2ZOLB

Crystal structure of h-2db in complex with the w513s variant of jhmv epitope s510
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
QKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Structural and biological basis of CTL escape in coronavirus-infected mice
pubmed rcsb
source organism Mus musculus
total genus 13
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zolB00
3LVEA 5F7KC 2JE8A 3HE7B 3LKNB 5FGCE 5K93A 1MY5A 3TWCL 5D1QC 5TF0A 5F89B 4MB5A 5F88B 4L3ED 4PV8B 4RFOH 4D8PB 3CSGA 3WJJA 5CSZB 1QFWI 3D39A 3MO1B 4K9EL 4EJ1C 1RVFH 4OBSA 2XN9B 4KQ4L 2AJYH 4A2LA 3K8LA 5E4EB 2AW2A 3FHAA 3MA7B 1AY1L 1S3KH 3REVA 4U1JB 3ILQD 4JFPB 4MNGA 1ZA6A 2BVOA 1IKFL 1P69B 2D7TH 4YZFE 1PKQE 1QQDA 4TVPD 1F8TH 1I8KA 1AGFA 2MQ0A 3K7UA 4Y5YB 5KVMC 2VR9A 4HX1A 3VXRB 2Y7QA 4K94H 1T6WA 2K7PA 3DX8B 4JFZL 4G6ML 5BVPH 2UUDH 2DI7A 4U0RB 3QB7C 1B0GA 4GKSB 5MEPA 1YY9C 1G7QB 1IAKA 2EDXA 1INDH 4KJQC 2BSED 3LKSB 4WO4D 3RPIB 4EBQL 2ICWB 2VXQL 4M4RA 5E8EB 4OLZL 3ZE0E 4QEGA 3ARPA 4OV5A 2DQEH 3PXJA 4JZOA 5KSBB 4JFFE 4IRSB 2CUIA 5IF0B 4HZAA 1MLCA 4KKBD 1Q0XH 4MS8D 3QJHA 5C6TH 3VGGA 4PS4H 1TQBB 2H1PL 1T1WA 1ZHNB 2DM3A 3OZ9L 2P5EE 3MGAA 3A67L 1T7XA 4MCZB 1S7RB 4ZYKB 1D3CA 1NFDE 5ELIA 2AK4A 4S1SH 4HIEB 3C5JA 1V3JA 2XYCA 3BPOB 4XPBL 2KZWA 4D3CH 5I30H 4J4PC 3BISA 1I8LC 1H9VA 1HIMH 2VH5H 5DJ8B 3RZCB 2B2XH 4K7FB 2CD0A 2DQJH 4QWWC 1BHGA 4MNQA 4Z0BH 1U0QA 3GSNL 2F8VA 1OVZA 5EZIL 5E7FA 1NGXB 4DGYH 5BZWB 5HVHB 1YN6B 1XGQB 4HUVA 2Q1EA 4WV1C 4KVNH 3KXFA 1H0DB 3LSOA 4ZFGL 7FABL 4FXLA 5IBTL 4GSDL 5JW5B 4K3DH 4CMMB 5J13B 2EYRA 4Z7VA 5IJKA 3E2HC 4Q2ZA 1GSMA 3LN5A 5DJ2B 3RGVD 5I73C 1L9NA 4CJ1A 1WWWX 5AD0B 2DQIL 4OZIA 4X4XA 4PRHD 1R5IB 3MLWL 2IJ0C 4CNIA 4ZDHA 1DVFD 3G5ZB 4LDEB 5F96L 3MRGB 1BQUA 3WMSA 3SDCA 1QA9A 2D3VA 3D85B 4RAHA 2NTFA 1RZ7L 1R0AH 4BZ1L 4YQXH 1GPOL 1KV3A 2ICEB 5IB2B 4DVBA 1F42A 3MRIA 2NX5D 1NSNH 4MJIE 1URLA 4WW2B 4OLEA 3P0YH 4DGIL 2I07B 2CRMA 4I0PD 1J0KA 4MQXD 5C0FA 4PRBA 1FVDB 5EU7E 5LGHL 1NH6A 5HHPB 4YLQT 3U1SL 3KYOB 4KVCH 2CK2A 4AEHL 2IH1A 5GHWL 5T5NF 4FXKB 2Y9RT 3WXWH 5TF1L 1X5YA 3GBML 4WJ5B 1IGYA 3RU8L 5F1OB 4LPYA 4WUUD 1DL7L 3L3KB 2WZPD 1ZT7B 1X5JA 3V0WL 1BVKA 1P2CA 1DFBH 4PRPE 4R4FL 3STBA 3G9VA 3VFUB 5GQBA 4J3OC 5J0BA 3VXOA 3HAEG 2AGJL 3KHQA 1R3LA 4V1DD 4LIQE 5DRWB 2XICA 5T3XE 4GAGH 5HYJA 4UAOC 3C5ZD 1CCZA 3U2SB 3WUZA 1OOAA 5TE7L 4KWUA 1YEIH 1SVCP 5HYSA 2CDEA 3M1BA 4MSWB 5D5MA 1FNEA 1QVOA 2JIXA 1JHTB 4ETYA 2IQ9L 4PJAA 3SE8L 4PRAB 3DURA 2LAGB 3MRJA 4NUGL 3HI5L 2HRPL 4DVRL 5E6IC 4P9HC 5AG9A 1L0XA 1DCLA 1JMXA 1F6FB 1WZ1L 4KUCF 5JQ6H 3QHFH 5DJDB 5IK3A 1UEYA 2ZOLB 5CKAA 1TCRB 1KJ2H 3HFMH 1IGCL 1UYWL 2GJ6B 2J88H 4Y4HC 5DVKA 5F7WC 3TO2B 3IJYA 5E2WL 3GB7A 3MQIA 1KYOK 2A77H 3B3IB 3QUKA 1SM3L 3QFDA 4HKJA 43CAB 4GMSH 1T80A 3IJSA 3IETA 5HVGB 3IAQA 2ERJB 3FO0H 3QUZD 1OAYL 2H2SD 3HR6A 2WUBL 1PYWA 3HE6A 5D7SL 5D7IA 3PHQA 5IB1A 5IJVA 1W0VB 4OCYL 3QXVA 1X5KA 1KB5B 2FX7L 3VGBA 2D7QA 4XVJH 5KS9F 4R96A 1A6TA 4L4VA 3GRWH 4TSAL 4U6YA 4PJCB 2MPAL 5CIPB 1OP3K 1EO8L 1V05A 4HWBA 4JPVH 1YPZA 5C07B 5ACZA 1TZHA 2CLVA 3NAAL 4M62L 1G6RB 3K46A 1QFUH 1VACB 5IHUL 4MZ2A 2CIIB 2XA8H 1DTUA 1RHFA 3MRQB 5DUMH 3GO1H 1CFNB 3BQUC 3L3IB 1KJ3L 2ATPA 2EDDA 1S7VB 2ZUTA 2RBLA 5FV2A 4I2XA 4OB5L 5C09E 3K8KA 3RWIA 2DLGA 2KKQA 3GI8H 3QJFA 1N5AB 1W72H 2X4SB 4FHBD 1WEJH 3RIAF 1S9YA 4JHWL 4FTVD 5MENA 3TO4C 1AO7D 3KLHC 4MA8L 4QHLB 1XR8B 1XF2B 1RK0A 1B4JL 4NKMB 4HC1A 1WCBB 2A2QT 3HA0A 2C4FT 5D9SA 2YBRB 4O51A 1HXMA 3MNVB 4N8VB 5DD3L 1TVBB 2OLDA 4WNQA 4M7JL 4KDTA 3BUTA 1RD6A 2MQ3A 4XVUD 3JWOL 1JZ5A 3SGKA 3MLYH 5CMAB 1ZVHA 4JANB 4AIOA 4ORZC 3BIKA 3QQ9C 4K3EH 5EZOH 1RIHL 4EN3D 1A6AB 3MRHB 2DN7A 1FLTX 5KVEH 2XFXA 2ORBH 1AGBB 4HQQH 1QKZH 1H15A 2F5BH 5DRXA 2W92A 1JTTA 3CSYB 2BMKA 3GSXA 3LRGA 1RUQH 3U7YH 4PJAF 3GJFH 4JRYE 5D93B 4XCNA 1IGML 1UC6A 5CZXC 4I9WE 1WITA 2YRLA 4AQ1B 2GI7A 4LCCB 4MWFB 5DK0B 4D9LH 4TUKH 3QUYD 1A8JH 4RAUB 1P4BL 5D7LD 2XTJD 4MQTB 4ETQB 2CPCA 1BQHG 1DBKH 1JPGB 4QRQB 5B21A 3RWEB 4BK5A 2Z31D 1D5IH 3LPWA 3BP4B 3LEXA 4QNPF 4ZFFA 3H6JA 2FYYA 3MREA 4PB0L 1ZMYA 3X14A 2VDPH 2AXGA 1MFAL 1Q9WA 1IILE 5DWUH 1YQVH 1RZ8A 3AS2A 4HK3J 1RUAH 5JXEC 4IOSD 2GTWB 3ARBA 5CEZE 4PJ8D 1Q1JH 1NFIB 1IEAB 1S9XB 5D7IF 2NY0B 4NUJA 4LSRL 4M3JA 5EOQL 4HIJA 1FP5A 4XPFH 3ZE1E 3M8OL 5C71A 1GRWA 2ARWA 3IDXH 3MCKB 3RTQD 2QHRL 2BVTA 4RMQA 3KR3L 1NGZA 3B5GA 5EU5B 3WNKA 3CXHJ 3QFJA 3QH3A 4XI5D 2XZAH 5L7XL 2VAAA 2R2HA 4XVTL 4P5TA 2BVPB 3MJGX 5CINL 2FEDD 1KC5L 5JMRA 3UAJC 3EO9H 4LARL 4PJ9B 3ZSSA 3P2TA 1HH6A 1TQCC 1B9ZA 3P9MB 2QSTA 4OLXL 3U46B 3BP6B 4OKDA 5B3JE 1EXUB 5IEKB 5GGRA 5DJCB 1T0MA 3EHBC 2W91A 3PWPD 4JCMA 5CLTA 5AUMB 4QGYA 1D6EB 3NIGE 5GRVK 4E41E 4POUB 4R97B 1EDQA 2PO6B 2EEDA 5I74B 3HRZA 5CZKA 4TULH 4FQJH 5K9QI 2F9BT 2ICES 4YBLC 3QQ3B 1G7LA 5FO7B 1OF2B 2FR4B 4XBGA 3PIQA 4EXPX 1I1AA 3VFWB 2R56H 2LTQC 3SDDA 2W0KA 4LEOA 1CK0L 2BNRD 2UWEE 1ZHBA 3DYOA 2NY2D 3RWJB 2BVUA 2WIMA 3RBGA 1JI1A 2NZ9D 3DGGA 4KJPC 1J0JA 5EU6D 5DMJB 1MFBH 4PJBB 4HV8B 5E9DA 3IU3A 4GW4B 3O3EB 4M6NH 4O4YL 2AABH 4P23A 4HAGA 5GS1A 2I60L 