 5BV7B 1W8OA 2YSSA 1NMAL 4LVNB 4Q74A 2EXWD 3AXLA 1HEZA 4IRSA 1U42A 2CIKB 5E4EB 4TSBL 4XAWL 5HJ3B 5TE6H 3OJVC 43CAB 1A7NH 4L4VA 4JHAH 4F3FA 1FC1A 1YDPA 1CT8A 3U30C 4DVBB 4WV1C 1B0WA 4NJAL 3MNZA 4ODWA 2H32A 3TBTA 1IQWL 3CSGA 1QRNB 1A7RL 1Z3GL 4R90L 4JFEA 4MD0A 3RGVC 4D0DB 4PLJD 4HUWB 5TFSL 4NN5C 2DKSA 4YBQD 4JZJA 1CF8H 2PO6C 5HI3D 1P2CA 1T66C 5HYJA 1E4KC 5FA4B 5IVOA 5CWSB 1KCKA 4I8DA 4TQEH 3ZDZF 4C56B 4YHOL 4N0YL 3OKKA 4LLVA 2OZ4A 1FNSH 5F9JB 5E08L 1VFUA 2CXGA 4RFNC 3EJJX 5E9DB 5GRUH 5ID1B 2VXVH 1C08B 5EUKA 4KKAC 3EYOA 4JM4L 2VAAA 4ZPTB 5IBUB 4RMTA 5ICYB 5KVGL 3T0EA 4M5ZL 3QCUL 3H42L 4U7MA 3SE4C 2AEQL 3OR7B 3IDIA 1WSST 2JB6B 1UA6H 1NGZA 3RIAF 2KBGA 1ZT1A 1LP9F 2JB5H 4KKLD 1WT5A 4CU8A 2FL5B 3BZEB 1T20B 4AG4L 4K94C 3X3GH 4CVXB 1DBAL 1SJEB 4WHDA 4KJPC 5J8OA 2QQKH 1OVZA 3MACL 5I16B 5IBLD 1AXSB 4F37F 2DQFA 1WFUA 4WV1B 5AYUH 3TIEA 4OUOA 4M7LT 5EWIH 2AJUL 3RGVB 4WWKD 4G8GA 2OK0H 4EVNA 3UXFA 3QIUA 4K3EH 2PO6B 3LEXB 4LEOA 3SKNB 2I9TB 1B4RA 4CVZB 3QJHA 4K3HA 1PDKA 2P5EB 4RMUA 3TBVB 5IVXA 1QR1A 3RVUC 4W4NA 5AD0A 2CPCA 4X4MA 3TV3L 1UH2A 3MRGA 4JO3H 1GYAA 3RWCA 5J3HC 4PJ8C 4RFNB 3V9FA 3FQNA 1FPTH 1NFDA 1ZT7B 1NKRA 2ED9A 4U1LB 4MAUL 3V6OA 3SKJL 3DTXB 4P0DA 5T1KA 3KPSA 2BY3A 4MDJB 4P59L 4JJ5A 4P2OC 1JTPA 5CHNB 5C0AA 3QZWG 4ZFZA 2DQTL 4PJEF 4NHCL 4XTRD 3KHOA 4BQ8A 1Y18B 2NY4D 2FHFA 5E5MB 2PYFB 4YHYC 4P5TD 1VKXB 1XH3B 3IDYC 2P46B 1TMCB 1QFUL 3TO2A 4OF8A 3FFCA 1M6OA 3FRPG 4CL7A 4NHUB 2EZ0D 1QYGH 4XBPA 3PIQA 3FO0L 4FNLL 2HN7B 1CCZA 2WUBH 2FX8H 1HHJB 2GSGB 4QYOB 3NOIA 1XGYL 3LN4B 2WWMD 4HH9B 2FHBA 3F5WB 2X70A 3QA3B 1PVHA 1OLZA 5JR1H 1H5BA 4IHOB 1EEUA 5A2LH 3ARSA 4N0RA 4OJFL 5HGDA 3G6JA 4JM2B 4NKOA 3FO9A 1YC8A 4M7LH 3VFVA 2FECL 3MLZH 4K8RH 4OFYA 4KI5E 2HJLA 4F9LA 2A6DA 3D2UA 1MIMH 1Y6MR 1FG9C 4KI5D 3DUUA 1JZ4A 1AGDB 4X98B 1U9KA 3LKRB 4WWID 5DQ9B 4AMKL 1P4BL 4O2EA 3ARBC 3WL9B 5I6XC 4PJ8B 3IDMA 1MJJB 1OTTC 1MFEH 3VD4A 3K74B 5JMRA 5HYIA 1EHLH 4RRPA 3HRZB 1CG9A 2A73A 2RAMA 3KXFE 4P2OB 5DHYB 5CZXC 4FTVB 2X1QA 3KXFD 3UJTH 3MLWH 3UROR 3HZVA 4XMPL 2O61A 4Y4KA 1LK2A 4YHYB 1RUMH 2BCKA 4KRLB 3IDYB 4JVPA 1UB5B 1UZ8B 4TNWF 4GRWB 2F53E 4PJCE 4S2SA 1CS6A 3VXNA 2FX9L 5BRZE 4HKJA 2F53D 5J12C 1R3IH 5BRZD 1BGXL 2D4FA 1S9YB 5T1LD 1JVKA 3C60D 1S7SA 2CGRH 3VE0A 4NP4L 4Z7WB 3NH7L 3NA9H 3OG4B 3QCVL 4YQXL 1MCBA 3Q6GL 4X9HA 1XF5A 1NCAL 3RJDA 4YH6A 3MV9B 4PJFF 4KVCL 4CMHC 1OSZA 4Y1AB 2EYTA 1EERB 3BIKA 4N9GB 2OQJB 4WJ5A 4L4VE 3NIGF 4CAGA 5EC1B 3A6OA 2DM3A 5LGHH 4XPBL 1SMAA 1VCAA 4I9WE 5EC2A 4D9LL 1JYXA 3F7RA 3PHOB 2LE9A 3B9VA 2GYSA 4I9WD 3GKZA 3BZFA 3G08B 4LMQE 4JFEE 3PABA 4C54A 4XNYL 3VXPB 3HB3C 4JFED 5GRVK 5DD6A 1CL7H 3ARBB 3KGRA 5I6XB 5JW3L 2Z8SA 5D5MB 3V4PL 5HY9B 2VDNL 5KVFL 2HTLC 5HYJE 2Y07H 4L9LB 4NQDA 3C5JA 5F1IB 4ZUTA 4GRMB 3C9NB 5HYJD 3G5VA 2DRUA 4PRIB 3UJIL 1QLFB 3PNWB 1H8OA 2Y25A 4XP1H 3M8OL 3U9PL 1R6VA 4X4ZA 4BJLA 1H9VA 1CFTA 3C08L 2FJFA 2KPNA 3RIFK 3U7YH 4OIBA 1OP3K 4HPYH 3EBAA 4X6DA 5D6DC 3HC4H 3X12A 1TZIA 3T0EE 2H6PA 2YUVA 2R56H 1TCRB 2X7LA 3HZYA 4D0CB 4OCNC 3T0ED 1QKZL 2HFTA 2X1OA 4UTBL 1B0GA 3MLXH 3MMEB 4LIQE 5ANMB 3OKLA 5K9OB 3SKOB 5BOZG 4XHQA 4CMHB 4FFZH 4F33A 3F8UB 1PKQB 2VR9A 5DD1H 4JREC 2YK1H 1VENA 5DR5H 2Q6WB 2NYYD 3AMLA 4LCCA 1TFHA 4K07A 5H8DA 5K33A 1OM3H 5KSVB 5DK3A 1NFIB 2PW2B 5F6HI 3MREA 4FFYL 2VJXA 1JNJA 1ACZA 3K46A 3VG0L 2XXCB 4PB0L 1LDSA 3SCMA 1QA9A 3D9AH 3O2DH 4DZBB 2JJSA 4G8GE 4GAJH 4POUB 4KMQA 1MJ7L 4PBWD 4G8GD 4S1SH 3STZA 4DK3A 4WI3A 1DE4A 1U8QB 4RIRA 3ZTNH 5IB3A 3QIUD 4XVTH 2EICA 1RUPL 1A9BA 3VWJA 1A6ZB 5IVXE 3IVKB 2OTWA 5F8QC 5FA3A 3AMKA 1FL3B 4X4ME 3R06A 1PX4A 3VFGH 5DD3H 4ENEC 4OZ4A 3QI9C 3TM6A 4JGMA 3MGOA 4JN1L 2D7TL 1V3JA 3V6OE 1N7MH 2VISA 3S3SA 3VFTA 5DMKA 4DKEH 4MNGE 3QPQD 1QSFA 3KPSE 4K23H 1F11A 5CS7A 5F71A 5T1KD 3KPSD 4LCWA 4WUUB 3QUKA 1KC5L 4I2XA 4GFTB 5EZJB 5C0DA 3U4EB 1NH6A 2CUIA 4NQUA 1U2HA 2EE3A 1RVFH 5JNYB 4APQA 1MCCA 3D87B 2HJKB 1X5HA 3DVGA 4RGMC 1A1OA 5CP7B 2ZNWA 5A16A 4JREB 1HHGA 2GCYA 1H8NA 1Q9KB 5AAWA 2P24B 4MA3B 5DJCB 1YNTA 3IU3A 4ODBD 1DUZB 1MPAL 5INDA 3IT8D 3SGKC 1XGUA 2ESVA 1CVRA 2QKIB 4PV8A 1DBMH 3ZZ1A 1X6NA 2V2WB 2KKQA 3U79A 1IAMA 2R0LH 3NFSH 3KR3H 2PR4H 2YRPA 3JSSA 2IMNA 4HS8L 5DURD 5FM5M 2RFXB 5EBMB 1CFNB 1EMTL 5FDWB 3K8MA 5JUEL 4NO2B 3N85H 5C0CB 4OFYD 3NBNA 2V5RA 5DJDA 3T65A 4JZNA 1U8KA 3D2UD 3T04D 4JN2A 4PRDA 1NDMB 2BC4A 5I0ZA 3O9WA 3I9GH 4PJHE 3QI9B 1S9VA 4ZUSB 3GRWH 3H3PL 4HK3N 1I85A 4CVWA 2C3VB 2XY1A 4NWUL 5CEZE 5DA4A 