4ZTEA

Crystal structure of human e-cadherin (residues 3-213) in complex with a peptidomimetic inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
210
structure length
210
Chain Sequence
IPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Cadherin-1
publication title Crystal Structure of Human E-Cadherin-EC1EC2 in Complex with a Peptidomimetic Competitive Inhibitor of Cadherin Homophilic Interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zteA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zteA02
1Q1PA 2QVFB 5JYMA 4AQ8A 4AXWA 1NCIA 2OMYB 2OMZB 1NCJA 5CO1A 4XXWA 3K6FA 3Q2WA 3K6IA 1FF5A 2WBXA 4AQAB 4ZMQA 4ZTEA 5JYLA 2OMTB 3K5SA 2OMVB 3LNDA 2EE0A 4ZMPA 2QVIA 2OMXB 3UBGA 3FF8A 2A4EA 4ZMWA 3Q2LA 4ZMLA 5KJ4A 3K6DA 4NQQA 4AQEA 5DZVA 3PPEA 4AXWB 3K5RA 3LNIA 2OMUB 1L3WA 1WYJA 2OMWB 2WCPA 4ZMYA 3Q2NA 4NUQA 4ZMOA 4OY9A 2A4CA 3FF7A 1SUHA 3LNFA 2O72A 1EDHA 4AK1A 2X2UA 3LNEA 4NUPA 4AQEB 4ZMVA 2WD0A 1O6SB 4ZMNA 4ZI8A 3Q2VA 3LNGA 4APXA 3MVSA 1NCHA 4AQ8C 1ZXKA 4QD2E 4APXB 4ZMTA 2V37A 4AQAA 3UBFA 4ZMXA 4XXWC 1OP4A 3LNHA 2YSTA 3QRBA 5CZRA 1NCGA 4NUMA 1ZVNA 1WUZA 4ZMZA 2WHVA 4ZT1A 3UBHA 2YQGA
chains in the Genus database with same CATH superfamily
5JHBA 1MH5B 5FDYA 3QDGA 4KKBD 2FZ3A 3S4SG 4UWQB 1SGKA 5CBEA 4AC2A 4OVVA 1QWUA 2XXGA 3QG6B 4OLXH 1QA9A 3DOSA 5D93C 4KX7A 3KWVA 5EA0H 1SN2A 3NJVA 4PJBE 4Q0XH 4R96B 1ZHNA 1HSAA 4N2KA 3LSOB 4OQTA 5DHEA 2B2XL 4QNPF 4HUUA 1K4CB 1ZAGA 1DSWA 3ET9F 2JWYA 4RX4A 4C4UA 4MNGA 2GIYA 5E23A 2H32B 5D5MA 2XTJD 4FNPA 4NSKA 3C08L 4WTZG 4UT6L 1YYCA 1EJ6A 4IS6B 3S96B 3KWTA 5G5DB 4L0PB 4NM8L 1U4EA 4JZJC 2ZKHH 1QVOA 4BH7A 1SHWA 3WFHB 2XG4A 3IFLL 3OKLB 4G7QB 4PJ8B 3QH3A 3WFBH 4CKQA 2B8OT 2YIHA 1FZMA 4LLQA 5AVUB 2EUXA 4D0BB 4Y16A 3W82A 3W39A 2VZOA 3VXOA 2GY7B 1KXVC 1HAUA 4QRRD 1FL3B 5F97E 1PBYA 3V7AG 1U36A 2G3MA 5KSAB 1D5IH 2ZYSA 3NTCL 3CBKB 4RWYH 1GAFL 2VL4A 3QUZA 4RMRA 3LZFL 3EYUL 2FIKA 4LDOB 4Q9QL 2O61B 2CWRA 4NAMA 1YEFL 1HILA 4ZJ9A 5DZLA 1HHIA 1UXLA 2NXZD 3N1QC 4YDIL 4BKTC 3U0PA 4MA3B 2OXHB 2XZAH 3K4AA 1HI6B 3HNSL 3SDDC 1SJVA 3QJTB 1VZIA 3QUYC 2DOCA 1TXKA 5IHHA 4IOIB 1Q9OA 4P48A 3VXPA 1CDUA 1AD0B 2CGRL 3DI2B 3QXWA 4NQCE 4PG2C 2LR4A 4V1DA 5EOCL 3VTTA 4DFIA 4J6RL 3OC5A 1A6TB 1UCBH 5JHDE 1JZFA 4LP8A 5I8CB 4NYLA 4MQTB 5E8NA 4ZPVA 3N44B 3W38A 5C0RH 1YJDC 3VXTA 1AQ8A 2OW7A 3VRJA 2HPTA 5DEGA 5DMJB 1PLGL 3DOIA 5JXEA 4JPVH 1A7NH 1UYWH 4Y9BA 4MZRA 3HOGA 1CBVL 2DDQL 1P69B 1GGYA 3S97C 3PQYE 3CIQA 2X4SA 4NQCB 3K2UH 2C7FA 4XB3A 1YY8A 2IPUK 1JVKA 4Y19D 4GUOA 4K9EL 3SKJL 3T8VA 5JHDB 1U8PB 2H5UA 2CR3A 3GHEL 1KIPB 4W81A 4Q89A 3FQTA 3H2QA 1CO1A 1IM9B 4FJYA 4W9FC 3IDNB 3RDTA 2WWNA 4AE0A 5IIEB 1DO6A 1JMXA 1EXHA 4H8HA 1A2YA 1FCCA 3K6IA 2CGYA 1EAQA 3B83A 4ZTEA 3SQRA 3OWEA 4OFQA 3TVMD 2H9GA 4YDLB 2XXFA 3EYSL 3PQYB 4HWNA 3BUPA 2ADJA 2MNWA 2N1TE 2XV6B 3UO1L 3A6BH 4PGCB 5BJTB 2PR4L 4AYDC 5HY9B 1TJIL 2FSEB 1P7BA 2UXTA 4K94C 4JQIA 3OZ9L 3FO0L 4TL4A 4AM0Q 5TD4A 4JO3L 3QHFH 3DTDA 4LSSH 2HKFL 4AT6A 4MAYC 3ILQD 2UY6A 4YXLL 1FV1A 4FMVA 1A6UH 3IDXH 4ODSL 1AP2B 2BRQA 3UCRA 1YO4A 1OPGL 4C4BA 4KAQH 1TLMA 3K5RA 1Y1UA 1K9TA 1XXFC 3FRUA 4HK0A 4MMYB 4YFLI 5H2BA 2IDFA 1CTMA 3X3FL 3L16A 3RA7L 2ZCHL 3CNKA 1UM6H 1WE5A 4YEFA 4LKCB 2G0LA 4X99A 5AW3B 2QELA 4F20A 2YAOA 4MWFA 1J1PH 3VCLA 2NY3C 2JMRA 3I9IA 2FQGA 2WQSA 3KBFA 1G7QB 5IQLA 5A40E 1TNNA 4L3EE 4XBGA 1A6PA 3LQAL 3WUWB 5H4ZA 1CDBA 1FL6A 2FJHA 5DA0B 3GSOA 1VEOA 4X5RA 1T7VA 5KJ7E 1G0XA 2FEEL 4QDGA 3VNZA 2Y1YA 3WY2A 3SDXE 3RAJL 4L4VE 2F7RA 3JXAA 5E99L 1W9XA 1VFUA 3CZFA 2R4SH 1FNSL 3O4LA 3Q2CA 2CO6A 3CXDL 4X8XA 4IIQA 3QUGA 5FF6B 4Q8BA 4TSCH 4G9FB 4DJMA 4B0MM 3HPLA 4KJPC 1SXNA 2V7HB 3TT1H 4XBMA 3CTTA 4L3EB 4PJ9C 5JA8B 3GXFA 1OCCB 2J8UE 4JKPL 2E7DA 5E9DD 5FA3A 2NY4B 3T3MF 4CKVX 3K80A 4BZ2A 1E6JH 1X5ZA 4FDWA 3RUGA 3SDXB 2XLLA 3HLKA 4L4VB 2ZPKL 1INDH 1Q9WA 4W6YB 3Q3GB 4J39A 4L4TD 1HEHC 4JFDA 2R0WL 1TYEB 1C5DB 1KN2L 3KPSB 1G4MA 4Q7DA 3U2SB 2B3RA 3LN5B 1FFRA 1OGPA 2BNQD 2J8UB 2OMYA 3KDMB 5KVGL 4PY7B 1MQ8A 2A6JA 4ZSOE 4FQQA 2MPAL 2BVQA 2PPDA 3N0AA 2BP0A 3LDBB 3PWVA 3HAEB 3OJVC 3IJSB 3VO0A 4U7SA 2CRZA 1RZIA 4P2OC 1F3RB 4XXWA 2D03L 3DARA 3IFOA 2X87A 2DMCA 3VG0L 3O3AA 3WGUB 1L0YA 3OR6A 2WSKA 4N0RA 5DHVB 2WWKT 3RTLA 2EE0A 2K78A 4XWGH 4HFUL 4OSUH 3AXIA 2VNCA 5DJYA 3R0NA 4JDZA 3A4DA 1ET7A 1WAPA 4P4RB 1MDAA 4ZSOB 1JHKL 4MJHA 2UWEE 5CFHA 1PY9A 5BO1H 2ITFA 1NEPA 1S9XA 2EXYC 1LWRA 5EUKB 1F11B 1OWWA 4FADA 1VESA 3Q05A 4XP5H 4CAGA 4M9PA 3ZE2E 1ZS8B 1T4WA 4DKAA 3SBRA 1LP9E 5EDXA 2JKTM 3ES6B 3MUY1 5IMMB 5I76A 2VITB 3O3DA 1X9UA 1X9RA 3AMKA 3U6XS 2VO5A 4HIPA 1NAMB 2XACC 3L3HB 4AYFA 2A74B 4ZFZA 4NM4L 4RGNE 1CZ8H 3HVDA 2CBQA 4FP8L 5ID1A 5IB3B 5IOPB 2VWEE 2Z4QA 2AV1A 3UZEC 4PJ8D 4OM0H 2EDKA 2IDUA 2WWMD 1IQDA 3HLAA 2BP5M 1E9PA 2J5LB 3ZE2B 4ADIA 1I3UA 2PP8A 2DQHH 1LP9B 2QKIA 3OLEA 5I74B 3VFMB 2DPKA 4ZQKB 3E7JA 3K6OA 4HJIA 1FG2B 4P4KC 5D70H 1JDDA 3O8XB 3FFDB 2NOYA 2NY0C 4NJAL 4N0CC 2V6HA 3V6OC 2RGSA 1FBIL 3U79A 1N6UA 4RGNB 1MG3C 3AUWB 2Z3FA 2EABA 1QTYT 4APQB 4MJ5A 2WIMA 1JNHA 4QXTA 1MEXH 4WI5A 3OJ2C 4PS4H 5IKCA 1F4AA 2FAUA 1SN5A 