4X5QA

Crystal structure of fimh in complex with 5-nitro-indolinylphenyl alpha-d-mannopyranoside
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Tyrosine Gate of the Bacterial Lectin FimH: A Conformational Analysis by NMR Spectroscopy and X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Sugar binding protein
molecule keywords Protein FimH
total genus 40
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4x5qA00
5IQNA 4LOVA 5JQIB 4AVJA 4AUUA 5AALA 1KLFB 1PDKB 3MCYA 5LNEA 3JWNG 3ME0B 4X5RA 1QUNB 1ZE3H 1N12A 5FS5A 4BUQA 4XOBA 4AUYA 3ZL2A 2WMPB 3JWNE 5FWRA 4XODA 4J3OH 5FLUA 5FX3A 4AV4A 5AB1A 4CA4A 1KIUB 4XOCA 2XG4B 2VCOA 4AVHA 2JMRA 3ZL1A 4CSSA 1UWFA 4AVKA 3RFZA 5F3FA 4J3OF 4AV5A 4CSTA 3SQBB 5LNGA 4AVIA 4XO9A 1TR7A 4ATTA 3JWNH 2XG5B 4XOAA 2JTYA 4X50A 5CGBA 5ABZA 5IQMA 2UY6B 2UY7B 4J3OG 4X5PA 5AAPA 3BFQG 4XOEA 3ZPDA 2W07B 3BWUF 4X5QA 5F2FA 3BFWA 1N0LB 5IQOA 4XO8A 4AV0A 2J2ZB 4AUJA
chains in the Genus database with same CATH superfamily
1MW3A 1UG9A 3I9GL 3KGUA 1FI8C 2DWDB 2IBGA 1AR1D 3B9KB 2D7MA 1MY5A 3NTCH 4Y5VA 3WNKA 2AEQL 3K3QA 4NQQA 5I0VA 1FLRL 5CGMA 1MRFL 2FJFA 3UZVB 1T7YA 1WD9A 3C6LA 4MCZB 1IZKA 3VFNB 2NXYC 2EDBA 3NJMA 5C2BH 4I88A 2EUVA 4UOW0 1KZYA 2R23B 2NY2C 4GNKB 1UUNA 4PLKD 3UEQA 2C1OA 4K9EL 1XCWA 4YDKL 2QGCA 2AZUA 5DRNA 4MXVF 1GSMA 1P1VA 5JYMA 3BIKA 4ZZKA 1C5BH 2Z8VC 3JT0A 1TEGA 3NEXA 4RAUA 1ACYH 5KYNA 1O75A 3V52L 4QF1B 5C0GB 4ZMAT 4M7LH 5IROC 3HI1B 5E70A 4XODA 3ZTEA 5I1JH 2GYSA 4W6WB 5AOMA 2HH0H 3U1QA 3QQ3A 3CZGA 3HZYB 3JWOC 1FCGA 3VYOA 4B9YA 2XV3A 1NCAL 1S9YB 1TTRA 4M29A 2J3SA 3IFOB 2R4SH 1KC5L 4CJ1A 4JFYB 2AQTA 3DBSA 5TE4H 4MGXA 4NCDA 3TN0B 2E9BA 3HS0A 3H3PH 2Y25A 1OAQL 2X4QB 3MRRA 3VH8G 2LLGA 1PGRB 4NQDD 3V6BR 2W9LA 3CDFA 5F0LB 1RUKL 1IO4C 1PLGH 4LVOC 5EA0H 5DJAB 1BLNB 2AXHA 1OE3A 4PJCF 1I1CA 4ZJ9A 3VQ1C 3FRPG 2P80A 2DLFL 1GH7A 3HB3C 2ZOLA 3TEWA 3C2AL 3GJFB 3HHSA 3VTTA 1U9KA 1AZUA 1Z5HA 4P5SA 1AE6H 2QBWA 1J9SA 1D6EA 4P57A 4WEBL 5EBLA 1M71B 3CN0A 3WHE0 4NO0D 4Z3EA 1T0MB 3VWJC 5IHWA 3IVKA 1ZT4B 1RZ7L 4ODSL 1MRCL 4ZBJA 4F7EA 3BSZH 1QBMH 1G6RA 4NO2B 2WBXA 5CP3A 5IV2B 3W3BA 3TN0C 4YEEA 3L5IA 1EJFA 4MFHA 2IH8A 3V4LA 4TS6A 2EKSA 4LK4A 1YNTB 2EDRA 4P5TC 5JPNC 4PB0H 3JSSA 2DQGH 5SWSA 4XBEH 1XEUA 3VQ2C 3EF7A 4TQEL 4XR8C 5AW8B 3LSOA 4YSQA 4DPBX 4TNVK 3TH3T 2RTTA 4FQXD 5AKTA 2JLPA 1T7ZA 2X09A 5F3BB 1VFAB 4FFWC 1GZQB 2WQ8A 4WFEE 2RBLA 1G0DA 4EN3A 2ZXBA 4U7MA 5FGCB 3I9GH 1MCFA 4WO4A 5DA0B 3UMTA 1XGTB 3OWEA 3EYVB 4OLWH 2IH3A 3KYOB 1PAZA 3L3JB 4PG9B 4EZLA 4QOKB 3G04B 4NKOA 5IIEA 4BKTC 3B2MA 2UX6A 2OV0A 3NABL 4FLHA 1RZJH 4PRHA 4J3OG 4X6FB 5L6YL 1PFOA 4NNXA 1DE4B 4C83A 1S9YA 5FDYA 1NPJA 3MLUL 4PYGA 5DC9B 4PJXA 1S78D 3KLHD 1SMOA 1LGVA 2A6DA 3CQPA 4NN5B 4RA0C 3TT1L 3D39D 4ZX3A 2F7OA 2ZOKB 1VPOL 4Q97A 2XQYG 1XH3A 4NKDB 4W81A 2VZSA 2A6IB 1NGQL 5A7EA 1AXSB 4HUXA 3P54A 3CHQA 4FZEH 4HMCA 1NGWB 3LS4H 3K72A 4M7KL 5I6KA 5EZJB 3IU4H 3ISWA 4XBMA 1INEH 4JHUA 4MKMA 4MMYB 2AJVH 4FF9A 4NSKB 4V33A 1S3KH 4P2OB 4WEUD 4HCFA 3IE4A 4N0UE 3FFOA 3PL6D 1RJYB 2DI9A 4K7PY 2YFOA 4LDLB 4O51A 3QISA 1NFDB 1SHWA 5TD4A 2V2XA 1PG7X 1OAZL 1CGTA 2PW1A 3WUWB 5E03A 1BVLA 1A25A 1ET8A 1FLTX 4TYUA 1VLXA 2O5XH 4ORZC 1QI4A 5DD6A 3E1F1 4N0UB 4YOKA 3E0GA 4W6XB 4M6NL 4N86A 2AJYL 1EFQA 4WV1C 3G5ZB 1L6ZA 4YFEA 2IAMC 4ZFOB 4AV5A 1I8AA 2YGPA 3LQAC 4HPOH 1BECA 1ZSDB 2YMXL 3LEYH 4BZ2L 2QT6A 5DURD 1A9VA 2CHNA 2HUEA 1E4XL 1CFNA 1KGWA 3QDGB 2ZNWA 4OCXL 5HHME 1KT2B 2ZPKH 4TULL 1RK0A 3I2CH 4PJEB 4UAHA 4F9LA 1PFCA 5GXBB 3L3DA 4DTGL 1U36A 5B39B 2B8OT 2WXNA 4P59H 2CJSA 5BUGA 4ELKA 3VVWA 5IJKC 1Q0YL 3S35X 5TFSH 3V0FA 4W9JC 4ZQKB 4ZMZA 1MQKL 3HI6L 2GTZB 3E80A 3BZ4B 2HMIC 1HH6B 4FCAA 1JRHL 3MNZA 3VXNA 3E8UH 4GQZA 4PBDA 4JM2A 3SD2A 5F1NB 4OLXH 1DVYA 3TBBA 1JJUA 4Y5YA 5E8OA 4NIYE 1NCDL 1UM4H 4WV1B 3G04A 1SNRA 3NJKA 2X4SB 3T0VA 1JYNA 1RIUL 4LLDB 4PJ8C 2WBKA 2Z92A 4AYEC 3O4OC 3MYJB 5L88L 5DD1L 3CN2A 3HBQA 1OCRB 5F7YC 2I25N 1F86A 3ZY7A 4YHYB 1QPPA 4ZXBB 4X4YA 1NUGA 3FCSB 5C07A 1KTJA 1M7IA 4BD4A 2VDKL 1ZOXA 5GJTH 2YD1A 1AGDB 3ARED 3NRQA 4KMQA 4BSWB 4P2OC 4GMTH 3AXHA 1XH0A 4ZSOB 1FNEA 3TH2T 2DQ6A 3K91A 2C9SA 1EHLL 4XCCL 1PEWA 1ZPLA 4PQXA 1AFVH 4MCMA 4QHPA 3TPUA 4KITB 4KVPA 3TA4D 3C5ZB 3ZMEA 3H53A 4Z23A 5KVEH 5GRXG 5IF0B 4FP8H 4OD2A 4QHKJ 2VLJE 2DBLL 2YN5A 3HE7A 4K3JH 2J8HA 4NPYA 4YLBA 5AB2A 1I1RA 5G55A 1I3UA 4JVWA 4Z7QE 1KXTB 1A6ZB 3JTSB 2YUZA 1PZAA 2FHBA 2ZSVA 4AUYA 2B2XL 3FQ2A 4ZOEA 5EC1B 2EIBA 2J8UB 3D9AL 2OSWA 2MNJB 1PY0A 1N7ML 3TJEH 4XCEA 3CXDL 4HWBA 4M62H 3KPSD 4Z7UE 1EO8L 3K6NA 3MV9D 4HLZG 4N2AA 2MKWA 1FPTH 2NMSA 1K4DA 2QKIC 1WIOA 2VXQL 3BESR 4WNSA 2DF3A 3TBTA 3VWKA 2NNRA 1T3FB 3SJVD 2NY3B 3KLDA 4P8QA 4A2FA 1MJ8H 1E8WA 2NY7H 4NM4H 1I8KA 5EOCJ 3RWCA 1NC4B 2QQKL 3LEVL 1CGSL 4W9LC 3ZQ9A 1CQKA 4G7YH 4LLMA 3MNWA 2VM3A 4OQTL 4OGZA 1UYWH 3SE8H 3WFBL 4N28A 1MFDL 5J8OA 1D5IL 4PRAB 2I9TB 1JNJA 1E8YA 1O7DE 1S7TA 3H9SD 3LPFA 1NIEA 4ZW3A 4NM4L 4HUUA 5IQMA 2WTPA 3J7HA 2Z34A 3WTSA 1JN6B 1KLGA 1NBVH 3T1FB 4P5TB 5I9QB 2BZCA 3HG1A 2HPTA 2WLJA 3QEQE 1Q0YH 4RX4A 4K3DL 4B96A 3HG0A 1SEQH 1U2CA 