1P7KA

Crystal structure of an anti-ssdna antigen-binding fragment (fab) bound to 4-(2-hydroxyethyl)piperazine-1-ethanesulfonic acid (hepes)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
214
structure length
214
Chain Sequence
ELQMTQSPASLSASVGETVTITCRASENIYSYLAWYQQKQGKSPQLLVYNAKTLAEGVPSRFSGSGSGTQFSLKINSLQPEDFGSYYCQHHYGTPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody light chain FAB
publication title Structure of an anti-DNA fab complexed with a non-DNA ligand provides insights into cross-reactivity and molecular mimicry.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 214
sequence length 214
chains with identical sequence L
ec nomenclature
pdb deposition date 2003-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p7kA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p7kA01
4DFHA 2FRGP 1ZVYA 3V5KB 4HWEH 3RA7H 3OL2A 3IJHA 1EXUB 5GGRB 1CLOL 1A6AB 3AS0A 5C9JB 1CLZH 1PLGH 1Q94B 1QVOB 3TNMB 2F53E 1FL3B 4P2RD 5I71C 4X5XB 5KJRL 1H0DB 1I4FB 3LKSB 1U91A 1MCRA 2NNAA 4KKLD 3P4OB 2H2SC 1KCUH 3UPRB 3UTQB 1NDMB 4TSCL 3GSNL 3KLAB 4HAFA 1MFNA 2C3HA 4F9PC 4HWNA 1ED3A 4JFEE 2CMRL 4PJBE 2BSRB 2DM2A 1G7QA 3FRUA 4YK4B 2BVOA 3QNYB 4M03A 5EUOE 5KSAA 3VWKD 4O58L 5SWZE 4EIZC 3RIFF 4XC1L 2XN9B 3O3EA 1QSEE 3ZKMC 5HGDB 1G6VK 1G6RH 1KCVH 3GK8L 3CDGB 1U8OA 3UJTH 4M93B 3IS0X 1AFVH 3AU1B 1RZJL 1NC2D 4YK4C 1JNLH 2R9HC 4LPXA 2HYMA 4JCMA 3VFTB 4XAWH 2Y06L 3GSNA 5MEOB 3V0WL 5ALBH 3F5WA 1WFUA 5TDNA 3BWAB 4M93C 3LQAH 5EOCH 4NCDA 1HHIA 3FB5A 3BI9X 3RWEA 4OGYL 4C56A 1RZ8B 1T2JA 3VFGH 1KNOB 4GKSB 4O00A 3QUKB 3C5SA 3FB6B 3PGDB 3A6BH 4XMLL 3ZMRA 2IF7A 4LLAA 2ZPKL 4FOMA 4MXVE 4KV5E 1XGPA 4L8CB 3B5TA 3O9WD 1ZXQA 3BSZH 3S4SG 1DLFH 4XI5C 5C0AA 1CS6A 3MLVL 4KY1L 1A6WL 5EO0B 5L7XL 1MCPH 1WBXB 5L6YH 2IPUK 3K7UA 4WFHE 2ZUVA 3IFNL 5KZCB 3MXWH 1CICB 2CLZB 3MRLB 3QNZA 5F8RC 5FOJA 3JV4B 4WI2A 4D0CB 1YN6B 2RBLA 4N9GA 4AIZB 5H2BA 3QEQE 5GGQL 1OAKL 5ID1B 1MWAB 2P24B 1RJYB 3JTTB 4WGVB 5GSVB 2FBOJ 2FIRT 3EGSB 1CICC 2GAZB 1QQDB 3BGMA 3W9EA 2DDQL 4PLNC 1QTYT 3T8XB 1Y0LB 3JWNC 4PRAB 2VXSH 2VLKB 4RMQA 1ND0B 3UP1A 5CKAA 4RAUB 2EDLA 5HHOB 1XH3B 5JR1H 5I16B 2YUVA 1DL7L 4PBXA 5D2LF 2BNUB 4M1DL 1NCNA 1QLRA 2CO7B 3UZQA 4FZEL 3V79C 1V7NL 3LH2H 1S7QA 4L4VB 4PIRF 3C8HA 3TBYB 3JV5A 1UWXK 3MV7D 5LGHH 3TA3B 3DV6B 1VA9A 5D2LB 5EBMB 3TH4T 3JTSA 3I9GL 3RVVD 4HKZB 5HYJD 5AWNH 4AM0B 5FO8B 4PG2A 2ADIA 3EO0B 1X5JA 4DKFH 2DYPD 4FFZH 5I76B 1Y6MR 3G5VB 4J3SA 3QDMA 1EJ6A 1R0AL 3CSGA 4C83A 4XBGB 4RFNB 1X44A 1KTLA 3TA3C 1SJVA 3QQ3B 4GQPH 3MODL 4EDXA 3QXAA 4IOFC 1U2HA 3V6ZA 3UPAA 4RFNC 4WW1A 5C7XH 1CDUA 2B4CH 5J6HA 2WWKO 1U93B 5KAQG 1FAKT 3FQNA 2YOCA 1B0WA 5IHZB 3O6KL 5KBNC 3GMNB 4P3DB 1JGEB 1DFBH 5HI4D 4Z9KB 2YPVL 5D72H 4NQEB 2N1KA 4LLDB 3ZYJA 2DQIH 4HC1H 4ENED 4EVNA 5C08E 3W0WE 1MUJA 2IBGA 1L6XA 2O5ZL 4TVPH 1FYTB 1OP5H 3E0GA 4ODSL 1CGWA 1QR1B 3BP5A 2NX5B 2O5YL 2QKIB 3INUH 4P9MH 5KSBF 3C8KA 4P5KB 4EQ3A 4W4OA 3U0WH 3ZKSD 4XCEB 1F13A 3BIKA 5J3HC 1DUYB 1YQVH 2BP3A 1NC2A 2FYYA 2VDKL 5KSBB 2FD6L 1LK2B 2GIYA 1MSPA 5B22A 4CW1A 3SE4C 4WI8A 3OX8A 2M1KA 4K9EC 5C0DB 2VDNL 4ELMB 2VL5A 1RZ7L 2J4WL 3CXDL 5DS8A 1A8JH 3O3AB 4LVEA 1X5YA 4L8DA 5IVXE 4TTGA 1VACB 4HG4K 4WW2A 1NEZB 2BVPB 4JM2D 2IWGA 4XPFH 4UDUB 1N59B 1R3LB 3ZDXE 1FGNH 1IEAB 3VXUA 1TJIL 5F9WB 3IAQA 3WIHL 3GMLB 3MUGB 1F45A 5IHUH 3C6LB 4JDZA 1MJJA 2MFNA 4PJHE 3QUXB 1WJ3A 2D7OA 3DX9B 4LIQE 4DW2L 3W82A 1S8DB 1LP9F 3DYPA 4OF6A 3LIZL 4DWHA 3I50H 1IKNA 1U8JA 5F9WC 3ARSA 2Y5EA 3EYFA 4ALAL 3EW3B 1B4JH 2VZVA 4JFYB 2HTLC 2OSLA 4OCYL 3V5DB 3C6LC 1QLEH 2W0FA 1A2YA 3IDNA 3QUXC 1KJ2B 4G6JH 1LP9B 1MCQA 3MJGX 4WCYL 1ES0A 1QRNE 4HUWA 4JY5L 2Q86A 1R3HA 4U1IA 4XP4H 1OAXL 5D70H 1WAAA 3WIHA 2ESVB 1T22B 2AEIT 3EOAA 2EIZB 5ABDE 3MZGB 4MQXD 3LKPA 3S35X 3ILQD 3L3JB 5ACMA 3I6GB 4UBDC 3EBAA 3D25B 5CBAA 4HWUA 2BSED 1YNTB 3TT3H 1W2KT 1CU4H 3T4AA 4MD4A 4ODUB 1FL6A 4NC0B 1IT9L 2EKSA 3REWA 4CGTA 2BX5A 5SV3A 1RSFA 2BHYA 4KUZH 5CCKH 5FFLA 3N50A 5DSCB 3HZMB 4Z0BH 1CFNA 1BGXH 1VESA 1DQTA 4NKIL 4MB3A 4BM7A 1AGCB 1TZGL 1FG2B 1XF2A 5DO2D 5EO1B 5FGCB 1UZ6E 4OCMC 2HRPL 4PGZA 2DQJH 2UWEE 3PP4L 2DQFA 4BZYA 5F9JB 4WWID 1PFCA 2JB6B 4RWHA 1YYML 2A83B 3DV4A 3OQ3B 2AXHA 2R8SH 1IC5L 4TN9A 1DQML 3GM8A 4TTDC 1KGCD 2AJUH 1P2CB 2GHWB 5EZIH 5GIRB 3VXRB 2F58L 5I1CL 2DLEA 2FR4B 1RUML 5IB3B 2YBRA 3IXTA 2VN4A 2OR9H 1IM3A 3S35L 4FNLL 5CUSL 5ESAB 1NPUA 1TZHA 1RI8A 5M94B 4ZFFA 2YR3A 5SWSE 5D1QA 3C2AL 3DGCR 1NDGA 1B0RA 3T2PA 4X9HA 1A6ZA 4OFIA 4NQCB 4KK9D 2HH0H 2ICWA 5GRVL 1YEGH 3QDGD 3QQ9D 1L7TH 4I48B 5DLML 1FLRL 5GHWL 5ALCH 2JIXA 2BNQB 3PWJB 1MREH 4I8DA 2FSEA 4JFFB 1BZQK 1N4XL 4P49A 2NW3A 4NKDB 2QR0A 5E00A 4PGCB 1NANH 2VITB 3IKCB 2FECL 4KKBC 1H3PL 1KC5H 5JUEH 1FIEA 3T08A 2F8XC 1A7OH 3P9LB 5E5MA 1D9KB 1P7QA 3LQZB 4MD0A 4XB7A 3MLTB 4PRIE 1FJ1A 4L9LA 5DJ0B 1FZJB 4Z7OF 5IMMB 2A74B 4FQJL 1I9JH 4DVBB 3GFUA 3TO4B 1MCBA 4PGJA 5C0BA 4PS4L 4U7MA 4BUGA 4QOKB 1D5XA 3D0LB 3MCG1 1QSZA 2VAAB 1PGRB 4DTGH 5I2IA 5EU6E 1D9KC 3RKDC 2R56H 4EI6A 4R0LA 4YDIH 4OBRA 4MCYB 4XPTL 5D7LD 1IBGL 4NIKB 2AK4E 4I3SH 1H8OA 3GSVB 1OT2A 3TO4C 3WXVL 4Y4KD 1MFDH 