2ZOLB

Crystal structure of h-2db in complex with the w513s variant of jhmv epitope s510
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
QKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biological basis of CTL escape in coronavirus-infected mice
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 13
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2zolB00
5C0BA 3L5JA 5CMAA 2NW2B 2R29H 4MZ3A 5DMJB 4W68A 5L9DL 1H3GA 4LLQA 3KPQB 2GKIA 4JZJA 1SYSA 3MNVB 4PRPE 3TYGL 1MHPL 3B83A 2YMXL 1IC7H 2HTKD 1OWWA 3VCLA 3P40A 2XI9A 3GHBL 4M7LT 4N0CC 4YK4B 2PYEA 3CLEH 4XT1C 1EFXB 1RU9H 4LFHG 4KQ4H 4BQ6A 3Q3GB 3U36A 1CXFA 3PWPB 1JRHL 5DS8A 3BVNA 2YPKA 3QUML 5IP4A 3KYOA 2X4RA 2A77L 3BPLC 2X05A 1XGQB 1J5OL 4NQCA 3SGDI 1NCCL 5ESAA 1YMMA 2FIKB 2HTLD 5GRVL 3FQXB 3UDWA 4QRTB 5I1LB 2VRAA 4LLMA 1MHHA 5IBLC 2YD7A 4N8VG 1T03L 4QY8B 1BFTA 1XGPB 1ED3B 3MBEB 1O5DT 4JAMA 4YR6A 4EZMA 4M6ML 4DK3A 2H2PC 2VDMH 4MD5B 4DUXA 4ODTH 2D4DA 3LQZB 4AL8H 4PJHA 1EMTH 4MS8D 3ZSSA 3QIUA 1QKZH 4KRPB 5J13B 2VDOL 4LIQH 1LNUB 2VXSH 4G8GA 2L7JA 3FMGL 3MBEA 3HPJA 5ITFA 2OTUB 1KJ3L 2EEAA 4YHIA 4Z78A 1M6OB 2HLFD 3VXME 5CD3A 3CFJB 3C5SA 2HKHH 1FFPB 5DUML 4QRTA 1ETZB 2CKNA 4M6OH 4UUJB 5FUZL 4FQQB 4F33B 1I7TB 1JF5A 1AD9A 3MCKA 4HIJA 4MQ7B 2Q3AA 4DW2L 2ICWA 5BVJB 4GSDL 1EAJA 4LARH 1YPZB 5IHZB 1GIGH 4GAGL 1UB5A 1IFHH 3UZVB 3WFHB 4YHZL 3EYSL 4DK6A 2V5RA 2AGJH 5IHUH 3G5XB 2ADIB 3MV8E 1QP1A 5KVFH 3WFBH 3ULVL 1EBAA 4M5YH 4HIJB 4MQ7A 4JR9H 3WFDL 2AQ1A 4X6DF 4CU8A 4MCYB 3UTQB 4NKIH 3V4UL 5I30H 4Z7QE 4Q9QH 4LPXA 1YEHH 5GGTH 4I13B 5I15H 3E3QE 5K9JL 2XZQL 3LKRB 1S8DA 4PJ7F 4I9WD 1OTSC 3QWQB 3GSVB 2Y06H 5C6PB 4D9LH 4X6CA 2BVQB 3C60C 2EIEA 1JF1A 4MD4A 4PJ8B 2IAND 1E4XI 