1KIUA 2MNWA 4P46D 3THML 4A2GA 4Z7QB 9CGTA 2X7LB 4MQTB 2YN3A 4IBLT 1U95A 2VKXA 4WV1A 2I24N 3MRBB 4HIJB 3UAJA 1GCFA 2OR9H 2QGDA 4HWBL 4DWHA 1OKEA 1QSED 1T2QH 1U3HB 1ADQL 2JCCF 2Z92B 1AQDA 2BIMA 2WXJA 1DBBL 1AZBA 4XP5H 2EXYD 2VTFA 1VRSA 3Q5OA 2KDGA 4ZFZB 1FNSL 4AE1A 1ES0B 3F00A 4L1SA 1R5IB 3BGAA 1MFVA 1U93A 2UV3A 3ZSTA 1GZHA 4GH7B 3APDA 2JELH 5C08A 3W81A 3KNBB 2VR6A 1CYGA 3QUMB 2DM7A 3TONA 5I0XA 5C97A 1FL6B 2Y23A 5IQLA 5F0PB 4EI0A 4DN4L 5DD1H 3IDMB 5AOJA 3C5ZA 4MXWH 3II3A 4YEFA 4PSRA 2FECL 2BSRB 2VZOA 4YR6B 1X9LA 4EI5D 4S11A 1XIWD 2JKLA 2NUPA 2PYEA 4D9RE 2Q86B 5E6ZA 3LH8A 1T83C 4JMNA 3GBML 3Q3GA 2VDPH 3FBQA 2AVFA 2F58H 2I60H 4PS4H 3LN9A 5GGQH 1CE1L 5FS5A 5BOJA 3L9RB 2FNBA 3ARFB 2KPWA 3CDYA 1RZKC 2VLRD 2Q8AL 1BF5A 3M1OA 5HPMA 3I74A 3MC0A 2PTTB 3WO3B 2DQCH 3MNWB 4K55A 1QG3A 3I02A 3O3UN 3MROA 1W6WA 2KYIA 1N70A 3LIUA 4O5LL 4OI9A 2VDQH 2L8AA 1EFXB 4APQD 2I9TA 5A40E 4AIOA 1MZYA 4UMSA 1U42A 1BMGA 2Z8WC 5MEQB 2VE6B 3UTQA 4ZUUA 2A9AA 4C56A 2RA1A 5IVXB 5FUOH 5FYJD 1EHAA 2IBZX 5I74B 3DO7B 4MMZB 2JKXA 4NM8H 5AWNL 1YYML 3RHWF 4DZBA 5MERA 4O2FA 5FX3A 4P48A 3KS0J 4H5SB 2FEDD 1QR1A 3VFSA 1EGJL 4EQ3A 5FO8A 3ZHLA 1OM9A 2VLJD 3VRJA 2HT3C 3LKQB 5JXED 2E46A 2HLFD 4Y19D 3QE5A 3H4HA 2HRLA 4D9QE 4PJAF 3SPJA 3Q05A 3TO4C 1CD1A 3EYUL 1KB5B 4FTVA 1KULA 2HCZX 3FN9A 3QEHB 2Y7MA 4NM8L 5AWNH 5GSVA 4L05A 4DETA 4IKKA 4NBYB 3I3EA 1M1SA 1HILB 3U48A 3ZHNA 4F1SA 5L7XH 3MTXA 2HFEA 1GZPB 1ONQA 2PYEE 3C5XA 3HN8A 3RVUD 4A6YA 1JZ5A 5DXWA 1BZ7B 2MTAA 2DWDA 3PIQB 2CO6B 2QR0A 4WJ5B 4X8JA 1T2QL 4YHYC 5I6LA 3QUML 1BM3H 1A4CA 2B1HL 2H3NB 4MWFB 2NX5B 3FONA 5DUPL 4DPAX 2WQAA 1F1AA 5DRWA 1KNOA 4FX5A 5CHNA 4G6AC 4FHKA 1K5WA 1KIQA 4KAQH 4IDJH 3L9EA 3RWJA 4RMWA 1NOLA 3K6SA 2Y7NA 4MTMA 1QLRB 2A73B 3TYFA 4WGKA 3KS0H 2JELL 5E5LA 4GSQA 4X5RA 3O2WH 1E6JL 5D6DC 2BC4A 3L1OH 4JAMA 1CU4L 3N50A 3TIDB 3DETC 4YHPA 2QVKA 32C2B 5DRNB 3TA3A 4ZMXA 5HHOE 2R69H 4IKNA 4QWWC 5D5ME 1SEBB 2GBAA 4JUTA 1UASA 5M95B 4J3XA 1I8IB 3FU9A 4WK2B 3DC0A 3IYLW 1CI3M 3CUPA 3GJFH 4QRQB 4RGMB 1OPGL 4BZ1H 2JKIS 2OYMA 2APXA 2CO2A 4XBEL 2E7BA 2FSEA 3QIWD 1N2RB 1CG9B 2EO9A 2Q6WA 4S1SH 3D2UD 1WZ1H 3QR0A 1URZA 3EJJX 1G6RL 1N3NA 3UIYA 5CN2A 3MRRB 5D2NA 3QRFM 2VE6A 3UTQB 5KG9A 4EBQH 4NCC1 1FORL 2B1AL 3WFEL 1A2YB 2IGLA 3SY6A 3T6VA 4O2FB 2X53A 4AYGA 4GP8B 3VSTA 3WKNA 2P5EE 2UXGA 4XNUL 3HHSB 2B59A 2P3YA 4LSUL 2BZ7A 2FT8A 2AGJL 4M7JH 4P9MH 3RB5A 4P57B 4K3DH 3JTBA 5EBLB 1XCQB 2Y2YA 3D85A 3PP4L 1IC7L 1ZT4A 1WBZB 1PD0A 3O8XA 4KDTA 3UTSB 3T04D 3IXTA 2AV7B 3D6GA 3ILDA 4U49A 4OJFH 3ZE0B 4WFGD 4H8VA 2P24B 4EUPA 1I9JH 3NA4A 4I3RH 3BAKA 3SPGA 3PWLA 1E67A 2XX1A 3S5ZA 1XIWC 1HL5A 5IKCB 1A3RL 3BWAA 4XN4A 2NY7L 5E8NA 2FX7H 4RDQG 3TA3D 4LVOB 4KK8D 4IOSA 2NTFA 1UZ6F 3ETBF 2BNRE 2LFGA 3MBEA 2GFBB 4AQAA 3TYFB 2P8PB 3UCRA 4ABWA 2IFFL 5CZRA 4FQCH 4W68A 1NKRA 3F3HA 4HYTB 1PZCA 2OTUA 4JM2C 2DLIA 1YN7B 3Q48A 4OCMC 5E99H 5JYLA 3US0A 4KZ0A 1KCLA 3LZPA 3EDDA 4ZRGA 1QKZL 2R0ZL 2XZCH 2J6EL 4Y2DC 2WBJB 1MWAL 1Q90A 1JCKA 3DX6A 5ELIA 4AK2A 2YRBA 5JUEL 1XSOA 3HOGA 1ZTXE 3CX2A 5KS9E 5LBVA 2A6DB 5DTFB 1MFEL 2CR3A 2OW7A 2OXHA 5FO7A 1MIEL 1JI2A 1UXMA 5IHLB 4NUQA 1N3NB 1MQKH 2VDKH 3H7BA 4HUNB 4N5ED 4NKDA 3STLB 4XPBH 5CAYB 4W70A 1OLZA 1L9OA 1WVZA 1LMIA 1NKOA 1WDAA 2KZ1B 2QGEA 5TGBB 1IEBB 3B7SA 1AXSA 1L6XA 1KTLB 4ZFGH 1U8MA 1U92B 2V5MA 2W59A 2DWEA 2F5BL 3APCA 5C0EA 4ZAKD 2HVJB 5F9WB 4OF7A 3AACA 3KPOB 1RIHL 1TTGA 2BNRB 1OW0A 2WZ5A 4OB5H 3Q7JA 3ZE1E 1XCQA 2BJMH 4DKEH 4WFHD 5TTRA 5JDSB 4KJWC 4XBPB 2WJ7A 2M8XA 5IK3A 3QZWG 4PJ8A 1SM3L 4YSAA 3BGMA 4JL2A 1MAMH 2D7QA 4GG6A 1RZ8A 4EXKA 3OV6A 4Z3HA 4F27A 4G7VL 2PO6C 4EOWH 1IEHA 1PZBA 3V10A 5FPIA 2WXIA 4KWUA 3AABA 4PJHA 1GKOA 1KN4L 2VLRA 5ISZE 2WLLB 4X7CC 1MCWM 3LQAL 5KS9B 2ALWA 1L9PA 4IBYA 4GB9A 1NINA 2F53B 3BD5A 3O6LL 4LFHD 1U3YA 1V7ML 3QI9B 3SY0A 1KPRB 3N40F 3SDYH 3RBGA 1OT1A 4JQIH 4FULA 5GS1C 3LNFA 4Z7OE 5L0QB 1C5BL 5CGYD 2PYFA 4JQXA 1R9FA 5F1NA 4Y88A 5IMKB 3S37H 5D6CB 2FBJL 3QJHB 5ADOH 1P0SE 4FFZL 1RU9L 1HSAA 5T3XE 3HE6A 2XG5A 4QHNB 1KGJA 2QDVA 2AJ3A 3IMWA 5E5RB 4EO5A 2OSLB 3MLYH 3ZDXE 3UGUA 2Z91B 3IDNB 4PJ8D 2JLLA 1I3GL 3KL5A 3QG7L 3PYCA 4KTDL 3EAKA 3TIEA 2YSSB 3GMQA 1ZHKA 3CIAA 4LPXA 2ID5A 4U1JA 4BSWA 3BFWA 4AC4A 2A0LD 2OXHB 2CIKA 4R7VA 5KYXB 2NDFA 4HK3J 3EYUH 3KD4A 4G7RB 1M57B 5TE6L 1JPTH 3PPEA 4PWEA 4A2HA 1CE6B 2AHIA 3BLBA 5J06A 3VFGL 3STBA 5IF0A 2ZUWA 3LVEA 1IM3D 4U31A 5B1JA 4OGAC 4K5LA 4NC1E 1Z9NA 5GS2D 3OZ9H 2BS9A 1B0GB 2AAVA 1SN0A 4FG0A 2YAEA 3RL1B 3BAIA 3D1MC 5JLZB 1MIEH 3TV3H 1ED3B 1T83A 2DMBA 1OOWA 1RHFA 3L5JA 3OM3B 1YMHA 1JPGB 4X6BA 2NCMA 3MCKB 3QPKA 3NPZB 4KVCH 4KKAC 1JVKA 3UZEC 3U6XS 5KSVB 5H35B 1J5OL 1RMFL 2XIBA 2IV8A 1NC4A 1E4KA 3BAJA 2WNGA 3QQ9C 2X4RB 1CFVL 2JIXA 3H8NA 4WWKB 5LAXA 1ADQA 5ABAA 5PCYA 4CMHC 3JWNH 5KS9A 4WSGA 1MZZA 2EJ1A 2GSGB 2IBBA 3JTTA 4JPKL 5KN5B 3EO0A 3QORD 1XSKA 2EIKB 2ZCKL 1UA7A 4KV5E 4Y8DC 1AGFB 2DN7A 4OZHF 5B3JE 3CFIC 2BVPA 2O6EA 3DDFA 4FQXA 4UV7H 3SBWC 4R4ND 4QTHB 1B6UA 3F05A 5AOZA 1T5KA 3CC1A 3QXWA 5HHQB 3JWDH 3GKZA 2MCPL 2ZP8A 5D7HA 5GQBA 2H6PA 4ZT1A 3SE3A 3WDJA 1DSYA 4TSBL 