3E3QC 3NABL 3RIFF 5I1DA 4W6YB 5D1ZC 5TQ0L 3EOBB 4H1LB 5LQBH 3VW3L 4DCQA 3H42L 1JHLH 1Q9LB 2A74B 2NY6D 1C08A 3L7EA 4U1HA 5EORH 4KZEH 1EAPB 4KK6D 4MAYA 1LK3L 5TE4L 2ITCB 3ZKXB 5I16A 2VDOH 5TE6L 2CR6A 5I1JH 1JTPA 1SJHB 4KZDL 1VADA 4ZXBC 4QRUA 3H9SD 4ZNEA 2PTUA 4O58L 2P5WB 3KNBA 3AS3A 5J8OA 3BPLC 3FT3A 4WHYH 1FG9C 4KPHH 1OL0A 3HI1B 3IDYB 3MR9A 4YFDB 3PV6A 4HUWB 1LILA 4FQHA 1OT2A 3TBWB 3DUHA 1OSPL 1NAMA 2VN7A 5I71B 5HI4D 1HKFA 4Y1AB 2NR6D 1HEZA 5K59F 4HJ0C 2P45B 3CX5J 1NGQL 4FP8H 4WGWB 2Y6SC 3GMMA 4LBEB 3NH7H 1KCKA 3MJ8B 4A2MA 4PGCA 4NCC2 3ZKNC 3MJ7A 1OAKH 3QDGD 1DEEB 2JTDA 4U7MA 2C3GA 3UYPA 4PG2A 4M5YL 2X05A 1MCEA 4I48B 3T0EC 5I8OL 3ULUF 3I02A 4X6CE 2NMSA 4XCFH 2AXHA 5J9PB 4NRXB 1KFAH 3U9PL 5GIRA 3AMLA 4UDUA 4C56E 1JGVL 2V7HA 1HE7A 2X4UB 3VRJB 2X2YA 1I7TA 4JR9H 5DS8B 4ELMA 1MOEA 4NKDB 4CW1A 4L4TD 1MPAL 3UTZB 4G6FD 3MRRA 5IKCA 4PJCE 1XZ0B 3WIHA 2QQNL 3ZL4L 1CLYH 1FHGA 5L2JA 1IQWH 3CLFH 3D25B 4HMCA 3RWCA 3C5SB 1A7QH 5AZ2H 1ZHKB 5DK2A 4RX4A 3DUSA 2ZUQC 1P7QB 3V6FA 2VLME 4R2GD 1S9KC 3GIZL 4WHTB 2R1WA 2VZOA 4JFXA 2H3NB 5GGTH 5T3XL 4OLYL 4NO2A 4N0UB 1YMHB 1SBBA 1JNJA 3QI9B 3ILPB 2DM2A 4HKXB 3QDMB 2AI0H 3QXDB 1EERB 3PE9A 3O6ML 3EOAB 2GK0A 5BMFL 2C26A 4JM2C 4R4NC 1IC4L 3OJDB 4FQ1L 3BP7B 4H20H 3MV9D 2LVEA 3MXWH 3GNML 2A9NL 2R0WL 4YUEH 2C4XA 4N90E 1M7IA 3T2NL 4HH8A 4M93B 4LSTL 2FLBT 3NZHH 4RDQF 5DK3A 4KKCD 2FHCA 4X7SH 3ARED 4GBXD 2JJSA 3B2VL 4XRCA 3ARDC 5JOEA 1QLEL 1TITA 1VFUA 2X89D 3LIZH 4G8GA 3ARFA 2YZ8A 3O2DL 4PJHB 1G7JB 4YPGB 4LPXA 4OJFH 3W9EB 4HJJL 3W2DL 2VDNL 2WLZA 1H5BC 2X4OB 2NY4D 4OQTA 1MCIA 3QSKB 3IXTB 3O2VL 2C3VA 4Z7UF 3UCRA 1T6VN 2VLRB 5IESH 4GRWF 4WDIB 5EIIA 2XA3A 5IGXH 1QZ1A 4WGVB 5I75C 1IZKA 1DJSA 3PHOA 4P59L 2O5YL 5EBMB 4PGDA 4P46D 4OFKA 2EH7H 3WDJA 4QRPE 1QSEA 5LAXB 2P8PA 1E6JL 5HHOB 2Y5TA 1OQXA 1FRGH 5CBAB 2VDML 4OLVL 4BFGA 4G42B 3OKDB 2EDWA 4PTUB 4ZTPL 4HK0A 4LAQH 5FUCE 2X4PB 1BBDL 2XOTA 3FFCB 4FFVC 4L3EA 1M6OB 3UX9B 3VXNA 1S7WB 4UDTB 5T1LA 4HIHA 3OHXB 2DM4A 5J89A 5FGSA 3VFRB 1MNUL 1IT9H 1CGWA 2BNQD 3QDJE 1TZGL 1IMHC 2X6MA 2M2DA 4TPRL 4Y2DA 1D5MA 4PGJA 1DBMH 4JKPL 1D5BB 1BJ8A 3MYZA 4KI1A 2FX9L 5DF0A 4OFYA 3FB8A 3ISWA 2Z92A 2CGRL 1T20A 3HUJA 4YHPA 3PNWB 1QLRB 1DQJA 3LPGA 3UTTE 4U1SA 2ZUVA 1QLFA 3DX6B 4OM1H 5MI0B 5IOPB 1YJDH 5TGBA 4YXKH 5FHAL 2GJJA 3DUUA 1S8DB 4I13B 5CGTA 2EDOA 3D2UD 5LXGL 4QRRB 2L7JA 3TVMA 3EJZC 1TPXB 4FQLL 3QWRA 3WFBL 4OGXH 1SY6L 2IPUK 5FYKD 4B0MM 5FUZL 3BHBA 5F7FA 4EI5A 2O5XH 2X40A 4ZS7H 5FECA 2BOCB 5SWSD 2DF3A 3I50H 4JJHA 1J12A 3C6SB 4APQB 4MX7A 2D7MA 3PDOA 1UFUA 3R0NA 1BD2A 3K3QA 4FRWA 4JFDA 3H7BA 4UOW1 1KT2B 3WYRA 1LEIA 3D69B 1INQA 4H26B 4FZEH 1SJEA 5KG9A 4X99B 4RFNB 4PFEA 4R26H 2R0ZH 2CKBA 4IJ3C 1HSAB 1BOGA 2Q86A 5EU7C 3GKWL 4N0CC 1LP9F 2N7AA 2VITA 4NO0D 2FZ3B 5JLZA 2CXGA 3BESR 3TT1L 5IVXA 1MHEA 4CADA 4P9MH 3GHBL 3O8XC 2YOCA 2F8XC 2OJEB 1ZTXH 4NQDD 3SDYL 3TZVB 3D9AH 4C83A 1N6VA 1B2WH 2VL5B 1T4KB 3S96B 1UWEH 1U9KA 3SDXA 3WS3B 5IIEB 3VDAA 5BS0D 3FO9B 4FG6C 1T22B 4POZD 1CDIA 3RGVA 4RGOL 1FAIH 3FQUA 1YYML 1PZ5A 1YECL 4P5MB 1MCOH 3U36B 5ESVB 2VERN 3WNMA 4UILH 4Y16C 2XKNB 1D5XA 3E0GA 4KGLA 1NCTA 3QCVL 5FM5M 5BV7H 3BWAB 5F97E 1K4DB 5EUOA 2YPLA 1RURL 4PY7B 2FSEB 4NCDA 2I9TA 3C60A 3RI5F 5DJXB 4AK1A 3VXUA 4KV5E 4JDVA 2R4RL 3O3AA 4L9LA 5IB5A 1DZBA 4WWKC 4PGEB 4OZGE 1KN2L 4OF8A 3L3JB 3FTGB 3TFKC 2Q7NA 5T1DH 3ARXA 2EE3A 3IDMA 3SY0A 4WU5A 2DJSA 3VXQA 4KKNA 1KJVB 3FMGH 4FQ2H 4L1HA 4ORGA 1MJJB 2EXWD 3PGDB 1ZS8A 4MA7H 1RUKL 2QLVB 3HUJF 2ZNWA 4YDVB 1SBSL 4WFHD 5L8KB 5L2KB 5KTEH 4Z0XB 3EJYD 4J8RB 1NUNB 3JWDH 2WINA 4JB9H 2WANA 3T3PF 2YXMA 1OAXL 5C0GA 3EO1B 3WDHA 5B38G 3O6KL 4U49A 3B5HA 2AS5M 5GGUB 4V1DA 4Z7OE 4OCWL 4HH9B 5JW4N 3G04B 1AQDB 4GAYB 4L8SA 2ZG2A 3V6ZA 5B8CB 5BQ7A 3UO1L 2X4RB 4J3TA 1K85A 5ISZB 5DJAB 4R4BB 2FGWH 5JHLH 4YXLH 4Y19B 2DWDB 2EEBA 3LEVH 4NQUA 1DQDH 3CC5A 3MNWB 3BDYL 1C16B 3Q0HA 4H0GA 3SO5A 1U92A 4RRPG 2MNUA 2R69H 4D0CA 1RZJL 1ED3B 3TC9A 3RVVC 3BZEB 1A7RL 1IM3A 3VG9B 3MLSH 2VC2H 1YNKL 4RRPA 1INEL 2IALA 4P0DA 4GKNA 1SQ2N 1O7VA 5HJ3B 4HGWB 1L7IH 3J8F7 3I3EA 4WI3A 3U79A 3QISA 4YHIA 3RNKB 2NLJA 1FLRL 1HXYB 4X6DB 1CR9L 1ZKAA 3L5XH 4LSQH 3SE4C 1N26A 3ME0A 3QUZA 4ODHL 1J8HD 4N8PA 1VFOA 2J3SA 5BRZB 3SDXF 1A6UH 2PW2B 1F4XH 4PJHE 5T1KA 5C6PB 3DNKA 3QG7H 3CPLB 1A9EB 5FYKH 2AXFB 4XNMB 4I18A 4ODUA 2ZCKL 5EOTA 2JB6B 1Z6JT 2HWZL 3EDJA 3V9FA 4FABL 2F54B 3IRZA 4UB0H 1GIGL 5CGMA 2HMID 4H8WC 1YA5A 3KPQA 1D9KD 1G6VK 5L9DH 4TRPL 2VAJA 4EVNB 1JGDA 4NHUA 4YFLF 2Q20A 3RX7A 5L0QB 5EULV 4QTIH 2P43B 3GUTB 2VLKD 1KB5L 1U36A 3UJTL 3V5KB 5AG8A 1N6QH 4GXVL 5EUOF 3UTSE 4OD1L 3TV3H 3VXMB 5J3HD 1NBQA 4G6AD 4L29B 5D1XC 1FFQA 1XGRB 4LF3B 1IM9B 1G6RL 1JF1B 1W8NA 5BO1L 1G7HB 5FOBA 3CUPB 4P4KA 1WC7B 1A5FL 4BFBD 4XHJC 2X70A 3LV3A 4G9DA 1AO7A 5C08B 1DUZA 2DLEA 4OCLC 3UJJH 1JPTL 2F5AL 4I3RL 4U33A 3O4LD 4ACPA 3OMZA 4PJDB 2IPKB 4OZHE 4MGXA 3QO1A 5CJQL 5E0QA 1U3HD 1EVUA 2PYEE 4WW1A 4Y4FC 4NQED 3ESUF 2ATKA 4PTTB 2ZJSL 3WSQH 3O9WB 1FC2D 1T5WB 4MA3A 5ICYA 1FVEB 5HI3D 4MJ5B 5EN2A 2ID5A 3AC0A 4XP9L 5E6IA 2P42B 2CK0L 4N0FA 1F4HA 