4ZTEA

Crystal structure of human e-cadherin (residues 3-213) in complex with a peptidomimetic inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
210
structure length
210
Chain Sequence
IPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human E-Cadherin-EC1EC2 in Complex with a Peptidomimetic Competitive Inhibitor of Cadherin Homophilic Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Cadherin-1
total genus 43
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zteA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zteA02
1OP4A 2A4CA 1NCJA 4ZMWA 3LNFA 4ZTEA 2V37A 4NUPA 4APXA 4AQAB 2O72A 3QRBA 4ZMZA 2WD0A 3K5SA 2QVIA 4NQQA 4ZMNA 3Q2VA 4ZI8A 1NCGA 2WCPA 1NCHA 3K6FA 5CZRA 1ZXKA 3MVSA 4NUQA 3FF7A 4AQEA 5JYMA 4AXWB 3UBHA 4ZT1A 3PPEA 4OY9A 3K6DA 5CO1A 4ZMLA 4AQAA 4NUMA 4AQ8C 1SUHA 2OMTB 4APXB 2WHVA 3LNIA 5DZVA 1O6SB 3LNDA 5KJ4A 2QVFB 3UBFA 3K6IA 4AQEB 4ZMPA 2A4EA 4ZMVA 1NCIA 4ZMQA 4AXWA 3K5RA 4XXWC 1ZVNA 3FF8A 1L3WA 4AK1A 3Q2NA 3Q2WA 3LNHA 4XXWA 2YQGA 1WYJA 2X2UA 3UBGA 1FF5A 2OMUB 1EDHA 3LNEA 5JYLA 2OMYB 2YSTA 3Q2LA 4ZMXA 2OMVB 2EE0A 2WBXA 2OMXB 3LNGA 4QD2E 4ZMYA 1Q1PA 4ZMTA 2OMWB 1WUZA 2OMZB 4ZMOA 4AQ8A
chains in the Genus database with same CATH superfamily
3MO1B 3MRKA 3PWNA 1UYWH 2WZPD 5T3XE 4TNWK 2JXMB 4LGSB 3BW9A 4MA8H 5GRXG 1EJ6A 4PJ9B 1QPPA 1Z2KA 1G0DA 4IU3A 2NRDA 2XZCH 3CFDA 3GDCA 1EVTC 5DJ2A 4Y4KD 3QIBC 4TS6A 2AXGB 1Z5HA 3DROB 4JY4B 4A63A 5KZCB 2VQTA 3BVDB 4O5LL 2DEXX 4GYBA 7FABL 1IBYA 4NN7B 3SDDC 3ULUE 3FSZA 4F7PB 3BAWA 2W9LA 5DLLA 2DQJL 4PP1D 3VD1A 2FLBT 5EEYA 1VZHA 1CFNB 4WFHD 4F5CA 2GSIB 1R3HA 4NUQA 5JUEL 3CXHK 3AY2A 4XVUD 1BAFH 4BWWA 1YEGL 3TBSB 3PAUA 2P45B 2ITDB 2OULB 3MLPA 3NSXA 4BCYA 3NSDA 1XF3A 3DA0A 4F33A 3LMJH 5D7HA 1MVYA 5HGHA 5C8JA 2EVFA 4JFDD 4J3BA 2JV6A 3GMLB 4I48A 1P6FA 1YO4A 3NJIA 4L4TD 4HXAL 1SXBA 2BNUB 3Q48A 2G0LA 1JD7A 1A02N 2VXTL 3MI6A 4HS6B 1NMBH 2BS8A 1RQ5A 1TZHB 5TPWH 1Z5LA 3SYQA 3W1ZA 3NPSB 3OAZH 1RZGB 4ZPTB 5IF0A 4PJEA 1RLWA 3EXLA 3VE0A 5DDHA 1ITBB 1E0OB 2Q76B 4LRNH 1KV7A 4IJ3C 4PV9A 5GRVK 2JJSA 4IGBB 2MHAB 4V2CB 4AQZA 5JNYA 1DJHA 1JDDA 2YO3A 3MLRL 4AXWA 2A6KB 3S3JA 3TFKD 1OTTD 1M1SA 2BP8B 4JZJA 4E5XB 3RFZA 5E2UL 4PRIB 1XXDC 1ZKAA 3DTDA 4NN5C 3QIWA 2IBGA 4WUKL 4Z7UA 4AK1A 1KCRH 2F7RA 3HPJA 2QEJA 2YGVA 5K33A 2WINB 3WBDA 4IRZL 3HLAA 4M7JH 4HJSA 3BP6A 1G7QA 3KXFB 3IBOA 4N87A 3C2AL 4UYQA 1FL6A 3WFBL 2HT3D 4XHJC 1E4XH 3ZLQC 3MV7B 3EGXB 2IWEA 2F0CA 1CD0A 1Q94A 4WHTA 1T20B 2I9LB 1W0WA 2A74A 2FJFA 4O51A 4ERSH 3MCLH 2N4IA 1BQLH 2B1HL 4I87A 5DJYA 1I82A 1A7RH 3ECUA 2XN9D 3MRHA 3RWEA 4JANA 3QR0A 5KVMC 3KXFE 4GBXC 4MRCA 4DP8X 3BWAA 1B2YA 5BW7C 4ZO8A 1TENA 2XN2A 1HX0A 1IZJA 2G5UA 3L17A 1M7IA 2FH6A 4QI3A 2VSMB 5DUBB 2ADFL 5HHOE 3PWLA 2AXWA 5E5LA 1F56A 4YSDA 3UTTA 3G5YB 2MNUA 4LNVA 4F7EB 5IJCC 2NQCA 1HEZB 4P23D 3CX2A 3ARGB 3NA9H 1JWMB 2A77L 5DRWB 1I8KB 2FEDD 3K6FA 1WK0A 1QBML 3RG1C 5BRZB 3JV6A 4X4XA 5IB1B 2WLIA 3W9DA 1F4AA 4BWTA 1AQDA 3DPBA 5JXED 2AQ3A 2BC4A 4U49A 5C0RH 3WY3A 4UU9A 4Y2DB 2FT8A 5JPNB 2FIKA 3O3UN 3RPKA 2A74C 1A6PA 1KCLA 4KK9C 1WC7B 1P7QA 2IALA 4XO8A 1GL4B 2DQGL 1UWEH 2WQVA 3FU8A 4H4NA 4QNPE 3K6DA 5D6DA 3FT4B 1LP9A 1NLBH 1CE1L 2WZ5A 5SV3A 5C97A 4LL9A 5AW0B 4O02B 1U3HD 1HOCA 4B9JA 5EUOE 1NANH 3WNJA 3QNZA 5HHPA 1QLFA 4MDIB 3NIFB 3SCMD 1PVHA 2R1WB 5EO0B 5CEYB 4UQEA 2X12A 1CI5A 5G4NA 2VN3A 2FT7A 5ITBH 3L9RA 1K8DA 2LOEA 4FI6A 2V9UA 1RD6A 1CGTA 4MS6A 3CN0A 2VMEA 3V8OA 3BHBB 1I9EA 5MENE 3QDGE 4MMZC 5MEOB 4PCSA 3GSNL 3X3GL 3U46B 4P2QD 4XP1H 2C1OA 2ID5A 2Z8VC 1U92B 1FG9C 4QRRE 4NENA 3KVPA 2AJYL 3FBKA 3POHA 2B59B 3K2UL 43CAA 1SQMA 4K3HA 3WDIA 1QEWB 3CXFA 1GZPB 3KPOB 3SSGA 1UZ8A 2N56A 4YHLL 3PWVA 4LMQI 5I19L 5IQ7H 4YR6B 1GS7A 2AJZA 1T0MA 2DS4A 3EKCA 5I1LA 1FNFA 1MPAH 1V05A 1YEKL 2NY6B 2IWGA 4YGVB 1JGLL 5G4OA 3RLSA 3UPAA 1AD9B 1UACL 3TZVD 1JNHB 1LO0H 1U8LA 4E41D 2ZYSA 1PPIA 4LSUL 4K5OA 1ZIAA 3FCSB 3I3EA 2UUDK 5GGUB 3MV9B 1K6QL 5DGRA 1OD9A 2OKMA 1EXUB 2VUKA 1NWPA 2XKUA 2VLJD 3APCA 3FUHA 3HN5A 5LBVA 3RPIB 3TIEB 1QSEB 5GZOA 1BLNB 3PUCA 1TFHA 3UPCA 3VI4B 4J3UA 3V4VA 1BWMA 3EH3B 4QHLB 3IJSA 5HYSG 5D2NB 4WW1B 3CUPB 4OCSL 1SBSH 2IEPA 1RIHH 1XF4A 4MWFA 4QPEA 4F2EA 1QFWI 1UD3A 1I4FB 4Y5XA 4GB9A 3GSRB 3MOAL 2VJ0A 1FVDB 3MRNA 5EIIG 4WNQA 4FABH 3ARBD 4R7DB 5I1HL 3ULUC 1AACA 1NCHA 2P5ED 1N3NB 1AJ7L 4K55A 4U0QB 2X2YA 3IGAA 4XNYH 3MRCA 2C3VA 1KCWA 2QLVB 5F89A 3N85L 4MDJA 2ICWA 4HKJB 1EHLL 4LLYB 1A21A 2VZVA 2NX5B 4KAQL 2SEBA 1OCWH 2XFGB 4F15C 2VDQL 4JRXD 4OR1A 5I1JL 4J39A 3C6EA 5F9JA 4HPOH 5HSFA 3SYAA 5D7KE 1AZCA 3KPNA 3EGSA 5DR5H 2FR4B 3JWOC 4D9RD 4MDJB 5KBLA 3CZNA 1YPZA 4X6FB 3VG9C 3HBPA 4L1DA 3B7TA 1IGCH 4G42A 2JJWA 4R7LA 4YS4A 3AACA 3OKDA 4TVPH 5EUOF 1B9ZA 2VAAB 3RTQB 4RZKA 3NEEA 2BVUA 2H0JA 4W6YB 3T3PF 1JWUA 4LLQA 4MJ5B 3RWJB 3GLDA 1IARB 4HG4K 4Z7WE 1LMKA 4KZEL 5CF3A 2HVJB 3K46A 3LQMA 2NNXA 4ZFOA 1AHWA 3BPOB 3W9EA 1RZPA 1NFDA 1TKWB 4YFLF 3EBHA 5GSVB 3VX1A 3AU1B 4JHVA 4AIEA 1F00I 4QRPE 4HLEA 1MFCH 4N9GB 5IM7B 2KS0A 5DFWH 2BDNH 5INDB 3L4XA 3MBEA 5T5FA 2ENSA 4GSDL 4Z7UF 5KZCD 3V0EA 3P3UA 4CC4A 3JV4B 4WVRA 2NLJB 