4ZTEA

Crystal structure of human e-cadherin (residues 3-213) in complex with a peptidomimetic inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
210
structure length
210
Chain Sequence
b'IPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-1
publication title Crystal Structure of Human E-Cadherin-EC1EC2 in Complex with a Peptidomimetic Competitive Inhibitor of Cadherin Homophilic Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 43
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zteA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zteA02
1SUHA 5JYLA 3UBHA 4ZMLA 4ZMPA 3Q2NA 3UBFA 4XXWC 3UBGA 3LNGA 4ZMXA 4ZMVA 1Q1PA 5KJ4A 4APXA 2EE0A 1O6SB 3Q2WA 4ZT1A 4AXWA 3Q2LA 4QD2E 3Q2VA 4AQ8C 4ZMTA 2OMYB 4NUMA 1ZVNA 5JYMA 2OMTB 4XXWA 2WCPA 4APXB 1NCIA 1ZXKA 4AXWB 4ZI8A 3K6FA 2WHVA 2YQGA 4NUQA 4NQQA 1NCJA 4AQ8A 2OMXB 2OMZB 2QVIA 3MVSA 3LNDA 1NCGA 3QRBA 4AK1A 2OMUB 2V37A 4ZMWA 1EDHA 2OMVB 1NCHA 2X2UA 2YSTA 3LNEA 4ZTEA 4ZMOA 4AQAB 3K6DA 2OMWB 3PPEA 4AQEB 4OY9A 5CO1A 3K5RA 3LNHA 4AQAA 3K5SA 3LNIA 2A4CA 4AQEA 3FF8A 4ZMQA 4ZMZA 1FF5A 1OP4A 2A4EA 1L3WA 2O72A 2WBXA 5CZRA 3K6IA 2QVFB 3LNFA 2WD0A 4NUPA 1WYJA 1WUZA 3FF7A 5DZVA 4ZMYA 4ZMNA
chains in the Genus database with same CATH superfamily
1FE8H 1NCAH 4J3OD 3W56A 3WN5A 9PCYA 4QY8B 1TJMA 3V0IA 4B95C 2PR4H 3ZX1A 2KLRA 3ESMA 1WFJA 5BZXA 1NH6A 3B1TA 3MRHB 4XCYB 4Y5VC 1HL9A 3LNGA 5K9KB 3SDAD 1U30A 1GOFA 2IPTL 5CMAA 3FCSA 5AFAA 3IDXL 2CKBA 4RSYA 5CILH 4MD5A 3O3EB 1GY2A 2BY2A 1KGJA 4HS3A 4AQ1A 3MLZL 3M1OA 5MEPA 4TLSA 1DQTA 4HCRH 1BBDH 3POHA 4AGMA 1TJIH 1MLBB 5I18L 1SM3L 5L4MA 4B0MM 1I4FB 1OTUC 3D4YA 3QUZA 3DDFA 4M62H 5LBGA 2NY1B 1JZ2A 2YD9A 3KL3A 3C2AL 2PO6B 4AEHH 2WQVA 1G0DA 4XX1G 1W72A 4HJJL 3VSQA 1KB5H 2QFPA 1BVLA 3UPRB 2VW6A 1HZHL 1KJ2A 4R2GD 3O3AB 4EZKA 3QUXA 3I50H 3SE9H 3WS6C 4Y9EA 5CZKA 4YDNA 2ATKB 4YDKL 1KN2H 4N9GB 4JFHE 1JGIA 4N8CL 4DGIH 3PCYA 3ILQC 3KLQA 3ZKQD 1ZEAL 3EUDA 2GUOA 3KCWA 2WQRA 2JI1A 4Z7WB 5KZCD 4UTAA 4JLRA 4TVSa 4DVRH 1N6VA 1NICA 1DN0B 3P11H 2E4TA 3PDGA 2C9PA 4GBXB 5SX4I 5L4FA 2IC2A 1TLKA 3D9AH 3VWJB 4S1SH 3BEVA 3VU2A 1KDJA 2HH0L 4XNXL 4XBEL 1UKSA 4PCTA 5E2TH 3K6DA 3VXRE 5B4MC 3V4PH 4G6AC 5J13C 4CA4A 2AK4D 1KPRA 1UM6L 4HUNB 4JEGB 4ZS6C 1JHKL 3S88H 2DQDH 4OFKA 7CGTA 1NMCC 4XO3A 4R7NA 2DBLL 2AQ3A 2V2WA 2YAFA 2CLRA 3W2DH 4WFGD 2I26N 4XPTL 3N91A 4X4ZA 4A04A 4G8EA 3NDZE 2BIPA 3X2QB 2VXSL 2O6EA 5A6LA 2QKIA 3CU1A 3NABL 3HRZC 3GSNH 1MJJB 4QRPA 4BCYA 1T3FA 1G43A 4LNRB 1MHHB 3T6WA 4GSUA 2B16A 2N1KA 4S0TD 3TBBA 2IDSA 3AS0A 5CJOL 5ADPH 2X88A 4ZUVA 5EBLA 1ACYL 2ZOTA 4YXHH 5ANMA 5EUOF 4QXTB 4YLBA 1YY9D 1S5HA 3W11C 5ETUB 4KROD 3CFEB 1UZ6F 2PCPA 5C8JA 2JKIS 3LH2L 1IBGH 4WFFE 5E6RB 3WO3B 4C58B 5BCAA 1SBBA 4K71C 2Z31A 4OZGE 4OF0A 5DJXB 1OQOA 3DTXA 1D5IL 3C5JB 1LO3L 1GR7A 4AUYA 4DGUA 1V8HA 3W9DB 1PDKA 5D4JA 2WXJA 1WBXA 3VGHA 4FTVA 1B4TA 3NTCH 5E8PB 3FUEA 3MREB 1HH9A 5HY9A 3HI5H 1QSFD 2WWMC 5EHFA 5I16A 4UANA 1WG3A 3RILA 1MCSA 3VI3B 2EDRA 1O9VA 1CICB 4JDVA 3S34H 2Q8BL 2WMPB 1R3JB 3ROOA 2AQPA 3SGDI 1RPQA 4PUBL 3X12B 3MA9L 3BVNB 2CIIB 4QEGA 4X9IA 5DD6A 3NFPA 4IU2B 2AV7A 1BZEA 2R23A 3SZKC 3US9A 1KULA 3B9EA 2WLNA 3WO4C 3UJIH 3QIBD 2AVFA 4EPSA 1KTDB 2DMGA 2V2TA 1A6ZA 1J05B 2ZD0A 4Y19E 3HUJE 1NC2B 1PU0A 2E9IA 1WZ1H 4KKNA 4DVBB 1PNCA 4ISVB 5KSBE 1S7WB 5DTFB 3FB5B 4RBPH 2KZ1B 1ZA6B 2EE6A 1PNDA 5A7BA 1O6TA 1CFTB 4KI1A 5GGRY 3HE6D 1M1XB 4AL8H 2J1WA 4OLUH 4Q6IA 5AW3B 4OCSH 1ULVA 4YEEA 3WNKA 2BSED 2QQNL 1JNHB 2FUQA 2ZP9A 3D12B 2YXVA 3IF1A 4HIEA 4JFDE 5FGCE 4XO5A 3ELQA 1G7QA 3UACA 4QHMB 1QSED 3HS8A 4IOSD 4TSBH 3WUWG 5J9PB 1OF2A 3SIKA 4BUQA 1FVDA 1RSYA 3BPLC 4NRZA 1T2XA 2DQTL 2BIIA 2IGFH 5K9QG 4F7MA 3U1SL 1JWMB 2EIDA 4H7VA 1MPAH 4PEEA 3RX7A 2VIRA 4WTZA 4K94L 1FGVL 5H37A 4F7PB 1U42A 4WEEA 3DHJA 3LS4L 5I8EB 5FHBL 3DO4A 3CNKA 3HB3C 2VDPH 1KCVL 5F8QC 2Q8AH 2YD8A 3V4VH 4ZQKB 4YHMH 3KPSB 4MS8C 2GK0B 2BP0A 4ONHB 3NH7H 4UBDD 4WW2A 1PGRB 4JGMA 1BZ7A 25C8L 2K9UA 4PW9A 1RZ7H 3T2NL 1D3CA 4P3WA 3VRIA 3S8FB 1JZ4A 1HEZB 1JXKA 3AREA 4XNUH 3ARBA 4M61B 4N1EA 1H3XA 1TZGH 4UQBA 1MHCA 3AQDA 3O4LE 2VDKL 1KOAA 5DYOB 4CNIA 1WD9A 1E5UI 1QLEL 3DX2A 1IAOA 2MSPA 3NIDB 4NO0B 4J5VA 3LD8C 4FQXB 5FYLE 5IP4A 1A1NA 1T83A 4YHPA 1QR4A 3P9LA 4N2DA 5A2BA 3NJFA 2EDYA 1MVUA 1R17A 4HKXB 3JVFC 1C5DB 4MTMA 2AV1B 1M53A 3GO1H 3HN8A 3VI4F 3AJ7A 1KJMA 2VMFA 3BLBA 2VAAA 4LCWD 2IH3A 1XGPB 3FSOA 3BZEB 4U33A 5IZ7A 4H40A 3CXFA 1E4KA 2UXGA 2VRKA 3MBXH 4PJFF 4RBPK 3ZW3A 4LOUD 4L29A 2Y2WA 1E4XL 3Q44A 2GIYA 4X80H 1Q9KB 4YHKL 3IDGB 5F8RC 4WUUE 4PP1C 1CFSA 3CBRA 1HINH 1U2CA 2Y06L 3UC0H 1X7QA 1X9UA 3GBDA 1JN6B 3TURA 3R06A 2ESVB 2JKWA 4YGAB 4B0MB 1GYWA 2OPCA 4AIXA 5IT2L 3QO0A 3RWDB 4G1EA 4GW5B 4Y19A 4PH8A 5CZXC 3SDCD 2ZG3A 5I1LA 3D0AA 4TUOB 1KJVA 4HC1H 5KSBA 2P8MB 4F58L 4OZHF 2QSTA 1VEMA 3P2DA 1TQVA 4MMYA 4LXFA 2G9HB 2FJHB 1CDIA 1B0GB 2ENSA 5JDSA 5ID0A 1YPZF 3OKMA 4N2FA 3RJDA 2EQDA 1QMUA 2WVUA 3SHSA 2QBWA 1QI5A 5EO9B 3JBG7 4KRPD 3WFBH 4LESA 3IKCB 5F88A 3BFOA 5DA0B 5TE7L 1OTTD 3ULUD 1UT2A 4XB3A 1N70A 2VQ4A 3RUGF 4D9QE 4NQUA 1UFGA 2DEWX 1C08B 1TSRA 5LGJB 2DWDB 