4X5QA

Crystal structure of fimh in complex with 5-nitro-indolinylphenyl alpha-d-mannopyranoside
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Protein FimH
publication title The Tyrosine Gate of the Bacterial Lectin FimH: A Conformational Analysis by NMR Spectroscopy and X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 40
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4x5qA00
5FWRA 5F3FA 1TR7A 3ZL2A 2JTYA 4AV0A 4LOVA 1KIUB 2JMRA 4X5RA 3ZPDA 4J3OG 2WMPB 4AVKA 3ME0B 4AUJA 4XODA 3BFQG 4AUYA 2UY6B 3JWNH 5FX3A 4XOCA 5AB1A 4CA4A 4AVIA 4AUUA 3JWNE 1QUNB 5AAPA 5LNGA 4CSSA 4BUQA 2XG4B 3MCYA 3ZL1A 4J3OH 1ZE3H 5IQOA 1N12A 4XO8A 5AALA 4XOEA 2J2ZB 5F2FA 5CGBA 5ABZA 3BWUF 1KLFB 5JQIB 3RFZA 2W07B 4AV4A 1UWFA 2VCOA 2UY7B 1PDKB 3BFWA 4XOAA 4XO9A 4X5QA 4XOBA 2XG5B 4X50A 5IQMA 4AVJA 5FLUA 5LNEA 4CSTA 4ATTA 1N0LB 5FS5A 4J3OF 3JWNG 4AV5A 4X5PA 3SQBB 4AVHA 5IQNA
chains in the Genus database with same CATH superfamily
3PFUA 2IC2A 3CPLA 4Y4FA 1BQLL 5EUOF 2OP4L 1UXSA 1J9RA 1KENH 4OSUL 3UIYA 4YSRA 5F9DC 4PRPB 2I5YH 1J9SA 2B4CH 3VXMD 2HT4C 3BXNB 5IREA 1CXEA 2WVTA 5T5NF 5HHMD 2GYSA 3FB6B 4AGMA 4AM0Q 4HYTB 3W5MA 3C60B 3CPUA 4GP4B 1FYTE 3WNMA 4CU8A 1YEDB 3APMA 3O11A 5E03A 4ZOBA 2GEQA 4XNZC 3CFCL 4HU2A 5C6WH 5A1AA 4L3AA 1V3KA 3BT0A 5DRWB 4L8SC 4Z76A 2HLAA 1U8CB 3MFFA 2YXMA 3LKQB 4G42A 5C0DA 4CBZA 1V7NH 3IFPA 3UMTA 1D9KC 4OH2A 1UT2A 1FWXA 3R4DA 3O4LA 2NNCA 2CBOA 4JFDA 4KX8A 3WUWB 2K6ZA 4W9EC 5EPMA 3SJVB 1QWUA 5DUML 4ZUUB 4E9VA 2WV3A 2XWXA 4PV9A 4RESB 5E95B 2ZZUT 2ADIB 2P5WD 1JRHL 3H9YA 4ESKA 4WFHD 1GC1L 2YC1A 3INUH 3PHAA 4IRSC 3MRCB 4P57B 3SGEH 4DVBA 2D0GA 3VXUE 2ZKYA 4UQ3A 3EXJA 1RU9L 3HC0B 5TD4A 1AH1A 1F18A 4FQQA 3FUKA 5AOLA 3HG0A 3CHOA 5GS1C 2VAAA 4OAWB 1G7QB 5T33H 4ZFOA 2YD1A 3AWFA 5HYSA 4OFYD 2PYED 3BLKA 3O8XA 2B20A 3CZKA 1QP1A 4QOKD 4WFEE 5TK2A 4KMLB 3G5ZB 1URLA 3GIZL 3VD3A 5E2WL 2ZAHA 3C12A 4GNKB 5EBLB 4LLQB 1GZQB 4GS7C 4ONHB 3J7HA 3I50L 5JXEC 4WGKA 1CFMA 5AL0A 3B2DC 2Z64C 5E6YA 2IQAA 3FRPA 1HTYA 1JGDA 1UWGL 3CGTA 1CK0L 1AQ8A 5ICZB 1N6QH 4IW4C 2Y0SA 3D9AH 3VQMA 4PJ9D 1S4IA 4AQAA 4ORZC 1DN2A 1D2PA 1XF5A 3AQDA 1N2RA 4M5YL 5LXGH 2ADFL 4HAFA 2FX8H 3QDJD 3H7BA 2BOCA 3EYFA 3RNKA 4HJ0C 3L95B 2WGXA 4OJFL 2WLYA 3MRIA 3MRPB 3NJVA 2APSA 4NWTL 1F4YH 5IW1A 1MJ7L 3V6ZA 1HHIB 1ZTXH 1U42A 2G3ZA 1EAJA 3RI5F 1TFHA 4GRLD 4LDEB 2CM5A 4A2LA 1A5FL 2QHRL 5DSCB 4PB9H 3CFDB 3NYKA 4Y2DD 5CHNB 4B9IA 4FA6A 3MV8A 4F7TB 3GSVB 4OGAD 1X4YA 2CIKB 5JHDD 5LQBL 1F4HA 2BIPA 2X6CA 3FQWB 3LN4A 4HGMA 4P4KD 2HB0A 3STLA 5JW5A 3ATAA 1JG9A 3LRGA 4L4TB 4N9GA 3ZKQD 4BFRA 5A2JH 4DO6A 4BYHA 1U36A 1AYRA 2OP4H 2Y9RT 1JDCA 4HJJL 3PGCA 3LRHA 4OSUH 4HIQA 4BWUA 4RGND 3VWJD 1QSZA 3H2WA 1KIUB 5CWSA 4GG8B 1Q38A 3ZPDA 5SX5H 3FT3B 1I8MA 3NFSL 5E1AB 2EDTA 5D7LE 5EHFA 1NCCH 3TJPA 2WXHA 5A43C 3BN3B 3FHQA 3EYVA 2F5BL 3CBRA 2XIBA 2B1OA 2ZSWB 1XIWD 5HGBB 2GIMA 3WKQA 1U58B 5H94A 1SHSA 4LVHC 4ZOAA 3FTWA 1DQLL 2XN0A 1ZA6A 2BP8B 3BUYA 5DJAB 4IHOB 4MJ2A 2UUDH 5FDWA 5DUMH 1ZT4A 1WISA 1IT9L 4NQDA 4R3SB 4A2EA 4MXQD 1JRHH 1L5GA 4G9FD 4GSXA 1GC1H 4HK3J 2VC2L 5DTFA 5FGBC 3V4VA 4EI5B 5MI0C 1RU9H 1XZWA 4DQOL 2CHDA 3HCVB 2NY6D 2D73A 4TYUA 1NCWL 4U1SB 4KBPA 4WV1A 4QJ4B 1E4WL 3MUJA 4TTDC 1U8OB 1R3IL 3JZYA 1SFDA 2F7OA 4KXCA 3GBLA 3IWVA 5L8KB 1IFRA 2FNWA 4JFTA 4DGUA 1UC6A 2EIKB 2OMXA 2F18A 1JGVL 1KBBA 5E2WH 1S7VA 5C3IA 1F97A 4JZNB 2VLRD 3GSWB 3DUHA 1M71B 5ERWB 1ZD6A 2GTQA 3I50H 3MLTB 3ARDD 3DOSB 3WXVL 4LOUC 1LE5B 3EH5B 3TN0C 3KGTA 5DEGA 1UWGH 4U1MA 2XG5B 1CK0H 3PQYA 2DWEA 5CU5A 1MUJB 1CJYA 2DPKA 4DK3A 1VKXB 2WQRA 2NNAA 3KPTA 1WZ1L 1FG2B 2L7EA 4N20A 3QIUB 4XWOC 1FF5A 1Y18A 3L2MA 1GIGL 4HLZG 1SLWA 1XR8A 4M5YH 2QJDA 5HVFB 1DN0A 4M7LL 3OWEA 5BZWB 2OJEB 2NNFA 5DC2A 2Z7UA 1XX9C 3ECBB 3HAEG 2BC4A 2WYTA 4OJFH 3BWAA 5I8OH 2M8XA 4OJYA 2ICEB 2BNRA 4NWTH 5ANMB 1UTDA 1F4WL 5DUJA 1MJ7H 2R0LL 4FJZA 1FV1A 4RZCA 1CICA 4HBQA 1A5FH 2N3JA 5HSFA 5J6SA 3DK0A 4QAMB 3ISRA 5L2KD 1TR7A 5D1ZA 3AY2A 3SN6N 4WUUE 1B4TA 2F74B 5JXEA 3FQNB 2Z8SA 4IKLA 4QRPE 3F85A 3OZLA 3HJEA 4HEME 4AW7A 4CN1A 3F7RA 4N24A 3JV4A 3MZTA 5HYJA 4OY9A 4HJJH 5B8CC 4LEOA 3KHQA 4LLUA 3VI4F 2JKJA 1QG3A 2FIKB 2PP8A 4FQ2L 3G5YA 5KSAC 4WZ9A 1IAIM 1JN6A 4YBLB 3SE9L 3O2WL 4WIQA 4ZW7A 2CLVA 1F2XK 4DIXA 5HDQL 3TOPA 4FFZA 1VFAA 2F5BH 1UKTA 3OKDA 1KBGL 5H4YA 4JE4B 2H9GA 3LKRB 3L08A 3QJVB 4M9PA 2HA1A 2I60L 4OZGF 1E8XA 3O9WD 4HUXB 3W11C 2UY6A 1BBJA 4IU2B 4IU3B 1TJXA 4EDWH 3HI1A 5SWZB 4U7MA 4U2YA 3WIIL 2ITDB 2C3GA 2KZKA 1I75A 2YWZA 1QEWA 2WLLB 5I0DA 3N43B 2DQCH 4KH2A 2BOBA 4APQA 5G4OA 5D5MB 2I7OA 1QLFA 3FSOA 5A6LA 3QRGL 4FULA 1VGKB 4DW2L 2A38A 5EO1A 4DVRL 4JVUA 1CBVL 2ETWA 3RIFF 4UM9D 2VLKA 1EH9A 4DQOH 3J27A 5F1NA 1BVLA 1HXMA 3CVIL 1NCWH 2VCOA 5AOKA 5CIPB 4YLBA 1E4WH 4MMZC 1R3IH 4QRFA 4UBDC 5FYKD 3L1OL 2HN7A 4GSQA 1BMGA 3PWUB 1R5IA 1OM9A 3RWCB 4QHKI 3D0LA 1CZ8L 2CH8A 4ZQKA 1JGVH 1M42A 1FIGL 1UHVA 1HH9A 1CFNB 3WXVH 1XZ0B 5TFSL 4WI2A 4XN7A 2XV3A 2Y5QA 4HKXB 4DERA 1QI3A 4JK0D 1CGWA 2W60B 4ZW6A 5I1LA 2DYSB 3MX0B 1WZ1H 1I7UB 5JR1H 1QR1B 1GIGH 4ZRGA 1KJ2B 3QXTA 3ENEA 4ATWA 4L3EA 