2NX5D 1J1OH 3BDYL 1Z9LA 3TV3L 4WK0B 3WFDH 3O6MH 2KHAA 2RBLA 4F7CB 3C5ZC 2ENPA 2BZCA 5ISZD 1GC1H 2W9EL 3PPSA 1FF5A 4ELMF 3MODH 3NFNB 2VSCA 3PIQA 1FYHB 3U1QA 4O2EB 3N0AA 1F6AA 4HHGA 2K3HA 4WTZG 4Q4EA 1WZ1H 5JNYB 1AJ7H 3JYCA 1MCIA 1U4EA 2FEDC 2VXQH 2R2CA 4FS0A 4PJCE 1WAAA 4F2MA 4ZMYA 3OMAB 4YDIH 4TUUA 4KKLC 2WTRA 1UM4L 5I5JA 3T0EB 1MOEA 2ZXDA 4YHLH 5AW5B 3FSWA 4AT6B 5JHLL 5IBUG 1XD1A 1AQKH 2BM3A 5L4FA 3AG2B 1K5NA 1N5AB 1L0YA 5CMAB 4PGZA 1EBPA 3D4ZA 1TVBA 4YBQC 2NZ1A 1ZAGA 1T6WA 3HC4L 3TEXA 5DHVH 1FL6B 3ILEA 3D2UD 3R06B 1TO4A 1CL7L 4IGBD 3SCMC 2W88A 4UM8B 4AEEA 2EDFA 2F54B 3QUZB 2ARJQ 2AP2A 3B4NA 5DRXB 1PX8A 3WY1A 4P9MH 2AF2A 4NX0A 1KIRB 1LJMA 2ZONA 2BSRA 2EXYC 3NG5A 1KY6A 1KXTB 4AI7A 3GM0A 5HYJB 5IG7A 4S0HA 3DYPA 3FUFA 3CZLA 4JL1A 4GG6A 1J87A 1FNAA 4AE0A 4CNIA 4E36A 1OSPL 4JPKH 1N0LA 3HE6D 2C4XA 3FTSA 5EU3A 3UADA 3QDGA 2CDGB 1HE8A 2X1QA 3RFZC 4TF4A 1G7IB 3VUAA 1IM9B 3DX6B 4HCRA 3A5VA 5DSCA 5GXBB 5L4JA 1F86A 3RBSA 1RK1A 3LRSB 3MR9A 5HPMA 4PJFA 3BGFC 3EO1B 4FFVD 3HJ0A 4QXGH 2Y7LA 4XBGA 3MUHL 3EH2A 3BRGC 4PYHA 4YSUA 2H32H 3BO8A 5DSCB 3DBXA 2WUCH 2GJ6B 5GGSB 2HLAA 2LAAA 2FWOA 4I77H 2XZZA 2Y0SA 1DJZA 2WXQA 3QZOA 3ETBF 4L1HA 2VLRD 5EBMA 4HWEH 4UU9B 1S9WA 3S37H 2C9PA 2F54D 1OXYA 2Q3XA 5CSBA 4IGBC 2H0EA 4R4ND 2Q6WB 2O6FA 2FO1A 2DH3A 3QJZA 1TVDA 5H94A 5IROA 3V6OC 3NJJA 1B4RA 4DO4A 2AI0H 1E2WA 4PV1C 4ZS6C 2L7EA 4WW2A 4FHJA 1LWRA 1YCSA 5CKAA 4P57B 2XN9E 3H85A 5L7XH 3V0IA 1B3IA 5FECA 3U0PA 1SY6L 2XPGB 1MLCA 1ROWA 4K73A 4LSTL 1JPFB 4AV4A 2G30A 4FQ1L 3BPCB 4TL4A 3L3GB 3SPVB 1A6TA 2PW2A 5I76B 2P5WA 4R90L 4WUUB 4ZSOE 2C3VB 2FHFA 2ZX5A 2YAQA 3P0VH 4HP5A 4AV0A 3HG5A 4OT1H 4LPXA 2Q8AH 4U1LB 2FGWL 2YK1L 5JXAL 1I1FA 1FFQA 1UATA 1I9RL 2G3XA 4NM4L 2QTVA 3C60C 1QVOA 5BO1L 1TQSA 3N1PC 3QEHA 1NC4B 2W9EH 4HMCA 2PPFA 1FRGH 1KGIA 2QQLL 1EZSA 2UWEB 2WXNA 1WWCA 4HUKB 3ECQA 3U7WL 3IMRA 2R7EA 4FJZA 4PGDB 5DQ9A 2N1KA 3EFDL 1YJDH 2D7MA 3F01A 3JTTB 2QQNL 4FG4A 4D8PA 3KPLA 4Q6IA 4JZNA 2ZAIA 3P4MB 3SKMB 4JO3L 5JOFB 2HVJA 4MB1A 4ODSH 4NO0D 4XCYB 1ETZA 5EH1A 4JRLA 5FF6A 3QUMA 2HG0A 3TASA 4GUPB 4I77L 3VX0A 1ZXKA 2VIRA 1KNOB 4L4TE 1U8OB 4UZSA 1TZHA 4N2FA 5C0CE 1FV1B 1KLGB 1JNJA 2WLKA 3FT0A 3OC5A 4S2SA 1BAGA 5FHAH 1GGBH 3ASNB 3WFEL 4QTHB 1JZ3A 1ZHLA 3PJLA 3U0WL 4M61B 2IQ9H 5SX4H 1CR9L 5E4EC 4JREB 2GTZB 4AQAA 1FLTX 4WU5B 5AUMB 1VRSA 4ZAKA 3MRFB 3MLVL 2BDNL 4NDMB 3DYOA 3BEWB 4G7YH 4YDJA 4XVOA 4PG2A 1OSPH 5F6IC 5C0BD 3UJTL 4E41B 3VXRE 5BJTB 4OLEA 1J11A 3NJXA 3SZKC 2JH2A 3BKJL 2AQTA 4GFXA 3MV9D 1WUNT 3WIHA 5K1NA 4POZC 3N1GC 5HD8D 4GW4A 4N8VB 3VFNB 2VDKB 4J3VA 2Q8AL 3IAPA 3S6CA 3B6SA 2DYPD 2A7BA 3KCPB 5GRJL 2ICWI 1ZVYA 1HYRC 4UV4H 1FIEA 1JTTA 3PABB 4MNQD 1JGEB 3L16A 4U05A 4G8FB 2BVOB 2B0SH 2O61A 1Z9SA 2IXQB 3SEPA 1E4KA 3CU7A 1TTAA 1THAA 1KCSL 3VGAB 3Q2WA 1MIML 3SY6A 1MHHB 4Q9QL 4LOUD 1MI5E 1CQYA 2A6JB 4NLAA 4NQEB 5CHNA 3TIDA 3KYOB 2RQEA 3LD8B 3S97C 8FABA 4ZSOA 3IFLL 1ZVHA 2AI0L 1RHHB 3DTXB 2R4RL 1U8LB 3X12B 1OWRM 2FSDA 1QP1A 3EBGA 1T1WA 4JY6B 1ES0A 3W9DB 2OX5B 3HC4H 5CXPA 1I1AD 1MCDA 1XCQA 3TGXA 2AS5M 3FQWB 5EN2A 4KI5F 1KCBA 3DO4A 4PJGF 3ZDZF 3P2TA 5KANI 1NAMA 5H8DA 1TO5A 5FXCH 4PVNA 3CVIH 3MOAH 3T0ED 5LUMA 1M3IA 3LCYA 4JJHA 3FB7B 1R5IB 2CDFB 1X5AA 1KIQB 1UFUA 1KJVB 2DMCA 4MJHA 3SKNA 2XKSA 3MRRA 1Z9PA 3NCFB 4M5TA 2O5ZL 3KW8A 2KPNA 2WP3O 1QSFA 4LCIH 2EUVA 4KUCF 1I7ZB 1VPOH 3ARSA 4HUUA 4K0OA 3S5ZA 4APQC 1KBPA 3QFDB 4P46C 3Q0HA 5DA0B 3V5DA 2Q1EA 2YC1B 1H6TA 5AOIA 1B4TA 4NHCL 4ZO7A 1AZVA 4PJGE 2A6IA 4AUJA 4NQCD 1H15B 1MCNA 3WKMH 1D3CA 2Y24A 4JG0L 4CADB 1BWWA 3TCLA 4J6RH 1B88A 3L3JB 4ETQB 3BSHA 3H53A 1MWAH 5AVSB 5JPMB 3A47A 3CAFA 5C6TL 3F05A 3WIHH 4PY7B 4H88L 3UXFA 4RBPK 4CDGC 5T1KB 5KSAB 1T83A 3ARTA 4RISH 5D7LB 2UXGA 3HZYB 1ZV2A 3TCLB 3CIAA 5IQLA 4HBCL 3NQIA 4R7VA 3HS0C 4ZFGH 5C9JA 1FYTD 1DSWA 2ZYHA 5JHDB 1AANA 4N68A 3LRLA 3V7AE 5I8CB 4FNLL 5AG9A 4RX4A 3OC8A 3EO0A 4DQOH 1YNTA 4NERA 1GYCA 2XWRA 3C09B 3BUIA 1BZ7A 2ENJA 2H3KA 4HPHA 3Q1EA 2ZOOA 2WZ0A 1AQMA 4OV5A 4W93A 1KFAH 1P7QB 4YHNA 5CZVH 4NENB 2ZP0T 4HUXA 4GAYA 5GRZA 4P9HC 4ZMVA 3CBRA 5D1QB 4UILL 5SWZE 1IE4A 3VWJA 1F4WH 1C5CH 1BAWA 1A6TB 1TG8A 1XWVA 2PW2B 2X42A 3E6HB 2BCMA 1GYUA 1VFBB 1F45A 2JJSC 4ENED 4KOCA 3FRPA 4X5XA 4IK6A 4G80A 4Y19A 1JZ7A 4B3EA 4KI1A 4BE6A 1KTRL 2CXKA 3EDEA 1G7PA 3HG3A 2PNDA 2CR6A 4Z78A 1K8DB 3QFJA 2ILLA 2Z64C 4JFOB 3VRIB 2HN7B 1I7TB 2DQDL 3FRPB 1F42A 3QW9A 2YA2A 2D8KA 3WI9A 4JJ5A 3UX9B 4XNXH 3QO1A 4UAHA 1ZA6B 3IETA 2R7EB 3V6ZB 1MJ8L 1COBA 1H6UA 1K5WA 2F58H 1HE7A 2YWYA 3DUSB 3HZMA 2EDYA 2NW3B 3S4SA 3ZTEA 1BM3H 4B7IA 4WFFE 2VL5B 4HJEA 1J7VR 3BC9A 1GHFH 4MS8D 3WJLC 2ZCLL 2DQUH 1FL5B 2UZXA 2HLFC 2QSTA 2YAMA 1YEDB 2VMJA 3MBWA 1JHKL 4EN3B 4YHML 2JNZA 4EBQL 1T1ZA 2X1XR 3NK3A 4J1UB 3W9EB 1J48A 2F7IA 2WD0A 3Q2CA 4PSRA 5EOCJ 4NJAH 4L4VB 4R5XA 4OLYL 2CA4A 3DYMA 1AS8A 4HC1L 4LB8A 5E1HB 5F9DC 3FS9A 4DERA 2B1HH 3CDFA 4L8DA 5C0EA 4LCUA 3S7GA 1DR9A 1Y0LB 2OLDA 4NDMA 3F58L 5HVHB 4XNMB 3ULVD 1J0KA 2MCAA 1SMDA 3K71A 4G6AC 2BPBA 3MN8A 4B60A 1I3GL 3TP4A 3VXUA 4M29A 4K94H 4BZ2A 1MELA 1EK3A 2PPEA 3KGSA 3QXDA 3QIWC 4UTAL 5I6KA 