4ZTEA

Crystal structure of human e-cadherin (residues 3-213) in complex with a peptidomimetic inhibitor
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
210
structure length
210
Chain Sequence
IPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-1
publication title Crystal Structure of Human E-Cadherin-EC1EC2 in Complex with a Peptidomimetic Competitive Inhibitor of Cadherin Homophilic Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 43
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zteA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4zteA02
3UBFA 4OY9A 3QRBA 4NUPA 3MVSA 1NCJA 2A4EA 3UBHA 2OMYB 2EE0A 2X2UA 4ZMNA 2O72A 2OMVB 1NCIA 3LNIA 4ZMVA 4ZTEA 2QVFB 3Q2LA 1ZXKA 4AQEB 4ZI8A 4ZMPA 4XXWC 1L3WA 4NUMA 4AXWB 4AQ8C 3Q2NA 4ZMLA 3K6IA 3UBGA 4ZMQA 1EDHA 3K6FA 5JYLA 4AQAB 3PPEA 4ZMTA 3LNHA 2OMWB 5DZVA 1NCHA 2WCPA 1O6SB 4APXB 2OMUB 1Q1PA 1WUZA 1OP4A 3K5SA 4AQAA 3FF8A 5CO1A 1NCGA 3LNDA 4QD2E 4AQ8A 3LNEA 2V37A 4ZMXA 2WBXA 5CZRA 1WYJA 2YSTA 4APXA 4AQEA 3Q2VA 4ZMOA 2OMZB 4ZT1A 4AXWA 2QVIA 3FF7A 4AK1A 3LNFA 4NUQA 2WD0A 1FF5A 2WHVA 1ZVNA 2OMTB 3LNGA 3K5RA 2YQGA 3Q2WA 5JYMA 3K6DA 4ZMZA 4XXWA 4ZMYA 2A4CA 4NQQA 5KJ4A 4ZMWA 1SUHA 2OMXB
chains in the Genus database with same CATH superfamily
4NXKA 1AP2B 4N2MA 1G7PB 4FTDA 4IRSC 3HRZA 1KEGL 2AK4E 4PBXA 2X40A 1ND0B 5T3ZH 2UUDK 3DURA 5AW7B 5ALCL 1EJOH 1FO0H 2ZICA 3H1ZA 4LB8A 4FFVC 2X9ZA 1G5AA 3CSFA 3ULVF 3B2MA 4JFUA 3U4BH 1FGVL 4PRHA 1AJ7L 2X6UA 4ZW8A 1U8CB 3ZHNA 2DW5A 5CJ8A 3MRCB 4YDLB 1F18A 2Q0ZX 1IX2A 5KOMC 1T5XA 1A6AB 2GB2A 3NIDB 4NXSA 4YDJB 3ZYJA 4NQEB 5B3SB 2DMCA 1CGYA 3G5VA 4KTYA 4Y4HB 1DQML 4JO5A 4R7NB 4M5ZH 4ZPVA 4HW6A 4N6RA 1PFCA 1UM5L 1VKXB 1QR1B 1D7FA 2ERJC 2ZX8A 3KPQA 5BJTA 2ZPKH 4AQ1C 4DO4A 3R19A 2Z65C 3OWEA 3VFRB 2XIIA 4IU3A 1TJHL 1W72H 3KHQA 3LN9A 4LRIA 1ZA6B 2CDEA 3BH9B 1GXEA 4L9DA 5EF2A 2F5AH 4PVLA 4BGLA 2F54B 2KHAA 2Y69B 2PPCA 3IFNL 4LLQB 1RZ7H 5GZNA 2XWCA 2Z4QB 5CJQH 5LDUA 4HIPA 1MLBB 4PS8A 2IJ0C 4LSUH 1AO7E 3APDA 4J2XA 4D9QE 4JVUA 3QEQE 4LGRB 3B7RL 3T3PF 4HGWA 2AEIT 2OJZL 4IK7A 3UZQB 4PCYA 4F2FA 4OLVH 5GS3A 4HV8A 1UJ3C 3B3IA 4LDCA 4FQQA 1FH2A 1TO5A 4XOCA 2IAAC 3NFSL 4X6FB 5JUEL 4WI9A 4W9EC 3S3PA 2CMRL 1UFUA 4EBQL 4E9RA 2KDYA 2AVFA 1XX9C 2EYSB 3KYMB 4V11A 4DTGH 3GZQA 4EOWL 3W37A 4Z7WF 3QJFA 2X1QA 2C4FU 1XSKA 1Q1JL 3OPUA 1AYOA 4EKJA 4NHUA 4YX2H 2EYRA 4B7IA 2FO4A 1MCNA 4PJCB 3JUYA 2W38A 4KKCC 1M71A 4NKMB 2BNQE 4RBPK 4CMHB 3F84A 3DA0A 4HU2A 2ZSWB 3D2UA 3IAQA 3KM1A 4HWNA 5ID1A 4XO3A 4KQ0A 4KDWA 3ETSA 3SEPA 4GW1B 4LBAA 3TV3L 2D9QB 1S7SA 1MQKH 3LH8A 1QFOA 4ORGA 4DP8X 2OSLA 1Z6JT 2Y2WA 2OP4H 3VFMA 3VM7A 2JJTC 4YSAA 2XWRA 4X42A 3VXTB 1PF3A 1JFHA 1Q4NX 5DMIL 4OIAA 4DGUA 3RIFF 2Y24A 2NNRA 4DN4H 1HFUA 1CN4A 4RFOL 3FQ1A 3NCJL 5F0PB 5FF6A 3GB7A 3BPLB 3O6FD 1CGSH 2ENYA 3TBVA 3CQFA 3TJEL 2BNQA 1HU8A 1TFPA 5CINH 2EXSA 4Y1AB 1EMTL 4Z6AT 1RAMA 2OPCA 3PAYA 5FUCE 1IBBA 1QPPA 2W65B 5GJTL 4G6JL 1HNFA 5D7IB 5HGDA 3MROB 1E8ZA 3VFGL 4UNVA 1N0XL 5D1XC 3MZTA 2RJMA 4PJDE 2HFEB 2WIIA 4HWZA 4HS3A 3PJNA 2YN5A 1CGVA 3DTXA 1E6OL 1TNMA 4ONHB 4WV1B 3WKMH 3EG9A 1BP3B 4OBSA 5DJCA 5B1BB 1S5IL 3Q5TA 4Y5XC 3O3BA 2IAND 5TF1L 4KKPA 2NNAA 4N3TA 1BFVL 1EV2E 1MZYA 2XSKA 1YY9D 2G30A 4N4YB 4LDLB 5C09B 5ELIA 1OK0A 3LMJH 2YGOA 2IG2L 3OHXA 1N5YH 3MTXA 3OMNB 1CLOH 3I02B 2KZKA 4GIOA 5F93C 3HE6A 2ITDB 3S7GA 2WBJB 1A4KA 3P77A 4MB4A 4ZNEA 1TTUA 5I16A 4QKXB 3K5SA 1F2QA 2Y6SD 4GXFA 4DKAA 4PJGA 5JPNB 1EFQA 4MAUL 1ZE3H 5E00A 4PJDA 5AZ2H 2UV3A 2FT6A 3QEGH 2X9YA 3DX7A 2AEPH 1CICD 4FYSA 2H6UA 2J6EA 4AM0A 3SPHA 3I6KA 2ZUQC 1LTXA 5ERWB 2WLMA 4PGDB 1YNTF 2DQFB 4ZXBC 5JIKA 3UTOA 4QIRA 4X98B 4H8QA 1WCQA 5JDSB 1IC5L 1BIIB 3HN5A 3S97C 3PWJB 5A1AA 2GC7C 2JJSC 3SE9H 2O93L 3MYJA 5I6XB 1T21A 7PAZA 3HS0C 4PWGA 5J12C 4TUJB 2I26N 1NTDA 2IPUK 1QBLH 3HZKA 3NP4A 3OAWA 4O58L 4P9MH 4QYAA 1OXYA 4M8VA 3W0WB 4X99B 2DZEA 2JQMA 3CSBA 1AHMA 5KUMA 4AVKA 4XC3H 5EC1B 1OB1B 5BCAA 1BD2D 2GJPA 1SF3A 1REIA 4P4KB 4L8SC 2YA2A 2R56H 1NCBH 1JZDC 3P9LA 4MXQC 4N2DA 3A6OA 3O3AB 2MKLC 4PTUA 1UUSA 4JY6B 3EHBB 2WSDA 3F05A 4AKQA 4O02H 2O61B 4JFTA 3TBSB 5E2UH 1GH7A 3H56A 4GQ9H 1FNHA 2J7LA 3FHEA 4HFWA 4ODTL 4F3FB 3QYNA 3GSOA 1QKZH 2ZOTA 5E1IA 1YEGL 4NWUL 2OW7A 3KBFA 3LNIA 2H9GA 1KNOB 3ARGA 4UOQA 1E27B 2EXYD 1MI5D 3AW5A 5AVRB 4DWHA 1PLBA 2WXPA 1PX4A 2X10A 4KY2A 5D5MA 4JFZL 4EUPA 3FU3A 3GSXA 3JVFC 3FTGA 4MYPA 3D3VE 5F7HA 1D5RA 5DWUH 3BPCB 1BQLH 3OSKA 1JGEA 2ENQA 3GJFA 4XPAH 5J13C 5F8RC 1YO4A 2C9QA 4XPTH 5E0QA 4H8WH 5FWQA 4BHUI 5IJBC 3OAYK 3HLAB 2AV1B 4FFYL 4HJTA 5F9WB 3S88H 4D3CL 4F7MA 1C12A 3WS6A 1ASOA 2WO4A 5DRZB 1W15A 8FABA 1S9WB 3HOGA 3GMQA 4OFDA 1R3LB 2GIYA 4YE4L 4MLSA 3HAEG 3VH8G 3SGDH 3ULUE 3DO7A 1YCSA 1NANH 1GTNA 1MJ7L 5BO1H 2GSMB 4MMZA 3ESUF 1PZBA 1TTAA 2OR9L 4QWWC 1HJBC 3SQBA 5JQIB 4HPYH 5HGBB 1BJMA 1X5GA 5CZVL 1R3JA 5E5RB 5T5NG 1QASA 2EIMB 1TTFA 3UAAA 3KPSD 4ICXA 4DEPC 5MERA 3CFKB 1JCKA 3D85A 3PE9A 2JIXD 4J3OF 1BOGA 4KX8A 2PTUA 5KSAC 3OXSB 5FDWB 4MWFB 1MH5B 5BPPA 3UZEA 2WLLB 4AQEA 1TEYA 4F33A 5J6GA 1KBBA 5GS1C 1TJGH 2F0CA 3OGCA 1NFDE 3RYMA 5I8CB 4YFLI 3FU5A 