4FQCL 3KJ6L 2BVUA 4OLWL 1B4RA 5AQ0A 1A6TA 4JREB 5D9SB 3LD8C 1K5NB 1ETA1 4M7LH 3IJYB 4QHNB 2PYFA 3SGJA 4C4KO 5FM4A 3P0YL 4P99A 1OM3H 1C5CL 2VLLA 4X4ME 3V0GA 3NIGE 1KIRB 5H2BA 1IQDB 4AI7A 1RZIA 2R0LH 2IBGA 4J3XA 5EIIG 3Q8EA 1RULL 3M46A 3P4MA 4ISVA 3CLWA 3K7UA 2NT0A 3BEVB 3ZMEA 1PG7L 5DRXA 5JOFA 1AZZC 1NOFA 1OTTD 4XMUA 3ZMNA 3WNKA 1GHFL 4IBWA 4W4OA 3C09C 4HWEH 5DLLA 3TN0A 2P5PA 4CUCA 1NKRA 5I6LA 2BLFA 4WSGA 5LWYL 2XZZA 1L9QA 1NAML 5DQDL 5C08E 4ONFL 2WSKA 2V3EA 4JJ5B 2V4LA 4FQ2H 3N06B 4A55A 4KRPC 4XBGB 5C0FB 3QZLA 2QDWA 4JR9L 1DQQA 1GAFH 4UYPA 4YDMA 3SE9H 3O2WH 4AE0A 5F7EH 1Q9OB 5J1TC 3N1GC 4MWFA 3U9UB 4Y0GA 4N26A 1NWOA 5EZJA 5EG6C 1KBGH 4TSAL 3GMLA 4HDIB 4A7QA 4MAYC 3VYOA 3ILQC 4GG6F 2I60H 4FZ8L 2XG4B 2QQQA 3O3DA 3RFZB 4NBXB 4WWOA 2DBJA 2ITEA 2XXMB 3LN5B 3WIIH 2ZAGA 2XZQL 1RP8A 1F4XL 4G5ZL 3SYPA 2CRZA 15C8L 4JRYA 2V3FA 4WFFD 3O3EB 2Q6WA 4DW2H 2O6DA 2WXIA 3P0GB 4DVRH 3D1MC 3PIQB 1CBVH 4PLJC 2L04A 1EAQA 3DDFA 5E8PA 1B4JH 4RRPM 5EBMA 1FVEA 3BPNC 1BBDH 1E9OA 3NDYE 4G70B 4J3OD 3VGAB 2BZDA 1JHTB 2EJ1A 3CVIH 1W8OA 4WENB 1BA9A 1E4KA 2BCKA 3K72B 4M8QB 4OGZA 3BFOA 3WFHA 2NCEA 2J6EL 3L1OH 3DTXB 4PJGE 2NQCA 1OTUC 2IALB 1CZ8H 3HZMB 2MOGA 4NZRL 2VZVA 1NEPA 1RSYA 2HT2D 4H8HA 4DH2A 1XGUB 2P43B 3CFUA 3FRUB 3HKZA 1SMDA 5TFSH 3WJMB 2WKOA 2J3SA 2Z92B 3THMH 1QQDB 3BD5A 1RP9A 3QI9B 3D87B 5EIQA 1QAWA 1WE5A 3VGBA 2BY0A 1F3RB 2Z1PA 3DIFA 5GS3A 2WTRB 2VE6A 4FQCH 3KJ6H 4OLWH 3LZPA 1KLFA 3NEXA 4EIUA 3BT2H 3E6HA 3VFUB 5FECA 4C54A 1XL6A 2N0KA 1JZ5A 5J6GA 1EJOH 3P0YH 5TE4L 1C5CH 2KKQA 3BVXA 4KMQA 4O2FA 4P46B 2E9GA 4ZX3A 2W95A 3SPJA 3LH9A 3T3ME 3BVNA 4XBPB 1KGXA 3LKOA 4PRIA 1NMCB 2VR4A 1RHHB 3HNTL 4FYQA 3IJEB 1RULH 1CDBA 2LOEA 2V7NB 1PG7H 4JPKH 3ZTJG 1X7QA 5E2UH 1GHFH 3MRHB 4K94L 1UURA 4ZMQA 4ANWA 2HCZX 5D1XB 1PG7X 1L3NA 1R1CA 2E6QA 3B3IB 3MYJA 1IU1A 5D7JB 3VFWB 3Q13A 4R4ND 1IEHA 1AZBA 3ZUNC 5LWYH 3HB3B 1NAMH 4PJBA 4N4YB 3WMSA 4ZNEE 5ISZB 3MTRA 4FFTA 5CUSL 4ONFH 2ZWYA 3RTQC 1G9MC 1F11A 1QLEL 2ESVD 2EVIA 1N59B 3CDCA 2JI1A 4IHBA 4PGCB 4AGOA 3GXFA 1BXAA 1G84A 2IAMA 3U4EA 1X5ZA 3IRCA 1TOXA 1U2CA 2Y06L 4HIJA 3BP6A 1FP5A 5DRZA 3LOWA 4HIHA 4MNGE 3INOA 4M48L 4YH6A 4J7RA 1T2JA 3DMMC 1SYSA 3LV3A 4TSAH 1UJ3B 1NWPA 1J8HD 3CUPA 4XE0A 1FQ9C 4PP2B 2FHCA 5F2FA 4KZEL 2ARJQ 5E8OA 1F4XH 2W0PA 2IAND 3BAKA 4NKOB 15C8H 4ILDA 3NRFA 2QR0B 4AYBA 1ZHLB 4FS0A 4D0DA 4XMKL 4QKXB 2YBRB 4AKQA 1TTGA 3FFOA 4UTAL 3NZUA 1E5YA 2PO6D 2VITB 4OLYH 1WD8A 2B1HL 4HMCA 1V3MA 2CJTA 4FQXB 1SEBB 1YECL 1I8KB 4J3UA 1JXDA 3MA7A 1X5HA 1TJGL 2D9CA 4RRPG 2HX7A 3S5YA 4FXKA 4GRMA 4F9PC 1OSPL 4JG0L 4MA8L 1S7RB 4K2UL 4NNYB 2PXYA 1ZKAA 2ZX9A 4X50A 5F3HB 3MRJB 2NY1B 1G7IB 2TRYA 3DRQB 3UTTB 4CNIA 1BM3L 4NZRH 4MAYA 1FCCA 2WXPA 1D5MA 4HUNB 4JO8A 4HD9A 5IQ9B 1KB5B 2BSTB 2WSDA 4MX7A 4LCVA 4YHPA 4FLHA 4KOBA 4B9CA 2Q76B 3QJQB 3V6FA 4C56D 3DX2A 3VCLA 1I3VA 3QUMB 1C8PA 1RPQA 2AJ3B 4XN4A 1WUNT 4UYQA 4A2DA 5FO9A 4OZIA 3Q06A 2WK2A 1PZ2A 4NJAL 1JV2A 1AO7B 4MB5A 1SUJA 4GQRA 1GOHA 1ETJA 4LHUD 2Z1KA 1DEDA 1IGML 1ZLSL 2GFBB 3N5AA 5I17B 3KPNB 4XNAA 3AGVA 2NTSP 1JZ4A 3BRFA 4H2AA 1EEZA 4J3OG 4EDXA 3WO3B 3T4YA 4JDZB 5TH2A 3P4OA 1RPKA 3UERA 3Q2NA 3IPFA 3VQ1C 4M7LT 4WWID 1V7ML 3BFQG 3FT4B 3KYNA 4TSBH 1E8WA 2E6JA 4LVEA 1K8DB 3TVMA 5C9JA 4K94H 2Q1EA 1QFHA 1P6FA 1ZVHA 3TM6A 1X5XA 2XKSA 3ECUA 3B9EA 3HMXA 1OLZA 4NAMA 4NSKB 2ADGB 5CUSH 1IAOB 4GIPD 4OIFA 4GUOA 2YGPA 4YC2C 1QLEH 2DKMA 3KG5A 5AVUB 3ZGIA 1A66A 1S7QA 4B60A 1C5BL 1QZNA 5C0EA 3FDWA 1RXLA 1UVQA 4E2OA 2R0KL 5AW7B 1FC1A 4LSPL 2Y06H 5T3ZH 5AG9A 2H47C 3UAJA 1MIML 3VFSA 1J87A 1FVCA 4RQQA 4M48H 1U8KB 2GJ6D 3VXTA 5IW3A 3N41B 4E5XG 3V10A 4UV7L 2FX9H 3SKOA 4NCC1 1CXLA 1FN4B 1GOFA 4H1LH 2GQHA 4R5TA 5LLIC 2HLEB 3N91A 4LRIA 1CL7L 5T1KB 4YFLI 3BUQA 4KGJA 1HQRA 3HC3H 5F1KC 3X12B 4IBVA 1PLBA 1RZGA 2J8UA 5JPMA 3MJ8B 4NHUA 4KZEH 1FO0B 1SQMA 4M61A 3WTWA 2A6KB 2WVVB 3LPPA 4P5TA 1IEAA 2CDFB 2XA3A 2AITA 2IXQA 5BS0D 3TV3H 2XN9B 3OKNB 5I9QB 4HG4J 4XMKH 4JHBA 3ZBMA 5I76A 1ZT1B 1G7JA 4UTAH 4MHHI 3G9VA 1A6PA 5IMOB 3TURA 1OQOA 2B1HH 1IBGL 3TPUB 3PWJB 4Y2DC 1ETZB 1YECH 2XXGA 5E00B 4YHZL 2RCSH 4NO5A 2VKXA 1TJGH 4P4KC 4UT9L 5DZNA 1OSPH 2FDBP 1KTDB 4JG0H 4JAMB 4MA8H 4FF9A 4S1QL 1JGEB 2E8YA 3DXAD 3RDTA 4A2GA 5DHVA 5LXVA 3VFVA 2VAJA 3QYNA 4GXVL 2H0FA 3DMMA 4ZUVB 3OPUA 4YDIL 3TBSA 1BM3H 1HESA 1AQDB 4OFQA 1RQ5A 4GBXD 1ACYL 1ET7A 2R23B 3HBQA 4MDJA 1XGYL 3V7MA 1T0NA 3HS0C 3P9MA 4HBCL 2NUTA 2JLLA 3CVDA 2BSCA 4IGBA 2H3NA 4NQXA 2CO7B 5GGVL 1HCYA 4LLMA 4A6YL 1LL1A 5KEZA 1JZDC 1DO6A 3DX6A 5BO0D 4ALAC 3MRLB 1AKPA 4M5TA 4QJ3B 1BMZA 5JTWA 4Z3TA 3CHQA 4PV1C 1I85C 3KAAA 4NJAH 4WTQA 2EE0A 5E5MB 3LX9A 3K2IA 5AWNL 3F5WB 2V3DA 4TQIA 2C1OA 4DNLA 3GSOA 1J8KA 4DEPC 3HZYB 3NA4A 4JFOB 3NFPA 4RAUA 1AXIB 1IC7L 1IGMH 3PDGA 4HKJB 4NPYB 1ZLSH 4YVUA 1B6UA 4YK4C 1WA0X 5EORL 1UOVA 4A7VA 1NCAH 3N2JA 4DAGH 2W38A 3PWPE 4LCCB 2RALA 4LVNB 1Y0LA 4FQ1L 3VXMA 5JYMA 2Q0ZX 2MQCA 3H9SD 3Q8AA 1V7MH 1WBYA 2AXHA 4H0HB 5CGYC 3MGOB 1DCLA 1TTFA 2NY6C 4HWZA 5IG7B 3WL9B 3BZEB 3REVB 1N8ZA 2M2DA 1NC2D 3I6GA 2WOBA 3FB5A 3LNDA 3ARSA 4UU9B 5AAPA 1JF1B 3KBPA 