4J6RL 1IAKA 2I9TA 1FLTX 5K9OA 2W38A 1B88A 4BSJA 1M7IA 4FQ2L 2Q1EA 2DLHA 4YDKL 1BIIA 4MJIA 1QHOA 2FIKA 4TUJB 3F7PC 4S11A 2BC4B 4HV8B 4WUUE 4NWUL 1AC0A 1AR1D 5HVFB 4HS8H 5D6DA 5DD3L 1NMBL 5D2NE 1A9EA 4XC3H 1MJ7L 4YNYB 4P2QE 2D7QA 5MEPB 3C6SA 2BSTA 1AXTH 3LN5A 3C9NB 1DZBA 4QGTA 1T0NA 5CEZD 4YPGB 4PFEA 1UC6A 2J8UA 1DLHA 3FMGH 5B38B 2EIDA 5CJ8A 4QHMB 1JPFB 3MXVH 2IEPA 3L3KB 5IW6B 2VZUA 1XF5B 4FXGB 3DI2B 1HH9A 4NUGL 5C2BL 1A1MA 5KW9L 1KCSH 5DJAB 4E5XB 3CX5J 3QWRA 4J3TA 3KPRA 4N8VG 2ZUWA 1FZMB 6FABH 3K4DA 1I7TA 2NY2D 3LPGA 3QULA 3AC0A 5D6CB 1CD8A 1KPRB 3PDDA 1J86A 3WFCL 3V5KA 2GFBB 2HTKC 1FL5B 2C4XA 5GGRA 4NKQB 4OI9A 1A6AA 3RUGE 4F9PA 1TJHH 5CILH 1QVOA 3TNMA 1D5ZB 2ADFH 4M7KH 1P84K 3DX8B 4H1LA 2YD9A 2R0KL 1FV1B 1OGAE 5CZXD 1JNHB 1I4FA 2VLJB 2BZDA 2MMXA 1NLDL 1EO8H 1NDMA 2ZCHL 3O6FD 4LRIC 1LK3L 2J6EL 2DM7A 2B2XL 2W60A 4FQLL 3OKNA 2BSRA 4LKXA 1XCQB 3CPLB 3QNYA 1KN2L 4M6AA 4LEXH 2Z8RA 2ICWJ 4ONGH 4XP5H 3I6KA 5TGBA 3DRQA 4Z7QE 5D93B 3H8NA 4POZC 1U8LB 4LPVA 2B8OT 3WLBA 3E1F1 4LOUC 4WEMB 3NACL 1ZLUK 3AU1A 3O11B 2AERT 5HI3C 5TFSL 3C5ZD 3KNBB 2OLDA 4E41D 3BZEB 2LAAA 3MLXL 1QSFE 3QIWD 4XCFH 3DROA 4X98B 2DN7A 2XY2A 5DJCA 3VFTA 1KXVC 2OTUB 4AMKH 1S3KH 1FFOA 2X89A 5D93C 5MEOA 4KQ4L 2J6EA 1KYOJ 5FUCC 3QDGA 4F7TB 4P2YA 5CKGA 5DD5L 3EUUA 5DK2B 5CD5C 5EC1B 2PR4H 1DQLL 3U7YH 2MKLC 2F5AL 1F90L 2UVFA 1RZ8A 1DCLA 5GGTH 5DEFB 4PRBB 4R4NC 1KNOA 1J8HD 5HYFA 2VDML 1D5BA 3FFDB 3PGDA 5HHME 1KENH 3ARFB 1QHPA 2CQVA 3MV8D 2LU4A 2HKFL 2FHCA 5I8CB 1AGFB 4PV9A 3VE0B 1FORH 1IAIH 1YEHH 2NXZD 4LASH 1HSBA 5JQ6L 5HYSB 4JFQB 3M45A 5EO0A 5C0RH 3CXHJ 1WBXA 2PN5A 2NY5C 3ARFC 4S1RL 1CICA 3Q1SH 3MRLA 3JV4A 2WLYA 1YN6A 3EYVB 1AQKL 3UYOD 2OL3L 4JHWH 2DWEB 4YHNB 3V4VH 3BEWA 3GEWB 3UJJL 5ID1A 4Q9CA 1RJYA 3BEVB 3JTTA 5EOTA 4Q9RH 1OPGL 1WFOA 3NVQA 3QUMH 3GJFH 5CEZL 4OM1L 5DC0A 2IGFL 2GTZA 3H9HA 2PYED 2BFVL 3OPZL 1MI5B 3D3VB 1R5VB 3RWCB 3TBVA 2R29H 3T8XA 1W72B 2DQDH 4PRAA 2VLKA 4OZIF 5JDSB 2IAMB 4RAUA 4FTVA 5HHOA 3UAJD 4M3JA 5I16A 1JTTA 4JFZL 1HH6B 3PQYB 5DC4B 35C8L 5F7UA 5JA8B 1HYSC 5JIIA 4IRSD 3GI8L 4P3CL 2OL3A 5J4MA 4LSSL 3RIAK 4FP8L 3O8XB 4IS6B 4R8WL 1Q9LA 3PNWB 2A77H 4L4VA 1KTKE 4WTWA 4OZIB 3GRWL 3TBYA 3OZ9H 2AW2A 4N0CD 2IAMC 3TA3A 5D2LA 1K4CA 5F1NA 3RVXC 3BD3A 4LAQL 1MCJA 4HKZA 5DFTA 4I3RH 2AJXH 3FZUD 4AM0A 5FO8A 3DX7B 3QJHA 1MAKA 3GMRA 3VFSB 4OFVA 2W59A 2NCMA 3BJ91 3NPSB 3O8XC 1G7LB 4DAGH 4OFYD 3MZTA 4WWKD 4XXCA 3DBXB 3SDDB 4NO3B 1HHKA 5HPMA 4YHLL 5F71A 5FYJU 2BNRD 2EDOA 3QQ3A 4TSBH 1WEJH 1PW3A 4HXBH 4PBWD 3ZTNH 4CVZA 2X6MA 4HJJH 4C54A 1BZ9A 4KZEL 3NPSC 5LKNA 1T20B 3TYFA 4OB5H 4IHOA 3SDDC 5D7KE 5ACLA 2PXYB 4NQSB 1CBVL 1N64L 1OHQA 1U93A 1NSNH 3UCRA 4P2RB 4HPOL 3QEHB 3L9RB 4MNQB 5EU5B 1DEEB 4JG0H 2R4RH 2DMCA 3SKNA 3GMNA 3U1SH 1JGEA 1ADQA 2APXA 4U0QB 4NQEA 4UUJB 4Q6YA 2PXYC 1ZEAL 4LLDA 1I1RA 4ZNEA 5F1IA 5FF6A 1KJ3H 4WTXA 3BKYL 2DF3A 2X9WA 3QHFL 2ED7A 1FYTA 1WIPA 3VWJB 1NBVH 4L29B 5KTEL 1QR1A 3EYSL 4PJFF 5DZNA 2NX5A 2DQUH 3WNMA 1C16B 1BJ8A 2GSIB 2ITCB 3DSNA 4DEPC 3KHQA 3PDGA 3KLSA 3QFJD 1IZKA 3L7EB 5ICYB 4XVSH 1DUYA 4KJYB 3C5ZA 2Y5TB 4MXQC 4PJFB 3VWJC 3WKMH 3VRJA 1I9RH 3MYJB 5GPRA 3OAYH 1RV6X 4U1GB 3HI1A 5C3TA 1CIUA 4LSPL 2J7LA 4K8RC 5C0DA 4ELMA 4YIQB 4QTHA 3EO9H 3O3AA 3A6CH 3PXHA 2D7TL 4TNVK 1JZ6A 1CF8H 3GMPA 4XPAH 3L5WB 1P4BH 1NEZA 2BVPA 4YBQD 3OAUH 4UDUA 1N59A 1ZLSH 4YXKH 4U1GC 2JCCF 3ARED 3GMLA 4NNPL 1FDLH 2Y7QB 4DKEL 4ZS7H 4HPYH 4TVPE 1FNSH 1S9VB 2AJZB 1MEXH 4LLQB 4UZGA 3NIDF 4H8WL 1G1CA 3QUXA 3O9WB 4HK3J 3QI9D 1BOGB 2WINB 2FATL 2JCCB 3X12B 2FJGA 2WIIA 5C0IB 2IAND 3RTQB 3D87B 4G3YH 3REVB 4MVBC 5DURD 3V5DA 4JRWA 4PJ7F 1KJ2A 3O9WC 4R9HA 5BMFL 1QPXA 1GIGL 2ORBH 4PP2B 3NCMA 5ITFB 3UROR 4YHZL 4BH7B 3IXAA 4GMSH 3AM8C 1HCVA 4F8TA 3RTQC 4ISVB 3S5LB 4HF5L 4PJ7B 5FO7B 4ZO7A 1IGTB 4M5YH 1TENA 5E2VH 3L3JA 2X4QB 2V17L 1CGSH 3I6GA 5FA4B 3MLYH 1MCDA 1OB1B 4PRDB 5J56B 3UTTD 2R1YB 1ORSB 3KPNB 4ODUA 5B39B 4NC1C 3MFFA 3CMOH 3B9KD 4BQ8A 1J1OH 5DHYB 3GHEL 1S78C 1KG0A 5D1ZA 4HS3B 4IRSA 4PJAF 3WNLA 5BV7B 3HZMA 1HILB 4Q9QH 4OF0A 5DEGB 4AG4L 3GJEB 2D31B 2EKJA 1MCKA 4YFEA 1E6JL 1IM9D 3D85D 4QRPD 1B2WL 4FZ8H 4XMPH 3O2WH 2DYPB 4PJAB 3O3BB 4OKDA 4JO2H 3HB3D 4XNXH 5D71L 5BV7C 1HQRA 1EO7A 3PIQB 2LFGA 3ZHLA 3MA9L 5F9JA 3RWFA 4QNPE 2EEAA 4ZYKB 4IDJL 1AH1A 3RVVC 3UX9B 4O5LL 1JFQH 3DSFH 2R0WL 5GIRA 5GJSL 2FR4A 3GBLA 3GZKA 5IB3A 4KJPD 5JOFA 5CSZB 5ESAA 4YEFA 1T03L 5C86A 1OGTB 5IF0B 4LF3A 4ZTOH 2EC8A 3FO9B 1FCCA 2E9BA 1E28B 2GITB 2X4TA 3NAAL 2X10A 2XFXA 5HYEA 4XT1C 2A1WL 5DRXA 5IESL 4KRPD 1XIWA 3EDEA 4I48A 1I3VA 2YUWA 4MS8C 4RFOH 1KFAH 3V4UL 3PWJA 4DGYL 4JFFA 1WF5A 2YD3A 4WGWB 3EJZD 5C6PB 2R39A 3H3PL 3OJDA 4FQCH 1YPZE 3MJ9H 4H26B 4GW1B 3QWQB 4GUPB 3QQ4B 2FX9H 3GNML 2QQQA 2VITA 3VRIA 4L8SB 4XCNB 4HH9B 3THMH 5ISZB 3VH8B 3L6FA 5ITBL 4OF3A 4U31A 4GKNA 4MHHI 4NJAH 2HMID 5SX4H 2AEQH 2WWMC 2AS5M 3I2CH 3QFJA 3P9LA 3LQZA 3U4BL 5CINL 5DJ0A 1DR9A 4BKLB 1N0LA 2A74A 3TJHD 1H5BB 3CSPA 4L8BB 3QCTL 4JM2F 3C8DA 4L8SC 1IGCH 4ZS6C 4PPTA 3STBA 4CADA 4OT1L 4AIXA 3D0LA 1AO7D 3VRLE 5HHXH 1K9TA 2F54B 2YN3A 2WAHA 3QT2A 2NZ9C 5LGKA 2NPLX 5FCUH 3BAEH 3RRQA 1AC6A 