5HDQL 2Z8WC 5K9JL 1HHKB 1JYXA 3LX9A 3U0WH 2JE8A 4KY2A 4JHAL 3STLA 4DW2L 2RQ8A 3NJKA 2W9EL 4J3TA 5KVFL 4N0YL 3ULUF 3ULVH 5I0XA 5IJDC 5DK0A 4ZTPL 4JPKH 2R29L 5LG6A 3AS2A 3OKDB 4C8XA 1R3LB 3KLAB 1EERB 2NY5L 2Y07H 3RILA 2DH3A 2XWEA 1BWWA 1E5AA 1BXVA 3L5XH 4JDEB 3N42F 5BUPA 2CLRA 3VRIB 3DV4B 4O9HH 5DJ8A 2JKNA 5GRUL 1P1ZB 1U2HA 1LWHA 2KZ1B 3VGDA 1BXXA 3QG7L 3TCXA 1JWSA 2ZKMX 4N90E 3CK0L 1RZ8A 1X5KA 4C57C 4JM2A 4DO6A 1M6OB 1IRAY 3D69B 3RY6C 1HNGA 3HC0B 5ESQB 3FTGB 4UOW0 1QBAA 3T1WA 1H0DA 5T3ZE 5E8PA 3OHXB 2OAAA 3SDCB 3BZ5A 1JGUH 1NCAL 3EAKA 1Q38A 4KPHH 2QDWA 2IEPA 4HWZA 1FF5A 3K71A 1PZBA 3JV0A 4YDKL 4E0RB 3ARBA 4NQCD 1NANI 4AGNA 1QLFA 2WC7A 3SGDH 1T4KB 1N4XL 2Z91B 1YEGH 5JHDD 5KVMC 1J5HA 2HTLD 4TYUA 4KOBA 2FH8A 4OD3H 4ZOBA 2KZWA 1A3LH 4U6VL 2PCXA 5HGBB 1IM9D 4QRRA 1SBSH 2D3NA 4OM1H 3FU7A 1KJ3H 3EFDL 2WXNA 4ZS7L 5DSCB 4UOW1 2J21A 1ZPLA 1HTYA 4WSKA 3S37X 1CD8A 1ORSA 4F92B 3MJ8B 2X9ZA 1BDYA 1KBVA 2HWZH 1JV5B 5IP4A 2Y36H 2A77L 3PQYD 4M43H 5T3XL 2ORBL 5D71H 1UOKA 2F5BL 1PU0A 3GSRA 1N0XL 1WTGT 3NFPA 5L9DL 3SO5A 1KLUB 1L5GA 2VSCA 1TZIB 5FM8A 3BHBB 1ET5A 2VSDA 5DHYA 3CDFA 2E5EA 3LKNB 3S48A 2OJEB 4MHHG 3TA3D 3P9LB 3HW7A 2WLHA 4KKPA 4YBQC 1KWKA 2EECA 3UYPA 3QNFA 3P30L 3S3DB 2HLFD 3N6YA 3FB5A 3V5DB 4K3EL 2VQUA 4EI6B 3MOBL 3MLZL 1ZWIB 1T1ZA 2GITA 1CLOL 1MKFA 4U05A 4BZ1L 5EIVA 3PV6A 5JUEH 4X6DE 4GB9A 4AEIL 1BQLL 3ECVA 3E8UL 3HC3L 1M3JA 1RUPL 5B3NA 1R3KA 3OAYK 4NO3A 1F2QA 2YPVL 1BYPA 4ERSH 1J0JA 5L0QC 1MHPH 1WP6A 3BT2L 3ULSB 3FCTA 4MAUH 3V0WH 1CR9H 3DIDA 3H42H 2CO3A 5F7LB 3KYMB 1EUTA 5DT1L 4JZOB 4N85A 4UMGA 1KN4H 2QLVB 2QL1A 4FXKC 2G9HB 5D1QA 1J1OH 3DA0A 5HDLA 3RFRA 3AGVA 3QFGA 3RY5A 4X6DB 1QYGH 3GMQB 3GLAA 5EBWB 5HYIA 1MFDL 1BV8A 5BQ7A 3CAFA 3HE6B 3W2DH 1E4XH 1ND0A 3RVUD 3DHPA 3FTYA 4FLHA 4L3ED 1KJ2L 4YHPB 4JK0D 2YRLA 2NY4D 2FJFB 4PJXA 4X6EA 2D3LA 3UEQA 2AJVH 1KULA 1NBCA 1CLYL 5A16B 4KO7A 4L4VD 1P5UB 1BAGA 1IBBA 3TASA 2DD8L 3FBKA 2R1XA 5HGHA 4RFOL 2GG1A 2NNXA 3C5JB 3S0PA 2JI2A 2IH8A 4NKMB 5IB2B 4BGDA 3EJRA 4PRNB 5D1ZA 8FABB 3KPSD 4MCZA 4O2CA 1G5AA 1NCWL 4AQAB 2ZJSH 5BNXD 4UNUA 5IUSA 5I2IB 4E41B 5F88B 4KDTA 3QDJE 4KUZL 2EVGA 1WICA 1DE4A 1OANA 1J11A 2VDMB 5DK3A 3OR7B 4AY0A 4TVSa 4U0RB 1RZKC 1YZZA 4M1CC 2X3BA 1MOEA 2VW7A 4PRPA 3SBPA 3DROB 4OF8A 3BYTA 3VSUA 2C1PB 2WMPB 5F7DA 3O6FC 3NSFA 5H37G 3IRZA 4M48H 4OV6F 4UU9B 1KGJA 2NXYB 1H15B 2JB6B 1P4UA 1VZGA 2ZX7A 3KPOA 3PP4L 4KHXL 4MMXC 4QRBA 2X9WA 2VZ3A 4JNXA 3QDJB 5F21B 1J0KA 1MRDL 1IC7L 2IJ0C 3F84A 4L1LA 5HD8D 3N40P 2BS9A 5DHVH 4QHNA 3R4RA 4OW6A 4Z9KB 4GRLA 4XP9H 5FHBH 1TTCA 3O4OB 4XODA 1R24B 3TO4A 2LU3A 1IGTA 4XCFH 4CILA 3HN3A 1JRHH 1NGQH 4JN2B 3RGBA 2PW2B 3L5WA 3VB9A 5GZNC 3E6HB 1OK0A 3OMNB 4MD4B 1KB9J 3WKYA 2XWJB 4YAQA 4B60A 5HVWA 2MCAA 1BPLB 3FNKA 3QC6X 4KVPA 1YUKB 4UF7C 4ZXBA 2E7CA 4OGXL 5IZ7A 3FU8A 4OH2A 5C86A 5FCUL 4E5XB 2R4RL 3INUL 2IC2A 3U1PA 4UZGA 1H6TA 1UURA 5AZ2L 2BNQA 3S3PA 1AIZA 1NAMH 3HAEG 2A6DA 3O8XD 4GFXA 4PGBA 3GLZA 2B15A 3F7LA 4HJ0D 4U0QB 4RGND 1TTUA 1EHAA 3HG4A 4EF3A 4DP0X 4APQD 1Z0MA 3BJLA 3PWPA 4EIUA 5LDSA 1Z0NA 1WFUA 4PJFA 4LEEA 4F7EA 4PJ5E 4F7PA 3IJ8A 3BH8B 3C08H 4MJ2A 4PJBF 1E2ZA 3C5ZB 4UT6H 2R1WB 3J07A 2ZYIA 4YSCA 3CFCL 2CBPA 2HAZA 3ZKMC 5DLML 3VDAA 1L6XA 2J1KA 3IFLH 3V0AC 2UYLB 4NQXA 3CFKB 3LH8A 2HUEA 1YNTA 3ECQA 4HUMB 3LSOA 4L1SA 4PJ5B 3N9GH 2NLJA 4FA8A 3V5KA 2OFQA 4DWHA 1UZ8A 2XKUA 4N2MA 5JYLA 3D39A 4FMKA 3T2QA 2NSXA 4HGMA 4L8SC 1PL3A 3ETBJ 4R4BB 3MRRA 4JFQA 2A6KA 4YIQB 3S96A 3W11C 1AKJA 1GAFH 3SDCD 4Q9QH 2CHWA 3LZFH 3TBBA 4BK8A 1E8WA 3C6LB 4HXAH 1BOYA 2LW3A 1KB5L 5A2IH 2Y3AA 2BM3A 1W15A 2YLHA 4NEHB 4YDIH 4ONGL 3QWRD 3WFHA 3OMAB 3QIWA 3BE1L 3OXSA 1CT8B 1JGEA 4N90D 3HNSH 4D0BA 3D06A 3AY4C 2ZX5A 4M93B 5DUBA 2ETWA 3IJYB 4JKKA 3V9EA 1XVSA 1GY1A 4ZYKB 4AVHA 15C8H 3TXAA 2BLFA 3OPZH 5T3ZD 1YNKL 2CGRH 2D7QA 2YARA 3CSFA 1CDHA 1CWVA 4LSRL 5KSAA 5MHSD 2EUVA 4WW1A 4M7KL 5EOCH 1F4YL 3RFZC 3ECBA 4J6RH 1ZGLP 4N25A 4TMPA 2MTAA 3OAUL 4L18A 5B22A 3BWAB 2O61A 1H3GA 2VR8A 5F9AC 2ENJA 1UWXK 4U6YB 1KCSH 4ZO7A 3CLEL 1T6BX 5D1XE 3CDZA 1PLGH 4GS7B 2OXHA 4GYBA 4MA3A 1GS8A 3BAXA 1HI6A 3CHQA 3VH8B 1CBVH 2CUMA 2B5IC 1GL4B 4OCYL 1J7VR 2W81C 4GAJL 4PP1D 3MLVH 2KLRA 4IOIA 1W72B 3GHEH 4HPOL 3Q2VA 4B3VA 4QOKE 1AQDA 1A6TA 5I8CA 2PP9A 4IDJH 5D1XB 4PJCE 1P6FA 3PDOB 1A22B 5K1JA 2VN3A 3SE8L 2D73A 3WBDA 2FYYA 4CDGC 4JQVC 1OP4A 2XU9A 4F9PA 2HMID 3WJLA 2PR4H 1NCGA 1JGVH 1TJIH 1K3ZA 4JR9L 3MJ7B 4K5LA 5C0BE 1EEUA 2WXRA 2P7TB 3FO0H 4JAMB 2EE2A 4S0TD 4XZUB 3GKWL 1LO2H 1EBPA 3AREC 4YXLH 4OZHE 3KW7A 1FPTH 3HG2A 1NBZB 3KCWA 4ODSH 5C7XL 2QSVA 3LVTA 4GG6E 2EVHA 1KYOK 3M17B 5IIEA 3H9SB 1OPGH 3HE6D 5JIIA 4ZBJA 4H44C 1ACCA 4MB5A 5GS1B 3H7LA 5BCAA 3X3FH 3VW3L 2ZCHH 3UBXB 3Q2WA 3DRTB 2AANA 1D2OA 3G6AB 2V9QA 4Z6AT 4A7SA 4H2AA 2GUOB 4NBZB 5BJTA 3UTTE 2VSKB 2JKWA 3GZKA 3JVGC 5ALBL 5HY9A 4OZHB 2QVKA 3FQNB 4GG6B 3SGEI 5DMKA 5AEAA 4ELDA 1OCWL 4P99A 1D2PA 3ESVF 5BRZE 3DSNB 3F5WB 5TFSL 2F7QA 1EZVY 4EZKA 5EEYA 3ZHFA 3JWNH 1QBLL 4TQPA 3JQOB 4U6XB 3LYRA 1EZVX 3D4YA 4IIZA 3RAJH 2JJSC 4RRPA 4E41D 2I27N 1FNSH 1I7ZB 5FAAA 3CXDH 1KEMH 1FSKC 