4NJAH 4U1SB 3QS3A 2O5NA 1RK1B 1GCYA 4PP2A 3VU1A 5FB8B 4XP4L 1ZHBA 4QRUA 4HS8L 1RPQA 2HYMA 5SWZA 3LNFA 3FBKA 1FIEA 1KB3A 1BZQK 4FI6A 3APMA 1XCQB 2TRHA 3C8KB 3VXPB 5JHBA 4TMPA 1F8TH 1YG9A 4Z7UF 5IROC 5EHFA 4IMKC 4WW1A 3TJHD 4L9LA 5D7JA 3RQ3A 5I8KH 2HUEA 3WFBL 4DZ8A 3ZZ1A 1KCRH 4I0PD 2ZXWB 3SDDC 4RISH 1KFGA 2MEJB 3HZVB 3CBRA 1R6VA 1AKJD 1H5BA 1M7UA 4WFHE 3AGVA 1UM4H 2JB5L 4TLTA 4RQQA 3X13B 5K9OA 3MRMB 4Y2LA 3I75B 1K6QL 4ZJ9A 3TIEA 2Z91A 2EJ1A 2H8PB 4E41A 2OMTA 4WEUD 4GAGH 3FFDB 3OKNA 5PAZA 1E5UI 2H0EA 4XHJC 2E4FA 5KVEE 4KK8C 4P04A 4M7ZB 5I8EA 4JFHE 3CQQA 4M1DH 3HG3A 4JCLA 1G0YR 2R0WL 4Z7QF 5I6PA 4L5FE 5FK9B 5CMAB 1JI2A 3LHAA 2VISB 4P99A 4C4UA 4F2EA 2NW2B 3DV4A 3C5ZC 2PYEE 1BQ5A 3V0WH 1PW3A 4HJ0C 3CGTA 2Q8BH 4K8RL 4XBEL 1VFOA 4EZKA 4FP8L 3V0EA 4JK0D 1XGPA 4AITA 4MGXA 5LLIC 5JIPA 2CJUL 3IJ9A 3D7PA 4TQEL 1D2PA 2GY7B 5D1ZD 2K7PA 4CU6A 4ZI8A 2WXRA 3QXUA 3D1MC 5I24A 1VAHA 3KPPB 5GS0L 4JFDB 1CB4A 4CSZA 3BN9D 2MPAH 4P05A 3MV8A 2ZCKL 4LL1A 2W9DL 1BX2A 5DMJB 3A6BH 2XN2A 1T4WA 2YFOA 1WZLA 5EU5A 4JO2H 3POHA 1VSCA 5E99L 4JKKA 1KXHA 4N20A 3TWCL 4TM9A 1J9QA 3H9HA 3I9GH 1NAMH 4YXHL 1ZAGA 5IHWA 4R8WH 3UPAA 3IFOB 3TEXA 3GS7A 5ADOL 1FFNB 1UKTA 5C07E 5F0LB 1Q72H 2PYEA 2Z8RA 3EYQD 4NIKB 2AW2A 1XIWD 3FN9A 4DQAA 2BM3A 4PJBF 4WW2F 1KCSL 5CM1A 3T1WA 5CD5D 5KAQG 1XVSA 1NUNB 3DO3A 1U2HA 2A73A 3GSVA 4N22A 3BKCH 5L4IA 5D55A 4KKLD 2YC1B 2VXSL 4R9HA 4UTAA 4KK9C 4NP9A 4OCSH 5DJ6A 1PEWA 4K3DL 3CJJA 3SDCA 1BVNT 2HPTA 5BZWA 1YYML 1EGJH 3C6LB 3RVUC 2X53A 4I13B 4CVUA 1IJNA 1XDTT 1JD7A 2Q86B 4PJEE 2YZ8A 1HQ4B 1YMMA 2WLNA 1CDIA 1MF2H 3LS4H 1HHJB 4PJAF 1YSOA 4KROC 4WWKA 4UT9H 5EG6C 1MFAL 1PAMA 2ID5A 4U1KA 3RWIA 3F04A 3OR7B 4UINH 2GY5A 1NKOA 1QOKA 5EPMA 4LE8A 4C56A 3FFCB 1X5XA 3IPBA 4JG1L 4XNQB 5IW6B 1Y1DA 4YBQC 3RFRA 5EOQH 3BIBX 3R7QA 1HVXA 1XR8B 2DQUH 3VWJB 4HP5A 2E8ZA 1PS3A 4M5YL 4WF7A 1R0AH 4MA3A 5LGJA 1CE6B 1HIML 1KENL 1KGIA 4WUUB 1NA8A 1MFBL 5GGQH 1T1YA 3M1BB 1WIOA 1G7IB 1UB5A 2IDTA 3ZXAC 1R3IH 3GF8A 3RB5A 5FW6A 1EJFA 2HFGH 1QLEH 4PJEA 3QC5X 1NSNL 3K72A 3S5LB 1B0IA 3ARFC 4G1MB 4LZKA 3BSZL 4NI6A 5H94B 2FCBA 1TQBC 3MXVL 1HNYA 1I7RB 4TN9A 5EB9A 3CU7A 3V7MA 1AZUA 2VLJE 2QPSA 2VUYA 4CSPA 2FX8L 1AIFB 1RZKH 1TEFA 1E9OB 5IY5B 2CHXA 2Y36L 1DJYA 3WL9A 2ICWB 1D7BA 2BVUA 1ETA1 4XO4A 4FZ8L 3K6SA 2W0LA 3JTBA 3TASA 2CIKA 2FBOJ 2FHFA 3US9A 4PB9L 4NT6B 4K23H 4HK3J 3T8XB 1QQDA 3IMWA 3BFWA 1WBZA 3DLQR 4JO8A 3WAJA 2BCKB 1RUAL 1K4CB 3O11A 1UZ8A 5BUPA 2J1KA 4LLYA 1JWUA 3LPWA 1G7MB 3UBXB 2VO8A 3GMMA 1ACYH 5IVZB 4E9WA 2YPLB 2KLSA 4NN6C 4Q7DA 4NJ9L 3QNYA 4WWID 1DE4A 3JTTA 4BCZA 2ZUSA 5DZVA 4HIEB 2FJFA 1FJ1A 2B15A 3FCBA 2AGJH 3QAZC 2V2WB 5KYWA 1VIWA 1WUZA 4JPVH 1E5YA 2IQ9L 4YGVB 3D30A 2P48B 1BOYA 5GZOD 2N0MA 4OF3A 4K8RC 5ANME 3LIZL 5CHNA 2G3ZA 3O2DA 2IDCA 1SFDA 3MLVH 1VFAA 4HALA 3HN3A 3A4EA 1K72A 4GRMA 4MNQB 2H32A 5JW4R 1S9YA 3GNML 1TQUA 1QI3A 4Y4FC 1I9RH 2F5BL 1KBWA 3R0NA 3PRZA 5HHXL 1AXIB 4BZ1L 2IH9A 1INQB 2OXHB 4CDHA 3LSOA 5D96B 3RWDA 3RDTD 5I19H 1SOQA 4WIQA 3VX0A 1A3RH 2ZX6A 5CFAA 5HHQB 5C7ZA 1TCRB 5DUBB 3G04B 5KSUB 1PGRB 3GKWL 2VLME 4Z9KB 4JW3A 1N0LB 4PJHF 4KZEH 5ANMA 5I1JH 2F15A 2ZF9A 3H7BA 4NZRH 2CO4A 2V9UA 2XN9D 5HSFA 5DD0L 5E94A 2HTLC 5F88B 3EXJA 4JO3H 2MNUA 1XSIA 1JF6A 1V7NL 4DO5A 5E6UB 2YD3A 1HL9A 2GAZB 3N40P 3E1F1 3CZFB 2OK0H 4G1EA 2IANE 2BHYA 5ILTL 4M93B 1JZ3A 4HEME 3T0XA 5JHAA 1GKEA 2OMYB 3DOHA 3O6FA 4BRJA 1FFRA 2W60B 2OMVB 3NAAL 3PWUB 1H15A 3QG6A 4LMQI 4P23D 5E51A 3UTSB 2CWRA 3BDYH 4Z95H 1PKOA 1U91A 2A9CA 2XT1B 1RHHB 4EVNB 5EOCL 4I5BB 1FNGB 3AQDA 1HESA 1NCAL 3GGWB 3X1FA 4BRVA 1BCIA 4FD0A 4BH8B 1I1AC 1T7WA 4J4PA 4L0ZA 1QHQA 5KS9B 3Q13A 4MD0B 4HWEH 4L8CA 1ZHKB 5LGHH 2CK0H 3DARA 4AV5A 4UTBH 3RVXD 4WEBL 2IANA 3O2WL 3V0VA 5JHDB 4MCZB 4Y4HD 4WHTA 5HYIA 3TO2B 2BVPA 1NGWB 1NUGA 1P1ZB 4CL7A 4D0DA 2XJLA 3M1OA 4XCCH 2BSCA 3N1QC 4KKBC 3QIWB 4I2XA 1I8LC 3W9EA 2FR4B 1UCTA 4GAYB 3S37X 1GGCH 4K9EH 5J89A 2ZUTA 4D9RD 4QRTB 2F54D 1B4RA 4QCIA 4WKXA 1P4BL 3K8KA 1HH6A 5FDYA 2EAEA 1Q0EA 4R2GB 4JM2C 4K3GA 5CP3H 3BEVA 5I28A 3MBXL 3R06A 1XGYH 2XKNA 4RNRA 4TSAH 1CICA 5FYKE 3ZUNC 4YDKH 2ODHA 1OP9A 5DQJA 2D2CC 1YEFL 5ETUB 1CR9H 4KXAA 3BPOC 2QDVA 4LLUA 1OLLA 4BK5C 4IHOA 4XVJH 1T0NA 5MEND 2EVFA 1L9SA 3FQNB 1ZTXL 4JKMA 1BVNP 2P5WB 3LN4B 5A16A 3MNMA 2XV6B 3S5LG 5JHLA 5E9NA 4JHZA 3FS9A 1M7IB 2F8VA 3ESPA 2VN3A 3L5XL 1ICTA 1WDAA 3K4ZA 4OGYL 2VW4A 4Y5VC 5HYSA 5JXED 2X2JA 3TM6A 3US1A 1X5LA 2KS0A 1S9VB 1NLBL 2ZWSA 3SDAD 1U8JB 1SHXA 1BD2A 1CU4H 1SYSA 3V4PH 4FABL 3RPBA 4JY4B 3CDYA 2DBLH 1S7QB 1JZ4A 1OTSC 4R7DB 3SDYL 4L2LA 1GZQA 1SHWA 2AABL 1ORSB 1RP8A 5LG6A 1H8LA 1N7ML 2Z8WC 3NRFA 1C08A 3E0GA 4WY7H 4PM1A 5HBBA 1JXFA 2E6JA 3AB0B 4U6YB 4YIQA 4LLVA 3FTXA 5DVNA 3CSYA 4CN1A 3AZUA 3TTYA 4A7TA 1RIUL 3LXAA 3B6SA 4I77H 1OAZH 2BSRA 3SY6A 3DIVA 2ZE0A 3DJTA 3VTAA 2K78A 4QRAA 1MI5A 5BV7H 3REWA 1SXAA 2DWDB 5I26A 5IEHA 3TN0D 5DFAA 1QLFA 2LU5A 1XXDC 2NZ9D 4TUOB 4U31A 1JBJA 5I5RA 1TT6A 2WO2B 2ZP0T 4IRJB 4NEHB 5ECGA 2QSTA 4Y2DB 2FK9A 4NHCL 2EVJA 4Z7UA 3HFMH 4TQHA 3T65B 5T33H 1XL6A 1BYPA 3C8DA 4M5SA 3MR9B 2G5BA 3P0VL 4NDMA 2XPZA 3ARWA 