2GUOA 4U3SB 4DGIH 4Z0BL 2XG5B 3C6LC 4QHNA 1UXWA 3MO1B 3FHQA 4NUJB 2WTOA 3MLZH 3N9GL 1BQUA 1ZA3B 5D96C 3LRLA 2Z91A 5KVGE 4XVOA 4XAKD 1PU0A 4UDTB 5DF0A 1VJSA 3S4SA 4LSUH 1BXAA 1W80A 3TEXA 3DSFH 4ONGH 2ZE0A 1FL5A 1UB5B 3AU0A 4QRPB 1YVLA 3T3PF 5GGRA 4KI5E 4XX1E 1AXTL 2BIIA 2FGWL 5I17B 4FOMA 4XB3A 1JVLA 3TEYA 4HLEA 3C8KB 1MRDL 2VSCA 2Z31A 4KUZH 5C08E 1WTGT 3LQZB 1MHHB 4QRPE 5EF2A 3RPKA 3FTGB 4JFPB 5DSCB 3IMBA 2BSED 1IC5H 2HJFB 2HLAB 5DDHB 1B0GA 2E7MA 3BKML 5TE7H 2Z35A 5KANI 1DQQA 1SVBA 4MAUH 4PGCB 4MZ3A 2Z93B 1EO5A 2GSIA 3QUXD 3W9DA 4GW5B 3RDTA 5A6LA 4UZSA 2GTQA 1IGTB 1IAKA 4P2RE 4PWIA 5FLUA 3EFDL 2OYKA 2IGTA 3WTYA 3ML8A 1T89A 4CSSA 2WINA 4WW1B 2X6AA 1E8ZA 1A7BA 2X9XA 2E5EA 4PBVC 4HWEH 3T71A 2O4EA 2BO0A 4YE0A 2IDUA 2ICEC 2YZ8A 5LAXB 3SSGA 1NWOA 2Y7LA 4KKNA 4TOYH 3ULUC 3BP7A 1INDH 3WLWD 5IMMA 3CSYA 3GXIA 1QP1A 2V2WA 2VOTA 4TL5A 5JIKA 5C6TH 2HTLD 1QPKA 3CE1A 4HJUA 4FXKA 2DQJH 5HDOA 4B0MM 1HL8A 2R1YB 5T1LA 5CEZD 3GJFK 4RZCA 2A1WH 3T9WA 1OALA 5GRUL 3RY6C 3QYMA 1BGXL 4NEHB 2QSQA 2F54B 2DOCA 3MV7A 5EUOA 2NNXA 2H9GA 3L45A 4RMVA 3P4NB 4WY7H 3GNML 3N1QC 5E00B 2PCFB 3QDAA 1KB5A 1SJXA 1U8KA 3RVTC 1ZA6A 4P2RB 1FF5A 2I85A 4DEPB 2NNCA 3PWJA 4E68A 3D39A 2I69A 3IEAA 1XR9A 3EJQA 2R1XB 3W38A 3H1ZA 3T4AA 1UOVA 5IVXE 2ITEA 2X89D 1OTUC 1ZHLB 3PIQA 2ZUSA 1NTDA 4P99A 4IIQA 5FW6A 4XO8A 4Q4IA 4PI2A 5JHDD 2HKHH 5D93C 5AYUH 3D06A 1OCWL 5JOPD 3P40A 1XGYH 4JFPA 5DSCA 4NAJA 3AUWB 4G5ZH 3V9EA 1XT5A 3IDIB 4X4XA 1H3WM 3TBYB 2IH9A 3U0PA 1F00I 1R0AH 3IBOA 2WGXA 5PAZA 3VU1A 4XPHH 4BFEA 2ADIB 3DROA 3V2AR 2Y1YA 2YWZA 3W9DB 5IFJA 3RUGB 1AGBA 4P59L 1AP2B 2BOLA 3AADB 4P04A 4I13B 2XWBB 5EEUA 5HI3D 1CFQB 4R7XA 2XT1B 1DVFA 4HJJH 2WB7A 1RVFL 2VL5B 4RBPH 1XVSA 4GKSB 5KBKA 1Z9OA 1SLXA 4Z7WF 1Y18A 1N19A 1RZFH 1CICC 1N4XL 2FIKA 2Q76B 2O30A 1R3JA 1XWVA 4CA4A 3FCUB 2OTWA 2E27H 3FU6A 4GIPD 3MRJA 1KPUB 3HPJA 1MNUH 4PJAE 1BM7A 3CSYB 2WXOA 1TZAA 2YD7A 3G5YB 3WY3A 4ZXBD 5DC0A 4YSEA 1KIRB 1TFPA 1CDCA 1AG6A 5E9DE 4AEEA 2R69A 1A2YA 1XMWA 3S2CA 3FHEA 2OXGB 4MJ6A 5KBNC 5I18H 4RZCB 4ZX5A 1XF4A 4AQZA 1Z7JA 1FYTA 5HY9B 4PR5B 4AZUA 4EF3A 1U0QA 5EUOB 5TDOB 3P9MA 5J9PB 5HD8C 5E00A 3O3BA 5GGTA 4L2LA 4H1LH 4TVPL 4XAWL 2RFXB 1KCBA 4O2EA 1JGUH 1QRKA 3S5LG 4X5PA 1J05B 2AV7A 1RUPL 5AYTA 3F7VB 4N8VA 4IRZL 1JHLH 2ZG2A 1YMMB 1JZGA 1UXSA 5F9JA 1HEJC 1OOAA 2WWKT 1PEZA 2B5IB 3RX8A 1S7VB 1BZEA 2ZXWB 2YK1L 3IJYA 3BT2H 4O02B 3O2DA 5KBPA 2J2ZA 3BSGA 5C0AB 5IUSA 3D12B 4YSTA 4DOHB 4KQ3H 3BWAB 1T04B 3L5WB 2PKDA 4X4KA 2B3IA 1TSHA 2WXQA 5HVHC 3B83A 3KM1A 5FB8A 2UY6B 4MX7B 2E9WA 1A4BA 4EDWL 2WKLA 1XGYL 3OLIA 5TE4L 5MENE 3WXVH 2IPUK 3BAEL 4K9EC 4CMHB 4P0DA 3RUGA 5EBMB 3AROA 4LSSH 4HG4J 4L8DB 2X4NA 1R47A 5EIVA 5FOJA 4G9FD 3BQUA 1QNIA 5B22A 3VFMA 2GJ6A 1M7DA 3ARFD 3I50L 2AJSL 4YHOL 2G5RA 4HKBA 4YL9A 4YXKH 3DX6B 1KN2L 5LQBH 4YHLH 1IIKA 3V7MA 3VFVA 4Y4HD 3J27A 5F93C 4MB3A 4TNVF 3T65A 4HCIA 2PXYC 2WOYA 1KJ2H 4WKZB 1V8HA 4QYOA 4IRZA 3IE9A 3ZPDA 1OAYL 2WUCH 2PR4H 3MRJB 2BNUB 1JGVL 4LRNH 3SZ6A 3EDFA 1JZ2A 2OI9B 5JORB 1JF6A 2QSTA 3QB7C 5BS0B 2FSDA 4LPWA 2OJZH 2OMNA 4GBXB 1CFBA 1KTLA 2B4CC 3PJLA 1MN4A 3L4VA 3Q9PA 3Q44A 2V4LA 1HHGB 4NQCE 2AEQH 4JY6B 4XMTA 3SIKA 3CVHA 2BFVH 3D0VB 4KGJA 1W6LA 3MV8B 4I0PC 5CN1A 2G30A 2JTYA 4GQ9H 4Q9RH 3B3BA 1WS7A 5J9PA 1UGNA 5J3HC 3OKKB 1BPVA 1N6QH 2WXPA 3O3BB 4A38A 3KEHA 3TZVA 4Z9KB 3OF6A 3VWKC 5ACLA 4D7PA 1ASPA 1F13A 5DHEA 1D5BA 4AITA 4JGMA 4V11A 4GG6F 2XV0A 3NT0A 2X70B 3BGMB 4WHYG 4BJLA 1RI8A 1YMMA 1CGUA 1PQZB 5TF0A 4RAVB 3GS0A 3ILPA 2QELA 4KTYA 2Z4QB 1MJ8L 2WLLA 3PAYA 1QX1A 3QNYA 4RH4A 4I77L 3EO1B 5IWLA 3QI9A 1O7SA 4CVZB 1MCCA 1BIHA 5HGBB 1N0XH 3ARFC 4KI1A 1FNHA 3ZE0F 1TQCC 3V4VB 3T6XA 1NZRA 5ES4B 4NQCB 3KPQB 2BINA 2CDGB 5FWQA 3EADA 3F6LA 4PJFB 4LF3B 2VDQL 5F7HA 3CLFL 2V6HA 2Y5EA 2A4ZA 4IBWA 1EEZA 4L8DA 3TS8A 4WENB 5FUZL 1KCRL 3GC3A 4KJQD 1ET5A 3BP4B 4K3EL 3WMPA 1KSRA 1M7DB 1V55B 3WY4A 3UPRA 3VG0H 2BX5A 3RI5F 1NEZB 4KK9C 1KTCA 2QPSA 3E6FA 5EF0A 2NR6C 5IHBA 2Y7QB 2Z1PA 4P2QD 8PAZA 2YSSA 4JN2A 2ZWYA 5C0DA 1RVFH 5EFIB 5L2KA 3NJNA 4PV1C 4BKLB 1I53A 4Y4HA 4OD1H 5CJXC 2RALA 3PGFL 4X7TA 2AQNA 1FL3A 3I6GA 4MMZC 4RMTA 3UABA 2ITDB 2CZNA 2G9KA 3HMWL 4NRYB 2VJXA 2WHVA 4HPYH 3UAJD 2AAAA 1I1AB 1E2WA 2BP0B 1PX8A 2EE9A 2MCPH 3BVXA 2QQKH 3JWDL 3K4DA 3QZPA 5F6IC 3UEZA 3TVMC 3VQMA 5B1KA 4JVUA 2B0SL 4MA7H 2BP3A 3X3FH 4E9TA 1Y1DA 3CVHB 4I0PA 4UNUA 4XGZA 3D0VA 1HHJB 5EU4B 2EP6A 1OP9A 3KZ8A 3IGAA 1IAOA 3QWNA 4TVPD 4EIBA 5C0IA 1DDHA 1ZK9A 3EYSH 5HYJB 1RPKA 4GJTB 3F65A 4NRXB 4DSYA 4EE2A 2Q7NA 2NLJB 4LE8A 2ERJB 5GZND 3AAZB 4ZMTA 1X5LA 3QDJE 2XTJE 1J18A 1XZ0A 2WD0A 2EINB 1G7IB 1MI5B 4Y2DB 1X5KA 1TYJA 3VH8B 1MW1A 1DBKL 2V3DA 5KSAB 1OK0A 3U83A 3HNSH 1RSYA 5DD5H 2W1NA 4GUQA 3DX7B 2FWOB 4WO4D 5B4MC 4IQHA 4ODBD 1IC0A 1A6WL 1FZKB 1QUNB 5DZOA 4BH8B 1H3UA 4XOBA 4WZ9A 1LNUA 2PNDA 1AGFA 2EXWD 2V8MA 2W95A 2EH7H 3KYMA 2CGRL 4O5LH 2H45A 2H2SC 4YHML 3K5RA 5DJCB 4GAGL 4EI5A 1Q8MA 2OK0L 3N0PB 3FO1B 1KTDA 1UFGA 1PLBA 4HXAH 4XVTH 2ITCA 5MP6H 3OLEA 3G6JA 3V95A 2VAJA 4HW6A 3KPRB 2JB5H 2LVCA 4Q58C 4MJ2A 2C9AA 4OIFA 1Q9KA 1OGAA 2F08A 