2JKJA 3QQXA 4LVOC 5C6TL 3MRFB 2HA1A 2EDHA 3UTTB 5EO0B 3LQZB 4LKCA 1KLGA 1OLLA 3T6QC 5BO0D 4JKPH 3UTZA 2OMWB 1QQDB 1RVFL 2OTWB 4Z3TA 5BRZB 5C0EB 3VA6A 1NCTA 2BCKB 1JF1A 3WUWA 4KRPB 2XWBA 2NXYD 3HE7C 4N0UE 4W9EC 3BCDA 3QI9A 2ZPKH 4Z3FA 2VZSA 3QDJD 3QQDB 2IFFL 4KKLC 1DBJL 3IBEA 3LNEA 3B2UD 3QPKA 1XH3B 2R0WH 1KN2H 2ZF8A 4PJIE 2J88L 1QFPA 5FF6A 2D4DA 1HOEA 4G9FA 2ATKB 1VF5C 3GF8A 4M1GL 4LQFH 2MMXA 3TYGL 5KVGH 3AU1A 2BSDA 1MW3A 1OAXH 2MPAH 5EU5A 2Y2TA 4DAGH 1IU1A 2DIAA 1GGIL 3FB8B 3RIKA 3BSGA 2D03H 4B53A 2BP8A 3VG0H 2HLAA 4CSTA 3SDXA 2IIJA 4JJOA 1GW0A 4L4VA 3T0VA 1FLRL 3KYNA 5B7FA 1ZJBA 4U1GB 4PJIB 2D7TL 3FRPB 2RHEA 3U30B 4HFUH 2D0GA 4JFTA 3TJHD 2BW4A 3FN0L 5DD5L 2QSQA 3KPSA 1FL5B 1JHKH 1ZVNA 3KLHC 1BJ1J 2J8UA 3NDYE 4KXDA 4EN2A 4Y89A 3MGOB 3KDMA 1YSOA 3FH7A 4PY7A 4S11A 3OB0K 4BBWA 5IF0A 1S9VA 2FJSA 5E2WH 2YXMA 4JFFB 5AB9A 4KTDL 3KNBB 2A9BA 2UWEF 4FQ1H 2CJTA 3VE0B 2Q8AL 1G87A 1TG8A 4R97C 4RQQA 3A47A 5I0ZA 4QCIA 3C5ZD 3CHOA 1AHMA 3Q1EA 4G8EA 2R1YB 4P46C 5I1DA 4J3OF 2XFXA 2FT7A 2P8PB 3OZKA 4I1PA 4U4IA 4NM4H 2V3FA 1FLTX 1TTFA 3KGTA 4FP8H 4MKMA 4WY7L 2OMTB 1LP9F 5ISZE 5AOZA 1SY6L 3LKRB 4A2HA 2W8CA 4GKOA 3T4AB 5F9WC 2CLZA 4Z7NE 1BOGB 4PJ5D 1G7IB 1GPOH 3OMZA 4UQIM 4ODVL 3ZE0B 4ZMWA 4HUNB 5F7NC 4NJAH 3ES6A 1T5XB 3WDHA 1SVZA 5IMMA 1AJ7L 2BJML 4QRQB 2ADGA 1WD8A 4P5RA 4Y5XC 4YZFF 3NJLA 3QZWB 2Q6WB 4XH2B 2NR6D 3KBPA 1NAMA 2Y5QA 4AVJA 3L3HA 1P2CB 1IMHC 4POZD 5HDQH 5GISL 5K9JH 2XBTA 4O2FA 3RG1C 4DW2H 2R7EA 2W9EH 5D7SL 5IOPA 3GTVA 3S8WA 5LO7A 3MLSL 4ZTPH 2R29H 3DC0A 2R2BA 4KU1A 1E3FA 4H5SB 5I1LB 3NCCB 4L37A 3VFMA 2A4CA 2ILLA 2ICWA 2BOCB 3MUUA 4UT6A 4ZQKA 5ACMA 5IROD 1FG2A 1PY0A 5IJKA 1OAYL 4GT0A 3FFDA 4TNWF 2K6ZA 5GRUH 2V3DA 3V6BR 3EYQD 3H3KA 5IMLB 3QG7H 4APQA 3CK0H 4Y5VA 4G72B 1CGSL 5I1IL 1KCVL 4J5VA 4RDQG 2PYFB 3P1VA 4ZUTB 3RJQB 4NGHH 4PVLA 1RZPA 2QPEB 5BXFB 5DD0L 4PRIE 3BUTA 3OKDA 1NCAH 1R3LA 2VDRL 3AWGA 1G9MH 4ENED 4WNJA 1I9RL 4QF1B 5B39B 4JFWA 4NIKB 3CBRA 3UAJA 2OL3B 2XWZA 2F18A 3CV5A 1N4XH 4WEEA 3TLRA 3I3EA 2FQFA 2HP4A 3TU6A 4AOFA 1JNJA 1NMBL 1HC1A 4NUMA 2Z4TA 3EFDH 3WNKA 4B7LA 2IOMA 5D1XD 3OF6A 4FQJL 4ORGA 1M6OA 3D69A 4PRIB 3DMMC 3NG5A 4Y7OC 3FTGA 1KIRA 4HGWB 5C3TA 1CGYA 4ANUA 1T0NB 3OHXA 3T09A 3H7BA 2A77H 2D3VA 2K70A 4LGPB 3AABA 3NJIA 1W72H 2ORBH 4HH9A 5T3XH 3P2BA 2NMSA 5L9DH 4F7CA 2JQZA 3QWRA 5ESAB 4E0RA 1IAOA 1QKZL 3MRPB 2AQNA 3TV8A 4FGMA 4OLYL 5GGSY 3BOVA 2RCSL 2Z91A 4WAFA 2Q7YB 2ZX9A 3DETD 1LD9A 3RWDB 3SPGA 1V10A 3TJEH 2APFA 5ICUA 2BDNL 4Y4FB 1CI5A 3H9SD 3P30H 4P2QE 5DSCA 1R4XA 2C4FT 1XF1A 2YKKA 3KM1A 1MCSA 1CICB 2FRGP 3MJ8A 3JVFC 3MLZH 3MOBH 1JV5A 1CLOH 4BZ1H 2GB2A 2N59A 4HALA 4H26B 5CILL 2NTFB 3NP3A 1BQLH 3SJVB 3E8UH 4OCWL 3VJ6B 3VH8G 3PPSA 4PJGA 2YPVH 3PHAA 5IW3A 1U8CA 2K0RA 1A9BB 1TZIA 1ZSHA 4N2DA 3BT2H 3BHBA 1WISA 2SEBB 2ZXAA 4P2QB 2OJEA 3PAUA 3SY0B 4X6DF 5DT1H 2WBJB 3ZDYF 3EXJA 4H0LC 1JUFB 1MFNA 2BERA 4HEPA 3R8BB 5T5NG 1T22B 3R06B 1SJHA 1YEKL 3BPLB 4HUVB 1ZWIA 4Z7WA 1SUHA 1MFDH 4PHZA 5F2FA 4BKLB 5CZVL 3UTTD 2IMNA 4LSQL 3O6ML 4G8GE 3STBA 3ZBMA 1I8KB 1KJ2H 4N9GB 2ZWYA 1PD6A 2IPTH 4BUHA 5BRZD 3NCBB 1IEAB 3SD2A 2DF3A 1BZ7A 3GHBH 4KRPD 3ULSA 1CLYH 4NHCH 3WV0A 1EAOA 3KYMA 1TDQA 2DD8H 3LZNA 5TDPB 3ZO9A 1TIUA 1KTJA 2G9HA 2MOVA 1XF3A 5IJBC 1A3ZA 2BFGA 1NCWH 4ONHB 2JIXB 5EBWA 3IGAB 4QTFA 4NC1E 1VFOA 1E50A 3C9NA 4WW2F 4KUZH 1NOLA 1PSKL 1CK0L 2AJSL 4YHPA 2W65B 2FJFA 2FJUB 4XN2A 1AGBB 1X9LA 1A1NB 1S7SA 1EPFA 3VB8A 4LOUD 1ZLWH 4MNHA 1PF3A 3QEUB 2ZUTA 5IR1B 3VUAA 5HI5C 4H8PA 1FFOB 2WP3O 4L4JA 3BXNB 4FKHA 1I7UB 3NJFA 2CM6A 3BZFB 3C5JA 3A5VA 2CBOA 4U31A 3NCYS 4KHXH 5IB2A 3PP4H 3P9MB 4PFEA 8FABA 1NCNA 3IU3A 5KSVB 5EBLB 1AZBA 3UTSE 4UAOB 4XPAH 4AJWA 2X1XR 1IC7H 4FQXB 4E41A 1KELH 3MV11 1GYAA 4X8GA 3OR7A 1OTSD 4KI5E 3MRCA 4HZAA 1VKXB 4OZFB 1MCEA 3DROA 1T21B 3DPBB 5C08E 5IQ9B 1WBZB 2C1PA 1LHZA 1B4JH 1S7WB 5GGSA 4Z7OE 2DEXX 4ZOAA 4XPHL 5DVOA 5EIIG 1N6QL 4M29A 3WHXA 4ECNA 2APWA 2CCLA 1U8JB 4WFEE 1H15A 2JB6A 3BQUB 5AW9B 4IMLA 5I73C 1AG0A 3QDJA 3N3EA 2QQQA 4GO9A 1O9WA 2GSIB 2ZP8A 4OGXH 3UTPE 5KYYA 5FK9A 1CDYA 4A39A 3WIFB 1JP5A 4HIEB 5FCUH 3FQWA 3F01A 1ZSDA 2NQCA 2R4RH 3DOHA 3INUH 1I8LC 2C9SA 5JR1L 4XGZB 5AZ2H 5C08B 5SV3A 3FHQA 4Z7OB 4Z0XB 5TH2B 3QWQB 3HC2A 1BLNA 4LPUA 1ETZB 1P9MA 1S7XB 3C6SA 1DFBL 3TOPA 2PW2A 5ICXB 3E6HA 4ZPTB 1RHFA 4U1HB 4LRIA 2AJYL 2XWJA 4JANB 4RDQF 5ISZD 2X2HA 2ICES 4JFVA 5B4MC 3FT1A 5FKPA 5GGVL 9PCYA 3OV6A 4NZRL 2LV4A 5HYSB 1G7PB 4WI6A 4PTTB 3V8CA 3FUFA 5CD5D 4E5XA 3DSFL 5E7FA 3E6FA 4P5MB 5I6PA 4P3CL 2BSSB 2YSSA 3WIIL 5DLMH 5JOEA 1WFNA 4NFCA 3Q8EA 2VQ1A 4LMQI 2HSIA 2H4EA 1IKNC 2I24N 3ARSA 2QTVA 2JI3A 2V9UA 5DVMA 4OFKA 5GGTL 1QI4A 2V7NB 3WN5B 1NMCC 2NUTB 4OGQC 4AUJA 2Y23A 2BW5A 2JSFA 3US9A 5C71A 1F4HA 1Y6MR 3C5ZA 5I18H 5LN8A 4DP1X 4W4OA 2DQ6A 3U6RB 3TNNB 4UUJB 4P49A 5CGBA 1NCDL 1DQKA 4LDLB 3STZA 3L45A 4KQ4L 4YHZL 1LMKA 4NLHA 2E8YA 2V5RA 3TURA 5EBMA 1Q72L 5INDA 4KKRA 3BE1H 1HEZB 3FUNA 1TCRB 3CFKA 3MBED 1S8DA 3REVA 3DVGB 5IM7A 5EN3A 5I66A 2O6PA 2O6EA 3OM3B 3QZPA 5I1EL 1LE5B 2OMZB 2R29A 4UQBA 3S5ZA 1G7JA 3CCHB 3ZR6A 4LSRH 4NWUL 2EEXA 