4HFWB 5FDWA 2BOBB 3ARYA 3O6FD 1X4YA 1ETZA 5C0AE 1OQOA 2WBJD 4XAWH 3BIAX 4ELKA 1B90A 4G8IB 5L6YH 3LN4B 2OR8A 2MCG1 4BZYA 5EA0H 4UNVA 3FB5A 1GZPA 1WLHA 1LO4H 4H25A 2AJSL 3W0WE 4AG4H 3LS5L 5JHDB 4QRRE 3RUGA 4QRSB 1DLHB 1H8NA 4KQ3H 2VTFA 1LK2B 1MIMH 4U6VH 1I7RA 3IKKA 4QHMB 3MRBB 3CFEB 4OIBA 4XX1E 5IROC 3OJVC 5D7LA 4G7YL 1T2QL 5C0CE 3U0TB 4TTDC 4K3JH 4KKAD 1NBVL 4UV7H 1UXWA 5F72S 4XHQA 1MI5B 1ZSDB 3RVTD 4O02L 3MRCB 2X42A 1A7PH 5LGJA 2FDBP 4X6EA 3BQUA 2GITB 5HGDB 3TA3B 3S3JA 3VFOB 3CVHH 5JXAL 1TCMA 3HNTH 5MP6H 5H94B 1P4LA 5DQJB 1FZOB 4NKOA 1A47A 5EO9A 1OTUD 2VXTL 1FNAA 2K1MA 2GSGB 3VWJB 1H8OA 2SEBB 4NNXB 3GSNA 3MLRL 4QKXB 3U83A 3TNMB 4MD4B 1XGPA 4M1GL 4MB4A 3C87A 4GW1A 5GRYA 2BSSA 1A1NB 5IVOA 1EEZA 2AJZA 4HF5H 1U93B 2ARJA 4F58L 4YE4L 2X4NB 4S2SA 2EECA 3Q6FB 5E95B 1RZJC 2APBA 4TNVK 5E70A 2V9RA 4LLQB 4UV4L 1OAZH 1MFCH 5CEYA 1RI8A 1II4E 1BWWA 1YYLL 2ZUUA 3MROA 4JQXA 4Q74A 4O5LH 3VMOA 2IC2A 3ZHLA 1P7HL 3DMMA 2GYSA 1FBIH 3PWPA 1BVZA 1UACH 3L5HA 4NRYA 2F19L 3LKQA 1MAJA 4KRLB 4E0RA 4FNLH 2QEJA 2KQNA 5JA9A 5DT1H 2UZYB 1ZA3B 2PXYC 4X4YA 3O2WL 1OAQL 2AK1H 4WFEE 4HBCH 2RFXA 3GI9L 1Q9OA 4KK8C 3FOLA 5LCVH 2XKSA 3LQZA 2Z8SA 3MGTA 1QYGL 3KPRD 4KTYA 5KVGH 3QUXC 1U8IA 3ZDZE 2EE9A 4PJEA 3V4PH 3DROA 4Z78B 4X7TB 3ULVE 4QTHB 1F4AA 1BGXH 1W0WB 4M9OA 4L3AA 3ZDXF 1CT8A 1HZHL 4PR5A 3JUZA 4MA1C 4MJ2A 1F4WH 2ESVD 4F7EB 4PJFE 4DAGL 2EZ0C 3QZWA 4JDZA 4C4KT 3CXDL 3KYKH 3G5VB 1AJ7L 1K4CA 3RUGF 4HCRL 5BZDB 4KK9C 1G7IB 2PTTB 1OM3L 1S9VB 5JXEA 1NJ9B 3SOBL 3TGXA 3FQTA 4IHOA 5DUBB 2DQCH 4KJYA 1RZKC 3MOAL 3VI4F 3C6LB 3H9SA 3JVGA 5EFIA 3HAEB 4O2CB 3RAJL 1F58L 2J2ZA 3WEXA 2BY2A 1ULVA 3SGEH 3DV6A 1TTFA 4RFEA 4S1QL 1YEJL 3X13A 2EDLA 3L6FB 5SWZB 4JY6A 5CJBA 4EKXA 2ADIB 3PWUB 3BH9B 1NANH 4EUPB 3HKFA 1FZMB 3F12A 1NCDL 5DHYB 3NTCL 4JO3H 4KJQD 1S7TB 4HG4K 4DOHB 3O45A 4RBPH 3DXAA 2Q6WB 2ZP0T 3QIBC 1KTRL 2EDNA 1OARL 4KUZL 1C5BH 1HHHA 3QXTA 3M17A 1GGIL 2VLJD 3BZFB 2MHAB 5EOCH 3ZZ1A 1WWCA 5I8CB 5GGSA 2LU3A 5JQHC 1C5CH 4Y5VB 5DUPL 4LL9A 4LDLB 4YEFA 1L7TL 2A1WL 3IAPA 3X3FL 3P4OA 3ZT5A 3KPSD 1WTLA 1QRNB 3IU4H 1P5UA 4L4TA 2V5MA 4GQ9L 2RB8A 1CFVL 3O0RL 2F54E 3IKCA 4CVXA 1JF5A 4JO4H 5I76A 2GJ6D 2HTKD 4LSPH 4MCYA 2DBJA 1U8OB 5IW1A 4YK4C 3D3VE 4QWWD 1TVHB 1NCCH 4HW6A 1T3FB 5IEHB 1GOGA 1FFNA 5ID1A 1HYSC 1ZE3C 4JJ5A 4BFIA 3MLZH 4G9FD 1NBYA 5IB4B 1DDHB 3DARA 5T33L 5CFHA 4F8TA 5DQDH 4OI9A 4LFHG 2P8LA 5J1AA 4HS8H 4WRLA 5I1CH 1R3KA 5F3HA 4H88H 3PQYA 5FCUH 3KWWB 5HHXL 1IC7H 5DQ9A 3NN8A 4YHML 1JYNA 1MCCA 5E99L 3UPRA 4FQIL 4UUJA 1TDQA 4K7PH 3OG6B 5CP7A 3S34L 1FV1A 1NKRA 4S0SD 1F90L 5C07D 4MAUH 3HPLB 5FUCC 4F2MB 4HDIB 3RL1A 3A6CL 3FQRB 1AHWC 2XNAA 4OM0L 5FYKU 2A6DA 1T0PB 1T21A 1CFQA 1I85A 3H7LA 1KUMA 3FOMA 1XIWA 1HQRA 4GBXA 5A2LH 1IKNA 2NY0C 4HWEL 4NPYA 4RMTA 2YA0A 1F6AA 2X89A 2DWEA 1CDJA 3RWDB 1JTOA 5FA4B 2ZUXA 3VFSA 5CSGA 4UT7H 4LNRB 1EMTH 4HULB 4GG6A 4U1NB 1FJ1A 3EYFB 2V17H 5I1HH 5D72H 1MFEH 4G7VL 1IQDA 4WTXA 3PGCA 1UJ3B 2H32A 4NGHH 3KPNB 3RL2B 1FIGH 1CFSB 3H0TA 4UIMA 5GGVL 1V3MA 3CVIH 5DYOA 4X8JB 5B22A 2CKBH 3P73A 2BHYA 1UVQA 1N64L 3L3DB 3OXSA 3AVEA 5DEGB 4RGMB 5E5MA 3ECBB 3OGCA 2ADFH 5DVMA 5IHBA 5ITFB 5TFSL 1FN4A 1U3JA 3GJFK 4DW2H 1GC1C 1MI5E 4JFQA 4X9BA 1FVCA 5D71H 3TIDA 4LCYA 3PABB 3EYVA 4UT9H 2AK4E 4UTBL 4KJWD 1KELH 1FZKB 4XZUA 4AENB 25C8L 5FA3B 4JREC 2IAMA 1BQHB 1M4KA 1DQLH 3IDJB 1ZEAH 5F7MC 1VKXA 2CLZA 5GS2D 4U1LB 3STZB 4MNQE 5KVDL 1VEPA 1ZLSL 3KDMA 1BQLH 3MV7D 3BH8B 1NC4A 5FYJD 4YGVB 2ADGB 4OZFG 4PJ5D 1DBJL 3EDFA 2Z91A 1GL4B 1Q9KA 1MQKH 4U1MA 4K55A 3V7AG 1A6ZA 1N6UA 2ITDB 3KXFE 5D2NB 1AI1H 1BEYL 4Y4HD 3ARGC 3UBXI 4OZFA 3EFFB 3KYAA 3C8DA 2ICWJ 1YEFL 4NO5B 1GGYA 5MHSE 3RNQA 1J5OL 4Z7VE 3HZMA 1B3JA 3C9NB 3V4VH 4CVUA 1VGEL 4JG0H 1J1OH 3WHXB 1PKQA 3B8SA 1Q0YH 5CILL 1CICC 4OZIE 5GSVB 3VE0B 3D18A 3P30L 4JQVC 3A6OA 4HPYL 4JPWL 4D0DB 5ENWB 2QQKH 3B6SA 3ABZA 2VQ1A 4P2OC 1KTKE 4XP6L 1T1XA 4HGMA 4IMKC 1Z0NA 4LK4A 3PL6B 4K7PX 1CI5A 3F58L 4I3SL 1CL7L 1WUNT 5GXBB 4X5XB 2E7LC 4JKWA 3C2AH 2P8MB 4HLZG 4NQCA 4WEBH 3MV8A 2VZ1A 1JNHA 5GZND 4NO0A 4AT6A 1HCVA 1PD6A 4YAQB 3GM8A 4XC3H 2D0GA 5F3BB 4JFFA 3L1OL 4Y5XB 4HAFA 5M94B 4GG6F 3TYFA 1PG7W 3GSQB 2PO6D 3O3BB 5F7DB 4CVZB 5EPMB 3A0OA 4NQDA 4EDXB 3P9LA 4XNUH 3EYSL 5DLML 3KLHD 4PREA 1EJOL 4OT1H 4WTZG 5LVEA 4GKOA 2WWKT 4YHOL 2LFGA 1ONQA 3IXAA 5KSAA 1U95A 2NZIA 1J8KA 5DURD 1TFHA 4PLKD 3VXSA 2HJFB 4WTZA 5CHNA 5HYJE 3LZFL 2VIRB 4D9RD 5CCKH 1NCBH 1MUJA 3MA9H 4N68A 3SKNB 3UBXG 4O2FB 4BYHA 1DQML 3ZYOA 2HFEA 1IGIL 3QQ9D 3OKKB 1RIUH 2AAVA 2UVFA 5D5ME 3BUYB 4ZTOH 2DIAA 1MF2L 3N9GH 2OX5A 4W4NA 1D5ZA 3QI9C 2D03H 4FQQB 4CN1A 4HMDA 1JK8A 1RULH 4DOHE 2VISA 4M61B 2NY5C 3WNNA 1G84A 4XCYA 5FCSH 5DO2C 1MCLA 5DEFA 4ZUSB 2YXFA 2XV6B 3ALXA 4RWHA 4XCEA 4JFHE 2NY7L 5JOFA 4QLRA 3X3GH 3AXLA 4QCIA 2P5WD 4JM2F 4YWGH 1JPSH 1G7MB 4X83A 4XPAH 5D7KE 4H5SA 3CFBB 4PJXB 1JWMB 3THMH 3UDWC 3F5WB 3B83A 4X7EC 3WUWB 4Y1AD 7CGTA 5D7IE 3LH2H 1FORL 2YPVL 2EH8H 3QEQB 4M7LH 2AV7B 4J3VA 2OZ4H 4YZFF 1DANU 2H26A 4LGSB 1E4KC 1FNSL 2AEPH 1JWSA 1CD1A 2E9WA 4RMVA 4FFWD 4XMPL 3E8UH 1YPZE 4P2CG 