1QWNA 4Y1AD 5FYLH 1KUMA 1A6TA 4KX7A 1NDGB 1JTPA 3D52A 4OZGF 4NQCB 3DPBB 2HT4C 4D0BA 5I6KA 5A3IC 3F7PC 1E5BA 2HFFA 4GLRI 4XMXA 2VXQH 4FG6D 3MLWH 4PJCF 3OMAB 1NM4A 3ILEA 4GEIA 5IQLA 3HB3D 3RWJB 1X6LA 4ZAKB 2VR6A 3DGGA 5I75B 2J4WL 3GZPA 3QVAA 5T5NF 2HJKA 2X4RB 2HLFC 4OZIB 4U6XA 3MLRH 1PCSA 3TXAA 4UMGA 3KPSA 1D6VL 4R4NC 4RA0C 1BXXA 2JIXA 5IWLC 2YA0A 1FH5L 2BSSB 3HI1A 4DPCX 3ATBA 2CDFB 4RFEB 3UJIH 2ZF8A 2F9BT 2JJVA 2DOCA 1YA5A 1D5IH 3G6DH 4PD4J 1TUPA 2WBJD 3QR2A 4M03A 2YHGA 5EUOB 1GIGL 3CCHB 1TYEB 2FL5A 2W8CA 3WFCH 3JWOL 2E5EA 3IFLL 1YC7A 2VKWA 1AXTH 1XAUA 3J07A 4PRNB 4XVSL 4NCDA 3T08A 1D9KD 5IREA 2EXWD 5E8DL 3VFNB 3VXQA 1TQSA 5TQ2L 4NYLA 2L7JA 3UG4A 2C9RA 5D2NE 1I9JL 3BRGC 2L3BA 4AIZA 2WXGA 1EFXB 1LDPH 3D12B 5DRXB 1U4FA 3RLSA 3RFZB 3B9KC 4A7QA 2Y3AA 5D7IF 2QQQA 1YY8B 1P7KA 4WSJA 3LD8C 4GAAA 4UM8B 1IBDA 3N42B 1KLFB 1P7QB 4QHLB 1AKJA 3ARDC 5DD5H 5EBLB 3L95A 5ESAB 4ZD3L 5IMKA 5I5IA 3BZEB 1CZ8L 1UXSB 1ZLEA 2JTDA 2R0ZH 3ARXA 3X14A 4F7CB 1DUYA 3NJNA 2GI0A 4Y2OB 4W9FC 1JUFB 3PIQB 4JQXC 5AKVA 1XSJA 4OB5L 2XWBB 3OX8B 4W9JC 1KBGH 3BN3B 3CK0L 3L7EB 1THCA 4P3CH 4BH7A 1K85A 3O6LH 3W56A 4FFWD 2PXYB 2IALA 4PY8I 2VDKB 5FKPA 1LO3L 4N6QA 5A6IA 1F4AA 2IO5A 4O2CA 4IIQA 4G7RB 3FU6A 3BP5A 1MREL 5E5MA 4WI0A 3DX0A 2CGZA 4EAEA 2WKGA 5FYKU 3EHBD 4FXKC 4Y4KB 2W07A 1L9MA 1YNLL 2ILLA 3QZBA 5D1ZA 3PHQA 5F1NB 3L6FB 1NCNA 4X6CE 4KQ4L 4AIEA 4ZUVB 3BEWA 4GRLC 4MA1B 2Z35B 3FB8B 1JPGA 5KW9H 1QFPA 4AK2A 3TFKC 1J8SA 1DVFB 3S4SB 3BWZA 3DETD 3V6OE 5LCVH 3RX7A 4YZFE 5FUOH 1DBAH 3CN2A 1OF2B 4I0CC 2XZQL 2XXMB 3IPEA 3AS2A 1I4FB 2Z31D 2DQHH 2DWXA 4M7JL 4AEIL 2ZUVA 1T03L 2J73A 3BOVA 2K6YA 4MMYB 4S1DC 5KVGL 2YXVA 1BGXH 2WXIA 2J25A 4DCQB 4LCIH 3MBEB 1YDPB 1XIWA 4ZFFA 5HJ3A 2CXGA 2IOMA 2OMUB 3IMVA 3QDMB 3S96B 4HOZA 4PJFE 1EZVX 5KAQF 1EEUA 2KZBA 2P8LB 1NCGA 3PAVA 3PU7A 4LU5L 1ZLSL 2XQYK 3SPJA 3ECQA 3ZKQD 1R17A 4OD3H 1DQJB 4PBWD 3PV7A 1NJ9B 4ODXA 1A7RL 1AD0A 5CD3A 1HL8A 3VFOA 2J12B 3I6GA 1KJ2L 4KWUA 5L9DL 3V6OA 5M94B 4M4RB 1Q0XL 3E9TA 5KSBE 1BLNB 3UPCA 2IH3A 5I1GH 3SKOA 4P4RB 2HJLB 3MCLH 4ZUTA 1DCEA 3FO9B 5TQ0H 2DDQH 2OL3L 1E8XA 1T5WA 2AAVA 2CGRL 3RTQC 2C8NA 5JTWA 1A9BB 3QCTH 4JY5H 1GJIA 3FT4B 2D4FA 4CU8A 5DEFB 5G4OA 4F7PB 4M7LL 1ZS8A 2VDQB 3KLHC 1WQVT 3N85H 3SQRA 1GR7A 4QRSB 1MDTA 2YQGA 4PGZA 3QXDA 4CN4A 5HYJB 2E7DA 1I8AA 1XGRB 3LTVA 4NP4L 2GJZA 2VMEA 4NB7A 4JPKL 4YHNA 2AK1H 5J3HD 5FCUL 1EEYA 3ZYIA 4NUGH 5KSBA 2E86A 4ZQKB 2DLEA 2GUOA 1NOLA 2A6DB 3QJUB 3IU3A 1NMBL 3HG2A 4PJ9C 4KXZI 3JWNG 2A83A 7FABL 1Q38A 1QUPA 3ZN6A 1HHHA 4PBVC 4FA6A 4H0LC 3JWOC 5IVXE 4FNLL 5E8NA 3DSNB 3DGDA 3DYPA 3OJMB 2XZZA 4XCFL 3ROLA 5IB2A 3L4YA 5I1IH 3BGFC 3X3GH 5HI5C 1IAKA 2ALAA 2APVA 4Y0GA 3FRPB 4ZFOB 1GGYA 1JNNL 1U41A 3AG4B 5CEZD 1YRKA 1XH3B 2BXYA 5EF1A 3D08A 1RY7B 2F1EA 2FX9L 4GH7B 4ODBD 2JF1A 1MVUB 1IQDA 1V55B 2YD7A 3OLGA 4PJHA 2Z7YA 3OZ9L 3DHMA 3EYFB 3VMPA 4MA8L 2V8MA 3U30B 5D9SA 5GGTL 2C1PA 1H6EA 4UQ2B 2OYMA 3FU7A 2K7QA 4JFDD 2AKRB 2N7SA 4K94L 3QO0A 2P43B 1Y1UA 4XE5B 4I48B 4KXDA 2DICA 2J5LC 4TQ8A 2ZOLA 4OCYH 4P2CG 3DYOA 4JM0A 2LQRA 2Z1PA 3TCTA 3K2UL 4TUKL 3SGJA 2K6WA 3OG4B 1R5IA 4IMLA 5GZOA 1RZFH 5DFWH 3TNNB 2XTJB 4HG4J 4OUUB 3X12B 3G6AA 1Q90A 3ZK0A 5IFHL 5TDOA 2BY0A 5MP6H 1QABA 2QVKA 1I3GL 4YHLH 1CGTA 2YGPA 5FO2A 3U2JA 3TNMB 4YHYB 4BQ8A 3S8GB 4EMZA 43C9A 2IQAA 1EDYA 2H0FA 1IJ9A 1CJYA 1CWVA 4IEFA 1EAPA 3D69B 5EEWA 2UZYA 3GMNB 1IQWL 2GTWB 3FQ4A 1G87A 3RDTA 4BA8A 1E4WH 4OLEA 5D2LF 4PY7B 4GAJL 4WI6A 4WUKH 4AZ8B 1EZUA 4GW4A 1LHZA 3ZR5A 3H2PA 1UACH 3B9EA 1XWVA 3EYVA 3NZHH 1KXTA 3O3EA 1HNGA 5C0EB 2PP9A 5E9DD 3QGVA 2FZ3A 5J56B 3SPVB 5AWNH 1M57B 2XN9A 4XPBL 4WNSA 3RUGB 3WG7B 2HLAB 3WSQL 1KEGH 2VL5A 1IEBB 4YN3A 4AL8C 4F8NA 4UB0L 1ASPA 2VXUL 5E5LA 4LK4A 4QF1A 3VWKB 3CH8A 5LBSA 4P2YA 1FGVH 3F8UB 2D2OA 5A6MA 3PAUA 3MRPA 4K7PX 4N2CA 5C86A 3PV6B 4EE2A 1JYXA 5IMMB 2WKOF 1WSST 1BMWA 4WUUD 3VG9C 4PTTA 5LVEA 3UTZA 1G7PA 3V6FB 2NUTB 4HUXB 1DQLH 1SLXA 1UM5H 3WIFA 1ND0A 3FH5A 3GSNL 1KZQA 3DBSA 5KVFL 3STLB 2A6IB 4FZEL 3X11B 4GBXD 2WINB 2GSGB 1BZ7B 1ZXKA 4M43H 1KTRL 9CGTA 4XMPL 1N12A 5L0QC 1HC1A 1TJHH 2WK2A 3PHOB 4IM8A 4A6YH 3SBPA 2HT3C 1L3WA 1LILA 1U8CA 1A9EB 1PLGL 3VCLB 3IFNH 3MRCA 1UOVA 3GS4A 1JZ7A 1OW0A 2OBGA 2PPAA 4G6AC 1A6AA 3VRLF 1L0PA 4Y4HA 1URLA 4G8IB 1UKQA 4R7NA 1PLCA 5MENE 1KJMB 3P40A 3T0EB 1VKXA 2BIHA 1NWOA 2ZXQA 1KJVB 4PLJC 5EU3B 2JLPA 2OJZH 4OI9A 2ZKHH 1BXAA 4OGAC 3VFRA 1QLRB 2ZCHL 2Z31C 5B3NA 2X4QB 3NFSH 2YAEA 3BH9A 3HE7B 2D7OA 2NY3C 4MNGB 2QQKL 2F54A 2CMRH 1NC4B 4OF6A 2Z4QA 3KDMA 1MLBA 3EO0B 5JMOC 3DX6B 3TYFB 4IOSD 1Q1JH 4U33A 3UZQA 1X7TA 1WLHA 2B16A 1FCCA 4ZO7A 3RBGA 2QHRL 3SE8H 3WUZA 3FQYA 5E4AA 4Z0XB 1ORQB 3MO1B 4YUEL 5KTEL 4CA4A 2KKQA 1JXDA 4XRCB 5MENA 3IS0X 5I0VA 4X6FA 1BIHA 4Z3GA 1AGEA 2VNCA 4HGKC 1X4XA 3ZL1A 4ANUA 3NSYA 1NCWH 2EYSA 1WZMA 3KYKL 2B59A 2DBJA 1YECL 2GJ6D 5D4IA 5JXEA 2G5RA 1OE2A 2XLLA 3HAEA 3SDAA 3VH8A 1OGPA 2FE0A 3S34L 1W0VA 3ILQC 4NUJB 4NNPH 4JGJA 3L3JB 3D0LA 3K6DA 1DN0B 1MWAH 1T0MB 3FRPG 5IESL 5IHHA 4RFOH 5C3TA 3NCJH 5ICZB 2CCWA 4KKRA 5IB3B 4GW1A 4AYMC 2XVLA 4GPVA 2VABA 3PNRB 4YQXH 1JK9B 