1WWCA 2DQHL 1RZKL 5BRZA 3SE8L 1H5BC 5HHQB 5DMKB 1M71B 5I17B 5I1AA 2VSDA 1CL7I 1U3ZA 3GSUB 4EXKA 5BVPH 1EJOH 4PJXB 4MXWL 3JSSA 2HFFB 3S34H 1JWUB 1MLCB 1FBIL 2ILLA 4M9OA 2RJMA 4U6HB 2WZPD 3RL2B 3QI9A 1RZIB 4YJZL 1JK8B 1JZ5A 4TUJA 3IDIB 2BC4A 3QIBB 4Y4FA 4HV8A 2VXQL 5C0EB 4LSUH 1F8TH 4LLMB 4LCYB 3RDTB 1DN0B 4P9HC 1T1ZB 4RMTA 5DDHB 2FZ3B 4HUUB 3FO0H 2DL9A 3LEVH 5B38A 5TE7L 1JPFA 3D0VB 3TJEH 3L3KA 3QIBC 2XWBB 3MLZL 4JM4H 4RGOL 4XMKH 1XF5A 3HTLX 1SMOA 4FXGA 4LSQH 4YWGH 3ILPB 1JV5B 3RPIA 3ZL4L 3RDTC 2ATPB 3DVGB 1EMTH 2DLFH 4FQQB 5BJTA 5GGVY 5B3JE 2V9QA 4JDVB 4E5XA 3VFRB 5HDQH 3VXME 1NAMB 4PJ5D 1FZMA 3G6JF 3RNQB 3ZTJH 5IJKC 3JBG7 4X4XB 4LSTL 4YZFF 3B9KA 3CFEB 4M1CD 2GFBA 4ODHL 4PTUB 1IC4L 2BVTA 5E2JA 2QSTA 5EBWB 1MLBA 4JN1L 3V7MA 2A0LD 1T83C 3MRFB 3IDXH 4JDTH 3KPQA 4RGNB 4P99A 3PHQA 3G6JB 2C4FT 4NQXA 4ZO8A 3D85A 2X5PA 3WEXB 5E8NB 5E8PB 1F4WH 2R1XA 2RGSA 2VLJA 3LV3B 4K7FB 5DJYB 1A6UL 5HPOA 4FQIL 4G9DB 1Q0XL 1YY8B 4RGNC 4GAFB 1YECH 3ZTJG 1C8PA 4KUCF 2IG2H 4ZUSA 3CCHB 3BN9D 3RZCB 4YDJB 3V5HA 1A7RL 1BMGA 2VQ1A 2VDOL 4KK8C 4OLWH 4TRPH 1JTOA 3P73A 4OLUL 2C1OA 1YEDB 3KNBA 4LRNL 3BZEA 4LPTA 3NA9L 4JY6A 5FKAB 1OM3H 1N8ZB 4X98A 4OLYL 1ZWIB 2EE3A 3RZCC 4JZJB 5LCVH 1CVSC 3MRDB 2H1PH 4ACPA 4QRUB 3CSYA 2WK2A 4ONFL 5IW1B 4F7TA 4PJEA 4GG6A 4HJ0D 1KLFA 1BF2A 2XQBL 5JW4R 1QBAA 5EC1A 4M7ZB 1YEFH 4V1DE 4LNRA 3F58L 1U8KB 4UV4H 5LBSH 3MRIB 1MPAH 4PRBA 5J1TC 4RAVB 5EIVA 3KYKH 4JZJC 4HFUH 3FFDA 4ZTPL 4P2OB 2OMNA 3ARFA 2ZCLL 4LVOB 1IZJA 3NCYP 4PJCE 1LHZA 1S9XA 4PRHE 5I8CA 4M7ZC 1RQ5A 4KDTA 4JKKA 3ULVH 3VFWB 4NO0D 4XWGL 5HYSA 4JFQA 3NFNA 3DMMB 4UNVA 4P2OC 5J1AB 5TDOA 3O0RL 4LVOC 3SE3C 3TZVD 4WDIB 3CH1B 4UT6H 5DK0B 4XNYH 1KEGL 3EYVA 4JFDE 3LB6C 4KVCH 4MJ5A 4YHNA 1E27A 4QTIL 2BY2A 3DMMC 5KVEL 5D7LB 2CLRB 1JF6A 2XPGB 5E8DL 4YHKH 5M7QA 1LWRA 2F53D 4Y4KB 3WNPA 5JORB 3S6CA 3U83A 3SDCB 3OKEB 1N0XH 4N0UB 4WUKH 5EDXA 1MI5A 4Z7VF 4Y88A 4P4KB 4Z7WE 2GJ6B 1OSPH 1U3HA 1R5VA 3WS6A 3TVMD 1W72A 2IAMA 1OWRM 2FB4H 3JUYA 1ZTXL 4NZTH 2KQMA 4JFED 3BFOA 3KYOB 4Y4KC 3OKKA 3IETA 4EIGB 4Z7VB 3SDCC 1YEEH 5LWYH 4V2CB 1CDYA 5HGAB 4P4KC 3O8XA 1ZAGA 3U0PB 4IS6A 3RJQB 4H5SA 3V0VB 5T33L 3IDUA 4I9WE 3U7WL 3PGCA 4JRYB 3CVIL 4JGJA 2ZOLA 1UM6L 1O5DT 2LAGB 2XIDA 3WJJC 1U95B 2OTPA 1EPFA 4KI5D 1AP2A 1HI6A 1JPGB 3HUJE 3NCJL 3BJLA 1U58B 1E4XH 4L3EB 3VXPB 1KIUA 4CNIA 3CD4A 1E4WH 8FABB 4PJ8B 3L3GB 2Q6WB 1G7LA 4LL9A 1NGQH 3CFDB 5C6WH 2WUBH 2YPLB 4JJHA 5IMOB 4ERSH 3EYQC 4NFBA 4RGMB 4Y89A 5C09E 1XAUA 2GJZB 1NQBA 2I5YH 2L4OA 4NYLB 3OB0K 4M02A 3GJFK 3GIZH 1SBSL 2C26A 1X7QA 4PJ8C 2G75A 5BO1H 5DJZA 1T20A 2F8VA 2PXYA 3DTXB 4NQSA 1CE1L 2RHEA 2Y9RT 1IEBB 3SGKA 4JRXE 5DQJB 4RGMC 3BH9B 3MO1A 4QF1B 5SWQB 4PJGB 3P4NB 2V2TB 4Q2ZB 1FSKB 3L9RA 4MNQA 5EU5A 2DB8A 3QWOA 1G0YR 5D7IE 1HINL 4GRLB 5FO9A 3D6GA 4UUJA 4UOW0 4WFHD 1XCTB 4MQTB 1RZFL 4OJFL 2JTDA 5CHNA 1GGCL 2QBWA 3FTGA 1G9NL 3P30H 5K9QI 1Y18B 1NUGA 1CLYL 5GS0D 1FSKC 3VWJA 3JWDL 4HS6A 3T4YB 4GRLC 3S88H 5CJXA 1BQLH 1C16A 5AG8A 2FO4B 4HIXH 2WBKA 1UQSB 1NC4D 3BE1L 4LLVA 4E41B 3FKUS 3MACH 1P4IL 3OF6A 2Y5TA 3IS1X 4X7DC 1TPXB 3WIFB 3B2UC 3MYJA 5FUOH 1GAFL 5I1JL 4H1LG 3F6IA 2HVJB 2E8ZA 2FLRT 3NFPB 1ONQB 3QUZA 1MCNA 3TCLA 3RP1A 3MRHB 4YIQA 2EH7H 2HJFB 3UTPE 4JO4L 3RVWD 4PB9H 5HHVL 1TPXC 4D0BB 3L5WA 5I1IL 3ORJA 1CDBA 5FHBL 1RK1A 4NZUH 3DURB 2NLJB 4WHTB 2OP4H 4JKWA 4LQFL 1QA9B 5I18L 1VGEH 2OTWA 1S9VA 2AJZA 4LLQA 1A5FL 4X4MA 3JVGA 3MJ6A 4JKPH 3QISA 1WBYB 2WINA 1K4DB 1S7RB 2APTA 3X12A 3MREB 5SX5K 3FT4A 2Y36H 1IQDB 3RTQA 3VG0L 1MRDL 4NN7B 3AMKA 3U9PL 3HNSL 1ZHBA 4WEBH 1MAJA 4F7PA 4ZMAT 4GAJH 4MA7L 3S36X 4KFZC 1YYLH 2P8MB 4NQDB 4YO0B 1KOAA 4BH7A 2AGJL 1RUPH 3S5LA 4NN7C 4PJ7A 3MRJB 1M7DB 3V4PH 3GKWL 2F53A 1MWAH 2IC2A 5E6ID 32C2B 1DEDA 2X4QA 5FA4A 5GRYA 4HUVA 4FHBD 4PRDA 5DUMH 3N85H 4HIEB 2R1YA 3BH8A 1ORSA 4G8IB 5MERB 2VYRE 4O2FB 5FGBA 3B3IA 3KPNA 3V6OC 1W0YT 1A7PL 4HWBA 3ZE0F 4Z8FL 5C08D 3VMNA 3H42H 4PJBA 3P2TA 1BD2E 1I8IB 5EUOA 4EN3D 4S1SL 5SWZA 2QJDA 5DEGA 2D31A 4TSAH 1KBGL 1QSEA 5HSFA 4TUKH 1CXHA 1CN4A 2VSCA 3OBAA 3D2UB 1Q9KB 4ZOEA 2Y1VA 3VFUB 4PJAA 2QEJA 2HJKA 3R1GL 2VC2L 5L2KB 3BPOB 3SOBL 2VABA 1I1CA 4N0CC 4QKXB 3UBXI 4ZYKA 1NANI 5CJQH 4P5MB 5IBUB 3HKFA 1JHKH 2Q8BH 2W91A 4DUVA 5FOBA 3IGAB 1MCLA 5DZOA 2I60L 4HQQH 1ZLVK 1LO4L 2YK1L 5E2WL 5GS0L 3G5XA 5HD8C 5DUBB 3BPOC 1OGTA 1IL1B 5IF0A 3FO9A 1E28A 2EO1A 1VKXB 4XP9H 5T1DH 3P0VL 1UB5B 3MRBB 1WBZA 3LKOA 4K2UL 4HEME 1FIGH 3HZKB 1PG7W 3K46A 3S96A 4OCXH 4BZ2H 3E6HB 2EDQA 5I15L 5EULV 2CK0H 3GB7B 4D9QD 1T1YA 2P7TA 1BLNB 3ARYA 3O2VL 1AGEA 3ULUD 1ADQH 2SEBB 3MROB 1BVLB 4YQXL 4H26A 4GUPA 5EZOH 1I8KA 3QQ4A 5IVNA 4UILL 5D5ME 1X5GA 1G9MC 3QEQA 1OCWL 3Q5YA 3QQNA 4HH9A 4L8SA 4XCNA 5ISZA 3VH8A 3C60B 1KLUB 5DR5L 1JPTH 4AENB 4GJTB 1MNUH 3CDYA 4LPWA 3RIAF 1JZ3A 1DQJA 2I26N 2B0SL 1HXMA 2AXJA 2GEEA 4K9EH 3GSWB 1CD1B 2PW2B 3RGVD 1GC1C 3DXAB 4R2GD 1H5BA 4X7FC 3C60C 3JWOL 3LQAC 3IRZA 4JEGB 1MF2L 3ARBD 5DC9B 2F54A 5AUMB 2PTTB 1SYSB 2GY5A 1T66C 3NIGF 2IPKB 5HDBE 1M71A 3M07A 5LXGL 4DGIH 4N0YH 5FKPB 2ADGB 7FABL 1HIMH 3MRKB 2E6PA 4PJXA 1OTUD 3DYOA 2EYSB 1ZA6B 3HG1E 3SKOB 4QXUL 2EEBA 