2FGZA 3LSOA 4PJEB 2IOIA 3X1EA 4JHZA 3UGXA 5BJTA 3D39D 2I9TA 5C9JA 5CCKL 3U4EA 2QGDA 1G9HA 1BAFH 3FF8A 4HHGA 5FK9B 5FB8A 4RVBA 1S7SA 5M7QA 3K8KA 1XL6A 1MUJA 4HJIA 1JD7A 4BZ1L 4RRPG 3EXJA 5CINL 3TWCH 2SEBA 3B3IA 5H2BB 3W39B 2D7OA 5E1HB 1C5BL 5J4MA 3MCYA 3SPJA 1ZGLM 4I85A 3C2SA 5FO9A 5J6GB 3K81A 4IKKA 2X40A 4HKJB 4MXQC 1X5KA 4OGAC 3CZLA 4OLXH 4Q58C 3TYFA 3GMOA 4W9CC 4DJMA 4I3RL 2H2PD 2MTPA 5D7IF 4OGYH 2I07B 4RISH 2COVD 8FABA 1Z5HA 1K8DB 3DMMB 4PJ9A 1E28B 4JPSA 1QLRB 1D7CA 5H35B 2GSMB 1E42A 1A3RH 1VA9A 4HT1L 4P5TB 5IB2A 5ILTH 1DQQA 1SDDB 1OTSD 5T3ZH 5I1DA 1BYOA 4AXWA 1G9EA 3LVEA 1FNEA 1FRGH 4ORGA 4ZFZA 5FR3A 4YH6A 1OZTG 3CZNA 4PJ5D 4Z7VF 3JT0A 4DQAA 3MV7A 3GJFA 4XWOD 4U1LA 1MHPH 5F1IA 4A2DA 3IK2A 3NJMA 1FJ1A 5CWSB 2ORBH 2ARJA 1FA4A 1OP3H 4CDGC 1BM3H 2BC4A 4FA6A 5KW9L 4G43A 2E7CA 1JGUL 3WNOA 4CUCA 5JR1L 1AC0A 1RFDL 4AX3A 4WUUA 3D33A 1AR1D 3QRGH 4P23B 3GRWA 5EORH 1AGBA 2IDCA 1RPKA 5IB5A 4TSAL 1EH9A 4FZ8H 3KS0H 4HGKC 4MNQB 5F89A 5A2FA 3ECBB 3WMQA 1CGUA 5INCA 3BKYH 5E23A 1Y1UA 4F9PA 4FOMA 2R2BB 4EXKA 2O5ZH 5I0XA 5DUBA 2F2HA 4PS3A 4WY7L 4EI0A 3KWWA 3N40F 2LLGA 1UFUA 3GMQA 3PWJB 3QO1A 5I17A 3WTWA 1RUAH 2OR8A 2XN1A 5IKCB 5FO8B 3BLKA 4JB9H 3X3GH 5CIPH 3C5ZA 5BMFL 5IFHH 2XZCL 1JNLL 4UZUA 3RTQD 4HOMA 2F74A 3EBHA 1I8KB 2AXWA 3AG2B 3D51A 4CSTA 3HG1B 2OCCB 4ZAKD 4G8GD 1O9ZA 5FUZL 2BFGA 2KBGA 2OCJA 1FNSL 1GS6X 3KPOB 3BI9X 4M6OH 2P9RA 1BD2A 1E2ZA 1XR8A 2XVLA 3TOPA 3KCPA 5GRVL 4PBVC 1EXHA 1SHMA 3RL1B 5SX5K 3VE0B 5BW7C 1OAKL 5DFVD 3QDHA 2K8QA 4M6ML 3WGVB 4LLQB 1NANI 4Y1TA 3RTLA 5F6IB 5A2LH 3ALWA 3HFML 2R2EB 4MJJA 1QUPA 3W1ZA 5AYUL 4X7SL 4AIZB 2CH8A 1MLCA 5J1AB 4EKXA 1ETA1 3OZKA 4LSUH 1T2QL 4IDLA 1KGYE 5KYUB 1AHWB 4XOEA 2PCFA 5B1JA 3GT6A 4PRPA 6PCYA 4JDTL 5BO1H 2O61A 1QI3A 4UU9B 3HLAA 4LPUA 4UI2A 4EN3B 4RFEA 4G7YL 4Z5RB 2EJ1A 3O6KH 3FXIC 3FPYA 1MRFL 2G2RB 2DH2A 4RGMB 1EFXD 3OM3B 1RK1A 4KVPA 3K2UL 5EU6B 3V0VB 1AMXA 2CO3A 3QQ9D 4HK0A 2XQBL 3VFNB 2DQEH 3BAYA 4KY1H 3TX4A 4OSUL 1WEJL 3FT2B 4L2LA 3T0DA 1NBVH 3JWDL 4GAYA 4FLRA 4ES9A 5IIEA 2Q7NA 3ZSTA 3NZSA 1Z0MA 1IRAY 3K71B 2BS9A 1T03H 2R56H 2JMRA 3OKKB 1IQWH 1RL1A 3T1WA 2AJ3A 3DYPA 1F18A 2AABH 2GQHA 4WEBH 3QFGA 1JWSA 1M2VA 3KLHC 1AG0A 2FR4B 2FX9L 4YPGB 3Q9PA 1PIGA 4ALAC 4JHWH 1UWYA 1EEUA 1VGKB 2VERN 4UV4H 3IFPB 5GISL 1YEJH 4A38A 3HC3L 3P4OA 4N2IA 3P73B 1ED3A 4F8NA 5DO8A 1CTNA 1G84A 5EZIL 2DQCL 2RACA 2VAJA 4WGWB 5EO0B 1BWWA 1VFAA 4LB8A 3HNTH 3MA7A 4PR5B 3SQOL 3QYNA 4L4TD 1CDJA 4P59L 5CEZH 4N0YL 5E24E 1U8MB 2P43B 4ZJ9A 1MRCH 3OAZH 4YXLH 3U36A 2P49B 3BUPA 2FZ3A 3IDYC 1N5YH 4L8DB 5D5MA 4LT7A 4N8UA 5E99L 4E9YA 4L9DA 3VDCA 5FM4A 3S5ZA 5ACZB 3FMGH 3CG8A 1U8IB 5CP7B 1F4YL 2ICEA 3CCHB 3FB6B 4WWOA 1PZ5A 3MACH 3Q8BA 4QIRA 5CHNA 1PG7W 3T0BA 4G42B 4L3EE 1BXVA 2M8XA 4M1CC 4PRHB 2ZF9A 1LD9A 4X0NA 2DQHL 1G7HA 5I6XC 2AZAA 2O5YH 3EJZC 3MOBL 3MLTA 2ARJQ 4HAKA 4X6CB 3MX0A 1MFNA 5AZ2H 2R7EA 2H6PB 3GNML 3HZYB 4DQOH 2DJUA 1J5OL 2A7BA 4LIQH 1LK2B 1AQMA 3E1F1 5IJBC 1CFQB 4PJCF 5AVZB 3T3PB 4N2OA 4JJ5B 1Q0YL 4J4PC 3F7QA 2YD4A 3RP1A 1R5WB 2IJ0C 2ZXCA 1TG8A 2QHLA 3OKOA 1OALA 2VDOL 5D2NB 5DRWA 4DN3H 2CO6A 2GY5A 3VDBA 1SFDA 1BFSA 2BX5A 4RA0C 4DKFL 2BDNH 5C0DA 2CG9X 3EH2A 4Y5XA 4CADB 3L9RB 5A6IA 3EFOA 3RVXD 1HXYB 2IPKA 1T89A 1FH5L 3M86A 3GHPA 3OV6A 3LHPL 3VD3A 1JV2B 3FHEA 4JFHD 4IRJA 1AZCA 4XP4H 1BIIB 1DBBL 4KRMB 3LRSA 4FMFA 2CJTA 4JFPB 2YQ3A 3BZFA 1U92B 2V2XB 4PLKC 4YHYC 4JUSA 4B41A 4HMDA 4M7KL 2FEDC 4Q6YA 2HKFH 3S37L 1ZGLB 3P40A 3GI8L 1OD7A 4DO5A 1QHQA 3LPGA 3PP4H 3QCTL 3BIBX 1FVEB 4QCIB 4TXVB 3VXRD 5HVWA 4KKZA 4NO3B 1OGTA 2W07A 4FFVC 3BDBA 3UAJD 1EXUB 2UX6A 5I75C 5LN8A 1O6SB 4M56A 1I8IA 3WG7B 5IB4B 1GCFA 2D7NA 1S7QA 4PLJC 3CV5A 2BS71 1IILE 3D18A 3FB8A 3H3PH 5JUEH 1NPJA 4GRMB 4Y8DC 1GKOA 4Z95L 5E8OB 4KXDA 5F1SA 1MCFA 5GQBA 5JHDD 2B77A 5AZUA 2FT6A 1FV1B 4M3JA 4HQQH 4X9BA 3OJDB 4LOFA 3IM1A 4NQDE 3Q06A 1DBAL 4JFVA 3KPPA 4GO6B 2YKKA 4JY4B 5F7LB 4NUJA 5D1XC 4U6XA 3UOAB 1PJWA 1TJHL 4I4WB 3QIWA 1Z6JT 3QUMB 4KKBC 1T1XB 3D34A 1JF1B 3NRFA 5IQ9A 4XCFH 3UADA 1MCWM 3S3BB 4WFFD 1UOWA 2RA1A 2RGSA 2NYYD 3WS3B 1OSPH 2R4RL 1AD9B 1G7MB 1QBLL 4UYPA 3FU7B 1BZ8A 2ZUXA 1IGML 1VERA 4OKVB 4POZD 4HGWA 5ADOH 1I1AC 2HFEB 4FYRA 3ROLA 1CGSL 1CD8A 2KMWA 2YZ8A 5KTEH 3O9WB 4YFLF 2VLKA 1R5IA 2V9RA 2E8ZA 1G6RB 2H26A 2VSDA 1SHWA 3QRLA 4LKXA 3TVMD 5CR8A 4TV3A 1J5IA 1A7PL 3ML8A 1OHQA 1MCLA 4Z7UE 4F2MB 2AGJH 4HZLB 1N64L 5SWSB 1X44A 3FUMA 5EBWA 3LNIA 2FATH 2JQAA 4H13C 2ZXDA 4IIQA 1UWGL 1I8MA 1A1MA 3ARGB 4KO7A 5DRNB 2GCYB 4JQXA 3MYJA 1SOSA 4PJHB 5J11B 3EXLA 1IE5A 3EO0B 1IZJA 4MMZA 2VLRB 1DL7H 4HG4J 3PV6A 5C6WH 3VB8A 4YOKA 3TNMB 5HPMA 4OZIF 1WFUA 2AKRB 4J3OH 3IGUA 4M5ZL 4PV9B 1YJDL 5AZEL 4PY8J 4LU5L 7PCYA 1NIEA 4PJGE 4X2UA 1TITA 4K7PL 3MNVA 4M03A 2CBTA 2WWOA 5E70A 3FPXA 3SDYL 3GQFA 1BLNB 5HYEA 4Z77B 3LKRB 3VA2C 1FO0A 4I0PA 4JFDD 4R4NC 4DUXA 1PX3A 1M4KA 2K4WA 3QB7C 3RFRA 1RZJH 3FQTA 2COQA 5IWLA 4U3HA 3LB6D 3WBDA 3MJ7A 2YSSA 4DO4A 4TMPA 4AT6A 1M05A 4ZXBA 2E86A 1U8JA 4PJ7F 1FP5A 2UY6A 4LCUA 1NGWB 2YJQA 4QRRB 3VAEA 3QDGB 1OSYA 2AMGA 3UAFA 3DV6B 1H5BB 3MJ8A 3OQRA 1FCGA 4GAJH 4U1JA 