2WP3O 3WJLC 3PGCA 4L1DA 4MSWB 5CEZD 3O2DA 3E6FA 1EHAA 4PRNA 3V6ZB 4FFWC 4J4PC 4QCIA 3P0VH 5HHNB 1NBZA 1CDJA 4RGMB 1CD1A 3CCHA 4UIMA 3QRFM 1QBMH 1WZMA 3W39B 5JDSA 2GTZA 1HDMB 3V4UH 3RP1A 1HI6B 1FNLA 1PFCA 1GRWA 1MH5B 2HAZA 1KT2B 4F7EB 4EDXA 1UM5L 5TE4L 1NMAH 3DYMA 1A9EB 3FONB 5T3ZL 1T3FA 1LE5A 1FZOB 2R1WA 3MODL 1Y0LA 4TSBH 1D7FA 3V0VB 1Y6KR 2CRZA 5FGBA 1IAOB 3GIVB 4XGZA 5K9KB 2XOTA 3NACH 3X13A 1NGWB 3SBWC 4S1DC 2X4PB 4GW1B 4YDVB 5DLML 4NJAH 3F12B 2Z91A 1IQWH 2R2EA 5GGRA 4JDVB 1A7RH 4TRPL 4R90H 3AS0A 1DCLA 2XWBB 1M7IA 4NQDE 3LPWA 3QO0B 5TFSH 2R4RL 1HQ4A 4NQDD 1U91A 1NMCB 3AS3A 5JPNB 3B9KA 5A43C 4K9EL 1FFOB 2RQ8A 3QQ4A 1AKJA 3CVHB 1KCUL 4Q7DA 3MOBL 4MVBC 3BWAA 3R0MA 3DX6B 4YHOH 5C07E 5LXGL 1FG2B 5E08H 2UYLB 5EPMB 5TQ2L 4KK6D 5C07D 4YFLF 2CJUL 3IRPX 4I5BB 4QRSB 4K8RD 5I2IB 4JM4H 4RDQF 1MHHB 1OWRM 2VXQH 1P7KA 5KVGH 2P47B 4U0QB 3H42H 2VDLL 4QHNA 4U6HB 3QUMB 1SJVA 4KTDL 3UTOA 3F7QA 2QL1A 1OP5H 1JZ8A 3BX7C 4ZFOA 3KLDA 3RWHA 1IL1A 3CFIC 3VRLF 2IFGA 4HWZA 4AG4H 5EU7E 5B4MD 3MLTB 3CC5B 3VXMA 2C9AA 3EGSA 3MACH 2FJGB 5L0QC 4MCZB 1BVZA 5I1DA 4HS3B 3SCMD 4NZJA 4Y2DA 3DETC 1NCUA 2OP4L 1MVUA 4Q6IA 5FCSH 3RZCC 2XICA 1P5VA 1BQHG 4XWOC 2AJUH 3OF6A 4PJAA 2H3NB 3HUJF 4NO3A 5SX5H 3VWJD 1UVQB 4JO2L 1NPUA 4KGJA 3HAEB 3CPLA 3FCTA 4NNYA 1FFPA 4HWNA 4BH7B 3TV3H 2VXUL 1ZHNB 2DQGH 1QSFE 4EBQL 2NTFA 1NAMB 3KYAA 3PWLB 4OLXH 5D7SL 4N8VA 1QSFD 4LCUB 1XR8A 1YY8B 3CX5K 3MRKA 4LCWE 4ODUA 2EDOA 4MAUH 4LCWD 1JF1A 3VU2A 2AV1A 3GSNA 3V52L 1FL6B 4PJGF 2DQTH 1GOGA 2FX7L 4L8SC 2DBLL 4NHCH 2HFEA 4ZAKC 5FM5O 5HD8D 1F3JA 2P45B 3MJ8B 5SX4H 5JLZB 1NUFA 5K93A 4IMLB 3V7MA 3T1FA 1BD2B 2VRAA 4ZDHB 1QFUH 2P5WE 2O5XL 3DURA 3F6LA 3M1BA 4NQCB 4YHPA 2IANB 2P5WD 3VMNA 1JHLH 5DK2B 3FO0H 3OG6B 3OKOA 3ORJA 4FNLH 4WEBL 1RI8A 4XNXL 3V5HA 2ESVE 5L0QB 5IEHA 3U6RB 3PJSB 3BKML 1XGYH 5HI4C 2ESVD 4U3XA 4JQXC 4LSUL 3RZCB 1SVCP 4H5SA 1ZLWK 1I1YA 1TJGL 1KXTB 1Q94B 4G8IA 4OZHF 3AY4C 1KB5H 1UXWB 4OJFH 3LD8C 4R4BB 3DSNA 1KPRB 1JL8A 5GJTL 1M05A 1YC7A 3BP4A 5DJAA 1UXSB 5F7HA 2H26B 2QTEA 4PFEA 2RHEA 5CBAB 4MAYA 3O9WD 1P4BH 1QSZA 3KYMA 3CZFB 3GJFB 3SHSA 2ERJC 1A6AA 5IB2B 4O4YL 4Y5YA 2DQCL 3G5ZB 2HVKB 5HVHC 2D9QB 3WJJA 4O00A 4AJ0A 2BVPA 3T0AA 5I30L 1AGCA 4L8SB 5IUSA 5DS8B 4ZAKB 5IIEB 4XMPH 3ILQD 3HCVA 4HUNB 1V7NL 3EAKA 4U1GC 1K2DB 3TVMC 1LE9B 2DYPA 1YYML 2AK4A 2B1AL 1V3KA 3VFMA 2FX9H 1JZ6A 4YIQB 4RGOL 2GIYA 5CIPH 4TYUA 1NDGB 5DI8A 3R8QA 1S7QB 3K1DA 4NP4H 3NH7H 5JQ6L 5H35A 1ZSDB 3QCVH 4YQXH 1EAJA 2FWOB 1N59B 3Q6GH 1NCAH 4KVCH 3O8XC 4ZXBC 4NT6A 2GT9A 3HR5A 4L8CA 1IMHC 3CMOL 2X89D 2MJWA 3CSPA 5BMFL 2VLRA 4XMKL 1IAKB 4LGPB 3LD8B 4XPBH 2XFXA 2N1KA 4D9LH 4G5ZL 1UKSA 5CGYD 3TIDB 1VDGA 3IDJB 2APBA 3S35L 4OSUL 4P3CL 3UPRB 4XNYH 1BFOA 2XTJE 2D31A 3HHRB 4QRQA 2X6MA 4WW2F 5E8EB 3MBED 2HKHH 2XTJD 4AM0A 2XY2A 3DX9A 2Q1EA 2VDNH 3V4PH 1HHKB 2XKSA 2ERJB 4XAKE 3Q2CA 5DSCA 1BF2A 4XAKD 4WRLA 1UWGH 5HVHB 2X4SB 3DSFL 3TCXA 4Y4HA 3FQRB 5LCVL 3C08H 1KB5A 2LAAA 3ET9F 4U1GB 3TVMB 2ZOKA 1UWXK 3BP7A 3LH2L 2E5EA 2C4FU 3OX8B 1QKZH 3SJVE 3FB7B 4OZFB 2PW1A 2I27N 5JORA 5IMKB 3WIHA 3MUGB 4RGNC 4MQSB 3SJVD 2ZUTA 4JFFA 3V4VL 4GBXA 1AP2A 2VWEC 1QTYT 3QJFA 4MXQC 4P4RB 5I71C 3IKCA 4ZS6C 3O8XB 4ZXBB 4NPYB 3BGFC 5DRNB 3WE6A 5E03A 1SJHB 2NXZD 5GGUA 3H9YA 4PJXA 4PLJC 3FQUB 4NQEB 1A47A 2N7BA 1OSPL 4FFYH 4Y2DD 4DUWA 5DFWH 3VG0H 3ARPA 2W9EL 4PB0H 4YBQC 3TJHC 1XF1A 5FHAL 3ZDYE 4MMXC 35C8L 3OF6D 2DJSA 5CIPA 5C6TH 5E95B 2HTKD 2FBJL 4FXLA 3O2VL 1MEXL 3PL6D 4YJZL 1RUPH 4Q9CA 4HZLB 1P4LA 1Q9OA 1I7ZA 3IGAB 5CCKL 4ODTL 2C7UB 5IBUG 3QFDB 1B88A 3MFFB 5GHWH 1N64L 3Q5YA 1MI5B 1I7UB 1XAUA 2B2XL 4Y19B 4YHZL 4JN1H 2D7TH 3P4OA 3WDHA 4BUGA 4U1KA 4MJ6B 3P4MA 1S3KL 2BJMH 2DJ4A 4O9HL 5EO9B 1EFXB 3ILPA 4KKLC 3V7AG 2BNQB 2FEEI 3TJEL 2DMKA 3TT1L 1GOFA 4RGNB 4M4RA 3FQWB 4WI7A 4GKOA 1FRGL 1QFWL 4KI5F 4NWTL 2BNRB 3L3OA 4R0LC 5DWUL 4W6YB 1U95B 5I71B 1LO0L 5IBLC 3BGFB 4X6FA 1I9JL 4MWFA 2X1XR 3HI1A 1Q9LA 4O5LL 3K8LA 2Y9RT 4HKBB 2AW2A 3MRFA 2H2PC 4PRBB 1MCKA 4HXAL 2JELL 4L3EA 1N6QL 4GRLD 4X7TA 1MPAH 3TO4A 2M2DA 3NCMA 3SEPA 5I74C 2ATKB 1KULA 4W6WB 1PEWA 1EZVY 1GC1C 3BPOC 2VN7A 1AC6A 3ME0A 4HCRA 2VDRL 2DM2A 4KMLB 3QUYB 3QULA 1RJCA 3MRMB 3MA7B 1KEMH 3CVIL 1EMTH 5JUEH 3O41A 4B53A 2I9LA 4MDIA 2NW3A 4N1EA 3SO3B 5LVEA 3IS1X 4MAYD 1IAIL 3ARTA 4HDIB 4BKLB 3GMOB 3VH8B 3MLPA 2YD8A 4ZPVB 2JCCB 4XTRC 4QTHA 1JPFB 1IC7L 4NWUH 1B6UA 4P5TC 5CMAA 2IH1B 1C16B 3CH1B 4X8JB 4HULB 3X11A 3PDDA 1LEKA 4XCEA 3HNVL 