1EZLA 1HKLL 1EGJL 1PZ3A 1T7XA 2OSLA 3S3BB 1U8NA 3MRHB 4KHXH 5DUPL 5BS0D 3CBJB 4PN6A 1C08A 3LKPA 2ZCZA 4FQXA 5IB4A 4XP6H 3ZYIA 5LWYL 1EA9C 5D70H 3VD5A 1AQHA 2W0PA 3KJ4C 2BIPA 4RVBA 2V6HA 1IKNA 1YEEL 3QXDB 4J6RL 2W0KA 4NUGH 3B9VA 3RE0A 4DKTA 2HP4A 4R83A 4M7LH 2F5BH 1M7UA 1NWOA 2OCCB 3LKPB 4MZIA 4N28A 4N0CC 3MFGB 3OXRB 3AWGA 3K2KA 4PS7A 2W07A 4K7FB 5CD3A 4JFEB 3NQKA 3DGDA 1DSFL 2XV0A 2BJML 1KBBA 1S9YB 5IHLB 2XZQH 5HJDA 4H20H 1GZHA 4NFBA 1E5UI 4L29A 4HJUA 4UT9A 3HAEB 1EAPB 1OWWA 3VG9B 3T71A 2AV1A 5DMJB 4F8TA 4FTVE 1ZJBA 1NGQH 1E4KC 1Q9WB 4DSYA 4KZCA 4QRSB 4YDLC 4NZUH 1AGEA 5F96L 1U8PB 2L0DA 3NJFA 4LP8A 3S3SA 4IK7A 4WENB 5BO0D 2YQGA 2FYVA 2BLFA 1OKEA 2YUXA 2DLTA 3QQ9D 2EADA 1OTSD 2DLHA 1ZVSA 5TDNB 1H8NA 1AS6A 1GGCL 4YDIL 5DEJA 4ZJ9A 3DIFB 2DD8H 4LO9A 2JTDA 3VFNA 5CCGE 2PPAA 1X5IA 2EZ0D 3OMZA 5JIPA 4XN8A 4KNQA 4YHOH 3VW3L 1MHCB 1JP5A 5E2WL 1HAWA 2AXJA 3S2AA 5DMYA 4ECNA 2ITEA 4N2MA 3QZMA 2WB1A 5IB5B 2Y7MA 2VRKA 3HFML 4J3OC 2GKIA 4AVIA 3EGDB 4Z7WA 1CK0H 5D96C 3T6VA 1T22B 1BIIA 1CFQB 3FAWA 4NUPA 3ECWA 1JN6A 5AOZA 1KIUB 4NOBA 2CLVB 1UWGL 8FABB 4CL7A 5I28A 4Y9FA 1JZFA 1G6RL 3WENA 3C8KA 2ZUSA 2AITA 4KBPA 4NKMA 1BVLB 4Y2NA 1X5HA 3H3BC 4YHNB 2Y3NA 3HHRB 5CGTA 1ANUA 3AXLA 1G1OA 2IF7A 1E2VA 2IPKA 4ZK8A 2R0KL 3HG1B 3IFPA 4FNLH 5GJTH 3B2UD 2R27A 3VD9A 4HJ1A 1DVXA 3HJEA 3EO1A 1IU1A 1CFMA 1OT4A 2BZDA 4XZUA 4W9EC 4WNQB 1NBZA 2H7WA 3CSTA 5GGUA 4DGIH 4AKOA 5MEPB 5LDSA 4FQ2H 4BYHA 2E9IA 3F58H 4XWOD 4QHNB 5CLXA 4EDXB 2EDMA 5DLML 4ICWA 5ADPL 5FO8B 1QFOA 2J88H 4AENA 4YHYC 4MZ3A 1CYWA 4Q4IA 3KPTA 3CCHB 1EMTL 1I1AB 1RUKH 1I8KA 2BSRB 4LDLB 3ZHDA 4WI2A 3H2WA 1ND0B 1SF5A 1FBIH 4WZ9A 5I71C 1OGAD 4N1CA 1TQVA 1R3IL 2FR4A 4PJXE 5FYKU 4U1LA 5IT2H 1B0IA 1BX2A 1PFOA 2CUAA 4C4UA 1CCZA 3SE8L 2AEOA 3WUWA 3QDME 3LZFL 4XMLL 4L0YA 2MSPA 1UM6H 2IGLA 3LSOB 1GIGH 3GSOA 4MKTA 2E7MA 1X6NA 1TITA 1TNMA 3IWVA 4FTVA 1VLXA 3AUVA 3THMH 1E4XI 3A6CL 1XD0A 2J8UF 2P1YA 3K8LA 4BSWA 1I7RB 4DUVA 3FT3A 5GS1A 5C09D 4PW9A 3CQQA 5FM5M 4DGYL 3QUMB 3OKMB 1ORSB 1U8HA 5I5IA 4F3FB 2DEYX 3VDCA 4DEWA 4DKFL 4QHKI 3MRQA 3W0WD 2O6EA 4N6RB 3QA3A 1NGPH 3EJYC 2A74B 2XX0A 3RDJA 4OZIF 4FMVA 4S2SB 1S8DA 5GS0H 2YAPA 3JV5A 3NFNA 1CYGA 3PV6A 3QS2A 2G3NA 1ULVA 4GW1B 3L7FB 2Q6WA 3P02A 4ABVA 2QGCA 1XQ4A 3I2CL 4KRLB 1J1PL 5AYUH 1T4WA 4AOFA 2VLKE 2NW2A 4GRMB 3FO0L 3DX9A 1HINL 3UPRB 3MUUA 5H4ZA 4P06A 1A9VA 2O1AA 4KXAA 2Z91B 4MCYB 2H9GB 3RAJH 4GSRA 1YUHB 2CUHA 3QDAA 4HBQA 1EHAA 3O11B 4J2QA 5B3JF 1DQLH 4PTUB 3TH4T 3QIWD 2YRZA 3GC3A 4X9HA 3N43B 3SODB 5ALCL 3EBAA 2YPVA 1ZANL 1BD2B 3VRLE 4PJXB 5EF3A 3NSYA 4OZIE 5TD4A 4KKAC 3ATFA 5DRWA 3SE9L 4YSQA 2WJ5A 2P3YA 1P7QD 1ACXA 4IMLB 2WYHA 2LVCA 5C0FB 3IMTA 5CD3B 1E5BA 3VNYA 2CK0L 2VXUL 4JFFD 2HVKB 4A2DA 3FMGL 1HSAB 3T5WA 5J11B 2Q7NA 2VAAA 1RPUA 1SLVA 1N4XH 2X1PA 4TVPD 4ABQA 1UVQB 2Y6TE 2J1XA 4M7LL 4WFEE 3SDXB 3UEZA 4Z95L 2J6EH 3QEGL 3SCMA 3WFEH 2PYEB 4ZX5A 2X0VA 1CFTB 1E6OL 3JVGA 5C0JB 4CVZB 4DZBA 4JCWA 4QJ3B 4HWNA 1C8QA 2JKSA 5FYJE 3RVWD 3ZSTA 5EEZA 4LSQH 1AFVL 3CHPA 4QUOA 2HTKD 3MUGB 3P4OB 4JQVA 3LIUA 4LF3B 2WLLA 2WKOF 2COQA 1TCRA 5GGRA 3IDIA 2DN7A 4K71B 4WGKA 2DLIA 3NCJL 4KNUA 1EO8H 2R83A 4JG5A 4X80H 1DE4A 1WG3A 3PAYA 2VIRB 3SE3A 3PJNA 4PBDA 4M62L 2YIHA 4N0FB 4Y1SA 1XF2A 3LZPA 1LWHA 3DMMB 2CBMA 4RZCB 3GGWA 3VXSA 4JRYB 3H42L 1Z32X 4WEUD 4I18B 4UQ3A 4M7LT 1PZBA 2ALWA 3UH8A 4ZQKA 5E24E 3GSWA 3RU8L 5ALBL 4O5LH 4PI0A 4P23C 5IIEA 2J8OA 1HHKB 3RVTC 3ARFA 2X4OB 4PJ8D 2APBA 1PD1A 5FAAA 1I7TA 1IM9A 5DEZA 2VSDA 3LV3B 1HQ4A 3PS6A 5J9PB 3H9SD 3F2LA 2BFVL 2A9MH 4P3DB 1J8SA 3FTXA 2KYIA 4ETYA 2EDHA 2QR0B 3T3MF 4HUWB 1CTOA 1W72A 1LQSR 3OLGA 4I2XA 4WUUA 2Z8RA 5TDPA 4FQIL 2WWOA 1VFOA 3AFLA 3PAVA 4AY0A 1Z5YD 3BISA 1S5HB 3TPUA 4A66A 4BV1A 2C7UA 2CIIA 2GUYA 3VXTA 1QFWH 3OKYA 4R2GD 5SWSE 2ZG3A 1GGTA 12E8L 4KJWD 4MRBA 3M8OL 4N2HA 3MCG1 3VXUD 4GXFA 5KYWB 2J72A 3OAYH 5FS5A 5ILTH 2J7LA 4Z7UE 2HFFB 5JR1L 1IKNC 2ZWNA 4CRPA 2FAUA 2FO8A 5F7EL 3CFEA 5DD1L 3OKLA 1IAIH 4HIIB 4L9LA 1AG6A 2CCLA 1TTCA 3KPPA 2FQGA 4K8RL 2NDFA 4TLTA 1D2PA 3RVVC 4KTEH 3GSNH 2H6UA 5HGHB 1S3KL 3ULSA 4FQJL 3DI3B 4V1DD 2IPUG 4KOBA 1NCGA 1B3JA 2HKHL 4EVNB 3OR7B 2WW8A 1KENL 1LEKB 5ICZA 4YHIA 4PGDA 5DQ9B 3MRGA 4QXGL 2WWMC 4U1GB 1I9RH 1QSFE 4D7PA 5D2LA 5LGJA 3PL6C 2X9XA 2FH8A 4HHWA 3SBQA 2NY1B 3CGTA 1UUNA 1X7QB 4XCFL 3CSYA 2EEBA 2ZXBA 2IWKA 4KO5A 2CZNA 2R0LH 1N8OE 4GRWE 3WLWD 4G9DA 2C5DC 5KTEL 3G6JA 4HS3B 1K4DB 4W9DC 3BKYL 3DGGB 3RWHA 5DC9B 4IJ3B 1EUTA 1MZYA 1GY1A 1ASOA 2UZIH 2EXSA 5IB3A 2OSYA 1JHTA 3L08A 5BRZE 3G6JB 1E4HA 2VXVL 2G2RB 4P3CH 4DKFH 3OBAA 5GZND 2H6OA 4H8UA 4BQ8A 1RV6X 4UIMB 3BQUB 4Y1AE 3NK4A 5KS9F 5IW1A 1C16B 4XNUH 4IS6A 4PJAB 2HT4C 3BFQG 3SD2A 4WJG3 4L0ZA 1YPZE 2DYPB 3OZKA 3VWKC 5IQMA 1MY7A 3DJ9A 2DW5A 3PHQA 5IEHB 1Y6KR 5K93A 3W0WA 25C8H 3FO0H 5D1XE 4ZW8A 2FGWH 3UTOA 4NFCA 1VFAB 1KACB 3BGMA 4Q74A 2JB6A 3EJZD 3WIIH 5C0EB 3D12B 3TJEH 2ZE0A 3QDMA 3OLDA 4ZUSB 2QDVA 1R24B 2IADB 4XXWA 5C0FA 5F9JB 1BREA 1XBRA 2WXFA 1TMCB 3NN8B 4ZO6A 2FWSA 1J0YA 3E8VA 2P8MA 4ZMXA 3FO1B 5IQ7L 2VDML 5H37A 3S35X 4E0RB 2YD9A 3DGCR 4DZ8B 4NQXB 2VDOL 3CLWA 