3QH3B 2L7UA 1EJ8A 1ZLEA 4K5MA 3VXSD 3RWFA 2H1PH 1G9NL 1YQ2A 4OFQA 3OXSA 4AL8H 2CKBB 4U7SA 4XXWC 4YX2L 3E6FB 3T0XA 5HYJD 3AGVA 2ZOTA 4IK7A 5FKPA 3HRZB 5CSZA 5I1LA 4HIHB 4YDVA 1CFSB 1S5HA 5MP6L 3NJGA 3K0WA 4QNPF 5CIPB 3RDJA 3MOBH 2XZAL 3ARBA 5HHNA 4H8UA 4HGWA 3SB3A 4AE0A 1TVBB 4L4VB 1HI6A 1J8SA 2P80D 5F7MC 4UQBA 1Q9WA 1OARL 1RULH 2FJFB 3L4YA 4QYAA 5GRJL 2EDJA 3IGFA 4DEUA 1OAQH 1NC2B 4FMFA 2FQGA 4KXBA 3SBPA 1FH5H 5DMKB 3OPUA 4XGZB 2EC8A 3FW6A 3GSNL 4F7TB 2MNUA 3ESMA 3NJHA 5EU4A 5HJBA 2WLIA 3GBEA 1YZZA 2ILLA 4JCWA 4JO4H 3VM7A 4UOJA 3BN3B 5C0IB 4ZSOE 1BJMA 4JQVA 3D39E 1T1WA 2OMZB 4EXPX 1IAKB 2A2QT 4PRBA 1OAUH 4QF1A 5C0GA 4POZC 2K6ZA 3TVMA 4IGBD 5ESQA 4MJIE 2OMYA 4A7VA 2HWZL 3T6WA 3FUHA 4KKCD 2UWEA 4WFED 3VYPA 1EDYA 4B3EA 3IFOA 5DFVD 3HBPA 3HMXA 3HZKA 5LCVL 4XP9L 3ARBC 2GI7A 3LDBC 2IMNA 4P4KA 4HC1L 2VLKE 1KACB 3B3IA 3JVFC 1RCYA 2PCYA 5IW1A 3L5XH 1DQVA 3QPQD 4LOUC 2RH0A 4Q6IC 1W91A 5SWZE 4BH8A 4JQXC 4PJ5E 1LNUB 2FUTA 2MKLC 3U1SL 3L2LA 2YEZB 4UUJB 4DGVH 3EHBB 4N26A 3OAZH 5EOQL 1J11A 1VFMA 2ARWA 3QUYC 3WS3B 1UD5A 3SKOA 2YEVB 4FFZH 1XXDC 4G42A 1OAKH 2VR8A 4QEGA 2NT0A 3GSVA 2OL3L 4NWTL 3ZZSA 1DL7H 5CLTA 1CFMA 3HZVA 5EUOF 4LLUB 1X9QA 2DBJA 1CDGA 1D7CA 4Y0GA 4ZD3L 1WZ1L 4X5LA 4W9IC 4FABH 4H8WC 2C8NA 1AZVA 1BREA 1CLZH 1I9RL 4WFHE 4J8RB 3SDCB 1A0QH 5TK2A 4OZ4B 3WKQA 4O2CB 3GMNA 5IV2A 1ETJA 2EIMB 5A2JH 4JO3H 3TO4B 2CHXA 5T1KA 3L7FB 5B38G 1TYEB 3ZE2E 4ISVA 4IOFD 3GXPA 1M3JA 1AFVL 1NIBA 3AG3B 1KBBA 3M1CA 4BYHA 5ILTH 1L7TL 5DQDH 4MB5A 3JV6B 2RHEA 4PJEF 2AABH 4BE6A 4BK8A 3WSQL 2J73A 4JDTH 1SM3H 4NQXB 4NBXB 5F3BA 1KY6A 5EU3B 5JA9A 1TQSA 1REIA 5ECGA 1ZVNA 1M1XB 3IFNL 1XGQB 4NI3A 3W57A 4ZMOA 4M03A 4NBZB 2R0LH 3ATAA 3GNMH 3CN1A 3ESOA 1YJDL 2B5IC 2J25A 1ECYA 3RRQA 1MJ7L 5KJRH 2ENQA 2QHRL 4ZTPL 3F2LA 1H3PL 4IMKC 1RK1B 3EDEA 3GBNH 4JLRB 4F2MB 2DKSA 1XGRB 3FSZA 2OMYB 3U7AA 2C34A 4GKSA 1I7TA 5ICYB 3NFPA 4JPKH 2QMJA 2E75C 5E9NA 3QJOA 4OJAA 2UZYA 4Y4KC 4CGUB 3CBKB 5BVPL 4G6KL 2FIRT 3FT4A 2WLHA 1PAMA 5IW1B 3B2UD 2P52A 4X6CA 1RU9H 1KGCE 3CHSA 4NQUA 3N43B 5AL8A 5I5MA 1DANT 4GSXA 3ASOB 3T08A 2LABA 3MRNA 3TXAA 4DTGH 1TETL 3NZ8B 1NGWA 1QKZH 2R0ZH 3PFQA 1R5WB 3II2A 3RPIB 3OKDB 2WGNB 3QEQD 2CG9X 4JO5A 4YSRA 1JV5A 4TLSA 1D5MA 3ZYJA 1JPEA 3RIFK 1OHZA 2EVJA 4OKDA 1EAOA 3FO2B 3MRIB 3BFOA 1ILUA 4M5ZL 1A7PH 4WO0A 3DKHA 2CJTA 5J7CC 2R4RH 1R19A 4DP0X 4Y2LA 4P5KB 2RACA 4YXKL 5CBAB 5LQBL 1TPXC 4MNQA 2BSCA 1LQSR 4DUXA 5JHBA 3VYNA 5IMOA 5C0FA 1OGSA 4PRIB 5JXAH 1ZLDA 2V7NB 4JM4H 1PIGA 5JDJA 3Q1SL 1DJIA 5ITFB 2HPOA 5DWUH 1F2XK 2P5EA 3L1FA 4KRPC 4ELMB 1L0PA 1E9PA 2XNAA 5KSUB 4TPRL 1LWRA 3GF8A 2Q7YA 3IJYB 5IB4A 1VGKA 4NRZA 4UAOC 3W5MA 4O02A 5FM5O 1XF2A 2CKBH 4KZEL 1ITBB 5KSAC 5FR3A 2JI2A 4QUOA 1IGJB 1AACA 2EIJB 2RQ8A 5IWLC 4EN3D 2XWJB 5H4ZA 2KT6A 2JK5A 2J1YA 2D0HA 4ZUVB 2MH4A 2R56L 1XGQA 3R0NA 1N67A 2FATL 4WI6A 2XJKA 3UG4A 4WTQA 2APTA 3Q5TA 4F8PA 5I30H 2K78A 2D7OA 5E8OB 2QV4A 1DJSA 3K1DA 5IZ7A 4LLWA 2NY4B 2AJZA 4FQJH 3FQWA 5E51A 3RA7H 1RK1A 3KPTA 4S2SB 5DJDA 3VVVA 1PDKA 2I7SA 2B1AH 3WFEH 1XB6A 4Q9QL 2YPVA 3NGBC 3CFJB 4R2GD 1XCXA 1IBGH 4UT7H 4PRIE 4JKKA 2AI0H 2BS8A 3CGTA 4QYOB 1PD1A 4U3XA 1VF5C 3WKPA 2ENSA 1E42A 5GS0L 2E7DA 4WGWB 3AZUA 5ESVA 5EPMA 4XNBA 2IALA 3M7FB 3UBXG 4AJVA 1ZV2A 2LGNA 4JKPL 3KE0A 4YBHA 1K6QL 4OU3A 4POZD 4DUWA 1IBGL 4UT7L 1KXTA 3JTSA 5JOEA 5GZOC 5IQOA 1WWBX 5HGGS 3K2MC 4MD0B 3SE9L 3R1GL 4AVJA 1N59A 5D7KE 4W4OC 4XCEB 2M1KA 2MOGA 5CBAA 3D2UA 1E6OH 2ZCHL 2MQCA 3N3EA 4S0HA 1T0NB 3FOMA 5I5IA 1JRHI 3DXAB 3CSBA 4U1KB 1CL7I 1H5BB 4WHTA 4MBOA 1EDHA 5I1KH 5IREA 1IJNA 2ZUYA 3LHPL 1DZBA 4UIMB 3HEIB 4F9LC 5FFLA 3ARVA 3Q01A 3PWPA 3IDGB 5AW2B 5ADOL 4OZIE 4X99B 1G43A 2QHLA 4LEOA 2VQTA 4IRJD 4KPHL 1M6UA 1M56B 4G5ZL 5FHAL 2EDXA 4XCFH 3T2LA 2B0SH 3O9WA 4JDZB 3SPVA 4FCHA 3ECBB 4MZ2A 1DBAL 1COBA 4NUPA 1OQOA 3T1FA 1ZWIB 3MRPA 1NA8A 1PS3A 4KTEH 4PB9L 2ATKB 4PGDB 1J1PH 5AD0A 4M9OA 4Z3JA 4HAFA 2CDGA 3FRUB 4TN9A 1TU2B 3IDXH 3V4VH 1L7IH 4YS4A 2AJZB 3QXUA 1OM3H 3VI4A 5DURB 2O93L 1NEPA 3FUIA 2NUTB 1GC1L 1QD0A 1HS6A 2VC2L 1F3JB 3B9EA 1I7UB 5IGXH 4ODUA 3KPPA 3P4OB 3BJLA 4XXWA 1ES0A 2N0MA 2ZYIA 4UOQA 2I32A 2XKUA 4DGIL 1KYUA 3CFJA 1J1OH 2C9QA 4KO5A 3W11C 1F18A 4WO4C 3CHOA 4OCRL 1F1GA 4FE9A 1ND0A 4HKZA 4OZGF 4NZTH 2IAND 4L8SC 3CPLB 3AB0C 3U82B 5FUCC 2EYSA 3LJ3A 5EPMB 3VG9C 2P48B 5EIIB 2XN0A 3IDMA 4AIZB 3S9DB 1F4WL 3VXMD 4WRLA 2X3AA 1S4IA 3UZVA 4A68A 1W8OA 4TNGA 3OKOA 1BJ1J 5DVOA 3LD8B 7FABH 2IOMA 4GY4A 1KV3A 1VDGA 3MREB 5TDPA 1NFIA 2J5WA 1EUUA 4G43A 2OP4L 1HHJA 1L0QA 4OGYL 1QSFD 3L16A 3Q3GB 2OYLA 5I6XB 3MGAA 3KPNB 4GQRA 1I7RB 1LDPL 4CAGA 3A4AA 4OV6F 2J21A 4YNYB 1U33A 4G59C 2CDFA 1T0NA 4NRXA 3P3YA 4N2BA 3TNNA 3W39B 3DHUA 4G7YL 3UAJC 5F7BA 3ZE0E 3V5KB 2N1KA 3MLSL 4N2KA 4OLYH 4Y2DA 3MLXL 3JZ7A 3PU7A 4JRYB 4MZRA 5DYOB 3IDGA 4QOKD 2C3VB 3GBDA 4ODTL 3IM1A 4F7PB 2FVNA 3BMVA 5SWSE 4AV4A 2BFVL 1EFXA 2ODHA 1JUFB 4ADJA 2XWDA 1FFPA 2NR6D 2XA8H 4FQIL 1QUNA 5T33H 4A7QA 4AGMA 5BV7H 4Y5XB 3DO7A 3SQRA 1EGJH 1FFOA 1WA2X 3G5WA 1SQMA 1RUAL 1BLNA 2ENPA 2YMXH 1TQWA 2IDFA 2OI9C 1WUZA 3LEYL 4X4ME 4BZ2H 5CJXA 