3P4NB 1ZTMA 2DM4A 4KDVA 2CIIB 3QUXC 4L29B 4RRPG 5DO8A 1WD8A 3OAZH 5GJTH 4G6JH 1KIQB 3NCWA 4QNPE 3U36A 1OLZA 3VXTA 3VFGH 1T04B 1LEKB 1N0XH 5LAXB 5CCHE 1MCLA 3TN0A 4UNIA 1RKRA 3BUTA 4NO3A 1YHPA 2WAHA 1UENA 2P28B 3I74A 3KBHE 2I9TA 5AYTA 4ZFQA 1E6OH 2VC2B 5IHLB 1TMQA 3NMEA 3IGKA 1S5IH 2AQQA 2A6KA 3UTSD 3FQRB 5DC2A 4Y1AA 4A7SA 3U7AA 1YEJL 1UH4A 5TF1H 5K5YA 1RU9L 2NDFA 2W65A 5AYUL 5DMYA 3CHOA 5D7IA 1NZRA 3MROA 4A2HA 4OJDH 2QVTA 4LPTA 5HVFB 2ZJSH 1OWRM 2HFEA 3ASOB 2HFTA 1AC0A 1CK0L 1E2VA 1UB6B 3DVIA 4FQXB 1QSFB 3ECWA 2QPEB 4ONHA 4MAUH 5I6LA 5ECJE 3V0AC 1BDYA 1FC2D 3WV0A 3GDCA 5JHDD 1YUHB 3BDBA 5I74C 4J23A 1T1XA 3U9UB 2HH0L 3GBNL 1O75A 2EEAA 4F9PA 4EKXA 1HI6A 1G1OA 2H45A 1JZEA 2CZNA 4PLNC 3F7YB 3LQAC 2NY5C 4P06A 2WBJA 1CDBA 4WO0A 1IC5H 2P1YA 2GEQA 1IUZA 5JPNA 2LFEA 1KCKA 3UYRL 2EDLA 4IGBD 3N41B 3QO1B 3SKJL 2ATKB 2GCYB 1MHCB 4R2GD 1RZIB 4O58H 5HGHB 1T0OA 1XF1A 1GMIA 3II1A 2NX5B 3LPGA 1JCVA 4J3WA 1OCZB 2J72A 4JQIA 4PGDA 2DQFA 1HSBB 5F7KC 4X9BA 4X98A 3QFDB 5JDSA 1OO2A 1BIIA 1S4IA 2IH1B 4KPHH 1V7MH 4N8PA 4APQB 1AOHA 4Z3FA 4DZBB 2Q76B 1X9QA 1LE9B 4FXLA 3EJZC 4ZMYA 5CXPA 2R29A 1JV2B 3ZGIA 4Z3HA 2VZ1A 4G6KH 3RRQA 4W4NA 4MJIB 4X99A 3C8HA 4NGHL 5KS9F 1G6RB 1OAUH 2X4OA 1F0LA 1YEGH 3MACH 2ZKMX 3RPKA 5C0JA 3JBG7 1OB1A 3RWCA 1J5IA 4ZOBA 3ECBB 2BP0B 5CU5A 5I0DA 4QXUH 3EOYG 5IIEB 2C3WA 3EO9H 1TZIB 5IB1A 3UJJH 4GQQA 4NNXB 5GGVL 1KCUL 3O3AA 3D2TA 4JY6A 1A8ZA 3CWGA 3L08A 5EFIB 3JV5A 4LSQL 1QFWI 2Y22A 3X3FH 2ZG2A 4P3DB 3FH7A 1YYLL 5GGSB 3TBSA 5LB1A 4F3FA 5DTFB 2JKJA 4FCAA 3Q2LA 1T6WA 4YS4A 4FFYH 4OV6F 5EUKB 3LEVL 3UZEC 4D3CH 1TZ8A 1TR7A 2N7BA 4OFPA 1KNOA 4F8OA 3HS9A 1OAYH 1IL1B 1QR4A 4YLBA 2FHCA 4R97B 5I9QB 4HCIA 4DVRL 4YE4H 2FJGB 1C16A 3HEIB 4L1LA 1H6FA 1MJ7H 3Q9PA 2CAKA 3BPCA 3ZT7A 4AWJC 5L2JB 5HP5A 2OR9H 4IRJD 4FLSA 3WTUA 1F90H 4LSTL 3K1DA 5CZVH 2OMWB 4BZ2H 4XHQA 1MJUL 1HEHC 3Q3GA 3HLAA 1YEIL 3LRHA 3WENA 4L9LC 3DIFB 5LBGA 5IOPB 5DRZA 3ARVA 3BISA 3ROOA 2CLZA 4AC2A 1S9WA 1EXUB 3RA7H 1R3LA 5FYKH 4B95C 3BVUA 2F8XC 1S8DB 1GW6A 2MTPA 3LY6A 4ZMXA 4WTXA 4HLZG 4Q0XL 2OZNA 35C8L 4D94A 4Z3JA 1VZHA 2FJHB 5HGBA 3CLFL 3V0IA 2YD2A 3GXPA 3ZJAA 4ZUUB 3KGUA 3B37A 4HS8H 1A6VL 1CBVH 4LKCB 3QJTB 2WLHA 3TF7C 2Q20A 5FDWA 3GJFK 1IKFL 3JWDC 3SOTA 3I84A 4MWFA 1MH5A 2CR6A 1O7DE 2WLLA 4HCRL 4FGMA 5DD1L 4TSBL 1JE6A 3WFBH 4GG6E 4C54A 3APCA 1OANA 1S7RA 3O2DL 4G6MH 4BM7A 4U1SA 2X3AA 3LJ3A 1RK1A 4KK5D 5CUSL 5FB8A 5ITBL 2RAMA 1XHHA 5CEZE 1QNZL 3HMXL 5A7EA 2YJQA 1TOXA 1XCQA 1JPSH 3VXPA 4EI5B 1F6FB 4R5XA 2R0WH 3LDBC 3RU8L 1F4YL 1LMIA 4R84A 1I85A 2Y72A 5FGBA 3EJUA 3QA3B 1FO0B 2BY3A 3C08L 1WT5C 2WLYA 4OCWH 4EN2A 1JWSB 1ROWA 4P2RB 1P7QD 1Z5HA 5CEYB 4DVBB 4K8RH 1MFUA 1FZKA 4XBEH 2FT8A 3X13A 1G94A 3MRMA 1WEJL 1LMKA 4LMQE 3I75A 3ZQXA 3CN1A 4TQEH 2WWKO 4GG6A 2H8PA 4FNTA 1ITCA 1NINA 2WXFA 3FFDA 3ULVC 5E2WH 3SDXE 3VB8A 3FQUA 3TEYA 4JREB 3P0YL 2DIAA 1KYFA 1G0DA 2ZCKH 3HC3L 2PXYD 1IGYB 4OZIF 1FYTD 2DI7A 5CMAA 4BFKA 1TQCC 2VISA 2WQWA 4Y9FA 1OTUC 2NW2A 3CQPA 3PQYB 2AZAA 1H3VA 1NFIB 1Q9KA 3FYIB 1Y6MR 1W72B 2GBUA 5EEUA 3TWCH 4DESA 1G7HA 3QXVA 4YXHH 2FECI 4WFGE 4AGQA 1F4XH 4Y4KD 2OI9C 4HLEA 5ADOH 2EIJB 1N67A 5EUOF 1O7SA 3S8FB 4OR1A 2FIKB 2EZ0D 1JDDA 1OP3H 4JFDA 4RMRA 4YO0B 1KCSH 2VIRB 3LNHA 1COBA 1JGIA 4AG4L 4L3CA 3S37L 4Q8BA 1DVFD 7PCYA 2C4FT 2YD8A 5EZPA 2CG9X 5FFOA 5L4JA 2VXSH 3QAQA 4TVPL 4RESB 3ZKXB 2CO6B 2XYCA 4RWYL 4K3DH 2A9BA 2H3XC 1QRNE 5E9DE 1FFNA 2J57A 5HI3D 1JV5B 2AJYH 2G2PA 1YYMH 3C09C 3ATFA 2MCAA 4AVJA 1P0SE 2ITFA 1N64L 3N42F 1XSOA 4HUNB 3GYRA 4MJHA 1I3VA 3QDMD 1E43A 3PP3H 4AY0A 5CCGE 1NICA 5B7EA 2NY1B 5CJXA 1MVFA 3AAZB 2D0FA 4BFRA 2HCZX 1L9TA 3S35X 5FM5O 4C83A 4HIXH 2DWEA 5KSVB 1RL1A 2R1XB 1HXMB 2AJZA 2VRAA 2GBVA 3EJSA 2I9LB 4P5RA 5MEPB 4U3CA 4I1PA 2C1OB 3KPOB 3NDZE 1RZQA 2HJFA 4W93A 1CI5A 1OM9A 1I1YB 4X80L 4NZDA 4ISVB 3WFEL 2Q86A 5B1JC 1HIMH 1HCYA 1HQ4A 4B7LA 2AI0H 2Q2LA 4LCCC 2EICA 5E9DA 3TT1L 4CVWA 2QPUA 1MFBH 2Z34A 4XN1A 3CUPB 5TE4H 3QHZL 1A2YB 3ABMB 4JRXD 5F0JB 1GCFA 5LUMA 1JERA 3BSZH 3D07A 3MXVH 5DD6A 3FFCA 3WTYA 5FV2A 5IW6A 4XNQA 4OLZL 3FNKA 1S9XB 4S1QH 3L3DB 5HYJD 3ZE0E 3D50A 1KTBA 1CE6A 4GRWE 3ML8A 5CGBA 4X9YA 2Y36H 2OZ4A 4WUUA 3UXFA 4H20L 3FU0A 4PS3A 3RILA 3BFOA 5IMOB 2XFXB 4FZ8H 1G7IA 3BKYH 5AZUA 1CQYA 1WISA 4PB9H 1XGUB 4J3SA 3G08B 4GBXA 3S5LA 5H94A 4G1MA 4BXVA 4XMZA 3MUZ1 3MA7A 5BRZB 3HC0B 2MIZA 1I7RA 4YSTA 1MFCH 3DBXB 4CW1B 1RUAH 2RR3A 2PO6C 4K5NA 5IJKC 4A2GA 3EH4B 1QW8A 2BY1A 2XICA 3UFIA 4K73A 2P49B 1A14H 2EDRA 5FGCE 4QHNB 2Z93B 4IU2B 3Q2NA 3VI3B 2ICWA 3LEXB 4KO5A 3T0WA 2XXCB 4XZ4A 3US0A 1X5MA 1BSIA 1XQ4A 3UZVB 5LXGL 3W1ZA 3NG5A 4NT6A 1IO4C 3T8XA 2JKIS 1A1NB 2OMBA 2ATAA 3N50A 1Z5YD 2BCKA 2IQ9H 5EORL 1OSZB 2GJ6E 3HUJE 4KJQC 1E67A 1BAGA 1FN4B 3BZ5A 1G7MA 2QELA 3BKJH 3QUYB 1F1GA 3LIZH 1TZAA 1DR9A 4GIPD 4O2FB 4XGZB 3CHPA 3LIUA 3KL5A 1LO2L 2FGZA 2NSQA 4YC2B 2VE6A 3GNMH 4IOSA 4L8DA 4HIEA 4A68A 1UG9A 3PP4L 4F7TA 3I50L 3A47A 1OZTG 4JFFB 3SYOA 3WLWD 4BZ1H 2BZDA 1XF5B 2A3TA 4M7LT 2UXFA 5FM5M 4HFUL 4MDJA 3IB4A 3CMGA 5E8OB 4HUUB 2ZNWA 4JMXA 3ULVE 1R19A 4NKOA 3GKWH 3KWVA 5F7BA 3SKMB 1CDCA 