2HFFA 1JWUA 2DM4A 4PGEB 4U6HA 5DD1L 5BOZG 4X5LA 1T04B 4PJDF 1AD0B 1CDCA 1RZIA 4YBQC 1JK8A 5AZ2L 1K6QH 4OF5A 3IDIA 2BMKA 3QIBA 4OIBA 4OLVL 1T4KB 5C0EA 5I66A 3QPXL 3VI3F 5DMGC 4EI5B 2E7LA 4LLMA 3CLFH 4QRRB 3RDTA 1T1ZA 4P23D 2YRZA 5EZLB 2X05A 4PJDB 5KG9A 1F58L 2DWDB 4HUUA 4F3FB 5MP6H 1GCFA 3ZE2F 1R5IB 3KAAA 3MR9A 1G7MA 1H3TA 5IOPB 3TM6A 2XWBA 3QDJA 3ZHKA 1BZ7B 1NEZG 1KJ2H 1RULH 4EI5C 4O2EB 4Y1AB 5SWSD 3TWCL 4MB5A 2ATPA 2R69H 3BO8B 1JMXA 3DIFB 2CR6A 4JDVA 5IFHL 3VFRA 4K7PY 2IBZY 3DUSB 4NDMA 2PYFB 2CIKA 2ARWA 2ED9A 1U41A 2W0KA 4X80L 5DD0H 2IH1A 4N1EA 3RNQA 5KSUA 4UOJA 3VXUE 2P5EE 1I8LC 3LHPH 3CFEA 1UFUA 3Q6FB 5DMYA 5C08A 2Y07L 5EBWA 3W0WA 3ZYOA 3ESVF 1PX4A 3MRFA 4NNXA 4QYOA 5C0CB 4XP6H 1KT2A 3G6JA 3D9AH 3FQRB 4OGZA 3MRCB 1IM9B 4TNVF 4QRPB 3PDOB 1NBZB 3WEXA 4Q0XL 5C07B 1AJ7L 2E6QA 3WE6A 4I77H 4PRID 3PWPE 1NCDL 4LIQL 5DJYA 2VWEC 4G9DA 3WFBH 3EFFB 1MFEL 1EHXA 4X4ZA 4QRSB 2ZKHH 3PHOB 4HXAH 1L9NA 4Q9BA 5I0ZA 5CEYA 4Y19D 4ZXBA 3OKDB 1AY1H 1QG3A 3G6DL 4AH2B 1DE4B 1U8PB 5GXBB 3CCHA 1WAAE 3SDAB 1NFDB 3VXSD 1E0OB 3FO2B 3TP4A 5JXAH 3RZCA 1MRCL 5EU6D 4LVNB 1IAII 1LNUB 4AEEA 4DUWA 2AK4D 4NM8L 1FNEB 2FX8L 1YEDA 5HBBA 4OV5B 3WCYA 1E6OH 1A14L 1E4JA 3V8CA 5FKAA 1N8ZA 5E2TH 3SDAC 5AZEH 1Z9SA 4MB4A 1ACYL 4F58H 4KRPB 4LVNC 4PJHA 4X9BA 5EU7C 5IK3B 3N1QC 2E5EA 4WUUD 2Z91A 1CZ8L 3EOTL 4RZCB 2Z4QB 4JVUA 1UACH 1R3KB 1U8KA 1S7TB 3P0YL 2DQEH 4S0TD 4BZ1L 3AB0B 1QBLH 2ICCA 4DOHB 3ET9F 4KRPC 4BUHA 4LCCA 5A2IH 1QRNA 1OAZL 1YY9C 4P2OA 3TC9A 1A22B 3TBSB 1SHMA 4AL8L 3SDXE 5DJ8B 1TTGA 4XRCB 1RVFL 4OUUA 2R4SH 3VGFA 4G6ML 3X3FH 5C0NC 5J9PB 1RFDL 1OY3B 3CUPA 4WFEE 3AB0C 4IRJD 1JWSB 5I1GL 1ZGLA 1G1YA 3DMMA 4ETYA 1XMWA 2WP3O 5J1AA 4EUPB 2XZAL 1YJDH 2UUDH 4WDIA 3GGWB 2B1HH 1OAYL 5DK0A 4PLOB 2HMIC 4O51A 1AO7B 3Q48A 1GGIL 5ANMB 4LLWB 3ARBA 4ZDHA 1PY4A 4I1NB 3H9SE 3QNXA 1S7XA 5JHDB 5JNYB 2XPGA 4PG9B 1YQ2A 3TV3H 5TE4L 4K71B 4M6OL 3RU8L 3HZYA 2XZQL 4JKMA 5JORA 1BEYH 3SDCA 1MCWM 3GSQB 3UC0H 2J5LB 4MA8H 3T2OA 3ZDYF 1ZA3B 2GJ6A 1FP5A 1HKLH 5KSVB 3QH3A 1KXQE 2JJSA 5D7SH 2P5WE 4OQTA 4K71C 2RCSH 5FM8A 3RWGB 3ULVE 4JGMA 2J5LC 5HGAA 2NY0D 3U0PA 2KZWA 4MLIA 4P23A 3VGBA 4JRYA 3M8OH 4LPUA 1K8IB 3SY0B 3KPMB 4G6AC 1U95A 4YAQA 1MH5B 1JPGA 4JPIB 3X13B 4KVNL 3HHRB 5C2UB 3S3PA 1QSFD 4L3EA 1HKFA 2GTWA 1ZANL 1SJEB 5EBGA 4MLSA 3U0TB 4UIMA 5C0BE 3AAZB 8FABA 4PJ8A 4R7DA 5E2UL 3ZO0A 1IEHA 4BQBA 5E99H 1YMHB 4WFFE 4LDLB 1IGFH 2GCYB 2QHLA 2BJMH 5JW4M 4J3VA 4XCCH 4NYLA 4Z7UF 4YR6A 3GUTA 5DVLA 2OJEA 3RWIB 3HMWL 1FPTL 4L9DA 4ODVH 3RY5A 3WHE1 4WI9A 4NRXA 1R3IH 5HHMD 4YGAB 3NH7H 3DTXA 3V6FA 2F9BT 1IEBA 1KB5L 3QHZL 5DQJA 1LO2L 5E9DB 2DL2A 1G7PB 1BWWA 4MJIE 5DYOB 4ZFOB 4DKAA 3BH9A 4Z7UB 4ZUVA 4UB0H 4PJGA 3LMJL 3P4NA 5B38G 2V2TA 3VW3H 3D18A 4Q2ZA 4M1CC 1I3UA 2CRZA 5I1LA 4GQ9H 2IH3B 1TJGH 4GRLA 1FAIH 1DANT 3MJ8B 4P59H 4PRIA 5TDPB 5DMIH 1X5AA 5A2KH 4KRNA 3BIAX 3UO1H 4OZHE 1JTPA 1Y18A 1EHLL 2AEPH 2CLVB 5HHPA 2B5IB 5HY9B 2ZUSA 5FUCE 3T4YA 2AVGA 2VLLB 2Z92B 4G9FB 4Y2DA 1DQQA 1MAMH 4XZUB 1Q1JH 1KB5A 2FO4A 4XPHL 3IDJA 4ODXA 1S5HA 5JIKA 2E3VA 1UQSA 1JGVL 1PSKH 1NFIA 3KPRE 1RY7B 2FCBA 4JN2B 5T3ZE 1AGBA 2CRMA 1BQHB 3BXNB 3UDWC 3WIFA 2B5IC 1AQDB 1A9BB 1UCTA 2YD5A 1W8NA 3UBXB 4QXGH 3BUTA 3ARQA 1TVDA 4XH2A 1BOYA 3BESR 4UV7H 3GI9L 1RJZB 3SGJC 1KACB 1WFNA 4LEOA 4KTYA 2VE6B 3HRZA 4IMLB 1ZK9A 4UNTA 5E03A 1CK0L 1A7QH 3I3DA 4P48A 1DVFD 4I0CC 4U1LA 4P2QA 4MWFB 4LSRL 4HBCL 3F7RA 4HDIB 4HK0B 3L5IA 5EC2B 3HE6B 3VD3A 3NCBB 4U1SB 4HJ0C 1XGYL 1A3LH 4OFPA 2O61A 1JN6A 1JP5A 2NY6B 3PJSB 1WBYA 3IFOB 1MCOL 2NY5H 4D9LH 4JQXC 1K4DA 4NO0B 5E1HB 1RAMA 1S7RA 3MLUL 3OR6A 2BSSA 5HVHB 3MREA 3WN5A 1E4KC 2XN9E 3HE6C 4FXKA 3T65B 3TZVB 4S1DC 4MZ2A 2X70A 2NY6C 3EDKA 5CGMA 1P4LA 2P1YA 5TQ2H 4X7SH 2OR7A 2HFGL 4G8GB 2P8MA 4ODTH 4GW4B 5D7KD 2PTVA 5HVHC 3PHSA 3VA2C 2IPTH 3RUGA 2LVEA 3TZVC 2QQKL 5MENB 1XZ0A 4HWEL 4NZJA 32C2A 3RA7L 1N3NA 1OGAA 3SJVD 1CXKA 3BKJH 1CLZL 4G8IA 4BA8A 2FJFB 3LEYH 3A0OA 1PLGL 1UB6A 4KHXH 3FONB 4KY1H 5T3XH 5HYSG 1UEMA 5L7XH 1EEQA 3RZWA 3S8WA 4KI5F 3WSQH 1W72H 3IU3B 5JPMB 1VGKB 3IFNH 1J0YA 1JYWA 2AV1A 2HWZH 1I8IA 3L1OH 5DJ6A 1KCUL 4HUNB 5JW3H 1S9KC 1KCRH 5I30H 1PKOA 2R2EA 4KU1A 2EO9A 3T2NH 2C9AA 3H9ZA 4WJ5B 3D2UA 1Q9KA 2VDRH 1TTFA 2J88H 2OBGA 4RISH 4I0PD 5IV2A 1EFXD 4LAJH 4ZUTA 5L2KA 4KK5D 4M61A 4GAGH 1G6RL 1KCVL 5AG9A 3O6MH 1FE8L 2ZSWA 3UJTL 1AFVL 4K94C 4P5MA 2W9DH 4KI5C 3JV6A 4PRPB 3T3MF 3IJYB 5IJVA 1PYWB 2BOCB 1FO0B 1FFNB 1SEBB 4KAQH 1JNLL 4GLRH 5SX4I 1JZ7A 4PGDA 4XAWL 5DUBA 4JPKH 5ALBL 3U6RB 3MV9B 3MLWH 1IL1A 1Q9OA 2C3VB 1HOCB 5FYKH 5EOCL 4KDVA 1JZ4A 3QUYD 1VKXA 2VLKE 4XX1G 1BFTA 4JPVH 4ZQKA 2X4OA 3BKMH 4QWWD 2JJUA 5HHOE 1S9YA 1UB5A 2A38A 2HT4D 2Z93A 4TUOA 3VFGL 2CR3A 3HZKA 1PAMA 3BHBA 2OXGA 3A6BL 1G6RA 4BSVA 5IFJB 4L4VE 3GB7A 2VNCA 1H9VA 3NGBB 4NRZB 2SEBA 4P46D 2ZZUT 3MROA 5D2LE 1I1YB 1BVLA 3BSZL 1DLFL 1W0WA 3MBXH 4KK6D 1MCPL 3KLHC 5L6YL 1J7VR 3BP6B 3C60A 5K93A 2NXYD 5FYKU 4QRQA 3MXWL 1TZIA 3B2VH 5DTFB 3WLWC 4AENA 4JAMB 5DRNB 4HZLB 1FRGH 3K8MA 3NGBC 2JELH 3H3KA 5F1OB 2B20A 3DXAA 3CSBA 3O45B 4MMXC 4X6BB 5C0FB 3E8UH 4YHIB 1Z3GH 2PUQT 3IDMB 2DD8H 5AUMA 2PTTA 