3VI4F 4PRID 4M7KH 4JJHA 4R4BA 4A37A 1H9DA 4NN7C 4YIQA 2NR6A 2OL3H 3OAUH 4HCFA 3EH5B 1ZRUA 1LO0L 4ZODA 3C6LA 1BQKA 3CLEH 3W57A 4N8VB 4RA0C 5DD1H 4U2YA 4YE0A 2VZUA 3WS6A 3FOMB 3K2KA 5DC4B 5BRQA 4NP4L 3Q8BA 1XCWA 5IROA 3GEWB 4GAJH 5DLLA 3IJYA 4FEMA 4ZYKA 1RURH 2A38A 3H56A 4Y4FD 4OCMC 5HGDB 2ZOKB 5T5NF 1CICD 1AZZC 3WNLA 3LNIA 1LDPH 5IOKA 5L8LB 1TVHB 3EOAA 4N9OB 5LBVA 5F1IB 4WO4B 3JV6B 3BUBA 1RZJH 3X1EA 2VR7A 4I5BA 5I6XC 5JPMB 4TNWK 3ALPA 1X4ZA 1OP3K 2YD2A 2Z31A 3BMWA 3GBLA 5B39G 3DBSA 5F6IB 1MAML 1M56B 2QEJA 5FM4A 4BFJA 5BOJA 4P2QD 4PJCF 1GIGL 4JR9H 4KGLA 4AK1A 2L0DA 3TCLB 5BZDB 2IWGA 2WBJD 1G1YA 3GKWH 4PRDA 2YA1A 4ZMVA 6TAAA 3L4CA 5D7IF 1NQBA 4KKCC 3IT8D 1WK0A 5C7XH 3O11B 3D4CA 3GT6A 1BEXA 2YGVA 2ZCLL 2CJSA 5DURB 4XVJH 3I75A 2WTPA 4OCRL 3OAWA 1N0LB 3PDOA 2F7OA 4M6OL 3VW3H 1O7SA 2ENSA 3D0AA 1VHPA 4KDVA 4QD2E 2J7LA 4X7SL 1CLVA 4OZHF 5BQDA 3QRFM 4OCSL 3NIGE 5EU3B 5HVHC 3MRJB 1NFDF 1YY9C 5ALBH 2G30A 4P04A 3H1ZA 4O4YL 3RWIB 2L8AA 2QR0A 2P7TA 3QHZH 4BZ1A 5BOZG 3HVNA 3G5VA 3KJ6L 3AWFA 2Z1PA 4ZW6A 4PAZA 4LDEB 1OCWH 3OKYA 2DM2A 2FX9L 2YMXL 3LRGA 5AW4B 1WUZA 5FW7A 1LO5A 2YPVA 4HCRL 2YD1A 2BY1A 2JIXD 5JNYA 2Q0ZX 3M17A 3RVXD 4U1SB 3H9SA 5L2JA 2QVFB 4UNTA 1UOLA 1AR1B 4NO0A 4HIJB 4RETB 1XGYH 3NIGB 4O00A 4J2QA 4X80L 2J6EL 2VZTA 1UXSB 3FCSB 4I18C 4IJ3C 5D55A 4F33A 5C6TH 3UBXA 4YBLC 1J8SA 4RGOL 4NI6A 3SE9L 3G6AA 2XQ0A 3APFA 1FVEB 3NIFE 2GUOA 1OQOA 3EDJA 1RVFH 4PMFA 4N2OA 1WGVA 2K4WA 4GQQA 4U3SB 4GG6A 5LAPA 1BM7A 1ECZA 2GIMA 2HJKB 2QQLL 3AACA 4YHYC 3IU4L 1SDYA 3DSNA 1KJ2A 2HKHL 3U2IA 1HHGB 2EZ0D 3RZCC 2Y7SA 2IFFH 1HDMA 1DBJH 4P9HH 4U6XA 2QVTA 3IMTA 4YHOL 4FQXD 1IGML 1HCZA 1QABA 3NIFB 4WHTA 3BH9A 4AZ8B 4XO8A 2J88H 3VX1A 4DOHB 2IDTA 3BWZA 2V8MA 1MCDA 4YGVB 4ONFH 2OJZH 2LFEA 3NABL 2VAAA 3NCXA 3TYGH 3EBIA 5DYFA 3PAVA 3HHSB 3BPCA 3NFNB 5D1ZI 5A2BA 4K07A 5EEXA 4ELMF 5F96H 3HI6H 4QWWD 5EU7C 5C0EA 1GGIH 2WN3A 4HSQA 4W9LC 2BCKA 4E9XA 2ODIA 4LP5A 3UTSD 3ZUNC 1FAIL 2X89D 3BQUD 2J5WA 1TJGL 1FLRH 5IBLD 1MW0A 4GI8A 4H20L 2CK0L 4X98B 4Y2OA 5J9PB 3KGRA 4OZFH 3WO4C 1XH3A 4YBHA 3FN0H 5DD5H 4YGAB 4BE5A 5D2LF 4HKXA 1UXMA 5C08D 1N68A 2ATKA 1AXSB 2W9DL 4B95C 2HT3D 4XN8A 2K6YA 4IU3B 4UB0L 1OGTB 1X44A 2G3XA 1J9QA 1I75A 2ZOUA 3C5XA 4WFED 4FNTA 3W1ZA 1R1CA 3HG1E 1FRGL 1MPAH 2XIBA 3UTPD 2BH0A 1LO3L 4LCWE 5EO9A 2Q8AH 5FLVA 3Q7JA 4OGYH 4NZJA 2WW8A 5E8OB 4NRYB 3INOA 2EIKB 3KPQB 1H3TA 4PJIA 3FRPA 4EDXA 2BIIA 1UD8A 4DO4A 4WY7H 1LQBC 3MOQA 1N5AB 3QNYB 1BJ8A 3ZE0F 1ODUA 3RPIB 1SY6H 3BAEH 1HIML 3HG1B 3MGOA 4TNEA 1ZLDA 4A2DA 4A7TA 4BSJA 2QGDA 4ODVH 4LCWB 3OX8B 4W9HC 4J2XA 3BSZH 2K7PA 1ID5I 2Z8VC 3OTTA 1IAIL 2W1NA 4JFFA 5IMOA 3V6FB 2CG9X 2GSMB 1OOAA 4ZQTA 3LZLA 1AJ7H 2UUDK 2NYYD 1XV8A 2J8HA 4NLAA 4G3YH 2YXWA 2OCFD 2VDQL 4HKZB 4JO2L 1WIUA 1IM3B 5C0AE 3T0WA 2YJQA 2K3HA 4Z7NF 2AQTA 3C6EA 5GISH 5AKRA 2CO4A 1LEGB 3NQKA 2OMTA 5DRWB 2ZWLT 1F3JB 3DVFA 3US0A 5T1LD 2GJPA 5HYFA 4AMKL 1DVFA 3EH4B 1HQRA 3LPOA 4K3JH 4ODBD 1ANUA 3IJHB 4GKZB 3QZNA 5EO1B 4YXHH 2HT4D 5GXBB 5SX5K 1WC7A 1RZKL 3OWRA 3FTVA 2XWRA 4LGSB 1FH2A 1MCRA 3SODB 5C0AB 2YFOA 5I82A 3MXWH 3WXVH 3LZRA 1HKLL 4Y1AA 3K1DA 3T77A 2VQ4A 1OP5H 3QZWA 2Q6WA 2BHYA 2YAEA 5I1IH 5T1KA 1NINA 1KCVH 5DHXB 2AV7A 4EAEA 5K5YA 3IS1X 1P2CA 2H8PB 1CBJA 1A9EB 3B9KB 3LEVH 4WU7A 2CIIB 1YQVL 3BAIA 3DECA 4Z7VF 4FE9A 5JXEC 2W07B 2BY3A 5DD0H 2AEOA 4HMCA 1H6FA 4E9WA 4H5SA 4NUJA 2A9ML 4IMKA 4YLBA 4CBZA 4QIRA 1ZT1A 2P48B 1I9RH 1X9QA 2B16A 1DJYA 3PAYA 5ICZB 2FX7L 1K6QH 4L5FE 4N2NA 4DVBB 3MLYL 3D25B 5SV4A 3LKQA 3PWUB 5AUMB 1P6WA 3GXPA 5IMLA 3RDTC 5FDWA 1NMBH 2HTKD 1MVYA 3P02A 4WO4D 1Y18B 5J1SC 3LXBA 2NDGA 4L3AA 3KBHE 3BZ4B 3RVWD 5BXFA 1QO3B 3EDKA 3TONA 2XNAA 2W38A 1TQVA 4HS3B 2BK8A 2EDWA 3HUJB 3N50A 4WIQA 3H55A 1U4FA 43C9B 4PCYA 2APXA 1WZKA 1WG3A 4QF1A 4KHTL 3HMWL 5IEKB 2FBOJ 2E9GA 1QKZH 2OL3A 1TZGL 4OLYH 5FOJA 2RCSH 2X3AA 1I1RA 1MF2L 4KJWC 4LPXA 1NEZA 2OCCB 3LXCA 1D5RA 4PJ7A 5DURD 2DWTA 4KX9A 3CHRA 1UB6A 4MQ7B 2ARJB 1S2EA 1MVFA 3Q8AA 4HGWA 4EZJA 1T0NA 1ZA3A 3L3GA 4I48B 2WHVA 2DWDB 1RHHB 5EU6E 1CXLA 4NO2B 3VD3A 5I0YA 2CO1A 2DTSA 3GIZL 4JDVB 4L29B 5DVLA 4NT6B 3MRPA 1T0MA 4BFIB 1DQLL 1KCLA 3SGDI 4HAFA 1MLBB 3CG8A 4PSPA 7PAZA 2Q7YA 2Z1KA 1NKOA 4Z7UE 4YSOA 2VW6A 3RWDA 1HCYA 1OCZB 2LE9A 1AQHA 5HYQA 3P0YL 1FHGA 3VFPB 4M3KB 1A4JB 1AR1D 2NZ9D 1FZJB 3V79C 4Y2DB 1V3KA 5EU6B 2GVYA 1YEKH 4IIQC 3TC9A 4LSQH 5B8CB 3T0EC 3O6MH 4H26A 2E6JA 4MJIA 2NTFA 4UIMB 4MGXA 3VJ6A 3SJVA 3Q6GL 3KLLA 5CMAA 4M03A 5JIMA 4DEPC 4HGKC 4ATTA 5B1JA 1A9BA 5JQ6L 2VXQL 4FNLL 1JIBA 1PTZA 3GMOA 2SEBA 5FA4B 5GGUB 2FEJA 4JPWL 4D7BA 8CGTA 4AJ0A 2Y1AA 4XN4A 4JFUA 3F65A 3QORA 1F6LL 2B1OA 3DJZA 2AAAA 1JUFA 2YXVA 2VXVL 4OGAD 3VQLA 1T22A 3R06A 1K2DA 3ARVA 5I15L 4HUVA 4TV3A 3PJNA 1A6VH 2YUVA 4BKLA 1EEZA 5HPOA 2AQQA 5EG6C 1IFRA 3K0YA 1PSKH 1CK0H 2AJSH 3MRBA 1OWRM 4QTHB 2APSA 2FTAA 3BUQA 3MRMB 1RJZB 1IEAA 3DYOA 5FECB 5F0PB 1ZVYA 2WXQA 2OV0A 1I85A 3U83A 3DURB 4AQEB 3ZDXB 1QRNB 4QGTA 5TDPA 3N41B 1RP9A 2BS8A 2IF7A 1TUPA 2QPSA 3L3OB 1E7UA 1KTKE 1WZAA 4WI7A 1P7KB 3PIQB 4UOZA 1Q0XH 3F3HA 3WJMA 1E65A 3O6KH 4MJJA 4ONHA 2JIXA 