3MRDA 1I3GL 3RDTC 2VKXA 2AK4E 3QWOA 1QLRB 3ULVL 3RWDA 5I8CB 2OM5A 1S7XA 4R0LB 4OAWA 2AK4D 1YMHA 2DYPD 1NBYB 3KPNA 4GS7C 3DGCR 3RY6A 4DQOL 2WWMC 5J9PA 4PJDB 2X4QA 5IFAL 3WNKA 3SDXB 4PBVC 4OLEA 4P5KA 1AR1C 5KW9L 3VD9A 1UM5H 3RWGB 1XF2A 5T3ZH 1HQRB 2PTTB 3RX7A 5F1SA 4LCIL 3BPOB 5FK9B 1F4WL 4E0RA 3IDNA 1GGIL 3GSWB 3MODH 2IPKB 3MLYH 2GAZB 3AAZA 5KANG 4BM7A 4ZUVA 4EUPH 2K9UA 3SPVB 2VLJB 1M7DB 1F42A 3S96A 5DJ8B 4TUOB 5DLMH 2F58L 1RSFA 2CDGA 2NLJA 5J1AA 5C0ND 4R7NA 1ROWA 4TRPH 5F6IB 4L29B 4G6ML 2XI9A 5B8CA 4WTZG 2Q3AA 4U2ZA 3BN9D 2X4RB 2D9CA 3T8XB 2R4RH 1VA9A 3WIFB 5E7FA 5TJWK 5IMOB 4F58L 4K9EH 1T7YA 1TTUA 5E70A 4LKCA 1FJ1A 3NCJL 3VFPA 1NBQA 1MWAB 1KCUH 3MOBH 4M9OA 1GGUA 1U0QA 4KVNL 4HS6A 1T03L 3PWPA 3RDTB 2B1HL 4AIXA 1JN6A 5LXGH 4KMTL 5TQ2H 5J6GB 3QQ3A 1A22B 4GS7B 1FLRL 4AEFA 4X6EA 5I1JL 4YBHA 2FCBA 1KJVB 5IOPB 4IRSC 4YFEA 5EG6C 2I60L 3V8OA 2CRIA 4TSAH 1U8HB 3GGWA 3C5ZA 4JM2F 4WGVB 2QLVB 1D6EA 2VDLH 2XZQH 1Z5LA 5IVXF 1EIBA 4FZEH 4PGZA 4KTDH 3SN6N 2EECA 2D0FA 3JXAA 5FOJA 3I6LE 1FBIL 3I6LD 4XX1G 4PJXE 2DKUA 4L8BA 1H15B 1JWSA 5I8EB 4K3DH 1HYSC 2VTFA 4LGRB 1GH7A 5DT1L 5EBWB 5BJTA 2J8OA 3S88L 2CDFB 4FOMA 2EIZB 2PN5A 4XHJC 2OP4H 4GMSH 1OQXA 4X6CB 4JPIB 2FDBP 4KZDL 5EUOF 3GHBL 4M3KB 3LKPB 2Z93A 4LPTA 3OKEB 4E5XB 4H8WH 1CFBA 3TPUA 2W1NA 4ZQKA 1R3JB 4XNMA 4ELMF 1A6WH 4GRWF 4IM8A 1HN1A 2CSPA 1GZPB 5FOBA 3J8F7 3ZT6A 1LO3L 5IWLA 4KV5F 2FR4B 2ICCA 3L3IB 5F1KC 1T5XA 5EZIL 4I48B 1T1XA 3T0EC 1GZQB 4BELD 4PGBA 2VXUH 3A0OA 4XCYB 1FZMB 3TA3A 4EUPA 4EBQH 1JPGA 4Y5VA 5D7IA 1RJZB 5D7SH 4P46C 3AB0C 1Q0XL 1N6UA 5T1MA 3KJ4C 4IRSB 1XMWA 3V52H 2NYYC 1ZHLB 5JW4Q 2FX7H 4PRAA 3F7YA 3KYOA 2EIEA 2BHUA 4L4VB 2EC9T 3WS6A 1WIOA 3WDIA 3ESVF 2O5XH 4PJHF 4G6FB 3HNTL 1CL7I 1BIIA 4RAUA 5ACZA 3S6CA 4JHWL 3T09A 5EOTA 4WEBH 4A6YA 3RPIA 4ZUUB 3B3IB 1DBKL 3TO4D 5DJXA 2W59A 2ATPA 1G7MB 2HG5A 1P2CB 4MNHA 5KVEL 3KHQA 4OCRL 5EBGA 2IBZX 4LSUH 3W11D 5D2LB 5A2JH 3WFEL 3GI8L 4LLVB 4UU9A 4RSVA 3V6FA 3THMH 5FV2A 3ARDA 3LHPL 3GJEA 3EYOB 4S1QL 4NSKA 1VSCA 3QDJA 1NEZG 1J8HA 1N5AA 3QAZC 3NIDF 3IDIB 1HH9A 1YEJL 4P46B 1NGZB 4FMFA 2MWCA 2VC2L 1U3YA 1WAAA 1F3DH 2IPUK 3H7LA 1JRHL 5EOQL 3KJ4B 1JF6A 1C5CL 4UINL 1KTLB 2E27L 5I30H 5IJVA 3LMJL 5HGGS 1MIEH 1WF5A 4HPOH 2YA0A 3L6FA 1V7NH 1VFBA 3EKCA 1RZGB 4BZ1L 1YYMH 1EPFA 2B1AH 5I73C 3NZ8A 3GMRA 1U8OA 4RGOH 3CFJA 5FUOL 3RBGA 1LHZA 1X4YA 5H2BA 1X5FA 1CFQB 1RHFA 1X3DA 3UJJL 5JQ6H 1WBYB 4J1UA 4LVOC 4Y8DC 4H0IA 4E41E 5C70A 3GMMB 4UOJA 3MNVB 4F9LC 4G9DB 1MFNA 4TULL 4E41D 2P7TA 4TVSa 1CQYA 3CMOH 5HGBB 4X0KB 1RV6X 4TTDD 4XMKH 1JNLH 4L4JA 4P3DB 1I1AA 3LY6A 3UTSA 4L4TA 5CBEB 5E56A 4G5ZH 2COQA 1G0DA 1NFDB 4NBZB 3O6FA 4GQPH 3ZKSD 4UDUA 3CDFA 4OGZA 4OSUH 4P3CH 3S35H 1HNGA 4X5LA 2NX5A 2Z0BA 5C0AB 1NMBL 2W65A 1CDIA 3QAZB 1MCPL 4Y4KC 1C1EL 5C0BA 5I1CH 1RUKH 3DI2B 3IKKA 3NCEB 2CLZA 3PWPE 3FFCB 5F9DC 3DSFH 4DGYL 3PWPD 4XBPB 3PIQB 5LCVH 4Z7NF 1ZK9A 2PNDA 4X7EC 1D6VL 2VZUA 5KSBE 5IW3A 4OGYL 5D1XC 1EO8L 1J0YA 5ISZA 3LH2H 4IOIA 4OCLC 2NY6C 4IOSD 1U93B 4CN4A 2X70B 4R7DB 1YUHA 4NC1E 1RQ5A 3V4VH 1Z0MA 4LVOB 3G6JB 4CNIA 2BVTA 5HYSA 4ZO8A 4G43A 1V05A 2R4SL 3GKWL 3MZGB 1WZ1H 3BRGC 2A6DB 3HA0A 3ZO0A 3S98A 1WCBA 3CNKA 1MRDL 2W0FA 3KWWB 4LHUB 3MUHL 2ILLA 5CJOL 5KG9B 4NZRL 1SBSL 5FYJH 3KPOA 1YQVH 3SDCA 1J11A 4U31A 2ADJA 1OSPH 4JG0L 2ZG1A 4NN7C 2JKXA 2W9EH 1X5ZA 2GY5A 5CSGA 2A73B 5FHAH 35C8H 3ZE2E 3UDWC 2Y5TA 1KGCE 3L3GA 3B2VL 3AFLA 3CSYA 1KGCD 2FBJH 5T3XL 1FSKC 4Y4KB 2LVEA 4UNUA 1MEXH 5T3ZE 4K7PL 2BCKB 4NYLA 5DEFA 3TP4A 1MSPA 3VXUA 4NZUL 1SQ2N 5JW5A 5T3ZD 3KVQA 3U0TA 5CCKH 4ODTH 2Q8BL 1KIRB 4LKXA 2EYRA 5HHME 1N64H 2YBRA 5D7IE 2X44D 4PR5B 3SQBA 5I66B 3TA3D 2AQ2A 2B2XH 2OMNA 5HHMD 3EYQD 3GO1L 3RBSA 1KF9B 1FZKA 1K4CA 3ECBA 4RFEA 1S3KH 3L1OL 4KWUA 1XF5B 5D1XB 4O9HH 4QOKA 5LBSL 5I17A 4HIJB 5JIPA 1BJ1J 2NY6B 3MYJA 4PB9L 4POYA 4KJYA 4LCCC 3TJEH 2FYYA 3Q3GB 2EDDA 4WJ5B 3TT1H 5B4MC 3QB7C 2DI7A 4XCNB 1QFWH 4NWTH 3RKDD 5EU7C 1E6JL 1MCRA 5DWUH 2Y7QB 3UPCA 4OM0H 2P8PA 2LV4A 4N5EC 3L5WA 4GMTL 5TGBB 3C6LC 2VUOA 2IAMC 5J56B 3PABB 3RIAK 4ZD3H 1FNAA 4O5LH 1JPTL 3FN3A 3DO3A 4HXAH 1FGVL 2JELH 1N6QH 4JFHE 5ENWA 4NN7B 3VWJC 1XGPA 2R69L 1EUTA 1NANH 5MENA 4JFHD 4NGHL 1TXKA 4ZFFB 5ICZA 3G5VB 1P7HL 5M7QA 4M1DL 1AGEB 3HAEG 5DJ6B 1HSBA 2VDRH 5FDYA 1FSKB 4K3GA 3PHQA 3CVIH 4OF6A 4FQQA 3JZ7A 3RA7L 1DTUA 4X6DB 1HWGB 3X12B 1TZIB 3L3DA 2H6PB 2WQ8A 5IFHL 5ESQA 1CICC 1J8HE 1IAIH 4MJIB 2OL3A 3I85A 5DDHA 2E7CA 1FV1B 2BNUA 