5FA3B 3KPPB 2VXSL 5T1LD 2O5ZH 3H7BA 4JVPA 3DRTA 5J89A 5JR1L 1U0QA 1YUHB 3LPFA 2XKSA 4NQEE 2EYSA 1ZA6A 3G5YA 3SKOA 4X99B 1ZGLM 5B3NA 5CJOH 3LH2L 4PGEA 1T04A 3FFCB 3PE9A 1M05A 3O6LH 4NUJB 1FYTE 5LGHL 1T4KA 4YHPA 4CMMB 4EI5A 2NX5E 1C5CH 5GS3A 3PABB 4QRRA 3PL6D 1P7KB 3NZHH 4DKFL 2ZWLT 4Y4HD 1P1ZB 1DBAH 2DWDA 3FT2B 3LPWA 3PP3K 2VDNH 4B0MM 3WHXB 3S98A 3RNKB 1ITBB 2VDPH 1R5IA 2HAZA 1MIMH 2MKWA 5IOPA 4ZFGH 2HT3C 3WFEH 2AXFB 4WY7H 1BZ7A 2P44B 5KSBE 2CK2A 5AD0B 4HIIB 4O2EA 1I8LA 4Y1AA 2CD0A 2VH5H 3DECA 4LK4A 1TJIH 1EVTC 1X5HA 4GRMB 4X7TB 5A1AA 5JPNB 2EZ0C 3BO8A 3CJJA 4M6NH 5I8OH 3DIFA 4ELME 4U1HB 2XTJB 4UTAH 4PREB 5C7XL 2B4CL 5GZOD 2RIKA 4HKBA 4F80A 1OTSC 2LQRA 2KPNA 2QSCH 1MFAH 4I4WA 3UZVB 1U8NB 1M6OB 5HJ3A 1U8HB 2XTJC 5C0CA 4EN3B 1P6AB 3ZE1F 3TIEB 2ZOKB 3BQUB 3P9WB 4IM8A 5D72L 2EDDA 3MRCA 1F6FB 3L5JA 1ZHKB 2DQIL 4HC1L 3PDOA 4R26H 3X3GH 1IGJA 5JZ7D 5C07A 4ETQA 5BV7H 3IDGB 4TVPL 1U8MB 3S5LG 5IVXF 4APQB 4DK6A 3WS3B 5DF0A 4EN3C 3EYUH 2EH8H 4P9ML 1JGDB 3BQUC 1LP9E 3T0EB 1EFXA 3PHOA 3ZDXF 3U0WL 4LCUA 3IFPA 1P5UA 1UKTA 1JYXA 1DE4A 1K8DB 4CUCA 1GOFA 1ZT7B 1NFDA 1YQVL 2V2XB 2RFXB 2ESVE 2DI7A 4J23A 1RMFH 2HLAA 2WP3T 5GS2H 1Y6KR 4TOYH 1HDMB 2F74B 3BD4A 4APQC 1A7NH 3EYOA 3MRGA 1G7IA 3PWLB 4HFWA 3T0EC 1FNEA 2CJUL 1PZ5A 3EO1B 1FFPB 5IG7B 4OV5A 1KIQB 2A6IA 4OD2B 1XGRB 4D2NA 2GK2A 3SBWC 3U2SB 15C8H 3ULUF 4JO3H 2MHAB 4M7JL 3L7FB 43CAB 4OKVB 1QZ1A 1WT5C 3I6LE 4XPFL 1UVQB 3CDCA 4B53A 1FGNL 5BS0B 3BKCL 4H25A 5EOCJ 5EFIB 4U7SA 2HRPH 3DARA 3OXRA 1I1FB 3NZ8B 2Z4QA 4F2MA 4YXLH 5IHUL 1R3KA 4N0RA 5IM7B 4X6CF 3S36H 1LILA 1ULVA 1C5BH 1N6VA 3OGCA 1IC5H 1J0KA 3I50L 3TBSA 4Q6IA 5FGCE 2X7LB 1INQB 1SY6H 3G5ZB 4D9RE 1MHPH 4X6CB 1QLEL 3K2MC 4NKMB 3ULUC 4G6JL 1BFVH 3UZEA 1J0ZA 1JWSA 5HVWA 3F7YB 2D9CA 4DCQB 4U1NB 1CE6A 4XP4L 5D70L 3OJMB 4UQ2B 3VXMD 3RGVB 4WO4B 3S3SA 3VXRE 4DZ8A 4A2LA 3FO1B 4FA8A 4KPHH 4C4KO 4YX2H 5E5UB 3WO4B 1ZS8A 1E4XI 4LLWA 4X83A 3LRSA 5JHDA 3EOYG 3RGVC 1OQOA 4PG9A 4WO4C 4NQCE 3TT3L 2UWEF 1CU4L 5T1LA 3MMEA 3I02A 2A9MH 3GSQA 5GJTH 3WO4C 2G9HB 3VH8G 1ZA3A 3M17B 5BXFB 4KUZL 4JFFE 5CCKL 5BZDB 5KSVA 4Z0BL 4KJQC 1Z2KA 1LVEA 4LLYB 1QBBA 1BGXL 4P9HH 3BP7A 4WI3A 1JNNL 5CEXB 5EU4A 3TPUB 4OGAC 1MOEA 1A6TB 1MFCH 4U6TA 4Y4HA 2X4SB 4YUEH 1K8IA 2DQJL 3SY0A 3FHAA 3KPMA 5DJ2B 1A0QH 2VLRD 1LEKB 2LVCA 1R3JB 2JB5H 5EG6C 4DN3L 4KQ3H 3O4LB 2R8SL 1PD6A 3JXAA 3DVFA 4KMQA 3U0TA 1BQSA 2AJUL 1DQDH 1AKJD 1QP1A 5EZIL 4RMSA 4CN4A 4QOKE 3UTSD 1OLLA 1QOKA 3MBEB 2OR9L 4BSWB 5JW5B 2GCYA 5F3HB 3SCMA 1MCCA 3EKCA 4Z7OE 3MPCA 1UM4H 3ZKNC 4LKCB 5AYUH 1V05A 5EN2A 5BRZE 2LE9A 1RD6A 5EORH 1P9MC 2VJXA 3HPLA 3ZHDA 3RWIA 5CBEA 1NAMH 2AJ3B 3ARUA 2HH0L 3ALXA 1YEGL 1R6VA 3OKMB 4BFIB 3T0VA 2OM5A 2OMBA 1L7TL 2C7UA 2Z31B 1G0XA 2JK5B 4NZDA 3MBEC 5ESQA 3U46A 5ALCL 5E9DA 1MREL 1G7PA 1YC8A 5DYOA 4PRHD 1T3FB 2ZCKH 3LOWA 2EEDA 4M1GL 4LCWD 4PTTA 1WIUA 4JZNB 2MQ3A 4IDLA 5F9AC 1AHWB 2IH3A 4K23L 4ZUWB 2BY1A 4NHCH 2Z31C 5EBLB 1WSST 4ONHB 5DXWA 1KC5L 4ZOCA 3HI6H 5JUEL 4ZAKB 4Y19B 3QXTA 4QXTB 3OG4B 4JFDD 5HYQB 1A7OL 3VXSB 5HY9A 2DAVA 4F8QA 5JMOC 5H94B 1AHWC 3ESUF 4KROB 2Z92A 4J3OC 1I9JL 2FJHA 4FFYH 2AQ3A 4ZAKC 5B4MD 1BVKB 4X6DF 4DTGL 2R56L 1A9BA 2UZIH 4KROC 4YDIL 5JXED 3UBXA 1T5WA 4I3SL 2BOBA 4MX7B 1U6AH 5LAXB 4DN4H 1MFDL 4X6DB 4ELKA 3CFKB 3V9FA 1BQUA 2JJWA 1EV2E 3FN9A 1IKFH 4H0HB 4OI7A 3N1MC 3BPCA 2GJJA 1J0HA 4Y8AA 3QO1A 4HDIA 4Z5RB 2VR4A 3L3HB 2CGRH 2VLJE 3HE6A 4HS8L 3QFDB 5TE6H 3D39D 1QFWH 3PJSA 3STLB 4XC3L 3S7GA 3IFOA 5IB2A 4HMEA 4IRJB 1AXTL 1L0QA 3T1FB 1VPOL 4BQ6A 3FQUA 3FMGL 4W70A 2DJ4A 3MXVL 3TN0D 4NT6B 4M9PA 4B7IA 5C09D 4WU7B 1CFQA 1WUNT 1I9EA 1KCSL 4MA3A 2XWJA 1BFOB 4G7VH 1RHFA 5FYJD 4IRJC 3L3DB 3RVUD 4LARL 3BMWA 2CKBB 4JRXD 4NHUB 4KRMB 4OSUH 2E27H 1VCAA 5MENA 4JFHD 5B8CB 2ARJQ 1I75A 5EA0H 2ZNXA 3LKQA 3IJSB 3BISA 4Z7QF 4HWZA 5FAAA 2H6PA 1TJHL 4R7NA 5CILL 3DOSA 1EEUA 1AD9A 1CD0A 3FONA 2ADFL 3TH3T 4M7KL 3LSOB 3LS4H 1H15B 4S1RH 2HVKB 1PEZA 3LZFH 1VGKA 4G7YH 3KR3L 5B8CC 5JPMA 2KKQA 4R90H 5F7KC 1BF8A 4BQCA 5D1XA 5EPMB 1C08B 1EO8L 4OQTH 1F3JB 2WQRA 3SEPA 3B9EA 4JO1H 3FN0H 2V7HA 4NQVA 1A4JB 4D8PB 2EECA 3MUHL 4WHYH 4DZBB 4U1KA 1EAPB 3CFJB 4G8FB 3UJJH 1OPGH 5H35B 2MPAH 4LEXL 4OM1H 1DTUA 1B0GB 1WZ1L 4ONGL 4XP5L 1JWMB 1J0IA 1UWGH 5CFHA 4S0SD 1AKJA 3ARGD 4UINH 5EZJB 4WNQB 4Z18A 1MHHA 3UTPD 4PRPA 3IJYA 4IIQA 4IRZH 2BOCA 1FO0A 1SEBA 1VFBA 2UV3A 4XCFL 3EAKA 3MUZ1 4V1DA 3LKRB 1K2DB 4KXZH 4RAHA 4O9HH 4AMKL 1S3KL 2X9XA 1MI5E 1S7VA 2DBLH 3I3BA 4WHYG 3R8QA 5T3XE 3VDBA 3D3VE 1JBJA 1NMCB 5DMJB 5DFVC 3VJ6A 3GRWH 4MDJB 2PR4L 3U7YL 1KN4H 3MOBH 3RGHA 2JJTC 5GGTL 3UTZB 1F11A 4PRHA 5HDLA 4H88H 4CVUA 4PY8I 3PQYE 1MVFA 5KSAD 1NGXA 2O26U 4NO2B 2XWTB 1KENL 5BQ7B 5IFJA 1NMCC 4OZIE 4GMTH 4XX1E 3BP4A 4NOBA 1FORL 1IAIL 2IALB 2HJLB 4NRZA 2IBZX 4Y16B 4YHLH 4LASL 1BECA 4X9IA 5GRWA 2OS7A 4JFDA 2EDXA 5C0RL 4I13B 3J7HA 2H32B 1GVIA 3BP6A 4G6FB 2PCPB 3NMEA 2FGZA 5INDB 3Q1SL 5BVJB 5IBLD 4HZLA 4WV1B 5I6XB 5DQDH 4I18A 5GGTA 2IJ0C 2EYRB 4Y16C 4Z7NE 4JHWL 4RIRB 1QLFB 4J1UB 3V4VL 5D7JB 3SPVB 4Z7WA 5BZWA 5ICXA 3AXLB 4C56D 5FYKE 2V2WA 4Q9RL 3O45A 2YRLA 4HMDA 3QUML 4TULH 4X8JB 4X6BA 