3WKPA 4CC0A 5KAQG 1VGKA 3TBSA 4EIGB 1YAIA 1BVZA 1E4XI 1JFQL 2EYTB 3VFOB 3LB6C 3BEVB 4LLMA 2LVCA 5HJ3B 2YMTA 2W65A 1PYWB 2X41A 2RMNA 1AGBA 3KVQA 3M86A 3F7VB 4X4YB 2VRKA 2XZQL 3QEUA 4JZNA 5IR1A 3OL2A 2BIOA 1FFOA 2NNRA 4XPHH 2ALAA 3BXNA 3RGVB 4L0ZA 1DQJB 4AX3A 2VXTL 5IEHB 3BZFA 3EYOB 3S34H 2P42B 4M56A 3DUUB 1IO4C 3MCLL 4KI5F 3P9MA 3VYNA 1TQSA 3ZZLA 4ELKB 4LLYB 5EBLA 1JZ6A 4V11A 3HG1D 4HEME 4Z7OF 1YECL 2QKIC 4FQ2L 5FO7B 1FWXA 4NXKA 2AC0A 2NSMA 5JR1H 4LCWD 1P5VB 2VXSL 3MYJB 4X9HA 1HNFA 1AGEB 1PDKB 2XQBH 4JFYB 3HZKA 1QHPA 4J3XA 4P3DB 4DQOL 4OZFA 5LJYH 5IB5B 1J8HE 1FG9C 4PJXF 1T21A 3DPBA 1H3XA 1N7MH 1BWMA 4QJ4B 1DFBH 1S7WA 5EOTB 1JPST 3NOIA 1IM3D 1NL0H 4GQPH 1YN7B 3CN2A 3TEZA 2ED9A 3SPCA 5EZPA 4C59B 1U8JA 3P3TA 4GUPB 4QUOA 2PPFA 2P5WA 3HB3B 5GGVH 1COBA 3UPRA 4ZD3L 3D52A 1F56A 4OIBA 3H0TA 1AIFB 1KYFA 2CE6A 2K3TA 4P3CH 5FLUA 4H1LH 4U33A 5C0ND 3WIIH 1J8HB 2Q2LA 1JJUA 2VDQB 4R7NA 1JGDB 4H0GA 4OU3A 1DHKA 4XGZA 5C08A 1NJ9B 4PBDA 1JNLL 2EDYA 3KPMB 3ZKXB 3IFPB 4TNFA 5C0AD 4PLJD 4Z0XA 5I9QB 1JRHI 1BBJB 1ETZA 4N2BA 4PGDB 5ICXA 4LOVA 4PGJA 3WXWL 4K71C 1SY6A 4JANA 4JM2C 3VG9B 3B9KD 2XTJC 3EJJX 4F8TA 3FBQA 4WHDA 3GHPA 5HYSA 3BSZA 3LNFA 3OKOB 4YSEA 1G7PA 4PTTA 4UTBH 3S8FB 4NAJA 3WO3B 3M7OA 1OK8A 4KBPA 4P5MA 4GUQA 2F1EA 4X5XA 1DBKH 2E7LA 4YHZH 3D2TA 2FE0A 4RWHA 3SOTA 5B38B 4KK8D 4NOBA 5LGJB 1Q72H 5IQ7L 4PI2A 1N5YL 1K85A 4ZK8A 2DL2A 1XSJA 5AVWB 4ONOA 2X7LB 1BZ9B 2X28A 3WHE0 3G5XB 5I1EH 3CFTA 1MY5A 2V7NA 4PB0L 3WN5A 4G1EB 3ILEA 2NUTA 3D9AL 4JW3A 3PL6B 3DVIA 4NWUH 3VXRE 3WS3B 2OYMA 4WUUA 2ICWI 1WCQA 3EOTL 5F0LB 1ZVSB 1LO0H 3U6RA 4G7SB 4CW1A 3TNNA 1FNLA 1OSPL 5E2UL 4JDTL 1B0RB 5CJBA 1GYVA 2NXZC 4AEFA 4HPHA 4ANVA 1ZS2A 1JZIA 2P26A 1LDSA 5KS9F 1HEZA 2SODB 1TCRA 1YYLH 5LNEA 3WHE1 1CCZA 2ZG2A 4NP4H 1DJWA 3KWXA 3VXRB 4Z3GA 5EUOB 1AO7B 3QRGL 3DX4A 1LE5A 2OMZA 1AXTL 1MCWW 1S7TA 1QSVA 2WZPD 3CCHA 4KZCA 4Y9FA 3GMNB 4GT7A 4L5FH 2ZONA 1CFSA 4HS6B 1NFKA 1MCKA 1FZKB 4FFTA 2CK2A 3GSNL 3DX1A 1PLBA 2LFGA 3S36L 1L7IL 4DP5X 2FBRA 4NDMA 4A7QA 5E4EB 3B1UA 1F8TL 2IV8A 5F89B 4MMZB 4OFDA 3K5SA 5K59F 3H6JA 4N8VA 4FQIH 5ENWB 4KRLB 3SQOL 4F7MB 4OV5B 1BM3L 1MAMH 2N1KA 5HHOA 3HS0C 3EGDB 5EV7A 4KY1H 3BEWB 2DYRB 1A64A 3QPQD 1GIGH 2A0LD 1FIGH 4X83A 4YDNA 4GSUA 3VMPA 3W37A 4C47A 1YNTF 1AH1A 3NJXA 4DK3A 2HFFB 3COOA 3LHPL 4UI2A 3N1MC 1R47A 5HGDA 2ZOKA 4Y2DD 2R0LL 5EU6D 5AWNL 2D8KA 1CD1A 2ZCLH 4JFZL 4YO0A 5AVVB 5F1IA 4EQ2A 4Q97A 3JV6A 5BMFH 4OCRH 3T3PE 4JHVA 1TLKA 2Z7WA 3AXLB 4M6OH 4KXCA 3TVMC 1BYOA 2UXGA 1ZANL 2LVEA 4JJ5A 1E4JA 4OCSH 1W0VB 4KK5D 1C5CL 1U8QB 3DIFA 2ZNXA 3S98A 3IBOA 1D5ZB 4WV1B 1L3NA 1OTUD 4O4YH 2VUKA 2Y0SA 3KJ6H 4XC1L 2PW1B 4KZDH 2H6PA 3B56A 1TTRA 5HDBE 3ILQC 1U8IB 2GTZB 2X2UA 1IUZA 4GP8B 3ARDA 3L3KB 3O11A 4HCRH 4DVRL 2YGNA 3LKOA 5DJ0B 5KAQF 2KDGA 1JXGA 4LFHG 4KVNL 3IGUA 3GIVA 1MSPA 3QWOB 4KDTC 5F3BB 2WP3T 5JORA 5J11C 3MRGB 4L8DB 5GZOD 2DWEA 4RFEA 2L7JA 3UG5A 1BW8A 1SXCA 4RGOH 3SE9H 4ZS6D 3RZWA 5GGVY 4M5TA 3QO1B 4Y9CA 3EZJB 3PS6A 5HDBB 3FC8A 3LAFA 1WO2A 3TBWB 2AJXL 4HIHA 5JXAL 1PCSA 4FF9A 1QRND 1X5JA 4LHUD 3RPKA 3RX9A 3RWIA 3ZDZE 3MGTB 5I17B 2WQVA 1U8LB 3LPPA 2B77A 2QQLH 2ZUSA 5KJRL 3IU4H 4RAUA 2HKHH 3FYIB 2WAHA 2L04A 1N3NB 3NIFF 1I8IB 3KLDA 3ZW3A 2EINB 5D72L 2VCOA 3ARRA 4W9DC 5BVJB 3D33A 4M5ZH 1A1OB 4PGEB 3SDDA 1FNFA 4HIJA 4EI5A 3FFCA 4Z76B 3QPXL 1ONQB 4NPYA 1A7QH 1IKFL 3QUYA 4GRLC 1UWGL 1FO0L 4JRXA 1H6EA 3NABH 3ZDZB 1E5UI 1I8MB 1V7ML 3O45B 1FYTE 1GZHA 1FQ9C 2UXVA 3UACA 3RGVD 5CLZA 2X44D 4W6XB 3V5HA 1Z32X 3GK8L 2HJKA 2YZ1A 1AMXA 3CSTA 1FAIH 1TPXC 1BECA 1DVSA 5IG7B 4LNRB 3V9FA 1B2WL 1TJGH 4OKVA 2G60L 2XIDA 3BESR 1HHGA 3EJYC 4XMLL 2FEEI 1WS8A 3AJ7A 4H20H 2CK0H 4H7VA 1G7MB 5DFVD 4GW4B 2K7QA 3JT0A 4WCYH 4AZ8A 1DVQA 1FC1A 1XCXA 2OYPA 3RWFB 3J2PA 5DJDB 2XIIA 1U8KA 2YAQA 1FNAA 3WY4A 3C2SA 4U1MB 4YGVA 1FYTB 4JVPA 2DQGL 1DQTA 1J48A 3QAZC 3LXUX 4FQPA 2UY7B 4GRWE 5C70A 2XTLA 3IVKB 3L17A 1FRGH 2OBGA 4LHUG 2WIIA 2MCG1 4PJEA 2WYHA 5DJ6B 4AXWB 1LO3H 1RIVL 3IKCB 1EZSA 4MASA 3HB3D 3UZVA 2WBWB 1M6UA 4X98A 3FUKA 3D0LA 4XXDB 1DVTA 2FJGB 1W0WB 3IEAA 4JO1H 4YMPA 2QQKL 2ZSVB 1J8HD 3IJ7A 2FX8L 4GRWB 3ESPA 2AZUA 1LEKB 1HIMH 1AXSA 3EOBB 4MAYA 3OXRA 4IU3A 3M45A 3ZTJH 1ZA6B 4ZZFA 5FGSA 5HI4C 1E6OL 1IAIH 1NOAA 1GJUA 1T2QL 3L5IA 4PG9A 1KPRA 1RJLB 35C8L 4UQAA 2PUQT 4BCZA 1EFXB 2EYSA 2VDQH 4HBQA 4JO2H 4U7KA 5A2CA 3JBG7 3KPQA 1I1CA 4GG8B 4PHXA 1RZFL 2F0CA 5KW9L 2CH8A 2X09A 3LRSB 4LU5L 3VXQA 3ZUCA 1BJMA 4QHPA 4HVBA 2X4OA 3QNYA 4PJ8C 4FJ6A 2WWMC 1BMGA 3QIWC 4JKLA 5DS1A 3RPIA 5AYUH 3HG1A 5CF3A 2IBGA 4XPTL 2XQYG 2HVJB 2PXYB 1DBAH 4MXQC 2E46A 1RZKH 3OSVA 2JF1A 3HKFA 3QRBA 4RAHA 2J4WL 4RRPM 2NY7L 4FHKA 5GS2D 3V6FA 3PCYA 3PL6D 1J8KA 5KSAC 4OZIE 3IDGA 1HKLH 1KTRL 3QQ9D 4FFYH 4H1LA 4NZTH 1GMEA 3QEQE 1KDJA 3TA4D 4PMEA 1IM3A 2R9HD 1MJ8L 3ZKQD 1M9SA 2F61A 2GHWB 4M6NH 1OY3B 3JTSA 5BOPA 2DEWX 4FNRA 1IIIA 3PNWA 4LEOA 5DRWA 2QGCA 5GGTA 2DMKA 1AD9B 2NUPB 1ODAA 1QSFA 3PF2A 3VFNB 1GSMA 2A9MH 3IJHA 2DWSA 5I26A 1Q9LB 3BKYH 3OGCB 4MLIA 5EO1A 5AB1A 3VXRD 2E0PA 5J3HD 4OZIB 1UUNA 1PZDA 1RU9L 2FX7H 2CA3A 3QEQB 3FT4A 2CD0A 4UV4L 