4B96A 1B3IA 1R3HA 4KK9D 3NZHL 3IXAB 3UTSA 5B39G 2CKNA 1T0NB 2CK2A 3U46A 1RUQL 4M7LL 3WLBA 4DZ8A 4A6YA 3QFJE 4IBVA 2WVVA 5F1NB 3VCLA 3E8UH 3K0YA 1QATA 3IBEA 3B9AA 3AB0C 4MGXA 3RWGB 2X4NB 3P3TA 5PCYA 1F0LA 3MRMB 1E6OL 4PW3A 2CQVA 2G2NA 3V5DB 2GT9B 1ZVSA 4PD4K 2VABA 4O9HL 3O4LD 2X4TB 2Q20A 4L8CB 1FWXA 3W38A 1E9PA 2CMRL 2R0ZL 4W4NA 4JREB 3HR6A 5FYLD 1BVZA 1YAIA 5I1KH 1N8ZA 5HHXH 3T0EB 1WH0A 3QZWA 2CDGA 5B7MA 4MJ2A 2G0LA 3HMWL 4AEIH 4EI6A 2V8LA 4P4KB 2IO5A 2Y7LA 2DYPD 3C5SA 4CMMB 3L5WA 3SDDB 4EQ2A 2VR6A 1GGUA 3AXLB 2EZ0D 1GC1L 1UVQA 3Q2CA 3U48A 1V7NL 1W8EA 2D4DA 4KMLB 4LZKA 3TO4C 5KVGL 3BIKB 1IZKA 5GSRA 2F15A 2P4AB 4YZFE 4Z7OB 3DIDA 3SCMD 4NQSB 1S7VA 1EEYB 4Q4IA 2B2XH 1S5IL 1XF2B 1UATA 1F1GA 3F05A 1XGUB 1S9YB 3WY1A 4JRLA 3CXDL 4PGCA 2AJSH 1Z9PA 4YHIB 3QJFA 5EUKA 1R5VA 4HLZH 2YGQA 1OAZL 3BW9A 2XT1B 3O41A 4FC3E 1PZDA 1KBKA 1YY8B 3BFQG 3TBCA 3CFNA 4OLYL 5KSUB 1Z1WA 2V7NA 4CN1A 2NY4B 3Q9QA 2W59A 1BBJB 3WDJA 3H7LA 4TUJA 4EI5C 5TDNA 3ORJA 3T77B 4MA1B 2Y3NA 4KX9A 4E9WA 3TIDB 1QR1B 1MFEL 5D70L 3S98A 4G72B 3B6SA 4IGBC 2DH3A 2WZAA 1LO0H 2AERT 4JJOA 2FT8A 5HJ3A 5I2IA 4H1LA 4QRSA 1KCSH 3D09A 1W15A 1NDGA 2E5EA 3JV4A 4WK0B 3VVVA 1RUPH 4JL1A 4D9QD 4OZFH 5EUOA 3G5VB 4GP8B 5JIMA 3RGVA 3H42L 3ARVA 1TKWB 3TV8A 4NXKA 3WN5B 2JJWA 4GQZA 4HS6A 4FQQA 2ZPKH 4LAQH 2BLFA 1J9TA 1DQLL 2FECL 3O4OB 3KM2A 4AZ8A 1MFCL 4WK4B 4WKZA 3S35H 4Z0XA 5L2KB 1U41A 5CMAB 3FCSB 1KIUB 2WPGA 3UCRA 3ULVC 4L5FE 1W9XA 1DBJL 1WC7B 3O3DB 4OZ4B 4EZLA 4HJTA 4PN6A 2I9LA 3QFJA 4HS3B 2QTEA 4N6RA 5AW0B 4AQ1B 4GBXD 4UOW1 4LRIA 1ECZA 2EDFA 4PY8I 3VWJD 1DANU 3NJVA 2HRPL 3HZVA 4S2SA 5TK2A 2DQFA 3QUZB 5C0CD 1NEPA 1AOHA 2PTUA 5TF1H 4WHYG 4YFLI 5FOBA 3HOGA 1H8LA 1RZ8A 3MBWA 2FBJL 3SKOA 2E7LC 2XZQH 4HJ1A 5D7HA 1I9IL 1W72B 1WP6A 4K3EH 3NCXA 4EUPG 4BKTC 2YKLL 1KJ2B 4WF7A 3AABA 3KPLA 4M1GH 3QS2A 4YSTA 43CAA 1J0ZA 5DJAA 5ID1A 2X70A 1FDLL 3WIHL 1I85C 1OPOA 2BOCA 1FFPA 1YYLL 1GZHA 3DHPA 5I30L 1REIA 1RP9A 5KSAC 5JIIA 4KJYA 2GUOB 1MQ8A 4GMTL 4HCGA 4N2LA 5E1IA 1JGVH 1JZ7A 1EHKB 1HWHB 1NL0H 2TAAA 4JLRB 3MLXH 4PSRA 1UQSA 1TMQA 4HW6A 3RPIB 2C4FT 2OSXA 4Y16C 5C07E 1V7ML 4O5LL 4XVTL 2WNXA 4NWUH 4CILA 1KZYA 2A9BA 3BEVB 5TDPB 1DO6A 2WOYA 1GPOH 5EBMB 1NCBL 3BKML 2D3LA 4DGVL 2NZIA 3MLYH 4HIJA 1G87A 1KYDA 3ZYZA 3U83A 1XB8A 4R90H 1KPRB 4ZTPH 3NP4A 4F8OA 4HD9A 3OPUA 1MHEA 3NVQA 5T33L 2V2WB 3ARFC 4HBCL 4BFOA 3C8KA 1UT1A 4NUPA 2ZXBA 4G8EB 3S97C 3KAAA 2QKIB 4GI9A 4P3DB 2WZ0A 4X6BB 2H9GB 4MAYA 1VFBA 4QRPB 3ZMRA 1CICD 3BE1L 1JZIA 4QF1A 3KR3H 3U0PB 1TQTA 4PWFA 4C55A 2V8MA 3M45A 3C6EA 1FIEA 1WJ3A 3BQUD 3GMPB 3FO0H 3QARA 4ZUVB 3RVVD 2NY5L 3E80A 3F7PC 2LAGB 5C71A 4C83B 3CLFH 4FXGC 4RGOL 3G5YA 1RJCA 3D85B 1A5FL 5EU3A 2ZOWA 2PCPB 4KZ0A 1R0AL 4HH8A 2CRYA 4JZOA 3M07A 2BS8A 3HG5A 4S1DD 3DTXB 2BNQE 4Q56A 3UJJH 1THCA 4Y9CA 2HB0A 4EIBA 1PLGH 1PDKB 2GAZA 3KLLA 4FTVB 5FA3A 1JPGA 5FUOH 2PABA 1GZQA 1HH9B 5HY9B 3L3GB 4Z3GA 3PDOB 4TVPE 1B0IA 5I16B 5I1IH 1CE1H 1A6PA 3QZBA 4F7KA 1V05A 3VD7A 2W9EH 1KDIA 2O6PA 3GBNL 3L3OC 3ROOB 5C0EA 3LXAA 4LCYA 1SUJA 4PJFA 4YK4C 4XAWH 1VLXA 3NJGA 2X4UB 3KNBB 5DJZA 2AV7B 2R23B 3ULUH 5B1CA 3RU8H 4JFTA 1R24A 1YC8A 4XO8A 5B1AB 1UXSB 2X3CA 3FCGA 1A6ZB 4MAUL 3LEVH 2DYRB 1CC3A 1T66D 1O6VA 2MQ0A 3EADA 4NHCH 3RDJA 3RPBA 5HGBB 4YE4L 1URIA 4X6FA 4OFIA 4UNUA 3GF8A 3KPSD 1FZMA 1VIWA 1EEZB 2IQ9L 4OZHA 3S36L 2WTRA 2GITB 2FEEI 3DA0A 1AR2A 1TCMA 4Z7QE 1U21A 3MCLL 5C0RL 3U82B 1YPZA 3WGUB 4JG0H 3IF1B 2XDHA 3EJRA 1D9KC 1GAFL 4CU8A 3BPLB 1G7QB 3ZDYF 1RUML 3AADB 3EZ8A 2D3VA 4JE4B 2XTJB 4ZO6A 4MRBA 3SO5A 3LRGA 1FVDB 4S1QL 3ZE2E 1HEJC 5DD0L 1Z3RA 4NRZB 3ARXA 1PCXA 5LNEA 3QZMA 1G1KA 4F7MB 2J6EL 4XBGA 2DWEB 3HB3B 3U7YL 2Q1EA 4JFYA 4RFNC 4JRYE 3BSHA 3IPEA 4IOFD 3QUML 3RQ3A 2BCKA 1BAWA 1H3PL 2B3IA 4KPHH 4LSQH 2YARA 4CL7A 1QNZL 3NCWA 4XVSH 4AUJA 5DHYB 4QR7A 4XX5A 2I5YH 1GGIH 4Q0XL 5ELIA 4L3ED 4P2CG 4JK0D 1N5AA 1BZ7B 3FSVA 5DMYA 3DX8A 3EYSL 4GY4A 5FUCC 3U0TA 4MXVF 3ME0B 4QJ3B 3FFCE 1ACZA 4G83A 5BOJA 3AREB 1G6RL 1CXEA 3ARBB 2JJSA 4YVNA 4ZTOH 1OAXH 1X5FA 1MHCB 2DIEA 3GEWB 3Q3GB 3IN2A 4LARH 5D7JA 3B37A 1J1XL 4OKDA 5C0GA 3F8UB 1DBML 4QD2E 1IAOB 1KG0A 2H8PA 4R3SA 1F2XK 1AKJB 3O6FD 3MRLA 1NCCL 4GO9A 3UTOA 4ODXB 1A1NB 5JZ7D 5K9QI 3P9LB 3ML9A 2VSCA 2NW3A 4ZQTA 1MVUB 3MUGA 4R26L 2CLVA 3L4TA 4DKTA 3FFDA 4JHAH 4NKIL 3U4BL 3LJ3A 3IFLL 1SF5A 3RY6A 2LLNA 3IDXH 5L7XH 1DEEA 4NNYB 1KJMB 3LQZA 2VAAB 1ITBB 2IH3B 5IJDC 1WICA 3MLZH 2PXYC 4N2MA 1KIRA 4Z7VA 1KXVA 1SM3H 2D73A 1BQ5A 2XX0A 1HCYA 1HNYA 5E4IA 5JIHA 1P4IH 1ND0B 2P8LA 1CFSB 1MDAA 2CKBH 2WANA 3JV5A 5E8DL 1N7MH 5A1AA 5TDOB 1JOIA 1X7QB 3HJ0A 1NCGA 1TQSA 3FO1B 2OSLA 4XZUA 4ODSL 4KI5C 4L8BB 1OM3L 2QGCA 5DFWH 1HZHH 1K5WA 3QRFM 3ZT7A 1ZE3C 1PZSA 4G1EB 1HHGA 4JZJC 5EU5A 4YC2C 1SN0A 3BX7C 1AGFA 3GPSA 1RZKH 5I1LB 3K0WA 1KJVB 1ZTXL 3TGXA 5KSVA 3APFA 1NUNB 4MMYB 4LCIL 5EIVA 2IH1B 4FYTA 5ID0B 5JDSB 1SXCA 2AMUA 3VGAB 3O2DL 4PJ6A 3BKJL 2FYVA 3FOMB 2IAAC 2JJVA 4WKXA 1J18A 1P84K 4XXCC 3TJHC 3CGTA 5DC9B 5A2AA 2UWEF 2P44B 3ZMEA 1OCRB 5DK0A 1AXSA 5F88B 2HH0H 4XNXH 1QTPA 4XBEH 1K2DA 2CCVA 5KYXA 1DVFA 4NQDD 4UTAH 4XAKD 2IWGA 