3QWOA 3VJ6B 1S9YB 3MCLL 4K3JH 5GRUL 3RAJL 1B9ZA 4FXLA 5E1HB 3TZVA 4Q9CA 3MRRB 4Z7OF 4LKCB 2FGWL 1BMGA 1BZ9B 4G7YH 2VLRE 5E6IC 1NBZA 3MJ9L 5DJZA 1CL7I 5DHVH 4Y4KA 3CC5B 5KAQF 4X6FA 2XWJA 5F21B 4P57B 3T4YA 3LKSA 3BGFB 2H32B 2IQAB 3MYZA 3RGVD 3EJYD 5FOJA 4BSVA 2PYFB 4NQCB 1XEDA 3DURA 2A1WH 1UCBL 1J11A 1TETL 4ZFOB 3MRRA 3ZTNH 1NCUA 2F54A 4Y5YC 4WFGE 2IADB 5CP7B 3PGDA 1DZBA 4DKFH 1FL6B 4GQ9L 2P5EE 2NCMA 3H6JA 4AK1A 1WAAE 2I27N 4GG6B 4XC3H 3EYVA 2VDLL 5DURD 2AEQH 3F7YA 3UPRA 4NC1E 2NY2C 2XWTB 3IF1B 4NRXA 4YX2H 1F8TH 4P2QB 4JRXD 3UYRL 1H3WM 2GTZA 1IFHL 2DDQH 5KVDL 5C2UB 1U8LA 3VWJA 3EYOB 4PGJA 5I16B 4D8PA 1EFXD 4NWTH 4OFKA 1NJ9A 3UTQA 5E5MA 3A0OA 1S7SA 3V4PH 4X9FA 4F7EB 4F7CA 1M71A 2F5AL 3RWGA 5GS1A 2MPAL 4JFXB 5CJQH 1MCCA 1MELA 5HYSG 4NUJB 1MHEA 4Y5XB 5EO1B 2UUDH 3BUTA 5HHNA 4KZDL 5EO0B 1JHTB 5F70A 3W0WB 3DPBA 4PR5B 5JW3L 5FHAH 2COQA 5C6TH 3VFUA 2AJSH 4OZGB 4AYFA 1OLLA 1PLGH 2SEBA 2GCYB 3ARPA 3OF6A 4NC0B 3ULVH 3GMLA 3MLPA 4JCLA 4X6FB 4UOW1 4O2CB 3BD4A 4LDOB 1ADQL 2GY5A 2F8OA 2ITCB 2MNUA 5K33A 3KJ4C 3RHWK 4G7YL 4JDZB 4KVCH 4JFDB 1KJMB 2O5XH 2X9XA 3D25A 4NRZA 3H9SA 3BZEA 5EU6E 1JWMA 3AS0A 4GKSA 1HQRB 4GUPA 5DJ2A 2GJ6A 4QHUB 3P30L 4P5TB 4LLWB 4OZGE 4CVWA 5BXFA 3IU4L 5BRZD 5HVHC 5DT1H 3CH1B 3MXWL 3B9EA 1I3RA 4NJAH 2BMKB 4X6CB 1AGCB 4MB3A 1P4IH 4MYWB 4OKDA 1T1YA 4GQ9H 1OT2A 1MRDH 1KF9B 2HKFL 5FO7A 3SDYH 5T3ZE 2FO1A 5DMGC 3QQ4B 4X6DB 3O2DL 4L5FH 4I0PC 2MHAB 2GFBA 4LU5H 1TLKA 3EYUL 2DDQL 5KVDH 2O26U 2NQCA 3OXRB 4I3GA 3HAEH 4NWTL 4WFFD 2HVKA 4EUPA 5I17A 1CT8B 4LMQI 3KXFD 4H88L 3FOLA 4EUPG 4MNQB 1F4HA 5IVXA 5TDNB 2FO4A 2HG5B 3Q0HA 1FYTA 2EIBA 3PG2A 4NQSB 3KDMA 4BUGA 3D48R 1ZGLM 3U0PA 3NCYP 1U8MB 4YHIB 3A6OA 5A16A 4Z5RA 4GXVH 