4CDGC 2R4RH 2GJ6A 3HUJA 5E6RB 3VI4B 3AY4C 3MPCA 5GGRA 3ZW3A 2CLRA 4QLWA 4P46C 1BM3L 3BZDA 4V1DB 3ZIMA 1INQA 4J4PC 1ZLVH 5JQHC 1KT2B 2E7MA 3U83A 2XJKA 5DJ2B 3F7KA 3VXUB 6FABL 5ILTH 1TCRA 5I0XA 4OTXH 4HHGA 2A0LC 3MN8A 5KSUA 4GI9A 4H0IA 4O02B 2ZUYA 2NQCA 3MV01 4ZS6D 5F7NC 1N0LA 2R69H 3NAAH 2A4EA 5FXCH 5J0BA 4YJZL 1DVXA 1VA9A 4L4VE 4ODVL 2J44A 3HI5L 4YDIL 2SEBB 5F88A 5HDQL 3T3PE 5FHBL 4PJ7B 3N44B 1FLRL 1A4CA 2GAZA 3D9AL 4OGXL 4P5KB 4X4XB 1NCAH 3CZFA 3X1EA 2LLNA 2JCCB 5F9AC 3V10A 3A6CH 3VWKD 4KK6C 5D1QC 1BMGA 3DUUB 1RSYA 2ZKYA 1OGTB 4P5TC 1HH9B 2BSED 3T9WA 1GKOA 2K9UA 5CCKL 2W60A 4RETB 2OMVA 3BE1L 3O8XC 3PWUA 3UTSA 1N70A 3ARPA 4WEBH 3COOA 1WGVA 2ICEC 1T1ZB 4AGLA 2PWEA 4JRYE 3AG1B 5F9JB 4RGNC 3TZVC 3OJDB 3UBGA 4N1HB 3H9ZA 4TXVB 1KGYE 2Z92B 4EVNA 2J1XA 1FNGA 4I5BA 3GGWA 3B7YA 3IDNB 3NIGB 2Q6WA 3SHSA 3WY2A 5EU7C 5EMYA 4BH8A 1KELL 3MRFB 4MD0A 4PPTA 1OM3L 1ZHKA 1ID5I 3SJVB 1G9NC 1EO8L 2V33A 1NAKL 1QX1A 2HT2D 4IRZA 2HXAA 4OD1H 4HXBL 1BZEA 1KN2L 4ABVA 1P4BH 1P69B 4KC3B 3SBRA 5JHDA 3RURA 4MCZA 1JXGA 4URTB 5C2BL 2Y2TA 1MQ8A 2APBA 2WNWA 3T0ED 3T4AC 1SOXA 1YEFH 2YLHA 3ISWA 1NGWA 1P1ZA 3BT2L 4Z7NB 1UWFA 4YSSA 4JBSA 2FR4A 2VDRL 4U6HB 1R5WB 5BVJB 3RUGF 4J3OC 4X5RA 5I5JA 4QRTA 4IKNA 4IGBA 3BAKA 4XNZB 1MHPL 1GA2A 1KGWA 3L5XH 1PZSA 3WGVB 3BMVA 2MQGA 3BUYB 3IN2A 5HHVH 3RWFA 3UL4A 3LN5B 3L8QA 4OGYH 2W0FB 2AEWA 2VJXA 3GMPA 4PLOB 4X6DE 4XI5D 3TYGH 4EN3B 5C0DB 1NLBH 1KTKE 1TU2B 3HNVL 2DYPD 3RWHB 1ET5A 1BFOB 2J55A 4GKOA 4FABH 4ZUWB 3VG0L 2N7AA 3GXDA 3II3A 3FQNA 4LAJH 3EBHA 4YWGH 3LN4A 3UCRA 2PCPB 5FW8A 4X9IA 1M7IA 4DPRA 1H6UA 3RY4A 2JKSA 3CU1A 1JK8A 1IB5A 4JPQA 4OI7A 3K0YA 2DRUA 3VXMD 5IQ7L 1D5MA 1S9VA 1U8JA 1M6UA 3D5OF 1RIUH 2X9XA 1TJIL 3MRBB 4OU3A 5ESVA 1ZGLP 3ML9A 4LPYA 1UD4A 1S7QA 3OD3A 3LKPB 3OKOB 4R7DA 1KPUB 4HH8A 3ESVF 3SGKC 1KJ3L 4GO8A 1WUNT 1ORSA 4LGSB 1IFHL 1X5FA 2PPFA 1U3ZA 1P5VB 3JWNE 1SLVA 3K0WA 3NCCB 4U6YA 4ZDHA 1Z9SB 5BS0D 2NW3B 4NHCH 4J5VA 4MAYC 3NJKA 1IARB 1ZT7B 2QKIA 3P0VH 3T2PA 4JHAL 2RCSH 2AJ3B 1DLHB 2JE8A 2R8SH 5IFJB 3AG2B 5FO9B 1WWBX 4FQHB 3MJ9A 5HHOD 1BBDL 3FBQA 4BFIB 4TUOA 5A2CA 4IOIB 1MJ8L 1QSEE 1OAXL 5TDPB 2OJEB 4FFTA 1J05B 4IRJA 5BMFL 3KPLB 2EIZA 1BA9A 1U33A 3T65A 4A66A 4PJ8B 4WWPA 4ODSL 2J4WH 1H0DB 2CE6A 3FZUC 5I17B 3B2DC 1EHXA 4BQ6A 4CN6A 5M7QA 4HZLB 4KO9A 5DO2D 1VENA 1KYUA 5I1KL 3IJSB 3SYQA 3DPBA 5CO1A 3EYOB 2ZP9A 4WW2C 3DXAE 2IGFL 3BQVA 3FONB 4BCXA 1XGQA 1WAPA 5DZ9A 4QRFA 3B8YA 1MCIA 2Y1YA 2F58H 4FQXD 1GIGH 5CWSA 5DURB 3JWOH 3CAFA 3RWJA 4N2KA 1NCUA 4OSUL 4RRPM 4LEOB 3AGWA 4N5EC 1S7UB 2X4RA 4OZIA 5E8DH 3LZLA 5C0ND 3RGBA 4UCFA 3FHAA 3WNKA 2QBWA 2QPFA 4XPHL 4JDEA 3NSCA 4QMEA 3WMSA 4AENB 2BSSA 2ZXCA 2CDFA 3RAJL 3E6HB 4LCYB 1H6TA 3IGUA 1BVLB 2XA3A 3BUDA 3D6GA 5IJVA 5ITFB 1V3KA 3TTSA 1I7TA 4X5WB 3DVGA 5EUOA 3CCHA 1ZSHA 4F37K 5ALBH 4ZO8A 3EDJA 3T09A 4TYUA 2P45B 1AY1L 1NFAA 2R4SH 5LN4A 4ZD3H 2ZXDA 3O0RH 3L7FA 1KG0A 3ZMNA 1CZ8H 3LNGA 3SO3B 2EDNA 4RZCB 3VFNA 3FCGA 4RGNE 1FYTE 1NCCH 2NX5D 4A67A 3A22A 2ED7A 4OB5H 1NMCC 3MMEA 4W6WB 3P11L 5AKTA 1NGYB 1RJLB 3CK0H 3TO4B 3L3KA 2W59A 3UYPB 5A2KH 1J0YA 2NXYC 5KYYA 4CJ1A 2YWYA 4PG9B 1J8HB 4M48L 1U3HC 3MOAL 5EZOH 4LSSL 2EECA 1LO3H 4K7PL 4XTRC 3RFZA 1XD1A 2IMMA 1YY8A 4GKLA 3UBHA 5C6TH 3MRIB 4UM8A 3FUHA 4F20A 1KLFA 1P7QA 2B9BA 2BOBB 2I69A 3DRQB 3HMWL 4NOFA 5ESAA 4HUCA 4KVPA 1WAAA 4CBZA 5IHZB 1UXSA 3TS8A 3O9WB 2GUYA 4ZMVA 4FHBD 1EHLL 1YNLH 4Y2OA 1JUFA 1F13A 1JPTL 3GO1L 3PIQA 4FLQA 3NJJA 4LIQE 2XWBA 4TNFA 3RG1C 5B8CC 1RZ8A 1SN5A 3PJSB 4TLSA 3Q44A 3ZE2E 2QVFB 4EEEA 2PXYA 1ZT1B 1FAIL 1AGDA 3RVWD 5I66B 4UT6L 4BZYA 3PDOA 1HHIA 3VA2C 3NVQA 3U6RA 4PP1D 1OP3K 3FT9A 4CC0A 1GGBL 2Y6TE 4AUYA 1UCBL 1CD1A 4QRQA 4M7JH 2AXGB 1C5BL 1P7BA 4AEIH 3QPXL 4Y4KA 1T03H 2G60L 2FECL 2VAAB 4NZFA 5KVGH 3VFUA 2ZUWA 3F6IA 4ELKB 3N1MC 5F1NA 5F96L 5ACLA 2Z9TA 1LL1A 1P2CB 3N1GC 3N41F 1IC7L 1SBSL 2QVMA 3F2LA 4NRYB 4WENB 5AVUB 3KGTA 3TVMB 1DVFA 1NCHA 3WIIL 4LU5H 2QADD 4X8XA 2RALA 1ZLSH 5CSBA 1QFUH 3T2NH 4AL8H 1OF2A 1UWGL 4XPFL 4JHUA 2B1OA 3O6KL 1I4FA 1RZGB 5DC4B 1IGCL 2CUHA 4UU9A 5AG8A 2V2XB 3QDJE 2ZWZA 1KJ2H 1DYZA 5DFTA 3U6XS 4N0CD 1Q0XH 3NGBB 4N2NA 4XNMB 1YDPA 4XR8C 3DROB 4JRXE 4PV8B 2OMUA 1QFWM 3GXNA 3QQ3A 3QDMA 3MRQA 3V55A 3WYRA 4HOWA 1DQIA 3UTTD 2P8LA 3OL2A 2XZCL 2OL3H 2CGRH 3F58H 4OI8A 5DVOA 4WU7A 1CXKA 2B5IC 4FX5A 1AE6L 4ALAL 1QA9B 2ESVE 4GXUN 2GK2A 2P46B 1NJ9A 1PQZB 2DJMA 1ZPLA 2DTML 4Z78B 1NBYB 4PJIE 1FL3B 4KNSA 4BKLA 4JFPB 5DVPA 4Z3EA 4A7GA 4NFCA 4P4RA 2HJLA 4FF9A 3M8OH 4A38A 4JPKH 5JPMB 1RK0B 1RZJC 2LU4A 3CVHA 4BJLA 1ZLWK 1J87A 1A9BA 4ANKA 2WVUA 3BAEL 3BAIA 4JRXA 4AVIA 1NMBH 5GRVK 1PSKL 4OCRL 4ONOA 5DEFA 4JFEE 7FABH 1DO5A 3BRDA 1VEMA 3CHRA 1UFGA 1G9MC 1XZ0B 3BT0A 4NOBA 4QRSA 4MKMA 3NK3A 3CVCA 5FOJA 2VN6A 5HGGS 1DBJL 3DVNA 4JAMB 4J8RB 2BP8A 5HYJA 2HRPL 4YHOH 4XCFH 5LHDA 3RKDD 5AUMB 1MXGA 4JZJB 1CL7I 4AT6B 6PAZA 2MNWA 3MCG1 3Q6FA 4PJBE 4ZTEA 2A6DA 4YNYB 2FYYB 5T3ZD 2GT9B 2QDWA 1UGNA 3BYYA 3RVTC 4LGPB 3L3HB 4HS6B 1J9RA 4M1CD 5J4MA 3FO1B 1KTLB 1OALA 5DQ9A 5JOEA 4XB8A 3L4WA 4MD4B 3VE0B 1HS6A 2X4SB 1WFUA 3H4HA 3HZYB 3MRDB 4NQVB 