3CDGB 1NAKL 1DANT 4HEPG 4I3RL 5GRWA 1WAAE 3EOTL 1KTKE 3OKLB 4APQC 4MNQB 1IC7H 4RFOL 3FB5A 3QXWA 4F33B 5F72S 1YPZF 5DRXB 1T1YA 2A0LC 2BRRL 4X5WB 1VACB 3HNVH 4ONGL 1T2XA 5C3LD 3ULVH 4JY4A 4C59B 3MREB 4LSVL 4HUUB 1OD7A 1MLBA 3ARFD 3F7VA 2HA1A 4DQOH 5IT2L 3C6LB 5A3IC 2IAMB 3KS0J 3R0NA 2J88L 3UTQB 3PWUB 5IFAH 4R9HA 2P8MB 3QIWA 4O2FB 4P2QE 1JV5A 4U1JA 2Z9TA 4P2QD 5I76B 1DE4B 5IB3B 5KW9H 5IHLB 2ZJSL 4U3CA 1KTRL 3WO4C 4NC2B 2OTWB 4WI6A 3BQUA 4CADB 5FA3B 4HKXA 1GGIH 1G7QA 4JY6A 5MERA 4JFXA 4KPHL 3UTSE 3O9WC 4L4TE 5FKAA 4CN1A 2KQNA 3JBG7 4OZ4B 3UTSD 4L4TD 1I85C 3LKQB 3QXUA 1F58H 4CBPA 3DO7A 4MB3A 1WCQA 3CXHJ 3O6FD 1F11B 1QVOA 2NX5E 4GG6A 2NPLX 1V5JA 1CICB 2X41A 1O7VA 1XIWC 2NX5D 4I2XB 3MRRB 5C0BE 4G6MH 3ISWA 3MQIA 5C0DB 1ZVSA 2DTML 3EFFA 3MCG1 5D96C 1R24A 4XPFH 5C0BD 5SX4I 4HXBH 3T77A 4APQB 4RAVB 1VADB 5LQBL 4HK3J 2A6KB 4Z76B 4J8RA 3VFUA 4F58H 4TUJA 1MLCB 4AEIL 3NCJH 5A16B 1S78C 1JGDA 1T04A 4NJ9H 4ZO7A 4PTTA 3KPRB 5J6HA 5L2KA 4KVNH 3TN0A 1T03H 1LEIB 4EKXA 1WV7T 2B1HH 2VDKH 5C08B 3IU3B 3IXAB 2E6QA 1T1WA 5HGHA 5A1AA 4JLRA 5INDB 1FLRH 1S7TA 1QEWA 5I1JH 1J86A 4TPRH 5DYOB 4WTXA 1QRKA 1MCJA 4Q58C 4WUKH 2I60H 2JJTA 4F8TA 4BH8A 2PXYD 2GQHA 2BSRA 4X99A 5FGBC 3B2UC 3MNWA 5GRYA 4JFPA 1VESA 4P23A 3CXDL 3WO4B 4Z7QE 5DJDB 4OT1L 3T65B 1MRFL 1FBIH 1U8KB 1XEDA 1FDLL 2P8LA 4PS4L 4S11A 3FB8B 2I5YL 2YUZA 3SDCD 3BUYA 1JPSL 4XI5C 1S9VB 3FOLA 1ES0B 2NY1D 4I77L 1OGTA 4QRUA 5KZCD 3B9KC 1CDYA 3VG9C 1XIWB 4KZDH 5DRWA 3GHBH 3O3AA 3VXQA 1KCSL 5FUCC 1L9NA 4WI9A 5HHQA 3VXUE 4RMRA 1NC2A 2GJZB 4QCIB 5CGMA 3B6SA 3PQYB 3VXUD 5JHLH 2MKWA 1CD1B 5KSAD 1FORL 2ICEB 1FYTB 2X4NB 3GMLB 1RZ7H 5EZIH 2GTZB 2FBOJ 4DFIA 5E8PA 1SYSA 5GQBA 2UY7A 4LNRA 2ZSVA 3EYUL 4EN3A 4U3HA 3G5XB 4OZFG 1N3NA 4QOKE 1ZANL 3FN0L 5GS1A 1Q0XH 3C2AL 4QOKD 4QRPB 2IMMA 2KZWA 1LE5B 1A64A 4U7KA 1JWMB 5BVPL 3FT4A 3ROLA 2Y4SA 4N0CC 5KS9B 2CLVB 5D7LA 3JWDC 2IG2L 4HH8A 1MCLA 3OKMA 4Q6IC 4WU5B 4NCC2 4JHWH 2BSSA 1ITCA 1P1ZB 4P5MB 2KH2B 5JIIA 4PD4K 4NCC1 1I9RL 3SKMB 2DMBA 3GHEL 2DI9A 4KRMB 1F8TL 3GIZL 3LZFL 3B9KB 3BUTA 5KVEH 3EJZD 3QQ4B 4FQ1L 4OCRH 3VG9B 1AKJB 5AWNL 3TBWA 5F1NA 2WSKA 1PAMA 3R4DA 3VWKA 3BZDA 4DW2L 3L9RA 1UWEL 4PG2C 1AHWC 3GI8H 5ICXA 5CKAA 2G2RA 3ZL4L 5DRZB 4GOSA 4HIIA 4QXUL 3LHPH 2L7JA 4FXGA 4IIQA 5L88L 4S1QH 4FQHA 4FFVC 3ZYZA 1F6AA 5FYJE 3WLWC 3VRIA 1QBLL 4FP8L 2G5BA 2ZWLT 1YEJH 4TVPL 1MNUL 3B9AA 1K4DA 2DJUA 4ZFOB 4DFHA 1JRHH 5EOQH 4UBDD 1IL1B 1C5CH 3QHFH 1CFVL 4HWZB 1YJDL 4UINH 2XKNB 2E27H 1H3TA 5HXMA 3MJ6A 3VXMB 5D1QA 4BZ1H 1DBJL 2AV7B 1L0YA 2CKBL 3FQTA 1OCWH 2N56A 3DYOA 3O3EA 2E8YA 3OJDB 3VFOB 1FE8L 2QQNL 2JIXA 3QIWD 5IR1B 3RUGB 1BWMA 4PJAB 3UJJH 4WI8A 1WTGT 4NRZA 5I19L 1BBJA 3BQUD 1PYWB 2FATL 3FCTB 4TULH 3SDDC 1DL7H 4NNYB 1F5WA 2VZVA 3JWNC 4FQLL 1AHWB 4OCWH 1R5IB 4PD4J 3VH8G 3EO1A 4GG6E 4JRYA 4N8VB 1LVEA 3FTGA 4LARL 4ODUB 2Z4QB 4Y5YC 5TF1L 2XYCA 3P77A 3OPZL 3LQMA 5B39G 3PXJA 4BYHA 2AV1B 5GGSA 3PV7A 3GSNB 3WJJC 1LO2L 1NMBH 1EXUA 3A6BL 1MCPH 1C1EH 5FO9B 4JG1L 3BD4A 4D0BA 3GI9L 1JBJA 1CGTA 4YHPB 1LK3H 3VW3L 2CLRA 5FGCB 3TN0D 5BQ7B 2EIBA 5B38A 5FGRA 2GJ6A 3V5HB 4J3XA 5K9JL 5IEHB 1CGWA 4OGYH 1CXKA 1EO8H 2H2SD 4PRPA 3P73B 5DO2C 2KUTA 4XH2A 4OD2A 2PETA 4OLYL 5E6IB 2DLEA 3ESUF 2APWA 1JZ7A 1XFPA 2GJJA 2NW2A 3OAYH 1Q38A 4A2LA 3GKWH 3BKJL 1IGJA 5IF0B 3SDDB 3S7GA 1MRDH 5IJKA 3ULVE 2DBJA 4QHMA 4GKNB 1P5UA 4NZRH 1SBSH 3KYMB 4MGXA 4BK4A 5DMIH 3ULVD 4GW4A 1UADC 3O2WL 3BN9C 4PLKD 4JG0H 4MA8H 4Y5YB 3FHQA 4YFDB 3I50L 2FH6A 4M7JH 2WINB 3ARGA 1UCBH 3MXWL 4I4WA 4Y4HC 1W0VB 1NC2D 1AGCB 3B2VH 2N7AA 3QUZA 1RZIB 1FH5H 3HCVB 1OAUL 4U2YA 5JZ7D 4K7PH 3LV3A 3D39A 2XZCL 3TNMA 3ZT5A 4NZUH 4DGVL 1NCBL 5GSVA 2Q3ZA 1NGXA 4QHUA 4YWGL 5DMGD 2Q8BH 1DVFA 2X9XA 3DGGA 4EN3D 1F4XL 2ZUVA 2GTWB 5FYLL 3GO1H 3IJSA 8CGTA 4D8PA 4YUEL 1A14L 1MF2L 5I75B 4GBXC 1ZTXH 2DWEA 3L1OH 4IRJA 5LBSH 2Z35A 1OAZL 1H3WM 1UJ3A 2GT9B 4JFYB 4PB9H 4XPTL 5IV2A 3OHXA 3HR5B 1N4XL 1QLEL 1M7XA 5IKCA 1JYNA 2VLRB 5DD5L 4PJEA 2UY6A 3IAQA 1YEGL 1OF2A 1EHXA 4GMTH 4AH2A 4LCYA 2BMKA 4LPYA 3DX7A 1JF5A 1BFOB 4HG4K 3P9WB 1JPTH 2D31B 4HJJL 4QRQB 4J3SA 1BREA 1FGVH 5AUMA 3P3YA 3DX9B 4KRNA 3MRIB 4I0PD 5TE7H 3LQAC 3AUVA 3ABZA 4WO4C 2R69H 1KLUB 1FYHB 4NGHH 5DSCB 2BVEA 2AXGB 4M1DH 2XNAA 3VWKD 4Y4HB 5JOPE 2GSIA 5JOPD 1KV3A 1KB5B 2FD6L 1T80A 2JJWA 4YDKL 1J0ZA 3EDEA 3RA7H 2Z92A 5E0QA 5IFHH 5BZWB 3WMSA 2FJHB 4CJ0A 2W0PA 1A5FL 1MCFA 2BERA 3I84A 5JORB 4WIQA 4NRXA 5F6HJ 3VI3E 1NAKH 4JFFB 1WBXA 4I3RH 