5A2FA 4LKXA 3DO7B 4AMKL 1A22B 1I4FA 2NPLX 4ZAKB 5GS0C 3T0AA 5TDNA 3MBEC 2AJUH 3KHOA 1UB6B 1E6OH 3LKRA 4K8RC 1PSKL 12E8L 1NAKL 5GRUH 3TH4T 2QADB 5HPOA 2WNGA 4P3CH 3W39A 1S7SA 5KSUB 4I2XE 1FO0H 4BH8B 1NANI 4UU9A 3FO2A 1ZLWH 5FYJH 4J6RH 3TN0C 1EHNA 4YHLL 3U0PB 1XGUA 4M02A 4P9HH 1I7UA 4Y7MA 4OCRH 1P6FA 5AZEL 3UAJD 3ZE0F 4KI5E 2HFFA 1N5YH 4F9LA 1J1XL 2GSIB 3FRUA 5MENE 2D31B 4PV9A 3KJ6H 3N85L 3CD4A 2IG2L 4X0KB 1U8HA 4MMXC 2X1PA 1DP0A 1RUPH 3EHBD 5F7HA 3TBTB 2BRQA 4KXZH 4RGNB 1J8HA 4F9PC 2YRZA 4NJAL 5F6IC 4L8BA 4X6BA 5HGGS 5CKGA 2PETA 3QDMD 2OMNA 1KJMB 3O11A 5FO8B 1NC2D 4L5FH 4NZRH 2WUCL 4HUXB 1JHKL 1WQVT 3RWGB 5J6HA 4OF3A 4P2RB 1OTSC 1KTDB 4NWUL 2VXQH 4PJIB 3WFDH 4G80A 4EEEA 4LSUH 2B20A 2AV1A 3SGJA 1CGSH 1D9KA 2H2PC 5CJXC 1P53A 3RDTB 3OKOA 1BBJB 3O2DA 4BSVA 3GSOA 1NCWL 1A6VH 3NPSC 1EPFA 4MLSA 4NM4H 3BE1H 4DN4H 1EZVX 1KN4L 4X9IA 5C0BA 4POYA 1EGJL 1DLFL 4F8QA 5ILTH 1KCSL 2FJHA 2X4TB 1S5HB 1PVHA 1FH5L 4IRZH 5E2VL 4NNPH 5GJSH 4UIKL 3GM0A 3L3GA 4P5KB 5D1ZD 3GMRA 4KRPB 2I9LA 4ZSOA 1WBZA 3NCEB 1SMOA 1YY8B 3T4YB 1HHGA 1WIUA 3DV4A 3P11L 2CUMA 5IV2B 5DGQA 4NKIL 3HCVA 1I1CA 2VDQL 1BZ9A 2YUXA 1U3HA 1NEUA 5F7YC 1GZQB 2ZUSA 4ZXBD 3V4UL 1HKLH 4NQEA 1YQ2A 3T0BA 3DIFA 3IFNH 5I18L 2YD9A 3GFUA 2J6EL 2XTLA 4GG8A 5FYLE 3MCG1 5K59E 4ZFGH 2DQUL 5TQ2H 2NY1C 3UTQA 4DZ8B 2WP3O 5IBTH 1E28A 2DYPD 2XRAL 3IDNB 4PJ7A 1RZFL 1YMMB 1FE8L 3HE7A 3LKNA 2HKHL 1EEQA 1YEEH 2XQBH 5F89A 3ULUE 3FFCD 5F88A 4PV8A 2BXZA 4D8PA 3VD4A 5CSZA 3MO1A 1TTGA 2B4CC 2DQIH 1KPVB 3QFJE 3ZKND 1KJ2B 2XN9A 1WFTA 3NFSH 3MA7A 3ZYZA 1HH9B 3T0ED 4U1JA 4JFPA 2APTA 1FYHB 5EC2A 5EDXA 5I19H 3BGFC 4A6YH 1RSFA 4M43H 4WO4B 4Y5YA 4NOBA 5IR1B 2FX8H 1QSVA 4XNZC 4XP1L 3VXRA 4DGIH 3DX8A 1RIVL 4XXDB 5HHME 4GMTL 5D70L 2XXMB 3F7QA 3LAFA 2RCSH 4UT6L 1SY6A 4GKSA 3RIAK 4NO3B 3WJLC 1G7QA 2VNCA 5ALCL 5EZLB 5C1MB 1PEWA 4GRLC 5FKAB 3LKSA 3MLTB 4RSVA 4Z7WB 5TF1H 4WFGD 3RPIA 1F5WA 1KEML 2ICWA 5E8EA 4Y4KC 2KH2B 2ZSWB 4B5EA 5KSBA 5JA8B 4IRSA 5IF0A 5D1XA 4GAJL 1FGVL 1M05A 5AYUL 5SV3A 2AGJH 3ULVC 5EU4B 1ZHNA 1A02N 5J56B 4MCZA 2FO1A 4APQD 5E9DE 1S7RA 4ZYKA 4HS3B 1W72B 4HIEA 4R4ND 2VOTA 1FFPB 1T66C 5BVJB 1MRDL 3U30C 3K4ZA 5DJ8A 3RZCA 3QEGL 4ZFOB 4LKCB 2YD5A 4K7FA 3X11B 4EDWL 1EVTC 1A3LL 1CG9B 5IFAL 3OF6D 1NGXA 4JRXE 1F3DJ 3ARDD 5BZWA 3UC0L 3REWB 4Z8FL 2F58H 3UYOD 1YN6A 1XGQA 1VERA 3R0MA 1ZLUH 4DVRH 4RMUA 1EO7A 4N0YH 4J3WA 4PRHB 3QG6B 2DAVA 3T4AB 1DVFB 1H0DA 1QFWL 1AQKL 1TJHH 2YMXL 1AGDB 3TZVD 5KVFH 4MVBC 3VFGL 3IB4A 4LPTA 1KBGL 1UYWH 3KJ4B 1A3QA 5JW5A 3CFDB 4CMMA 3G6DL 4Q6IC 4XBEL 2NX5B 4LU5H 5I1EH 1DBAH 1GXEA 4OI7A 4Z77B 3TT3H 3GMOB 4F33B 3X12B 3AM8C 4I0PB 5AD0A 3S88L 4YHNB 1OAYH 1R5IA 3GJFB 1MRFL 3G5ZA 3MRGA 5D7SH 5HBBA 5FUOH 3D85A 4MYWB 1FSKB 4BH7B 2ICEA 5IB2A 5IT2H 1MQ8A 1WGOA 4OGAD 1LO5B 4MJ4A 4RNRA 1ZT1B 4WW2A 4LCWE 1RY7B 2ZWLT 5JW4Q 3WLWC 2I07A 4WUUB 1FVDA 5FEBA 1KGCD 2B0SL 4NN6C 2BHZA 4PRIB 4ELME 4OAWB 2WIIB 3OAYK 5HHPA 1HINL 4HIXH 4KAQL 3KYOA 1RUML 4HS6B 5CS7A 2BVEA 3QUMH 4FXKA 3STLB 5E8PB 2GUOB 4FQCH 4LPCA 3T2QA 4FFZL 3C5ZB 2UY6A 4ALAH 4WJ5A 1EFXD 5B38B 3L3KA 2RQ8A 1ZT7A 1A0QH 2H9GA 2OBGA 3VFUA 3VXPB 1I3RB 3VA6A 1FL5A 4FOMA 2Y4SA 5C2BH 2VZ3A 1CLCA 4JGJA 1TMCB 3NCJL 4ENED 3I6KB 5DRWA 2IPTL 5DD3H 2EKJA 4WUKH 4NSKB 4M6OH 3L9RB 5KSBF 3U2SA 2GQHA 1S7XB 3SKJH 1JE6A 1I7ZB 3S35X 3EJZD 3DETD 4WTWA 1GAFH 2D7PA 4MSWA 1AGEB 3BMWA 3FONB 1JHTA 2H32H 4KTEL 3PF2A 1HHIB 1KIQB 4PRAA 2W07A 1J0YA 3EYUH 3UJIH 4M1DL 4ERSH 1BQSA 2EDRA 2CSPA 3OB0K 1MCQA 4JFED 1B0WA 1FPTL 2GK2A 4J3SA 2ZSVA 4P2RE 5DJDA 1D6VL 3RIFK 2ZOLA 4PJIE 1MJ7H 1TCRA 3SJVE 4JPKH 2GJ6A 3TO2A 4ZUVB 4N0CD 4MXQC 2RAMA 4HJGB 3B3IA 4K71B 3DHMA 3F7YB 3DSFL 3QRGH 43CAA 1P4BH 5FYJU 2V2XB 2EE6A 5F9WB 3UTPD 1IL1B 4U05A 3O8XD 5E2TH 5FK9B 3I2CL 5GJTL 4LLDB 5GZOC 2RHEA 4X7FC 4L9DA 5BRZD 2EIDA 4MNHB 3ZKSD 1O5DT 4K3GA 4ZD3H 1JPST 1W0VA 2OMBA 2BC4B 4PB0H 1QSEE 4DQOH 1J88A 1KB5A 4OIIL 5IFHL 2XKUA 1RZIB 4M9PA 2RR3A 1NUDA 3LKOB 3WIFB 1Z3GL 4PJCA 5CIPA 4FG6D 5ADPH 3O4OC 5C07A 4LSDA 4M7LT 1XF4B 1G6RA 4NZDA 1PZUB 1VACA 5B3JF 1P5VA 3F7VB 4L3EE 1BVLB 2AJXH 2CIIA 2HKFH 3M8OH 3DTXB 4GLRH 1TXKA 4NZUH 4Y16D 4XWGL 1CFNA 3L3IA 1YZZA 2HH0H 1BIIB 1S7VA 4KXZI 3VXMD 1A7OL 1K6QL 3PP4H 4WW2F 1J86A 5I1KH 4TSBL 1BFVL 4TVSa 4TVPE 1N5AA 3LDBC 2X4SA 1MJUL 4XPTH 4N8VG 3KPPB 1E4WL 3PGFL 5CINH 5KOVC 2UWEF 1XR8A 3B9KB 4IDJL 4QHLA 3TFKD 1XF2A 3HUJE 4NKMA 5DJ6B 1WCBA 4EN3B 4PYGA 2YBRA 3MNVA 4XTRD 4N8VA 1TVBA 1V5JA 4XB8A 1QRKA 1MEXL 2W1NA 2D0HA 2QL1A 1BX2B 5CMAA 5CUSL 1ZGLP 5J11C 4LSSL 3U9UB 3UZQA 1FZJB 3V6OA 4ODVL 4YHYB 2OSLB 5T3ZL 1A6AA 3MRHA 4S1DC 2XQYK 4M03A 3SDCC 3QUYB 4CGTA 3BXNB 1L6XA 2XTJB 5CSBA 3QIWB 3H3PL 1NMAL 3Q6GL 4P4RB 1FGNL 2HFGH 1XGTB 3CSYA 4JFDE 2Z31B 1LDPH 1XF3A 4FXGB 5HGAB 5T5FL 5ADOL 3O6LH 3VMPA 1QFPA 3D39B 1IE5A 1JNLL 2Q8AL 4U7SA 4LCCA 4MWFA 1MELA 5DK0A 2OI9B 4RAUA 1JRHL 5I8KL 5IVXE 1QHOA 2A9ML 1MH5B 4PJ8B 4ETQA 1KYOJ 4TOYH 1JPGA 4MNGB 4YDLB 4QRQA 3RWEA 5F6HI 1WT5A 1J05B 2HJLB 2NY3C 3BP4A 4NOFA 1BAFL 3RTQB 2VDLH 4UZGA 5TE6H 2ENYA 4HBQA 4X6CF 3EZJB 3HMXH 2GTWA 1NFIA 2VXUH 1IEAA 