4XNYL 4DUXA 1RK7A 1OSZB 3QEHA 4UOW0 4XNXH 5EF2A 3FU8A 2F53D 1HL8A 3WS6C 1SLVA 1C5BH 2GW5A 5DFVD 4CAGA 2R0KH 3CD4A 2BP5M 3CX5J 2MCMA 4LAJH 1X6NA 2FZ3B 4U33A 5GRVK 1MIMH 4QXTB 4PJDF 1I53A 5K9KB 4P2RE 1YNTB 1Q72L 3TZVA 3IDGB 3QFJB 5MENB 2P5WA 4LHUG 4UV7H 3AW5A 2P5EB 1NC4B 5MERB 3SDDB 3HAEA 1ZJAA 1OAKL 2V2XA 1CL7H 3P73B 4EN2A 1ED3A 2VNCA 3CDZA 1AVAA 2DMHA 1E28B 3UBXB 2FD6L 4M6AA 4X8XA 3QJFA 3TBBA 5HJ3A 2J71A 5DURD 2YD3A 5K9OB 1QUPA 1E0OB 1VACA 2R2BA 4OFYA 2A74C 4W6YB 1O7DC 1FBIH 2PYEA 3EFDH 4HHAA 4ODWB 3TBWB 4LCWE 1BEXA 4PJCB 3BGFB 3EAKA 2KI6A 5BUGA 4QOKA 5IB3A 1PEZA 1AS6A 3ZE1B 2JELL 4J3TA 4YHZH 3QXWA 1UOKA 3GMQB 2XJKA 4ZTOL 4UT9H 4LKCB 1OOWA 2AEOA 3QULB 2OMVA 1BZ8A 4XZUB 1BF5A 4BA8A 4WGWB 2EE3A 3GRWL 5DJ8B 5A2LH 5HVGB 5GZNC 4JKMA 1SY6L 4K5LA 4OCMC 3D3VE 5BV7C 1YPZA 2Y7OA 1R3HB 5DFWH 5ES4B 2O93L 4PJ9A 3LNEA 3L8QA 4OLZL 3IXAA 4HS3B 3UG4A 3VWKC 1DZ0A 4GAGL 1OT2A 2HJLA 1A3QA 2DZEA 1ZDSA 3AWEA 4JFQB 3RPIB 4FL4B 3QDJA 1I1AD 1H3TA 3WKYA 3QZPA 4HBCH 3OKLA 4BSVB 3KS0H 3WTVA 1X5AA 2HJFA 4CVWA 25C8L 2E76C 3NESA 5GGVH 4A6YH 2APXA 4CRPA 4GAFB 2X89D 2AMGA 3CWGA 1CLZL 1YUHA 1MFBL 1HOCB 3MNWB 1E8ZA 2CRIA 3ARPA 2H6UA 3GGWB 4GRLA 3HVDA 3IYLW 3BMVA 4OIBA 4Y4HA 5AWNH 2V9QA 2BVOA 4Y2DA 2XFGB 5L7XL 2ICWJ 1RIVL 1PZUB 2A73B 5JHDA 2DLTA 4P4KA 1OGTB 1JIBA 1U2YA 2AV1A 1IC7H 5GSVB 4DN3L 1WC7A 1NGXA 4OTXL 1UWXK 1NFAA 1X6LA 3LMJL 3VTAA 2AQTA 2DI9A 2PWHA 5IM7B 4Z3EA 1Q94A 3G9AB 4I0PB 5TGBB 2VL5B 4NUJA 3SE3A 3VWJA 4L8DB 3OLDA 4OZ4B 3IRPX 4ELMB 5D2NA 3JWNE 1KPVA 3OJDB 4QMEA 4H8QA 3TCLB 2OYLA 3QQ3A 2IMNA 4PMFA 3VMNA 3SDYL 3J8F7 3DVGB 4FKEA 4L8BB 2IH1A 4WI5A 1N3NB 2VKWA 4D8OA 3VG9C 2Y7SA 3SODB 3M1CA 2XTJD 3N1FC 4XNYH 2PPAA 4LZKA 4ECNA 8FABB 1ZHNB 2X1QA 1B0WA 1XIWA 4XWGL 3ZL4L 4MD4A 3GJFK 4K3EL 2DL9A 3MREA 3FO2B 5EIVA 2E86A 1C7TA 3QDMD 4IKJA 1QZ1A 3NT0A 1IX2A 2J1XA 4KHXH 1T83C 3SDCD 4JPIA 5EWIH 3L2LA 1JVLA 5HYQB 4F1ZA 4N5EC 3IETB 2QKIB 4IKKA 5IQ7L 5I26A 4QXUL 3VXSD 2WO2B 3E38A 4G9FA 3QXAB 2Q8AL 5CD5D 1OAKH 5L4JA 1OARL 1NIEA 4LBEB 4NZJA 1EAPA 5D7EA 2L4OA 4X6EA 5EIIA 2FD6H 3EDJA 3RA7H 1DBKL 2VW7A 5BRZE 1JBJA 3QAZB 4G1MA 2AEPH 4JRFA 2AJZA 1LE9B 5PAZA 4H20L 2CK2A 4MJ4A 5IMLB 5MEQB 5I66A 1CLCA 2C4FU 3U1SL 1CBJA 1ASOA 4NKMA 5FK9A 1UKQA 4ETQA 5EDSA 2JELH 5CBEA 2VLRA 4Z9KB 4JFHD 1AAJA 4JL2A 4ZTOH 3EGSA 3G08A 3KW7A 5IBUB 3ARDA 3ZE0E 4N1CA 4KO5A 5EOTA 2FJUB 4Z23A 3AAZB 1RJLA 1F42A 3GRWH 1DLFL 1T7XA 3RWGB 3TONA 3CFQA 5ANHA 1SY6H 3HE6D 4R2GB 1BZOA 4RISL 2Z4TA 3ZJAA 4G7VL 3RZCC 3PPEA 2VR8A 4OLZH 4U3SA 5FHBL 3BAEL 4GAGH 1F6LL 3RUGB 3I2CL 5HPOA 1L7IL 3BLPX 3BIKB 1JWUA 3HI5L 3MACL 3AITA 1M1XB 5CJQL 4E41B 3TJHC 2MPAH 25C8H 1BEYL 1WAAE 2Z7WA 5E8NB 2H0EA 1QBLL 3MJGX 4Q6IA 4G8FA 5ILTL 5IBLD 2FWOA 1MI5E 1YEKL 4ZOEA 1MLCB 2GIYA 1CLZH 1XB6A 3F6IA 4BFNA 1MFBH 2H1PL 4GXUN 4U3CA 4I5BA 1XO8A 4Z78A 4QHPA 5IEKA 4QRRD 1THCA 2CHNA 3QEQE 3TBTA 1WV7T 2VN3A 4L1SA 3BH9B 4IBLT 2YK1L 3MI6A 4F5CE 5L2KA 2EUXA 3EG9A 1RIVH 3AB0B 4M03A 2BCMA 3RGVD 1RK1A 2G2RB 5K59F 4DN3H 1SXZA 1TNMA 4OTXH 1LXMA 1YZZA 4PWHA 3LMJH 4GI6A 3LS5L 5IMKA 3BP5B 3DGGB 5H37H 1OZUA 3PS6A 1UM4L 4JFPB 4X9IA 3IDYC 1YEJH 4LE8A 4G59C 3QWQB 2J88H 4UTBH 5DI8A 3ZKXC 3SJVE 2CKBA 4KKBD 1UWXH 1ZVYA 2EDQA 5D4QA 1GSMA 3CAFA 3F7VB 4CW1B 2W88A 2X0UA 2X10A 4TLSA 5IIEB 4U7SA 1PTZA 3SDAB 1KJMB 2VR9A 1B0GB 4UTBA 3L3JB 2FJFB 3H8NA 3MBXL 3ZL4H 2R1WB 4PJXE 2TSBA 3O9WA 4JRXD 5IHZB 4YDJA 3ZE2F 3TH2T 1NKGA 4PYHA 5G2NA 2R9HD 4PJBF 2IVFC 1U91A 4HJGA 5CJXC 3SCMD 9CGTA 3DROA 4M7KH 4Y5VA 1WHPA 3GWJA 3S3SA 3UTZA 5IQ7H 4EQ3A 1UXWA 4QXUH 2IADB 4LBAA 4CMMA 2Q8AH 1J88A 3JWOC 4KV5F 2HFFB 2WN3A 1WFNA 1OARH 1X5LA 4HCGA 2NTFB 5C7XH 3RVTC 4UM9A 1FC2D 2XN1A 1P5VB 5EBGA 1KCSL 2UXFA 5DGRA 1DBKH 1IGTB 3CFIC 3T8MA 2YAHA 1J05A 1A6UL 3WE1A 3T0VA 4Y16B 4L2LA 3A3YB 5KSVA 4ANVA 2ZXQA 3QQ4B 4IIQC 3U1SH 4E0RB 4L0YA 1LP9A 2NQ3A 5FS5A 1LQBC 1WFUA 4GAAA 1HL4A 4I87A 1J5IA 3CDFA 2BSRB 2E46A 3JYCA 4MJHA 1YG9A 1TETL 5AYUL 1L0YA 1DLFH 4PRPD 3NACL 4PJ7A 5C07B 1ASQA 1KLGB 2QTEA 3G5XB 4GXUM 4N0UB 4RISH 4G7VH 4FG2A 2JCWA 4AWJC 1UZ8B 5INDB 3ULUE 1BREA 3ARGB 3FQXA 3BAEH 3SGKC 1H6EA 3OAYH 3I2CH 3VFRA 4AT6A 1L7IH 4Z77B 5CFHA 4ZMZA 3HI5H 3MACH 3P11H 4HKZA 4G8GB 3W57A 3WJLA 4ZS6D 5ADOH 5CJQH 4YS4A 3LDBB 2EICA 1AP2B 3EUUA 5KZCB 1HE7A 2WXGA 4N86A 4U6YB 5FAAA 1UM6L 1QBLH 4P2CG 5F8RC 5ACMA 3RWHB 5ILTH 2ZWNA 1EHLL 5D2LB 4AUJA 3HZKA 1T03L 1DJIA 2H1PH 5SWQB 1WGVA 4XBMA 2CDGB 3RPKA 3ZYJA 5F7LB 3FQRA 4N2AA 3X11A 5EEUA 4M5ZL 1E5AA 3EGDA 4CN4A 2C4XA 2CBTA 1YC7A 4LSTL 1XCTB 5FCSH 4CADA 3NFNB 1JWMB 1SJEA 4JB9L 4CSSA 1J5HA 2GY5A 1KTKE 2YEVB 3T09A 4OZIF 4KOCA 1XF3A 1AS7A 1BD2E 1S5IH 4RRPA 4M6ML 5D96C 1LQSR 1ETB1 4PWGA 4TF4A 1IGJB 1TZAA 5DMKB 4WKZB 3ZMRA 1H15A 3RNQB 1UADC 4DO4A 1G4RA 5D1QE 4HZLB 2YD8A 4HOZA 4EZLA 1S7SA 3MRNA 2X6VA 4YLQT 3RU8L 1U8NA 3W5NA 5C0IB 2ATPA 1CYXA 5JQIB 3MBXH 5D6CB 4AV4A 4XNDA 2R2HA 4N87A 2WB1A 3MCLL 4XRCA 3FONB 2MNWA 1ZXQA 4Y9BA 4AXWA 4GP5B 1KYOK 5I0ZA 3FMGL 1O9VA 4MCNA 1A9VA 3BZ4B 5FUCC 3QHZL 4JKWA 5DR5L 4BZ2L 4R7LA 3E3QC 4FJ6A 1M7UA 1DANU 1G7LB 1P4BL 1J7VR 1HN1A 5ITBL 3K6SB 