3EOTH 2BFVL 3PDOB 4GBXB 4XB8A 4DN4L 2VITB 3B5HA 4RFOH 3E8UL 1NGPL 4KDTA 4FG6D 5C0GA 3IKCB 4S10A 1RD6A 1KJMB 5F7EH 4HK0B 3WE6B 2NY2C 4LLQA 1KBGL 3U9UB 3O45B 4PJXB 5EZOL 4KAQL 4X6CF 3FRPA 4HJGB 3SE3C 5IT2H 2V7NA 4BSJA 1CFSB 3KPLA 1L0XA 4RISH 2J88H 2R15A 1ADQL 2HFGL 3O4LA 3EYVA 5IHBA 4KU1A 4HUVB 1FO0L 3QBTB 3MX0A 1NFKA 5EU4A 2MFNA 1JI2A 2ZJSH 4WO4B 1KTDA 2IGFL 5DJ2A 3O3BA 1Q9OB 5HHPB 3TWCH 4ODHL 3OGCB 4X4XA 4HG4J 1JI1A 12E8L 4KPHH 4PPTA 3QXAB 3UC0L 1D5XB 4FQPA 4AEHL 5BV7L 2VKWA 4KJQD 5KSBF 3CLFL 4X6BA 3SGDH 3JTSA 2C1PA 3RVTD 4UTAL 3SY0B 2CMRL 4M1CD 4PJBB 5F7NC 5C0JB 5ID0A 3OB8A 4Q9QL 3H9SB 2DTMH 4FQCL 3U36A 4PV9A 2AKRA 5DJYB 5LQBH 1YECL 3BGAA 4C83B 5JO5A 2HLAA 3D85D 3JV4B 3IETA 5EFIA 2VQUA 3RY6C 3GK8L 1INQB 4X6FB 1DDHB 3KLHD 4MWFB 2YD9A 2GJ6E 3FFDB 3ZDZE 1Q9LB 1UB6A 2NY2B 3WFDL 1A02N 1INEL 3UYPA 2GJ6D 3L95B 4HT1L 9CGTA 3QXTA 3HRPA 4L3EB 3FB6A 4MXWL 1UQSB 1EO7A 4JKPL 4PRPE 4C4KT 4UDTA 3W0WA 3S37L 1KELL 4ONFL 3DRTA 3ZE2F 4L8DA 3BPCB 2GITB 1BZ7A 2M1KA 3X14A 3NVQA 2F8XC 1BZQK 3WFBL 1ZV5A 3K80A 1AD0B 5LGJB 5EOCJ 3WSQL 4TTDC 4YHMH 3LS4H 3PP3K 2YD3A 3CXDH 3O3DB 4OT1H 5D7IF 1MRFH 1U8NB 1MQKL 1FDLH 4X4YA 1XGTB 2OTUB 4KHXH 4PS4H 3K2UL 3JWOC 2I5YH 4MJ4A 1RULL 1JPSH 3PP4L 5B8CC 1S7VA 1VGKA 3MRCA 4I77H 3CFKB 1HILA 3TCLA 1CLOL 3UTZB 5L2JB 4WEMB 5GS0C 3X11B 2UWEE 4LSSH 1LEKB 1ZA6B 1XGQB 3ARGD 3OMZA 4OUUA 4WI4A 1T5WA 3HS0A 3BEVA 1KCSH 3MFGB 3ROOB 1BQUA 1PY9A 3CK0H 3MRDB 4N1CA 3D39E 3QUZD 3VD7A 3ETBF 2G75B 3RTQD 3VRJB 3D39D 1GHFL 1FORH 1E4WL 5K59F 1FZJA 1F2QA 3HZMA 1DVFD 4DOHE 5J9PB 2OJEB 2X4QB 3U82B 3C5ZC 1R0AL 5ESVA 3EYUH 1NUGA 4HIEB 2Y1VA 3L3JA 3FHAA 5TQ0L 1T21A 4U6XB 1ZANH 4LLUA 3C2AH 4NC1C 1BQLL 3L3KA 3T0VA 3VFSB 4OIAA 4NQSB 1EFQA 4Z78A 2ZCKL 4B5EA 4E0RB 5BVPH 4YO0B 3MV01 5J89A 4JZOB 4EIZC 3VFNB 4LHUG 4ZUVB 4Q97A 1D9KA 4M00A 2AJVL 4TSCH 1VFOA 4F7MB 3BGMA 4RNRB 2IG2H 1VHPA 4PUBL 3GMNB 3IFLL 1RJYA 5D6CA 4Q2ZA 2ADGA 2NLJB 1CTOA 1WAAF 5BVJB 3NGBB 1VB9A 2AJXL 3MJGX 1I9RH 1FVEA 3GHEH 3TC9A 1FNGA 1F8TH 3GIZH 3LZFH 5IWLC 1JWUB 5IEKB 3MRNB 3OAZH 1FJ1B 4FQ1H 4K94L 2F74A 2ARJB 5AWNH 2AJZB 3S36L 4DW2H 1UWEH 1A4JB 3WNNA 3NAAL 1JN6B 3ZL4H 5L8LB 3EYQC 4PGCB 3BKYL 4Y5VC 2VR4A 4JAMA 4YR6B 3SGEI 5HYQA 1R5VB 3QH3A 4QXUH 3EO0A 2LTQC 5L88H 4YNYA 4X6EB 1RJLA 2YRZA 4KTYA 5ADOH 4YEEA 4XBGA 2WLZA 1KCRL 4PBXA 1QBLH 3C5ZB 1IEBA 4P48A 4FP8H 3T2PA 3GUTA 1D6EB 2YRLA 4TVPH 5DFVC 1CDGA 1BM3L 1MNUH 2OJZL 3WS6C 3QEHB 3VXSA 2QQQA 4WGWB 3IYLW 5IHZA 1JMZA 1NCDL 1CFVH 1YJDH 3OXRB 5DZLA 3RNQA 3L7FB 4POZD 3CUPB 2YN3A 1LD9A 2I07B 4HD9A 1G9EA 1DBJH 5BJTB 2CKBH 5JHDA 5GRXG 1AD9A 1FE8H 2Z93B 3TPUB 2A6IA 3QFJA 3IFPA 2X4OA 5I19H 5E8DL 5FOBB 1GPOL 3ARDC 3I3DA 4XVUC 2YD4A 2FATH 4HC1L 1KPUB 5HTSA 4OB5L 1BAFL 2YEZA 4B41A 4J2XA 4J3TA 3UZQA 4N0UB 4DAGL 2XN9A 4Y5VB 3OR6A 2NY5L 3IDGB 3VXRB 3CD4A 4LARH 3REVA 5E00A 2XV6B 1DLHB 5TF1H 5T1MB 3OPZH 1G9MC 3D3VD 2HFFB 4TNVF 5E6ZA 1LO2H 4H8WC 2ZUWA 3A6BH 1QFWI 4PRAB 4AYFA 4JDZA 1AE6H 5E2VH 2X1PA 4JG1H 1CYGA 1X7QB 1QZ1A 1Z9SA 5E24E 3GI9H 4NM4L 1CIDA 2HJFA 1G6RB 3VW3H 1MCSA 4MQ7B 4RMVA 3E3QE 1A2YB 3W0WE 4A6YB 1MAJA 3TBYA 1CLCA 3RPIB 3X17A 1W8NA 3QT2A 3W0WD 5DJXB 5K9JH 1T1ZA 1IQDA 2VIRB 1QFWM 4LU5H 3BO8A 4D9RE 2ZUUA 4H25B 3WNPA 3GSVB 3S4SB 3UAJC 1MHEA 4D9RD 2A83A 2FSEA 4P9HC 1H0DA 4RX4D 6FABH 4OLYH 4LQ1A 1YQ2A 4UU9B 3BISA 1IBGL 2R9HD 1I1AC 32C2B 4HFWB 4DVRL 3ARDB 3MC0A 3GJEB 2CQVA 3BKJH 1IAII 4GAYA 3O6FC 4M4PA 4RBPH 3QDJB 1YNLL 2VQ1A 3I2CH 4J6RL 3U1SL 5C0FA 3UO1H 2XPGA 1SYVB 1J8HB 4UQ2A 1WZKA 4P4KA 1N5AB 1P7QA 3O6LL 2NZIA 3HNSL 3CGTA 3O2WH 5ILTL 1HH9B 2MOVA 3BPLC 5IFJA 3IJHB 1R3LA 5CLWA 1PQZB 2YD6A 1YMMB 3I50H 1NL0L 3GSRA 2EKSA 4OZGB 25C8L 2E7LC 5EIIB 4BSVA 3MRJB 3MXWH 1WITA 5C6PB 5CKGA 5IJVB 1CLZL 2FHCA 1IAIM 3ALXA 4KK5D 1VFBB 1K8IA 4KQ4H 2XZCH 1DN2A 1RZKC 3C8HA 1VFAB 3HUJA 4PGEB 1XF4B 3BP5A 4DGVH 1LGVA 3GFUA 4YWGH 5LAXA 3NZ8B 2E9BA 2EDFA 3MO1B 1BIHA 3RJQB 4EJ1C 3LAFA 5D1ZC 1F4XH 3AU1B 2J12B 5H2BB 3MJ9L 5ITBL 2IBBA 5FYLH 4B50A 4FXKB 4YUEH 1A14H 1MF2H 4U1NB 4DTGL 4ZTOH 3RVWD 3REWB 5C71A 5LKNA 4Z77A 1CE1L 1FL5B 4YHIA 1CGUA 2BVOA 1OAZH 4P2RA 4XPTH 4HBCL 2GFBA 2P7TB 1V7ML 1CDBA 1E28B 1KJ2B 1N4XH 1QLEH 5MEPA 1PZ5A 5CP3H 1X5KA 1D9KD 4JQVA 1ZLSL 5BXFA 5DD5H 4IBLT 1I1AB 2CXKA 4KKBC 2NY1C 1YEGH 1S5IL 2HT4D 3KPPB 4ODSL 1C5BH 2EDWA 4UDUB 2Q7YA 4WU7A 4ORZC 1G7PB 4FQXB 4HJJH 2A77L 1VEMA 1JHTB 3RU8L 5KTEL 3OQ3B 4KQ3H 3RZWA 3RVVC 3BPLB 3K4DA 2W38A 3P4NA 4EXPX 1DEDA 3O4OC 1CDUA 