1U6AH 5F7EH 1S9XA 1PJ9A 1JYWA 1G1YA 4OF0A 3FZUC 3E6FB 3MCKA 4IRJD 4QHNB 1LEKB 3N1QC 1RJLB 4PJCF 4K23H 3L95B 4OFIA 5EU5A 1QFWM 1HQ4B 5LWYH 4OSUL 4JY5L 4LLWB 5EUOE 1XT5A 4HGKC 5HPMB 1U58B 2NX5E 3LY6A 3IDIB 1LQSR 2BVPA 3VXUE 4GAFB 3SO3B 4OCXH 2YD6A 5ID0B 4PJ9A 5FM8A 3P9MA 3KLAB 4HWNA 2CKNA 2AJVH 3U46A 3BP6A 5IEKA 4JRYD 3OAUL 5DJCA 5E08L 2JB5L 4NN5B 4I9WD 5AUMA 2VYRE 1D6EA 1GOHA 3MLXH 5I1LB 1R3HB 2NY2B 5JW3L 2PO6A 3IFLL 4ZG1A 4AEIL 5EU6B 3ZL4H 2FRGP 2IH3B 3QQ3A 4ZUUB 5FO7A 1OF2A 1BREA 2FR4A 4YFEA 2Z4QB 3V52L 4WVRA 5J12C 1ORSB 3HE6C 3VGHA 5BW7A 2A6KB 3VFWA 3B8YA 3QXUA 4ONFL 4V1DE 4EXKA 4LIQH 3RWJA 5T3XH 1JF6A 3DVIA 3G08B 4KFZC 2NY6B 4JAMB 5CEZD 5C0EB 4PJBA 3ZTJH 4HV8A 4HCRA 4DKEH 3CFCH 3LN5B 4RFOL 4GW4A 3O3EA 5KS9B 4H1LG 1HILB 1CXIA 5J1SC 3O6MH 2KZ1B 4XWOC 1IC4H 2AJYL 4BELD 1FL6B 2XZQH 2N7BA 4LVHB 4GXUM 4NCC1 1MIEL 4RAVB 3ZT6A 2D7TL 3EOBA 4H1LA 3GNMH 2AP2A 4YBQC 1Q9LA 2HRLA 2A74A 1F8TL 2NXYC 2VUYA 3QAZB 3GKZA 5JO5B 4ODWB 1MCSA 4LSTH 2B1AH 5JDJA 1EAPA 4M6MH 3U0WH 4UQ3B 2ITCA 4K94L 4KI5C 1QLEH 1LNUB 4NBYB 1CICA 5BVPL 2OXGA 2QTEA 5TPWH 2EYTB 2P5WA 3GHEH 3QDGB 1M1SA 2YC1B 4JQVA 3QIUB 2B7DT 3MRDB 4TTDD 3HI1A 2W0LA 3AROA 3MX0A 4F37F 1INDL 1B4RA 4E41D 1WK0A 4KDTC 4Z7QE 1QBLH 4PPTA 3TBWA 4N5UA 2J5LB 3SCMB 4Y1AA 3SGKC 5A3IC 4AYFA 5ALBH 4NKQB 4U1IB 2JK5B 1P2CB 2DQEL 3U82B 4LBEA 1G0XA 5CP3A 3MJ8A 5C6TL 2CRYA 4PS4L 1DEEA 4G6FB 2ED8A 1CD0A 3HZVB 5I15H 4I48A 2BFVH 1AE6H 3P4MB 1H3WM 4S1SL 5J9PA 4NRXA 1DUYB 1NDGB 3VWKB 4JDTH 2R15A 4JVUA 4D3CL 5GGQL 4QOKB 5I30L 4S1RH 1HIML 3VRJA 2X4UA 4ZTPH 2VH5L 2B2XL 4F7CB 5I17B 1VESA 5DS8A 1UH3A 4R2GB 4D0BA 2DQJL 4NKDA 1W2KT 4BQ9A 4PY8J 3UTZA 4Z0BL 2HG5B 3SGDH 3RI5K 3QEUB 1CN4A 1XZ0A 4CAGA 1P9MC 3HLAB 1LDSA 2E3VA 4GRMB 2WQ8A 3D25A 2R2BB 3C5SA 4FTVE 4WI4A 4RCAA 1AO7E 4KVNL 1ZHKA 3WXVH 5E6ZA 5DHVH 1P7QA 4LASH 3WD5H 2VDRH 3MNZB 2V6HA 3MV9B 4WHTA 2WW8A 2H3NA 3SDAC 1EEUA 1O0VA 4K3DL 5DRZB 1OWWA 2QKIB 2C7UB 4N0UA 5BV7B 3NCFB 1T0NB 2P47B 3QI9A 2EDBA 3ARBC 1X6LA 3AREB 3ILPA 2VE6B 4HKXA 2X10A 3ARUA 3QXDA 5F21B 2JKXA 1JPFB 3EOAA 4X9GA 1CQYA 1X5FA 3OJDA 4AEFA 5AYQA 3BP7A 3ZDXE 3ULUC 5H37H 4EQ3A 1R0AL 5FFLA 1U8MB 2AEWA 4PJBF 4YQXL 3QUXD 2VN4A 2NY4B 2CDFB 3GIVB 1MREH 4H8WH 2Y06H 4X4MA 4L4VB 3WKNA 1NSNL 4R3SB 4U6YB 3G6AB 3RVWD 3P0YL 1H3GA 3VGAC 2EO9A 4P5TC 4KU1A 3RUGE 1A1OB 2CJUH 4OQTL 5EB9A 4C56D 4KVCL 4PJHA 1G7JA 4P46B 5FGBA 4YPGA 3U7AA 3W9EA 5B39B 2R23B 2ATPB 2IAND 5D7LE 2X4OA 2Q8BH 3SHSA 3WXWL 3IXTA 4N5EC 3RWIB 2ILLA 5AWNL 4KK9D 1AD0B 1NL0H 3PL6C 2VLRA 1BF2A 3QJFB 3EIFA 4TYUA 4WDIA 1EJ6A 3TT1H 4YNYB 1DFBL 5DMGD 1ZLVK 5ACLA 1GJIA 1BECA 4NT6B 5FO9B 3AB0C 2HTLD 2EYSB 5I6XC 5E1AB 5EBMA 4X80H 2R2EB 3OR6B 9CGTA 2VLMD 5LAXA 1I1AC 5HHOA 1QFHA 1EX0A 2VABB 1OAUH 4Y5XC 4KV5F 4GAGL 5CEZH 5CBAA 3Q1SH 1MCHA 2BNQB 1MHPH 4G42A 4JZNB 3OKDA 4P99A 3RJDA 3ZHDA 1P7KB 4CRPA 3MODH 1IAMA 4N0RA 2X4PA 1YEIL 3FFCA 1M6OA 3KVQA 1S7WA 3DYPA 4UDTA 4M48L 2FECI 4P23C 5F7NC 3OHXA 5GRJH 3WO3B 3QIBD 5GS1C 1YEHH 1X4ZA 2HLFC 3VFRA 3RA7H 4R8WH 2P48B 4PGBB 3TNNB 3IT8D 2IWGA 3QCVH 3F62A 5CJOH 4WU7B 1OPGH 2I5YH 1RURH 4K2UH 4W6XB 5JQ6L 3T77B 4JFOB 3OSKA 3QHFL 1D5BA 1QP1A 5AAWA 4U6XB 1Z9MA 5DA0B 1KJ2L 2ZPKH 3D2UB 3HFML 6FABH 1L6ZA 2QSCH 4Z7OF 1MCFA 1N7MH 3PWPE 2A77L 3PNWA 1QLRA 1JP5A 3DX6A 2DBLH 4GMSL 2C3WA 5SWSB 5CJXA 1BLNB 2FBOJ 3FO0L 1A7NH 4LHUB 4KDVA 1S8DA 1U91B 3FT2B 3WIIH 4LRIC 4QRRA 1CE1H 4EIZC 1MFDH 1SMAA 4RISL 4XVJL 2BNRE 1S5IH 4JN1H 2FO4B 1OAXH 5JORB 3GRWL 4QRPD 1UB5A 2W9DH 4PJEE 2BOCA 2X5PA 4PG2C 2DMBA 2DQFA 4Z95L 3T04D 4U2ZA 1ADQL 4APQA 3C6SA 5DVNA 2XA8L 3D0VB 2BJMH 5EBLA 5DUML 1KT2A 3D69A 4H26A 3QHZH 4LQFH 4X99A 1QSFB 1HSAA 3I3DA 1BF8A 3GI8L 1CZ8L 1SJXA 4JO2H 2FZ3A 3D48R 4HWZB 4OV6F 1W72L 2Z35B 5BS0B 1RZJH 3BEWB 3ROOA 2FH8A 1WEJL 3DWTA 4XT1C 4PJHF 1NMCB 5ITBH 2R1YB 2OJEA 1QPXA 3WV0A 4BJLA 4ZFOL 2B1HL 1X6NA 3H9SE 2MWCA 3TZVA 5E1HB 2QADC 2XPGB 1T4KA 3S96A 4L8CB 3VGDA 3UTTD 3WS3A 5IIEA 3OKMB 4PY8I 2JCCB 3I75A 1QSZA 3FO9A 3MYJB 3DYMA 1FLRH 1T22A 3V8OA 1CR9H 3MLYL 3UBXB 3V7MA 3INUH 4P5MA 1G9MC 2GJZB 2G9HB 3U36A 4XP4L 5ESVA 4K3EL 3DXAE 5EZOL 2XKNA 3V2AR 5KVEL 1VENA 2ORBL 4MXWL 2EIBA 1A64A 4HQQL 5K9OB 3SDDB 2ZZUT 5D7JB 4M1CC 3BWAA 1K4DA 2F5BL 3F8UB 4PY7A 3Q5YA 2FSEA 1WBYB 1RU9H 1RUQL 5DJXA 4X9HA 3U7YL 2JJSC 3LEYH 4F7TB 4Q9BA 5LBSH 1TNNA 4X5LA 2OYPA 3WE6B 1R24B 4PGEA 1FNLA 4OZHF 2PR4H 1HHJB 2OJZH 3FTGA 3SE9L 2JELH 2KUTA 4IDLA 4L4TE 3ARFC 4D9LL 4TUKL 1PKOA 4OD1H 4XBPB 1KJVA 5IHZB 1JMZA 3JV6B 3PWJB 4WI9A 3CVHB 1D5IL 1OB1B 1MJJA 4TQEH 3PGDA 3G9AB 5E4IA 4PRNB 4YDVA 1RZKH 5KBNC 1A5FH 1CTNA 4EZMA 5L2KA 2VDPL 3CH8A 1E27A 4NM8H 5DZOA 4Z0XA 4J8RA 4Z7UB 1CXEA 1A3RL 1I9EA 4LVNC 4JCLA 1YQVL 2R0KL 3EO1A 3EGSB 1RUAL 4JN2B 5H2BB 5C0DB 5FOJA 5GGUA 1Q1JL 1MVUB 3EW3B 3PQYE 4HH9A 5JTWA 3G04A 1AQDA 4GAYA 3HC0B 4XPFL 4JHBA 4M00A 1OCWH 5B8CA 4O2EB 2X4RA 4RMSA 4LGRB 5DJAA 5ISZA 4R4BA 3RGHA 5JR1L 1NEZB 2CMRH 1T7VA 1A7BA 4Y19A 3TBVB 4HZLB 2DWDA 3MNWA 1C16A 1KENH 3OPZH 4BQ6A 2OQJB 2CK0H 2XZAL 1J0HA 2D2OA 1ED3A 3BZEA 4NRZB 4P2OD 1MFNA 1PGRB 3EO9L 4CJ0A 4YO0B 3PWLB 