1PW3A 3NEXA 5JW4R 5EC1A 1T20A 1JGLH 2V17H 1SRDA 1UM6H 3LSOB 5BJTB 1YEIH 4BQ9A 2I9TB 4ZW8A 4TQIA 5C9JB 3OF6D 2JELL 3HC4H 4G8FB 4Y2NA 3F04A 1AOZA 5FB8B 2AEWA 3P3YA 3O2WL 1QZ1A 4AQOA 4FERA 5GHWH 2FO1A 3FO9B 4JM2C 1M7UA 2Y1VA 3HR5A 2Z3FA 4TULL 4AIOA 3NABH 1AKPA 3QUYC 3P3UA 5I76A 5HYJE 3B3IB 4KUCF 3PJSA 5EDXA 3BD4A 3BKCL 2X5PA 1DUYA 4G6KH 5FO2A 3V7AE 1MRDL 2NXZC 1OV8A 2IAMC 1G7IA 5BUPA 2HRHA 4Z3JA 2DM4A 1NFDF 3OHXC 3TYFB 4NSKA 4NHUA 4NO2A 2W95A 3GMOB 5FPIA 1O0VA 1LO5A 4Z18A 1RU9H 3GBMH 1U4EA 4GRWE 4PTTB 8CGTA 4AQ8C 3T1FB 8FABB 3RIKA 1IAIH 5IW1B 4ANVA 3MBED 5E0FA 4FL4C 4PJ9B 1E30A 1EHAA 1LO3H 3O0RL 4TUKL 2CR0A 5HYSA 5DC4B 1XGRA 3RVWC 1E90A 3QAZC 1MAKA 1RURL 4IU3B 4M48H 5IB2B 4MJ5A 4YSPA 3BISA 4L3CA 5I1DB 1QEWB 4AXWB 3BCFA 3TZVA 4AV0A 5JHLA 1HJBC 3FONA 4RZCB 4ORGB 4ZFZB 1HWWA 1SQMA 1S46A 1TZHA 3BVUA 1A47A 4X6DF 1JRHI 3MV7B 3GJFB 4OCXL 4ZSOA 1TVHA 1T5XB 2ARJB 5F70A 4F91B 3KZ8A 1V3LA 4UINL 5FDWA 2BC4B 5FLUA 3HS0A 4GXVL 1YECH 2VSMB 4PUBH 1KNOB 3LVTA 4MNGE 4I87A 3KYNA 3ZN6A 2BNUB 1SHSA 4Y1SA 1KTCA 5IB5B 4P46D 5F89B 2MMXA 2FK9A 2YGNA 1F58L 4Y4FA 5INCB 2HT2C 2HLAA 4QT5A 5GZOA 1IC7L 1CR9H 3IDNA 3PWNA 1B2YA 5GPRA 4JPWH 4GKZA 3EIFA 2ERJC 3KWWB 3SE8L 3GMQB 4CC4C 1JJUA 2WLKA 5MERA 3WL9A 2O4EA 4C56A 5KG9A 1SYSB 3U7AA 2YEVB 3RB7A 3CC5A 3C5ZB 5BV7B 3F2LA 1OD9A 2OZ4L 4TQPA 1I8LA 2VLLB 2J1XA 3KPMB 5DEGB 4ZMZA 3DUHA 1N4XL 3UIYA 4IHBA 3D4ZA 1BD2B 1QYGL 4FADA 2R1WA 1XIWB 3K6IA 3KCPB 1QEXA 4FFYH 4XE0A 5EA0H 4DTGH 3D2UA 2DQTH 4X7TA 1D5BA 3FQ4A 3ECUA 1VCBC 4HX1B 3FT1A 3CDYA 4AJ0A 4PJCA 4W9DC 5DQDL 2EC9T 4P2YA 4HALA 3VRJB 3QORC 3VSUA 1W72L 4NBZB 4DFIA 2YA0A 2YMXH 1RHHA 3BUIA 3WD5L 2DMHA 4QTHB 5I15L 4J3XA 1MLCB 1KJ2L 3DUUA 4I1RA 1TT6A 1IB5A 3Q1EA 2UZYA 4PRPB 2O61B 1G0XA 1FYTE 2AP2A 3HLAB 4Y2DC 5ALCH 1L6PA 2J20A 3EOAB 4TOYL 1GYAA 5LWYL 2J8OA 1PG7H 5HHQB 3EGSA 5DC2A 1QBBA 2IALA 5DCCA 3MTXA 1GSKA 1RK1B 4IBWA 1SJHA 3EYVB 2F8XC 4URTB 3BP4B 5DQ9A 3MRCA 1KBWA 4HK0B 3BP7A 1EZVY 3B2UC 4GAYB 5IIEB 1EBAA 1JDAA 2Z93A 4P3CH 4NKMA 1FFNB 3U9UA 1LDPL 4M1DH 5AW5B 5AWNH 4BGDA 2AJ3B 2NY7H 3VQMA 4AVJA 4NLHA 4PRHD 2YA2A 5DI8A 2NY6B 4K7FA 3O81A 4BSJA 1JBJA 1MCOL 1JG9A 1GW6A 3U7WH 4E42A 1K6QH 3U0WL 3IYLW 4Z3FA 4GEIA 3IDYB 5JQ6L 3MA7B 4GYBA 2WYIA 2Y06H 3ILDA 4N0UE 5HHVL 4D8PA 1AO7E 4NPYA 3UZVA 2OJ1A 2TSAA 4IDJL 2FZ3B 1BQLH 4QXGL 4OJAA 1EHLH 5D5MB 3UYPB 3GDCA 1SXSA 1J1PH 3G5XA 4NQEE 2OR9H 3OR7B 3VXSA 2WNKA 1HH6A 5F9WB 2PWFA 5FCUH 1LMKA 3RDTC 3PNRB 4AOFA 5DJ6A 3NDYE 5CHNB 3VNYA 4F58H 4U31A 2HT4C 4R84A 4I2XE 1U8LA 1AQ8A 1KGWA 2YR3A 1IM3A 3APDA 5JW3H 5EZLA 1OO2A 4GSRA 1G7HB 2J5LC 3ZO9A 1CLYL 3AQXA 5GRJH 2YD6A 3MLTB 3II2A 2DD8L 1YEKL 4R8WL 1EAOA 2WLHA 3CFMA 2R7EB 2VQ1A 4XP5H 3HZKA 3BVDB 5E9DA 2MPVA 1RHFA 4HIXH 2UXVA 2WO2B 4JFFE 1BREA 3GEFA 4EIUA 1D6VL 2NNRA 4LPTA 5L4JA 2P52A 4NT6A 4WFED 4R97C 1E4HA 2E76C 5L6YL 1KMGA 2X87A 3WOVA 1W0YT 2IANB 3OWEA 2CO6B 2JKSA 4LPXA 4N5EC 2AVGA 3KBFA 1KCUL 2QPDB 4KK6D 4HUVA 4Y5XB 2X2HA 43C9B 5DUMH 3EFOB 4ANWA 4XNBA 2FHCA 1RPUA 1C5BH 5TFSL 4OZIA 3V5KB 4IRJB 2ZCKL 5DD3L 1FYTA 3LRSB 2R9HD 5DDHA 1MJ8L 4A39A 4KK8C 1YN6A 3BZFB 4N1HB 5KN5B 3N41B 2Z7UA 2X9WA 3P0GB 1KPUA 5DO2C 5C07D 4BSWA 4LVEA 1S9VA 4RCAA 3M17B 1MQKL 4AH2A 3UFIA 1UXWA 3W9EA 3PV7A 2JCCE 3AC0A 1D2PA 1MH5A 3BVTA 2YBGA 5HHNB 2WVSA 3L8QA 1T0MA 2JKJA 3ZJAA 3SGJA 5HJBA 4KWUA 1YMMB 1OGTB 5MEOA 3GMLA 4FKHA 4PJ7A 4ELMB 5BOPA 4HT1H 2MPAH 3FUFA 5PAZA 5D1QA 3ZKND 4Y4HC 2X4RB 5KYWB 4NNPL 4MSWA 4GJTB 1NWOA 3FB8B 5AW4B 1WS7A 2C7UA 5FFOA 1JZHA 5FYLH 5INDA 4HIIA 3GLAA 4OLVL 2OK0L 3AU1B 4PMEA 3EO9L 4KKAC 4DIXA 4XVJH 3S3DB 4MLSA 2WLYA 4XMZA 3DVFA 1DFXA 1R3IH 4GKSA 5JR1H 4WHCA 2AJVL 3QCVL 1RFDH 3RA7L 1N3NA 1ES0A 1L9OA 1AZBA 2MCMA 3A3YB 3KPPB 5H4YA 1NPNA 3GJFH 3JTTA 3D69A 4PJ8C 3ARGD 4U6XB 3W5MA 3QZLA 4JKNA 1KBVA 2W88A 4GG8A 1FZKA 3SDXE 5IQ9B 4PRIE 4NQEA 3HZMB 1JS4A 2VLRD 1JPFB 3GRWH 3LZLA 5I8KL 2BNQD 1NEZB 1FNFA 4J3VA 2XKNB 1U3HC 3F85A 4AQEA 5BUAA 3GLEA 4OR1A 5BMFH 5IVXF 1SPDA 2APBA 2VLKB 1R5IB 5MHSE 3NIGF 4ADJA 1MSPA 4LKXB 3ZTEA 1OCCB 1FNSH 3NA4A 4FQJL 5IV2B 4XNYH 4WZ9A 2UZIL 3QPXL 1NCWL 1AANA 5EBWB 5HDLA 5IROC 1UJ3A 3EH1A 4WU5B 5BV7H 3RFZA 4JN1H 4IIQB 1GY1A 5F6HJ 1EBPA 4G6MH 1A1MB 1A4AA 3EHBC 4MWFA 4QRRD 3TA3A 4G6FD 4YDLB 4G6JL 3MYJB 3QDGD 4IRSD 1W6WA 4WU7A 3ZE1F 5GRYA 2NY0C 4MA7H 4MMZB 4QHLA 5AYUH 4X7SH 1E9OA 2I7SA 4AKPA 3DIFA 5HPMB 5ABZA 1FHNA 1PY0A 3P4LA 5K5YA 2ZKWA 12E8L 1CJYA 1TQCC 2OMTA 1U8HA 2R69A 3HMXA 4AIEA 4KJQD 5EIIG 2K3HA 1TOXA 1PLBA 3FQNA 4XO4A 4OI8A 4X4XA 3EW3B 1ZT7A 2DICA 4W4OA 4G7YH 3WIIL 5B8CA 2XBTA 2CHWA 4H0HB 2VDLH 4QTIL 1MRFH 4JO4L 3IJ9A 5CEYA 4XH2A 3BWAA 1QZNA 5B3JF 4I0PB 1N0XH 2Z4QB 2IWFA 1N10A 3APMA 2AEQL 1QOKA 2YPVL 4JHUA 1EO8H 1XD1A 2XQBH 3MJ7B 4X4MA 3L95A 4FKKA 1EIBA 1M05B 4AT6B 1WEJH 4LL1A 4N0CD 1A6TA 1M1SA 4LCUB 3GJFK 3PU7A 2ZQKA 3TH3T 4DCQB 5JA8B 3QUHA 2V5MA 4YLCA 1YUHA 4HU2A 4U1GC 3LPOA 3O3BA 2NNAA 4U1JB 2Z35A 3KL5A 4ONGH 3UO1L 4JRYD 4JG1H 3B7TA 1UJTA 3KEDA 3C6LD 2VLJE 5G4NA 1M3JA 3B9KC 3UTSB 3THML 1I7TA 4Y9FA 3U46B 4NZTL 4P4KD 3S5LB 3WLBB 2XOTA 4DZ8B 5JIDA 4TUUA 4HP5A 1NGQL 2JJTC 2CIKA 