3QJRB 2K9FB 4MA8H 4P2QD 1VFUA 4KOBA 5GGTH 3QIUC 4OBRA 2FO8A 4H1LB 1T7ZA 3EFOA 2VZSA 5AZEH 4K15A 2XQYG 4ZFOA 3FRPA 3WFHB 4OCXL 5HHMB 4E0RB 5DS2A 4GIAA 3P4OB 4Y9CA 4KTEL 3VD9A 4HJGB 2XWTA 3K2UH 4TUKH 4LLMB 3VFTB 1MVUA 4I9WD 4CKVX 3VFPA 1CE1L 4GG8B 4N1CA 1CDUA 3EYFA 2G0KA 1ZGLB 1F1AA 4MJ5A 3NJFA 3QIBB 4RRPA 3W11D 3MV7B 4NKDB 3OHMB 4JVWA 1TENA 3T6WA 2WUCL 1KIPA 3II2A 5AOLA 2AKRA 4XWOD 5EO0B 1IKOP 3U9WA 3KLAB 3S3CB 5TD4A 4EQ3A 4A2MA 4I48A 3L45A 2H5UA 4N8CL 3ZDYE 3P3UA 1KC5H 1IM9D 1IQWH 1HZHH 2EE9A 2L4OA 3IE4A 4U4IA 1TYJA 3BW9A 4R96A 5HI4D 5DS1A 1HAUA 2BVYA 3NRPA 4OUUA 3QQDB 4AMKH 2CHDA 3NQIA 4ZS7L 5CGYC 5HXMA 1NUDA 1VEPA 5T8IA 3OB0H 1UH3A 4YSOA 5T5FA 4B9KC 4ZPVB 3TNMA 5JOPD 4N6RB 5H37H 3BWUC 1WZAA 4XPBH 5BJTB 2NPLX 3T5WA 2RA1A 2K4AA 1IM3B 1VERA 3T0AA 1OSEA 1PKQB 3ABKB 2KLTA 3D69A 3WSQH 1Y18B 3VD2A 3GMNA 4IU3B 4HG4K 1EVTC 3B1TA 2ZWLT 2VXUH 1VZGA 2AK4B 3BVNB 2CDEB 2FD6L 2ZYRA 5KVDE 5LAPA 3LZNA 4PY7A 3AJ7A 5CSGA 3IEAA 3FTUA 1ZLDA 4NKIL 3FK3A 4HUMB 4AMXA 3GRBA 1DDHB 1HJCA 4S10A 4L1HA 3FT2A 1EBPA 1QP1A 4LASL 4MDIA 4DOHE 1QACA 4PHXA 4HJJL 2H26A 2NUPB 1RI8A 5HJGA 3RVVD 3RUGA 3G9VA 4DP1X 5C6WH 4DUVA 1UA6L 3NJXA 3Q0HA 3IF1B 4HV8B 3GSNH 4FQQB 5BV7B 3T2QA 1T66C 4FZEH 1MPAL 4HXAH 4ALAC 3RGVC 4NPKA 3RI5K 5C3IA 3LQAH 2NY5H 3LRSA 1KGCE 2BINA 2R29L 4KJPC 4XMPH 3SY0A 3VWKA 4JPWL 2XVBA 3WHE1 4BSJA 3FC8A 4X7EC 2BSEA 3PV6A 3CDGB 3HZ3A 5IMMA 3RZCD 2QGDA 4LFHG 1JS4A 4FQPA 5DGRA 3H3KA 2XZAL 1FRGL 3SBWC 4UQ9A 2TSAA 3MUHL 2NUTA 4YHPA 2ZX5A 4NHUB 4HUXA 1F4WL 2EYRB 5DMGC 4L18A 2W0KA 4Q6IB 3NK4A 2VAJA 3QDGE 3STLA 3X11A 5CBAA 1J9TA 4KJWD 3I3EA 1AO7B 2DLFL 1BZ7A 1M71B 3QEQB 5SX5H 2Q3XA 5CJBA 3MJ8A 2ZCHH 3D2UB 3TIDB 1ID2A 1W6WA 2Z3FA 3KS0J 1KB5A 2QQKH 2G9HB 1A9EA 2B4CL 3LZFL 3VCLA 1I8IB 4GXUM 1J48A 3C60B 3ZO0A 2NY4B 4JR9L 2XY2A 3ISRA 1S7SB 3QULB 1U30A 4G8IA 4KMTL 3NQKA 3T0EA 3LNDA 1KJVA 5EU3A 2WM0A 1NLDL 4TOYL 5K59F 1GS7A 1SXZA 4B5ZA 4OQ1A 1OB0A 4Q56A 1S78C 4XN5A 2GVYA 1ZMYA 3UDWC 3TA3C 5FF6B 4MNGA 4QT5B 5CLTA 3VXME 3V4UL 5T1MB 4QJ4B 3TBVB 3B7TA 5EO1A 3WNLA 4TULH 2BNQB 3KYKH 4WJKB 3QYMA 3MRLA 2A99A 2I25N 1ZK9A 1FG2B 3DX6A 5A40E 2WXHA 4XXCA 2Y1AA 4JJ5A 4MD5A 1JIBA 5HGDB 4NUQA 4RSYA 1MEXL 1CGUA 4ZRGA 2ZUXA 2DYPA 3QQ9D 3IETA 4JZNB 3DK0A 3MO1A 1KBKA 2WIIB 4HWZB 1MCOH 4JB9L 4XRCA 4HS3B 3Q8AA 5BS0E 1QBML 2R2BA 4FXGA 2VRKA 4LSDA 1E28A 4MTMA 4GMSL 1NIFA 1E4XI 3QQ4B 3SYAA 2X3CA 5KJ4A 2UZPA 2NNAB 3U4EA 4EIGB 3ATEA 4ZPTB 2BSTA 2UYLB 4NAQA 3P3TA 5HHOE 3WJLA 2FIRT 1ETB1 3OHXB 4WI7A 3QXAB 4H1LG 4V1DD 3VI3F 5I1EL 3HE6B 2YBGA 2WJ7A 4Z3IA 3P77B 1A4KB 1T0MA 3FO0L 1OCWL 4WV1C 4XO9A 4PWEA 1A64A 2BRRL 4YEEA 3UO1L 5E00B 4PJDB 4EXKA 5IB3A 5IB4B 3VXRE 5BS0A 1OWWA 1BWWA 3P4NA 4J2QA 3A4FA 5C71A 2CIIA 1YEJH 2KI6A 3CXHJ 4A39A 3GXFA 1HAWA 1RU9H 3MRRB 5AYUH 1SNRA 1KIQA 4AQZA 4PIBA 4PMEA 4HUVA 4XXWC 1WH0A 2HRHA 3JWDH 1LEKA 1S3RA 2EUWA 1G7JA 5LAXA 4LT7A 4WJG3 1WIPA 3DHPA 4Z18A 3W2DL 3L3OA 2YMXH 4GLRH 1T21B 5AW9B 4U0RB 1HDMB 3AREC 5ID0B 1JPST 2VXTL 3TT3L 3F6LA 1AGFB 5E2TL 2XPGB 2HG0A 1CLYL 2VCOA 1KXQE 2NR6C 1UTDA 4NC0B 3GBNH 5BZZA 4DT2A 2NRDA 4Z8FL 5CGTA 3VI4F 1XV8A 1J0ZA 5I6XC 2V5MA 2WWMC 3DRTB 3P9LB 1OT4A 1UB6A 1YEDB 4BQBA 1EXGA 4FQXA 3ZDXF 4KAQH 1DQQB 3SJVD 3SKNB 4K5LA 5CEXB 2V17L 4WI2A 1CCZA 2PNDA 4HH9A 4PIRF 1IAOB 3MXWL 4TNVK 5D8JH 3GSOB 3S35L 1YUHA 2WN2A 1OE3A 3PXJA 4P4KC 1CXHA 5DK2A 4AJWA 3O81A 3ULVH 3U9UA 2Y7LA 4F2ME 1SPDA 2ERJB 3A67H 4K4KA 2MCMA 2Z6FA 2ZKXA 4N2AA 4NPYA 3F7YA 2VR9A 1KXQA 2XHNA 2E8YA 4OM1L 3L5JA 3NABL 2BIPA 4RDQF 4ZTOH 5TK2A 1JGEB 4CC4C 2AV7A 1BJ1J 4IJ3C 4UBDC 2YPVA 4WSKA 3GJFB 3QO1A 3VO0A 1BECA 2ATKA 5IP4A 1EWHA 4F80A 3S48A 3WNIA 3VD0A 1UWEL 4FQLH 1RZIA 5HGHA 2MOQA 3ECVA 3MCKA 4BUGA 4PJ6A 4O5LL 5BO0D 4LO9A 4NGHH 2NX5A 1C12B 2AMUA 4EN3D 4F7MB 3R8BB 3S6CA 4YMPA 3BZFA 8FABB 3PS6A 3SB3A 1BEYL 4CU7A 4R3SB 1MNUL 1HSBA 2H3KA 3CV5A 3GMQB 2XVKA 5INDB 3QFDA 4OZGE 4WWOA 4OY9A 1UJ3B 3N06B 5IBLD 2MPVA 2IH1A 2YD5A 3MKKA 3DO7B 4L3AA 4LRNH 4MMZB 4DZBA 2O5XL 2Q76A 1KCUH 1MCEA 1I7UA 2COQA 2E9BA 4Q97A 1LE9A 5F9WC 3NIGF 4FCHA 1R3JB 4WKZB 4LSQH 3U9PL 4E9QA 3D3VB 5G55A 1E9PB 2WGNB 4MJIA 4WU5B 5MERB 2XCMC 1G6RA 1U3YA 4XP5H 4MQSB 3NZUA 3U4KA 1PY0A 4NCC1 5JOFA 2PTTA 5FW7A 4KFMA 1PEZA 3ECBA 2BP0A 5E4EB 2DD8L 4AQEB 4F33B 1TO4A 4DP7X 5IIEA 1KGUA 1TZIA 3DDGA 3OGCB 3HC4H 2NY0B 1KCBA 2AQTA 1L0QA 5EFIA 3ZHFA 1ZHBB 3H9SD 4QRUB 2ITCB 4L23A 3UTTE 3K74B 5DTFA 3S3JA 1U2YA 2QV4A 5JYLA 1MJUH 2TAAA 4OZHE 4EZLA 3NCEB 4X9HA 2B2XL 5EUKA 1IC0A 1NM9A 5BUGA 4X6BA 2EABA 1TNNA 4DFIA 4OLUH 4G7YL 3O4LE 1IL1A 3X1GA 4ENED 1ZXQA 5L7XH 3Q01A 4HPOL 3P9MB 4MNHB 1O6SB 1U8OB 4M3KB 3FQTB 5I15L 1JHLL 3TU6A 3L5HA 2ENPA 35C8H 3IFPB 5K9OB 3VW3L 1N6VA 3CFTA 1GOHA 2OMWA 2Z91B 3CLFH 4PJ8D 2XWZA 5DU7A 3TIEB 4WI3A 1NFDB 2D0GA 4DGWC 3CVIL 2NYZA 3D25B 4GSDL 5AW8B 5EC2B 3DIFA 5AOMA 3OLIA 2ADFL 1A6VH 5IOPA 2K1MA 4NBZB 3UTTA 1TSRA 4OZHA 3W82A 3DV4B 4HCRH 1PX8A 5ANHA 4FTVE 4NI3A 5DYFA 1WWWX 2YJLA 3EKCA 3V0FA 2FJHA 4Q9BA 1G7QB 2BVQA 3I9PA 3GK8H 2FVNA 4M7ZC 3CVDA 4MVBC 5CUSH 4R26L 5B21A 4N24A 5T3ZE 2XKUA 3BUQA 4JZOA 3GSRA 4ZUUA 1L9OA 3V9CA 4ELME 