3W39B 1LM8V 1ORSB 3PP3K 2BMKA 5ESVB 3BHBB 5JO5B 1AIFA 3N1MC 4PY8J 5KJRL 1S8DB 3WLBA 3QO0B 1J0KA 1KCSH 1OD9A 1RZJL 5IKCB 4HUUB 3CHRA 2F6AA 1WGOA 3UPAA 5I16B 1A6UH 3GQFA 2CPCA 1FE8H 2F5AL 5DZVA 1HZKA 2X4UA 4P2QB 1IQWH 3I6KA 4PGEB 4PWEA 2OMYA 4PG9A 3D4CA 2EE6A 3ML9A 4H8PA 1MKFA 3ZX1A 4L4TD 2E9WA 5TQ2L 5JNYA 4U0QB 2FT6A 5ANME 5F3BB 5HHPA 2YEZB 1TETH 5AYUH 3T3PB 3ZKMD 4PJHB 4KPHL 2JK5A 5IZ7A 4K9JA 4PWIA 1TPXB 4KNSA 1L9TA 5KVEE 2B5IB 3IJSA 4FYTA 2WXMA 4U6XB 5DXWA 3S9DB 5FYKU 5TE6L 3BRGC 4M62L 4TQPA 1LO2L 1ZOXA 4P5KA 5I6OA 2ZUSA 3JUZA 1JP5A 1LO5A 3C6LB 5IMMB 4N2DA 3IRZA 4E5XA 4PGZA 1NA8A 3DJRA 5I1CH 4HUWA 2KLSA 2J7LA 3V6OE 1PY4A 3QYCA 1ZGLP 1CXIA 1K8IB 3GXIA 4TXVB 1EHLH 4PEEA 4E42B 2L8AA 3NP3A 1T03H 1ORQA 4RMQA 1MAJA 3BD3A 5BZXA 5D7KE 1EFQA 2DIJA 1ZS8B 2EIZA 2DQMA 2WHVA 1DDHA 3O41A 4XI5C 4WK4B 4BUGA 2ERJC 3MSPA 2OL3B 4M5ZH 1DJZA 2A99A 2X4TA 1U92A 3ULSB 5KBNC 3AGWA 2Q8BL 4ABUA 2VIRB 4LSTH 4TVPE 3IT8D 2DQDH 3QEGL 5DVNA 5E94B 2E9JA 4EI5D 2EYRA 5IB1B 4LDCA 2A9CA 4K07A 5HGHB 2W9LA 2YZ1A 5C3TA 2WLHA 3ZQXA 2YD2A 4M6MH 2YQ2A 4J8RA 2JKLA 2ESVA 1DJHA 4H88L 1ID2A 3GB7B 2Y7NA 4KKLD 1WBXA 2YAOA 5SWSE 3RWEB 2AXFB 2QMKA 5E1IA 2I26N 4XZ4A 4NO0D 4FERA 2WIIB 4UDTA 1HT6A 5DHEA 1OTSC 4NZUL 5AUMB 2EE9A 5KYNA 2DQTL 1MFAH 2JKWA 4ZYKA 3EJCA 5K9QI 1A7OL 2AKRB 1M7XA 3BFWA 5CCHE 4UQAA 1GC1C 2CM6A 1J8HA 3JZ7A 2J2ZA 4QRQA 4A7GF 5J4MA 4GMSL 3MCLH 4PRBB 2CUMA 4KZCA 4NRZA 2IH3B 4W81A 1QASA 2IANA 4JZJA 5IVOA 3B34A 5FGCB 3QIUD 4QXWA 3PJLA 3QHZH 3CC5A 1K72A 5DR5H 4BZ2H 3QRFM 2OXGB 1P4BH 4IBQA 2ICWB 2F0CA 2IPUK 1COBA 2PO6A 3CN0A 4N2BA 1BQRA 2ZSVB 1JCVA 3RL2A 4FP8L 3TS8A 3SKMB 2EZ0C 1U33A 4YSDA 4KK6D 4KRLB 1RZJH 5DYFA 4KMTH 1BF2A 2VZ3A 5AKRA 1W16A 4I88A 2BX5A 4KKAD 1KACB 1BVZA 4XE5B 5FV1L 2F5AH 2NZ9C 4CGUB 1CDGA 1LLAA 1A64A 2K70A 5CNHA 3OQRA 5TQ2H 3L5IA 1Z3GH 2WY3B 4GW1B 4B96A 3EADA 3PNWA 2YSTA 2EDYA 3MOQA 4KPHH 4WHDA 3VI3A 1XCQA 4X6CB 5EF0A 2X3AA 3W0WB 3MRFB 4P23C 4C56A 3UPRA 4TOYH 4P2OB 5LJYH 3BDBA 4HIIA 3GXPA 4M62H 1I7ZA 4WW1A 3MLSL 4LK4A 4CN6A 1LO2H 3QNZA 2JSFA 4DUWA 3U7AA 3VSVA 3MV9E 4PG2A 3MTXA 5HI3C 5JMRA 2F8VA 1O6VA 3Q8BA 3DX8B 4LHUA 3CN3A 1YPZF 4LFHD 4HK0A 3L4YA 3KXFB 2WB7A 1JPGB 1LO0L 2I7SA 4NQCE 2HVBA 3EYQD 1ACCA 2KHAA 5DEJA 2K4WA 3A6OA 5SWZD 3UPCA 1A6AB 3EOTL 4QRTB 3SKUD 4EIBA 3D2UD 3QUKA 1DO5A 1P7QB 2LU3A 2YSSB 2Q8BH 4X9YA 1RJYB 1AGBA 5AVYB 1W6WA 3ETSA 4PGDB 3QEGH 2IG2L 4QTHA 3SPIA 4GW5B 4PMEA 1GZPA 3OPZL 1IL1B 3NN8B 5ACZB 2B1AL 1NINA 3NPSB 5DHYB 4E9WA 2BRQA 2FWLB 3T8VA 4DEWA 2RFXB 3QYMA 4H88H 2VDLL 2BNUB 3T0ED 3NSYA 3MROB 1HXYB 2KZ1B 2OMWA 3B7UX 3DUUA 4Y4FB 1IC1A 3R7QA 4BCZA 1R3LA 1MF2L 3FHAA 2DQTH 1KJVA 1TQCB 1HAWA 3WU1A 2IWGA 2GJ6A 4KX9A 2DWDA 4UUJB 3LQAL 1J10A 1A7OH 2VDPB 5GGVY 2CU9A 4P4RA 2F58L 3G3LA 3CVHB 3DX7B 4GMSH 2VDKB 2Z31C 3WKML 2R2EA 3HNVH 3O11B 1NCJA 4KQ3L 3TWCL 1KMGA 4B41A 2O6PA 3BP7A 4OU3A 5BS0A 3MFFB 2VM3A 4M43L 4WU5A 2YXVA 3DC0A 2ZG1A 4M7ZC 3IFPB 5E6RB 4ZO6A 4K5MA 2QL1A 2J6WA 1QA9B 4JFDB 3TC9A 3QZOA 4L0PB 4TUUA 5EPMB 4YDKL 3T65A 1CFBA 3AFLA 2FYYB 4K23L 4FP8H 1MAML 2P4AB 5K9JL 4X6DA 5L4FA 2VXVL 1OAZL 1OKEA 1RIHH 3DBXA 1NEZB 2UVEA 4L9LA 3SO3B 4DVBB 4UQ3B 1YMHA 1YVLA 4XCNA 3DXAA 2KDYA 3POHA 5DC4B 1IE4A 3MOBL 4JO1L 4FQQB 4XXDA 3WNNA 2QVTA 3HRZC 4GBXA 4LHQB 4ZFOB 2QHLA 5CP3H 4HCRH 5HYSB 1ECYA 35C8L 2OS7A 2Q10A 3TCTA 1HEZA 2P3YA 4BCXA 2QPSA 43C9B 2XTJC 4OZFB 3LIZL 3T2OA 1Q9WA 1KG0A 3MVSA 3UYPA 1IVTA 2FBRA 2P42B 4HCRA 5IVXE 1LILA 1RVFL 1CYWA 2IGTA 4X5LA 1CFSB 3FRPB 3ABKB 3HHSA 3MLSH 5E4IA 5PCYA 3KR3L 1DCEA 4YE0A 5I75C 4OCWL 1WDAA 1B0IA 2I69A 5D1XE 1Z32X 3BYYA 5IOPA 1MCWM 1XXDC 4BV1A 1P2CA 1BJMA 3GMRB 4DZBA 4N90E 4AQAB 1CDYA 3H9ZA 2AJUH 1VFBA 3GSNH 5GQBA 1LO0H 1N2RB 3BPOC 2VQUA 5T1MB 4YHNA 3H7BB 2BOCB 5CD5C 3LPOA 2EDDA 2R29A 2EDRA 3EOTH 4Z3GA 1DEEB 1E4XI 3OSKA 3WKPA 3H9SA 3X3GL 3GSNA 2CUHA 3V6ZB 2IH8A 4XO8A 1NC2A 1HSAB 1G1CA 4XOEA 3WNJA 5SV4A 2IG2H 4ZMXA 3OPZH 4LXFA 1KXQE 5EOCL 1KC5L 2H26A 5E1HB 4GUPA 2ZUXA 4BSJA 1Z5LA 2B1AH 4UAOB 1NDMB 3JTSA 3LN4B 1UWFA 2WBJB 2BVQA 2NSXA 2F53A 3RWJB 1XGRA 3STLB 5JW5B 4WKXA 3KWVA 2P48B 4N9GB 1QWHA 3OLGA 3IAGC 2BW5A 2FEEL 1MF2H 3AJ7A 3PGCB 3ML8A 5JHMA 3L54A 2GK0A 2LR4A 2MQGA 3HE6C 2JJSC 4NLAA 3HC2A 3LQAH 3DYPA 1I8MB 4LL1A 3UBXI 1JFQH 4IQHA 4F24A 1PG7W 4LFHG 4IJ3B 1TZHA 4MJ5A 3HE7D 2FO8A 4KQ3H 3TWCH 1DUYA 4MA1C 4NCC2 3EYVB 3QI9D 2MKWA 4F33A 4Z7VB 1IC5L 2CHXA 2ZCZA 1HILB 4CVUA 1MZYA 2ID5A 2MEJB 3O4OB 3WENA 4M43H 1M7IA 3CZNA 4BM7A 2D3LA 4QDGA 1KN2H 4AIZA 3UTTE 4BK5A 1XBDA 1K4CA 4HF5H 2FBOJ 4F1SA 3BUYB 5FIEA 2IWKA 2CBQA 3FTXA 1UA3A 1KDJA 4NN6B 4FRWA 3PUCA 3DWTA 5FDWB 4YDKH 1OK8A 1ZT4B 3K6DA 4NQDB 4P46D 1MAMH 2VABA 3DPBA 4XBEL 1OAZH 1L5GB 3V4VB 4AGNA 5DTFB 2H32A 2JTYA 2WKGA 3EBGA 3QB7C 3K6FA 3TEXA 4OV5A 4E68A 1H9VA 2IPKB 3MOBH 4JO1H 3MLUH 2OCCB 1ERNA 1AO7E 4JE0A 1UH2A 3FYEB 2YAMA 4OZHE 1E42A 4Q2ZA 5J13C 1I1AA 3ATFA 2XY2A 3HFFA 4XNZB 1EHAA 35C8H 2OQJA 5ISZD 2QPUA 2EDHA 3VMOA 1S7VB 3IN0A 3QORC 2X89A 3LIZH 5B1JC 1SEQL 1IAKB 2V37A 1RVFH 1D9KB 3EFOA 1HC1A 5JW3L 4U1MB 3KR3H 1BM7A 4OCWH 3GEWB 2DWEB 2R9HC 4LKXB 3ESMA 