3MXVL 4XP9H 1M6OA 1WUZA 5KW9L 3UYRH 1RZKH 4LRIA 4HJJL 5TQ0H 4L1BA 4UQ2B 3VACA 3QIWB 1Y1UA 4PJDB 5KTEH 2FO4A 3TFBA 1XTLA 5D1XD 4RA0C 2F8XC 1ZA6A 1T4KA 2AFNA 3QUZA 4OV6F 4KXDA 3HBQA 4GEIA 3PP3K 4JN1H 5JW3L 2JI3A 3QFDA 4JPSA 1AIFA 2X3AA 2R15A 2BNRD 5I6PA 4UOW0 2UXFA 4Y1AD 4YFEA 3ARWA 4DETA 3UYOD 2VDNL 5EU7E 4UT9H 5LXGL 5BZXA 4MJID 4I0PC 4UQ3B 4O2CB 1PY0A 2BW4A 1HXYA 4WCYH 2VDPB 2J5WA 3LD8C 15C8L 2YBGA 5T3XL 1GCFA 3KGRA 2PLTA 3WFCL 1THCA 5HBBA 1AGDA 5I1GL 4QYAA 1F0LA 4KAQH 5T1KD 4N2EA 5EG6C 2LU4A 3L5XL 4TUKH 2B39A 2DQJH 1Z0MA 4I1RA 3PIQB 2QR0A 3EJSA 1ETZB 1IZKA 3HBGA 3PNWB 2WHVA 3EYVB 4AGMA 4M3JA 1CFNA 5DVLA 1R6VA 1S9WB 3TIDB 4K9EH 2HX9A 1LNUB 1YVLA 5D1XC 4MLIA 4WF7A 3NACH 2ROYA 1ZTXE 3K6IA 2VKWA 3CVBA 3BVNB 3RNQA 4YBQD 3B7SA 1SXNA 4BDVA 3ARDA 1PQZB 4H8VA 4PJEE 2XWBA 2A9NH 3H7BA 3BT2L 5CUSH 1S7UA 2O93L 3R1GL 2AKRB 3SQOH 3ARPA 4OFYA 3BVNA 2IPKB 3WJJC 3L3GA 4W4OA 3FT9A 5DZNA 1S3RA 3WEXA 4A6YB 4X0NA 1EXUA 4PJIA 3EIFA 2C9UA 2VR5A 2VISA 1I9JL 3FH5A 1JL8A 2AK4A 1S5IL 5TE7H 5SWSD 4ERSL 1ZLVK 3GMNA 5ID0B 1R0AL 1GOHA 2AZAA 1IQDB 1S7WB 3O6ML 3QCTH 1HZHL 1FZJB 1DDHB 3REVA 2BHZA 3H4HA 1CFQA 5FM4A 5HVWA 1DJWA 1GC1L 2R4SL 4JN2B 2Z91A 3L1OH 1DJXA 4E9YA 2XTLA 1BFOA 3VFSB 4UQBA 1IL1A 5ICYA 2CO6A 1FFPB 5ICXA 2YQ3A 4HHAB 2AABH 3ASOB 2J8UA 2DQMA 2FWOB 5D4QA 1EEZA 2K78A 5T3XH 2IDFA 4OZFH 3VFUB 4PJ8C 2DI8A 4JG0H 3QZLA 4JN2A 5F89B 2Z7UA 4IRZA 3MV11 1LYQA 5FGCB 4C55A 4K3EH 1WGOA 4PRPD 4KZEH 4PD4K 5KSUB 4XCYA 3MV7A 3NFPB 2G4GA 1F90L 1ZDQA 3CZSA 2NSXA 1E6OH 1KTLB 3TC9A 3ZZLA 1PKQE 4HJJH 5TQ0L 2BP3A 43C9A 2NNAB 3GINA 3F7YB 1CVSC 3EO0B 3APFA 2FX8H 2R0ZH 3QORC 4AL8C 3S2CA 4FQQA 5F7HA 1IC7L 2GSIA 3O8XD 3FTVA 4BQ6A 5B7EA 2GK0A 4WQOA 3HMWH 5D71L 3IE9A 1G94A 3BPLB 3LYRA 3MJ7B 5JZ7D 2ODIA 3SKOB 2ZCHH 3BVTA 2VJXA 4RRPM 3PQYE 2W65B 4NZRH 1B2WH 4M6NH 1A4JB 2OPCA 1CZ8H 3AXHA 3VWKD 1YN7B 2ZUXA 2KLSA 3KHOA 2RHEA 4N2AA 3CZFA 4ZD3L 1OV8A 4YVNA 4FA7B 4HUUB 3FQYA 4WI9A 1I1YA 4HJ0C 3ARFD 4PJ8A 3VG0H 4CMMA 4OIBA 4QAWA 4NPYB 4QRRB 5HHVH 3N0PB 5T1DH 2KUTA 3CVHL 3K80A 4X4XB 5IB1A 5J1SC 4NO0A 1N9PA 1PLCA 1PKQB 4BH7B 5K9JL 2C3WA 1EZVY 3V6OA 3PWPA 3NP4A 5DHVA 4F3FA 1BSIA 3E0GA 2X7LB 4OLUH 3C5XA 4NQDA 5E2VL 4FYSA 5A3ID 5E6IA 1TETH 1D5BB 4G6KL 3GT6A 2BY1A 5H35B 2I26N 2YGPA 4OTXH 4K9EC 1OCCB 4Y19E 4BKTC 1WBYB 4BK4A 5BZWB 1E3FA 4K9EL 4W9JC 5D4HA 1X7SA 3KPSE 2X9WA 1T7YA 1XGQA 2ADYA 1E40A 4I3GA 3DBSA 2JIXA 3N42B 3NACL 4FQIH 3PWJA 1XGPA 5B1AB 2NT0A 4MJ6B 1JYNA 1XGTA 4ZX3A 1INQB 1JGLH 4OF0A 1AIFB 3L9RB 2KMWA 1KT2B 3W5NA 2W95A 4XN5A 4F91B 2K45A 5EN2B 2A9NL 1AE6L 5GZNC 4JVUA 1G87A 3ZTDC 4DP1X 4L8SB 7PAZA 3Q8FA 3QP3A 3BFWA 2D7PA 1BBDL 4LVOB 1UVQA 1JZ5A 5F0JB 1FHGA 3KPQA 4DESA 5FOBA 4XMPH 4F7KA 5F1NA 1I9JH 5DYOA 4EXKA 3HMWL 5B3JE 4AGPA 4KVCL 1EZUA 3BKJH 2DQFB 1LE9B 2IDUA 3RIKA 2VDNB 1UGNA 5EOQL 1SXAA 4XMKH 4N85A 5B7FA 1KXTA 4LDCA 2VQ4A 1KWKA 3MNMA 5I73B 2A6DA 5TJWK 4ZTEA 3T6XA 4XVJL 2WXJA 4E41A 4Y4HA 4PJHB 5GRJH 1JZJA 4JJ5B 4G82A 4XO9A 2NMSA 1C7TA 4KVPA 3P77B 3QDMD 1IKFL 1SJEA 1XEUA 4FXKC 2CLRB 3GRWH 1PD0A 4N2OA 3X14A 1J86A 3L2LA 5A2JH 2H1XA 3IYLW 3EOBB 4GAGH 3OB0K 4Z7OF 4QYOB 3D9AH 4DVBB 2VSKB 4TSBL 3QUKA 4QO1A 1G7HA 5AD0B 4G1EB 4EZLA 2HT3C 5I24A 3T8XA 2GC7C 3TA3C 1F3JA 3T4AB 3JYBA 2PUQT 4QHMA 2LQRA 1BQKA 5CIPB 5E8PB 1MCOH 3QYNA 1HYSD 1QSFD 2RFXB 3LPOA 3QUXC 5TE6H 3R8BB 4ZG1A 5EO9A 5EBLB 4QRFA 4XAKE 3JUYA 4LL4A 4HCRL 1QWNA 3HPLA 1SEBA 1P4LA 5CP3H 1H8OA 1KULA 2ZUQC 1Y0LA 2B3RA 2BO0A 1JRHH 2BMKA 1EHLH 3S96B 1YQ2A 4AV5A 4MQXD 2O5XH 3UIZA 2OR9L 4L05A 3OWRA 4JVPA 4PLNC 1IX2A 2PCXA 5HYIA 4POUB 4PB0H 4Q89A 2F74B 1G0XA 4HAGA 4KVCH 1R33A 2BSTB 5IK3B 1NM9A 5AG8A 4MA1C 3LPPA 2UYLA 1XX9C 4I2XE 4YHIB 5EN3A 4GIPD 2HRLA 2CDEB 2FEEL 3OF6A 4MXQC 4YPGA 1PGRB 2OMXA 5LAXA 4NN6B 4J3OH 4N6RA 5CLZA 1XB3A 4LLQB 3OXRA 4R0LA 1P2CB 3QRGL 4B9KC 2WOYA 4OUUB 5SWSB 5EF0A 2X6AA 4L5FE 3FQNA 1YPZF 2W5PA 3H9SE 4YK4C 3V2AR 1BMWA 5I8OH 4K3GA 1XL6A 3BPCA 5B38G 4M00A 2JKLA 3AXLB 2W0FA 3S5LA 3THML 1WWBX 1ZXQA 4UTAA 5F1IA 4AMKH 4LU5H 3HUJA 1BX2B 1OAZL 1QSED 3CU1A 3KWWA 4TSBH 1RJYB 1C8PA 2IOIA 4XNAA 5F7BA 1UOVA 1G9ML 1MVUB 4ZW5A 3L9EA 5JIMA 4IBWA 2V7HB 4EUPB 1CL7H 4LEBA 3TS8A 4D3CL 3X1EA 1YMMB 2V37A 2DWDB 4N5ED 1DYZA 3E6HA 3WD5L 1YYCA 1TTBA 3ZX1A 3QBTB 2J3SA 3K5SA 2BSBA 5JIQA 4XOEA 5CCKH 4HJ0D 2ARWA 2OSWA 4OGXH 2G2RA 4HOWA 4HOZA 1CURA 5DHVB 3D0LA 5KJ7E 1ZGLP 2MMXA 4D2NA 2OW7A 3CFUA 1DBBH 4OZGF 4LEOA 3VG0L 4JEGB 3NT0A 4XVJH 4KRPD 2O5XL 4M03A 4YEFA 2XZAL 4IBQA 2EYRB 5ADOL 5AKRA 2OJZL 2IPTL 5JHLA 1T5WB 2XQYA 4EI0A 3GHBL 3D2UA 4QF1B 5A3IC 4YEEA 4LEOB 1RERA 1WHPA 2ZX6A 5LDUA 4LASH 4PGCA 5E08H 1BM3L 2Z7ZA 5FA4A 4ZUUA 3ESPA 3JVGC 1IAOB 3Q7JA 2ARJB 3SPHA 1E2ZA 3UO1H 4YQXL 3MLTB 3D69A 1KBKA 2NDGA 5DO2C 3LH8A 4XC1H 3EYVA 1CE1H 3QPKA 2BIQA 4YVUA 3G7TA 3HAEH 1P5UC 4WI5A 2Y4SA 1BOGA 1J0JA 4PRAA 3QRGH 1KIRA 5HI4C 1FPTH 3QA3B 1Q9OA 3ZE2F 1QI5A 2AXHA 3MV8D 3MUGA 3P4OA 1A3ZA 3N42F 4U6XA 4OJYA 2QTEA 4XO4A 4PRNB 1VACA 1K3ZA 3MOQA 2EVIA 4KGJA 2AHIA 1TR7A 3TT1H 1WAPA 1SPDA 4WWKD 5LNDA 1IAIM 4GNKB 2PWGA 1HHHA 1MG2C 2H1PH 4HXBL 4WJ5B 4FMKA 1SDDB 2XQBL 