1QNZH 3HMXH 4MKTA 5ITBH 2J20A 1RXLA 3UERA 1SM3L 5EWIL 1BX2B 1P84J 5LN8A 4DEWA 1ED3A 4DP0X 4Z7OE 1HTYA 4IKIA 5EU5B 3FQXB 1IKNC 4P2QE 3FRUA 2NY6B 3C08H 2UZIL 5DHYA 1SY6H 2PYEB 1N8ZB 1WEJH 4QOKE 3U0WH 2E9JA 3EH3B 4FFZH 1WE5A 1KCVL 3IKCB 3N0AA 2YPKB 1Q9LB 5ISZD 4G7VH 2DQTH 1BYNA 3TBYB 3TO4D 4ODWA 5IQOA 43CAA 1UXWA 2B1HH 2VERN 3HC3H 3GHBL 1J8HD 1O0VA 5EZJB 2IDFA 4YBLC 3HHSA 5F72S 3IDIB 1XL4A 3QA3A 1FO0A 1XCTA 3GKZA 4JO1H 4LSVL 5DJ6B 3GUFA 1JWSA 1N10A 4A6YB 5LXVA 5CEYA 1XAKA 4UAHA 1PMYA 3QZLA 5BZWB 2JKWA 1JGLH 5FO8B 3O9WD 4E9XA 3INUL 5C0RH 4KO6A 4P2QA 5CJ5A 1HOEA 4DGYH 3BGAA 1I1FB 4Y5YA 3EUDA 5C07B 4ZO9A 4ADGA 4HIJB 4AE1A 3OV6A 5IG7A 2QT6A 1IGYA 3S37H 2FSEB 2EC9T 5K1VA 1BFSA 1W72A 4JLRA 3C6LC 4R83A 2GI7A 1ZEAL 4HEPA 4P57B 4FOMA 4TVPH 3ZTCC 5E2VH 5T1LB 4ABWA 2WMPB 1RLBA 5F89B 1QTYT 2OULB 4RWYH 3WO4C 4F8LA 5JOPE 5KBPA 4GKZA 4MA3B 4MCNA 1Z9LA 2FEDC 2FIKA 3R0MA 4TVSa 1N64H 2GC4C 1T1YB 4YO0A 2VIRA 3EJYD 1UYWL 2Q87A 3Q5YA 2WYTA 1P5UC 3ZT6A 1IAMA 4PJEB 3TVMD 4YHZL 2IOIA 4N0FB 2HWZL 4L4JA 1T7YA 4HBCL 4FHJA 4HT1L 1H3PL 1IM9A 3IMUA 3T0BA 5EIIB 4EDXB 5EO9B 3VWJC 3OR6B 4HMCA 4JFVA 4IRZL 1THAA 2LU3A 4LOEA 4M02A 4N0YL 3WAKA 4JPSA 2BW4A 1JV5A 3KXFD 3PUCA 3ZTEA 3TJPA 2WB7A 4AW7A 4X80H 5J13B 3WL9B 3AU1B 3MLSL 3G6JF 3IYLW 3K6SB 2HMID 3TT1H 4HKXB 3LKSB 4XP6H 3AAZA 2Y7OA 2C3HA 3IKKA 5TH2A 1QQDB 1WO2A 1XMWA 1WBZB 3VMNA 1JZ8A 1MWAB 4Z1PA 4TNWK 2R1XA 1AHWC 2EEXA 1OARL 5SV4A 2FWSA 2I9LA 1UZ8B 4OT1L 3IWVA 2C1OA 4LLYB 2WCSA 5E2JA 5LG1A 1I75A 3GFUA 1I53A 3GMMB 4OLZH 5F7UA 4F27A 1G9NH 4ISVA 2VLJB 3QXWA 1Z9MA 5F3FA 1Z5LB 1RUQL 4Y7OC 4FADA 1DE4B 2APTA 1OOWA 3MVSA 4DEPB 1BV8A 3P3YA 2FJFB 1FJ1B 3DMMC 3KVDD 4Y9GA 3CUPA 1VZIA 4F93B 1MCCA 1CS6A 1LP9E 2GTQA 3CC5B 1CPUA 2P24B 1AGBB 5LNEA 3EJQA 2JI3A 4J3OH 5BW7A 3ZZLA 3ZRCC 2PR4L 3GJEB 3K80A 4I18A 5GJSH 3UIYA 1CFBA 3ZTJH 2LFGA 2M83A 3ORJA 2FLBT 3L3DA 3O2VL 1ODUA 3RZCA 3ZKSD 4KKNA 1ILSA 4GRMB 2H32B 1EO5A 4RCAA 3O0LA 1GGTA 5GIRA 4NAMA 5I8OH 2VZVA 5IMOA 2XFXA 3QHTC 4BWWA 1CF8H 5LXGH 1XGUA 2HX8A 2X4UA 3CDZA 3G08A 2WXQA 3LSOB 3W57A 2O26U 3DBXA 4ZMTA 4CW1A 2V8LA 2G0LA 5EORH 3SDDB 4ES8A 4ZTPL 1HCVA 3WY3A 5D2LE 3FB7A 4IU2A 1UD2A 2BX5A 4TKWA 1HZKA 3LEXA 1GYUA 5ANMB 3TWYA 3KMDA 3H7BB 3NBNA 3FF8A 4NS0A 4RMSA 5KBNC 1HEJC 1D6EA 5H4YA 3S98A 2YD4A 5C7XL 3ECUA 3UZVA 3FUNA 3PP4H 2KPWA 5HHMD 3I50H 2BLFA 1A6UL 5E08H 1UQSB 1A1NA 3O45B 4I3SL 1OSZA 3IMTA 2C9VA 4UTCA 4MRCA 5JR1L 4J6RL 3AMLA 3MV7D 2EUXA 2F7OA 4O2FA 3WLBB 3QG6B 4XGZA 2G2RA 2GTZA 2H41A 3V4VH 3JYBA 1AC6A 3LXUX 4PRPE 5HJBA 1LNUB 2APWA 1PZ3A 1A6WL 5AVXB 4KHTL 2VW7A 4IKJA 3ZMEA 1U91B 1WICA 3RGHA 1FC1A 3QW9A 4JFFA 1BM3H 3K8MA 2XBDA 4M93C 2EH8L 4FQ2H 2MRYA 5DRNA 3GSQB 5FFLA 3F12B 3ARBD 5E8OA 3ZKNC 4ZZFA 2JCWA 3SOBL 1BW8A 2QFRA 6FABH 4GO6B 4HUUA 2J71A 1DSFL 1UD8A 2BHUA 4WFFE 2MWCA 2A74A 3G5YB 2IANB 3V0VB 1FHNA 3VI4A 4WHTB 3VD1A 4KZDL 4YXKL 2WLKA 1N6QH 4KI1A 1E7VA 4J3BA 4ODVH 4D0DB 2DWSA 3HI5H 1IM3D 2GQHA 4V1DA 4YDIH 3U2IA 3GINA 4LEXH 5K9KB 3LPOA 5HDQH 5KOVC 3QJZA 2VH5H 2IV8A 4MXWL 1KT2A 1FLRH 3STZA 2AK4D 3QRGL 3D9AH 5DJ2A 4MS8C 1NEPA 3ILPB 4TQIA 4HKZB 5GRYA 3PY9A 1X5KA 2Q7YB 3MHZA 4E9YA 1ZD6A 4O02A 3VSVA 1HH6B 3VB9A 5L2KD 4U7KA 5CCKH 3BEVB 3R06B 2F53E 2XKNB 4KI5F 4RVBA 1AS7A 3LS5L 5I18H 4AEHH 3QIWC 2WANA 2Y7SA 2SEBA 4PJ7A 2DJSA 4XN4A 1LE5A 3AABA 5IHBA 2JCCA 4POUB 1Q0YL 2WNGA 3VFSA 4FC3E 1Q9OA 2A9NH 3QUZC 3DUUA 5ICXB 4L37A 1OM3H 4LKXA 5EIIG 1KN2H 1BG9A 1J9CT 1LJMA 1RMFL 5FYLD 3AQXA 5TK4A 1T1ZA 2VDKL 1KF9B 5CIPH 5F9JA 2H6PB 5C2BH 1L5GA 1Z2KA 3OJDA 2DL2A 4XO5A 2Z92A 1AO7D 2ISDA 3NJVA 1XF4B 3QEQD 3DO4A 3ARFB 4L3FA 1TQBB 2HG5B 5DSCB 5DJXB 2MSPA 4N0RA 1C08B 3SJVA 1SMDA 2H2SC 2XI9A 4HSCX 4N9OB 3CSYB 3C12A 1MHPH 3C60D 3W38A 5CLWA 2NY4D 4WDIA 4MZ2A 1GTFA 1KYDA 2PN5A 3AWEA 1ZT4B 2VMCA 4HC1H 2XWXA 3HNVH 3REWB 3SCMC 1NIAA 5IEHB 4DNLA 3FF7A 4U6HA 5DGQA 3VG0H 5BVJA 3GBEA 1V27A 5E6ID 1ZCRA 4Z7IA 1YEHL 2FDBP 2VXVL 3KS0H 4NDMB 5IT2L 3WXWL 1LQSR 2G5BB 3BUYA 4NN6B 2W0FA 1IGIH 3F65A 5T1DH 4EN3A 5C0DA 4NQDD 2Q8AL 2E6PA 2Y7MA 3L3IB 1OD7A 4U1NB 3ULAB 3RWHA 2EIBA 4QTIH 1E4KA 4D0BB 1B88A 5CLYA 4ZUWA 2EDEA 2CDGA 2ZXBA 3QAZB 1IC4L 2VR8A 2HFFB 3UBFA 3H9SE 1MIML 2AZUA 4Y2DC 5IK3B 2PCPA 1IFHH 2YAOA 4Z7VE 2E46A 4JVPA 5GRJL 3QDHA 1RJCA 2DQEL 1RFDL 2FNWA 2G4GA 1LO5B 1OTTD 1H3TA 2JIXB 1RUPL 3RPIA 4JHAH 5CILH 2ARJQ 3MRBA 5HHPB 1KWKA 1JTTA 4Y4FB 1MSPA 3QXTA 4UM9D 2VDQL 1KPUA 2DL9A 3A4AA 5CU9A 1BBDH 2C9AA 1GMEA 3MLZL 4H2AA 4ZAKC 3U2SA 1N3NA 2VLRE 1UM6L 5I75C 1IILE 1T7VA 1MJ8H 1AVAA 5F1SA 5I82A 1OAXH 4AQ8C 1WAEA 3GEWB 3H9SA 1MCPL 3VXQB 3ABZA 4TNEA 1ZT7A 3T6XA 4U3XA 5DHVH 1EQWA 4S0TD 3VRJB 4MLIA 3VU2A 2AJ3A 3SZ6A 1RZJH 5IQMA 5I1KH 2Y7QB 3GRWL 4AJYV 4FQHA 4N5UA 2IGFH 4I0PB 2YUVA 3KW7A 1Z32X 4IOIA 1NAMA 4G42A 1AKJB 4FQCL 3L95B 3CLEL 3LXBA 5TDPA 1G9MH 2OJEA 1OZUA 1CTNA 3OXRB 3VYPA 3KPLA 3WJMA 5AAMC 1GGUA 4PJ8A 4W9LC 1H0DA 4MMXC 4B27A 2H7WA 3V95A 4ZFOL 4XN9A 5T3XL 4LPWA 4HZLA 3FOLB 4XPHH 4BH7B 3QWRD 3CN3A 4IRSD 3RFZC 3IJSA 1IZKA 4KVNL 3FAWA 2IALB 1NMAL 4LEEA 3T2LA 4ZMOA 5E5MB 5D2NB 2VERA 4GAFB 2VDLB 1MCQA 1LO0L 1I1CA 3GPSA 5DJDB 4FFVD 