2HJLA 4FS0A 3AWEA 5C0AA 3TBYB 4BQCA 3D07A 4DERA 3FQYA 3AGWA 1KCUL 2ZF9A 3QFDB 4NNPL 2H6UA 1HX0A 4Q58C 4B9YA 1XD0A 2V9RA 1A9EA 3B9KA 3FQXB 1KXQE 3IJ9A 3N91A 5GRXG 3D50A 4PJDB 5KJ4A 2DH2A 3EFFA 2Z35B 1KWGA 2DMBA 3T1FB 4IBWA 1WCBB 2G3NA 2W07A 4P2OA 1FNGA 2H2SD 4CMMA 4AC4A 5AVZB 1TU2A 2WZ5A 3FAXA 5J5EA 1CG9B 3Q0HA 4KHTH 3HMWH 4G7VL 2BXYA 3KD4A 1TZGH 5ALCH 3F7YA 4DTGL 3WTXA 4EZMA 3FUDA 1KPVA 5CSZB 2HTLC 2PNDA 4J28A 1MF2H 3PWUA 3ATFA 4K55A 1CN4A 1M7XA 3UYOD 3ZMEA 2A9DA 2QMJA 1F4XH 1M42A 4M4RB 3RNKB 1Y18A 1NIEA 1LMIA 1S7QB 4X4XB 5JIQA 1ZE3H 4YDLC 3RHWF 1DJSA 1QO3A 2MOGA 3FT3B 3MTXA 4HS3A 1URZA 4YSDA 1JCVA 3HUJA 4BRVA 1VFAA 1R3IL 1GGTA 5IEKA 2X6VA 4G6JH 4B6ZA 2VTFA 2EH8H 4WDIB 1DQLH 3NIDF 4XN9A 1VIWA 5G2NA 3A23A 6FABL 1OP9A 3NZHH 3X11B 2P80D 5DJZA 2XVBA 3Q48A 2MHAB 3PJSB 1I53A 5F9DC 2VO8A 2WZPA 2NY1B 1T1YB 4QYOA 2ARJA 4Z5RB 5LHDA 4NO5A 4CN4A 1J5DA 3UGXA 3WDJA 3MFFB 2WLIB 4Z7UF 3OAZK 4I48A 3V6OA 5L6YL 2X4QB 3Q6GH 4U1IA 4NO2A 3ZTDC 4JDVA 2R0KL 4L29A 4L3FA 1K5WA 5JQ6H 2VXQH 5DUML 3UP6A 5DQ9B 1AGDB 2B3IA 1FFNB 2ZXGA 3QI9C 4U1JB 1NFIB 4I0PB 2C9QA 3JYBA 1MWAL 3I9GL 4JPWH 4PWHA 2PN5A 4PS8A 3REWA 1M71B 3WSQL 4BELD 1A4JA 5L8KB 2VXVH 1DBBL 1FZJA 3CQPA 3KYAA 4Y2DA 4EPSA 1MRCL 1EHLL 5I15H 3PABB 1DUYA 1OARL 3MSPA 4MB4A 5E56A 3ABLB 5B8CA 3RVUC 1D9KB 4UIMA 3JV5A 4OKDA 3VXME 2NY4C 4HLJA 4WK2B 2A1WL 4HCRA 1UZGA 3QJVB 4P23A 1FUNA 3BLPX 5AAWA 1BFSA 4LVNB 5DMYA 2VLLB 4WI8A 3ZZ1A 3S35L 4NKOA 5GGUA 3UBXI 3QISA 3L4VA 1DBMH 3BVWA 1KGXA 2FD6L 4MJ4A 3CGTA 3DGDA 4HHWA 4ZOEA 3G08B 4OLUL 4ODWA 3VXMB 4WHYH 1E5CA 1JFQH 1FYTD 1L3WA 2JK5B 4D0DA 5HPMB 2A99A 4QO1A 3FUHA 5E03A 3LDBC 3ROLA 5GZOA 2ZICA 4ZMOA 2CKBB 1I1FB 1UZ6E 3MRMA 4PJGF 2GIXA 1AS7A 3U2JA 2CMRL 2XZQH 3VWKB 1LE9B 2F53E 4PR5A 3L4ZA 3UTOA 5E2VL 5DS8A 3DURA 2ITCA 1QRNA 3AT9A 3GXMA 2EH7L 3DPDA 2VXTH 5BZXA 1LK3H 3L3OA 1MLCB 1QPPA 3KJ4B 2ZP0T 3UX9B 3MCLH 1P7KA 2BCMA 3PIQA 2GK0B 2GJ6E 3VNYA 4M3HA 2ICEB 3RIFF 2VKXA 1YECH 4Y4HB 4Z7WF 4FQ2H 1AACA 4LNVA 5TGBB 3RTQB 5I1KL 1H8LA 5HD8C 3BRDA 4NC2B 5HJ3A 1A14L 2F53B 2VXSH 1ZXKA 3PP3H 2J43A 3EO9L 4JREB 4BXSV 2VXUL 3OMIB 7CGTA 3X1GA 4DQOH 1QZNA 4LLUA 3F7VA 3RWEA 1KT2A 3QEGL 3RU8L 2ZSWB 1EFXD 4PQXA 2X5PA 3GJFB 3RGVA 2GJ6B 3LNHA 1DQJA 3PU7A 2OS7A 3T6VA 4JRLA 1HYSD 2A74C 3EYOA 4QRTA 3DUUA 3FCGA 3R4DA 2YRBA 2B20A 2QPDB 1OAZL 4LLYA 2E27H 4OLWL 3ZSSA 3T2NL 2J5LC 3G6JA 2AKRA 4KI1A 5I74C 2PXYD 1F4WL 4PI0A 1R3HB 5FO7A 2EYRA 2Y7QA 1CE6B 3E2HB 3HPJA 5LB1A 4OF6A 1JNLH 3O8XC 1AGEA 1PDKA 4P3DA 4FXKA 3Q9PA 1KV7A 1J9CT 5IB5A 2B9AA 2V9TA 3OKMB 5C0DB 4RGNC 2VLKA 2ZXCA 2AHIA 2E59A 4APQC 1RPUA 5EOTA 3WXWH 2ID5A 2VWEC 4AYSA 3IRPX 1S46A 3ARGB 5KZCB 1WZMA 5IV2A 4GUPA 1ZHKA 4X9YA 1XX9C 2XI9A 5DYOA 4YSUA 2ALWA 2V5TA 3F85A 3MNZA 2EIZA 4FNSA 3F00A 2WNKA 2PO6B 3GXUB 4MS6A 1N67A 4GKSB 2XFGB 3VU2A 4HUXB 3VM5A 1J8HA 4HV8B 2ADIB 1JGDA 4OFYD 1AGCB 1NJ9A 4O58L 4RSVA 3SYQA 5IQ7H 5JMRA 3QEQD 4FL4B 1N5YH 3KPMA 2VYRE 2W60B 3PPEA 2XN9A 2AQ1A 1JK8B 1PG7L 1B9KA 3BFWA 3MV7E 4PB0H 4LKXB 1KBGL 3BP4B 1U3JA 1UVQA 4LCCB 1WUNT 4PRHB 2AQSA 2J2ZA 3OHXC 2M2DA 1H3WM 3D85A 3KLSA 4LASL 1TF4A 4IQHA 4PY8J 3X1NA 2AW2A 4HWBL 5GRZA 2H3KA 5DGQA 5FUOH 3FF7A 5E2UH 2FB4L 4I4WB 5K9KB 4FFYA 1QSZA 3VU1A 5B38A 1EEYA 4X0KB 5LGJA 2R8SL 4PYHA 2VDOL 1GRWA 1HXMA 3MV7B 1JPTL 4YHIB 4Y88A 1VGEH 3G5XA 4MS8D 2XA8L 3QUMB 4XCNB 3TWCL 2HFEB 2D0HA 1AXTH 3NJJA 4B9GA 3ZTCC 3FSWA 12E8L 1JXJA 3L1OH 3WS3A 4PP2B 2P28B 3WE6A 2KH2B 4OCNC 2F8IA 5INCB 5MI0B 3F64A 3GSNH 3NPSB 5IVZA 3S36H 1L7IH 1BAWA 1UWYA 2P5EE 2F7IA 3NUKA 4MSWB 4OD2B 1F8TH 3D87B 4R84A 2IOOA 1T2XA 4M02A 3SQOH 1N9PA 1BM3H 2ZYRA 1T1XA 4ODHL 3IM1A 5F1OB 1XFPA 4G1MB 2VN5A 2D9QB 3ZRFC 1SLVA 4X7TB 2YOAA 1DANT 3TN0B 5EUOA 1AO7A 3BVTA 4I13B 4LSDA 4PP1C 5IFAH 5MEQB 3BDXA 3T0XA 5DJXB 1E40A 3LHPH 3QC5X 2NY1D 3GMNA 2YC1A 4HUWB 5AWNH 1KOAA 3J27A 2P5EB 4CVZB 4M62L 2XBZA 4HXBH 4JFZH 4TTDD 3NJNA 4A2LA 3LPGA 5I1AB 4EOWH 4Q4EA 5F89A 5AB2A 5I0VA 1EVTC 3K6FA 4PBXA 1ZDSA 4OV5A 1ZANH 2CQVA 5ENWA 1KMGA 2NW3A 2X6CA 2HMIC 1C5CH 3EGDA 5AW8B 2XXMB 1SF3A 1IEBB 1JTOA 3BEWA 4I0PD 4NJ9L 2BRRL 3T3PF 1PW3A 4B9IA 4XC1H 5GIRB 3EJUA 3GGWB 2X2JA 2HFFA 2WKOF 5D7KE 3HR6A 3H9HB 2PCPB 3GBDA 3ZL2A 4HK3J 4J3SA 1AZUA 4ETQB 1RMFL 3P4MA 3PGCA 3QCTL 4KVNH 5B1BB 4GP4B 1IBGL 4XNZB 1D9KD 3WENA 4AKPA 4MNQA 4H0HB 3AXLA 4N2GA 1F13A 3OGOE 3ESUF 2QQNL 1EO8H 3M1OA 1E4WL 1W0VA 4NQUA 3ZY7A 2PYEA 3V0IA 4L8SA 3U25A 2AJXH 3ELAT 5JXAH 4WV1A 3L81A 1H5BA 4Y7MA 4K3DH 2PW1A 3RHWK 5KJRH 1U8IA 1WBXA 2GTZA 4BWTA 1Z5LA 6PAZA 4JL1A 1AHWB 2LABA 1C12B 1PKQE 1XIWB 5DJ0A 3S3JA 5D72H 3VXMD 1XWVA 4QXUL 2VXQA 3QWOA 1O75A 1G7HB 1TR7A 1W2KT 5F3BA 1UQSA 3NK4A 1NMAL 2G75B 2ZTBA 2P52A 5KSBA 4U0RC 2Y9RT 3S3CB 1IKFH 2C3VB 1CF8L 4L3CA 1ZHBB 1UWGH 1FO0H 4Q6KA 1WS7A 4LIQE 4B27A 5FOBA 1SYVB 1V7MH 2M83A 3NGBB 3QO1A 4GIAA 4GNKB 3VWKD 3JTTB 3MJWA 4JQIL 4YNYB 1IGFL 5FYLE 1PKQB 2EKSA 3MGTA 1LK2B 2NXYC 3K46A 1DJGA 3RB7A 1HJCA 3X3GL 4NQDE 2O4EA 1B2WH 2G60H 4XMLH 5E1IA 1N3NA 5GSRB 3ZJAA 4HU8A 1CFNA 1MDTA 1U33A 1RXLA 3LRKA 3B2UC 3CMOH 3CFIC 3WFEL 5BVJA 4Y4HD 4PGEA 3RTQD 2G2PA 1TSRA 1VFBB 