3FOMB 5C0FA 1NBYB 4GOSA 4WV1C 4YHIA 5I6XC 1Z5LA 3IDMA 1RUKH 2FH8A 5FA3A 3MV01 1B3JA 5D7JC 2R29L 1WWAX 1YMMB 1I7RB 4XCYB 1EZVY 5GZNC 2EXYD 4MNQE 3CDFA 1J1XH 1QUNA 2AQ1A 5ETUB 2MOVA 3C5JB 1Z9OA 3TIDB 1F6AB 5FB8A 2IFFH 3HE7B 5F7MC 5C0GB 3HUJA 3OTTA 3K0WA 4FG6C 2HG5B 2A77L 2CUMA 1UZ8A 1RIHH 3Q6GL 4ORGB 2XNAB 4HW6A 4CVXB 3OZ9L 1XF4B 4I2XB 3QUMA 3GJFA 4CMMA 4I3RL 3LVEA 3F7QA 3HE7C 1P7KA 2X4UB 5A2FA 2VXUH 4LGRB 4RA0C 1N5YH 3RBGA 3OKLB 3WHXA 4NPYA 4MAUL 3RNKA 4DAGL 1YNKH 1NGWB 4QHNA 4PV8B 4PJFE 4GKZB 4JR9H 3MNVB 2X40A 1WEJL 4HXBL 5AD0A 3ZTNL 1HSAB 3P9MB 4IMKC 4HJJL 2FLBT 5KOMC 5KAQF 1CXLA 3MC0A 4X7TA 1KB9K 4U1HA 3SJVB 3UTOA 4OZGA 1IC1A 4PP1C 3F12B 3K81A 2F8OA 1NSNL 1GXEA 2OQJB 4U0RB 4JG0L 2R4RL 5TF0A 3U1SL 1G7HB 2ED8A 2K3TA 4MJ4A 1KIRB 4X4ME 3FQWB 1IGYB 4JJ5B 4XWOD 3SGDH 1UWEH 1ZHKA 4UMGA 1J12A 1NMAH 1LE9B 2JCCE 2Z8VC 1ZLUH 1KJ3L 4CRPA 5L0QB 4X6EB 4MHHG 3DO7B 3TBWB 3N1GC 5CAYB 2VDQL 4U0RC 1CFSA 1U8MA 3QCVH 3NIDE 1NBVL 4BH8B 4GBXC 4APQA 4HX1B 4YDVB 1ZT4B 2Z35B 2DQUL 4KGJA 4P5TA 3VDCA 5CJBA 2P45B 3OSKA 1UCBL 3ARGA 4D3CH 1K8DA 3M1BA 1ZT7A 5L0QC 3QPQD 4XVSL 5F3BB 3T0DA 1JHTB 2RFXA 2X4RB 3SBWA 1M7XA 4NC1E 2NYYC 4PJ7E 3WKML 1ZT1B 5I75B 1I9RL 3O3UN 2DLGA 5IEKB 2KBGA 3EO1A 5IVZB 1FFPA 4C4KT 2NR6C 2XXMB 5CZVH 1I9IH 1XGRA 4HHAB 3EO9L 3A6CL 4XTRD 4JLRA 2NTFB 3HG1D 4LCIH 3O3DA 1CF8L 4OD3H 2FDBP 3IU4H 3U2SA 4XPAL 4YGVB 1P4BL 2MHAA 43CAA 3L7FA 3OAUL 5I75C 2QQNH 3B9DA 1ZLSL 4YXKL 5BS0A 1XT5A 5DT1H 2HLFC 1FDLL 3S37X 1I1FA 4ZS7L 2BVEA 4LGSB 4HPYL 5I74B 1FNSL 3VCLB 1MEXL 1OLZA 2OR8A 2BK8A 2ENYA 4R4BA 3T09A 1G9MH 3T0XA 5IBUG 3CX5K 4O5LH 3DGGB 3P4MB 1N2RB 4UQ3B 4PJAE 5F89B 3JV0A 1IILE 2NXYB 3TFKD 7CGTA 4G3YL 1INQA 5I74C 3G5ZA 5E94B 5LQBH 4NKMA 1GC1H 2VRAA 4O4YH 2YZ8A 4HD9A 5GISL 3F7YA 4F7CB 2E7BA 3TYGH 1EHAA 1QNZH 1V7ML 4XGZA 1WITA 2NQCA 4FFVD 4GMSL 1KCLA 3V7AG 2NXYC 1DUZB 1H8NA 3VXUD 2VERN 4M5YL 5FXCH 5FCSH 2Q3AA 1BAFH 4NNYB 5E2VL 2QHRH 1BD2A 1CGSL 1LO5B 1DBMH 3H3PH 3MLYL 3N9GL 4CN1A 2DQGH 2XQYG 1A4KA 5T1MA 4J2XA 2DKMA 1X6LA 2FL5A 3CMOL 3UYRH 1FNGB 1J1OL 3KPSB 3V2AR 3SE9H 4HAGA 1YEKH 1CGXA 4M4RA 3M17A 3ZKQD 5BXFA 1XEDA 3TNNB 5A3ID 2AV7B 3QA3A 2FHBA 4Q9QL 2IADB 3QEGH 3OMZA 4LLYA 2X1PA 4PY7B 4G43B 5CINH 3F65A 3HC3H 1IAOA 1LGVA 1HN1A 1YDPB 3PWVB 2R0ZH 5CEXA 1I1AA 5L8JB 5ISZE 2WSKA 4FZ8L 4XMPL 3O2WL 3OXSA 2R2HB 3FT3B 5JLZB 3HAEB 3KXFB 1F4XH 1H3VA 1XGUB 4JO2L 4XNXL 2X4SA 3KDMB 1KYOK 5DJ2A 2K7PA 2G5BB 3K8LA 3QO0B 1LEKA 4U33A 5I1DB 3TPKA 1FZOB 3O4LA 3B8YA 5FECB 1RU9L 4HIHB 1CG9B 1ORQB 1N5AB 1P9MA 3BX7C 1JFQL 3DSFL 5GRVK 4KMLB 4AYFA 1HNFA 1HQ4A 4WIQA 4QHLA 3MBEA 4BSWA 5JW5A 2F54E 3L3OB 2QADB 1XGQB 5F3HA 5GGVH 1FBIH 4ZTOL 1D3CA 4Z77B 4ZPVA 1LE5B 1KTDB 1KULA 2VIRA 2EC9T 2AJ3A 1DBJH 3KYMA 5GGUB 4BFIA 4PJXE 2W92A 4NOFA 5F88A 3LN4B 5D8JH 4UT9H 2EIBA 5D96B 1GZQB 2QADC 1KFAL 4RFOL 5D5MA 3VFNB 1T3FA 1BBDH 3IT8D 4OAWB 4OZ4B 2YPKB 4FQCL 4JZNA 5F6HI 1WLHA 3VRLF 5HI5D 3MJ9L 1AI1H 3DETD 5EWIH 3RWJB 2O5XH 1NGPL 3LN9A 3EDJA 2FX9L 4Y5XA 5EBLA 4ONHA 1CQKA 3ROLB 5DVNA 3THML 5D96C 43C9A 3SKMB 3G08B 2X4PB 2YHGA 2YEZA 4NJAL 5F21B 5I1KH 2AEQL 4PJ9B 3I2CL 4F7EB 3QDJE 4OF7A 5H94A 3ARDB 1GRWA 3GDBA 5D1QD 2ZJSL 3H9SD 1G7JB 4R96A 4P57B 2X4NB 1YEIH 1IGCL 3RKPA 3MNWB 4IBLT 5TJWK 5LGJB 1WGOA 3RL1B 4GSDL 1BVKA 4PJ9C 5HHXL 3WL9A 1BBJB 2JIXD 5I1EH 3LY6A 1IFHH 3MJ9A 4RCAA 5FCUL 3BAEL 3HG1A 3GBNH 5LVEA 2GYSA 3ARDC 2M26A 3DI3B 4HKJB 3WFHA 5L2JB 5J1SC 3IAPA 1DN2A 3CLEH 5LAXA 5JHLL 4X6DA 3ULVD 1A47A 4RGNE 5BVPL 1EJOL 5MEQB 3G6JE 4ZSOB 4YZFE 5FK9A 3S34L 4U1JB 4J7RA 5F96H 3CZJA 3L3HA 1P7QD 3MCLH 2AI0H 4LSUL 1REIA 1F8TL 3QFDA 4OLUH 4FQXB 5C0BD 4U05A 3ULSA 1JYVA 4LRNH 5BW7A 3LEVL 2YA1A 4NN5B 1ZV5A 4WFFD 1CVRA 2LV4A 4HH8A 4JM4L 4NT6A 5DUPH 3W39B 4WU7A 4XMKL 1IAIM 4LSQL 4YWGL 1U36A 1TITA 4FQXC 1EMTL 1MHCB 2DLFL 1BFOA 4XP1H 3DVNB 2P5EA 4EUPH 1WZMA 5IEHB 3OHXB 2A6JA 5HDQL 3F58H 4N8VB 4POUB 4NN5C 4X7EC 1ETZA 1U8IB 1I7ZB 3WYRA 4MJID 1JRHL 5GGSA 4R4FH 2ZCLH 1HHHB 1WCBA 4KI1A 5IMLB 3LCYA 4X4YB 1O0VA 1X3DA 4YHMH 4GLRI 4R3SA 5F44A 3IDXL 3R06A 4PJIF 3STZB 3CFBB 3HI5H 3MQIA 1FN4B 2PO6B 1XGTB 2WBJB 3PWPA 4ZPTA 5ACZB 1MIEH 3NCYS 1MCWW 1RJCA 5I1HH 3LSOA 4MAYB 1DDHB 1FH5H 4NFCA 4QRTA 3VFOA 5EUKA 1H15A 2HVKA 1CT8A 3QIUB 1F4WL 5K9QG 5EPMA 4PJIB 1F3JA 1F4AA 3J8F7 5GSRA 3FJTA 5IR1B 4D8PA 2PO6C 2WBJC 1YECL 3TT1H 4LFHD 3QWRD 2VLRB 3U9UA 2IG2L 1IRAY 3KPRD 5IQ9B 4MAYC 5H35A 1XR9A 5T3ZD 3QIUC 3F7VA 3H6JA 5FEBA 4OLWL 5ADOH 4TRPL 3UTSB 5EZJA 1TLKA 3RAJH 4PGBB 2IMNA 2H2SD 3VFPB 4FABL 3KJ6L 3HS0A 4CVWA 1VENA 4PLJC 5D7LE 4JQVA 2V9RA 2JJTA 2H8PB 4YLQT 1OM3L 4KMTH 3LKRA 1NGZB 5LCVL 2DIJA 2H1PL 4N0UE 3MRPB 1TCRB 2ATKB 2GJ6E 2K7QA 1DSFL 4YFLF 1OF2B 4M48H 4MDJA 3ZKMD 3FB8A 3GO1H 1YEFL 4UV4L 3SDXA 2I07A 5LBSL 3UTZA 4LCWB 1MPAL 2G2RB 5ENWA 2EDYA 3KYKL 3GSXB 4HFUL 4Z7VE 1NL0H 1I3RA 2R9HD 1I8MB 3NABH 4MNGB 5BQ7A 2WQ8A 1ZHLB 1PKQB 4MD5A 4BQ9A 4JRYE 1IMHC 4Y16A 3ULVL 2ARJB 5KS9F 4IOIB 2OYPA 3OAZK 1XF3A 3ZDZF 5HHNA 4L3EE 3HNTH 2AKRA 3BDBA 2DM3A 2JE8A 1HWHB 2PCPA 1KTRL 5LJYH 3H9SA 1HHGB 1ITCA 4WHCA 2X89D 5BVJA 4AT6A 4WV1A 4XHJD 2YPLE 4XNYL 2I9LB 3K2UH 3GSOB 2EYRA 