4DN4H 5F6HJ 1HINH 3RWEB 2XV3A 1KEGL 4JQIH 3TYFA 4M7ZC 2FJSA 1NLDH 2E74C 1JI2A 2K1MA 3UABA 4GQ9H 3N41B 2C9QA 5ISZB 2WINA 3SKNB 2WN2A 3H9SB 3MGOA 3U36B 1R46A 3NABH 1KCRL 1RLBA 4MDRA 3V5HA 1ZHBB 3H42H 2CO6B 1LP9F 5ICXB 4ZSOB 1CD9B 1U8KB 3A22A 4X4ZA 1P5UA 1X4XA 3ME0A 2OK0L 1XCWA 4UT6H 1RY7B 4X50A 3V4VH 4DJMA 5E8OB 3EFDH 1U9KA 2BJMH 1TNNA 4PJ9D 1L7IL 3GSWB 3O3DB 4ZBJA 1XR9A 1I75A 4H7VA 2UWEE 5GGVL 4HUNB 5EORH 1JK8B 4LCVA 3ZDXE 4Z3TA 4XX1E 3VFWA 4LF3A 2CGZA 4QXVA 4WKZA 5LGYA 1OGAE 2V2TB 4BFIB 5SWZD 3MGAA 2YK1H 5JXAH 2BHYA 4A1RA 3DOSA 4RMRA 5JIDA 1WHOA 5E1GA 1CLYL 1DTUA 3EO9H 1F4XH 3ZBMA 1R3JA 1DSYA 3LZRA 4F2FA 1M9WA 5GZOC 2OAAA 3V0WL 4ZMAT 2F61A 4KJQD 12E8H 4CVUA 1SDYA 2X70A 3UL4A 1QOKA 2BFGA 2WSPA 1BG9A 2Z3FA 3C87A 3NCYS 4KQ4H 1MCEA 5ANHA 4CW1B 5I8KH 1LWJA 1NUDA 3NGBB 2EYTB 2H3NA 1SNRA 5D1ZA 2B77A 3L1OL 1JYXA 2MCMA 1FVEA 3AREC 3FRPG 1OLLA 1IC4L 1SEQL 5FUCE 3V9FA 1A5FL 2JIXD 4Y7OC 3RPBA 3HBZA 3CFDB 2BINA 3FQUA 3O81A 4MDIA 1B0GA 4Z7VB 1OVZA 2WTPA 1NAKH 1MQKL 3SPJA 2FGZA 3MNWA 3TNMB 3MRBB 2XYCA 2GAZB 4Q97A 4K3DL 2VN7A 5IW6B 2X4TA 1AHMA 1H9VA 4MJ2A 1SLWA 4M3KB 1N64H 1QLEB 1PG7W 2ZXCA 4JGNA 1L6PA 2VUOA 1H3PL 1JV5A 4Q9QH 2CNZA 3H9YA 3VH8G 2I9TB 4A7TA 5I6OA 5IMKB 1T0MB 1SVBA 2H8PB 4H2AA 3IF1A 2L7QA 5DDHB 3VD4A 4X4YA 4XHQA 4OCYH 1NFIA 5DUML 1X5KA 4KJPD 1VAHA 1SEBB 4XPBH 5JW5B 2ZWSA 2CHZA 1I3GH 1G7PB 1OE1A 3L8QA 2WWNA 3CXDH 2OYLA 2VMCA 4APQD 5FWQA 3BJLA 3PWVB 1EGJH 2J88L 2P5WB 4FI8A 4DP7X 3BMVA 5I1LB 4EN2A 5HJBA 1Z3RA 2WWKO 1IGTB 3F6IA 4NC1E 1E27A 3WL9B 1RUKL 4AEFA 4Z7QB 5F3HB 4A7UA 5L0QC 3COOA 3GZQA 3R4DA 4K94C 5K9OB 2J57A 2O6DA 2D31B 1X9LA 1KENH 2QSVA 4XI5D 1ORQB 5F7UA 1PKQA 4PHZA 3T6QC 3M86A 2V9RA 5GRUL 1MLBA 4Z0BH 3PDGA 2JLLA 3ZDXB 3B8YA 1I1AA 1BVOA 1ZSDA 2X4NA 2XKNA 4BE5A 4MNQE 1J5DA 2IFFH 5MEQA 1HN1A 2X6CA 4P23B 4F9LA 3LVTA 2OV0A 4TVPL 5EBMB 1ZEAL 5JMOC 3BP6B 4YFDB 4YHYB 4GMSH 2FB4L 5HDBF 1UD8A 4OZ4A 1LE5B 5C0JA 5KVDE 4NWTL 4IIZA 4AUYA 2CRIA 3CZJA 4AYID 4F9PA 2BP8A 4IKLA 5DD6A 4OM0L 3KE0A 4A7VA 1O9WA 1CGSH 2HUHA 4TUJB 1QSZA 1UC6A 1AY1H 1JRHI 3NJLA 4KUCD 3ES6A 4PLOB 5SV4A 4AUUA 4BHUI 5AZ2L 4AW7A 2AANA 5EF1A 4XNYL 1OL0A 1HEZA 2GI7A 5FK9B 3PP4H 2EDTA 3WE6A 4YSOA 4P3WA 2ZOLA 1GGCH 3PFUA 3MZTA 3WIFB 1TJHH 3JT0A 3LQAL 1CLOL 3JV6B 4P46D 3JTSB 4ADGA 5FLUA 2R2EA 4KX7A 4X6BB 2BC4B 1WZAA 3C60D 4PB9L 5I0YA 3C08L 3I75A 3DHMA 3MRGB 3K6SA 3TPKA 2QBWA 2JCWA 2K7PA 1G7LA 3FQXB 1XF1A 3ARGA 2VRAA 4GW4B 4KKZA 3IJ7A 1AAJA 4GS7C 3GBDA 5DC2A 4RGOL 2HFEB 4U33A 3WMQA 4FZEL 3UBXB 2JJTC 1ET5A 1OSZA 2WXGA 4ZZFA 2D7TH 3NDZE 4P2QB 2EO7A 1EGJA 2O5YH 6FABL 1TFPA 1RUPH 1VF5C 4XPAH 3X12A 4ORGB 3UTQA 3ESOA 5AL8A 2ICCA 5F72S 1GR7A 3I3BA 3VGDA 3D5OF 5D7IF 1MJ8H 2A6JA 3D25A 3MOBL 2GQHA 3MRIB 3CQPA 4HJGB 3FQNB 4LSQL 5A6LA 3CZUB 3F83A 2FB4H 1A7OL 1CXIA 4XWGH 3D3VA 3RVWC 3D0AA 1P7KA 3TU6A 2XLLA 3VXQB 2YOAA 3FUJA 1KYUA 3VXSD 1MFUA 2D3JA 1GGYA 4U3HA 5A7BA 5E2TL 1JF1A 1CN4A 5L9DL 4Z7NF 4HIJB 1LP9E 2F8IA 1J05B 2EDEA 2YOCA 5FW8A 3ULUF 4K4KA 3UAFA 3L54A 3LEYL 4UT9L 5LXGH 1DDHA 4RSVA 1KCVL 3L1FA 4PJEB 1NL0H 4N3TA 3SZ6A 1UD2A 4N2NA 4X9GA 3HI5H 1MAMH 2XBDA 5DRXA 4LLVB 2O72A 4N3UA 5HHOB 4R4NC 1GPOH 2WAHA 3VXME 4OUOA 1CICB 1AGBA 4NZFA 1PAMA 2BMKB 5DC4B 1SOQA 2DQGH 3B56A 4LSPL 2R0WL 4GRLD 4XMZA 5DMIL 3SDYH 4Z0XB 2R4SH 3IXTA 4CILA 4JHUA 3PFQA 2YZ1A 4ZQKB 3NFSL 1JZHA 4TM9A 4D8OA 4RFOL 3GNMH 5T3ZH 3FONA 3O3AA 4DP5X 3BI9X 4N8CL 5KSBE 3WXWL 1BVKB 1AD0A 1OSYA 4HKXA 4PBVC 2P7TA 2EO9A 4ZT1A 2HSIA 3SDAC 2YWZA 5SWZA 3B9AA 4LFHD 5I16B 5C7ZA 5HGAA 4FZ8H 4L1TA 2QHLA 4D94A 1QLEL 5KEZA 1LDPH 1IKOP 4JDZA 4DAGL 4LSUH 3KM2A 4QKTA 1UXLA 3OV6A 4GXVH 3B2DC 4GBXB 4FA6A 5BZDB 4G6ML 4WEMB 2X6BA 1CGSL 2J21A 3LN5B 3WOVA 5J11C 2G9HA 3B2VH 2DIEA 4AENB 2OQJB 5F0PB 3TWCH 1RK0A 2NXZC 5JQ6L 4TQ8A 1ET8A 1NUNB 4PJGB 1HXYB 4WTZA 4XMUA 1CLCA 1UXMA 4MNQA 2X09A 1VA9A 1FFOA 5ERWB 4OJFL 4NM4H 1H3TA 3T0EE 1MAKA 1Q4NX 4GXUM 3U9UB 1NEZG 5JW4M 3QZWB 3S98A 3VMNA 3OAYK 4IDJH 4DOHE 5KBMA 1AZBA 3HEIB 4HH9B 4N8VA 2VZ3A 2X2HA 5E23A 2FLMA 3NTCL 3QFJB 4XCFH 3SQRA 5C0CA 3CSYB 5IQOA 4KHTH 1ET7A 1K4CB 5EU4A 5IMMA 1UCBL 3WTUA 1IQWH 4NN6C 4B97A 1TJGL 4K3EL 1EDHA 1GZQB 3SBRA 3HRPA 5E1IA 2ISDA 2IH1A 1X5GA 1WE5A 3EW3B 1AFVH 1DQJA 4QD2E 5T8IA 4TQEH 3N1QC 3FT2A 4OZ4B 1LE5A 3EHBB 1XGYL 2GB2A 2LLGA 5DEFB 3ERXA 5KYXA 4OW6A 1J88A 2VDPH 3ZE0E 3SD5A 5EU5B 1IGIH 3A4AA 3QUMH 2NX5E 4NAMA 3RILA 2IV8A 3EO9L 1AXIB 1FCCA 2MQ3A 1I7RA 2WXPA 1ZTXL 3QULB 5H35A 1FJ1A 4L8BB 3QXAB 2EIMB 4CSZA 4HIEB 3OKOA 4PRID 3QQ9C 1UHVA 1DN0B 4AQ1B 4PJCF 4MCZA 5C07B 4BK8A 5ABZA 5CM1A 4ANVA 2QQLH 1F6FB 3DV6B 1HNYA 5BOPA 3DK0A 4JUSA 3ARVA 3WNPA 4DKDC 3BEVA 4P4KC 1F6AB 3MJ8A 3FHEA 5A1AA 2LTQB 3DRQB 3BE1H 1N6VA 5EEUA 2E86A 2L4OA 1IM3B 3D85A 4JE4B 4AXWB 1SJEB 1GY2A 1S7SB 5E8DL 3KWUA 4NT6A 2IGTA 4DCQB 5DJXA 2CM5A 1A7BA 4PV9B 3I6KB 1HDMA 1U36A 4FNUA 2C8NA 1EHNA 1G7JB 4APQB 2EC9T 3O3BA 4J23A 1TTRA 1FFNB 2EYRA 3D4CA 7TAAA 3HG1A 3IFPB 5HI3D 1JOIA 3C60B 1TZ8A 2JQZA 3V95A 5CIPA 5E8PA 5TE4H 2APTA 2VLRB 5D4JA 3DUUA 1WTLA 2G60H 3OKNB 3QUHA 5BOZG 2X41A 1KJ2L 4ZTPL 1PFCA 2XWJA 1DQIA 1S4IA 4YJZL 4JPWH 