3WHE0 3OKEB 5H35B 2AJSH 3ES6B 4Y2DC 6CGTA 3KG5A 1JGLH 3LS5H 4FFYH 4JLRB 5HJ3A 1RJYB 4HGWA 3AM8A 4LVEA 5D2LB 2EEAA 1K5NB 3QYCA 4JZJB 3QNYB 5IFJB 3RNKA 2CIKB 1HXYA 4TULL 4X6DA 5KN5B 4NZTH 4FQJL 3HPJB 3BD5A 4HT1H 3UZEA 4WHCA 4RGND 3I6GB 3ET9F 5BRZA 2VLKB 3CCHB 2PW2A 2R56L 2CDGB 3WO4B 3V6FB 3CPLA 1A9EA 4O02H 3TVMC 2AXFA 4XNMA 3BEVB 4J12A 1KULA 3QT2A 4KKBC 4LSVH 3VG0H 4MS8C 2F54A 1LVEA 2KQMA 3QNZB 5F9OL 4XC1H 2Z93A 4EVNA 2FHFA 4M6NL 4M7KH 2AABL 3IRPX 3GUTA 3BPNC 1WICA 3V5KA 3RJQB 2B5IB 2VB5A 1OGAB 3O4LB 3VXMA 3V5HA 4CMHC 4L29A 1A9BB 5LQBL 1XGRA 4LF3A 4OLUH 1KCVL 1IM9A 2BNQE 4KRNA 1JF1A 1L4IA 1G7HA 4IIQB 4G6KH 3CUPA 4KZEL 1WC7A 4KRPD 1JNNH 2Y36H 4ODSL 1LP9B 2VDOL 4GS7C 1BFOB 2J6EA 2UZIH 5C08A 3S3SA 4XPHH 1CGTA 4HFUH 3ZDZF 2BERA 3E6HA 5DO2D 4PJDA 5F1SA 2IPKA 4KPHL 3ULVF 3O6FB 3RWHB 2WBJB 3QHTC 3VH8B 4MD0B 1AP2B 5D96C 4PTTA 1NCNA 3O9WA 4PJFF 5EIIB 5AAMA 1T5WA 3V7AE 4B50A 2F19H 2XWTB 2M26A 1FVEA 3RGVC 4MJ5A 1VFMA 4FP8L 3VI3E 3UMTA 4JPIB 4AY0A 4NN7C 1YMMD 2ZCHH 2FGZA 5FYKE 3TH3T 2BOBA 2CO6B 3GI9H 1EUUA 4G8IA 1MHHB 3LN4A 3Q48A 4XCFL 1GC1H 5SWQB 2BVQB 1KFAL 3C60C 4KY1H 5A2IH 1CYGA 5KAQG 4DGVH 5JHDA 1I3VA 4QRSA 1DLHA 4JR9L 1OGTB 4L9LC 4JE4B 2NXZB 4NQCE 1I3GH 1OP5K 5GS0D 5HTSA 4QHMA 5HVWA 3MRBA 3MV8E 3UTSD 4M8QB 3CFEA 4TUJB 1F13A 4K8RD 3GBNH 1CLYL 4J7RA 3U0TA 4FQXB 1A4JB 2A73B 1IQWL 3CLFL 5CEXB 2PYFB 4HCRH 5AZ2L 3TN0D 4OFDA 2DKUA 1OM3H 1S9WB 4QXGH 5KANG 1D5MB 1MI5A 1ZSDA 4NQDE 3LD8B 2E7BA 3MRCA 4X6DF 1JYXA 3VRIB 2H6PB 4K3HA 5GGTL 4PJGB 5ANMB 5HDQH 1T20B 1J87A 3LQAC 2GITA 5HGDA 1DQJB 3MUGB 3TA3A 1F2XK 4ODXB 3U4BH 4NP4H 3VFOA 2W9EH 5BS0E 5H94A 4ZUWB 2PYED 5DQJA 2DQDL 2A0LC 4L8SC 1FZOA 4PIRF 4JO1H 3VXSE 1OY3B 2GSGA 3VWJA 5HSFA 3NGBB 1M7DB 1T89A 2SEBA 4YC2B 4H20L 1CDCA 3WDIA 3MXWL 4MD4A 2BDNH 4YUEL 1J9CT 2X1OA 2X4QB 3VFVB 1A1NA 4HSQA 4EI5B 5C0AD 2J4WH 1U93A 2H2PD 1ZLUK 5IVZB 3Q6FA 2IBZY 2G75B 1B6UA 4IBLT 1EV2E 4LLQA 3LIZL 5GPRA 3W0WD 5DUPH 1UM6H 3FN0H 3IDGB 2CKBB 3ZE2E 2OTWA 3KPRB 1OTTD 3OX8B 1CXFA 5IESL 5IGXL 3IFOB 4P3WA 1CBVH 4R0LB 4WFHE 1XCQB 3H8NA 4PJDF 3T0DA 3NCMA 3QUZC 1ZA3A 5F7UA 3N06B 2EH7L 2ESVB 1U2CA 5D1QB 4I18C 4GW5B 4C54A 4Z78A 2C1PB 4X7TA 4QTHA 4QY8B 1W0WA 4LAQL 2OCFD 4NQVB 2BCKB 2CQVA 4LLAA 4Q0XH 1KXQE 3ZO0A 5CD5D 4F7EA 5JDSB 1LMKA 1F90H 3OWEA 1ORQB 1IT9L 3G5VA 3A6CH 4PRID 5JIHA 4OM0H 3HMWH 3QWQB 5C7XH 1MRCH 3K4AA 2XACC 1G7IA 2PTTA 1S9VA 1DBML 4XP5H 1NJ9A 2FATL 4P4KC 4N1HB 5TH2B 2NY5H 4LCIH 3WN5C 5DUBA 1CU4L 5C86A 1YEKH 5E00A 1JGUH 3C6LA 3HAEA 4O2CA 3SY0B 4JVPA 4NHCL 3TCLA 4EUPG 4OM1L 2AERT 4YHZL 1VFAB 2VLJB 2GEEA 3L6FA 4YXKL 1J8HE 5SWZA 2ADIA 4MB3A 5HGBA 3PWUA 3BH9A 4K9EC 4EUPA 1FZMA 3F65A 5DHYA 5D4QA 1S7TA 5FIEA 1CGXA 3V95A 1PFCA 5HD8C 3KPSB 3JUYA 4Q9RH 4MXVE 4MQ7B 1CWVA 2O5XL 4ZS7L 1EIBA 2J8OA 1MCKA 3CMOL 3I50L 3BZFA 3J7HA 2BNUB 2HN7B 2MHAA 1WZLA 5I8CA 2VLKE 3L3OB 4NC2B 3VCLB 2OK0H 4Y5VA 5C0BE 1KXVC 2R0ZL 5GS0H 4Q97A 4G9FB 2C4FU 1P1ZB 4G6JH 1R3JB 4HXBH 1K2DA 1QRNA 1T66D 3DRQB 3BKCH 4K8RH 4WV1B 3ARZA 4HWUA 1IEHA 1NGYB 1YN7B 4R7NB 4Z7VF 1U8OA 3QCTL 5DMKB 1TVHA 4ZSOE 5IEHA 2Z31C 2BXYA 4Z5RB 4ONHB 1ZTXL 4OZIF 1DEDA 1ZHLB 2PCPB 5MERB 1AD9B 3E2HB 4YX2H 2WM0A 3CMGA 3D9AL 4MJ6B 5I73B 3O4LE 2ENSA 1B2WL 1DDHA 3L5JA 1UWEL 1VFBB 4NQEE 5F93C 1A14L 2EXYD 4ZPTB 4MVBD 1TJIH 4PJ8C 3KWWA 1UKSA 1FAIL 2MTPA 3QPXH 1NGWB 1H3XA 1Z9SA 4UILL 3LPFA 3MSPA 4PJ7E 5E8DH 3HPLA 4F2MA 4HDIA 2VZSA 2F53B 1MAKA 4HLJA 5BV7L 3QDHA 2DLTA 3FQRA 2DQHH 5IB3A 1DE4B 2YEZB 4GH7B 4XI5C 1GGBH 2AQ1A 2XN9E 1UGNA 3BKYH 4I0KA 3EOTL 3BP5B 3UEZA 2FEDC 4XP6H 2VKWA 3WFHB 1OSZB 3SBWA 3RWDA 5T1DL 5FA4A 2DB8A 2XZCH 4I3SH 3AS1A 2IGFH 1GGCH 4JQXC 4LNRA 2YD4A 4U1NA 1RMFH 3EYFA 3VXRE 3FMGL 3FRPG 3DMMC 3AY4A 3B9KD 4U1GC 4E42B 1UJ3A 2DOCA 2OL3H 3AU1B 2G5BB 3RZWA 1XH3B 3GDBA 2EDKA 3KPNA 4LEXH 2V5TA 4M5ZH 3S9DB 5KTEL 3CJJA 3RL2A 5INDB 1CFSA 3JWDL 3VFPB 3FRPA 4JB9L 4UAOB 4X8JA 4YDKH 1RK1B 5D5MF 3L3DA 5DEGA 3EO0B 2JJUA 4YHKH 3ECBA 4BQ8A 3TYGH 3W82A 5KSBE 5ITFA 3DECA 2EDFA 2NY2C 5ETUB 3TM6A 4OLWH 2N56A 1P9MA 2FGWL 2R29H 2NZ9C 5JHLL 1FO0B 4O9HH 1GGTA 3DVGB 3QIWD 3MV7B 2L4OA 3LEVL 3BPCB 1CIUA 4XMLH 4PJ5B 1FG2B 2VLLA 3PABA 3LZFH 1ZAGA 2GFBB 2R69L 2WMPA 1FZKA 4AENA 2B4CH 3GMLB 1Y6KR 4KKLC 5FA3A 5HHNB 4FS0A 4Y4HB 3D39D 3CK0H 3SDAA 4ELKB 3TBSA 1BQHA 1IGIH 3IDJA 2YKLL 3MLSL 2VC2L 3STZA 4U1LA 1XF1A 2FD6H 1MWAB 3S37H 4D9QD 3BH8A 5HY9B 2ADGA 2L0DA 1L7IL 4PB9L 3KPTA 1XR9B 3ZLQC 1N2RA 4LQ1A 5T1MB 3MACH 2OTUB 3JVGC 2ITDA 5D2NA 4HUNB 1MSPA 3B9VA 3L5XL 4LSQL 5EH1A 1YPZF 4U1KB 3EFFA 4DKFH 1FQ9C 4QGTA 2V5RA 1CLZH 3H9YA 4NO5A 1A6UL 3T65B 3K8MA 1F4XL 3VRLE 5DHXB 3W11C 1QHPA 3C9NA 3QG7L 3V0VB 5FYKL 3WHXA 2EICA 5GZOD 5BXFB 3LS4H 5JNYB 5GSVA 5EZJB 3VE0A 4L4JA 3BQUB 4UB0L 1XCTB 4D0DA 1JIBA 5HGHB 5L9DL 1A6WH 4ONGH 3BN9D 5ENWA 5D8JH 2AQ2A 5DR5H 2PW1B 3ULVH 1R5WB 4QTIL 4KI5F 1UKQA 3PL6A 4N1EA 1N6QL 4Q9QL 2ESVE 3VFTB 4X5XA 4KHTH 3TV3L 1AH1A 4MLIA 2P8MA 1LO0H 3L7FB 3FB6B 1AIFB 4P49A 3TO4B 3MFFB 1VA9A 1Z9OA 3SN6N 5F3BA 4Y5XA 5DURB 4S0TD 1AGCB 1F6LL 4KUCD 3GSQA 3UJJL 5F7DA 4CVZA 5EPMA 2QQLH 4EDXA 1M71B 