3AB0B 3HC3H 1WIOA 4P2RB 4A6YB 5EZIH 2LVCA 4XMPL 1OL0A 4ZYKA 3VCLB 5L88L 4P59H 4WUKH 4A7QA 2NY3C 5DZOA 3FFCD 4ZMOA 3HPJA 1EO7A 5DWPA 1I8UA 2OW6A 1HKLH 1ZVSB 5FV2A 4AQAB 2FBRA 3US0A 3GSVA 2X4QA 4ZBJA 2VABB 1G0YR 2AQSA 5E99H 4UNIA 4PRIA 3QEQE 2YOAA 3QEGL 5HVHC 1JXJA 2VC2B 3PWPE 1ID5I 3LCYA 4QOKE 3RWCB 5D55A 4AC2A 4JO1L 1N8ZB 3V8OA 4EBQH 4BGLA 3VWKA 3TM6A 3V52L 2W0LA 2XG4A 5ABDE 1GH7A 2A9AA 1HDMA 3CDZA 3D30A 1N6QH 4WENB 4G3YL 1YY9C 3TJEH 2CXKA 3C5SB 4UQ3A 3L5WB 2EINB 2BSBA 2H45A 3FN0L 1UVQB 1DFBL 4MCNA 4MYWB 2WBJA 4UOJA 2F58L 4FJZA 4ICWA 4TNFA 1AHKA 1XF5B 1ZANL 2DQUL 5GSRB 4XP1L 3K7UA 1J5OH 1HQRA 4ELKA 4ZO7A 3MRKA 3LQMA 3PGFL 1LGVA 1HHIA 1S7VB 2KZBA 5FM8A 3L4VA 5IHUH 2VDOH 4WO4C 2CJSA 1EERB 3TP4A 5GRXG 5CD5D 2BP5M 2VZ1A 4G5ZL 4L8SC 3CVIL 4PGCB 4QHUA 1FH2A 3VXMB 2LFEA 2VOTA 2CUMA 3QJFB 1R3LA 1MCQA 2Q3AA 1YRKA 2DEXX 3BW9B 5IMLB 4EI5B 5K59E 5L2KD 3O41B 4Z7AA 4F57H 2C5DC 3GMMB 1GMEA 1BECA 3A24A 4IGBB 1X6LA 2V7NB 3OLGA 1OTUD 1BEYL 3GTTA 1H3GA 3L5XL 3VM5A 3WMSA 2EIBA 3B6SB 1LJMA 4FNTA 3GI8H 2M2DA 3KYKL 3MRRA 1J1OL 2WCSA 5HJ3B 4AY0A 5I2IB 4H1LB 3AG1B 4KVCL 4MXVE 4QRSB 5GRUH 1ZWIA 4MKMA 1NDGB 3JV4B 1F2QA 3KVPA 2IMMA 2LU4A 5EUOB 4DPCX 5IBTL 3RGVB 1LP9E 5IBUB 2FT7A 1YQ2A 1JYNA 3ILQD 4D94A 2JKNA 1OAJA 4HS6B 5GGSA 4BK4A 1JZ5A 4FQQB 4WI0B 5F6HI 4MZIA 4JG9A 4AZ8B 2R0WL 3UG5A 3K1DA 2VLJA 1HJCA 2FWOA 1UCBH 3BUYA 4JMNA 1OLZA 3V9FA 4Z0XB 4LVHB 1ZPLA 4H25B 1BFTA 1EJOL 4HJ0C 1T5KA 1CFNA 5HYJD 4XCCH 2I9LB 4N6RB 3STZA 4Y8AA 5B4MD 4Y4KC 2P8PA 4G6AD 1JV5B 3HZVB 1F45A 4S2SB 1KY7A 2RMNA 4ZS6D 1RZ8B 5I66B 3SKOB 3F7KA 4PHXA 3QEQA 3NCJH 2B0SH 1L9RA 1TTBA 3GSWA 4JFEB 4P5SA 4GSDL 4AITA 3KHQA 2R4RH 4FFZL 1QBLH 3VXNA 4LASL 4O02A 2ZSWA 4OJCA 4QOKA 2OI9B 43CAB 4CC0A 5DJAB 2X70B 1IGMH 4FQIH 1FFPB 1MWAA 3OD3A 3QI9A 1O75A 4Y16B 4KJYB 4LSVH 4RFOL 4ALAL 3BH8A 2X7LA 5CSGA 5D1XE 2APVA 1UQSB 5IREA 3I6GA 4CGUB 2FB4L 2H32A 3W11D 1T21A 1T7ZA 4XOAA 3PG2A 5LBSL 2VGLM 3B2VL 3VYPA 2VM9A 4TQ8A 4XI5C 4DN4L 3FSZA 4J1UB 3KS0J 2VWEC 2R29L 3LMJL 1EPFA 3QHFL 4JPKL 3D85D 2BHZA 2FD6L 2G60L 4GRLC 2Z8SA 3ARFB 3K4DA 4Q4EA 1WCBA 2WQ8A 5DUJA 1F6FB 3BH9A 1RERA 3BVVA 1MHEB 5B22A 5TQ2H 2WWMD 2VRQA 3FB7A 3C8KB 4ZMXA 3EYFB 1YJDH 3DECA 5AZEH 5BQDA 4HHAA 3QPQC 4NEHB 2I24N 4ZPTA 2JE8A 4JPIB 2EADA 3QE5A 1F42A 1VFBB 2B15A 4M43H 4QF1B 1YSOA 4YR6A 1XF1A 2B4CH 5BNXD 5ICYA 4V2CB 3PHAA 1H3UA 5ISZB 1NFDE 1A6WL 2DQIL 4YDIH 3G5YB 4AGQA 5GS1A 1MEXL 2WZ5A 4MHHG 5KJ7E 4JZOB 1FO0H 1DVXA 1HHKB 2Y36L 2B08A 2K0RA 2GC7C 3OMZA 1CS6A 1NAMA 3BMVA 3N43F 2GAZB 2Q3XA 2LU3A 4M7LH 1P7QD 5FA3B 1JPGB 4PJBF 1CZ8H 1GZQB 2V3EA 4U3SA 3L3OB 4JM0A 1KCKA 5KS9F 4TKWA 5HDBE 3VI4B 1E5BA 1NIDA 2Y1ZA 4PVLA 3NACL 1GTFA 2FH6A 3D3VE 5AOJA 5C0EB 3RY5A 4BDVA 4LVNC 3HE7A 4PJFB 5FOJA 1E6OH 1HZKA 1MIMH 2CDEA 3F6LA 3RAJL 1AGEA 4O9HH 1F1DA 3FQWA 4PVMA 3FHQA 1OVZA 4BH7A 2QR0B 3H6AA 1R24B 4BINA 1Y18A 4RWYL 3DYOA 3HB3D 2CMRH 1B88A 2O26U 2QELA 2R0ZH 1RULH 4JRWA 3ZDZF 3UO8B 1G4MA 1BPVA 2NR6A 4MS8D 4X42A 3D0VB 5AVVB 1XCTB 3ARDC 1XGQA 3HMWH 4OF3A 3TT1H 5DEJA 1FZMB 1JL8A 4OZHB 2CHNA 3X14A 1D9KB 2FBOJ 5A7EA 2OTUB 1TDQA 5ABAA 2PPDA 1GC1H 4UV7H 1YPZB 4WI2A 1V7NH 3CFJB 4JNXA 2YN5A 3PAUA 1FAIL 1JUFA 3K2IA 1BGXH 2UWEA 4C8XA 2HKAA 3SN6N 1JPEA 1DR9A 1MNNA 1M9WA 1PKOA 1ADQA 1EV2E 2OCFD 4MA8H 2L7EA 3QXDA 5E1AA 3T0XA 4OCRL 1LYQA 5FDYA 4TSCL 5JQIB 3IWUA 5CLTA 1AO7D 2D9CA 1AKJD 2ZUYA 3RUGB 3U9PH 3MZTA 2AQRA 4IKLA 1A7NH 4YZWA 3MUY1 3CXDH 4YXKL 4JFYB 1V3MA 4DHLA 4DP7X 3Q6GL 3CHQA 1QQDA 5C2BH 4YDMA 3OLIA 4Y2LA 4WV1C 5BXFA 4XPAL 4A7VA 4X4YA 5GXBB 5DA4A 1U2YA 4KRLB 3LZQA 1MCNA 2L04A 1OK0A 3CHPA 3FU8A 1FFQA 4XBPB 3WU1A 5F9DC 1N5AB 3OBAA 4NUMA 4PP1D 1UB6A 3M1BA 1JCVA 2C34A 1CMOA 3KBHE 2OMXA 3LQAH 2FHBA 3UMNA 3DX8B 5F0PB 3U0TB 1NBZA 1G7LB 1RZGA 4JVUA 1P6AB 4H88L 5CZXD 1NFDA 1A2YB 2NX5B 5F96L 3OJVC 5C0GB 4JFFD 4R5TA 4LRNL 2QDVA 3FH7A 4JW3A 1KG0B 2IDFA 3MUZ1 4R3SB 5D7IB 5HVGB 3T4YA 4M5YH 1A1OB 2BW5A 3ZKXC 3MRLB 4JR9L 4P05A 4LLAA 5IBLC 1A4KA 1C9SA 3QA3B 1XV8A 2NW3B 3H9HA 2AJYL 2FTAA 3G9VA 3MUGB 4ZNCD 3FFDB 2PXYB 5CFHA 5FX3A 4ETYA 2XTLA 3J2PA 4PS7A 3LQZB 2B5IC 1NMBL 1KCRL 4UF7C 3IWVA 5C08E 5LXGL 2VL5A 1YG9A 5DEFA 5DZAA 4WTZG 4YHLH 3IE4A 5H37G 2R83A 1P69B 4X6DA 1Y1DA 4Z7VB 1AE6H 5DFVC 3FT0A 3ZZSA 3D3VA 3VQ2C 1LVEA 1TR7A 2APTA 1ZHLB 5JPMC 2P8LB 1UM4H 1L0PA 2FO4A 3FTXA 5E5UB 5MI0B 1MCPH 1S4IA 1PSKL 2FBJH 4OD2A 1WHPA 4XPHL 2EYTB 1I53A 4IBZA 1UENA 3HG2A 2OSLB 4RDBA 4LSSL 1A8ZA 5DVPA 1UA6L 3NCBB 2OP4H 3ULVE 3CLWA 4HIHA 5EU5B 4RSVA 1AGFB 4I3GA 4F1SA 4GG6E 2MOQA 4Z3IA 1FDLH 1CD9B 1I9RL 2H0PA 2A0LC 3B5GA 4FQHA 4XPBL 5CEXA 2FL5A 5F72S 3MC0A 4Z78B 4MKTA 4PG2A 1G94A 4Y2OB 2OLDA 4HLJA 1ETJA 2BRRH 3NRPA 4MXQD 4OGAD 5E8NA 5DS1A 1CGTA 1JMXA 4DW2H 4WSKA 1V7MH 3K6SA 1NPUA 4JY5L 1H0DB 1EVTC 4JM4L 5TPWH 1AXSB 2J5WA 1PD6A 5AOMA 4ZMNA 1DO5A 2K6ZA 2NZ1A 1NCBH 5KYXB 1DVFB 2F53E 2ICCA 3O3UN 2HLFC 5HGHA 4BZ2L 3W82A 1YEGL 2ZWLT 1IKNA 5IJCC 1DSFL 5LGKA 4DH2A 2FJFA 1E5AA 2HTKC 2QT6A 4BE5A 5FM5M 4HBCH 4J3OF 1C5CH 1UHVA 3QUYB 5ANHA 3S37X 3APCA 1OEZW 2BJMH 2YAQA 1Q9OA 2Z9TA 3HR5B 4C4BA 1RLWA 1I1FA 3QZNA 5C1MB 1D5MA 