1OIOA 3KPSA 5IVNA 3GBLA 2XXCB 4FLOA 5C0NC 5GGTH 4FL4B 2LLLA 4JFQB 2CBQA 4AZ8B 2J25A 5KSBA 3BSZH 3QH3B 3RDTB 3ZHKA 4K3JL 2B4CC 1KGWA 1VEPA 2V3DA 4JPIA 2OJ1A 3GMNB 5ID0A 1MEXH 1A1NA 1ILUA 1UWFA 2NY7L 4OFYD 1OPGH 2HLAB 2WKGA 4I0PD 3FQWA 4DUWA 5DJ6B 3WFCH 1KB9J 3AADB 4YBLC 2X4OA 4DGVH 3ZN6A 4FHBD 3PV7A 3A21A 4U6YB 3B83A 2OR9H 3E1F1 1T21A 1FNSH 5IB5A 1W16A 2ZIDA 5TDNA 1OLZA 4UINL 1A5FH 1I7UB 3T0BA 2B5IB 2ZWYA 4FE9A 5CZXC 3NMEA 1CLZL 4R0LB 2R0WH 3GGWB 5DMIH 3VXSB 2CDGA 3GZKA 5E2UH 2NYYC 3MJ9A 1F13A 1JGUL 3BMWA 2MCG1 4NS0A 3EJPA 4PRBA 1F4YH 1MKFA 4DPCX 1IIIA 4OZFG 3T9WA 4KITB 3HN3A 1U8JA 1C12B 2WLIB 3RX8A 5I1AA 5IEKA 3QWQB 1E5CA 1GTNA 2I07B 2YD2A 1N59A 1G4RA 1MWAA 2IQAB 4ZTOH 1ONQA 3UG5A 1R19A 2DKUA 2VNCA 3QDGD 3BWUF 2D3LA 2IG2H 4UTBA 1NGWB 1WFJA 1RK0B 4RGMB 1H5BB 1WBZA 4TKWA 3MRJB 4U1KA 5A2KH 2XXGA 3M07A 1LO3L 2ZJSL 5C08B 2MPAL 3O41A 4FQLL 2XWTA 1WCBA 3DETC 2EIBA 5BZDA 2IAMD 3BDXA 4RMTA 4LIQE 3BPNB 1EEYA 2BHUA 3F7LA 3O2DH 5ALCH 3IS0X 3ZY7A 1MVFA 1BEXA 1PZ5B 2W59A 2ZCKH 4ZXBC 5IJVA 5CIPH 1E9QA 3SDAA 3MX0B 4Q2ZA 3ATEA 3LKOB 5E4OA 2XG5A 4NZTL 3ROLB 4YBLB 2P8PB 1P1ZA 3AQDA 5FUOL 5JOFA 1R3LA 2ZSWB 4GQRA 5CINL 2FE0A 1Q38A 4IKJA 4H44C 5I1GH 4ZNEE 2CKBL 1XT5A 4MD5B 1H3VA 1U8QA 3KEHA 3ZT5A 3SYOA 3VFRB 4A2MA 4C83A 5JHDA 4OF8A 2EIZB 3QXTA 3ROLA 3ZW3A 4F93B 3V6BR 1U8NB 3HC3H 4H40A 1MN4A 3GBNL 1HK6A 2ZD0A 2A0LD 5D72L 2EDXA 2H8PA 2YKLH 4U6XB 5IROC 2Z31A 2KDGA 3DX7B 3QIBB 2YAEA 1JGDA 5HGBA 4ZMQA 2ZUVA 3ILQD 2HAZA 3PNRB 2NTFA 2GVYA 2WJ7A 5C3TA 3RNKA 1Z1WA 1SY6A 2P8MB 1PYWB 5EEWA 2J1ZA 3AQXA 4H20L 5HHOD 2VWEE 3WDHA 3UO1L 2E46A 2ZPKH 1EUUA 2OMWA 3A23A 3CZGA 5T1LD 1AHWB 5I8EA 1OAYL 4H0IA 3F7VB 3IDMA 1JSYA 3GDBA 4NRYB 4WI0A 3NJKA 1ERNA 3MRQB 3O9WA 1BMGA 3QNFA 4LVHC 1ODUA 4K7PX 4X0KB 4UQIM 3BXNA 3DX2A 4WO4C 4OZGB 3BZ4B 4O4YL 3R0NA 1YQVH 4NZ8A 4ONFH 4Y4HD 2NY3C 2OP4H 5AOLA 1IGJA 1NDGB 4OD1L 4FX5A 1ZIBA 2L3BA 1IM9D 4I3RH 4QRAA 1C16A 1NEPA 3O2DL 4M9OA 3E9UA 1J9TA 4TQHA 5EO1B 4ODWB 5M7QA 2VXQA 1UXSA 3ABKB 4WV1A 1U8CB 4Y4FA 5FDWA 4J27A 2JK5A 2OJEB 2PTTA 3CFTA 3PHQB 2GJ6A 4OFQA 2WUBL 4PGEB 3GSVB 5IEHA 2IPTH 5B1KA 1ND0A 4XNZB 5KVFH 2E6JA 3BLKA 4OD2B 1J5HA 1QBAA 3NFSH 4LXFA 5D93C 3TO4B 1YZZA 4KH9A 3IJ8A 4NQTA 2LHAA 3IDXL 1EBAA 3O0RH 4HZLA 3BGFB 4Y4FB 1AGDB 1K4CA 1EDYA 5JA8B 4X83A 5AW6B 5CHNB 4PG9B 4HU8A 5F3HA 5MI0B 1WBXA 2X1WL 4ZYKB 4FZ8L 2FJFB 3KLKA 4EI5D 1D5BA 3CFNA 2NY2B 3M45A 2A38A 4JGUA 1TQWA 1TJMA 2VC2L 1UT9A 3IGFA 1MCJA 2CCWA 3DUHA 5E9DA 2EKJA 4G8AC 1XGRA 5KSAD 2D9QB 5HDBB 3EYQC 1NFDE 1H0DB 1TJHL 5I82A 4Y4HC 3KBFA 1T1YB 4M8QA 4YBHA 1FNHA 3SY0B 4B9FA 2YUZA 3BP5A 2ED8A 3CN3A 4U6TA 3D48R 3CSGA 2E7LA 1BVNT 1HWWA 4KFZC 3G5YA 2G9HB 5L2JB 2VYRE 3B9DA 1JTPA 4F9PC 3OR7A 4DEUA 1UYWL 4ZFZA 5FOJA 3U4KA 4GI9A 4O02H 1L9NA 2BY3A 1O6SB 2Y5TB 4IOFD 4FFTA 4MMYA 3RP1A 3U6XA 4LQ1A 1JFQH 2YC1A 2VDLH 5INCA 3VI3A 1A6WL 3ARQA 3IGKA 4JFEA 3S4SG 4AJ0A 1RUQL 1MXGA 1OO2A 4QCIB 1JMXA 2BXYA 1PJWA 4P5TD 1UD6A 4GSXA 1BPVA 2VLJE 3L81A 3O6LL 1TPXC 4O2EA 5DJZB 1GIGL 2XOTA 3ZQ9A 3WAKA 2VQ1A 1HEHC 2WC7A 2YXWA 1ZLUH 3FCUB 1V27A 3IJHB 5EFIA 4E41E 4TTGA 1KB5H 2GFBA 1U8PA 4MJJA 5EZOH 4YMPA 5I74B 5IHUL 2QELA 3CDZA 5A6IA 3A3YB 5B1JA 2IH1B 5EORL 3LH2H 2FQEA 3ZZSA 3BUDA 4Y2DD 1F18A 3FTGA 4KV5F 5TDOA 3MQIA 3EH4B 3KWWB 5TE6L 4PRDA 1D6VL 5BPPA 1YMHA 4Z76A 3EYFA 5E6RB 1ROCA 5C7XH 3LDBB 4QOKB 1QNZH 1WAAF 1Q9KB 1QHOA 4IRJD 3L6FA 3EYUL 4KY1L 5JO5B 3RWCB 3EJZC 1SN0A 1ZDSA 4FKEA 4LHQB 4N2DA 5TK4A 1M1XB 3IMSA 3QHZL 3TEUA 4FEMA 3KPSD 5I75B 1MIEH 4HF5H 1OCWL 2XPZA 3NN8A 4GKLA 4S1RL 3RWCA 1IJNA 3IDGB 2D73A 4NKIL 1S9XA 1VHPA 3GI8H 3QDGB 4P04A 3WU1A 4WNSA 3HFMH 3VD3A 3QZWA 5GIRB 5FO2A 2M26A 2TRHA 1RZ7L 4AJWA 5GSRB 3NTCH 3VXNA 1U8QB 1FFOB 3AROA 5CSZB 4MAYB 3A6BH 3RGVD 4L8CA 1TJGH 5ESQA 4HUCA 4DQOL 2GW5A 2YEZA 3Q05A 4JQXA 1UUSA 4Y2OA 4N86A 2RD0A 3QJTB 3UAEA 2ED6A 4Z78B 3SIKA 5BUGA 1KZQA 2FIRT 1JTOA 4UOQA 5LN4A 2BERA 4FNQA 4J1UA 3VSVA 4A2EA 4NJ9H 1CXEA 4WW2C 2FX7L 3WTWA 2RR3A 1VKXB 4HX1A 1T1XA 1LEGB 2FNWA 1U3ZA 2CGRL 2XSKA 3U4EB 1MJ7H 1JFHA 2E7DA 2JKTM 1D6VH 5BOJA 1OANA 5IV2B 4U31A 4JKNA 2CBTA 4E9WA 5LJYH 3E9TA 2FJHA 3DSNB 3QAZC 3RVVD 4GPVA 1UB5A 5IOPB 2X6MA 5D7JC 1II4E 4AX3A 4QAMB 1QSEE 2Q9OA 3QPQD 2VLMD 2LGNA 1FAIH 1DDTA 2UY6A 1RZ8B 4W4OC 5F8QC 3QORB 4I5BA 1ZANH 1EWHA 3HB3B 2AJ3A 1XGUB 3KYNA 4KRPC 1KIPB 4Q9BA 4JM2B 4MSWA 5E56A 4Z9KB 4FLSA 4TNWF 3UTTD 3SKJH 3VFRA 3D7PA 4N25A 1C9SA 1YA5A 4WU7B 1E7VA 4H1LG 5FCUL 3PHOB 4KMTH 2CK0H 1E9OA 2OMUB 2VXUH 1DO5A 3K72A 4K23L 5IROD 3W11C 3RY6A 1J8KA 3VXPA 4FFWC 3O0RL 4XC3H 2OMVB 1GSMA 4ZFOB 1KG0A 1L9PA 4WWID 1QATA 4AZUA 2XDHA 1KXQA 1N70A 3OD3A 4AW4A 4MX7B 4OI8A 2VN5A 4W9LC 3QWOB 1RPQA 2W81C 2VGLM 1TSRA 4PCYA 3ZGHA 5IFHH 3S8GB 2G60L 3MRLB 2OMVA 2XCMC 4LU5L 2WLZA 4Z6AT 5CJ8A 1YEFL 2XETA 2NOYA 1HXMA 1Q94B 1AC6A 1LQBC 1PEWA 1QFPA 2DLEA 4GQPH 5AB9A 2HFGL 5I18L 1M6UA 2AVGA 1YHPA 4K94L 3FZUD 5IHZA 4LKXA 3G6JF 2E8YA 4K9JA 4YFLI 3WSQH 4YDVA 1BCIA 5KVGE 1O6SA 4RFEA 2UZPA 4ZI8A 3MLZH 2OBGA 1MEXL 2NY7H 2FX7H 2Y5QA 3NZHH 1KZYA 2AK1H 3VCLB 4UNVA 4GRLB 2J56A 1IGJB 4OQTH 3KLHC 5LCVA 1Z9MA 3MV7E 