3MRRA 2NNAB 4HJSA 3BI9X 3CDGA 4CMHC 1P7KB 4LGRB 2BO0A 1XR8B 2R2CA 1B0RA 4MRCA 1MCLA 4PCSA 3WE6A 4QHUA 1T6VN 2E59A 2EQDA 3KLLA 4R6UA 3S36L 2EO9A 1IGFL 2BC4B 3BWAB 3HRZA 4PHXA 3QO1B 2BNRB 1T1ZA 2QGEA 2WXQA 4J5VA 4GKSA 1T1XA 2Y2YA 3WN5A 4P3CL 4PJ5D 2KQMA 4RZCB 3L5WB 4MCYA 1FLRL 3OHXC 3UTQB 5T3XE 3KCPB 3C8DA 3SYAA 1G6RA 5IHBA 5I1EL 3BIAX 1XGQA 4KI5E 3AREC 2GUYA 5EOCH 1BVOA 4FQXD 1NMBL 3UGEA 1WIUA 2JCCE 1MRFL 5JUEL 3WIFA 1LWHA 4HAKA 3QDMA 2D8KA 3ECWA 3N42F 2WNXA 2XN9E 1FSKC 3PXJA 2NY1D 3SDCA 3GPEA 4KHTL 2UV3A 1QOKA 3G5YB 4NRXA 4PJAB 2DBLL 5CP7A 1U95B 3VXSA 3GDBA 3WV0A 1UGKA 3OAZK 1JN6B 4OLXL 4PD4J 3FB7A 1SYVB 1YMME 2GK2A 3PAVA 2CLVB 3U2SA 1AG0A 2QVIA 3EBIA 4UMGA 1VFAB 3BPCA 3OC8A 1IC5H 2YGQA 5CR8A 5I6KA 3ZRSA 1G4MA 1G94A 1EMTL 1QLRA 3QJRB 5LGKA 3AXHA 3CQFA 3ARQA 4LCUA 3C75A 2XCMC 2E75C 2GBTA 4CJ1A 1SZNA 1MH5B 2ORBL 1H5BC 1V5JA 2XKNB 5T5FA 5F9OH 4APQB 4MZ2A 4TULL 2D0HA 3A6CL 4N2MA 2FL5B 4XBEH 5KS9A 5EO1B 1BZ9B 3POCA 1Z9MA 3QG6A 4W9KC 2IF7A 3HE6A 3ARWA 3LTVA 3EGXA 5FA3B 5IUSA 1MLBA 3D18A 4U1HA 4BCYA 5GXBB 1NDGA 1HXMB 3VQ2C 2N56A 1SPDA 3ALPA 3DRTA 4L05A 4UCFA 3LY6A 5LCVH 4QUOA 2Z9TA 2C8NA 2VQ1A 3WIHL 1SXCA 2XPYA 3CZSA 5CJ8A 2BXZA 2YQBA 2HN7B 3JWNH 2Y7QA 3VMPA 1B3IA 1AC6A 3B2UC 3SBWA 2KZWA 2M1KA 4ZQKB 1EZUA 2N7AA 5LCVA 1R6VA 3VDCA 3AABA 4C4KT 1HH9B 2XQYK 1JZ3A 4LVHB 4NQVA 1I9IL 2K78A 2NT1A 3WY4A 2WQSA 4QRRA 3NCWA 4UNVA 1H0DA 3KVQA 3WFDH 1PX8A 1KF9B 2ICCA 3KD4A 3L5XL 5I1LB 1GGUA 2FJSA 4N8CL 4YPJA 3RGVA 2A0LC 4XMLL 5T1KD 1REIA 1QPPA 4KZ0A 5MI0B 3WS3B 1A6TB 4GAYB 4Z0XA 1BYPA 4Z7WE 1NLDL 2V5MA 1IGFH 1E7VA 1FNGA 2VLLB 3BKML 3QHFL 2FX7L 5H2BB 5HYEA 2WAHA 4CVXA 1IV8A 3S36X 1RZIB 3KGUA 5AAWC 4P3CH 5AZ2H 1WBZA 4GIOA 4XHJC 3RILA 2XRAL 3FAWA 3QFJE 3P4MB 3T0BA 3PNRB 5MENE 3K46A 4PQXA 3VXOA 3QWOA 5I1EH 2GJZB 1RZKL 1NMBH 4NRYA 3IGUA 2F54E 1VEOA 2OJ1A 4BXSV 1MRFH 2P7TA 5C0AE 5ALCH 5JUEH 1RY7B 2YJQA 3TN0B 2I27N 3UTPE 4JRXA 4YXLL 3WGVB 2H5UA 4N22A 4JQIA 2ZCHL 5JXAL 1BVNT 3ZKMC 1RIUL 2DLFH 4KHTH 3SCMA 3PXHA 2WBWB 3WFZA 4PJCE 4TUJA 3GSRA 2DLHA 1H3UA 1AC0A 4RA0C 5DK2B 4Q0XL 3ZE1E 3MDJA 1Z2KA 4OLXH 1DQQB 5EOQL 5FW7A 4Q14A 3ULUL 3KPLA 4MWFB 1GY2A 1XGPA 3KDMB 4JGNA 3C5JA 3GMLB 1BPLB 2PF6A 1RUPL 1W9XA 1EMTH 1BIHA 4EPSA 3O3DB 3UJTL 4QY8A 4NQQA 5IW6A 3MGTA 3FCBA 1Z9SA 3FUFA 2ORBH 3B9DA 4PRNB 1YEHL 4KVNL 4TS6A 1TCRA 3TYGL 4TULH 5BCAA 1EK3A 4ZD3H 3A6CH 1I1CA 2JF1A 5TJWK 2Y3AA 3BUBA 4FG4A 2LHAA 4WDIA 2L7JA 4PRPA 2YPVA 1A4AA 1UH4A 5KYYA 4B27A 3DX9A 3MO1A 1FVEB 3NTCL 1E9OB 1CIDA 2Z6FA 4KKLC 2FLMA 2P28B 3WIHH 4AQ1C 4LLDB 1KCBA 1YEDA 3NJLA 2ZF9A 4XN9A 3S5LB 3WFHB 1HZLA 2PWEA 2IDCA 3R4RA 3LB6D 1CF8L 4KKZA 1N10A 3UBGA 5DUPL 1U8CA 1EANA 3LKQA 5HI4D 2EYSB 4P48A 3W56A 1I9IH 2ED8A 1YEIH 2JJTC 2VLMD 3CLFL 1JD7A 3SDXB 4AMWA 3MUGA 3T3MF 2GTWB 4LPWA 3S2AA 4KJPD 4BFBD 2AK1L 3C2AL 3L5XH 3VI3F 1AD0A 4N8CH 1O75A 4MKTA 1MW2A 1X9RA 1A7PH 1NC4D 4I3RL 1EUTA 2NSQA 4XMLH 3SDDD 3EO1B 3MRCA 5JYLA 1KLFB 3LNGA 4TNVK 5TQ0L 2BERA 3HC0A 2BY2A 1JHKH 1GGTA 1NLDH 5J6GB 5F7YC 4ZX5A 1C1EL 4WNQB 3BKMH 4P0DA 2OK0L 4O2FB 2FX7H 3V7AE 3SBRA 1WLHA 3BVNB 4GKZB 4P8QA 3LKOB 4MMZB 4KK6C 1OOAA 1TCMA 1QYGL 1TG8A 2KUTA 2WXKA 4F15C 2VMJA 4D2NA 1EDQA 1RZKH 3G5ZA 4G6FB 1X7QB 3RY4A 1EV2E 4ONHA 1QRNB 3RWDB 4YSCA 1MWAL 3GUFA 1BAFL 4YSUA 4YXLH 3UXFA 4FQLL 3LN9A 2ZCHH 5ICZA 3ZSSA 1RIUH 3CSGA 2P8PB 4ORGA 1F11B 3F6JA 3FOMB 4ATTA 2D03L 1M2OA 1Q1PA 4RWYL 2WUBL 4Q0XH 1PL3A 2IAMB 3ARBC 3U4EB 1PZDA 4FYRA 4HIJB 3BP6B 5EOQH 5DRZB 5C2BL 5KVEL 2E4TA 3EJYC 4HIHB 4ES8A 1TJIL 5E6ID 3MRPA 4JFYA 4LCYA 3OZ9L 4QXVA 1HHIA 1RUKL 3FN0H 3LV3B 4GQ9L 3CHPA 1RZQA 1RUPH 3S3PA 1MCWW 3CUPB 3HBGA 3V52L 3UJTH 5DSCA 3RUGE 4FTVD 3CFDA 5CHNA 5E2TL 4OVVA 3PWNB 5FF6A 3GSVA 3S97C 2CIKA 4M5SA 5LBSH 1YEHH 2BZCA 4KVNH 2HTLD 3C09B 2PCPB 3TYGH 4OBRA 2WZAA 5CZXC 4L4TA 4M1DH 4D0DB 1LWRA 3ZU8A 4AIEA 4I0PD 2WVUA 1T89A 3EBAA 3NQKA 4NFCA 3RY6A 5B39G 4O4YL 4TVPL 5FX3A 5LBSA 2PKDA 3V4PB 1GW6A 1U41A 3SEPA 3NTCH 4H5SA 1K3ZA 3MA7B 1CCZA 2JJUA 4KRPB 5J56B 5DFAA 2GCYA 3C6SA 4X6DF 4BD4A 2HLFC 1T20B 1Q9KB 3O3BB 1A1MB 1AE6L 1EWHA 1E9PB 4XXWA 2FUTA 4N2OA 4NIKB 1OPOA 4WF7A 2AMUA 1GZHA 2D2CC 4NZFA 1TYEB 3A24A 4CNIB 1KZYA 4MAYB 3SSGA 5FKPA 5HGBA 1PEWA 4GFXA 1D5MB 2V7HA 1U58A 1OQXA 4Y9GA 1OGAE 1Y07A 3DO3A 2X53A 3CLFH 3RHWF 5IJDC 2BP8A 3VW3L 3KLSA 5DJAA 3EJRA 1T0MA 4YHPB 4WEUD 3S2CA 3VCLB 5DWUL 4KTEL 5C0CE 2Z91B 4MDRA 4N2HA 3MLZL 1OL0A 4NZ8A 2HMID 4I3RH 2CWRA 2KL6A 2QGDA 1WFJA 2MIZA 4EI5A 1E30A 2AQ1A 5TQ0H 4X5WA 4G6AD 1GMEA 4KK8D 3V0WL 3BPNB 3EO0A 3W82A 1C1EH 1TU2A 4U1SA 3K8KA 2QSCL 1A14L 3U1PA 1HYRC 1U8OA 5IJKC 1QYGH 1R33A 4NO0A 4EDXB 3L81A 3T4YB 4RVBA 5FHAL 4RAVA 4ZZKA 1T4KB 1XD0A 5EV7A 3KYNB 3TVMB 3V8CA 5ERWA 3O6FC 1LD9A 5C9JB 1ZK9A 1KJ3L 1BAFH 3OG6B 3OAWA 4KROC 4XVUD 3OAUL 2ICWI 4FQLH 5DHMC 4R2GD 2DLGA 2E27L 3ZZSA 1MUJA 1VKXA 3VD1A 4NPKA 3TIDA 3BH8B 3QIUA 4AGPA 3SPCA 3ZHNA 5C0EB 3IFNL 4RWYH 5B4MD 1UVQB 2WUBH 1S7TB 2ZKHL 3MBWB 2CGZA 2OJEA 4E41D 3PDOB 3ECBA 4PS7A 5C2BH 3RAJH 3VFSB 5KVEH 2GAZA 4NAQA 1TJIH 5FFLA 1G0YR 4Z7UB 5IK3B 3FW6A 1JWSB 5C07E 4HKBA 1M9SA 4GQ9H 