2DL2A 4JRXA 3L81A 5H37H 3U6RA 3L7EA 4FLRA 3MA7B 2FJUB 3VFSB 3V0VA 2WUBL 1IAIH 1X44A 5EU6E 1O7VA 2XHNA 3LZFL 3TL5A 5K9JH 5SWQB 3BYTA 5CKGA 2DQJL 4ELMF 4U6YA 4JS7A 2AS5M 5AVSB 2VUOA 5FHAH 1SOSA 1C08A 3OMIB 3QIUB 4IJTA 3ZKMC 4P07A 3FFDB 4KO9A 3UJTL 4ODUB 4UOZA 2XQBH 2XN2A 4NO2A 1BBDH 2IVFC 3DDGA 3CJJA 4GUOA 4Y16A 2UXFA 4XWOD 5DQ9A 1OGAE 1UURA 3BH8A 4NQEE 4DAGL 3VXQA 1TZOA 5EO9B 3HNVH 4LO9A 1IB5A 4I1RA 3T8XB 1E2ZA 2VDPL 4WNQA 5SWSB 3WIHH 3J07A 4MWFA 3QAZB 1X7TA 2NX5A 3FONB 5JQ6L 1M9SA 1QA9A 3IAQA 5ENWB 3OC5A 3FYEB 1BX2B 4L9DA 4PJ9C 5F3FA 2AV1B 4OGQC 4ZMPA 3MREA 5TDPB 1F3RB 2NSQA 2EDTA 1BAGA 3H42L 4HEPG 2CXKA 3CFUA 3PCYA 2WLIB 4I18A 3KPNA 2EYRA 2X0WA 2FO4B 3KM2A 2NDGA 2CMRL 3DOSA 3EOTH 3EYVA 4B5ZA 4BQBA 4JVPA 4C4UA 3QXTA 4FQ1H 2E86A 2PTVA 3IS0X 5CD5D 3CZUB 1OP5H 1A9BB 2GEEA 4GW4A 3WHE1 1KEGH 3VXUE 1NOFA 8CGTA 1G5AA 3OD3A 4EDWH 1KCUL 1ZIBA 2FSEB 5E2JA 1BYOA 1CG9A 1P5VB 3REVB 3RX7A 4WK0B 2O26U 2K4AA 4P5MA 1CYXA 4Y5YC 1S7QB 4JDEB 2BY0A 4KROB 3OQ3B 1U8QA 4R4BB 2VXSL 4Z0XA 4AV0A 1HSBB 5E0QA 1I8MB 2RJMA 3DBXA 5ICUA 2JJWA 4J3VA 4JPSA 4WTXA 3FQRA 4ZODA 4MDRA 1JNHA 4UZGA 3WS3A 4DO6A 4LCIH 3WUWG 3ZKMD 3LQMA 4KNSA 2WOBA 5I71C 2YQBA 2EVHA 3QQDA 5IHZB 3PUUA 3U0WL 4AENB 1QQDB 2R2EB 2B59B 4I9WD 3HZVB 3O45A 4PJHE 1YYCA 2NNAB 1NLDL 3DVNB 3E6HB 5C71A 4BFNA 1E4XI 1FO0B 1TTCA 3Q6GL 2NR6A 3GMMA 1C08B 3QIUA 1S3RA 3UDWA 2ZUUA 4CVUA 3MMEA 4PLJC 5F7AA 2VM4A 4IMKA 4JFHD 5TFSL 1Z6JT 2O6PA 3Q2VA 1TF4A 4IDJL 3G6DH 1JWUA 1SN5A 3IJ8A 1DTUA 2TSAA 3L08A 4P2QB 4LLQB 4YAQA 2ESVE 2WC7A 4IM8A 2ZCLL 3TO4A 3ZL2A 3P4LA 5DMJB 5D1ZA 3WEMA 5JXAL 4LB8A 3D30A 1P7KB 4AT6A 1OT4A 3KVPA 3MKGA 4PJEA 5H2BB 2PTUA 1EJOL 3CQQA 3RKPA 3RNKB 4DZ8B 4GUPB 4F7KA 2ADYA 4OLUH 1YEJL 2J55A 3B56A 5E4AA 3KHOA 1PL3A 2XVBA 4MB1A 1VCAA 4WFFE 2WZPA 2FJHA 1P4LA 1RZFL 1T0PB 4F8QA 1A3LL 4HBCL 5AZEH 3WIHL 2GFBA 1DVQA 3X14A 4JY4A 5DVLA 2I27N 2G2RB 3NFSL 5F1KC 2D9QB 2MIZA 3WJMB 2OTUB 3WBDA 5I8KL 3MJ9L 3FPXA 3MKKA 4EMZA 2VERA 1NFAA 4F15B 5JHDA 4U7KA 3S6CA 1IGYB 2F1BA 4W1TA 1DQMH 5I24A 2LLLA 1LXMA 2AJVL 2VJ8A 2FD6H 3M45A 4PJIE 1MUJB 4FNPA 3U9PH 3ZJAA 1E65A 4MAYA 1NIAA 3G7TA 3CFBB 3CK0L 1AOHA 5HHMD 1DFBL 5AVQB 2VDOB 3MXVL 4W9CC 1D5RA 4HXBL 3NFPB 3WOVA 4WW2C 1S7UA 1EA9C 2F1AA 3N55A 4GAJL 1M7IB 4LZKA 4P2QE 4DJMA 4P5MB 2UZYB 1EO7A 1BD2A 3QO0A 3RWEA 5CWSB 5GGRY 1NGXB 3PE9A 5JW5A 3H7BB 3MNVB 1KDIA 4GSRA 1NJ9A 1HSBA 2GEQA 3H9YA 4KV5F 4ETYA 1JFQL 4ERSH 3MRNB 1AY1H 4PJ5B 4FQ2L 3X3GL 2EC9T 5LGJB 2FWLB 4WIQA 5FHBL 4E5XA 1A66A 4OLVL 5IHZA 4AEHL 2YPLE 1MI5E 1K8DB 5C0CB 3KW8A 4H0LC 3TV8A 1AAJA 1DVFD 3MRIA 4IGBC 4HAGA 4K5PA 2DJUA 3PDOB 4P5KA 4PEEA 4PJEE 3ROOB 4PWJA 3WLBB 3H9SA 4I9XA 1V3MA 3HMXH 1PG7H 1DCEA 3JYCA 5IBUG 4AKQA 4DGYH 5GPRA 1NSNH 1D9KA 4TVUA 4CKQA 3CV5A 2P7TA 5HYFA 4BHUI 1HDMA 1IARB 4YAQB 4QRAA 3VWJA 4JNXA 4JFFD 3O41A 4PW3A 3QCTH 1UQSA 2XWTB 3OKNB 2HJKB 2XOTA 3K2KA 1ZPUA 3MUY1 3V0JA 1WHPA 2PWDA 4M6OH 3AWFA 2BOBA 4ZD3H 1S7TB 4R0LC 5IFHH 2UWEE 2VYRE 2D3NA 2YD2A 3QZOA 3T8VA 4AG4L 4DQOH 3RVTD 3B4NA 3TYGH 1SUHA 1V7NL 4M7ZB 4TMPA 4J1UA 1NAMH 4UM8A 1DHKA 1R46A 2ITFA 2VXVH 3IF1B 4RMQA 5D6CA 2J4WL 1BHGA 1IGYA 2E76C 3FAWA 3QRGH 2DQUH 4HJGA 3BUTA 3C12A 1NPUA 1WFTA 5GZOD 1LE9A 4W4NA 1TVDA 3FQWB 3WO4B 5D96B 2EIZB 3HJEA 4MAYC 3FN3A 1W8EA 2KBGA 4GQPH 4OCWH 5LCVH 3L1EA 1AR1B 3FT3B 2J6EA 5C08D 5GGSY 1D5XB 3OKMB 5IBTH 3BOVA 1MWAA 2GBUA 1F4YL 3NCJL 2IQ9H 1ZEAH 5T1LD 3PNWB 4LVEA 5DD0L 4JUSA 1DBJL 1FCCA 3OHMB 5C08B 1LEKB 2GBVA 1DQML 1JNLH 2OX5B 2BLFA 4HZLA 2R0KH 5JW5B 5EOQH 3KLAB 3PUCA 4B9KC 1RJLB 1VFBA 1NJ9B 2ZYHA 3GRWA 3CZFB 2ZXAA 1ZVHA 1QHQA 4ZW8A 3BP5A 3ARTA 4I2XE 4YPGA 1MF2L 4M93C 5KYWA 1DO6A 4K73A 3HPLA 1QPXA 2WYIA 5DQJA 2LVEA 3KPSE 3AXLA 4N0FA 3GXMA 3TV3L 4YDLC 2A77L 3PWPD 2WCPA 4OJCA 3LX9A 4TUUA 2WTRB 4M1CD 1GC1H 5AG8A 5KVMC 2W81C 4YHKL 1VERA 3UERA 5KSBF 1CLOH 5D6DA 3QORA 2UVFA 5FKAA 1UD3A 2E7LC 3DX8A 2EE3A 1GGIH 1IBYA 1JPSH 2CNZA 2PWGA 3AQYA 1BWWA 4TLKA 4ZTOL 3H9SB 3S4SG 2APFA 3P11H 4KQ4L 1VZIA 2VZVA 2ZF8A 3UJIL 5D4JA 3ECWA 1P5UC 3NZHL 4WHTB 3QIBA 3Q6GH 2UYLB 1PG7L 1MFBH 4KGLA 4PLNC 3KR3H 3GSNH 1KYOK 3QEQB 1IBHA 3BVVA 5EH1A 3E3QC 2Z31D 3BN9D 3VWKD 3TJHC 4FAAB 1IE5A 4OTXL 3I6LD 5KN5A 1A64A 1BD2E 2NY1D 4PWKA 2W0PA 2BOBB 2P8MB 2EDHA 3BISA 1NFDE 3O9WB 4I48B 5I1EL 4HALA 5KWYC 1G5GA 1HIMH 3LNIA 1HE8A 3BUYB 4H40A 2CK0H 4P2CG 4Z78B 5MERB 5HVFB 3BPCB 2JSFA 2YKLH 4UT6H 3H85A 4W9ZA 1WBYB 3L3OA 2X2HA 3WHXA 1QR1B 1YMME 3MHZA 2JXMB 2GBTA 3RAJH 2AK1L 1I31A 3DPBB 2KQNA 2BSTB 4GEIA 4Z7NE 4MJ5B 3LZFH 4GO9A 2NUTA 3OAYH 4L8BA 5AFAA 3ABGA 5MEOB 3L3IA 3S88L 5AW6B 2CKBL 2XWCA 4FQXC 3N42F 4R7DB 3SBWA 4CU8A 5T5FA 4FXTA 3EGSB 1D5XA 3AREA 2YS4A 1U3NA 4NWUH 4GXVL 4HH9B 3VCLB 3IPFA 3MRCB 2ZKHH 3QORC 1RK7A 1FNGB 1JZHA 5AZ2L 1DBMH 2F7PA 3IDJA 4ALAC 1BVKA 2P45B 3ATDA 4QRPA 4RQQA 1IILE 4G2AA 5DRXA 3T0ED 2IDCA 5EDSA 1T1ZB 2QQQA 3KH3A 3V0WH 4NYLB 2OMWA 2Q5BA 4H20L 5AOLA 3C8KA 5AOKA 5DWPA 4DEWA 4MVBD 1A21A 2WMPB 4KJYB 2Z31B 2ZXCA 5K9QG 1HXMB 2BJML 1U8CB 2CLRB 3O2DH 3T4YA 5ETUA 4OGXH 4B9JA 1EAPB 1FJ1B 3CSPA 3F84A 2FYYA 2HJFA 2ZUQC 3M1BA 1ZD6A 5DDHA 