1NICA 3FQRA 4EI5B 4NC1C 4AYFA 4J2XA 1KLFB 3L5JA 3FO9B 2WYZA 5CAYB 4XX1G 3S36L 5LO7A 2ZF8A 5H2BB 3POCA 2QQKL 1ZS8B 3FOMB 1LO0L 1USZA 3HE6B 1HNFA 4X5WA 5HHVL 4DP9X 1F3DJ 4ZMLA 3BRFA 2QQNH 3EF4A 1XF2B 3QE5A 5C0GA 3D34A 3P0GB 5DMGC 2V5YA 1CG9A 3QDJE 5T5NG 4MB5A 5BRZA 2GIYA 2FEJA 1JERA 4A7GF 2XA3A 1YY9D 2HRPL 1JGVH 1JPTH 3GSUA 2VO5A 2UZIL 1XCTA 2AK4E 1YEJL 4HGWA 4L1SA 1T89C 2HJFA 1G1YA 1MHCA 4JFFB 5IG7B 3WTSA 2NUPA 5C3IA 3N5AA 3S88H 5EF2A 2DWYA 4WI7A 1C5BH 3FYIB 4EUPG 4R90H 4XNDA 1IGYB 4JMXA 3ALWA 1TTUA 5C09B 2FHBA 4D7BA 3TT1L 3DVIA 4GO9A 3PGCA 1IAKB 1UXWB 2V5MA 5KVFE 1JCKA 1Q1JL 3ETTA 3TURA 3CFCL 4QHMB 5MERB 3GXNA 3W39A 1H9DA 3VFTA 1QA9A 1QFWM 3MRDA 3B3IB 1WICA 5LB1A 4I3RL 2PPDA 4KTEL 5DK0B 1IGTA 2DYPA 5FUOH 2Z31C 4KZDH 2DV6A 2K9FB 3E7JA 4JPQA 3HE7B 4NNYA 3QJUB 1YY8A 3KDMB 4Z0XA 4GJTB 1KB5B 1BFOB 5EZPA 5J6HA 3QJXA 3AITA 1RI8A 4RIRA 3CFQA 2ATPA 1UWGH 4UBDC 1XH0A 3ZQXA 2EICA 1EAQA 3EOTH 4D0DA 4Q58C 1SOSA 3INOA 3QZPA 1S78C 4H26B 4PRPB 1H15A 3A4EA 5GJTL 1MFNA 5E6ID 5FKAA 3R8QA 3U79A 3UTSE 3M8OH 1SLXA 3TWYA 1TJXA 4TPRL 4K5LA 1GW6A 1T1XB 3IRPX 1YAZA 1JPST 4JN1L 2CA3A 2VR6A 5IJKC 1PQZA 2VDRL 1QUPA 5DMKB 3G04A 3VTAA 4IRZH 4M7JL 4Y5VC 1MCHA 1YEJH 2BSCA 5EBGA 4P46A 4I9WD 4L23A 4CVXB 4GP4B 4HDIA 4L3ED 4M4PA 3PYCA 4RGND 3SGKC 1ZMYA 4PH8A 2HXAA 1KF9B 3T0AA 3BSGA 4NQDE 2WIIA 2GTWB 4GSQA 4UZGA 4LLUA 4OQTL 5LAPA 5DFVD 1AHWC 1KN2H 1KY7A 2Y7OA 4XCCH 1IVLA 3VXUB 5L6YH 5E5MB 1OM3H 3DWTA 4H0LC 3REVB 1BQHA 4U6VL 4XXCA 4A39A 3F7PC 3L1GA 2Y36L 3QXWA 1MJJB 5DWUH 1FE8L 3ZMNA 2QQKH 3I3DA 1ADWA 3EJTA 4UB0H 2XRAH 3MLTA 1WFNA 4DQAA 3QJFB 1N12A 4K15A 3ZTCC 2K70A 3RURA 1ID5I 1NC4D 3GKWH 1AD0B 2X1OA 1KMGA 4ZUVB 3BZ5A 2VL5A 3G5VA 1ACYH 2C4FT 4JR9L 3MA7A 1NGPL 4YHKL 1A9BB 5IVXE 1IGFL 1T5WA 3ORJA 5T3ZD 3BXNB 2R1XA 5AOJA 2X4RA 1KLUB 5C0AB 3AREB 1HT6A 4RX4D 4XR8C 3UC2A 3P9WB 5FFLA 1LDSA 5EPMB 1HYSC 1A4KB 5ELIA 4AMXA 5PAZA 1P5UB 3ZSSA 4Z8FH 4JHWH 2Z1KA 1RIUL 1WO2A 3RI5K 4TSAH 4KUZL 5ABAA 3H6AA 3ZL4H 1IE5A 5ITBL 2OM5A 1QNZL 1XR9B 1DQDH 4WUUE 3PHAA 4MD4B 1UTDA 3LVEA 3QEUB 1O7DC 1M6OB 1YEHL 5ISZA 3M1CA 4R96B 4XBEL 3QQ4B 4LSDA 2PO6C 5B39G 5F7FA 2YPVL 3KLQA 3QPQC 2WZAA 3BQUD 3K1DA 2CU9A 2QVMA 4W81A 5DJYB 3QUYA 4OU3A 2A4CA 3VD2A 1AKPA 4LHUA 3WJLA 3VU2A 1ZCRA 2MKWA 4NAQA 2P8LA 4W4NA 4FZEH 4PIRF 4XB3A 5EUKB 5SX5K 4DP6X 4CGTA 4NHUA 1LTXA 3E8UL 3P30L 4XHJD 4P5MB 3ULUL 4AEIL 5KWYC 2G0KA 1BXAA 5DWUL 5F8RC 1CDGA 4TOYH 4YLCA 2FBJL 2C9SA 5E7FA 5GS2H 3CK0H 4AWJC 5AFAA 3LHAA 4BFNA 4M93C 3TCXA 2DL9A 5TDPB 1CXLA 3U0TB 4FF9A 4OZIB 3WHE1 2WBJB 2VABA 2VDKH 2YJQA 2P52A 4I0KA 3GIVB 3ESMA 3MLXH 4PLJD 4U1KB 2N01B 3PPEA 4MFHA 4XC1L 1MAJA 5HDBE 43C9B 1JXJA 1ZWIA 2WWKT 3F04A 4ADJA 1WC7A 2IALB 4XCNA 2AKRA 5LVEA 1NCNA 5I6MA 2KH2B 4BHUA 3SGDI 5IM7A 4MNHB 2XHNA 4MD5A 1MSPA 3MO1A 2X2JA 5K59F 3AGVA 4ZOBA 5FYLD 2CJTA 4OZHA 5JO5A 5KVGH 2QPSA 1XH2A 2GEEA 3CHOA 2IH3B 3O6FB 1KDJA 3VCLA 4MNGA 1WA2X 5KJ4A 2JSFA 3WXVL 2CUIA 1N2RB 2BRRL 5T1MB 3ZE1E 4EN3C 2XYBA 2FIKB 1KJMB 2IIJA 1HSBA 1OF2B 2PR4H 4FQXD 4TLUA 1Y6NR 3GTNA 1NOLA 4JB9L 2QMJA 3RI5F 2XQYK 4HCGA 5ID1B 1BD2D 2ZWZA 2BNQB 3WNIA 2YPKB 2YD3A 3M17B 1HI6B 1DVFB 4HSQA 1TETL 1T6BX 2ATKA 4OVVA 2C9RA 3EGDA 1PSKL 5CINH 1KB5L 4W9ZA 5DO2D 4Q8BA 4F24A 1WH0A 4LBAA 2P5EA 1A6AB 3G5ZA 3MNDA 5IHBA 4XMXA 1MH5A 3ECBB 1S9XB 4AJYV 4KMQA 1GH7A 1TOXA 5JIHA 4CVZA 5CJXC 3VSTA 2IQAA 2WXRA 1OOAA 2CIKA 4KK5D 1DSFH 2ERJB 4QCIA 1MCFA 2AEWA 2R8SH 2W9DL 4HLZH 4KK6C 4ZXBB 5E9DE 1BP3B 3VFPA 2V2WA 4HUXB 2R0KH 3VXOB 2EE0A 2CRMA 3HR5B 1WWWX 2SODB 1NUFA 5E95B 4TSAL 2KZ1B 5D7LD 3QHTC 1EQWA 1UA3A 4AJVA 1LO4L 4OSUL 5B38A 3WSQL 2F8OA 1FUNA 4EXPX 4RMUA 2H0FA 5FFOA 2V2WB 2I9TA 3LHPH 3E6FB 1PYWA 3ZE1B 3G5XB 1WFUA 3V10A 5SWQB 2ZXEB 4GKNB 3CZFB 2BWIA 3DSNA 4PBWD 3O11A 5GS3A 4LIQH 2NLJA 1K2DA 4OJEH 3EUDA 1MAML 2R2HA 3H54A 4Z7UB 2D9CA 3DX3A 1X7TA 3D2UB 4HALA 1AR1B 5CU9A 1WZ1L 2A9BA 1BZ9B 3UBXG 5KN5B 2CHXA 4LLMB 3MDJA 2GITB 2UZYA 4LLYA 4MKMA 3MMEA 4GFTB 5E2WH 4UBDD 3UP6A 4PG2C 1OD7A 1F41A 2YGNA 4KMTL 4NO3A 4P07A 1MFAL 4K7PY 4PG9A 3T4YA 1CFSB 2HYMA 2N3JA 4W9FC 5E4EB 4F8NA 1BZ9A 3VM5A 3TA4D 2EP6A 3CFKB 4ZUTB 1DQJB 1DLHA 5I5RA 5LBSA 4EZJA 1AKJD 4WI8A 4Y16C 4KXBA 4Y5XB 1WITA 2CD0A 3KH3A 4GEJA 4N5UA 4A2HA 1CJYA 3TBSA 3WDJA 1GZQA 4QYOA 4LVNC 3REWA 4Z3IA 4WU7A 4H8WH 5E6SB 5C08A 1BZDA 2EDKA 2IANA 4EIZC 2R56H 3D39D 1KB3A 1J12A 3NJHA 2YLHA 3FT2B 2YEZB 4BZ1L 2CKBB 3F64A 3QPXH 3JSSA 2BIOA 2ITCA 3KPMB 3QO0B 1ZT4A 1CC3A 4IKKA 4F7MA 1RPKA 1SGKA 4JFXA 4PJFF 2OMNA 3NYKA 4PREB 1BBJB 3W82A 4OCWH 4ISVA 2EYSB 3V4UL 5F3BB 3U4AA 2X4UB 5A7EA 4OSUH 4ZNCD 4V33A 4IHOB 2OMZA 2E6QA 2YSSA 2J4WL 3IPFA 5A16A 1TKWA 1NMAH 4TQIA 4TNFA 2F1BA 3GO1H 3Q3GA 3FPYA 4YSTA 4CDHA 1FN4A 3HCVB 5CN2A 1ZRUA 3B5TA 1TQBB 3QJOA 4MB3A 5JOPD 3ASWA 1E28B 3DV4A 1ZHKA 4X5LA 5DT1H 4K23H 1JWUB 2FHCA 4U3XA 2COVD 3BWUC 3GLEA 5F1NB 4IHOA 3HMXH 1OTUD 3A4DA 4XC3L 4LEEA 3TA3A 1T89A 1UB6B 3QCVH 4DKEH 2D3VA 2HKFH 1FO0B 5E9DD 5FYJU 3KHQA 1BQ5A 1HL8A 4PPTA 2J71A 3GS7A 2PMZA 1Y6MR 2EVGA 2FSEA 4Z76B 1FGNL 3V52L 4JW3A 1NCAL 4DEPB 5JW3H 1A65A 3CFJA 1AYOA 2R29A 3CK0L 5EC2A 