3SKOB 3MRMA 4BQ8A 2IWEA 4E9YA 4N0UE 1NFDA 1P4LA 5DO2D 4I0CC 1U8LB 1M53A 2J8UB 2A3TA 4NHUB 1AQHA 2WXRA 3C5ZD 2DS4A 4X6BA 4KZDH 4G8GE 4P5TB 3FQNA 4TUKL 2WZPD 1E6JH 4K3DH 1SJMA 4KX7A 4OB5L 1T7VA 4WJKB 7PAZA 5I76B 1FZJA 4F58L 5D2LE 5IQLA 3RTQB 3A4EA 4JHUA 1SMAA 3MRBB 1KFAL 3GEFA 4O4YH 4TVPH 4OLEA 2FIKA 2GVYA 3AZUA 4BQ9A 5DMIH 3CZUB 4BFKA 1I8LA 4FHKA 4YBHA 3VD5A 3GUTB 2ICES 1TZIA 1I7RB 4XN1A 3I6LE 5CEYA 5DHVB 1NCUA 3VFVB 3DMMB 4F7EB 2LU7A 1HH6B 4B9JA 1N12A 2H3KA 4Z3HA 4J3BA 3OL2A 3OKMA 3ZDXB 1GCFA 4MDJB 2G9KA 3UH8A 2APFA 3LSOA 4RWHA 4YGAB 3S96A 2NUTB 2VMFA 4IU2A 4X42A 1Z5HA 3RKDD 5SWZA 1G1KA 4BFOA 3VW3H 4Y1AE 2ITDA 1ML0A 4IGBB 2H3NB 4NQXB 2X7LA 3D2UA 2NY5L 4LLMB 1ZWIA 1DJGA 3DX6B 1ITCA 5D5MA 5DWUH 3IWUA 5D93C 4Q9BA 3MLZH 3FN9A 1VGKA 4WHYG 5CIPH 3VXRD 3HUJB 2D7OA 1M3IA 3QUXC 2C1OB 5DZAA 3V0WH 4L4VD 2EDEA 1DQJB 2YO3A 2EDNA 3M7FB 4S1DD 3T0EA 5F7DA 1F3DH 2QSCH 1A14H 2ZWZA 4UMSA 5EUKB 2UYLA 3R7RA 5EUOB 3ZTEA 2W81C 1T5WA 4Y16D 3PWUA 4PJEB 3RWCA 3EIFA 3O2VL 2H45A 1KXVC 3K2KA 3VFOB 1Y0LB 1TTBA 4WQOA 4X7FC 1WBYB 2DIAA 1QSFE 3VFTA 4KXBA 2V0AA 4HWZB 4TMPA 5HHMB 1HDMB 5FCUL 3PJNA 3UBFA 5C8JA 4F93B 2VUYA 1KJ2H 1CFNA 1H3WM 2EILB 3I6GB 4UILH 1KJ3H 1VEMA 3FB5B 3O2DH 3P2DA 2IPUG 4KDTA 4HKXA 2HP4A 4X5PA 1WH0A 3OAUH 3D39E 2W60A 1QFPA 4MVBC 2BHYA 2E27H 3P0VH 5E4OA 3QP3A 3QEHB 1I7UA 3ARGD 5AVVB 3PV6B 1KJ2A 3IFNH 1OP9A 2EH8L 1TO5A 3O2DA 4NN5C 3DO4A 4HFWB 3P2BA 1QSEE 4KXZI 3MMEA 1CE6B 1EJ8A 2ZKHH 4POZD 1E3FA 5I1AB 4RBPH 5C7ZA 4QHNA 1YLBB 1MFCL 5ICUA 5KZCD 2DI7A 4BJLA 3M6DA 1IQDA 1MEXL 2PP9A 4N0YL 4PJHE 4LPCA 5H8DA 1RH8A 3OGCB 3F62A 1LEIB 5J6HB 2V9TA 5CINL 1ED3B 3CDZB 2V5SA 4QI3A 3GJEB 4DCQB 3AT8A 5TDOB 4KQ4H 4HW6A 2XXCB 3QJFB 4TUKH 2UXTA 4X8GA 3QNXA 3D3VD 4JFSA 1VACB 2CCLA 1KGCD 3CMOL 5CLXA 1YYCA 4HHAB 1NPJA 5BMFH 4F58H 2DAVA 1MVFA 4R96A 5IB3B 3BP4B 1KFAH 4YC2B 4RDQG 2XQ0A 1ONQB 4XBGA 5CR1A 4WW2A 3FBKA 1LDPL 1OAUL 1NGPL 3ZTCC 4DESA 2C7FA 4ZXBC 3STZA 3J2PA 2CRYA 1WCBB 3U9UA 3ZKND 5AZUA 3L9YA 4WK0B 2H8PA 5IWLC 3O3AA 2QGCA 3IXAB 4K9EH 4CKQA 4HDIA 4GEIA 2DJSA 1TTAA 3BSGA 4HMDA 5IF0A 1OHQA 5C92A 1J0ZA 3RFZA 1YJDL 2MQ0A 4S1RL 2B9BA 3AMLA 3LN5A 1CO1A 1WQVT 3L5HA 5A2FA 32C2A 2AK4E 2Q9OA 1YUHB 2SEBA 2GSIB 4NWUL 3O3EA 4QHMA 3HR6A 4KNQA 3FU3A 5L2JB 4Q4IA 5HVHC 4WFGE 1ROCA 1QNIA 5FLVA 1IGCL 4Y2DB 2YPLE 5KVGE 1EZVX 1UXMA 5MHSD 5JHDB 3OX8B 4P4KB 4ZT1A 1P53A 3Q9PA 1NGXB 4RAHA 1Z0NA 3K72A 5FC9A 4JFUA 4M8QA 1Q94B 2F7QA 5B3JE 3DTXA 4KKPA 3IXTB 3VRIA 2R56L 3O2VH 4P2QD 4RGNB 3VWJB 5D2NB 3HZMA 3D08A 2GG1A 4KK5D 2WCPA 1DVUA 3QUML 1R19A 4NFBA 4YFLF 1XGUA 3HS0B 3O6LL 3ISYA 3LAFA 4KAQL 5IB2A 3HE7A 3T9WA 1YYML 2IH1B 3WJMA 5B3SB 1CG9A 1PZSA 2Z92A 3T4AC 2OM5A 2IPTL 3QI9A 3D50A 1L7TL 4R83A 2DD8L 3OD3A 3LHPL 4W4NA 3COOA 2UWEB 4MD4B 5F70A 3KM1A 3CFKA 1TVHA 2WTRA 2ZE0A 3CFJA 4I2XE 4HA1A 2RGSA 3E8UH 4MS8D 3VFUA 2YBGA 1F13A 3NJJA 4WWKD 4HU8A 1MFCH 4JPIB 1YQVL 4DEPB 4ZMYA 1GJIA 4P46A 1OWWA 1MEXH 3BGMA 2NY3C 4N0YH 1AHMA 3MA9H 4XBPA 1QNZH 4X6CE 4G9FB 3W0WE 3ZDYB 2MMXA 1KXVA 5CINH 3IJ8A 1IGYB 2W5PA 1EAPB 5C0NC 2VLJD 1URZA 3GJFA 3U7WL 3ZE0F 2NY6B 5EIIB 3MRHA 4JS7A 1RUML 1FCGA 1JNHB 2WAQA 4NHCH 5SX4I 4G1MB 1SDDA 3O0RL 4RCAA 3GTTA 2AJZB 1OE2A 1FZMB 4N8VB 5ISZA 1LNUB 4NKMB 5FK9B 5B7EA 3L9RB 5T3XL 2VLRB 1N59A 2R69A 3OKKB 4PGCA 3G08B 3U82B 3MV7D 2PTVA 1LDPH 1WAAF 3DX0A 4X99B 1RFDL 1RJLB 2JFCA 2K6WA 3LVTA 4HALA 4PY8I 3JQOB 3NCEB 4MAZA 4P9ML 3NUKA 2BDNL 4NBYB 5GGQL 2WBXA 4WO4D 1E3ZA 2NX5D 1UJ3A 1V3LA 2MHAA 4KJYA 1JPEA 1JWUB 4A38A 1YJDH 2UZYB 2WWMD 4S1RH 4NN7C 4X4YB 3H85A 4HZAA 3B2VH 1QKZL 5HBBA 4G8FB 2FWOB 4JKKA 4BUHA 1B90A 2QR0A 4NWUH 4PJ5A 4I5BB 4Z78B 5IEKB 4JN1L 4BSWA 2D3NA 2VITA 3KWTA 2UXVA 2MPVA 4FQXA 1IGCH 1SEBA 3ULVD 1I8KA 3EG9B 3B2PA 4LPVA 2VXTL 2HKFL 3UCRA 2NXYC 5LG1A 2IGFL 1MCSA 1CR9L 4QF1B 4X2UA 3VDBA 1Z9LA 2NQDA 2VZOA 2R4RL 3QCTH 4ICXA 5ABAA 5IMKB 3CQPA 5F3HA 1G9EA 5BV7B 2RD0A 3NEEA 1QWNA 5JHLL 2RQ8A 3JTTA 4JFDE 4W68A 3DJZA 3O4LE 4D0BA 3QUMH 1AGFB 3TH4T 4MBRA 1K6QL 5GGTL 3O6LH 4JL1A 4WEBL 5IQ9A 1KB5A 2KZBA 3W38A 4RNRA 3B6SA 1YYMH 1MCJA 2MQ3A 2X2IA 3KYMB 3TA3C 3MBEC 2X4NA 2IPTH 4ONGH 2J5LC 1YO4A 3FC8A 2E7LC 1L7TH 2YXWA 5L4IA 1ZA3A 1JXGA 2DD8H 1CS6A 4GI9A 3LHPH 2H6PB 3OM3B 4P2OD 3VQLA 1A6WL 1H8LA 1EBPA 5HI4C 3KPQA 3OWRA 4YDJB 3GI9L 4QO1B 1W0VA 4E9SA 1MFEH 3GBEA 3VAEA 4TL5A 1MHCA 4L8CB 3UROR 2NW3B 4KJPC 3DROB 3QZBA 3DDGA 3KXFD 2WWNA 4F7PA 2VXQL 3K1KC 4PLOB 5I17A 2X4SB 4CMMB 1CXKA 1IJ9A 4Z7QB 1HHGB 1E4XL 4XVOA 4LSRL 3REWB 2CRMA 4UM9B 1P7QD 4JM4L 3FT4A 3R18A 3U7WH 3UFIA 1K8DA 1F1DA 1PZCA 1RUMH 3FUIA 1J05B 3O0RH 4D8PB 5A3ID 3VG9B 5KSVB 2VJ8A 1S78D 3I85A 4HT1L 1LP9B 2ADGA 1IAOA 4JQVC 3V0JA 4KRMB 1VENA 5T3XH 1GJWA 1U8PA 2M83A 4P2YA 5J3HC 1SDYA 2NZ1A 2I24N 3HJ0A 1KSRA 1RFDH 5KVMC 2QLYA 2BJML 2PPDA 3V5DB 4HWNA 5EMYA 4PJ7B 5JIMA 3EYUL 4P9MH 1U8KA 2CGYA 1FO0H 2BDNH 5GGQH 5JPNC 3RVXC 1UD3A 1DVYA 4KTYA 3LPGA 1NDTA 1INDH 3MV8E 4AT6B 4XPFL 5C0JA 5T1KA 1OHZA 1JS4A 1ZTXE 2JXMB 4HIXL 4HKZB 4MAUH 4WWNA 4Y19B 3X12A 5G4NA 1VFOA 5DYOB 3ZT7A 1FO0A 4I4WB 1QKZH 1Q8MA 5E6IC 2A6KA 2WVVA 2IDSA 3K6IA 