3I6GA 3NFNB 4U6YA 2CLZB 4QY8A 4LF3B 5D2NA 4L1HA 4M61B 4R8WL 5J1TC 2FD6H 1MCHA 4OZHA 1DQJA 1G7LB 4GSDL 4YDKH 1PSKL 2DQUL 1BOGA 2EH7L 5ISZB 1P69B 5E8NA 1L4IA 2X2YA 2IALA 5D1ZB 5E2TL 1YUHB 3ULUF 1EH9A 3MRLA 4P9ML 4BQCA 1X5GA 3VXSE 3I02A 4CNIB 2BFVH 3HZKA 3MLUL 2DQDL 4DN4H 5HYSB 1FIGL 2ZCLH 3E8UH 3RWFB 3VXSD 1NGPH 1MCNA 1J0JA 2QQLL 5IROA 4CMMA 4U6VL 2Q7NA 2HLFD 1WCBB 2W0FB 5C09A 5E2UL 4HIHB 5IVNA 1KBGH 4F57L 5C0EA 2BOCB 1P4IL 1LO5B 3KPOB 5EZOH 1QBBA 3RHWF 4H1LA 5DJ0A 1EUUA 1I8KB 4G42A 5JHDE 2NY1B 5J0BA 5JHDD 5KZCB 2H9GA 5FKPB 3UP1A 1U8PA 1ADQH 2HFGH 3QFJE 1ND0A 5HYEA 1OAQL 4IMKA 1QO3A 2XIDA 3HKFA 3L3GB 3QFJD 1S7WA 2B8OT 1T2JA 5IP4A 3C09C 1HOCB 4NYLB 1G7IA 3QDGA 2HT3D 2IGFH 5JW5B 3N0PB 3O4OB 2EC8A 1ETZA 5BO1L 2WBJB 4FHBD 4ODHH 2NCMA 2XN9E 12E8H 5GISH 1Y6NR 2YPKA 4Q6YA 1YY9C 4K2UL 2A6JB 4J3UA 4AEHH 5BV7H 2R0KL 2XN9D 5CP3A 3CLFH 4ZYKA 1FZKB 4JFDB 1K4CB 1RHHB 1MHPL 5I1LA 1DUYA 3GMPB 3INUL 2ICWA 5DQDL 3T2QA 4GAFB 2HWZL 3K81A 4M6OL 1AO7A 5J11C 2CMRH 4U05A 4ZTPH 3W5NA 1PJ9A 5MEQA 1II4E 4G9FB 1ED3A 4WCYH 3RNKA 4ORGA 4Z7UF 3V8CA 2ITCA 2L4OA 5F44A 4Q9QH 3HE7D 1RAMA 2ICES 1RK0A 4PJ7B 4WW2A 2CD0A 3ARUA 5CEXB 1MCIA 1TVDA 1YECH 4UV4L 2VLKB 1L7IL 1T4KA 3MRBB 3GK8H 1LEGA 1I75A 5TDPB 1HH6B 3IXTA 3WFDH 3QIWC 5FECA 4HT1H 4Y0GA 5DGRA 4KJWD 3KDMA 2H8PA 4MXWH 1R3HB 1N0LA 5SWSE 1QQDA 4LOUC 3S37H 1KELH 1XGPB 3T4YB 4LPCA 5MENB 2ZCHH 3CVHL 5SWSD 4CKVX 1IM9B 1T0MA 3L7EB 4F2MA 5I1AA 1OB1A 1HSBB 4QXWA 3FZUC 4ZFGL 4TVPE 4UOW0 2MQCA 1JCKA 4TVPD 2P1YA 3C09B 4FQQB 3OJMB 1RPQA 3IU4L 4OZIB 3I6KA 3GSOA 5HHOB 2C1OB 5ESQB 1MQKH 3RL2A 3I3EA 2OL3B 4NKDA 5ALBL 3K2UH 2BNUB 3BHBB 4QRRE 5HDQL 3QUML 1RULH 3PP4H 1CXEA 5FB8A 1BBDL 3RWEA 4QRRD 4CW1B 3TZVD 4BFIA 4IOFD 4EDWL 1OT2A 5D70L 1CLOH 5HI5D 3PV6A 4PGDA 4M6NL 4EI5D 5J11B 3LRGA 1T1YB 3NN8A 1XCTB 1ADQA 5CSZA 4GKZB 3TN0C 3UBXG 3HUJE 4Y16A 2DAVA 3HI6L 1Z6JT 1HWHB 4EQ3A 1E4WH 3BH8A 5HGAA 1IM3A 4KROD 2R23B 2UUDH 2H2SC 4QKXB 4NO0A 3LRSB 5DEGB 1GIGL 2NY7L 2J8HA 1WC7A 1JTOA 1H3UA 3QIWB 4Z5RB 1OAKL 4YXLL 1PG7L 1NGQL 1RFDH 5TQ0H 1JHKL 5IVZB 4P2RE 1BQLH 4P23C 3QNZB 4P2RD 2ZCKH 2VDML 3B43A 1IC1A 1JFQH 2PCPB 4HKXB 3B9EA 1G7QB 4JFXB 3GMQA 1QG3A 5FKAB 4NOFA 4XVJL 4WFGE 1NAML 43CAA 1IT9L 2WAHA 4WFGD 3ULVC 2AJVH 1PD6A 3D25A 1ZWIA 3EW3B 4DVBA 4PLKC 4Z18A 3DO7B 1MQ8A 4YDJA 4PUBH 1QVOB 3D18A 5KJRL 1OPGL 3IFLH 1AGFA 3VI3F 1OQOA 1DQLL 3D1MC 3ZKND 4D0DA 2EO9A 5F9AC 4HUWA 5DHVB 1ZVSB 4PJIE 3LSOB 1R24B 3T77B 1CK0L 2V9QA 3NIFE 2O5ZL 4OQTL 3HPLB 4TUJB 2VQTA 4ISVA 5D2NE 4K94H 5FA4A 5CWSA 5DMGC 1JGDB 4PTTB 3S36H 4C56A 5DEZA 4CU7A 5L2KB 5L6YH 5F9JA 3NAAH 4RWYL 3S8WA 1JGVL 5E9DA 5GS2D 2Z31B 3BKYH 3V5DA 5ID1A 1C08A 5JXAL 5TPWL 4ZPTA 4G7YL 5GS1C 1F2XK 1FN4A 1A7PL 1S7TB 2L7UA 4NUJB 4JKWA 5ICYA 5IQ7L 1KCRH 2NXYD 4PP1C 5IW6A 1HE7A 3RY4A 4LRIC 3WHXB 3OR7A 2BSRB 4NDMA 4X99B 4ZOAA 3MNWB 4K7PX 2JB6A 4JFPB 1XF3B 3HE6D 1F3RB 2OJZH 5DTFB 4P23B 5C09E 2FL5A 1T20A 4QTIL 2P8LB 3MRQA 5AZEL 1EEYB 5C09D 4ZG1A 1NCDH 3OKNB 4QRTB 1SJEA 4MXVE 3DVIA 1HZHH 4LLYB 3CFCL 1WBZB 5I16A 1AXSA 1CZ8L 4PY7A 4WV1A 1C5DB 1S7UA 4P3WA 1VGEL 2GK0B 4PGJA 4S0TD 3RIFF 5FYLE 3O3AB 3VXQB 1TZHB 1TQBC 4OCSL 1ONQB 4RZCB 5FYLD 1KG0B 2X4UB 1FVCA 3QDGE 2V2TA 4MJ5A 1KACB 4IRZL 3QDGD 5E8DH 3LEXA 4GRWH 4U1SB 1GPOH 4IIQC 4QXTA 2I9TA 1BMGA 4HC1H 2P5EA 7FABL 1YYLL 1KEGH 3C2SA 4OB5H 1WQVT 4LNRB 3PWJB 1BAFH 1ORQB 1LDPH 4HLZG 4OLVH 4OI8A 1W2KT 3MROB 1AO7E 1ZT7A 2C4FT 2NY5H 2W92A 5GS1B 1A6TB 4U1LA 1AO7D 3KPQB 1ZHBA 3DTXA 3FO1A 4FG6C 3QDHA 2VL4A 4MDJA 4NQVA 2NR6D 2A9ML 3FT4B 1F6FB 3MRHB 3M07A 2BSTA 3JV6A 3BIAX 4UI2A 5E5MA 2PYFA 2XWJB 4NKIL 4DGIL 1VKXA 2DKMA 4YZFE 4BQBA 5D1QC 5D7LB 4UNTA 1A3LL 1QSEB 2BP3A 4NM4H 2HRPL 4GW5B 3EHBD 3OKMB 4NHUA 5T1DL 1N6VA 4MQXC 3WD5L 2YPLE 3P30L 3PWVB 3ULSA 2BSSB 5ALCL 3U30B 5TDOA 4QYOA 3ZT7A 2GSGA 2YPLD 4X83A 2UWEF 5CEZH 4WENB 3DUSA 4UILL 3LN4A 5IMLA 5DFTA 1FGNL 4NQXA 3LN5A 1NCWL 2Y36L 3QA3A 5FYKL 4NN5B 3TBWB 4IHOA 5F1NB 4LRNL 1TQBB 4QLRA 3SGJA 3L9RB 1OTSC 2JJVA 1KB9K 1U8LB 2JK5B 4IS6A 4JM2A 4XP5L 1IBGH 4HIIB 1B0RA 3L5XH 4DVRH 2DQHL 4FXGB 4JFQB 2PUQT 1H8SA 2XTLA 4F7PB 1AGDA 3QNXA 4X98A 1YNLH 4J6RH 4E9LA 1NQBA 3CLEL 3VRIB 1P6AB 3U1SH 4OLZL 5HDOA 3WL9A 2R2HB 3PHSA 1MJJA 3O6LH 1D5MA 1RIUL 3HG1B 5A2IH 5ILTH 4MNGA 5D8JL 3DX8B 5EU6B 4AQ1B 2R0ZL 3JTTA 1ZA3B 1K4DB 1NL0H 4Y8AA 1GSMA 1U8MA 25C8H 5DHYA 3WHE0 3VXTB 4WTZA 3S97C 2BRQA 3OKDA 3X3FH 5EUOA 1CLZH 3LEYL 1YEHL 2D7PA 3ARYA 4Y16D 4Z0XA 1J88A 5EU3B 