3C09C 3I6LD 5AZEH 1I9IH 3CNKA 3UPAA 1KPUB 4PLJD 2DI9A 4YR6B 4X7CC 3KXFD 3WSQL 5DFTA 1ACZA 3ARWA 3FCTB 4N9OB 3BSZH 1J0IA 2HJFA 3MJ9H 2VIRA 1NLDH 3H3BC 4JRXA 4O2FA 1SEQL 2O26U 3NACH 1A21A 2H8PB 3S4SG 4AIXA 4XAWL 3PV7A 4A6YB 2A6IB 4Z6AT 1TJGH 2LAAA 3TJEL 5L6YL 4Y88A 1Q94B 4PD4K 1WWBX 3OKKA 4U6HB 5EA0L 1QBMH 1LO4L 3BUYA 3QQ4B 5IWLC 2YD2A 35C8H 2O5ZH 3SDCD 1FYTB 1JN6B 1I85C 4FQQA 4KKCC 2O93L 1XIWC 4GBXC 4OZ4B 5DEZA 1IKNC 3VD5A 2J8UB 4BKLB 4ZUTB 3MOQA 1B0RB 4M61A 1MIML 4U6VL 3HN3A 3KPSE 2W9LA 1S7UB 1LEGB 1KN4H 4LRIA 1EGJH 1E4JA 4ZUSA 3JWOC 1C12B 4K3JL 2GJ6E 3MPCA 3WUWG 5KJRH 2UYLB 4UV7L 3EOYG 1KXTB 3QIUD 3DX7B 3EYOB 2LV4A 4HUMB 1G7MA 5K9QG 5EUKB 3BO8B 3CFBA 4PJXA 3L3HB 1JWMA 3HNSH 1A7PL 2IQAB 3F5WA 5C0IB 2V5SA 3WUWA 1Q72H 4LCWA 3SCMD 3CVHL 3UROR 2ZCLL 3S36H 3H9HB 3HNTL 4GUPB 3QEQA 2AV7A 5I0DA 4TSCL 1I8MB 4OD3L 1JJUA 1J1PH 4MHHI 2F74B 4IOFC 5C07E 3DO7A 2HVJA 1JUFB 3MBXH 3LHPH 3FZUD 4ZAKA 3VWKD 1TQCB 1MJ8H 4QOKD 5INCB 4HF5L 4P48A 5I9QC 1KTLA 1T5XB 1EHLL 3S98A 5KSUA 2IAMC 4BH8A 2JIXD 3WCYA 2DI8A 5DD6B 3PXHA 1MFCL 3U0PA 1ZWIA 1NBZB 3BDXA 3WFEH 4O5LL 1I3UA 3MOBH 1NC2B 2YPKB 1FBIL 2GSIA 3KYMB 4YBLB 3V6BR 1UACL 2D31A 5IG7B 4DFHA 4BA8A 4R90H 1PW3A 2LTQB 3TBTA 5I1IL 5DT1L 2EKSB 5D70H 5E2JA 5MEQB 2AK1L 3I3BA 4HBCL 5LCVL 3HG1B 3QWOB 3NCBB 3CLEH 2C1OB 1KJMA 5FO8A 3WS6A 1K8IA 3QCUH 4X5WB 5KVGL 4HUXA 5ACMA 4QXTB 3RWGA 4ZO6A 3TLRA 3V6OE 2P8LB 4P2RA 3V4PL 1KTDA 4PJIA 3SJVA 1BGXL 3ARSA 1KEGH 3ZMRA 2DRUA 3RDTA 4G43B 5D1ZB 1BBJA 5SX5K 2OM5A 2ZNXA 4LDOB 4NYLB 4L4VD 5K33A 3QUMB 1F4WL 1CQKA 2YWZA 5AYUH 3DX9B 1RV6X 1FDLH 3KYKL 4NC0B 4AL8H 2X4TA 1S5HA 4HXAH 4Y89A 3I84A 4ZQKB 4ZXBB 1ZANH 1A1MB 3FL7A 1MRDH 4MHHG 4P5KA 4YXHL 4AM0B 1I9JL 3BPLB 4RIRB 2KBGA 3UP1A 2P24B 5FYJE 2GW5A 4EDWH 5I1AB 4PJ5E 1YY8A 1N0XH 3T4YA 1OP9A 1PG7H 2A83B 4BZ2H 2DYPB 5IV2A 5IHLB 2FEEI 1F45A 2APWA 2X9YA 5CZVH 5MEND 1GZQA 3U7WH 3HC4H 1AXSB 1X5ZA 1JFQH 5KSAC 1AQKH 2H32B 3CDCA 5I66B 1KOAA 1JGEB 3T0EB 1U8LB 4DZ8A 4JO3L 5DJYB 3IDNA 4ELMF 3NA9H 2C3HA 5GGVY 2XWJB 1C5BL 3MRPB 4F7MB 1I9RL 1KPVA 5EOCL 1KJ2A 1OW0C 4KROC 2O61B 4IS6B 4ONOA 3IJHB 1C5CL 1YNLH 4WY7H 1HH9A 1HOCB 2VSCA 3FFDB 3IU4L 3EYVB 5HHQB 4JKMA 3TESA 4TUOB 4BQBA 5TJWK 4WO4A 5SV4A 5IR1A 2ZUQB 4JO4L 1R6VA 1JWUA 3RVXC 4P2QB 3BAEH 2VO5A 1FCGA 4XXDA 1YEDB 1A4KB 3K2UH 4KAQH 2EXWC 2K7QA 2L7UA 1RUMH 1UCBL 3MLZL 2IBBA 4NO3A 3GRWA 4ZOCA 5EZLA 3T09A 5I1GH 3DBXB 3EJYC 3MLTA 2DDQH 4QT5B 5DQDL 4LHUD 4Z7WA 4JM2B 4CVWA 2EDEA 3NIDE 1ADQA 4HS8L 4CN6A 5I1CL 1IAIH 5FGCB 4H88L 5FCUL 1SHMA 3K1KC 4G3YL 1IC7L 1WISA 2C3XA 2GAZB 2XXCB 5E2UH 4K7PL 2EIZB 5DI8A 5FYLD 4D9RE 1CGYA 5EU4A 4MAUL 3NIFF 4KK5D 2E6QA 4PJBE 1WFOA 4PJIF 3ARDB 4BFEA 5DC9B 3ALPA 1FCCA 1PKQB 1W72A 1ZVSB 4HS3A 3HAEH 4JG1L 3G5YB 1FFPA 2FJFB 5BVJA 1T7WA 1KCRL 1EHAA 3ULUD 1QSFD 2NW2B 3EUUA 4ZFZB 4ZFOA 2DMCA 1H5BB 4LKCA 4DK3A 3X11A 1BZ7B 3QFJD 3ULSB 3QRFM 4KTEH 4OD2B 4XX1G 1QTYT 3JV4B 2ZOKB 2UVEA 1CG9A 3BYTA 43C9B 4J23A 4UT7L 2Z8WC 1TLKA 1U8NB 1EMTL 4P5TD 5I75B 1NPUA 2D4FA 2VXSH 2V17L 4F9LC 1YC8A 5D72L 3PJSB 3CX2A 1MFEL 3ZYIA 3AAZB 3QG6A 4PRHA 1Q8MA 4JHAH 3T4AA 1DVFA 2F15A 2N4IA 1D6VH 4NJ9L 5ESQB 2P5WE 4NGHL 4MDJB 4F7PB 1FIGL 1KSRA 3CFDA 4N5ED 4NNYB 2W38A 3CVIL 1PG7X 2NX5A 3TBYB 2P5EB 1MCWM 4Y1AE 4AIZB 4Z77A 3GMOA 4F33A 2ADFL 3X12A 4I0PA 4R6UA 1NFDB 4YHNA 3GJFA 3BZ4B 5J7CC 1N3NB 3FKUS 3K81A 4DW2L 4B41A 3SDDD 1DN0A 5D7JD 3SGJC 3UTOA 1D9KC 5IMMB 5DSCB 2NW3B 3P0VH 4BH7A 4ISVB 4F15C 5D71L 4HWBH 4LVOB 4UT9L 1LO5A 2I26N 1ZT1A 3NFPB 3OAYH 1NKOA 3BVNB 1KELL 5FHBL 1EFXB 4LOUD 5ERWB 2E8YA 5E9DD 3TP4A 4WUUA 1WBXA 4LLMB 1IRAY 3RX5A 1V3KA 4P23D 4PRIA 4DEPC 4W70A 4YH6A 3NOIA 4OAWA 2WIIA 4E5XA 1ZEAL 3MRLB 4JFYB 5TDPB 4HS6A 1N0LA 3ALWA 1BIHA 1D5ZB 3A6BH 1BQLL 2V9TA 4UI2A 3STLA 5E8PA 2OP4H 2GUOA 3VD9A 1MQKL 3FQWB 1I8IB 3C5ZA 3MRFB 4LRNH 3IVKA 1FFRA 5B38A 4XCYB 1AI1L 2A6JB 4MAYD 1BOYA 2YK1H 4WWID 3PGFH 3EYQC 3VXPA 1I3RA 4HC1H 1BJMA 1U3HC 3HNVH 5JOFB 4IDJH 2VRAA 3HI6H 3LQMA 4N0UE 4Z7WF 5DDHB 3I6KA 3V4VL 5BJTA 5EWIL 1J1OL 3QDME 4NSKA 4ZO9A 3L9RA 1Q0YL 4NIKB 1MLBB 5HDOA 1Y18B 1OHQA 4OTXH 4JFEB 4MJIB 4F3FA 1I7ZA 1NDMB 3HE7C 2WWMC 2DIJA 5IVXF 4IJ3B 3FONA 4QYOB 1Z5LB 5FM5O 4FZ8H 1HHIA 1KIQA 2BK8A 3OB0H 4X4ME 1X9QA 3WNLA 5E4EC 4L1DA 3GSRB 2EC9T 3C2AL 3LKPB 4ODTL 4WEBL 2BX5A 3H3PH 3O8XB 1MCPH 3R06B 3QXAB 4R7DB 4JGUA 1NCAH 1ZK9A 1QEWB 3MLVH 4Y5YC 3BWUC 4PRPB 4XC3L 4UOJA 4ZUVA 1UZ6E 2WBWB 4HJGA 1S7SB 2R0LH 4KKAC 3F7YA 4U0RC 2XT1B 3JSSA 2VLRE 4EOWL 2V2XA 1JRHH 2E9JA 1MY7A 4KMLB 4XNUL 5I8KH 1IL1A 3ESVF 5FK9A 3RVTC 2Q76A 4LLDA 5HHVH 4OT1L 1RZGB 3QA3B 5GSRB 3R8BB 4MNHA 1VPOH 4Y16B 1LO3H 2FNBA 3X17A 5CBEB 5KW9L 2BC4A 4HKZB 5HHOE 3MRKB 1RZIA 1CLOH 4IRSC 4QF1B 5FYLH 4BK4A 4F37K 3WIFA 4L3CB 5CCKL 1NCBL 1TQBC 3MA9L 4L8BB 5HYQB 1F4YH 1XF4A 1KIRB 2NYYD 3FT4B 3F7VA 3WN5A 3FFCE 1QPPA 1BVLA 4WWKB 1AC6A 4WHYG 3DTXA 4FTVA 4QXUH 3ULUH 1RIUL 1T04B 4ZTOL 5J6HB 3BPOC 2HT4C 1OGAD 3N9GL 1BIIA 2D03L 3S5LB 4RWYH 2E6JA 3RZCC 4M1CD 3GMQB 1RULL 4IOIB 2ZKHH 2DQGH 4OSUH 1VEOA 3CIQA 1ZT4B 3NGBC 1CVRA 4BSJA 4JM4H 4MD5B 4YC2C 5HVHC 