2PP7A 2CDFA 4LAQH 4TLTA 1S3KH 1BD2D 1BXXA 3QFDA 4G80A 4L29A 3JYBA 4JN1H 2ALAA 1ZT1A 1BQHB 4UQCA 1RUAL 4PN6A 1AQMA 5E4EC 1FFOB 3U4AA 2UZIL 3PWJA 3U4BL 3MJ9L 4HJIA 1DVXA 4CSTA 1IO4C 2NDGA 4K8RD 2VXTH 2HKFH 3WG7B 5BVPL 2LABA 3CIQA 2HTLC 3D7PA 4HJTA 4CADB 1U3NA 1SJEB 2DQUL 5B39A 4JAMA 2F68X 1JGEA 2WWOA 3AM8A 3CSBA 1XF3B 3AS0A 4NNPH 3R8QA 3KPPA 4ZUVA 2EE2A 1WS7A 2IQ9L 3B9AA 3HG3A 3RZCB 4UINL 4E9QA 3MLXL 5JHLH 3GSXA 5C09D 2CO2A 3SHSA 4N2FA 1R5WB 1LO4L 2AXGB 2R23A 3D69A 1MJUL 1RMFL 2CQVA 4NQDE 4WEBH 4BFEA 5JIPA 3UG3A 2XBTA 1S7SB 2X87A 3MRNB 3MKKA 2CO7A 5EBWA 3N50A 2JB5L 1U8NB 3NK4A 4F7CA 4Z7AA 2ATPB 3H3BC 5AD0B 4POYA 1YEWA 3IKCA 4GG6B 3MRLA 4R7NA 3SB3A 4KK9D 5KYXB 1QO3B 1NQBA 2ZWLT 3KPSD 4XAKE 1CTOA 3GI9H 2X1WL 3VGDA 3F5WA 1WFMA 4FG6C 4JFXB 3W1ZA 3WEOA 4Y8AA 3DOIA 4I77L 1LYQA 2OMUB 3JVGC 2ENPA 5LN8A 4JFOA 1XWVA 4NPYA 2XWRA 1ADQA 5F6IC 1RL1A 2DB8A 1SM3L 2YA1A 4X7CC 4D9RE 4B9KC 4Y7MA 1E4XH 2N59A 1QI4A 4LCCA 4GQZA 3IDYB 1TF4A 5LN4A 1DVSA 5AAMA 4G6AC 4RMUA 3WLBB 4JM4H 3MGOA 3WL9A 3ZKXB 4I48B 4AJYV 3BZEA 3OHMB 1A6ZB 3CVBA 3PQYE 3WY1A 5J1AA 2VMDA 5EZIL 2B39A 2LU4A 1UWYA 5IFJA 3ORJA 3EH4B 3DGCR 3U2JA 2X4UB 4HT1H 4V11A 1QFWL 4YBQD 2WBJD 1NGYA 4PG9B 1AACA 3HG1D 4PBDA 1F45A 2BNRE 5JNYB 4LPTA 5HHPB 1DFXA 1U8JB 1V3JA 2BJMH 2JK5B 1BDYA 2R7EB 1L0QA 2ADJA 2LV4A 4QXTA 3EYUH 5K9KA 43CAB 1J0IA 2EDLA 3QBTB 1YNTA 4IBUA 3IDGA 4NQEB 3IJSB 1XT5A 1EPFA 1JL8A 5JW4R 5LDSA 4U1KA 1HQ4B 1NC4A 4DP2X 5MERA 3SDDA 5B4MC 4XPFH 1NCDL 3VB8A 3P73A 4HIXH 3U36B 3W2DL 3DUSA 2XKUA 4DHLA 3AMKA 1E28A 2ROYA 4M3JA 3IVKB 3MUHL 5HYJE 4HUWB 3WKNA 4J4PC 1KPRB 4EEEA 5F88A 4YNYB 3BQUC 3KZ8A 4I0KA 4YXHL 5K9OA 1HI6B 4ZNEA 4PJFA 4YHKL 1UM5L 5MEPB 3TBWA 4HULB 4JFFB 4IIQB 3O41B 1GH7A 5DO2C 3QJTB 5SWSD 2W1NA 1RUAH 3K8LA 5DZPA 4JQVA 3ZQWA 2UZIH 3LQAC 2X4TB 2YAPA 3C5ZC 3U4BH 3N43F 2E74C 4B9GA 3GMQA 3QISA 1JZEA 4FXGC 5D5MF 5DA4A 3G6AA 1FGVL 3QULA 2BS9A 1K9TA 3IDNA 2YD0A 4XZUA 1GSKA 3RI5K 2DQUH 2XYBA 4XVJL 1BSIA 2HT4D 4JKPL 2B3RA 3CJJA 3ELQA 2X12A 4QT5B 3LH8A 1FL6B 4XNMA 4HS3A 4UINH 4RMVA 2GI0A 3KYOB 5KANI 1LO4H 4JFQA 4H8WC 1MJUH 2DWXA 4Q9CA 2H1LM 3SKJL 4JFED 4C4BA 3JVFC 4WI0A 1AIZA 5FYLE 4PVNA 4NQSA 2NOYA 5E6IA 2PCYA 2JB5H 4OF8A 3BX7C 1ES0A 4XMZA 3GRGA 3GO1L 4YR6B 1J18A 5ECJE 1TITA 5ENWA 4WHYH 2VLKE 4KNUA 4AEIL 1J8HB 1D9KD 2WANA 1YUKB 3GGWA 3L4ZA 5CKGA 4FTVA 2OMBA 1I7TA 2AJXL 2UZXB 2A73A 4JZJB 4WSJA 3FU0A 3SQOL 3F64A 3FUDA 1WCQA 3UEQA 3PLYA 4IRSD 1SM3H 5I74C 4I0PA 1FH2A 2P24B 2HVJA 2WLIB 4TUOA 1NEZG 5D96B 4ELMA 3GSUA 5KBMA 1HWHB 3G6JA 3K5RA 5IQOA 3L3DA 2JKTM 4ZMWA 3LKNB 1JK9A 5DVMA 3ECVA 2K8QA 2ENSA 3O0LA 4M29A 4Y5YC 4ODSH 3ARFC 1CDCA 3BISA 5EZIH 4N5UA 1KLUB 4L8BA 4FDWA 3U30C 3FTGB 4L3EE 1J86A 4HJEA 1QFWH 3MV9D 1PDKB 3FO2A 3HKFA 2D7QA 4OZFG 3ARZA 4ONOA 3PNWB 4R97C 2ZWSA 4JVWA 5HPMA 3M07A 3MRGB 4GRWE 3VRLF 5DZJA 1BFSA 4X8JA 1XCQB 1UEYA 2CKNA 4C56B 1RURL 4OF5A 5E5LA 3QXAA 1I7ZB 1NCDH 2Y72A 2VISB 3QNZB 3C9NA 4HJ0D 3Q0HA 4NP4L 4GY4A 1DQKA 4JY4A 3TBVA 3W2DH 5IHUL 3OTTA 2AC0A 1CXHA 1DDTA 1WJ3A 2ZKWA 4HISA 3AT9A 3CXFA 5FM5O 4H2CA 3FCSA 4HK0B 1NANI 3DTUB 3V6BR 2ZXAA 4X5XB 4UT7L 1HX0A 2YD7A 4YHKH 5IMLA 1ZDQA 4EVNA 1BW8A 3WSQH 2FRGP 2DQEH 1ODUA 3WBDA 2F61A 1AGBB 3AAZA 4TLUA 3RWGA 4QTHB 5DJXB 4XVJH 1GZPB 4LOVA 4JKPH 4I9WE 3PF2A 4O58L 3MGAA 1HEJC 4LEXL 1GYVA 4PRHB 1UB5A 4G8EB 2FCBA 5CJ5A 3IJHB 2OMWB 3BIKA 3IN2A 4JRYE 5FFGA 3SKJH 4LLVB 4JPWH 1R3LB 4E41A 2F8XC 1NCHA 5JDSB 2PTTA 2WP3T 4GJTB 1P1ZB 4IRJC 2GJ6B 5E8NA 2DWDB 2X88A 5EN2A 3LXUX 3GO1H 4P07A 3MXVH 4D9QD 2OX5B 1MLCA 5IESL 4P4RB 1ZLWH 2OLDA 4NP9A 4AEIH 4BQBA 4DP1X 3KVPA 3L4CA 5F72S 2R2EB 4MXWL 2ERJB 4TV3A 1ZSHA 3AG3B 3LKSA 4UIKL 2J8OA 5GJSL 3BLBA 1DLHA 1WYJA 2AJXH 4UOQA 4UZUA 3BP7B 2WZPA 3SQOH 5BS0B 3HEIB 4WU5B 2R1YB 4FQHB 4LVOC 5D7HA 5JQHC 3JWNC 4XO5A 3BP5A 5JOPE 4JFPA 1X5KA 3T65B 4U1LB 5F96L 3WJJA 1P4IL 5AL8A 1KULA 3F7VA 1YMHB 2OMNA 5K59E 1MFNA 1SJXA 4G6JL 2UY7B 3SDAA 1ZHBB 1KJMA 4XXDB 3RIFK 2VXSL 1B0GA 3IFLL 4NDMB 3UYRL 2WPGA 3L3JA 1G7HB 2FJFA 5KYWB 3EYOA 1H6TA 3KCWA 4ZMPA 1J0HA 1SXBA 5AVTB 4LOUD 1MHHA 2R51A 4NKDA 4UF7C 4UZSA 2ENJA 2E7DA 3KHOA 3P3YA 2WNGA 4GYBA 4OJEH 4Z1PA 2NY4C 2W9EH 2EIDA 5F6HJ 4K4KA 1KEGH 2BIOA 4PRIE 3S8WA 4XWOD 1P7BA 1IBDA 1Q9WB 1KG0B 3TASA 1B88A 4JEGB 1XTLA 1RURH 3FQTA 2IADA 2VERN 4HV8B 1W8NA 3VXRA 3IMBA 4PYGA 3GZQA 2HFFA 4NP4H 4F9LC 4MS8C 1BYOA 2AJSL 5IHUH 5A2CA 4WWKC 5IOPB 1E9QB 3F01A 4J1UA 3RB7A 1P2CB 1PNCA 3ZE2E 4L4VA 3FXIC 4FNPA 3B2XA 4GH7B 1OB0A 4PJBE 5DO8A 1VFBB 5IR1B 4Q9QL 1MCRA 1FFPB 1FLTX 4QTIL 1BMWA 4UT7H 3UAFA 3QVAA 1XH0A 1UWEL 4EMZA 1TQTA 3NGBC 4Y16A 5BJTB 4O02A 4DOHB 4GMTL 1ICTA 3LZFL 3AG2B 3GZKA 3QQ4A 3H4FA 4P49A 4KV5E 5HHXH 4DP9X 1NMAL 1RZ7H 2BSRA 4L1TA 3KNBA 2HX9A 1PCSA 1NC2B 2BPBA 4DKTA 4IBZA 3DVFA 2ZYHA 1EXUB 4H26A 4XGZA 4F7KA 3BAIA 2AERT 3WDIA 1KLGA 2H26B 5GS0L 3G5XA 4XP1L 4O58H 4P23B 4FKHA 4UDUB 2NXZC 3HLAB 4W9IC 3JTSB 4LEXH 5KSAD 3ARGA 5INDA 4M6NH 1EFXD 2F53B 1XGRB 4QXGL 2CUAA 5GGUB 1FL3A 4MJID 3ATEA 4Z77A 1UD5A 1S9XA 4YSTA 4JFZL 1C8QA 4UT6A 1WA1X 1KGYE 3OR6B 3UDWC 2G9HA 4U6YA 1NOLA 3QE5A 4FFYL 