4K5PA 3PJSB 3BE1H 1TZOA 4MVBC 4B50A 3FU0A 1G9ML 3E6HA 4PD4J 1AY1H 1UYWL 1G7IB 1WPCA 2DJSA 3CDGB 4MA3A 3G3LA 1GRWA 1F4AA 3VXOA 4NSKB 4FL4B 1LO5B 4RGOH 2OL3A 5C97A 1A5FH 3GBLA 5CN1A 4LMQI 4AEFA 4UNVA 2D2OA 1AD0A 1VKXA 5E94A 5HGAA 3NK3A 4KUZL 5EU4A 2J57A 5BZWA 2E6JA 5HYSB 2UXTA 2Y69B 3BWZA 3ISWA 3V0WL 5JLZA 4RLDA 4K9EC 1U8PA 5ITFA 5J7CC 2F7IA 3TZVB 2XIIA 1DQVA 2BSRA 1KJ3L 3FONB 4MCZB 3NJXA 2CBMA 4A55A 5DHVA 1AFVH 4ZSOB 2XQYA 1LE5A 4HCRA 3L3KB 1IBYA 1EJ6A 2C3XA 2Q86A 4ERSL 4Z8FH 5FDWB 3HS0B 2ZF8A 2MOGA 1QBML 1XIWD 2H5UA 1OPGL 3KYNB 3WSQH 1YQVH 4L5FH 2Y9RT 1F13A 4AMKL 4BIKA 2BFVL 1DN2A 4AYFA 5IEHA 4W9ZA 4Y4FB 5CCGE 3S96A 3FL7A 1X9QA 3DTDA 3IMVA 1OSZA 3L7EB 1QFWM 4GKZB 3AGVA 4YE4H 3J8F7 2QLVB 2J2ZB 3WAKA 4DZBB 4GOSA 4B9PA 3S36H 1PLCA 2IQ9H 1GW0A 1T5WA 2DKMA 3FYIB 4C56B 4U6VH 5E9NA 5EN2A 3ULVL 2W65A 1T0OA 4MQXC 4P2OB 2EABA 4PJIF 4LCCC 1Q1JL 5DK2B 3K91A 4ZUWA 1GAFH 1QFUH 1KT2B 3PNWA 3NIGE 3UBXA 2VXTH 4LLDA 4AYID 3VXTB 1G1CA 2YAOA 3QQDA 3FRPA 4IEFA 2R1WB 1QA9A 2ZX7A 3VG0H 4DPAX 5JYLA 3I3BA 5DD0H 3V4PA 4K7PX 1WISA 4LDCA 3D2UB 1SXNA 1D5BB 3S3PA 4UQEA 3CFTA 3SE4A 4PJCB 3ABKB 4OIIL 3RLSA 3SJVA 3KLHD 3JXAA 2AJUH 2RQ8A 3JQOB 4UAOB 5E56A 3UTTA 1IEAA 4K8RL 4ZZFA 3WCYA 4R7VA 3PWPD 1RHHB 3TN0C 4J23A 2P7TA 3DUUB 5AAMA 1EMTL 2K45A 4ZMTA 7FABH 4KDWA 2Y72A 5LQBL 2PETA 2UZYB 1GGBL 2FVNA 3I6KA 3GD1C 5BRZE 1H15A 1OB1A 1IKFH 1JPSH 3DPBB 4A7SA 2QMJA 4I9XA 1E7VA 4KHXL 1IGIL 1TYRA 3LKPA 3EGSB 4G5AA 5I1JH 3VQ1C 3SQBA 3CWGA 4ETQA 2IALB 1J1XH 2CBOA 1IGTA 1SJHB 3V0DA 1NCDH 5IG7A 3ARYA 4KO5A 5C0BA 1Y07A 4B3EA 1JFQH 3MRCB 2VUYA 1P1ZB 4JZNA 2ISDA 1KIQA 3D87B 3V0HA 4M1CD 1M56B 1NIAA 5BVPL 4NKMB 2EVIA 4Q9QL 5L9DL 2NXYB 1LDSA 3EJZD 5FUCE 2BW4A 4NKIH 3RJOA 3V9EA 1TFHA 2XXMB 3IFLH 2X38A 4GLRH 4H26A 1KC5L 5DI8B 5FYKE 2QJDA 4K7FB 2WBWB 5D1ZA 1M6UA 5J12C 1PKQE 2EEXA 4J7RA 1TF4A 2ZUUA 3BT2L 1AIZA 3OL2A 4U4BA 2L4OA 3W0WE 3U4KA 2WB1A 1JZEA 3EDKA 4MBOA 2VW7A 2QVKA 3FQXA 4J4PD 4BFGA 2XICA 5E8DH 3NT0A 4NQVA 4TVPH 2Y7QA 3OZLA 4XCNA 1GIGH 4IJ3C 3BN3B 2XVBA 4NPYB 3UZVB 3V0JA 1VEOA 3RDTB 3GI9L 3MLUH 1RJZA 4HKBA 2CU9A 2YOCA 1OT4A 4B53A 2IAND 2RR3A 1B9ZA 1HTYA 3G5XB 3VRLF 3VXSB 4LPCA 1HH6B 3K2MC 5GGQH 5GS0C 2ZUWA 5DJ6B 2VMJA 5HBBA 5D4IA 3IE9A 3CFIC 3IBOA 1TU2A 3JUZA 1U8LB 3T0VA 3O2DH 1IM3B 3BKJH 4PLKD 5EZLB 1JYXA 1XCQA 2FEDD 3ZTCC 2XY2A 4O58H 1KBGH 3QAQA 3TBSB 2CUHA 4ODWA 5LXVA 3Q7JA 4B7IA 5IVXA 4KI5E 4D9RE 3PWVA 4JRFA 4L1SA 4M29A 4Y0GA 3KLAA 2VQ1B 4Z76A 3PP3H 2Y7SA 2M1KA 3HZKB 4LLMA 3RVUC 5E9DB 4FFVD 3BEWA 1T7WA 1ZD6A 3CN4A 3ZUNC 4BFNA 3KYAA 3RL2A 4N2NA 4NZUL 2IVFC 4OQTA 1R9FA 4NT6B 4PLJD 4G7VL 3IETA 4XN4A 1YMMD 2D9QB 2JELH 3QZPA 4HFUL 4ZMVA 2H3NA 3IXTA 4LLWA 1GGYA 1SEBA 1K4CB 2YBRA 4HUVB 3DETC 5G4MA 2HJKA 4IHOB 4KJPC 1NBQA 1CQKA 1WITA 5EWIL 4PRBA 3T65A 4YBLB 2Z92A 1KYAA 4OZIB 5E2UL 2OMZA 2GBTA 3A6CH 2JJUA 3DVGA 3SKMA 1A0QL 1MRDH 5CJ8A 4XN9A 3F62A 3IN0A 5DDHB 3B43A 3BP5A 1YN6B 2E74C 5D1XD 2L7UA 2ZXEB 2NCMA 4L4VE 4BYHA 4E41A 3NSYA 4Q9RH 1KFAH 5KUKA 4KKBD 3WNNA 2WHVA 3AFLA 1J9QA 5DURD 1JNNH 5JIPA 2ZKHH 4BSWB 1N19A 4NQQA 4TNWK 1H6FA 2CCWA 1E40A 2JFCA 2QPUA 3RIAK 4AH2B 4L2YA 3W9EB 1MH5B 5G55A 1T0MB 3AS3A 4JFZL 2GTQA 4NZRH 2ZCZA 4QWWC 2WW8A 1INEL 1DJGA 1ECYA 4TUKH 1A6UL 3D5OF 5MEOB 3LXUX 1V10A 1I1AD 2ROYA 1U36A 4PJ7B 1HHHA 4BK8A 1HSAA 5D1QB 4XMLL 5A2KH 3QNZA 2WXOA 1E43A 4MSWB 4P07A 1ET8A 4JPVL 4AC4A 1AVAA 3O6MH 5I8CA 5INDB 3TIEA 4OCXH 2WTOA 4HIIB 4IBQA 2D7TH 4F5CA 2LOEA 5DD1H 2GEQA 4J3SA 4LVOB 1IMHC 3P69A 4EMZA 4GKSB 4PJ8B 1N3NB 2HWZL 3LN4A 1VF5C 5FYKL 1PX4A 3PFUA 3ULUF 3HBQA 5DT1H 5JW5B 3JTTB 1AS8A 2O93L 3CN1A 4X7CC 3US1A 3D69B 4R96A 4TRPL 1P7KA 3PP3K 3TEZA 2J8UE 1OAQL 1IC7H 3IRPX 4GG8B 1L3WA 4PJXE 1U3HB 3PUUA 4NN7B 5HHMB 3CSTA 3CQFA 3ZL4L 3SE8H 2F18A 2OJEA 4A68A 2NY1C 2Y6TE 1RZIA 2PO6C 1RVFH 1PD1A 1F8TH 2OZ4H 1TEYA 2DKUA 1BFOB 4R4ND 1MFUA 2B9AA 3RZCB 4LSDA 4N4YB 3BUTA 4U6HA 1HSBA 3AT9A 1KLUA 3C08H 3ZKMD 5DEZA 1QUNA 1KEML 4NP4L 3UZEA 3RFZB 4OCYL 2R2HA 5GJTL 1OP5H 5FKPA 2NY0B 5MEND 4R83A 4HJSA 1UH3A 2PMZA 3ZR5A 1ZT1A 3O8XA 2YD5A 3MROB 3OKLB 3NRQA 3GKWL 4MWFB 4PREA 5D7LA 4FABL 5D93C 1CN4A 3ETSA 4PJAF 4WU7B 5DQDH 2EILB 1OT1A 1TQCB 1RJLA 1E9OB 1Q72L 2EH7L 2IFFL 3WD5H 3DIFB 3ZL2A 5C0JB 3CXHK 5I15H 3MRNB 3QYMA 5E03A 4KHTL 1D2OA 2KQNA 3ALXA 2W81C 2OMTB 2IIJA 3MRJB 4DUWA 1U8HB 4OF7A 3AQYA 2OYLA 4QXUH 3KXFE 4P2RD 2E27L 3FQNB 4X4XB 2DQJL 5CGBA 5GZNA 3MJGX 2B39A 4OLWH 4UZSA 4TOYH 5JTWA 5FF6A 3K6FA 4LHUA 4OT1L 1Q94A 4L4VA 5GGTL 1E5ZA 1NEZG 1VADA 5CM1A 1UTDA 2A38A 2EH8L 5CEYB 4XH2B 2IBZX 4BK5C 3HI1B 3EUUA 4IRZH 5J3HC 3PL6A 3WLWC 2X9XA 5DUPL 4JDEB 1X5HA 3NIFF 3ESVF 4U1GB 3RNKA 3L95B 5C86A 3QEUB 4GW1A 1RIHL 3CVHL 1I3GL 3A6BL 1YUHB 4FLQA 3KJ6L 1P84J 3O3BB 1THAA 3VD9A 2NNAB 1WSST 2F54E 2Z35B 3KBEA 3ABLB 4KTEL 2WN3A 4OLZH 4G2AA 4QI3A 1I7TB 3TO4D 3O11A 4JPQA 4N0RA 4W9LC 1B4JH 1J8HB 1GJWA 2EACA 3HBGA 3OVUB 1UH2A 4N8VA 3QIUA 2CIKB 4KQ4H 2IWKA 2NDGA 3I2CL 5M94B 4PWJA 4KAQH 4LEBA 3U0WH 3OR6B 4ZYKB 2VDQL 1YNLL 3P54A 1AI1L 5HHPB 4YLQT 1CPUA 2CNYA 3VUAA 5D2LF 4QPEA 2A74A 5IEKA 2UZXA 1C16A 1XL4A 5T3XH 3WKNA 2X89A 