3RTQC 5CD5D 2PN5A 4OCYL 1MFEL 2R69A 1EVUA 3K91A 4JKLA 4ALAC 4D0CB 3NESA 1A3LH 2GJZA 3EFOA 4PJAF 3L3HB 5E99H 4JFFA 5F7KC 3BAXA 4KO6A 1TZIA 1O5DT 1M2VA 2ESVE 4NRZB 2RIKA 5KYWA 2V5SA 4U1HB 2ADFH 3LTVA 2VISB 3GSUB 4GRWF 4FMFA 5JQIB 1I3RB 4QO1B 4M62H 3GXPA 3KL5A 1T7WA 2GT9A 4FG0A 5D4IA 3R1GH 2PO6D 4MZRA 3FDWA 1OP5K 4E9RA 3FB6A 4CNIB 5HJ3A 3ILDA 1QSEA 1UKSA 1LL1A 3M1OA 1NQBA 1PCSA 1QKZH 3A4FA 5FYJD 1GJWA 3GSQB 3MNZB 1S5IH 5TE7L 3L95A 4JFDA 4AC2A 4AYBA 2D0FA 2Z35A 5ICZB 1DBML 4EAEA 1NMCB 3MYZA 4GO6B 3GHBH 1P7HL 4RFEB 3GO1L 1N67A 4NNYB 3ARFB 2E76C 3L4CA 5D5MB 1N6QL 3N44F 2UVEA 2BP0A 2D0GA 4JRFA 4TVPE 3T65A 1QR4A 4JG1L 1Z3GL 4YGVA 5AOKA 1ZHNB 3EZ8A 3TBVA 4BUHA 2I7SA 1KN4H 1A3RH 2ZUUA 5TTRA 1BFSA 2QHRH 2F74A 3FT4A 5DZVA 4KI5D 1M05A 3JWNH 2RCSH 1IEBB 1JWSB 3OGCA 4XVSL 3HS0A 2VZSA 5MERA 3AS3A 3UBFA 2MOVA 5D2LE 1T2JA 2L8AA 3O2WL 5HI5C 3IN0A 4KUZH 4MA1B 2EQDA 1F6LL 3PQYA 3U25A 1H19A 1TU2B 3FT1A 1I8MA 1QWHA 1KNOA 5T33L 1KJ2H 3CV5A 3OXSB 4QWWC 5DMKA 4XP5L 1XGZA 1HCYA 2NY1D 4I48B 5F7EH 2QFRA 1GS8A 3F62A 4ABWA 2CIIB 2VR7A 4X80L 3MRJA 4Z3EA 1SJMA 5IJVB 3JZ7A 3W0WB 3GBML 1FORL 1UM5L 1TZOA 3QEUA 1KJVA 3QXVA 3SBPA 3UTZA 2IQ9L 4G5AA 4XP6L 1U41A 1E5AA 3DPDA 4PRPA 3EUUA 4Z23A 4WV1B 5SWSA 3IFOB 3AU1A 1RUPL 4PJFE 4XPAL 3QFJE 1KCUL 2IAMA 3SO3B 2Y2WA 1FE8H 4UUJA 1I8AA 4NQEE 5I1IH 3CC1A 3QARA 4ONHB 2X3BA 4E9VA 1GOGA 1ZE3H 3KPRD 3F5WA 1QKZL 4U1SB 4ZS6D 5C0DB 1WFTA 1D9KB 5D7EA 5DO8A 3DDGA 4Z7VA 4OI7A 1BD2A 1ASQA 1O7SA 1PMYA 2OCFD 1YYMH 2XTJC 4JAMB 2LLNA 4OCLC 3DGGA 4ZUVA 3CJJA 4OIFA 4I18C 3CVHA 3K1KC 5E2VH 3Q01A 5KSAA 4KK5C 4YDVB 4X8GA 1KN4L 2EE6A 5GISH 1LO2H 5DYOB 5J57B 1GTFA 3H0TA 5FM5O 2XV6B 3BJ91 5IP4A 2WBJA 5FGBA 5IY5B 2YFOA 4RDBA 1HVXA 4FULA 4RMVA 4N26A 3ILPA 1BBJA 2VDOB 1BQHB 1SOKA 3Q9QA 3SE3C 3TONA 3N1MC 3AM8A 2PYEA 4X6FA 5F7YC 4TUOB 4NSKA 4Y16B 2XICA 4G43A 2OL3A 5D7IE 3IFLH 1AKJA 5BV7C 2NY4D 4N2BA 3T2PA 3T2LA 1HL4A 4UM9D 1YECH 1Z5LB 1H8SA 2TRYA 4JM2F 3B7UX 3BEWA 3IDGA 2EE3A 4U0RC 2OJZH 2X4PB 4Q56A 4ODHH 3S36X 1FI8C 2BNUA 2HLFD 3W3BA 4LOUC 2XBTA 1KJ3L 3EHBC 4LHUG 2AK1L 1GYVA 3BIKB 3OKKA 2J5LB 4GUPA 4Y89A 1BG1A 4JDEB 1ZHKB 4WY7L 2QVFB 4UV4L 4NRXA 1VENA 3CG8A 3I02B 2XWEA 2BS9A 2IGFH 5FYLH 4DK5A 2Y25A 2F2HA 4XOCA 1OB1B 2YKLL 3CX5K 2EUWA 1IM3A 3D85B 2APXA 2XUWA 5J89A 1P6AB 4MVBD 3UYRL 4UTCA 1PNDA 3IK2A 4KHTL 1B90A 3ZL4L 1BBDH 1SJHB 5G2NA 1TYJA 3FPXA 4BGLA 2IVFC 2AVFA 1P84K 1K85A 3B3IA 3H3KA 3OPUA 4MJ4A 4AGOA 3UAJD 3GEFA 4LMQE 3VVVA 4X8CA 3Q1SL 4N9GA 1ADQA 2QKIA 5I1DA 2H1PL 4KJYB 4MQTB 1CXFA 1VCAA 4OJFH 2YPVH 3FB6B 2YSTA 2NY0C 5HHNB 1L4IA 1NC2A 4HBCH 5IUCA 1V7MH 3FU6A 1QA9B 3MRDB 1BJ1J 3GBEA 4HXAH 4W9IC 2L7UA 3D39A 1QPKA 4F57L 1I3RA 1ZSHA 1NJ9B 2FL5B 4KROB 5HVFB 4GKSA 3OZ9H 4F5CE 1YNKL 1RURH 3MCLL 5I6XB 1EEYB 3K71B 5AB1A 2PR4L 5JORA 1SRDA 3QIUC 5EV7A 4S1QL 3QGVA 4XPGL 3WUWB 4R4FL 5GRUH 2LV4A 3SGKA 4CC0A 1U91A 4NHCH 3VFUA 4JLRB 4M56A 2DJUA 3VI4E 3KAAA 3MTXA 5J56B 5HHME 5IWLA 2OTPA 1DVFA 3O6FC 2A5UA 5KVDH 1MWAB 3MV9E 4QGYA 5D5MF 2AGJL 1EXHA 1ZGLM 3N44B 3TBWB 4DUXA 5C6PB 4G72B 1JAEA 2JWYA 2JXMA 4JKWA 5GS0L 1TZAA 2FLRT 4MNHA 4ANUA 5C0BE 3EOTL 1AQDB 1RZIB 3DPBB 1NCOA 1DVYA 1CDUA 1F2XK 4S1DC 4HCRH 5GGRY 3T0DA 4ZAKC 2W9DH 1JDAA 2AMGA 1MHPL 1T66D 1RSYA 4XMVA 2BIIA 1QLRA 2APWA 3DBXB 1EEQA 5CSGA 3UZEA 3FCBA 3C8KB 3WFZA 5IHZB 3GXIA 4ONFL 3L3KA 2KBGA 5K59E 2DQEH 1TZIB 2ZNWA 25C8L 2BCKA 3AG4B 3HI6L 3NH7L 2N7AA 3A24A 2VLLA 3U0TA 4OZIA 2CJUL 1CIUA 3ABLB 4HC1H 3WJJA 3FFDB 4ZTPH 2ITCB 1I1FB 3VM7A 1SDAB 2X87A 1JPEA 5JPMA 1GAFH 1P0SE 4RWYH 4JRWA 5F1IB 2P43B 4LIQL 3EDFA 3GMMA 2JB5H 2K4WA 1H3WM 2ZYRA 4A2GA 1BF5A 4A2LA 4HK3J 3O45B 5I6NA 1OPGL 2F1EA 3OKEB 2BNQE 4ZFOL 1QEWA 3H2PA 3M6DA 1CPUA 2X7LA 1GKEA 2E56A 2EIDA 3QUYC 4Z7OB 3U82B 1YEIL 3QDMB 4PJBB 2FX9H 4K71C 3C60A 3NJGA 4IMLA 4OCMC 5J12C 1F90H 3SJVE 2GYSA 1G7HB 3H9ZA 5KUMA 1EAJA 3T2OA 1R5VA 3TBYB 3GSOB 5JW5A 2X4SA 3QUZC 3IDNB 3MCKA 4UWQB 1JJUA 3L5IA 4LSRH 3LS4H 5LCVL 4WGVB 4OAWA 4QXWA 1IJ9A 5JLZB 5AVQB 2A99A 3H4FA 2VDLB 1IT9H 3QK0A 3RWIA 4L37B 5IR1B 1FO0L 4OD3H 2GK2A 4XPBL 4P99A 4OZHE 2WBWB 1S6NA 3SKOA 3FB5A 1E42A 3SQOL 3BYTA 2WVVB 3QDHA 1ZLSL 2WPGA 1GGIH 3N1FC 5D93B 4CUCA 3P54A 3BYYA 3ZKND 3U1PA 3LNFA 4BUGA 4FQQB 3F8UB 1B9KA 1MW3A 2FJHB 4BCXA 1MDAA 3PV6B 5AYTA 5BCAA 1BYOA 3TNNB 5DQDH 4I18A 4IGBA 2FECI 2JTYA 4G1MB 2HFTA 5ALBH 1NC4A 3MKGA 3ARGD 5C07A 2Q10A 4ABUA 4N0FA 2R1YB 5I15H 1KGUA 3L5XH 4JS7A 1YG9A 5IIEB 3VDBA 4U6VH 4ZFFB 4YSPA 4XPFH 3BD5A 3Q43A 3FO1A 1NGZB 5FGBC 1BXUA 1KJ3H 4XX5A 1JF6A 4Z18A 1D7FA 1RU9L 3IU4H 4Z7IA 3DMMC 5DR5L 5E9NA 4LVHB 5CP7B 5AAWA 4ODVH 1QR1A 5T3ZL 5IB2B 4N22A 1T7VA 3A6BL 2Y1YA 3U2SA 2IG2L 5EC1A 5B21A 2UUDH 1NCUA 2XIIA 4JO4L 4X9YA 4HV8A 2JIXB 2WNWA 2NZIA 4L4VA 1SF3A 4CU6A 4TSCL 5F9OH 3EJRA 4GUOA 3BT2H 5CUSL 5CCJA 3IAGC 3GHEH 3A0OA 3UP1A 3MPCA 4DNLA 3O41B 2DEWX 2X9YA 5L0QB 2EEDA 2QFPA 3G04B 3H0TB 4A37A 5M94B 4YDMA 2OYPA 2IAMC 3MFFA 1QG3A 4L48A 3ULVC 5E99L 2C9AA 5CP3A 4HOXA 5AW8B 2LABA 1W0YT 2VLRA 3B2PA 5C70A 2DJ4A 5IQ9A 1AP2B 3QHZH 1R3KA 4IIQA 1NGQL 3NOIA 2IOOA 4Z7AA 4NUJA 4HCFA 3K2MC 3ARDB 2DM3A 3ALPA