5D1QB 4ELMA 1UZ8A 3L5JA 1LO4L 5EO1B 1W72B 4NO0D 4AIZB 4U6TA 4HC1A 4PJ5E 5C0IA 1TJIL 2JIXB 3RAJL 4PJ5D 4AENA 3JV0A 4KRPD 4OKVA 3OV6A 2JE8A 4DTGH 1MAML 2MCG1 1CE1H 2W9LA 1JNNL 2VUYA 5T5FL 4YGAB 4Y1AA 4N9GA 1EGJL 3EOAB 1KN4L 1V7MH 1B9ZA 4KDVA 2EDTA 4WFEE 5IJKC 2VLLA 2CDEB 3EJYD 5E8OB 3SGDI 4WFED 1ZLSH 2AQ1A 3EO1B 2NY0C 1ZLUH 3PHOA 2KQMA 4JRYB 2YA1A 3FTGB 1ITBB 2P42B 4XXDA 3G08A 1S5IH 4ODSH 3NCYS 1F4YL 4FQ2L 3VXPA 1MVFA 3ARGC 1NUDA 2PF6A 1KB9J 4PJHA 1EXUB 2ZPKL 3BI9X 3OL2A 5D5MA 2C5DC 3RU8H 5KTEH 2W9DL 3OB0H 3F58H 3LDBC 4L9LA 1C7SA 3HMWL 4HGKC 5E2JA 4C56E 2SEBB 1U3ZA 5F9OL 1QLFA 1DVFC 4C56D 2DM4A 2P43B 5E9DE 1S5HB 3B8YA 2AJ3B 2C3HA 3DNKA 4R8WH 5E9DD 2YPVL 1MFCL 5CD3A 5IESH 4GSDH 3BE1L 1PSKH 4Z95H 4IRJC 1TCRA 4D0CA 4UQ3A 1VEPA 4LPWA 4NNXA 4PRPB 1S9WB 1K85A 1UJ3C 4PJ9C 5E2TH 5IB5B 3W82A 5ANMA 4P9MH 3G04B 3V7AE 1SM3L 3MLUH 2NW2B 3SKOA 5HPMA 1CTNA 3D69A 2V9RA 2QQLH 1PKQA 2QJDA 1UENA 4OCXH 2Q6WA 1LP9B 1ODAA 5E2UH 5DXWA 5F7UA 4H0HB 1NFIA 4F57H 2ADIB 3OAUL 4K71C 1P4IH 4TN9A 3HLAB 4GW4B 5DVMA 2NY0B 1OP5K 1A1NA 4NFBA 2FB4L 3MLVL 4DZBA 4G6AD 1ZGLB 3MV7B 3ARGB 1EA9C 4I4WB 2X5PA 4XWGL 1OAQH 5I1GL 4MB4A 5DUBA 1G9NC 1U8QA 4UT9H 1YZZA 2CK0H 3LDBB 4U1MA 2P5EE 1A6ZA 3IVKA 4OBRA 1BF8A 5GSVB 2P5ED 4UAOC 5BO1H 3LVEA 2DQEL 1DQTA 1E6OL 3DGGB 2YMXL 5C07A 2HMIC 4K2UH 2R0KH 5JTWA 5SX5K 3EDKA 1T22B 3IJSB 4D8PB 4KKAD 3DARA 1MHPH 1CGVA 4FRWA 1GGCL 5DQDH 5J12B 1GC1L 1LQSR 4IRJB 4KDTC 2HWZH 1DZBA 3PUCA 2Z35B 1NEZA 1TETL 4M6OH 3QWRD 3K1KC 5IV2B 1A0QL 1KIQB 4JPVL 4PJ9B 1D5BA 5EZJA 4G80B 2VL5A 5IKCB 4WHTB 4D3CL 5LGKA 1A3RL 3WUWB 4BQ9A 4POZC 4PJEB 2ZUYA 3N1MC 4LHQB 2HJKA 4UV4H 1L7IH 3C87A 3NFPA 1XGRA 4LCYB 2BMKB 4QWWD 3DX7B 1D5ZA 4YHLL 1MHCB 2FGZA 1Q9KA 4GXVL 4HV8A 2P24A 4MA3A 4K71B 3TFKC 4R2GC 1QFOA 1TNMA 2YC1B 2Q86B 5CZVL 4X7SH 4BQ6A 1JZ3A 1MWAL 2QKIA 3CVHH 1U36A 1WIUA 4JGUA 3LQZB 4U1IB 2OX5A 3IDXH 5GGVH 2RCSL 4ZFGH 4JM2D 2GSIB 1XCQB 2DL2A 3DPBA 1CFNA 2AVGA 4NO2A 4L3AA 5C0CA 4YFLI 4NM8L 3IU4H 2Z92B 4XP9H 2ZSWA 4UAOB 3DI3B 4ZO9A 5JW4M 3VGHA 2BVUA 3LPGA 1FVDB 4Q9BA 5ALBH 1F90L 2D03H 2UV3A 3TGXA 5J3HD 4PJ8D 3QI9A 1ZLVH 1NC4B 4J7RA 3QUMH 1DEEA 4LFHG 3DROB 3DXAB 5A2FA 3M45A 3T08A 1BBDH 2VE6B 4X8XA 3VDCA 2NZ9C 1MREL 3CFEA 4FTVE 1JNHA 3MA9L 1AFVL 4EDWH 1JYVA 5D70H 4MSWA 5C0GB 3P11L 4P2OD 4M6NH 4FTVD 1CU4L 5EUOE 1HXMA 1FAIL 3HR6A 3RFZC 3V6ZA 4ELME 1NBVL 4GRWE 3FOMB 5E2WL 3EYFB 4PP2B 3QPXL 4JHBA 3FO2A 3E3QC 4KV5E 3HI6H 3UTPE 5DF0A 2P5WA 3W39A 1HDMA 1XT5A 3BH9B 3UTPD 4JRWA 5IG7A 1HI6A 4Z7WE 2NY7H 2YOCA 1RZJC 3O4LB 3S4SG 4YXLH 1W0YT 1PG7H 3VFRB 2EO1A 1NGQH 4IDLA 1KT2A 4R2GB 4F7EA 4JGJA 1JHKH 4AT6B 5IQ9B 5EU4B 4Y1AE 2FEDC 1F02I 1A9EA 5GZOC 5FF6B 1A6UH 3HAEH 1IZJA 3U48A 1OWWA 4Y1AD 2DLGA 5D7JC 2XG5A 2VDMH 3BKCL 1K3IA 4PJFB 4HGMA 4X4XB 4LPUA 1DQMH 1YEIL 1NAMH 1IAOA 3GIVA 2DICA 4M5YL 1L6XA 3KPMB 4XX1E 1IT9H 1NGWA 5CJXA 5FAAA 4YDVA 3QUXC 1SBBA 5KJRH 1OPGH 1HHIB 4HW6A 4NO5B 4WHCA 5E7BA 5D5ME 2HVJA 1DQLH 2OLDA 3ARBD 2WUCL 4ZNCD 1AJ7L 2XWBA 1OTTD 5DZNA 3QIBC 3QO0A 3I75A 4PV9B 1CK0H 2KL6A 3BYTA 5JPNA 5JO5B 3WJLA 1HIML 4OQTH 1FFOA 3IETB 5EFIB 3B5GA 3QSKB 2Z8WC 3GDBA 4R3SA 5CZXD 4JANB 5H94A 3DX6A 2OSLB 1UB6B 1FG2A 4RWYH 1GOHA 1JK8A 5E4IA 2UYLA 5EPMA 5SWQB 1JGVH 4P57A 4I5BA 3WS3B 5JXAH 4DEPC 5I2IA 2J8UB 4UDTB 5TPWH 4G7YH 3WBDA 3RQ3A 1P9MC 1A7PH 1MHHA 1I8LA 3DRTB 3HC3L 3KLSA 5DQJB 5IQ7H 5ANME 5CEYA 3X14B 4CVUA 1K6QL 3STBA 3BEWB 3NIDE 4U6HA 3QUMA 1KSRA 1PKQE 3BRFA 5ESAB 2ZP0T 4XAWH 4PRHB 2ADFL 3MR9B 5D7JB 2X89A 5IMMB 4I1NB 4QTIH 1N2RA 5AZEH 3HTLX 4NKQB 1I9IL 1IGIL 1YPZA 3GJFH 1FAKT 3CC5A 3P9LA 1VGKB 1HHHA 2FJGA 3MRCB 3BXNB 4MCZA 3CFCH 2F8OA 5DK0B 3UPAA 4HS3A 3TYGL 1CZ8H 3QUXB 1Z3GH 3TCLB 3QDMB 1VGEH 4LBEB 3MBEA 1A7BA 1TVHB 1YN7B 2NNAA 1CE6B 2H3NA 3MGTA 5I1KL 2W91A 3QIBB 4UB0L 3Q1SL 1UVQA 4IRZH 5ERWA 3O6ML 3HAEA 3V0AC 3ZMRA 1FZJB 3HZMB 4N0YH 2E9IA 7FABH 1YYLH 3EZ8A 5FHBL 1IC5L 4BH7A 4QGYA 1ZHNA 4K3JL 3U7WL 1NAMA 3WXVL 3L3JB 4C4KO 4O02L 2DI8A 4LCUA 2MSPA 3MJ7A 3EOBB 4WUUE 2HT2C 2QADC 4DEPB 3M17A 1OLLA 4M5ZH 2VZTA 3QCUH 1Z2KA 1TITA 4WUUD 5HYSG 2AEQH 2VERN 3SJVA 4N0FB 3K4ZA 3GRWA 4DCQA 1FL6A 5KSUB 1BJ8A 2FEEL 1FCGA 3E2HC 1A7NL 2XQYK 4R4ND 2ICWI 2XQBL 4NKIH 4B0MM 4DGIH 4IMLA 5CJ5A 1A3LH 4V1DA 4YX2L 3PF2A 4ZDHA 4OQTA 4XXCA 1DBAH 1J05A 2AEPL 2HRPH 4I3GA 1B4JL 1MCWW 3WD5H 3P30H 4Z7NE 5HVFB 5ALCH 4GO6B 2D3VA 4FA8A 3U6RA 3PJSA 1FVEB 1WICA 4OV5B 1FNGB 1FGNH 1U8JB 1EVTC 1NCWH 1FNEA 1SEQL 5FYKH 2IC2A 3G5YB 