3GSVB 4IQHA 1E5CA 2J8UA 1PTZA 3N9GL 4PRIB 4PJDE 4DAGH 1OP5K 4FA8A 1FQ9C 2YD3A 3DURA 1BJMA 3EZJB 3VXMD 1MVFA 4UT6A 3GDBA 1YYML 3V6ZB 5KVFE 4EI5D 4HVBA 3VWKB 3ZDZE 3OGCB 1W0WB 1SY6L 3RVVC 2XG4B 2Z4TA 1DQJA 4IGBD 5DVMA 3V6OC 1HDMB 1J86A 3HVNA 1SYVA 4X5XA 5CIPA 4AMXA 5LLIC 1XBRA 1R75A 3MR9A 2GIXA 5J1SC 1YEKH 3A22A 3QQ3A 5JHLL 2UYLB 5C08D 2E7HA 1VZHA 2WBJB 3LS5L 2RCSL 4ZO8A 5AAPA 3FQ1A 4JGUA 3DGCR 3I02A 1UD2A 3QK0A 1IE4A 4KNTA 4ELKB 2X0WA 2GBUA 3S5LG 4WO4B 1QHOA 4X5QA 1D6VH 1P4BH 1VRSA 2RQEA 1YC7A 3GINA 3EOTH 4R9HA 3Q5YA 5AALA 5JORA 1F11B 1OE3A 1PL3A 3B34A 3H8NA 4L8SB 3WKML 1CF8H 3DJZA 3LIZL 3L4ZA 5JO5B 4R0LA 5F0JB 2L3BA 2X41A 3IS0X 1Z0NA 2Q6WA 3ULVD 2YMTA 4QHUB 2A9NH 2CK0H 3T71A 2OYMA 2FYYB 3QXAA 4RMTA 1NIFA 5BO0D 3W3BA 5JPNA 5CLWA 2ZCKH 4FLSA 2OR7A 4XRCA 4U1NA 2WLIA 4UM9A 5GGRB 1MJ8H 4JQIA 3NPSB 2WXNA 3MGOB 5B38A 4N85A 2WAHA 1Z9MA 3SKJL 4YNYB 3C75A 5DJYA 2EEAA 2IMNA 2EYSB 4MDJA 4KBPA 3MRRB 3DBSA 5T1MA 4WWKA 3TBVB 5KOVC 3UJTH 2YD7A 1MQKH 5AENA 1UUSA 5ESQA 3UEQA 3D50A 1ZWIB 4OBSA 3DHUA 1H19A 4KMTL 1MFBH 2NZ9D 2F53D 5KYNA 3ZTNL 1TJGL 4JFED 3OC8A 4XO9A 2YPKB 2FX7L 3HAEA 4L1DA 2AXGA 4RMRA 4G9FE 4GW4A 5KSAD 5LN4A 1KTBA 1ZLDA 2ZG1A 1CI5A 2F54A 3NSDA 2X2UA 4DK3A 3DVIA 2VLJB 2FWOB 4Y16D 4ZNEA 1GMIA 3MO1A 2OK0H 2F6AA 3EO9H 1RY7B 2XV0A 2RAMA 2EE2A 5D4QA 4PJBA 5IQNA 4MJIE 1CFNB 4FQXC 1OCWL 5KS9A 4M8UA 2JKTM 2P8PB 2CPCA 2NW2A 4DEPB 4XX1E 1U8QB 4FJYA 1Q9LA 4LSTL 4HWBH 5AOKA 1HFUA 1KPVB 3IVKB 2PKDA 4P2QB 3ARFD 4QAWA 4NAJA 4X7DC 3SKNA 2QZQA 5KVDE 3QEQB 3NQKA 1L0QA 2J7LA 3GSWB 3MRDA 4YE0A 2YAMA 3TT3L 4H1LG 4JCWA 3VXNB 4O02B 2ADGA 2Y07L 5DWUL 1HL4A 1BQUA 1DCEA 3L7FA 4DEWA 1UWEH 4X5RA 2WXFA 3QQXA 1A7OL 3QI9B 1EHXA 3PY9A 5BRQA 5IBUG 2BM3A 1QLFA 3BH8B 2CXGA 3QT2A 5C2UB 1S9WA 2O6FA 3IJYB 3NGBB 3I6GB 2H32B 1T21B 2UZIH 3QJRB 2GW5A 3L3HA 5A16A 1Z9OA 5CLXA 5ISZD 1DQIA 3ZDYB 3EFDL 2OX5B 1Z32X 5DJCA 2H6OA 4GQQA 1WCBB 2FQEA 5F7DA 5EZJA 3BH9B 3ZYJA 1N59A 3VFUB 4DEUA 1FL5B 4BWUA 2DJMA 1OT2A 2CJUL 2JWYA 3FB7B 2HZHA 3W57A 3DO7A 2PCXA 12E8H 1GHFL 3APNA 4KNSA 3CPLA 4HUKB 3MRGA 1KV3A 4HHAB 1ASPA 3PWLA 4GXFA 1NGYA 4ZPTB 1UB5B 5GS2H 1DYZA 2BXZA 3WIIH 4LPVA 5IJKC 1J12A 5F21B 4YR6B 4I13B 5ICYB 3CSGA 3HMXH 5BS0B 5K39A 4TN9A 3BCDA 2NYZA 1TENA 2HPTA 2ATAA 1CBJA 2JKXA 4NYLB 1B6UA 5D9SB 1BX2B 1MREH 4J3WA 5GS1B 1D6EA 5DHDA 1IJ9A 1MF2L 3R1GH 4KTDH 3VW3L 3ATFA 3AM8A 4G9FA 4YPJA 4FHJA 1XGTA 3UO1H 1XD0A 4WWNA 1FORH 2A9DA 2WUBL 3GSQA 4OZGF 5ICXB 3BSZL 2J88L 4NZTH 4ZDHA 3CFCL 1VCAA 2FJUB 2E46A 3DOSA 1D9KD 4U3SB 1VFUA 4E0RB 1W91A 1JPTL 3DMMC 4GMSL 4MJIA 5EOTA 4MJHA 1L0XA 3MFFA 3B5TA 4X8GA 1FL3B 3BD5A 3GIZH 4E9SA 4PRAA 3UL4A 5BRZD 4QO1B 2BPBA 3HE7B 3OXRA 3MJWA 3EO1A 4BKLB 4F8TA 2WO3B 4P5TC 1GXEA 4JKPL 2BNRB 2AF2A 1AGEB 4JVWA 1BJ1J 3H9YA 3NJNA 3FQWB 2VDNH 3T6ZA 4Z7NE 2W8CA 1N0LB 5ESVB 3QEGH 1Y18B 1A9EA 4W9IC 1J0HA 3ARDB 3UX9B 1L9NA 3QDJA 3AS1A 4MHHI 1CQYA 2DIJA 2AK4E 3FKUS 3PUCA 3ZRFC 4F2FA 3V52H 2H4EA 4L9LA 1UXLA 4TYUA 3O6LH 3HUJF 2ROXA 3ALPA 4NJAL 4UMSA 4P23C 4B7LA 4G3YH 3DJTA 4AQZA 5KSBF 5DGQA 1EDQA 1ONQA 2YC1A 5F3FA 3X14B 5FYKD 4FNLL 2H47C 3FQUB 1MZYA 3N1MC 4X0KA 1CE6A 5DLMH 3WMPA 4N0FB 1ZANH 4XP6L 1CG9A 2RFXA 1A7RH 4XP1H 3B8YA 1JUFB 3W0WD 1NC4D 2UWEB 3NN8A 3CFQA 3PGFH 4G80B 2KC0A 5T8IA 4I18A 3BAXA 2NX5D 1Q0EA 1DE4A 3ZDXF 3E9TA 5IM7B 4JFXA 3DXAE 4WIQA 4I9WE 1T04A 1VGEH 3JVGC 4KMQA 1ZLWK 4H2AA 4NQCE 4GAAA 4WV1B 4G5ZH 2IEPA 5DHXB 3QJUB 4AYDC 2QSQA 1CDCA 1IAII 3TCXA 5LB1A 5D96B 2PXYD 2QSCL 5BXFB 1UWXH 2XFXA 4X4YB 1DCLA 5EEYA 4JN2A 4APQC 1ZSHA 5E6IC 1BVKA 3SDAA 3UH8A 1E3XA 1UB6B 3M1BB 5AVQB 2KPWA 1QASA 3BO8A 2OMXB 4HWUA 3MLVH 1QSFE 3VFTB 1L6ZA 2KL6A 2Q7AA 4FQ2H 5F6IC 1J1OH 5E08L 4KI5D 3WY3A 1NBZB 2F7PA 4D9RD 2G4EA 1RZGB 4IK6A 4GSXA 3VFVB 4U1HA 1BV8A 4HV8A 5IBTH 2ADJA 1ZK9A 1AHWC 2HFFA 3MKKA 3P30L 2WLZA 3OGOE 2ADFL 3IRZA 1HKFA 3T4YB 4UCFA 1ZOXA 2HSIA 3QISA 2EYRB 3QW9A 4DSYA 5LAXA 3AY2A 4EN3C 2N7BA 2JB6A 3Q48A 1A4KB 2JKRM 4D7BA 3U6RA 3BWUF 3TJHD 3H9HB 1XEUA 3MKGA 1NGZA 4RGMC 5TE4L 1L9SA 2Z7ZA 5C0FA 3VGEA 2FEEL 2SODB 3EF7A 4JVPA 3MFGB 5DEFB 1OGAE 3CZSA 4UILL 4QHKJ 4X6DB 4B9IA 1E27A 2R69L 2DOCA 4GUQA 2VKWA 2FIKA 1YEEL 3SOBH 3FBKA 4OD1L 3EJUA 3FCTA 2FO4B 2Y25A 2BY1A 4H20H 1U93B 2VDRL 4CC1A 3CZFA 4Y1AD 1QSEE 1ZT4A 2OS7A 1DLFL 4JM2D 4GSDH 3VFOA 4HIHB 2ED9A 3QUYD 2NY2B 5T5FA 4YL9A 3E38A 1WUNT 2AK4A 5GGVH 5JMRA 4XC1H 5CEXB 1QWUA 4ABWA 2FL5B 2NXZD 2IAMD 2VZUA 4RFOH 2AAVA 5EZOL 2YK1L 2NMSA 4PFEA 5E8NB 4E9TA 2WVTA 2OMNA 5FW6A 3WUWA 1F5WA 4D0DA 4E5XA 4XXWC 2FB4H 6FABL 4YEFA 4PAZA 3K6SB 3M8OL 3HNSL 2XVKA 3ATAA 4PJIA 3QEHA 1MWAH 4QRUA 3KPRE 4DN4H 4UYQA 3PGCB 5IQ7H 4ODTH 1NFAA 5FW7A 3QHFH 4N2EA 5IF0B 4BA8A 2R4SH 1IC4H 4CDHA 4HWEL 2FSDA 2XN9E 4WNQA 3RVWD 5HGHB 5MEQA 2M83A 2CUAA 2HX7A 3MGAA 5JYMA 1E0OB 4PLNC 2FJFB 2NY5C 1SXBA 1B0WA 3Q5OA 4IOIB 3W37A 1ZLUK 4ZZKA 1PY4A 2OMYA 1BZ9A 1Q9OB 2MQGA 1ZXKA 2DM2A 2P5PA 4FP8L 4DO6A 5ESAA 4JO2L 3BAEL 1RK0A 1QPXA 3LX9A 1I1FB 2VJ8A 2NUTA 5E5MA 1D5MB 2VWEE 5JXEC 4ZD3L 1MKFA 2KPNA 1KCBA 3C60B 3QNYA 5D2NC 1AZRA 1BIHA 1QSFA 4J12A 4LCWE 3WI9A 5F3HA 4MA3B 1PAZA 3PQYE 2BXYA 