4NRXA 4Z76A 4QHMA 1J9TA 1RJCA 2F53D 1HQ4B 1TQCB 1WAAE 1NCBL 1XR9B 2MQ0A 2HG5A 3KLKA 3O4OC 1PZ3A 2DQGH 2MH4A 1NGZB 4NXSA 4TS6A 5CN2A 1IC5L 1P9MC 2DLGA 2H26B 3O45A 4MFHA 4NQDB 3NMEA 1XO8A 4E9LA 2HRHA 4ISVB 2GJ6D 4LRIC 5EPMB 4BYHA 5CLYA 4J3BA 1RIVH 1N59A 5IG7A 2Q5BA 4LNRA 3W0WE 5C6WH 1W0YT 4FZ8L 1G0DA 1OVZA 4HFWB 4GRWF 4OIIL 4AGOA 1L9TA 3NH7H 1GVIA 3TJHC 1G7MA 1NEZG 1L9RA 1VFMA 3NN8B 4ODTH 4OT1H 4A7GF 3RE0A 2EDXA 4GW4A 2QQKH 4UDUB 4OLZH 3S6CA 2FX8H 4PB9L 3RWFA 3GJFH 3OLIA 5DJDA 4CC4A 1XGZA 3KPLB 2AQRA 4U1MA 5M95B 3BW9B 2XY1A 3FF8A 5DVPA 3AREA 2RIKA 2Y22A 1HL8A 2UY7A 3NZ8B 4OF5A 5CUSL 1JK9B 1PD1A 2FWOB 1ZDQA 3W0WB 1T2QH 5FYJU 4BZYA 5EZJB 3S36X 3ARGD 5KZCD 5DJ6A 4DP9X 35C8H 5FYJE 4W9GC 5ERWB 3C5ZC 5AENA 2EICA 3VGFA 1AHKA 4W4OC 4L8CA 1TEGA 3G9AB 2GFBA 4IW4C 1RZFH 5KW9H 5FB8A 2PO6D 1PJWA 4LU5H 2P3YA 4XXDA 2FJGA 2OMUB 1CYXA 3V8OA 2ZSVA 5K1NA 2C3WA 4J23A 1UWEL 3AAZB 3BIAX 1ZA6A 1M7IB 2HN7A 3N1FC 4LSVL 3NBNA 3MNWB 5EZIL 2F68X 3TH3T 2J4WH 4BDVB 1M3IA 3VXSB 1MRFL 3RIFK 5DK2B 2XQYK 3FHAA 3L1GA 4PRHD 4BFOA 2NR6C 1MNUL 5DMGD 1I4FB 1LILA 4ANWA 2YWYA 3ISRA 4JKWA 4W1TA 3U4BH 1KCBA 1KV3A 3MA9L 3C6LC 3LRSA 3RI5F 3TF7C 3MZTA 3QEHB 2WTRA 2MNJB 3DRQB 2LLGA 3MV7D 3WS6C 3HE7A 4JM4L 5AOMA 3WMPA 2PXYA 2FUQA 3AVEA 3MC0A 5HHVL 4CN6A 5IROC 5AD0A 4XNMB 1RU9H 1SJXA 2EE6A 2JCCE 2YUZA 1AS8A 5GS0D 5CWSB 4UM9B 4R7LA 4CNIB 4OZGA 4D8PB 4Z78B 1G9MC 2YAPA 2P8LB 3EYQC 4NNPH 1QI5A 4JG1H 2D0FA 4E9TA 3KHQA 5DO2D 1G9HA 3ASNB 4NNXA 2Y25A 4MTMA 3U4KA 4PD4K 1N70A 3QXDB 1BVLA 4X5PA 4M00A 5CJOL 1ZEAL 4JFPB 1WQVT 3MUZ1 4C58B 4BQ9A 2Z31C 1QLEL 3VFVB 5GS0H 1AD9A 1OGSA 2NUPA 4BA8A 4GS7C 1E28A 5H94B 1LVEA 2UX6A 3S5LA 1ZGLA 2JCCB 3VFNA 2CZNA 1CF1A 4N86A 2VJ8A 4GKNA 5K9QG 1Q9LA 4OZIA 4G7VH 4YJZL 4HT1L 4OFYA 3UZQB 3VFRA 3TN0D 1FDLH 4K15A 4DTGH 4XBEH 5IESH 4XP6L 5TDOA 1HZKA 3TBYA 1HOCB 4OCLC 1FCGA 1FVCB 2P5ED 5EA0L 4LF3B 5IQOA 3EJCA 3NCFB 4Q0XL 5D1XC 2WYIA 2ZOLB 5GJTL 4DETA 3I02B 5I1JH 4NENB 4PJDA 1A7OH 1D7BA 3HFMH 3B2MA 3T1FA 4DCQB 2BVTA 4C83B 1AANA 1IV8A 5TE7H 4KNQA 4QR7A 3H4HA 1R3IH 2VDLL 3NZSA 1J8RA 1CG9A 4UM8B 2FQEA 2P1YA 4DP8X 4P46A 3GSNA 1V3LA 3WEMA 3DETC 3ZDWA 4CRPA 6FABH 1BP3B 2D4FA 1H3UA 2RTTA 3WFBL 4RMBA 3NRFA 4X6BB 2VLRB 3A6CH 5LGYA 3RNKA 2GW5A 4ABWA 2O5ZL 4FTVA 5GS1C 4LBAA 5JDSB 2H3NB 4K7FB 4IGBB 5F7WC 4C54A 3FT3A 3BWUF 3L7EA 1LNUB 1BZEA 2ZG1A 5L6YH 1ZTXE 2DIBA 2HJFB 1D5IL 7PCYA 1ZVHA 4Y5XA 1CQKA 1U3HB 1RUKL 2B59B 2R0KH 5D7KD 1J87A 1VJSA 2I7OA 5LWYH 4LCIH 2DQJH 4WDIA 5I16A 5DUMH 1ZV9A 4BD4A 1JV2B 5IB1B 1BVNP 2FGWL 4GIPD 2DB8A 5EH1A 1ETB1 4JMNA 2ATPB 1MWAH 3I9GH 3X11A 4Q6IA 2K6WA 3WLBA 4KQ0A 2X1WL 3WKQA 1XIWD 2X6MA 3P4NB 4ESKA 1OTTD 1MAKA 1WPCA 5IFJB 3KWUA 3WSQH 1MRCH 4Z5RA 1EHLH 3IK2A 1OARH 3WKMH 2EAEA 2NNAA 4MX7B 5D96B 2GSGA 1J0ZA 2X4QA 4OR1A 4GEIA 5EF1A 3G04B 2A1WH 1UCBL 4XE5B 1CYGA 1UJTA 3GM0A 2J1WA 2N0KA 4AEHL 4KRPC 1XDTT 4TNGA 3S35H 3CVHB 2XTSA 1NFIA 4I0PA 4AL8C 2VUOA 2YQ2A 3P3RA 3SPHA 2FD6H 4JPVL 1M71A 1E9QB 5C2BH 1OT4A 1SXSA 2DQEL 2JKLA 3KVDD 1DSFL 1D7FA 2R59A 3L4YA 4IK6A 4MD0B 2GUYA 4OLUH 3K2UL 3PABA 5I75B 1C1EL 3CSYB 1CMOA 2CO7B 4XOBA 1B0GB 5FYLD 1BEYL 5LKNA 4X9GA 4R90L 1JZEA 5EOQH 1BQRA 4XAWL 1EIBA 3VX0A 4NQDD 3B3IB 2G2RA 4O51A 5FO8A 4LOUC 1KGYE 2R27A 3R18A 4N5UA 3FULA 4MJ6A 2VLLA 4I2XE 4LIQH 4UT9H 4J1UB 5LBGA 3ARFB 5E2VH 2IQ9H 1UGKA 3FHEA 4U1GC 3C8HA 4TVUA 1FO0A 3OJDB 3CZEA 4KO6A 3U30C 2Z0UA 3KS0H 4AZUA 3BLKA 5FYLH 5HYJE 3A6BL 1UZ6F 2ZG3A 4IKKA 3ZHDA 1R5WA 4G6AC 4U1KB 2VH5L 1OSZB 3VXMA 3CX5K 1OE3A 2EADA 4WSGA 4LSSL 1ACXA 4HHAB 3N55A 5IW6A 4IJTA 2RR3A 3O6LL 1A6UL 3CFUA 4I2XB 5BPPA 3GSWB 1OTSC 1R5IA 1UXWB 1DVYA 1I1FA 2J1YA 2VXUH 4P5TA 3W0WD 1U8MB 5AALA 4HISA 1AFVH 3VWKA 1Z9NA 4B0MB 3QEGH 4N2LA 3RU8H 5F9JA 3ZZSA 1F3DH 5HYJB 3FT2A 4JG9A 1UM6L 2EDNA 3SCMB 2XPYA 3M1BB 1FZOB 3ML8A 4YPGB 4AYGA 3FONB 2N7AA 3IJEA 4PUBH 4XPGL 2GK0A 1N19A 5FIEA 4YPJA 4D9RE 1W91A 1X5HA 2EIEA 1OAZH 4N2CA 4OF7A 4R26L 5I5IA 5CP7B 4OLWH 4ADGA 1E9OB 2D2CC 3T2NH 1DFXA 4Y4HA 3T4AC 4EUPG 4M6AA 2CUIA 5TGBA 5AAPA 5CM1A 5FYJD 5I6OA 1NDMB 1ZTMA 5HHME 2CHXA 3DO3A 3APMA 3NA9L 3VXSD 3CPUA 1OSEA 2WQ8A 3EHBB 4XCCL 3ME0A 3GJFA 4CVXA 2GJ6A 3HR5B 1I1AB 3EGSB 2JB5L 1UC6A 3CVBA 3RBSA 4Z3IA 2ZUYA 2H0FA 2BMKB 2VN6A 2DM3A 2DYPA 1NIFA 5FYJH 1E6JL 5IBUB 1IILE 2E47A 3SPJA 4LQ1A 5HHNA 1CE1H 1HHHB 5HHMB 3ZYZA 4C56E 1CE6A 5IQNA 3V10A 4O58H 4XN7A 3ZK0A 5EN2B 4UM9D 5ANHA 2Y1VA 3FQRB 3OKMA 1UD4A 3GM8A 4KTGA 1PG7H 1T0OA 2PMZA 2XCMC 1FA4A 5C97A 3EBAA 4P59L 1TJHH 1F41A 1YPZE 3X12A 1IFHH 5C6PB 1MWOA 4KDWA 2GJRA 2JFCA 4W9CC 4LASH 5GGRB 1H3VA 1NTDA 1NWPA 2ZUQB 4QRPA 4FQHA 4HWBH 4C56B 2PO6A 5CHNA 4HJGB 4G5ZH 4GKSA 2FB4H 3SYOA 3UBGA 3WD5L 3VYPA 2K45A 3CD4A 4HV8A 2R8SH 1RSYA 2VDOH 1AGCA 4XWGL 4AQOA 1OB1B 3Q44A 4JVWA 1BQSA 5ETUB 3CDGB 1HFUA 1JK8A 4PWKA 1QLEB 3WNJA 5DJCB 1UA6H 1CIDA 5BO1L 4LKXA 4M7LL 12E8H 4HCGA 3BP4A 5DU7A 4PRHA 3OKKB 3D51A 5HGAA 5FGCE 2Y72A 2F74A 3S35X 1ZLSH 4CL7A 1QHQA 4I4WA 3MO1A 4Q4IA 2E4TA 1UA7A 2J56A 3II2A 2P46B 4ODHH 2GBUA 3E3QE 2ZXWB 5T33L 1RZJC 4YHIA 5A43C 5DZAA 1VZHA 2CPUA 3GMPB 3RI5K 2C9AA 4XCNA 1Q8MA 