2C3GA 3PWNB 4LRNH 1Q94A 3PL6A 3P0GB 5C0CE 2NY3C 1FCCA 4R4BA 1KPRA 4XP5H 2EDLA 5C0CD 3UTTB 5HYQB 3GSXA 3MPCA 1UXSA 3QH3B 2DQHH 4M7KL 5DVLA 4YNYB 5CBAA 4OZFH 4ENED 3LN9A 4XBGB 5IM7B 3CLEH 3QI9D 3CZFA 4OLZH 1IEBB 3RPKA 3IAPA 3GUTB 1H3PL 3KNBA 3ARWA 3ZLQC 1RIUH 4BZYA 1HKLL 4NBXB 2E7MA 1V3LA 3SKJH 4LNVA 5SWZB 2FZ3A 5D8JH 2WIMA 4P59H 2QADB 5IB2A 3G5ZA 3VXSB 2WW8A 1I9EA 2PYEB 1PZUB 3X3GL 4Y5XC 5DS8A 4ZAKA 5IIEA 2YZ1A 3LEYH 3E2HB 3PXHA 1YEHH 1LD9B 1RMFL 1K2DA 2VABB 1LE9A 2CO6B 4W4OC 4YIQA 4NIKB 4PJIF 1NDGA 4GRLA 3NIFF 3RAJH 4UZGA 5KVDL 5JIHA 1S7QA 4V2BA 1T6WA 3DVFA 4CU6A 2FWOA 1MAMH 1N59A 5E5RB 3W9EB 3IF1B 1JNNH 5T5FH 2XWTB 4JQXA 1RK1B 1EGJH 4HX1A 1KN4H 1I7TA 2YUXA 5DMJB 4GG8B 3AY4A 2NY3B 1IAKA 2YEZB 4P4KC 3R1GL 1RZ8A 4ZSOA 1XZ0A 3S37X 5SV4A 3REVB 4AMKH 5HI5C 1NGYB 1F4YH 1QP1A 4FQ2H 1EBAA 3UPRA 4G7VL 4HF5L 3C8KB 1BHGA 4PJ7F 4PREB 4UUJB 5E8EA 2OR8A 1IGML 2ZPKH 3U2SA 2PTVA 2V5YA 1U3HC 1MRCL 2XACC 3BP6A 2D7NA 2OXGA 5F9OH 4KROC 4PYHA 3DV4A 3SOBL 3CX5J 4MXVF 4Y5XB 2F54B 3VGFA 1SMOA 2VSDA 2WUBL 2YPVH 1MFCH 1E4XI 3BDYL 2O93L 5J13C 3BE1H 1IQDB 5F89B 1K5NA 3CU1A 1EV2E 1BGXH 3D0VA 4OZFA 5MI0C 4YHNB 5JR1L 1I3RB 5IMKA 3MUGA 2A83B 2FSEB 1BFSA 3VGGA 4R96B 4JQVC 4OZIF 1AQDB 1SM3H 1WISA 5CJQL 2CK2A 3O8XA 4ZXBA 1ZHKB 1IFHL 4GAYB 1YPZE 5DRNA 2YS4A 3BMVA 2VQ1B 1SJHA 2VZ3A 5C0FB 2XPGB 3HFML 3ZKNC 2WWKO 4QT5B 4UQ2B 3OAUH 4NQEA 1P7QB 1SEBB 4P4KB 8FABA 4GAGL 1MFEL 1X5JA 2F15A 2R1XB 5M94B 5HYFA 4J12A 4HKZB 2FB4H 3MLVH 3GSRB 5JW3H 4BSVB 5KVFH 4M6AA 4XWGH 4YZFF 5D2NC 5I1GH 3QNYB 4XMLL 4AY0A 1MCOL 1W0WA 5CD5C 2ZNXA 2EDBA 1U3HB 3WNLA 4LMQI 3UJIH 5A40E 3BP5B 4JPKL 3M8OH 1TNNA 2CR3A 1J1PL 3U9PH 2C7UA 5LAXB 4MVBD 4LDOB 2DQEH 3QFDA 3AREC 1JGEB 1E6OH 3MFFA 1I7UA 2YMXH 1XR9B 2G60L 4Y19A 3VFWA 2L0DA 2EXWC 1I1FB 4BFEA 3ZDXE 3BRDA 3QEQB 1GGCH 4UTBH 4CGTA 4Z77B 1GC1H 3IFNL 1I1RA 3WFHB 1EFXA 4YXKL 3QG6B 5IROC 2BVOB 1TETH 3NCCB 3S36X 2W60B 2BNQA 1A0QH 4JPVH 2GUOA 5I15L 3FQWA 2WMPA 1A3RH 5H37G 3H9ZA 4V1DE 1J7VR 1KPVA 3PDGA 4LP5A 4M93C 2BNRA 2QSQA 2CUHA 4PJGB 3LEVL 2A74B 4M8QA 4V1DD 4F9PC 1UH4A 5BS0A 1UACL 3S3JA 1K9TA 5JPMA 4NC0B 1JYWA 4WU7B 4YHLH 4HKBA 4CRPA 4PRBA 5J4MA 4GXVH 5DJZB 3D0LA 2VDOL 4IMKC 2YD2A 2ZUXA 4G8EB 4PG9B 5HI3C 2XKUA 5JOFA 3DETD 2Q20A 5CZVH 1MWAH 4ZOCA 1MJ7H 3RZCD 3I6GB 2HP4A 2V5MA 4J3WA 3U46B 5IGXL 1BX2A 4U7SA 4M03A 3QUYA 2RCSH 4C57C 1T89A 1T0PB 3MA7A 2IQ9L 3H0TB 4BSWB 5DGQA 5D7KE 4OZHB 3DOSA 3HC4L 4Z7VB 2IADA 2W07A 4NM8H 5D7KD 2R56L 1BOGB 4HDIA 2IPUG 3AREB 1WVZA 5E8NB 5JW4N 2IALB 5IB4B 1F90H 5EBLA 3MCLL 2YXFA 4ZPVA 1T83C 3MRLB 1KENL 2R2CA 4I0KA 3ULUL 1JPFA 4WW2C 4EI6B 1MREH 5B39A 2IH1A 3CH1A 3MA9H 1KC5H 1AFVH 5KANI 1BVKB 2OR9L 3P11H 4CMMB 1OGAA 4P49A 1S7RB 1WWAX 3EHBC 4ZAKD 2D7QA 1OM3L 1QLRA 5EN2B 4AL8L 4M93B 4R0LA 3QPXH 4H1LB 3T3ME 4BUHA 2GEEA 4TNVK 3DMMA 3D9AL 3O2DL 3WNOA 2H9GB 4PJDA 3LKSB 2VR5A 3NTCL 4OGAD 4WWKC 3SDXA 3DIFB 4NNPL 2PKDA 3NPZB 5JA9A 3H7BA 1FHGA 3RWGA 2XZZA 2DLIA 4V2CB 1HQRA 1G7JB 5FK9A 1ETZB 3GSWA 4HS8H 4N68A 1YEIH 4ZSOE 2YPKB 1MFDL 4M5YH 2VLJA 4YGVB 1DUYB 4DUXA 3TPKA 2ICWB 5DJ8A 3ZSTA 4GLRH 5C86A 4TUOA 5EZLB 3DHMA 1X5YA 3OGOE 3H3PH 5MEQB 2NY4C 3MCKA 4ORGB 2WUCH 5ECJE 3LPFA 1BZ9B 1A4KB 1HINL 2ITCB 1AJ7H 1REIA 4BFGA 3T8XA 2X09A 1RK0B 4WW2B 3L3HB 3WIFA 4Y16C 1UYWL 2ARJQ 2X4TB 1IVLA 5IMOA 3KYNA 3DV6B 5FYKE 3CZJA 4L5FL 2EZ0C 2VXSL 1MWAA 3G6AB 5FYKD 1LEGB 5C6WH 4LQFL 3FKUS 1R3KB 3WN5C 4KY1L 3WV0A 3UZVB 4KRPC 1Q8MA 3TVMD 1IRAY 1FP5A 2R39A 3LKNA 1L9MA 4DZ8A 4QXGL 1AR2A 1QQDB 4RQQA 3HC3H 2VDQL 1KJVA 5L8JB 5I1AB 4WWKB 1U8HA 4TUKL 3KR3L 1K6QH 5TE4H 4ERSL 3S9DB 5I74B 3U0PB 3EJYC 5IK3B 4YXHL 1F3DJ 4PLOB 4QHLB 3O8XD 4EQ2A 3V5KB 4ZXBD 5GRJL 4E41A 4KI5C 2ADFH 3GSOB 3PGDA 5TDNA 4NQEE 4MCYA 4NKDB 3VJ6A 1I9IH 1IGIH 1EHNA 1H15A 1KXQE 5I8EA 3QHZL 4NQED 4HLJA 5EBWA 3BZ4A 5FB8B 2EIZA 3TYGH 2E9JA 4ZFOL 1KFAL 4HZAA 1IGTA 4X6CA 2UVFA 4HUMB 4JPIA 2BVQB 3OKEA 2NY4B 4ETQA 1HNFA 2QHRL 2Y5EA 4P5TB 3GEWB 4F7CB 5I1KH 1AXTL 4LAQL 4UB0H 3P0VL 1WFNA 3Q1SH 1GZPA 4XC3L 3JWDL 3W9DB 3HPJB 1QNZL 2FR4A 3O6MH 1UFUA 1MI5E 3L3IA 4H26A 4OF0A 4Y19E 4I48A 1MI5D 4NO0B 5FHBH 3C60C 1GZQA 3J7HA 3WN5B 1AGBB 1WC7B 4Y19D 4RCAA 2CJUH 2V6HA 4K3JH 1FZMA 4XCYA 3U7WH 4NZTL 3WXVH 2YD7A 4KRPB 4MQTB 1RJZA 1KLGA 4O02H 1ERNA 1UGNA 5KSBA 3TEUA 1NLDL 2BNQE 1EFXD 1M71B 2QSCL 4RGNE 2BNQD 4DKDC 1QR4A 4RGND 1ZHLA 2BNRE 3GMQB 3ZTJG 2CRMA 2VWEE 4HFUL 5E1AB 4QGTA 2BNRD 2Y6SD 5BS0E 2XQBH 1EJOL 3NACL 4MXQD 3D25B 2EE2A