4WHDA 3O41B 4DKDC 3CZFB 2G5RA 4MMZC 3B9KA 3X3GL 1IAOB 1C5DB 3C08H 1IEBB 3KPOB 4G8GD 5DJ6A 5IQ9B 4EN3A 2CH8A 5A40E 5B3NA 4YWGL 1JPSL 3SKOB 3OAUH 5F9AC 5E08H 4XPAL 4OCSL 1TETL 3HZKB 3THML 5J13C 1BX2A 2EDHA 3IFLH 4WFGE 3GGWB 2G60H 4PBWD 3LH2L 5DD0H 5I0ZA 2EH8L 4M7LL 3MUY1 2YS4A 2OZ4L 3U9UA 1FZJA 2CXKA 3CH1B 1NLBH 2OSLA 3Q3GB 2HT3D 5ABDE 2AEPL 1QSED 3E8UL 3QUYA 3MMEB 4LLUA 3BXNA 4W4OC 3KYNB 2GHWB 3UTQB 5C09B 4P4RA 1XGTA 2LU7A 2W60B 2Z31A 4X4ZA 2AEIT 4FXGA 1RHHB 4WW2C 5HGAA 3MLUH 2AJUL 1E6OL 5GRUL 1OD9A 2NXZD 5LJYH 4P3CL 5T1LD 5DHVB 1FO0L 2LU4A 1UQSB 4Z7QF 1RPQA 5FYJL 5T5NG 4J6RL 1SJVA 5GGTA 1AKJB 4P9HL 1MIEH 1MH5A 4FQXD 4PJ8A 4OCRL 2IMMA 1N5YL 3BGMB 5EC2B 1J05A 2HJLA 3NVQA 2FLRT 3BRGC 3KJ6L 3RTQA 4I4WB 4Y2DD 2MOVA 1ZV5A 4IRJB 1RUPL 4OFYD 4GRWH 3GMPB 4RQQB 5GS3A 1MWAL 4DTGL 1IGJA 4F57H 2IFFL 4X8XA 4OGYH 1ROWA 3QEHB 4H0HB 5DD5L 3ARRA 4MDIB 5EO1B 4L5FL 1NAMH 4NZRL 3E6FA 4LMQE 2M8XA 2E7MA 4QHNA 1LEKA 2BY3A 4HUUB 4J3UA 1YC7A 3WFDL 4N8CH 4LSUL 1RJLA 2NTSP 3IYLW 4YGAB 1CGSL 5C9JB 3TVMD 3L95A 4JRYB 3QWRD 1IC1A 5D1XB 1HQ4A 5C0RH 4LLWA 1A6VL 1M05B 4GT7A 5JPMB 4KTDH 4EI5D 5C8JB 4NM4L 1UM4H 3BE1L 1U58A 3BOVA 4DN4L 5HPMA 2OR9H 3IDIA 3JTSB 5ILTL 3PWVB 1IAII 5ID0A 1BD2D 4JFDD 4Z9KB 1KGCE 4IRZL 3MXVH 3KLAA 4NNPL 4WCYH 5GJSL 5KZCD 4XNQB 4H0IA 5GGQH 32C2B 3V0AC 3WNOA 5FM4A 2HTKC 5TDOB 1DN2A 2BNRA 1HSBA 3TPUB 5I1LA 4NQTA 3WIHH 4Y4FB 1R3HA 4XVSH 1CGVA 3ZTNH 1IZJA 5EU6A 1S78C 2IBGA 1UWXK 1PY9A 2IH3A 5L2KE 1MAMH 2FB4L 1UENA 4ZUUA 2ERJC 2EC8A 3P9WB 1HKLL 3W9DB 3I9GH 2Z4QA 1ORSA 5M7QA 2A6KA 3IFNL 4F80A 1CXHA 5D1QD 4XXCA 1H3UA 5TQ2L 5JIIA 3DRTB 1UXSB 3G08A 4JAMA 4WIQA 5C0EA 3O81A 5ISZE 1OT1A 3CFIC 1G9MH 1YEEL 2XQBL 2R8SH 1BM3H 4KMTL 4E9LA 2GTZB 4YIQB 5DTFB 5KS9A 4Y19E 1HILA 2V2TB 2YSSB 5DVOA 3NFSL 1FL6A 1DQQB 4RAVA 3IS0X 2LABA 2HVKB 2YPLD 5I19L 5DMIH 4E41B 4RZCB 3WKMH 3C60D 4ODWA 5JO5A 4JFEE 3FQXB 4K07A 4RNRB 4A6YL 4M43L 3WNPA 3VXUD 2FX8L 4NQSB 2E9BA 4UQ3A 3SKUD 1VCAA 1YY9D 1TVDA 3RQ3A 4W6WB 1LNUA 5K9KB 2EYTA 1ODAA 4OQTH 3H2WA 3QDGA 2RCSL 2YC1A 3QIUA 3MRDA 4X6DE 3GSUB 3UTPE 2UWEB 3WLBB 4QHUB 5AWNH 4UMGA 4I8DA 5BRZE 1VSCA 3SCMA 3S35L 4YDIL 4U1IA 2JK5A 2H9GB 3DI3B 2NNAB 1N59B 1FL5B 4NWTH 3MCLH 2KDGA 3V6OC 1FNGA 3WL9B 3HZVA 4J4PD 2IF7A 1NGPH 3GSVB 5HYSG 2AKRB 2A0LD 3P4MA 3BRFA 2R4SH 1DUYA 3BKML 1NDGA 3VWKA 1IC5L 3KS0H 1ND0B 1KLFA 4M4PA 4KJWC 4OKVB 4AH2B 1UM5H 4QOKA 3B2UC 5I17A 4F7CA 2GY5A 4LLYB 3VXME 5D93C 4M48H 3U48A 2BY0A 1UA6H 4KHXH 2HG5A 4LCCC 3QEUA 1LO2H 3HLAA 2F58L 5FB8B 4TVPH 1EHXA 4UQ2B 4GRMA 4XAKD 2R2BA 4N0YL 1WT5C 2PXYB 2P7TB 5C08E 3VFMB 1PY4A 1G7PB 15C8L 1FNHA 1TJHL 2ZSVB 5IMKB 4PJEF 3CFJB 5KVFL 3MNZA 4OF5A 3TIEB 4PJDE 3MV9A 4M8VA 1YUHB 1O7SA 4G5ZH 3QUXB 4P3DB 2DLIA 5DRZA 1IBGH 2QKIA 2YUVA 2C7UA 5IWLA 1T0NA 4LU5L 2Z8RA 3AREA 3T0XA 5I1EL 1DBAL 2VE6A 4TTGA 5L88H 2MCPL 3TT3L 3FB7B 4X6CB 5JUEH 2Y25A 1JPFA 4XNYH 4MA1B 3VGEA 5T1KD 1XGYH 3LRSB 4BUGA 5FUOL 1U8PB 2F53D 4C56B 4BM7A 5MEOB 1U8MA 2IANB 4X98B 1WAAA 1FNFA 2CDFA 4RISH 1JRHI 3GIVA 5IT2L 4R3SA 3G6AA 5B39G 1TIUA 4Z95H 1GOFA 5DC0A 4C59B 5JHDE 3BT2H 1ADQH 3WFCH 1A1OA 2GCYB 3OG4B 5F9JB 4PJ9C 4HIXL 4ZPVB 2FBJL 4OCNC 5GZNC 4P46A 1CFTB 2E8ZA 5B39A 2R23A 3QUML 2JLLA 1X7QB 3G5XB 4HPOH 1IGTB 2VXVH 1ZLVH 3MUZ1 1Y0LB 4FQCL 1AD0A 1HNFA 1CZ8H 2PO6C 2Y07H 4R97C 4ALAL 5I74C 4P4KD 4DUVA 4YNYA 1X5IA 1A0QL 2WLYA 1U8QB 3S8WA 3D6GA 3ZT7A 4NT6A 4JY4B 5FO9A 4UTAH 2EYSA 3RP1A 5C2BL 4I5BB 5E1AA 1V7MH 2B1HH 2R2EA 3QIBB 2YUWA 5BW7C 1MCRA 3OR6A 1YNTB 5EOCJ 1QUNA 1UKTA 4I77H 2VABA 1V3LA 3HS0B 4WUKL 4PLKC 4M6OL 5ECJE 1HWGB 2BNQA 1R3IH 3OXRB 4JZNA 2HJKB 3LRHA 4PP2B 3SKJL 1P7KA 2OS7A 3RHWK 4XNXH 1NMBH 3GMNB 1JV5B 1GAFL 5E6ID 5HD8D 3SKMB 4XP4H 5I8EA 2E7HA 4PGBA 2QQQA 4OF6A 2IADB 3TNNA 3KS0J 4MXWH 4ZO7A 1LD9B 3EYUL 3UJIL 4ERSL 4WU7A 4YK4B 5GISH 2VSDA 5DA4A 5ESAB 3G6JB 3T77A 4JFOA 1XF3B 5IMLB 4U6XA 1HDMB 1MJ7L 1YEGH 4I0CC 3CFKB 4JPKL 3D2UA 3ZKXC 2Q87A 2OR7A 4MZ3A 2QV2A 4OUUB 3U6RB 4XMKH 4LHUG 3SE9H 3QRGL 1JZ3A 4QRPB 2ARJQ 2E6PA 5SWSA 5CWSB 5E2TL 1BLNA 1UZ8B 5KSVB 3IDYC 3VD3A 2DTMH 4IMLB 4LHUA 5FKPB 5EG6C 4HHAB 2P4AB 2HFTA 1HHKB 1U91A 3FT2A 4ZD3L 5I71C 4XH2B 2BRRH 1U8KB 1P4IH 3K0WA 4DQOL 2DKMA 3LQAH 1U8JB 2Q7YB 1AHWB 1A3RH 1JZ7A 2FO4A 5JORA 1EFQA 2R0KH 3BQUD 5GRXG 3BI9X 5ADPL 2W65B 1DBBH 4FFWC 5IP4A 3GSWB 5C9KA 1IGFH 3HHRB 1V7NH 3DHJA 2HKFL 2AJXL 3D0VA 5DJ0B 3QDJB 5DJZB 1WAAF 4NZUL 2DD8H 3ROLB 5JR1H 2HH0L 3OQ3B 4LHQB 1QSFA 3PP4L 5I1KL 2W0FB 1KB9K 3TO4D 4WFFE 3OKLA 3UTTB 1LE9B 4HWZA 2Z35A 5BS0A 1TNMA 3BEWA 4XPTL 3QULB 1CE6A 1K8DB 2JF1A 3RKDC 1KG0B 1QD0A 2R1YA 2V2WB 3P40A 4DUXA 1NUGA 1F02I 2FECL 3EZ8A 5E8NB 2BSRB 2DIBA 2XPGA 3TEUA 1J10A 3DMMD 4JQIH 5GGRY 1RFDL 4L8CA 1EUTA 2XQYG 3CDFA 2OTPA 1OW0A 3OKMA 1E4XH 2JCCA 3MYJA 5SWZE 3UYRH 1NUFA 5E03A 3R1GL 1PAMA 1ZGLB 3UBXA 5DD1H 5E5RB 3S4SB 1SYSB 1KIPB 2GJZA 4DN3L 3T08A 2N1KA 2G9HA 5FF6B 1KIUA 3CDGB 5SX4H 1PLGH 3F6LA 1ACYH 1QOKA 5K9OA 5D7JA 4J1UB 1N8ZB 4JREB 1H3PH 2ADJB 5CZXD 4RDQG 2HFGL 3OBAA 5J57B 4UOW0 1BWMA 4XPGH 1LDPL 1WBYA 1FYTD 4M93C 8CGTA 5F9OH 5IBUG 3TPKA 3KPMB <