5KUMA 1PJ9A 2D7TL 3IFLH 1DQQB 3DUSB 3LRSB 4UAOB 1LO3H 2WAQA 4MA3B 1EDQA 1AMXA 5FKAB 1I7RA 2WLKA 3B9AA 3QW9A 32C2A 3TA3B 5BOPA 1Q9OA 4NO3B 2YJLA 1JGEA 4Q14A 4KTGA 1QRNA 3IMUA 5LBGA 2NXZC 4YHIB 1SEBA 4H8WH 5E6SB 4PJ9B 2YBRA 1N68A 5ADPL 2HFFA 4QHKI 2CRZA 5BJTB 1RZKL 1JZFA 2H7WA 1CZ8H 3QEQA 1D5ZA 1IM3A 3P9WB 4MMXA 3IU3B 2Q6WB 3CDGA 3FB8B 1MHEA 1TQBB 2FEEL 3OTTA 1JUFA 3VGFA 2OPCA 5HD8D 2XN9D 4ANUA 4ZTPH 1OAXL 4I48A 4A39A 3QNFA 1R24B 4E9SA 5KG9B 5KYUB 2JKSA 5IROD 3MJGX 1EXUB 1NMBL 2XQYK 4PJ7B 4UQ3B 5I8CB 3C5ZC 4X9HA 5F0JB 2Q3ZA 5ITBL 4JRXB 2KPNA 4NNYA 4RRPM 3S2AA 3ZZLA 3CSGA 4GSUA 4D0DA 3V0VB 3OQRA 4YZWA 3RGBA 4ODXA 3ECUA 1C1EL 2ZQKA 4IOIB 5SWQA 3UO1L 5DT1L 3OR6B 4LU5L 3C09C 4K23H 4QXGL 4RNRA 3SCMB 5CEYA 4JRXE 4L8BB 1BW8A 4JFDA 1NMBH 3K2UL 1A3RH 3MLXH 4A7GA 3EGSA 1CXFA 1YY8A 1U8NA 5D55A 5DZLA 2OR9L 4B60A 5IQ7H 1MH5A 1RERA 4MXVE 1KCSL 2J43A 1DBBH 1Z9LA 2UY7A 3L95B 2VABB 2DQHL 4NC1C 4LASL 4YBLB 3MUHL 1YEHL 2R8SH 1MOEA 2ZAGA 4MS6A 1U3ZA 2P24A 4JFZL 2CXGA 4ZOBA 5EO9A 1ZE3C 2PXYA 5FCUL 2X2JA 1QEWA 3VMPA 5C86A 1TKWB 1J5DA 5BCAA 5E2WL 1Q9LB 4H8PA 3HI6H 5EU6B 5IW3A 5E0FA 5E8NB 1J9TA 4Y9GA 3U1PA 3GD1C 5ETUB 3P69A 1EXHA 1FJ1A 1KYDA 1WISA 3QUGA 1G7LA 4X4XB 1IFGA 3TBYA 1M6OA 3KYNB 3RZCB 3W0WB 5GIRB 2DTMH 1FIEA 2DPKA 1R3IH 5I26A 1GPOL 3CWGA 3H9ZA 5E5UB 2LFEA 4O9HH 4QHUA 4FKHA 3LCYA 1AP2A 1ASQA 2D7TH 2XWBA 5KJ7E 4D94A 1MQ8A 1X5XA 2HX9A 3FAXA 4HLZH 3S7GA 2SEBA 4NXSA 5M7QA 1CLOL 1CIUA 2IANE 5D2LF 3SN6N 3NRFA 3CLWA 2FD6L 3LN4A 4P3DA 4NQCD 2OZ4L 2FIKB 4N5EC 1U6AH 5E4OA 1P7QD 4OT1L 4ALAL 4R97C 2HN7B 5DS8A 2JNZA 3WTUA 1KFGA 4N6RB 5IW6A 3QJRB 2YMTA 1WTLA 4ZXBC 1QSFB 5I6NA 4RGOH 1Z32X 3HFFA 4PWGA 4FGMA 3STLA 2MFNA 1FYHB 3VI3B 3LKNA 4HULB 1HHIA 2JMRA 3AWEA 2QSCH 4PG2C 1MFMA 2K1MA 4FFYA 5I1JL 1Z3RA 2BY2A 5C0EB 1MVFA 3SDDC 3MUUA 2DJ4A 1D3CA 2VR3A 3GSWA 4F93B 1OT2A 1OW0C 2YMOA 2ZWSA 3AGWA 1UEYA 5HGAB 2HT4D 3KXFB 4N4YB 5CM1A 1ETA1 3E7JA 4CC1A 4J6RL 5DJXB 2CH8A 5D1XE 4AEHH 3M7OA 5E2UL 4HWZA 5FYJU 3FO0L 4X7DC 4U1NA 2ZJSL 3RHWK 2DD8H 2GIMA 5ALCH 1SXAA 1KG0A 5J13B 2V3FA 2XTLA 4LSSL 3ZDYE 2A4EA 3KJ4C 1B4LA 4FZ8H 1G1OA 4MRBA 5LUMA 4KK5D 3QI9D 1TZHB 4NZUL 3D4YA 3EJSA 1TSRA 5F9JB 3E8UL 1XXFC 4OV5A 4PP1C 1ZS8B 1JSYA 1WHOA 4UIKH 5IG7B 4CILA 4DZ8A 1SY6A 4TQHA 2HRPH 1T6VN 3NEEA 4OJYA 4XP9H 5J1AA 3H2WA 4LSDA 1G7MB 2IWKA 5D7JA 3P3SA 3MU3A 3MLYL 4LQFL 4BUQA 4ICXA 4XE5B 2C3GA 1P4LB 3EIFA 3N42B 5G2NA 1A7RH 3MTRA 1H5BC 4JM0A 4KXZH 1QACA 4IIQC 1JXJA 3BZEB 1I3VA 2BOCA 3OF6D 3RB7A 4XVUD 2CRMA 1YEHH 3GXNA 3O8XD 4WO4B 2BNQD 1SF5A 2BP5M 5DMYA 1R3KA 1O5DT 3A22A 3MA9H 4YDJB 2IH3B 3KYOA 3WI9A 3ABMB 1UB6A 3L1OL 4HPOL 3SDDA 3QHZH 4FXGA 2SEBB 4UT9H 1NAMB 1YEKL 2ZXDA 5AZUA 1EHLH 5FYJL 3HTLX 3EG9B 4UQDA 3IK2A 3FUMA 1L0YA 4CN1A 4NNXB 5HYEA 1M7XA 1T5XB 2D7PA 3RA7L 5HDBF 5DEGA 1QVOA 5AVVB 5DS8B 5AAWA 1T0OA 4PJHF 2J8OA 3O4LB 2JWYA 1ZEAL 1NGXA 3I9AA 4LLYB 2D4DA 1E7VA 4LCYA 5LXVA 4RGNC 2DLGA 4A7GF 4Z7OF 3CXFA 1FP5A 3ZHKA 5T3XH 4ORGB 3H4FA 4XH2B 4ZMQA 4AUJA 1HHGA 4U0QB 1FNFA 5F96L 3UC2A 4KJQC 4YC2C 4NSKA 2GHWB 1M3IA 2N3JA 2KKQA 4FYSA 3PREA 5I15L 1ZT1B 2CO7A 2FB4L 1NCTA 2AQRA 1A4AA 1SHMA 3NSJA 3TBCA 3IFPA 3MLTB 5EO1A 3M8OH 3TP4A 4MCYA 1D9KD 3JV5A 3UTOA 3VW3L 5FGBA 3BDBA 2IPKA 1DQLL 3VXRE 2V3EA 1RFDL 3EJCA 1VGEH 4N6QA 3X2QB 4AJ0A 1N10A 2MHAA 2H6OA 1IBFA 2IEPA 4PWHA 1Y0LB 1NGYA 2ICEA 3G6JE 1QSZA 2Z4QA 4ZMLA 2CHWA 5IG7A 3SE9H 3OAUH 1WFOA 2DQIL 3JTTB 1JE6A 2V17H 5FECB 3EO0B 1E43A 3EH2A 3A5VA 3T2PA 3CBRA 4WGVB 1WH0A 2AJUH 4HWBH 5KVGL 5CD5C 1QFOA 3FB6A 4ZO8A 5AW4B 4UNVA 1XIWA 4NDMA 5KTEH 3BZEA 3IJHB 2IQAB 2YXFA 3LRMA 4LQFH 5C9JA 3HG2A 1EH9A 1UT9A 2IXQB 4UM8B 5D72L 4PJFA 1R5VA 5KVGH 4LCCA 4KBPA 3WNOA 2G75A 3FCBA 4UIKL 3CU7A 1SXCA 1AO7B 1H6UA 1UA3A 2O5ZH 5IJKA 2XVLA 5AW1B 1CPUA 3UTTD 1F6AA 5HP5A 1NEZA 1UEMA 3LHAA 3EO9L 3NOIA 4LFHG 2NY4C 1WUNT 1XO8A 4OQTH 1WZLA 4YK4C 3C5JB 2OAAA 3WEBA 2DQEL 5BRZB 4ZNEA 4LPYA 3SYPA 5DR5L 1L9NA 2HKFL 4ZPVB 4WFFD 1BEYH 4NZFA 4MD4A 3ZKXC 5ICZB 2OX5A 2HAZA 5IFHL 4LLYA 1AGCB 1SDDB 4LCYB 3VGBA 2G60L 4IU2A 1NIFA 1TDQA 4V1DB 4N24A 1A8JH 4A7UA 4A7TA 3QC5X 3P3UA 1I9IH 2GSMB 3DHMA 2MRYA 3I84A 3L4UA 4JJ5A 4LSTL 5F8QC 2XQBL 2DYRB 3U9PL 1BQLH 4N0FB 3GMPB 4GKZB 2QDWA 3VFUB 4N3UA 1YNKH 4QLRA 4V1DE 4MA8L 3VJ6B 4MRCA 4XMXA 5HDWA 2Z35B 3ULSB 4PGCA 1J0KA 1K85A 2Z93A 3MSPA 4YDIH 3QORB 1QATA 3MLTA 4XZ4A 5EO1B 3DX8B 1PY4A 4FQPA 4XN8A 1FRGL 2WXLA 5D7IF 3MV9B 5FYLH 4EI5C 1SXBA 2C9UA 1WA0X 2QPUA 2WINB 3QXVA 4QD2E 4YFLF 4IRSD 12E8H 1N6VA 3FB7B 4NZDA 4R7NB 3HC2A 4CC0A 4LDCA 4XMLL 1C16A 1F8TH 4OLUL 5DFAA 3MACH 1IC7H 4JFOA 4CSZA 2G5BA 3N9GH 3WIFA 3TM6A 3S97C 3T77B 4WW2A 1VESA 5C0BE 1UOWA 4QRPD 8FABB 4KHXH 4BFGA 3N44B 3TESA 5KW9H 3UPAA 2Z8RA 1YAZA 4U1HA 3NSDA 5DK0A 4ATWA 4XCNB 5T1MA 5FV2A 2IQAA 1KLGB 4R96B 2YD0A 4N8UA 5I1GL 4C59B 5JXEA 3O6FB 3S37X 4NN6B 1KTDB 3MAWA 3CC5B 1DJGA 1RP8A 1WBYA 1UOKA 1HX0A 2C4XA 2HP4A 3L3OB 4PJDA 4Y4KB 3NUKA 3SGKC 4ZMYA 4KHXL 4XAKE 1C9SA 1E5ZA 3TNMB 5JQHC 3L9YA 5FW7A 1P7HL 1IC5L 3GINA 4KQ3L 3BQUD 1U3HA 5D72H 4J3WA 5F44A 5MEOA 3AT0A 3VD0A 2A9NH 4G1MA 2A9MH 4XN7A 5I19L 