2OMWA 1T80A 1MIEL 2HT2D 2WQSA 2DQIH 3ULSA 1FC1A 2E59A 1BMZA 1E6JH 3VSVA 3SD5A 2BZ7A 4ABUA 4P9MH 5JXAL 4FXTA 4Y89A 1IC5H 4HXAH 1AD0B 5FM5O 5E94B 1VKXB 1FHGA 4IMKA 2BVYA 5BZWB 3VGDA 2BSCA 4H0LC 3QIBA 5HDQL 2ZXQA 5JLZB 3EDDA 1XAUA 3MV01 1U8PB 5ITFB 4DNLA 2PW2A 2BSRB 3L9EA 4HFWA 2HYMA 4P2OD 4YQXH 3D0LA 4KX8A 3CU7A 4F27A 3BESR 3MLRL 4UOW0 3WY4A 3KXFD 1NAMH 3BIAX 3B2PA 1LE5B 2Q86B 1BWMA 3PXHA 3HE6A 1WBYA 1NGXB 3ES6A 3MCKA 1QVOB 4D9LH 2BSEA 3DUSB 4HOWA 3ZUCA 5I1CH 5KVEE 1EGJA 1NAKH 4PBXA 1QSEA 3QORD 4AYFB 2EUVA 4IOSA 4RWYH 1KB5B 4PYGA 5CNHA 3P2TA 3EKCA 5I5RA 3LAFA 1LEKA 2EIZA 3HHMA 4GKNA 2DDQL 2EVHA 2FRGP 1KENL 2R9HC 3Q1SH 3TL5A 1KBBA 5F7FA 4L05A 5FFGA 2DB8A 2OYKA 1L9PA 4Y2DD 4WJ5A 5TE6L 2G3XA 3VXQA 3VDAA 5C0IA 1T5WB 1UXMA 3WFDH 4LEXH 5EN2B 1TTCA 2W65B 3VI3F 1L7TH 5D6DA 3SB3A 3T4AA 5KJ4A 3WJLA 4ZUWB 4APXA 4BZYA 5I0YA 4AVHA 5E2JA 3UBXB 4O2EA 4LLDB 4QTFA 2FE0A 4LLYA 2HPOA 2P47B 3B2UD 1AXIB 2X1QA 3FRPB 4KDTA 4UTBL 1ZS8B 3GXMA 2CRIA 5EEVA 3T3ME 4NENA 4U1MA 3V4PB 1S9KC 2R0LH 3BRDA 1TNNA 3FQ2A 2WY3B 3HC0A 3O9WC 1DTUA 3OHMB 2ZZUT 3SJVB 2WCPA 2XA8H 4RRPA 3Q6GH 4FYQA 3INUL 2GBAA 4HCIA 4H8PA 3UTTB 2VN4A 1C1EL 1IEAB 3EGDA 4YGVA 3B3BA 3I9PA 1I9JH 1FFOA 2VDML 3MODL 2KHAA 4XPAH 3QJQB 4M4PA 2P7TB 4A63A 5D7SL 1KY6A 1CL7H 2ICWA 2W9DH 2FUTA 1JRHL 2VUKA 2P46B 3DGGA 1UD6A 3I6KB 4JO3H 2AEIT 1OB1B 3NJHA 5J11C 5CR1A 4PJ5E 5E6SB 4LCWA 3SGDH 2W94A 3LKPB 5KYYA 4I77L 4R7XA 2A6KA 1IX2A 1P4UA 4ETQB 4FNUA 3REWA 1IGTB 3F83A 3P9MB 3RDTD 4YHOH 3HJEA 5IG7B 5C0BB 4DKAA 5IESL 2LE9A 2HT4D 4JZNB 4JR9H 3QNXA 1KIQB 3ZE0E 4OB5H 3GSRA 3MJ9L 3WFHB 6TAAA 4MLIA 1LQBC 3WJJA 2BWQA 2GJ6B 2YHGA 4NWTL 4OY9A 2F5BL 5D8JL 2MCPL 3FSAA 1IGJB 3SBWC 3SDCA 3ZHNA 3DK0A 4NM8L 1J0JA 1DBKL 2NTSP 2F68X 5D1ZB 4F15B 2N56A 3VFWA 5IVOA 4ZPVB 1LTXA 2XNAB 4OFYD 1FF5A 3RWJA 1S7UA 1AXTL 4WNJA 4GAGL 4XBMA 4FXKA 4HEPG 2BINA 4M6NL 3PS6A 4GT0A 3FQXB 2HFTA 3CSPA 3KYOA 1EHNA 1PSKH 1R3KA 4NQVB 4XPHH 4X9FA 1RZFL 4N5ED 4XCNB 5C09E 3PAVA 4X5WA 3LOWA 4DTGL 4LSSH 1RJZB 1XH2A 4HKBB 2HP4A 3PHQA 4QYOB 5L2JA 1XZWA 4Z9KB 1S9XA 4A66A 4JQVC 5B7EA 4X50A 3D39A 1RP8A 4KK8D 4ZMPA 1YEFH 2PF6A 3CD4A 3FBQA 3CZUB 2FLRT 4KQ3L 5HYQB 3ECQA 5DO2D 3VFGL 1Y0LB 4ODWB 3HS9A 1RIVH 3DKHA 5IVXB 2QPSA 4JY5H 1M7IA 5E6YA 3ZYOA 3PWVB 4IKJA 3R4DA 4JM4H 2HJLA 4KNQA 4JREC 1HYRC 3KLAB 4N1CA 4Z76B 4LLMB 3IT8D 4HH9A 4HPOH 2GFBB 1L0YA 3T0EC 3BEWB 4KTYA 3U2IA 3WKQA 3I74A 2P5EE 2CDFA 1MJ7L 4BZ2H 5FKAA 4OTXL 1U9KA 4RQQA 4DKEH 4Y4HD 3EYQC 1OAUH 4UIKL 3WN6A 3GXFA 3SDDC 1DJYA 1SEBB 3HHSA 3H4HA 3ETTA 1SJVA 3F5WA 2YBRB 2Y4SA 1WQVT 4KKAD 3ZE1B 3HNVL 4Y7OC 1OW0A 2HJKB 2VDPB 3SYAA 4P2AA 3V4VB 4EIGB 4FYSA 4PRBB 1WAEA 3SODB 3L17A 3T65B 2Z92B 2WXIA 2OMZB 4AE0A 5JOFA 3KPNB 3SKMB 4Q97A 1U6AH 5A3IC 3RYMA 4KNUA 1KLGB 3H54A 3BP5B 1L4IA 4ZS7H 4E2OA 4PJ8D 2RHEA 4PJ5A 5CZVH 4E41B 3H2WA 1GGCL 1CLOL 5BOZG 3OB0H 5K1VA 4HUXA 1MFDH 4PLOB 2XWDA 4LSPL 4WQOA 4K3DL 2XRAL 3TEYA 2APXA 1A4JB 2WLLB 2NY4C 4PJEF 3BPOB 5ICZA 1ADQL 1U3HD 5H94A 4GIPD 3S3JA 1GZPA 4YSQA 4IMLA 4KUZH 4YDZA 5HHMD 4AE1A 4OV6F 2OL3H 2YPLE 3JT2A 4UQ2A 3DX7A 5IW6B 2P5WE 4P48A 4ONFL 4LCVA 1FIGH 5HGDB 5I8CB 4WEUD 3L9BA 3GC3A 3BXNA 3VFRA 3ARTA 3MV8B 2CWRA 3B83A 3CMOL 3JWNG 1KWKA 5IROD 3RZCD 1YNTF 1SN5A 4AV5A 4Y88A 3WN5C 3WTTA 2WGNB 2UVFA 3CDFA 3RTQA 1XHHA 1QBMH 5CLYA 1CURA 4PWKA 2YJLA 3EHBD 1HIMH 2XN2A 3LN4B 3NG5A 5CD5C 4XMTA 1RK7A 1E2WA 3O4OC 4ZAKA 2BFVH 2NY0D 2KUTA 4G8GA 5DHVH 3CHXA 3LKSA 1XCWA 4R96B 5D2LA 1H9DA 1P7KB 4PRNA 4XN2A 1BJ8A 4EDWL 4PB0L 1TZIA 3MHZA 4AQ1C 3WEOA 2B1HL 4J6RH 4HSAC 4MX7A 3OX8A 3H9SD 1NDTA 4ZMLA 4ADIA 3UYRH 5CUSL 1HX0A 1CU4L 3BGAA 3QUZC 1U8NA 3TNNA 1G6VK 1RZIB 2EIEA 3ZTDC 3N0PB 3ULVH 1AC6A 3QXWA 4YFEA 2VZVA 4ZT1A 3MPCA 5ENWA 4U6HB 5EBGA 1WE5A 1TCRB 3BC9A 1KLUB 1QUNB 2KH2B 1UACL 4KKCC 4Z7UF 3LPFA 2V6HA 2XBZA 2BH0A 3OMIB 4HEME 5D93B 3ZY7A 5FKPB 3WNMA 5F7YC 3BDYL 1EFXA 4TTDC 1ZT1B 2DLFL 4OJDH 4PREB 2ITCA 3IFNL 4P4RA 5D7LB 1PF3A 2A83B 3UABA 3B9KD 2YAHA 2DI9A 2XZZA 2IADB 4BV1A 5C0AE 1LQSR 3T0WA 4Z23A 3FULA 4MCMA 1EMTH 2EICA 4FQCL 1UZGA 3GSOA 3DSNB 3CZJA 5ACLA 3EBIA 1J8HD 1GGBH 3NA9H 2QQKL 2EC9U 3QCUL 2AANA 3BGMA 2NY3D 2PYEE 3RJQB 1DZ0A 4BQ6A 4PJGF 4NJ9L 2QVMA 5FF6B 4ANUA 1M71A 1Q94B 3MRPA 1VADB 3CVDA 2Y5QA 5JHDE 1TYJA 5HHOD 4ODBD 3PL6B 5I24A 2CCLA 2X28A 3C9NA 5DRZA 2ITDA 2QSVA 5E2WL 3K6NA 2QKIC 1DLHB 2WQAA 5CGYC 5E6UB 4L4TA 3HVDA 3DTUB 1KN4L 1AS6A 1X5IA 3DXAD 4GW1B 4I9WD 4NI3A 1ZLSH 1FVCA 4NQCD 4Q9QH 2XQYK 5L9DH 3RI5F 5K9OA 1QRNE 4OM1H 3K5SA 4PGDA 3Q8AA 5EOQH 2W0FB 2PPFA 3N1FC 2YN3A 3P2BA 4XR8C 4Z3EA 5I5JA 5ITBL 2F7RA 2I60L 4V2BA 1BXAA 2Z31C 3ZT5A 1ZHNA 4GIOA 4JG5A 4W9FC 4UB0L 3RGHA 2CSPA 3VA6A 3OZ9H 4KGJA 2PTTA 4ODUA 4WO4D 4HUMB 3E6FA 5DZ9A 3U2JA 3I9AA 1HE7A 2D31A 3U2SA 1I3RB 2A74B 5IEKB 2UZXB 1MY7A 3OPZL 1C16B 2WXKA 2ZWYA 2XQ0A 3WXVL 1OM9A 5D7KE 1UKQA 1BVOA 3UTZA 2OJZH 3VJ6A 1QWHA 5D71L 1WWCA 5ERWA 2H1PL 5K93A 1FNHA 3K4AA 3CHOA 3DURB 3LZFL 2F1AA 1MXDA 1SMDA 4A2EA 1MFAL 1SLVA 3R8BB 4K9EL 1N8OE 1X5XA 1DQJB 2PP9A 5CIPB 3NCYS 4YSUA 3P0VL 2BVQB 3QDMB 4MJ6B 1LHZA 3MR9B 3KW7A 5FCSH 3MXVH 3TEUA 3QQ3B 1OGAD