2ARWA 4WO4C 3RWHA 2ENYA 4FHBD 3Q1SL 3C60C 4MJ5B 3V5HA 1SOKA 3W11D 3OMZA 4IDJH 1DP0A 2WWMC 2P45B 2BNQD 3FOLA 3ZL1A 4JPQA 3F84A 4F33B 1FH5L 5D8JL 4GLRI 4EQ2A 1XCTA 4P59H 4X7EC 5DURB 2P9RA 1LK3L 4N9OB 1XB3A 4YHIA 1K4CB 1KY7A 4NC1C 1J9QA 2I9LA 3QWRD 4G7QB 4OGXH 2DTMH 2FWUA 3B7YA 3EOAA 5IVZB 1TQBC 3T0DA 3OLIA 4FQPA 3NSDA 3OZKA 4K3GA 5D4HA 1P4IH 2VABB 4UBDD 2FJGB 4IMKC 4WKZA 3Q48A 5KVGL 4MQXC 2WJ7A 5HGDB 1MCHA 4G6JH 4OV5B 2PW1A 4UZGA 4G6FD 3UYRH 4OZIE 3VO0A 2WIMA 2VXSH 3IFLH 1HU8A 3GLZA 3KEHA 2I32A 3T6WA 4LARL 1QRND 2IJ0C 2H7WA 5D6CA 3UG5A 5T1DH 5AW8B 2VC2B 2BY1A 4LOEA 4PREB 4Q2ZB 1ROWA 2GC4C 2KPNA 4QD2E 3FONA 3MCG1 2I25N 5TF0A 3GMOB 1XSOA 4A2MA 2OQJB 4PSRA 1HL5A 3F04A 2C5DC 2JKSA 5CMAB 4UQBA 4MB4A 3BZ4A 1MNUL 4IK6A 1M6UA 4B5ZA 2CPUA 1G7LA 4M7ZB 3BVWA 3L5JA 3EFOB 5HI5C 2PCFA 1LDSA 1ORSA 4M93C 5ESVA 4GSDL 3BHBA 5JO5A 4UOW1 5DZOA 3MUUA 1S8DA 2ZOLA 3N41F 3CDGB 2YHGA 5IKCA 5HJGA 4QTIH 4Z5RB 1C5DA 4KI5F 1UD8A 1VRSA 2QSQA 1UWEH 4FN0A 2IIJA 2JCCF 4AV0A 4GMTH 3LZFH 4P2QA 3DV6A 3HRZB 3IM1A 1NMAH 3G04A 4PGEA 1SHXA 1KB9J 1T1XB 2DM2A 1EUUA 4AGQA 1RAMA 2Z65C 4MCYB 5F3BA 2YEZA 5E2VH 1AQKL 3S5ZA 1G6RB 2XZCL 4HC1L 3ULUC 4WEEA 1XGQB 3GHEH 1SQ2N 2KH2B 3TPKA 4NQUA 1TZ8A 2XTJB 5F44A 1S78C 3GMNA 3P3SA 4XP1H 5T3ZE 5GS0H 1OF0A 1YMMD 2LE9A 2J8UE 4KRPD 2WZ5A 3WIFB 2MJWA 1X5FA 2FO4B 3LEYH 3QDMB 4XTRC 3NJGA 5I75B 4JFZH 4RFEB 1T22A 2Z3FA 4ZJ9A 5IV2B 3KM2A 4WWKA 2YGNA 1MREL 4OBSA 1VAHA 4JM2D 3SE4C 4FFYH 3BUPA 4NRXB 1BVNP 1K8IA 1PZBA 3IGFA 5FKAB 4E42A 5CP7B 3VYPA 3Q1SH 3OXRA 1JZGA 4IRZA 1ZS8A 3WY2A 2V2TB 3K4DA 2D4FA 2OL3A 2VLJA 2I9TB 4XNUL 4AKOA 1I8IB 3BPCB 1CVSC 3EHBD 1FH5H 5D8JH 3WHXA 2FECI 1FGNL 4TN9A 1W80A 3KW8A 4JMNA 1OCWL 4UAHA 1T04B 5IB1A 1URIA 2RMNA 5HGHA 2LVCA 5I1HL 4YMPA 4JO4L 3KWWA 1OEZW 3FUNA 3DSNA 2WLKA 4HQQL 2K7PA 2ZP8A 4R7VA 4K8RC 2VDPL 1LVEA 3RWEA 5D1QC 2WQWA 3MV7A 1IAII 4DGYL 5KS9B 1D6EB 4MNQD 3CHSA 5E9NA 5KVGH 4XC3H 5AUMA 1OTUD 2YKLL 3MUY1 3UDWA 2I5YL 2B4CL 3ALWA 3HE6B 3NJIA 4X5QA 1HFUA 3EGXB 5FM8A 2EDKA 3S5LG 4U1HB 3D18B 4WO4A 1PU0A 2XFXA 4LARH 4MSWB 3DRTB 3RVVC 2RBLA 1NGZA 2NX5A 2AI0L 2IFGA 2VQ1B 4JCMA 2CO6B 1L0PA 1T2XA 5F7NC 5INCA 4MA1B 4A66A 3ULVH 2JKRM 1Q0EA 1UT1A 1MNUH 4GO8A 5DLML 2OXGA 3H4HA 3VXME 5KUKA 2ICWA 3NABL 4NQVB 4KK9C 4XCFL 5HHME 3DURB 1H0DB 2EC9T 4GSDH 4CVZB 1BQUA 2ZSVA 4MB3A 1YNTF 4I1NB 5T1JA 4IMKA 3INUL 4UANA 1RJZB 2YD4A 3GKZA 2EABA 3K2MC 4PPTA 5C0AD 1GGCL 4Y4KA 4FQJH 5GRZA 4LSUL 4A67A 4B9YA 5C0RL 3E80A 1AHKA 5I6XC 4WHTB 4AVKA 4Z7NB 5HVWA 2QVKA 1U8HB 3NJMA 4G8IB 4CVXB 1EAOA 5T33L 4M1CC 3UAAA 1EEUA 4GW1A 1IIKA 4F2MA 1JYXA 2AQSA 2P5WE 1UZ6E 2XZCH 3NCMA 4HC1H 3VXOB 1CFTA 4PJCF 4WFHE 2ED6A 3RTQD 1W0YT 5I5JA 4CL7A 3ZE1F 3MRFA 2VJ0A 2P7TB 4P2OA 2W9DL 3HR5B 2VSKB 4X9GA 5AENA 1S3RA 4L1BA 4D94A 5FYJD 1CGYA 4PJIA 5KBPA 5F1IB 3V6OC 4J28A 1TIUA 1MREH 3DX8A 5T1LB 3TO4D 2PYEE 1WPCA 2Y6TE 4QJ5B 4M3HA 1VA9A 1A7BA 3KXFA 1JPGA 4QOKE 1OAXL 1CIUA 1OW0A 2DMBA 4X7DC 1NAMB 3TIEA 4KITB 4P2AA 4QRTA 3KPLB 3UZVB 4AKPA 1P7QA 4XNUH 3WDHA 1F4YL 1XGPB 3CBKB 4JO3L 1K5WA 1ZTXL 1CDUA 3C5JB 3KPRD 4M8UA 1FGNH 3OHXB 1YPZE 1TMQA 2OR9L 4PGDA 1OCWH 2YZ8A 1GYAA 4L5FH 2BOLA 4QY8B 3AREB 3T8XA 5IW6B 1IL1A 2BM3A 5I1HH 4JO4H 2LTQC 1NLBH 3QDJE 2EDFA 4HQQH 5SX5K 1OALA 4JGUA 4UV4L 2Y5EA 2VDPH 3MROA 4FOMA 5EULV 1HXYA 4QHLA 2ED9A 4DGYH 2E4FA 4FE9A 5I5IA 1FSKB 2YKLH 4WDIB 5JIKA 2ZNWA 3AVEA 5KYYB 3DX9B 3MO1B 4UUJA 2DIEA 1JZ7A 3ES6B 2N7SA 2C9AA 4ODHH 2NY2D 4U6VL 3CVHA 1NCCL 3DX7A 2AI0H 4UB0L 5JHDE 2MSPA 2K8MA 5KSBB 4JY5L 3IGAB 1Z3RA 4G7SB 1PYWA 2HVKA 4K71C 2UUDK 2A6IA 3U79A 3FCTA 1CD1A 5DLMH 4EN3C 4RGNE 4QNPF 1T1WA 4KXZH 3GNMH 1BD2A 5D2NE 4M8VA 4HAGA 5I0XA 3NABH 3AS3A 3V4VL 4DTGL 1S7UB 4XCFH 1JTPA 5CD3B 1QA9A 1XHHA 3NIFB 4DT2A 5CEZD 2E7MA 3MUGB 4FNUA 5C86A 2ZUUA 3G5VA 1E50A 4CSPA 1ASPA 4BXVA 5CLZA 2FYYA 1AD0B 3T1WA 3SGDI 1BZQK 1MQ8A 3ZN6A 4YHOL 1NEZA 3QJUB 1FDLL 3V8OA 4Z95L 1GGCH 4MRBA 2BSSA 4LSUH 4AC4A 2XUWA 4MKMA 3W9EA 1A1OB 1JZIA 4V1DD 5C0RH 3MOAH 5A40E 3US0A 5LVEA 3D30A 5C09A 3V0DA 3APFA 3S8GB 1Q9LB 4G9DB 4WO0A 1PSKL 1NPNA 5HDWA 5FOJA 4G9FE 5E4AA 1A7NH 1DQTA 4LNVA 1XH3B 3ZDYE 4OZFA 43C9A 1DJWA 3OLEA 1PX4A 4ZDHA 4ABWA 5BUAA 2W9DH 3BZ5A 1KZQA 5F1OB 1CFSA 5A6MA 4JY6B 2NY7L 3KPSA 1VGEL 2E3VA 5AVSB 2D31A 1X4ZA 5IB5B 2VDNB 4M00A 1CTMA 4RDQF 1JGUL 3PAYA 3GMRA 5DZLA 1TJHL 4ORGB 2ZXGA 1CD0A 2BRRH 1MWAA 1OAXH 4BWTA 5T1MA 3RUGF 3CIAA 1R47A 2VLRE 3QUHA 1BJ8A 1KCLA 3AG4B 5IEHB 1A22B 1DEEA 4W9HC 5I8OL 1QLEB 5I6MA 3BRDA 1U4EA 3A23A 4JFYB 4LCYB 4MFHA 2RAMA 3NEOA 4JO3H 4MMYB 5C1MB 4N8PA 2CAKA 1HSAA 2OTUA 2OR9H 1DBBL 1NCTA 1T66C 4R26H 4N85A 4TTGA 3IF1A 1WIPA 4OGQC 3VM5A 2VN6A 4OI9A 3EJPA 4LMQI 5FF6B 3CFMA 3H6AA 1NDMA 4KFMA 3RWJA 2WBJA 4FI6A 4HMEA 4UV4H 3HG1A 5CN1A 5I24A 2B59B 5AKTA 2W8CA 5E70A 5ELIA 5ETUA 5EU6B 4YDLC 4F20A 4N28A 4WTXA 4MD0B 1TJMA 1SBBA 2NY5C 2X70A 1WFIA 3L9EA 4FFZL 1FL5A 4H5SB 5K1JA 3RGBA 2J73A 2GCYB 1OO2A 3C6SB 5L2KE 3NJHA 4U6VH 2RH0A 2B14A 4UTCA 4XX1G 1FAIH 4UB0H 4JY5H 1WG3A 4X4XA 5FOBA 4OQTH 2QMJA 5ESQB 3VGHA 2VDOB 5FO7A 4Z7VA 1HILA 3U6XA 4GPVA 3QPXL 2XLLA