3PWNA 4LHUB 5KS9B 4KVCL 2UYLA 1DJSA 4RQQB 4J1UA 5D7JA 5IMKB 1HHJB 5ELIA 1S9WB 2Z8WC 4KJWD 4XI5D 4X8JA 2EICA 2GT9B 2XZCH 1GGUA 4YHKL 3FOMA 1NBYA 1S7SB 2H26A 3CVHB 1FVCB 2P5WA 1N0XL 4WUKL 1T1WB 5B4MC 1OSPL 1JUFB 1SYVB 4PJGE 1I3GH 4XCYA 5JXEC 3RWDB 3NCCB 2FB4L 4NZTL 1NJ9A 4N1HB 5CP3A 2F15A 2DBJA 1F6AA 5CMAA 2EDWA 1YEEL 3WJLA 2Q7YA 2VB5A 3D39B 1WVZA 5KZCD 1CICD 4Y5YA 5LWYL 4MCZB 2HG5A 1KJVB 3BE1H 4MNHB 4XNQB 3VXTB 2DKSA 2IFGA 2XNAA 4CVXA 1OARH 4W81A 1J1PH 3QG7H 4I2XA 2EE6A 4D0DB 1D5MA 1JF1B 1YJDC 3TN0B 2EDTA 4OCLC 1FGVH 2L7UA 2YWYA 1L0XA 2EDKA 3RY6A 3UBXG 5DRWA 1T5XA 1T7YA 2VZ3A 2N7BA 2MWCA 4Y5VB 1E4WL 2KZ1B 4OI8A 4E41E 1NGQL 2R2CA 1NGWA 2WUBL 4PV8A 3RPKA 4ERSL 1EO5A 5T1KA 4JRXB 1PJ9A 3TN0C 1OQXA 1ZMYA 4E0RA 2VLKD 1QEWB 2I5YL 4JHBA 4FTVD 5HHOD 4B41A 3GIZL 4RDQG 4Y5VC 3ES6A 2XV6B 1JNJA 5BO1L 5T3ZL 1TCMA 3TGXA 4A6YB 4JE4B 5DJDB 1EEYB 3MGOA 2CDFB 5DQ9B 4L4VD 4R97B 4PRNB 4U6VH 1ZLWK 3TA3D 2OQJA 3VD4A 2NW2B 5DA0B 4OZHA 1WFTA 5IB1B 1G7HA 4GBXA 1BX2B 4WU5A 4NGHH 4OLZH 3FQWA 1RIVH 4IOFD 3VD5A 3O2DH 1CXEA 1CFTB 4R97C 12E8H 5IQ7L 4X6EA 1JE6A 4EOWH 3P30L 3TBWA 3X11B 5ERWA 4MSWB 5FM5M 4K94H 3BT2H 1IC7H 2IQ9H 1GOHA 4HX1A 3T0AA 2H3NB 3S88L 1BQLL 1J5OH 4IOSD 3IFLH 2DTMH 3IJHB 4HIXL 3OB8A 3C08H 4NQDE 1EXUA 5LG1A 3MACL 3TO2B 5KVFH 5C9JA 3V6OE 5ADPH 1HZHH 4XPGH 2KH2B 5FUOL 5K59F 1Q94A 2X1OA 1VFAB 1FL3A 1RJLB 1UENA 2W1NA 9CGTA 2AABH 5IEKA 4NSKB 5IVZA 4X5XA 1FO0H 2CUHA 3FHQA 1U91B 2NNAB 4KZDL 1H0DA 2BVQB 2EH7L 3LKSA 1MRFH 3P4OA 4HHAA 4NQED 2RR3A 1HK6A 3UPRA 3UTQA 5TPWH 1INEL 3KLAA 4PB9L 1ED3B 4G80B 4YGVA 4ZD3H 5J3HD 4NZUL 1G7QB 2BVOB 2OP4L 1FYTD 2F5BH 3OKOB 2VAJA 1VGEL 1BHGA 1OAUH 2NX5D 3VCLA 2XN9A 3ZE0E 4JKPL 5HGDA 3AY4C 2QQLH 3CDGA 4WI6A 1JPSL 1F4YH 1FNHA 2C5DC 2ID5A 3P4MA 4J4PC 1N2RA 1FVEB 2LABA 2YD6A 3F6LA 3ZSTA 4UAOB 2Y36L 5E2WH 5L2KE 3GSNB 4WEBL 3F5WB 4GH7B 5TDNB 4GAJL 3MNZB 3BWAA 3KG5A 3RWEB 1YYLL 4CMHB 4C56B 1UXWB 5J6GB 1RUPL 4UAOC 4K2UH 1DUZA 1LEIB 3C5SB 4GKSA 4FS0A 1IQWH 3QUKA 3V4PL 3FB6A 3WD5H 1MWAL 3WFDH 4ZODA 2HTLD 1VEOA 1XGPB 4GXUM 3C6LD 3O2VH 1LO5A 3QUXD 4L8CA 4CMHC 5DUML 4YFDB 4F57H 5CSGA 3V7AE 2CRYA 2ICEB 4LP5A 5C0AB 1LD9B 1FNGA 3H42L 4YXHH 1NCUA 5DR5H 3CK0H 4UOW1 4W4NA 3TNNA 3T3PF 1RZJC 2CLZA 2IADA 2OZ4H 2OJZH 2PETA 4PY7A 4TSAL 2EXYC 4G43A 4D0CA 3QSKB 4N9GB 1QFPA 1I7UB 3ARVA 4AIZA 5TQ0H 5L8LB 4TUKL 3S97C 2V7NB 4KKCC 1MWAA 2P24A 3HAEA 5GSVA 3KXFA 3OB0H 1XGUA 3BGMB 3EGSA 3ETBF 3KDMA 3W9EB 2PF6A 2GAZA 1QQDA 2G5BA 5A40E 3QO0A 1MCIA 4RX4A 3BVNB 1N6QH 1FZOA 3DXAE 1JHKL 4S1QH 2Q8BL 4HIHA 1ORQA 4Y7MA 2V5YA 1Y0LA 1ND0A 1XH3A 4HQQL 5AAWA 3I6LD 4L4TB 1QLRB 3ARTA 2BNUA 5D1ZD 1XGQA 2D2OA 1KTDA 2YSSB 4XP9L 4K7PH 5T1DL 2VXVH 3QPXH 3MUY1 3DV6A 5EBMA 4TTDD 3LN4A 1FIGL 5CGYC 4OCXL 4F7MB 3SKJH 1GZQA 3EO0A 3QDMB 3NIGE 4FFWD 1RURH 5F7LB 3VFNA 3ZYIA 1QO3B 2CK0L 3G5VA 4C83B 5I76A 5CGTA 4D9RD 4XBGA 1ADQL 3RWJA 5EZOL 1PQZB 4QRRE 4PG2C 4EDXB 4G5ZH 3VFVB 4PJDE 3ROLA 5T5NG 2NY1D 3LEXB 1SJHB 4DQOH 4XWOC 5EIIB 2E9IA 1JPTL 4QEGA 1MNUL 4PJ9A 1Y6NR 4NRYB 1G9EA 3VI3E 2D4FA 5T5FH 3ARDA 4K9EL 4Y1AE 4DGVH 1QFWI 1G7JA 3ZE2E 3RX7A 1C7TA 1LDPH 5IHZA 4XVUC 4OCRH 1ZE3C 1XIWD 5A16B 1D5IH 3WKNA 3RL1A 4KKBD 4P3DA 25C8H 5FHAH 1BBJA 1QFUH 3QPQC 1I85C 2ERJB 3L95B 4JFFD 4EVNB 3H3BC 5L8KB 4H0IA 3ALPA 1MCSA 3WFZA 1GPOH 5HGGS 5L2JA 5JOPD 4DGIL 4MQ7B 4UTBL 4N0YL 3VDAA 1LDSA 3AROA 5C0CE 2VWEE 4LIQH 1HIML 5SX5H 3VWKB 5MEQA 2YKLH 3C8KB 4KKLC 3SDYH 4ZSOA 4XTRC 2BXZA 4L1HA 2QKIA 2XRAH 2ERJC 4QRPE 4U1JA 2AK1H 3MGTB 3SE4A 3G6DH 4P5KA 3EFDH 2AJSH 4XCEA 5C07E 1K6QL 1D9KD 3RKDD 4OV6F 1NC2B 1HYRC 3ULUH 4IEFB 3VWKC 1PG7X 3VXQB 4FQXA 1F3RB 3CLFL 4JREB 4CW1B 3Q2CA 5I19H 5KSBA 1LK2A 1INDH 3C2SA 3S9DB 4QOKD 4W4OC 2VL5B 5MP6L 3TESA 1T6VN 5DS8B 3MLSH 1NFDE 3FQTB 4L8DB 1MQ8A 4L3AA 5IT2H 3W39A 1ZOXA 5EU7E 3H7LA 1KJ2L 1RULL 3AUVA 1CFVH 1VACA 5BRZD 1WICA 3TFKC 4JREC 1QD0A 1MHCA 1R3LA 1QBMH 2R69L 1IEAA 4XVJH 3OHXA 4JDZB 4M5ZH 1MJJB 3MUGA 5A2LH 3C6LA 3ZZ1A 1U8IA 1I7ZA 3DX9A 5DD0L 2YN5A 1GSMA 4H20H 1S8DA 4JPWL 4M7LH 1RUQH 4HK3N 2B39A 4Y4FD 1HHHA 3LHPL 1U8JB 5IMLA 4BFGA 4DVRL 1WAAF 4AQ1B 3D69B 2ZUQB 4XP6L 1A2YB 3IDNB 4JFYA 3STZA 5ACZA 2PO6A 4KXZI 5CSBA 4DOHE 4FXLA 1LP9A 3A67H 1DDHA 3IRPX 5F72S 2XZAH 3QIUA 2E7HA 2R0LH 3EOAB 4I77L 2BRQA 5TF1H 2ESVA 1T22A 2EDFA 2EIZA 5A3IC 4HCRH 1QRKA 2ZUQC 2HTKD 3WFBL 1ZLVH 3ROOB 4OCWH 3LKPB 4HXAL 4JHAH 1AY1L 5IQ9A 1L4IA 3ARWA 1HEZB 4UT7L 1UG9A 3QG6B 1A3RH 5JXAL 3D25A 4MMZC 4BJLA 1YNTA 3LRHA 3LD8B 2EKSB 3REWB 4GS7B 3MTRA 3VFPA 1OP3K 3S37H 4NQTA 1E6OL 5JHDE 1CFNB 2H8PA 5DSCA 3DO3A 5E2TL 5AZEL 1KLGB 1NGZA 4F58L 4POYA 3K74B 3MV7B 4AEHH 3LD8C 4JG1H 1XF2B 1NEUA 3MRPA 5HYJB 4GS7C 1AGCA 1TCRA 1FG2A 2ATKA 3K8KA 2VLJD 1OF2A 4POZD 5EO1A 3FCTB 2DQFB 4N1CA 2DQEL 5HI3D 4KTDH 2W65B 1B6UA 1QBLL 3DV4B 2JB6A 3ZDYE 5DWUH 2A83A 4WRLA 5AEAA 1MY7A 4OFKA 4OLEA 1CWVA 2BERA 1P2CA 3VXRA 1S7UB 3IXTB 1DBKH 4OGXH 4QLRA 2R4SL 3X3FL 5CD5D 1TZHB 3NOIA 3N06B 3MRRB 1T0MB 5D1QB 4KHTH 1NDGB 4R4ND 1T2XA 2F19H 1S5IH 2B1HL 2G60H 1LO3H 1TMCB 4M62H 4NQCA 3HZVB 3BZFB 3GSOA 2FGWH 3NFSH 2VZ1A 4YHOH 2W9EL 3UJIH 2BNQA 1HHJA 4UIKH 1PX3A 1YN7B 3ME0A 