2VDKB 1AHWB 5IJVB 5JO5B 5B7EA 4KZDH 3PDDA 3HRZA 5CSZB 2C3HA 4XN1A 5BRZA 1NCWH 1R5IA 4OVVA 4ZFQA 2Y3AA 1S5HB 4LCCC 1MAJA 2HRGA 3DUUB 5EU5B 1UKQA 3NJJA 3KYKL 1LWJA 2L7QA 3ALPA 3PP3K 3ECVA 3NVQA 4JE0A 4HS6A 5IESL 1T1ZA 1SDDA 5CJBA 3CN3A 4U3CA 3ARBB 5HHNB 35C8H 5CP3H 1TVBA 3WNPA 1H3XA 4JN1H 4OM1H 4E41E 3MLVL 3UBXB 2WMPA 4KJYA 5I0YA 4WUKH 1JZDC 1NBZB 3VGAC 3UXFA 3V0GA 1BVOA 1Z3GH 1ZDSA 3BUBA 4X0NA 3VFNA 1FYTE 3U4EA 4OVUA 4FJ6A 1K4CB 1R6VA 1DO5A 4KK8C 2R23A 3HVNA 2HKFH 2XZZA 3DUSA 2LQRA 4LLAA 2VLKB 4LVNC 4DP7X 3D0AA 5HYQA 3DROB 5IB3A 1BG1A 2L3BA 3C6SB 2EDDA 1A8ZA 1R3IL 1KGCD 4HS8H 3U46B 4K3HA 3J2PA 2N56A 5HJ3A 3PGCB 1Z5LB 2BSEA 4DVRL 5CZKA 2F7RA 1DVFB 1EHKB 4PJ9A 3AQZA 2NRDA 1U91B 1Q0EA 1JRHH 4Q2ZA 3WO4C 3OB0K 3QEGH 4AK1A 4PVNA 3INUL 1MFUA 4KOBA 4L48A 3OC8A 4IJ3B 3HZYA 1H3TA 2AQQA 3D0LA 3ZN6A 1BVNP 2RB8A 3I02B 4HXAL 2VQ1B 4P4KB 1WC7B 1Y07A 2F5AL 2OTWB 2YZ1A 4KFMA 2O5YH 1RPUA 3BSZA 2VWEC 3O6FC 4L3FA 3D87B 3O0RH 4YSOA 3QIBC 3A6CL 4S0TD 2ADGA 2EDOA 5EO0A 3S8GB 3NABH 4FG4A 4PTTA 1X5YA 5E8EA 1BBDL 3WL9B 4F8LA 2LV4A 3LH9A 3V0IA 5IVXA 4XNZC 1CE1H 2EDNA 1KXQA 4PJ7A 1CS6A 2I9LA 5EHFA 5I8CA 3VG0L 4I85A 3UYPB 1S9WB 1XF4B 15C8H 1T4KA 3QRBA 4NN5C 2X2IA 3SDYL 3VRLF 5FO8B 3T1WA 3GJFA 4NNPH 4Y2DD 2H47C 1B2WH 5DFWH 2ZXGA 4F7CB 5IT2L 2GK2A 4ZOCA 3OR6A 1RUMH 4HUVB 4DHLA 4WF7A 3VM5A 4G6MH 4P9HL 4J8RA 2OJEA 1T1YB 4HA1A 3IVKB 3ESUF 3QHFL 2XICA 3BCDA 5CJ5A 1MH5B 3CG8A 1QZNA 4LCWB 2B2XH 4ZS6C 2XRAH 1JPFB 1T89C 4HG4K 5I23A 3SE4A 2JQMA 3NACH 5AW3B 2HFGH 2J72A 3DYPA 2K4WA 4ODWA 1TEYA 3QXAB 1H6TA 2CO6A 3B7YA 3IAGC 2QR0B 4JFFA 1Q9LA 3VDBA 2C7UA 1TJIH 2V5YA 4K2UH 2CALA 2B08A 4ONHA 3LSOB 2HUHA 1J7VR 1P2CB 3BLKA 5AW5B 3QUZD 3TC9A 2A73A 3KYNA 1NCWL 5GIRA 4XXDA 4IEFA 4M00A 1QLEH 1G1KA 2ZJSH 2ZUXA 2BC4B 2H32H 5GGSA 2R51A 3L2NA 1LD9A 4XOAA 3BXNA 5K1VA 3HRZC 3VRIB 4DFHA 4PG9A 1EERB 1KDJA 1DFXA 2KDYA 4YC2B 3FF7A 6PCYA 5IR1B 1Z5LA 3WKMH 3EJYC 4FG6D 3C08H 4PRHB 5ICYA 1AZZC 2MPVA 1IBBA 4UT9L 2D73A 3RLSA 4HIEB 3WNJA 1DE4A 1YHPA 1OTTD 3T65B 1NKGA 1TLKA 4BXVA 5A43C 3MJ8B 4NKMB 4QCIA 3WENA 4ZYKA 5ID0B 1CT8A 2DB8A 4PGBA 2PETA 2IAMA 5DWUL 4XNQB 4MYWB 2ADGB 2VN5A 3TWCH 2G5UA 4LSRL 1OGTB 5C0CD 1MCOH 1S7XB 3CSFA 3VI3A 5LBSL 3T2NH 4HZ1A 2F8XC 2CQVA 3LMJL 4IKJA 4LKXB 2OCFD 3ZR6A 3OG6B 1OSPH 3RPIA 1BQ5A 3FQ4A 5EZJA 5AVTB 1BFOB 3TU6A 1L7IL 1GYWA 5BZXA 3PWPE 3S36H 4IKIA 5FXCH 4XRCB 4QT5A 2HG5A 5AKRA 6FABH 5KBLA 1UXLA 2G3XA 5B1AB 1D6VH 5DJXA 1BG9A 4X9GA 4GXVH 5JIHA 1OTTC 4PTUA 4HWEL 4PBWD 5TQ0H 1DJYA 1UWFA 2JJSC 1JP5A 5KZCD 1KPVB 4X7SL 3KHQA 3DETD 1H3VA 5IM7B 4WI7A 1UCBH 4FP8L 1P7QB 1MCPL 3QT2A 4GKOA 3IAPA 1ZKAA 4JG1L 4WI0B 3L4CA 3RVWC 1ORSA 1JPFA 3Q8BA 1Z9MA 1IKFH 1RZJC 2V7HB 2EIDA 2EVIA 1Y6KR 3MLZL 2XFXB 2Z0UA 4GEJA 4WJG3 2DIAA 4F37K 4FD0A 4N90E 3QXAA 5LGYA 5IP4A 1IE4A 2HG0A 2KQMA 1JZ3A 1NGQH 1O6SA 4HHGA 2AGJH 4P9ML 3IMRA 4QGTA 4UINH 3OGCB 1F97A 2W9DL 4M7JL 3QNYB 3PQYD 5GHWH 1AS6A 4KRMB 4W9HC 4AJWA 2FR4B 2CK2A 3SPHA 5T1KD 3GB7A 1MKFA 4KKAD 1P7BA 1Q38A 1RUPH 3CFEA 3HNTL 4BSVA 3RVUC 4EVNB 1P2CA 5BZWB 1U8LA 3B2VL 3BP6B 3FFCB 4N87A 4XO5A 3LEVH 1ESOA 3QCVH 4PM1A 1WZMA 2EECA 3ATFA 4Q9BA 2COVD 1YN7A 4XPAL 1IKNA 3BXNB 5EUKB 4JZOA 3GZKA 4ZS6D 4PRNB 1IM9B 1HN1A 3MBXL 4A6YH 5I0ZA 2F2HA 3FCGA 1TZIB 2GQHA 1P4IH 3P30H 1OQXA 2XXMB 4G7VH 2WBJA 4XOCA 3VXTA 2HT4C 1D2PA 5CBEB 1VACA 1VEOA 4GRWH 5DHDA 4D0BB 1AQHA 5J6GB 2GKIA 3AG4B 4G8GB 4YL4A 2QFPA 3BAEH 1KXVA 2XVGA 5L2KB 3SJVE 4TQIA 1CT8B 2J6WA 2Z65C 3ZTJG 3EFFA 3RL2A 2AJUL 5FO7B 3MV8E 3T0EE 4Z77B 2VW4A 5DVMA 3SKNB 1GPOH 3HE6D 2XSKA 2PW2B 1ZVSB 4Z7VE 5BRQA 1JHTB 2R1WA 2BWDA 1W72L 5DO2C 3FXIC 4C57C 1RZGB 1I9RH 1QTSA 3QJFA 4K7FB 4QTFA 3HE7B 5J12C 5C3TA 5CU9A 2WP3T 4IKLA 4ABUA 4R0LB 2Y22A 4M6MH 4I77H 3QIBD 4N9GA 3BKJL 4PRPD 3T2NL 4IGBA 2VZTA 3KCWA 2HVKA 4QT5B 2YD4A 5CEZH 4XMKL 1RIUH 1F1DA 2NY2D 4LARH 2HLEB 2VXTL 2DV6A 3F58L 2IJ0C 1KCSH 1JBJA 4A1RA 4JRYE 1KPVA 4AWJC 3QUYD 1U30A 3FSOA 4LASH 1E90A 2NLJA 6FABL 4F8NA 2XI9A 1LYQA 5F97E 1OVZA 3C75A 3JWOH 1YECL 2ZNXA 4HEMA 4PCYA 4ZFGL 4PRDB 4FERA 5BNXD 2QSCL 1BFSA 2DH3A 3U7WL 2XFXA 4KZEH 5GGVL 5KSAA 1FVCB 4WCYL 1KTBA 4HUCA 1EANA 3MXVH 5TH2B 1SLUA 4MA1B 4PJHB 1W0YT 5JPMC 1XF3A 4X6DA 2BP8B 3MX0B 4HKXA 2BRQA 2VN4A 3VDCA 4FEIA 2LT9A 4UQCA 4Y16D 5I18L 3IETB 4I7ZC 1H6EA 4CRPA 3CFEB 3KYMB 4KJWD 4J3UA 4LSQH 2XN9A 4DNLA 1UGKA 4TVPE 4OFYA 4NO0B 4P5TA 3W5NA 3MOAH 1CD0A 4MA1C 5FWRA 4HEPA 1OGAD 4PW4A 3U2JA 1KIUB 3DHPA 3S98A 4D8PB 1E4WH 4M7LL 2A9DA 1QWHA 1IAII 1S7RB 2FX9L 3RIAF 4CU7A 1OXYA 3MRBA 4HIJA 4XCYA 3HE6B 4ZAKC 1OGAB 1JZ4A 1F3JA 4JRXD 1RFDH 3D48R 3L48A 1XX9C 2OSLA 3O6ML 4TNWK 5CBEA 4B0MB 4PS8A 3CFKA 3DLQR 1EX0A 2EDFA 1HIML 3TZVC 1MCBA 5D7JC 5I1LB 4BHUA 1E3FA 3GMQB 2BPBA 5JZ7C 2UZIL 4NWUL 3NZSA 3CPLA 1OSZB 4OZGA 1M2VA 3LPGA 1OGPA 4NLHA 3Q8CA 1W8NA 3UACA 4AIZA 1PZSA 3BMWA 5KVDL 5L0QC 1ZLSL 1NGZA 5E1GA 4MQ7A 5CR8A 2O61A 2YD6A 2WQSA 3C5SA 2D0GA 4N0YL 4ZX6A 1RZGA 1MFBL 1E3XA 2ZX9A 4G8FA 4XI5C 3OSVA 2NXZB 5DO8A 1PMYA 5I82A 4G43B 3MBED 4NN7C 2CLVB 3FTZA 4HJTA 4YWGH 2Q86A 3G6JF 5JLZA 1DBML 1HH9B 3S3JA 2F53E 3BCFA 4PJXF 