4K3EH 4N1CA 3QEUA 3K3QA 5EZOL 1ONQA 1DDHB 1I9RH 5MEQB 4HGKC 5SWSE 3GIVB 3WKML 4PJDA 4Y7MA 2C7UB 3HI6L 4ZUVA 2IFGA 1JGDA 2OSLB 3AY4C 4HULB 5JW5B 2ZZUT 3FO2B 3PWLA 4L3EA 1A14L 3UCRA 2P5WA 2XZCH 2LVEA 2Z8SA 3PV7A 1L9NA 3DRTA 3O4LD 4YPGB 4AEIL 4YR6B 3PGCA 4WW2C 3FFCE 3WIFB 3X11B 3P4NB 3D18A 1F58L 1BAFH 1IC4H 3RA7L 1RZKL 3TM6A 3SKMA 2XWBB 3HUJF 4LVHC 4R4ND 3IKKA 4PRNA 3VGAC 4OZHE 3ULUC 4Y5VA 2JJTC 4F2MB 4ZUWA 1ADQH 4RRPA 1NGXA 4OLUL 4JKPL 5L9DH 4POUB 12E8H 2NX5A 5K59E 1A7PH 3C5JA 4ZYKB 4JFFD 5JUEH 1R5IA 3SDAA 5HYFA 3Q3GA 3U36B 3O3UN 3MLUL 2QQQA 5EU6D 3I75A 3BDBA 4UBDC 2V2TB 5FYKE 2J6EA 4NJ9L 3VFPA 5ISZE 2VLJD 4QT5B 3G5YB 3V9FA 3RDTC 3RVUD 3D6GA 2IALB 5C0DA 2IG2H 5HTSA 2IBBA 5KANG 3LSOA 2OR8A 3G9VA 2GSIB 5HGHB 3VXRB 3ZKXC 2AXFB 3TPKA 4CRPA 1BQLH 3OKDB 1ZHLA 5BV7L 2Y5EA 3QDJA 4H1LG 1G9MC 4N9GB 4J4PD 5IW3A 4YXKH 5I1EH 5IMMB 1V7MH 1DQJA 1P84K 1T0NB 4EN3B 2HN7A 3T3ME 3DO7A 2ATPB 4PJXE 1CBVH 1PG7H 5FB8B 3ARYA 4AJ0A 1RUKH 1GYAA 3L3GA 3QSKB 4OQTA 3W9EB 5C0CE 3WLWC 3P0GB 2FNBA 3P9WB 5E5RB 3G6JB 3WHXB 1FN4A 2RFXA 3K80A 4X7FC 2RIKA 4HHAB 3KYNA 1DQQB 4M00A 1KENL 4FN0A 1MREL 1A6AA 4U1JB 4I2XB 3DXAE 1MIML 1WZ1H 2YD6A 4PJEB 2ZG3A 5JHLL 3HI6H 2PO6C 5B4MD 3BIKB 4L8DA 3BHBB 2WV3A 1MI5A 1UM6H 3VGFA 4CMMA 3G04B 5IKCB 1LEKA 2IQAA 2B2XL 2IH3A 1DJSA 3ARXA 3TNMB 2DIJA 4X99B 1KCSL 2DKUA 3RBGA 1JYNA 4JRYA 5F1OB 4OSUH 1UACH 3QRGL 5I1GH 4ODXA 4XVSL 3WDHA 4N90E 1MLBA 3N0PB 2XT1B 4PTTA 5JW4Q 2E9BA 4URTB 4ZOEA 2Y6SD 4F37F 1JZ2A 3RZCC 2LAAA 5LGHH 3WNLA 4U7KA 1UA6L 2F9BT 5C8JA 5GS0L 1NPUA 1MJ8H 2R2BA 1GGBH 1R3HB 2ZUYA 3MRQA 3T3MF 4Y4FD 1CDBA 5CUSL 4GLRH 4EDXA 3BPNB 4LEXH 1G6RL 2B8OT 4FQHB 3WFCH 4P2CG 4EQ3A 3GMNA 3RGVA 1A6TB 4BKLB 2ARJA 2J4WL 5JOFB 3EYQC 