1V3MA 5TF0A 5EEVA 1I1AB 2VN5A 1LD9A 1TIUA 5ISZE 4UZGA 2GIMA 1ZGLM 1EGJA 4DN3L 2XQYA 1A0QL 5D1ZB 4M00A 3PHQB 2WWNA 1S7UA 3CX5J 3H9YA 1RUMH 4PJGF 4DERA 4KX9A 2CU9A 3IMSA 4TL5A 4PJDF 2O5YL 3E3QC 4MB5A 1JPGB 4PJXE 1R75A 4PG2C 3P11H 5TPWL 5HDLA 3OKKB 4LCYA 4IYKA 4UT9A 1BVLA 4M48H 3ZDZF 3MOAH 4LSSH 4X5WA 4K7PH 1BQKA 1DLFH 1VLXA 2D3NA 4FG4A 3CFCH 3FTYA 3ARSA 1SXSA 4XVUC 5KJ7E 1S2EA 2UZXB 2BWQA 3KAAA 3HMWH 5T5FL 5D93B 5FA4B 1KYAA 2DQMA 4KXBA 3MNZA 4RZCA 3FJTA 3QI9C 4ZFFB 1Z66A 1EHLH 2Z8SA 3WN5A 3F00A 4JM2B 3M1CA 4ZMNA 5ISZA 1K5WA 4LARH 1U8MB 4XXDA 1RJLA 3TO4A 3FCUB 1M4KA 5JZ7C 3UYPA 4B9CA 1GGIL 1TMCB 3MYZA 4X6CB 1J8HA 4U6VL 3BQUC 4YFDB 4UOZA 5J6HB 1LEIB 3GLDA 4UT6H 3N1PC 4H88L 4D7BA 3WKQA 4NBXB 1H3XA 2OSXA 1GGBH 4JGUA 4ODXB 1ONQB 2BOBA 3MBEC 3I6GB 5IHZA 5AG9A 3C87A 1C5BH 3FCTB 3TBCA 1JF1A 2H3NB 3O9WA 3QPXH 2G60H 3D3VD 1BJ1H 2H1XA 3NA4A 3PXHA 3V0HA 4F58L 5KEZA 1PD1A 1B4JL 3KEHA 5F96H 3TCLA 1IC7H 1SBSH 3CSPA 4ZW3A 1T5WB 3B7SA 3WKNA 5HYQB 1ZT1A 2G3MA 1CT8A 5DLMH 1EAQA 5I66A 3SPGA 2A9ML 3CPUA 4PJFB 3KXFE 5DC0A 1ZS8B 4KKCD 4XC1H 4XPFH 3GRGA 3QUKB 1T83A 3O6KH 1U2CA 1JNHA 1IGCH 5CF3A 5D5MF 3AG3B 4UYPA 1I8UA 1T6BX 3A3YB 1YPZE 2Q7NA 3L9EA 2MHAB 1P2CA 1NL0L 4YHNB 1QUNA 2PW2B 3JZYA 4HETA 1MIEL 4ETQB 3Q1SL 5KSBB 3H6JA 1EZSA 2MCPL 3IU3B 3TVMA 2WOYA 2WVSA 4BFBD 2A83B 1QAWA 1H3GA 1DZBA 4K7FB 2H2PC 1AE6H 4ALAH 4GMTL 3D39E 1RZGA 4XX1E 1J88A 5E8NB 5E9AA 2AVGA 3DX2A 4GSUA 2V2XA 3WD5H 3CFJA 2XRAL 2RMNA 3G7TA 2F1AA 3H2WA 3ROLB 4UOJA 1W0YT 4XNYL 1Y7VA 1ZJBA 3FT0A 4C58B 1L7IL 3DROA 3QE5A 4PV8A 1I9EA 1KDIA 4UNUA 4UV4L 3WTXA 2YD1A 1HX0A 3EDKA 3GSUA 3RTLA 3MQIA 4WGVB 4QRPD 4RDBA 4FKEA 2A7BA 5D1XD 4LSPH 4LVHC 2Y2YA 3BAEH 1AR1C 2DQGL 4OCRH 1UD6A 3ZKMC 4JPIA 1SOKA 4B9YA 1DCLA 1T2XA 4G3YL 2QMJA 2XV2A 5D9SB 3ZR6A 2ATPB 5J1TC 4Z78A 1E2ZA 1DBJH 4JHBA 2W95A 3E2HC 2HRPH 5IVXB 4WFHD 5A2LH 3EJRA 4KV5E 5C3LD 3B1UA 2VGLM 2CHWA 5JPMA 1RK0A 4N25A 4QUOA 3ULUF 4KOCA 1GS6X 1QMUA 1UWXH 2HTKC 4YSPA 2I5YL 2H4EA 4JFHD 1R5IB 4IMLB 5KBKA 3U30C 5E8EB 2J8UE 4GFTB 1KEML 2IFFL 3CSGA 3QJSB 2YMOA 2YUZA 4D2NA 3WFZA 3G6AB 3K1KC 3RY6C 5TDOB 3KH4A 2IPKB 4JAMA 4J8RA 4LLWB 4MQ7A 4Y16C 2W0PA 4K3HA 2D03L 3LRMA 1T89A 3CD4A 5DJYB 4AT6A 3OBAA 2IQAB 4N86A 3BP7B 4YNYA 1UT9A 2ZAGA 2NQ3A 4U1HB 4UV7L 4P2OC 4YDVB 4ZXBD 4HS6A 4OCXH 2XTJC 4EDWH 5BRPA 1TSHA 3L9RA 3FO1A 3OTTA 2VUOA 2XQBL 1VCBC 1X4ZA 3B9KB 4E36A 3VE0A 2E7LA 2X4SA 3HZYA 5CBEA 4U6TA 4NQVA 2N59A 1OGAE 3EYVB 4K07A 4UTBA 4KMLB 4KITB 4YHYC 4NCC2 4KHXL 3IMBA 1R1CA 2BDNL 4H1LA 4C59B 2PW1B 2VLKE 3WJJC 5C07D 1EZVY 2A38A 4LQFL 1U8PA 3QWOA 4TPRH 1N18A 3DSFL 3IAGC 3WFHA 4P9HL 1F4HA 3P4OA 4HJGA 1UATA 3MZGB 3VFTA 2VC2L 1WFOA 4QF1B 4MXQD 2YSTA 4OZFH 1ZDSA 3IU4L 2WYHA 5T1LD 1ZGLA 4OF5A 1RLWA 2X0WA 5CNHA 3MV7A 4JQVC 1G1KA 1PNDA 4ZS7H 5GISH 4BFNA 1JZHA 1JGUL 2ED9A 4P23B 5CP3A 2BO0A 1JNLL 3EZ8A 3LRLA 5CR8A 5EO0A 4BKTC 3KLAA 2DLTA 1XD0A 4GRLB 3BUBA 3LKOB 2CNZA 1MW0A 4WI8A 5JW4Q 2DI8A 4JRLA 4HUKB 2WVTA 5L2KE 5DXWA 3ZMRA 2V9QA 3ARBA 2FD6H 3QISA 4G5ZH 5DA0B 1HINH 2NY7L 1OHZA 4F7KA 4Q2ZB 1YN6A 3QQDA 1JGDA 1N59B 3K5RA 4NKIH 2BRQA 1P9MA 3TURA 5DRWA 1FE8L 1FZJB 2XG4B 4C55A 4F24A 3UGXA 3QFJD 3OMIB 4LASH 4V33A 2C7FA 4ATTA 1FFPB 4NZ8A 3GC3A 1E4JA 2WPGA 3V4PA 2KPNA 5KANI 1CIDA 1IM3A 1PKQA 4Y2NA 1FDLH 1SDYA 3QORC 1Y18A 4YXLH 1OP5H 1M6OA 3T2OA 3P3RA 2BFVH 4UI2A 1GJWA 5FS5A 1L9RA 4UIKH 4HZ1A 4JKPL 5BVPL 1Q9WB 2AK4A 3UGUA 3BVNA 2WLJA 2DEYX 4MQXC 5FYLE 4QWWD 4WHCA 4JS7A 1DDHA 2P8MA 3KDMB 3WDHA 2VLJD 5L2KA 1OAQH 2Z1KA 3BKML 1O6VA 3EBIA 1YQVH 3ABGA 3H3PL 2NUPA 1FRGH 4RLDA 1OK8A 3BD4A 1AFVL 3FN3A 5KSAD 3IF1A 2EDDA 3HE7C 3GIZL 4IOFC 4HK3N 5MENB 3B9DA 1AQ8A 1MRCL 2DLFH 1P1VA 1AGEB 4LXFA 4PJEF 1BLIA 5GHWH 3OB8A 1CLZH 4X5PA 4RX4D 2FATH 4JHWL 2BIMA 1HXYA 1G6RL 2B59B 3CDGA 3LZFH 3CH1A 4G8FB 4NQUA 4Q9QH 1A21A 1FNSH 4JR9H 3QG7L 4F9LC 1U8NB 4KMTH 3HAEB 3SDAB 3VH8B 2QTEA 2F08A 4DUXA 1W0VB 4Q6IA 5IROD 5IQ9B 5B22A 3D0LB 4W9HC 1NLDH 3BPNC 1AO7A 2FTAA 4TOYH 3QEQA 4PJ9B 3M17A 4KQ3L 4F5CE 2VXQA 4WFEE 3SDDD 3TIDA 2V3EA 1FI8C 3ETBF 2WQVA 3KPMB 3C2SA 4BWUA 4HKBA 4NFBA 3ZVVA 2G9HA 2ZXAA 3SODB 1BAWA 3AS0A 1I8IA 4NQDE 3V4UH 5KUKA 2VABB 3C60A 3QULA 3GXUB 3BGFB 2N1TE 4XHJD 1X9LA 2Q9OA 3O3DA 4KK8D 1FV1B 3HBZA 2RBLA 4D8OA 3U36B 3UTQA 4DGVL 3PWPE 3CFMA 1JRHL 4OJFL 3TN0B 3C5ZD 4R0LA 3M86A 4NO3B 2EVGA 4JB9H 3DJZA 2ZKWA 5E6IA 2WD0A 4HJ0D 4RFNC 2I9TB 4QT5A 4P59L 5T1MA 3X2QB 1HEZA 2OYKA 4F5CA 4KNTA 1JD9A 2A6KB 4EXPX 2YS4A 1B0GB 1FG2A 3PWVB 2VR5A 2H0PA 4JUSA 4I9XA 2VLMD 4NQDA 5I1HH 2DM7A 4JDVA 1EHKB 5L88L 4JZNA 3F64A 2J5LB 4P9HC 3W39A 4BBWA 2QGCA 5FM8A 3CHXA 1X5HA 3SYCA 1OCWH 4LL9A 2WWKT 3FT1A 4NZUH 1KV3A 3HB3B 4B97A 5JIHA 4K7PY 3C2AL 3UO1H 3IJ7A 3AROA 3QQ4A 3WHXA 2CBQA 3IGFA 3REVB 2EEDA 3QT2A 1KN4L 4ZPTA 1A6ZB 2UYLA 3GBDA 3E8VA 3GD1C 1T1XB 3DIDA 4KDTC 4YHKL 1KZYA 3QXAA 4YHML 4CC1A 1HI6B 2YEVB 4UM9A 4AYSA 2NY2C 1M56B 3GTVA 2LW3A 5LJYH 3UAJC 1F11A 1T2QL 3ZTDC 4PGEB 4G9FD 3HI6H 4KK9D 5HVHB 3MLPA 5EU6D 2FEEL 2CJ3A 3K91A 3W2DH 4UT7H 1WFIA 2W81C 2F8IA 5G5DA 3K6NA 5IB4A 1D9KB 3AY2A 3M7OA 3RVUD 1MCRA 2CBOA 1GZHC 4MZIA 4ZMQA