4WTWA 4Y4FC 5TE6L 2FO8A 4CADB 4ICXA 3IXAB 5FGCB 2CCWA 2FQDA 4GLRH 4NQSB 4IGBD 2WOYA 1TMQA 3ULUE 3GPSA 1AQMA 5SWQA 5CKAA 1RCYA 4MSWA 4OD2A 3Q9QA 4WLCA 4RIRB 1U3HD 2KUTA 4PJ9D 3CFEB 3ZRCC 5JIKA 2ROXA 2GC4C 2J20A 4YHNB 2UZIL 1MEXL 3KS0J 1EH9A 5B1JC 4PS4L 3VGEA 4ZMTA 5CD3B 3DXAE 1JWUB 4G1MA 4NJ9H 2BRRH 1BPVA 1QLRB 5DR5L 2AXFB 1U92B 4X7TA 4UTAL 2RJMA 3K7UA 2WBJC 1A8ZA 3V6ZA 3ZHNA 2XKNA 4OJCA 2YD8A 1JCKA 1JPGA 2QTEA 3DYPA 4ZTOL 5DJXA 4RBPK 2Y07L 1UD3A 3L95B 1BF5A 2X4UB 5K9OA 2OI9B 1F58L 5F8QC 4HUWA 3BPLC 4LARL 1BZDA 1ZV5A 2C9PA 4N4YB 4Y9EA 2IAMB 2XZCL 1YDPB 3MLUL 3B8SA 1IKNA 3WU1A 1IBGH 2OQJB 5CJ8A 4ZO8A 1F3DJ 1FI8C 1YMMA 2FVNA 3D1MC 3B3BA 3VD2A 4Y5YB 4NQVA 5CGYD 3ZTNL 5HDOA 1ID2A 7FABL 2PTUA 2E74C 3PXLA 3Q13A 5AVSB 1E4WH 4PS7A 3T6XA 5LNGA 2QT6A 2PPEA 1QAWA 2HLEB 2BSTB 1IEBA 2OXGB 3MHZA 2X4RA 1NSNL 5GIRA 4XMUA 4QRUB 2F54E 3GGWA 1T20B 1B0WA 1BIIB 3H9HA 2DMHA 2PCPA 3ALWA 3W5NA 4MCYA 3BPOB 3EYVB 2KQMA 5EB9A 3IDMA 3RVXC 3OAYH 4QXUH 4TF4A 5IUCA 1YN6A 1ITCA 1UH3A 3VD9A 3RLSA 5HHPB 1BX2A 1JI1A 3QCVL 1MWAA 2EXYD 3HI5L 1SBSL 3GXIA 3SE3C 3B9AA 4IEFA 3ABGA 3DGGB 4OM1L 1KJ3L 4P9HC 1QR1A 5E5RB 5HVFB 2WXFA 4WZ9A 2YD4A 1INQB 2F54B 3ARFD 4UT7L 1U2YA 1IGFH 3MU3A 4FN0A 1FN4A 4F3FB 2B7DT 4QRSA 4NC1C 3X3GH 4X5LA 3QYMA 2EZ0C 5JHLL 3O2VL 4PH8A 2LU4A 4ACPA 5I23A 1EXUA 1XIWA 4HZLB 4KX8A 4UAOC 4Z0BL 3WFEH 4YSSA 4HJTA 1X4YA 4L1TA 1C7SA 4WI2A 5IT2L 2WQUA 5KANG 1PG7X 1OAQL 2C3VA 1U8OB 1ZHBA 1XGPB 5D4QA 1SYVA 1IC5H 4N0CD 3KYOA 4QWWC 4DSYA 5HYJD 1BGXL 1K3IA 1R5VB 3SE4C 3SN6N 4PRBA 2CDGB 3SCMD 3LEXA 4ZDHB 1JYNA 3U7YL 1OOWA 5JUEL 3HHMA 3UABA 5TQ0L 1BFVH 1LK2A 3VSTA 4XHJD 5F93C 2CUHA 1L0XA 3BQUC 3D18B 1BIHA 2AEPH 2X0WA 4YSTA 1CXHA 2IH9A 4LAJH 5IBLC 1NGXB 3VFSB 4GSQA 1AOZA 5GSRA 4OIIH 2GKIA 1MG2C 4XAKE 4MAUL 5JPNA 1XF2B 2IXQB 4HOZA 2WOBA 4UT9A 1A1MB 2BVPB 5CCHE 5IJVB 1A0QH 5M7QA 1HQ4A 2WB7A 1XR9A 2C7UB 1NGPL 1CLCA 1D5XA 2HT3C 2X4NB 3UROR 1J1OL 3L3IB 1CXFA 5ANME 1JL8A 1QYGL 4N26A 3EHBD 2H26A 2WTOA 5CR1A 1KTDB 1CD9B 4ISVA 4D9RD 1I1AD 5EPMA 1E4XL 5LG1A 1BHGA 3A67L 1SEBB 2F58L 4G7RB 3QK0A 3MRLB 1Z9MA 4YQXH 3LS5L 4S2SB 5CZKA 1BG1A 5A6MA 1PZ5B 4HFWA 2X2YA 2HUHA 3G5YB 4F8PA 3IDYB 3LJ3A 3I6KB 3NN8A 4WK4B 2FEDC 5HHMD 4EN3B 4UDUA 5ANMB 5C09E 1EJ8A 4F9LA 1RZ7L 2R2EB 3BGMB 3KPLA 1UWEH 2PABA 3GS0A 5IMKB 1SXBA 3QJHB 2R23A 2QPFA 1E8XA 4LSVH 4WTQA 4NHUB 5D6CB 5J89A 2HH0H 3TPUB 3WN5C 3I2CL 3QUXB 2C26A 3T2OA 5EZJA 5BW7A 4HIIA 1TJMA 5TK4A 2JTDA 3GNMH 2FL5B 1MRFH 2BSED 2NYYC 2X4TB 2XG5B 4HX1B 5ERWA 3PAZA 3DVNB 4PN6A 1MNUH 4JBSA 3IAGC 2EVFA 1UM5L 1QWNA 5C09B 4C56D 3MA9H 1CFTA 2MQGA 1QEWB 2OMUA 3PHSA 4L9LA 4JFOB 4KVCL 4IRJB 4ZUSA 1XEDA 2F1BA 3VWJB 3NCWA 5IVXE 4JM4H 3CZJA 5HHVH 2HT4C 2YWZA 4JKNA 3APNA 1LXMA 4DGUA 1IAII 1W80A 3EO0B 4ZFGL 1URLA 3GSQB 3QYNA 1C16A 3VXSA 5DK2A 5IBUG 1T7YA 1BMZA 4R3SB 3X13B 4G9DB 4RFNB 4Y4KB 2JCCF 3BGAA 2E9IA 1NGQL 5CJOH 4A2GA 1QLEH 3BAKA 1FJ1B 5DTFB 5E6SB 2MCMA 1HXYB 1TKWB 3NFSL 4KH2A 3DRQA 2NYZA 3LXAA 1KJMB 1G43A 3HMXL 4JHUA 1YQ2A 4HT1H 1AZCA 4XNMA 4YS4A 5I5JA 6PCYA 4UM9A 2WGNB 4HWBA 4FHBD 4XP6H 2VR4A 4JY4B 1YEDB 3ZHLA 2B0SL 4D8PA 2Z34A 5CCKL 2P8LA 3VXUE 2YD5A 3RL1A 2BIMA 2R2HA 1NAML 1E5BA 2HTKC 5J6HA 4WO4C 1II4E 3MOAL 1YEEL 5GJTH 3TH2T 1ESOA 5JPMC 3BYYA 4WUKL 3V0FA 4H2CA 2F8OA 4OI9A 3RVWC 1WTLA 4DQAA 4LCVA 2NY6C 5F6IC 3ZIYA 3EOYG 3CC5B 5FUCE 5J13B 2IFGA 4XVOA 4P9ML 2VDLH 3E8VA 5D2NE 4PRAA 4U6HA 3DO7B 4G6FB 3Q01A 5E95B 3VXUB 2LU5A 2BSRB 2LAGB 3KCPA 5A2AA 4AKQA 1ZXQA 4XCEB 4PJBB 1VCAA 3MRKA 2PWDA 1GGBH 3ULUD 4JPIB 3ARDC 2VR5A 32C2B 5CEZE 4KUCD 1UWXH 1FVCA 1I7TA 1XMWA 3EZ8A 5JO5A 3QQ3A 2IAMD 3BZEA 1K5NB 1K8IB 3SE6A 4F93B 2VISA 2O5ZH 4BQ8A 3LEYL 4Y2NA 1ETJA 3N9GL 3DTXB 3UO8B 3BDBA 4FZEL 3MAWA 1PS3A 2JJTA 5D2NB 4C83A 4R83A 4JRYE 2BO0A 3TFKC 1FE8H 4DKFL 4WEUD 4R6UA 2H1PH 1RUKH 2K9UA 4UM8A 3JT2A 2L7UA 5FEBA 3O6FD 2WLMA 4TUJB 2C3XA 1QUNB 4AEEA 2FGWH 4HXAL 1YA5A 4X6CE 1Q0EA 1UA3A 4MRBA 3P4OB 1S9WB 1ACZA 1GH7A 5PCYA 3FQUB 3GS7A 1E8YA 1X5IA 3QR2A 1N6VA 4PTUA 3BX7C 2VLRA 4H40A 2IANE 1AR1C 3V0GA 1GTNA 5GRYA 2NZ9C 2CXGA 3P2DA 4EI5C 4JRYB 2EXWD 1HL9A 5JDSA 1MHEB 2NW2B 5A7BA 1G1OA 4JCWA 4IGBA 15C8L 2IBBA 3OPZL 3I74A 1YEWA 1LNUA 4EXKA 4ZFOB 1UENA 2ODHA 3IDJA 4TULL 3WNNA 5DJAB 4HWEL 2F54D 3F7RA 1XGQA 2B59A 3QJRB 1GZHC 4X6CB 5EC2A 2IDSA 1K4DB 1CDGA 3NCEB 3TZVB 4EJ1C 1E2VA 4AEHH 4F27A 1JV2A 1JWMB 1KCSL 4TUOA 3QA3B 2IANB 2IADA 2ATPA 4QY8B 3AZUA 3KW8A 4OJFL 4XRCA 4X9FA 3BRGC 5T3ZL 3LCYA 2DQEH 4Z77A 1DSFH 3NSDA 4MQSB 1ZT7B 3MMEB 4OGAC 4PJHE 3V95A 2LQRA 1B6UA 4FCHA 4YR6B 4XVTL 4BRJA 3B9VA 4E9VA 3MLVL 3FH8A 4MA1B 4O02B 1C1EH 4PLKD 4BE6A 3DX7B 1DDHA 2V2WB 1BEYH 5KEZA 2DICA 2V8LA 4R90H 3G04A 1WRFA 4XAWH 2ZAIA 3WNOA 1IGCL 4KMLB 1WWBX 3WY3A 3ARPA 2J73A 4IDJL 5F9OL 4ODUB 2QLYA 1P0SE 5I8EA 2NX5A 2HCZX 3GBEA 4PY8I 4FABL 4IOSD 4LESA 3VQ2C 2Q86B 2XV2A 2IQAB 1A21A 4PJHB 2XETA 1E9QA 4DFHA 4BM7A 4MA7L 1NWOA 3C5SB 4MD0A 1JGVL 1SF5A 2VH5H 3WL9B 2WLJA 3ZKMD 1PEWA 2OP4H 3AQYA 3LZOA 2CIKA 4PJAE 1LO2L 3CSYA 2CO7A 3TA3B 1B0GA 1PPIA 2P4AB 3BP6A 3O6LH 3WLWD 2WXOA 1FPTL 5F9WB 1L9MA 1IAMA 4JFEE 1XB3A