5D1QC 5DJXB 2QR0B 4OCSH 3TV3L 2GT9A 1IE5A 5E00B 4NKDA 4PD4K 4PY8J 1S7SA 3CVHA 1BEYL 1FVCA 4MA1B 4PGCA 3ARFD 1T1WA 3UC0L 4MA8L 5E9DE 5HI4C 3IKCA 2ZP0T 4Z7UE 3P40A 1SYVA 5GRUH 3CAFA 1HKLL 4LMQE 4ENEC 5E5MB 1P7QB 4MD0B 5D7SL 1YEJH 1VSCA 3WDHA 4L9LB 1D9KA 2BRRH 2XYCA 3MLTA 4MA1C 3U79A 4O02H 1FZJA 3QB7C 5IMMA 4DVBA 3TO4A 1JGVH 4XNQA 4MNHA 4LP4A 3VXTA 1D5XB 3M8OL 1QYGH 4QOKA 3BRDA 3BYTA 4TNWK 4D0DA 2BDNH 5I2IB 4ZOAA 2VAAA 4LSVH 4R0LB 2GK0B 5C9KA 4G9FE 3H2WA 4L9LC 1AGDB 4NQUA 3SGDI 4MCYA 4JM2B 4LHJB 4Y5VA 3GSVA 3BMVA 3F8UB 1HYSD 5K9OB 1HWGB 5E99L 2D03H 4LGPB 1MI5D 1TVBB 5T3XD 3OJVC 1U3HD 1IGFL 1CK0H 1OOAA 1Z9LA 2BJML 1SVCP 2VUOA 4MJIB 4R0LC 4OZFB 3OJ2C 3VI4F 4B50A 2FIKB 2IAMD 1QEWA 3W2DH 1MQKH 4XCCL 4WFGE 3RVXD 3HC4H 1GL4B 1OT1A 4JM2C 2J8UF 1QKZH 1WIOA 2PW1B 3PQYD 3WO3B 1XGYH 2CKBH 4ODVL 4I0KA 3IVKB 3EJJX 2H41A 2Q87A 5JMRA 4A6YA 2P46B 4HT1H 1R3IL 5CP7B 3NH7L 5DJDA 1EEYA 3O8XD 3V52H 4KWUA 3C6SB 2BSTB 4PRNA 4YNYA 1T0NB 4QCIB 5MEPA 4G6KH 2J8UB 1DLHB 2AEWA 3C9NA 4YPGA 3VW3L 2NW2A 3Q3GB 1A6PA 4QHMA 1BX2A 4GQ9L 5IW6A 1TJGL 2MCG1 5D6DC 1A1MB 1FAIL 4P59L 5DMIL 3SO3B 1CFTA 2YS4A 5DJAA 3SDDD 3W5MA 3UO1L 1IARB 4HULB 1I7TB 1ZKAA 3QULB 3X11A 4CAGA 4LPCA 2Y6SD 4P0DA 2H3NA 5FYKD 2X1WL 5KVGH 1MAML 5D6CA 1Q1JL 3SO3C 1KPRA 1X5FA 4G8GE 5ILTH 5FV2A 4MQXC 4LDOB 2DRUA 4PB0H 1FL5A 1PSKL 2EDRA 2PXYD 3ILQC 1H3GA 5E95B 3TO2A 4Q97A 4LRIA 5FYLH 4CKVX 1Q72H 1VFAA 5MENE 4H1LB 4QXGL 1D5ZA 3SHSA 1RJLA 4MNQD 4NKOB 4NSKA 3DX8A 1FV1A 1H3UA 2BVQA 4UV7L 1JNHA 2X41A 4U2YA 5GRJH 4XPBH 3AY4A 2XG5A 5BCAA 2W60B 1GJIA 4G80A 3OKNB 5F7WC 1A7QL 4LKXB 4X9GA 3QJFB 5I73B 1NLBH 1EA9C 4J4PA 3V6BR 1NFKA 4MXQD 3OKOA 3VWJD 1XCQA 5DI8B 3CPLA 5DVOA 3VMOA 3I6KB 5TGBB 3DRQB 1B6DA 1A3LL 5DO2C 3RI5K 3WLBB 4K8RD 1T89C 4NCC2 1FE8H 1YNLL 1U8LA 4N68A 4KI5E 2NY5L 3RWHB 3WUZA 4D9LL 3MFGB 3O11A 5I73C 5E8OB 3OF6D 1FVEA 2D3VA 3DROB 5DJCB 4L5FH 3MLRH 1FFOB 2OTUA 1KELH 3MX0A 3QUZD 3H0TB 2H32H 3QDGB 1GHFH 3BRFA 3MNZA 4PRPE 5TQ2L 4X7SL 3RX5A 5J11B 5DK2A 5C6TH 1IGMH 4ODTL 2I24N 4WEUD 1UXWA 2IPTL 5J6GA 3EZ8A 2PTUA 5DEFA 1LEIA 2APFA 3AS1A 1D5BB 1Q0YH 4NZRH 1BM3H 3MV9E 1T2QL 4XHJC 4KK9C 3T3ME 2ZNWA 4LBEB 3QQ9C 4ZG1A 2K9UA 1CXIA 4MVBD 2Y4SA 4PV9B 3U7AA 5J11C 3O81A 2WLZA 1MFBH 1AGFA 3BKJL 3VE0A 3RVTD 1HSBB 3CMGA 3LEYL 4U4BA 2ICEA 4HLZH 2NY3D 4KJWC 4MGXA 1CGTA 1LD9A 4KHXL 5T3XL 4OM0H 3WSQL 2Q76B 1UJ3B 1W72L 4ZFZB 3RTQD 4YPJA 1TIUA 1UM5H 2HWZL 3CH8A 3L1OL 5CP3H 5L9DH 4H0GA 4WI5A 4Q58C 5JW3L 4HGMA 4NJ9H 1KCRL 1HXYB 1P5VA 5I30L 3T2NL 3BEWB 1I7UA 2DWEA 3GBMH 4YE4H 2V7NA 4TQEH 5EOTB 1OSZB 1UJ3C 3BDYH 2VDRL 2J88L 1D6VH 3BEVA 4RISL 2GTZB 3H9HB 5F97E 2ZUTA 1S78D 4EBQH 4CDGC 4HLZG 3DHMA 3HFMH 4GAGL 1XR8B 3O6ML 3BVNA 3TBVB 1VB9A 2W9DL 2UZYB 3D3VA 5A2JH 3RWCA 2D0FA 4KAQL 4FTVB 2HKHH 5JDSA 4L4TA 1HH6A 3PQYA 2OL3B 4JPKL 1UYWL 5EO9B 3MLWL 1GZPB 2UY6A 4OUOA 5FYKL 1Q9LB 2NY7H 5SWZD 2YSSA 3PNWA 1UKQA 2V9TA 4JPVL 2YUXA 4OZIA 3BKML 1QSED 1K4CB 5F1NB 4PBVC 1WQVT 1X4YA 4F7MA 3QJHB 3GMRB 1AR1C 3DX7A 2IMMA 2XZZA 3FFCE 4KRLB 1QO3A 3VFSA 2OK0H 5IP4A 1NAKL 1HHKB 5GS2D 5HPMB 2AXGB 2ICES 3DBXA 3QXWA 4CU8A 5F1KC 3SDDA 5I8KH 4NO3A 4CVZB 1PQZA 4ZOBA 3MBXL 1BZ9B 2NY2B 2PKDA 3VFVA 4FQ1H 3LEXA 1SJHA 1Z6JT 5EIIA 1MHEB 3B2VL 4MS8D 5E08H 4XXCC 3TYFB 3AVEA 2A73B 4IHOB 1FRGL 2CUIA 4NRYA 1I85A 1A02N 2JELL 2R15A 3CFCH 4K8RL 4U2ZA 5FDWB 1NCBH 4P2RA 2NY2C 3QEHA 3SKNB 1BJMA 2XTJE 2W07A 1K3ZA 5A16A 1DEEA 4OZGE 1CR9H 3ARPA 4GW5B 3E8UL 4K3JL 1Z3GL 1NBQA 2AJVH 3BOVA 3L95A 2DD8L 3O6FB 5F1IB 3NCEB 3RQ3A 1HNGA 2WWMD 2LTQB 4XNUH 5FF6B 2DQCL 4LFHG 4TPRH 4M43H 4MQ7A 5F6HJ 5C92A 3VWKA 4XHQA 1WWBX 3WIIH 3QEQD 5CZXC 4L29A 4ZS6D 5ISZD 2G5RA 3MJ7B 3LS5H 5CJOL 3O6FC 5F7EL 3MGTA 1RUAL 3DNKA 2ITCA 2GSIA 4YBHA 2LTQC 3L5XH 4OTXH 5JW4Q 4ELMF 3L7EA 1EEZB 2NZ9D 3O6LL 3C5ZB 5ICYA 1F42A 4MDIB 3QIWB 4KJYA 3ZE1E 3VRJB 4PJFA 3VXQA 1C5CL 3HI1B 3T0EE 4JFXB 2CJUH 3NZHL 4GXVL 1CI5A 1NCAH 1DBAL 3N1FC 4OD1L 3HNVH 3VGEA 3ZYZA 2VDPL 4QTHB 4N0FB 1MIML 3FQTA 2F54D 3C5ZC 2D0GA 4PLKD 4ZFGL 3GMPB 3WFEL 3HC0B 4WY7L 3O41B 3QIWC 4M7JH 4W6XB 3DHJA 1J8HB 1JGLL 2VH5L 3BKCH 4X9FA 3QZWB 4YH6A 5HDOA 1JHLH 4M6NL 5I8OL 3SGEH 1OL0A 3MV8B 2Y7QA 1L6ZA 4UTAL 5GS1B 2V5RA 3Q5TA 2C3WA 3O9WA 1N7MH 1BOGA 1WISA 2NXZB 5BS0E 4F9LC 3QIBD 2FJGB 2QSCL 1PY9A 1MFAL 2JCCA 2VR5A 2WIIB 1QFOA 1U2CA 5C0IA 5J0BA 3D69A 4D9QE 2C3XA 3AM8A 3RDTD 4XAKE 3U4EB 3ULUE 4Z95H 4HWBL 3REVA 2DOCA 5GS1C 4ZO6A 2NXZC 4R26L 4PP2A 2RAMA 3X3GL 4CBPA 5BV7L 5JIPA 3QDJD 3IXAB 4HUXB 5ITFA 4UU9B 1T21B 2B1AH 3GHBH 4X6CE 4ISVA 3EYUL 2EH8L 2ZUUA 5FO7A 3ROOA 1IGTA 5HGBB 2PYEB 2VISB 3QDHA 3HAEH 1HEZA 1A64A 1ZSDB 3QG6A 4LMQI 1RMFL 1OB1A 3MFFB 1EGJH 4OLXH 1JVKA 4TOYL 5B39A 2XG4A 2DLTA 1A7NL 2GQHA 4H8WC 5DHYA 1KG0B 3W0WD 5D1ZB 4IRSB 1W0VB 4RGND 4HS3A 1HILA 4QHUB 3GJEA 1KLGA 15C8L 4JO3L 1JNNH 3MV7A 4KTEH 3UAJC 1L7IH 5HYJA 5D1ZC 4KK8D 3HAEG 1NCWH 2DYPA 4IRSC 3O3BA 1HQRB 2Z9TA 4PYHA 3FCTA 4YXLL 2FBJH 4WWKB 2W65A 3RWFB 3PIQA 4ZXBD 3S36L 4DN3H 5JDJA 2R2BB 3TH2T 1C5BL 2BNRB 4RMVA 3RZCD 5DRZB 1JGUH 3FZUC 1T7WA 2NY1B 4FFWC 1S7UA 1PBYA 5K9JL 1SY6L 4L3CB 5JOFB 4KUCD 1MHPL 3ECBB 4EDWH 4LF3B 4WWKC