3PRZA 2IV9A 1D7BA 4M5TA 4M6ML 2BHUA 2QKSA 4YNYA 1PKQA 4J3TA 5FUCE 4OKVB 2DMCA 1OZTG 3TNNB 3NA9H 1W72H 3MQIA 1IL1B 4I5BB 3LXUX 4N85A 5KANG 3HUJF 4RFEB 3LOWA 4KY2A 3EDJA 3G5VB 3VXRB 1C16B 4AQ1B 4JPIB 3RAJL 3CHXA 4I1PA 2C3VA 4E42A 4N3TA 1CLYL 4NKIL 4TRPL 4JRFA 1V54B 3DGGA 1RIHH 2XBZA 4BWUA 4M4PA 2C3XA 5GRUH 4AM0A 4OLEA 3KWWB 3ZDXB 1T2XA 1THAA 2V5RA 5MENB 1OD9A 4YGVA 5MHSD 2YARA 3MOBL 1A0QL 3MBWB 4DEPC 2BVPB 3UTZA 1NPNA 3MRGB 4XP1H 1ULVA 1U58A 1ECZA 2AMGA 3KPLA 4QTHA 3OB0H 4Z5RA 1WJ3A 4Z7QF 1JD9A 3F6JA 2ESVD 3GSVB 1FG9C 3GKWL 3T3MB 2CGZA 4D8PA 2H6PB 4JHWH 4U6YB 5EEZA 1B3JA 1TMQA 3VRJB 1S7RA 2WIIA 4IRSA 4XCYB 3RYMA 4YXHL 2OSXA 3MRMB 5DMGC 3ZBMA 2AF2A 2UZPA 2FT7A 2YIHA 5D7IB 1U8OB 1FGVH 1YEEL 4LL9A 4TUJB 5D1ZI 5I1IL 3KLHC 3GUTB 2ZG1A 4C56D 2C9VA 4UDTA 1AS8A 3IFNH 4L8SA 2DYPD 2VDRH 3RWDA 2HMID 2BHFA 3RPBA 4F33A 4GKNA 1ZXKA 1UWEL 4L3EE 4IOSD 2QPDB 5DGRA 2GK0B 4MNGA 5GGRB 3S34H 4BBWA 3GJEA 4CDGC 3P0VL 3F7YB 1II4E 4XPHL 3T8XA 1CWVA 1AO7D 5K39A 5TF1H 4X8JB 5LNGA 2N0KA 4XN9A 1CL7L 2EE0A 4KK9D 5LXGH 3LNDA 1XTLA 3GM0A 1ASOA 3PJSA 3SO3C 3WFBH 2VXSH 4NQXA 1IEAB 2ZAHA 4UOW1 1JK9B 2GJZB 3BPNB 3ZR5A 1NCAH 4QHMB 6PAZA 1C12B 1RD6A 4EKJA 3K6SB 1RZIA 3D07A 4F57H 1F58L 4HK3N 5HYSA 4A2MA 3L13A 5HGDB 3EJZC 4OI8A 1K5NB 4DQOL 3ZDZE 3C8HA 3V4PH 4JAMB 5TF1L 3ULVF 2QEJA 3QIUD 3CMGA 1QFUL 4LSPH 3WIAA 1A9EB 3B9DA 3FT2B 2JH2A 5C0RL 3L5HA 4G6AD 1EVUA 4JW3A 4YXLL 3UYRL 4FQLL 5KOVC 4X5WB 4NZ8A 1F4XL 4DT2A 1SJVA 2XLLA 1D9KC 4OSUL 3INOA 3R7RA 3RKDD 3VE0A 3QIUC 3R7QA 4AL8C 4AXWA 3EJZD 5DRZB 2DTML 5IMLA 1TJHH 3L3KB 4NX0A 1PZ2A 1U8QB 5DLMH 4L8CB 1J5HA 3MRLB 2CE6A 25C8L 1XB3A 1H15B 3DARA 4KH2A 4DH2A 2R0WL 5IVXF 4X6EA 1OK8A 3GRGA 2P8LB 4JHAL 4DP1X 3WTTA 1H6FA 4OUUB 1B4JL 2EE6A 2EKJA 5EU7E 2I9LB 3BUQA 4G6JH 4WUUB 5FDWA 1E6JH 1R5WA 5I2IA 3B2DC 2Y36H 3OKDA 5DUBA 5F70A 4CBZA 2GJ6D 1A6VH 2HLFC 4PJ5D 1JV5B 2LR4A 3QJTB 4WUUD 4NN7B 2EYTB 3FU3A 4XC3L 2OK0H 1OAJA 3RJQB 4B97A 2X4UB 4IRSB 1BXVA 4JHAH 4L4TB 3RVVD 4PLOB 1TXKA 3MMEB 2FWUA 3QJZA 3GSXB 1BCIA 3DO4A 3KPSB 4GSDL 5E4EB 4FI7A 1ZA6B 2F8IA 4JANA 4TUJA 3GUTA 1NBYB 4HWNA 1OIOA 3PWJB 1KBVA 4PRIA 3V9FA 4NC0B 4LCWA 3RWDB 5DEFB 3T4AB 2J12B 2XWEA 4E36A 5E1HB 2D8KA 1ZHLA 1I9IL 3LXAA 2ICES 3ETTA 1J0ZA 3ELAT 2YD9A 4GUPA 2PXYD 4NRZB 1QWUA 3D18B 3LRGA 4X80H 4KNUA 4JFFB 1WFNA 1ROWA 1LP9E 4FTVE 2ZKMX 3O6FD 5GISH 5F7KC 3V7AG 4J2XA 1JWMA 2JCCA 2VR7A 4OQTA 3T0AA 4KKQA 3O2VL 1PX3A 4Y9CA 4TUOA 4JFFE 1WT5C 3WJMA 2WQUA 1NMCB 5GS3A 5BO0D 1OSYA 4G8IA 5BRZE 2EE2A 2YHGA 2J1ZA 1QW9A 1JDDA 5G4OA 1FQ9C 7PCYA 3MCLL 1A9EA 1LJMA 3IPEA 4XZUA 1ZSHA 1AR1C 3GMOA 4S2SA 2HKHL 4YO0A 2DQCL 4MAYB 3GIVA 4LDOB 1TQUA 3IDUA 2E9GA 4ZS7H 1ZV9A 2QADD 2WV3A 3A67H 5E1QA 2Q76A 4Z7NF 3LS5L 7TAAA 1D5IH 4TSBH 4HV8B 1BD2B 1NANH 3NN8B 4PGBB 2OBGA 2FK9A 4PCTA 3BEVB 1E6OL 2EDLA 3JWNG 3QWOA 5ESVB 4XNQA 1XD1A 4LGSB 1H15A 2QTVA 2ZSWA 3G6AB 2M83A 2ORBH 3KLSA 2P8LA 3KAAA 4DPCX 2ATAA 3F7KA 4IRJA 1NEUA 4FNTA 1YEKH 2DWEB 2OXGA 4MJ6B 4YIQA 2WCSA 5T3XL 1K72A 4V1DD 1K8DA 3P2DA 4GXUM 1XDTT 4XRCA 1BVZA 5AB9A 3EBAA 2AJSH 5I8OL 1WEJL 3BGFB 4U2YA 1AJ7H 4JZJA 2A74B 1OTSC 1A7RL 5FGBC 1YQVL 1NBYA 3SKMB 1H0DB 3VUAA 4PJCA 4P06A 2A4CA 1NUDA 2MCAA 4UTBA 1XBRA 3S0PA 4W9KC 2F8OA 1WFUA 2OMVA 3F7VA 4M61B 4N8VB 5DYFA 1RZ8B 3IPBA 4JN1L 4OM1L 3VXMA 3ARXA 4F2ME 4GRMB 3QXDA 2ZP0T 4MBRA 4HQQL 4MXQD 5F7DB 4AL8L 3BH9B 4NN6C 3ARUA 3BHBA 3GYRA 1TR7A 2KUTA 3FTWA 3HN3A 4IHOA 4TTDD 2R2BB 2PCPB 1JWMB 1A02N 4K7PX 1MIML 1W0WA 3SKJL 4XMKH 4JJHA 4R2GB 1AIFB 2Y07L 1A14H 2V9TA 4IRZH 3DXAE 1HINH 3RZCD 2WKOF 5AD0B 2A6JA 1RUKH 3I75A 1KCUH 5JHLL 4LBEA 3O3AA 4TUKH 5F0MB 4KVNL 3H2PA 2O6DA 3ZHFA 1LE9B 1F02I 3VI4B 3DIFA 1EGJA 1JXKA 2BZDA 3DVFA 4GLRI 4U1MA 4DOHE 4N2CA 4PW9A 4QRBA 5DHMC 3Q1EA 3VFMB 2X4PA 5DHVA 2IF7A 4AYFA 2Q8BH 3EXJA 1MREL 2Y6TE 1U4EA 3L1GA 4JPWH 4CGTA 4FTDA 4NP4H 4UTBL 3FUDA 1FHNA 3DV4A 4WKZA 4Y1AD 4YXLH 3RURA 4FEMA 4OIBA 3RL2B 4Z77A 2CIKB 1LEGB 2BNUA 1NLBL 1S9VB 2FBRA 4DP4X 5GS1B 4GIOA 4M1DH 2B14A 4AQ1C 4Z3TA 1DQLH 3MFFA 4DFIA 4BCZA 4AVIA 1GS6X 3I50H 3F83A 3WNIA 4IDLA 4NLAA 3IN2A 4R0LA 1JXGA 1TETH 4P23B 1UM6L 1JWSA 3QDME 2C1PB 3X1EA 4HIIA 4PY8I 1AANA 3GBLA 3WFDL 4O00A 3ZE2B 1P9MC 4YK4B 1R3LB 5D5MA 4FLQA 4FFVC 4E5XG 2A74A 1BVNT 5INCA 1DUYB 5E1IA 4G9DA 2HTLC 1NEZG 1LHZA 4AZ8A 1PX4A 5AKSA 4HMEA 1DN0B 4M61A 5DJ6A 4G11A 4YBQD 3ULUF 4WTZG 1RZJL 1IAIL 2WUBH 4F7PA 1NCBL 4GLRH 4KKLD 1AXIB 5HHXL 4AH2A 2I5YH 2CO4A 1UM4L 3IB4A 2CBOA 1NCDH 4QO1B 3F8UB 2IAMD 4PAZA 4CN6A 2VDNL 4OCRH 2QSVA 4MHHG 5EULV 1BYPA 4D0CB 3NTCL 1W0WB 4Z95L 1GYCA 3GZQA 1CGWA 2LW3A 4NO0A 3LKPB 1DANU 2YAQA 1Q1JH 4NQCA 3HS0C 3ZL4L 1IAMA 3QUXC 2PABA 4ECNA 4EJ1C 5GJTL 4G9FB 1W0VA 1BQHB 5TDNB 4X9IA 4ILDA 2ZX8A 1IGCH 2GUOB 2PWEA 1UWYA 2AKRA 1QLEB 3UJJH 4U1MB 3C9NA 2YD8A 5BS0D 5JUEH 3MCYA 3L9BA 4OUOA 1OPGH 3FQTA 4P4RA 3ZMNA 2ZIDA 4AQEA 4WEMB 2L0DA 2XCMC 4K4KA 4K3JL 1XR8A 3WJJC 5F9DC 3LKRB 5FUOL 1KGIA 3WY1A 1GY2A 3DV4B 1HQ4A 2PP8A 1QBBA 5C0DB 4RQQB 3TH4T 1MJUL 4PRHD 2GCYB 1GOFA 4BK5A 1IGCL 4PJFE 1G7HB 4M5YL 4NYLA 3LVTA 5AAPA 3PHOA 4OLZH 4X7TB 3UP1A 5I17A 5F6IB