5C8JB 1DQTA 5HD8D 4H8WL 4JHAL 2N7AA 5FYKD 3LEXB 3V0WH 4NJ9H 4WFGD 4C58B 1FPTL 3L3IA 4HKBB 3PDDA 4UZGA 2FR4B 2ZCLH 1E0OB 2X10A 3N1QC 2NY3D 1Q9KA 1FZMB 3TH2T 3VFVB 5IT2L 3DOSA 4NP4L 5ABDE 4WEUD 1CLZH 2RB8A 3L3HB 5FHBH 1GVIA 4WW2A 1I8KA 5I75B 3SKNB 2OR7A 2NZ9D 4KJYA 1KB5B 1YEEL 3NZ8B 4W70A 7FABH 1WZ1L 2IH3B 5F96L 5EZLA 4GMTL 4GRMB 3D3VD 1NEZG 3KNBA 1A3LL 1RUKL 1DN0A 3GJFB 2ZJSL 1WCQA 3O9WB 3HPJB 3HUJE 1R24B 3MRDB 3WS6A 3LCYA 3DVNA 1F4AA 3MZTA 4JKKA 1FO0B 3BSZH 2EEDA 1L0XA 2QSQA 3RRQA 4PRHB 3IKCB 2QKIB 3GSUA 5DK0B 1Y18B 5IJKA 3WE6A 3E6HA 4YPJA 5I1AA 1S9XB 3O81A 2D7TH 5E03A 3ULSA 2HN7B 1S7QB 3FT3A 3RVTD 1AHWA 4UT7L 5HHOE 3QDMD 2VXTL 3QPXH 2NY1B 2AK4E 1HKLH 3BP4A 3RX7A 3RY5A 1AC0A 4JG0L 3LRHA 3O6FA 1SM3H 3LHPL 1GH7A 1DBJL 3GMPB 2J88L 3RZWA 2GUOA 4YHPB 4Y2DD 5DHVB 4D0BB 5IB4A 4HZLA 2UWEA 4PRDB 1YY8A 3DIFB 5B3NA 3LIZH 1T3FB 1TZGL 4JO2L 5SWZD 4GRWB 4GW4B 3HG1B 4XPGL 4RDQG 1HHKB 3DI2B 3AY4A 2HWZL 3QCTH 5C09B 5GS0H 1J1OL 2Y9RT 3CSYA 3HMWL 4OZFA 5E5MB 3ZDYF 3OAZK 3V5KB 3JWOL 1G6RH 3E0GA 3REWA 1TQBB 4PRDA 3ARFB 5EUKA 4KK8D 1G7JB 1UADC 2FWOA 3MXWH 4N8PA 3QHFH 1W0WB 5HHPB 5C0AD 3F7YB 5FCSH 2QQLL 4HAGA 4NFBA 5DHYB 4KGLA 2VQTA 5CEZD 5HHMB 1CGYA 4EBQL 3N1PC 4RGOH 3T1WA 4WWKB 3KS0J 5GGTA 2NY2D 3UAJC 2V7HA 1RUAL 2J8UA 5F9OH 4QRSA 1S9XA 3ARBD 3TBVA 1G7QB 1N26A 43C9A 2DBJA 4PJ9D 4KUCF 3GJFK 3NIFE 2NR6C 5FGBA 4Z7WE 4BFIA 1JWUB 3VRLF 1AKJA 4C56B 4U3CA 4H0HB 4ELMB 5CJ8A 1ZWIB 4OZIB 1N0LA 4ELMF 4YHLL 3SY0A 3VXOB 4XCYA 5D6CB 4K23L 4ZUSA 1MAKA 4GSDH 4GO6B 3DTXA 4WEBL 4F9LA 5F7FA 4NZTH 1MQ8A 5I1KH 2A0LC 4OBSA 4LSTH 4FQCL 4JFEB 2NY1C 4MB5A 5F7HA 2H2PD 4WHCA 4XBEL 5TH2A 1IQWL 2LAGB 2ZP0T 3FMGH 1CDHA 3K81A 5D1ZC 1UWEL 5C9JB 2JE8A 4WU7A 3HZVA 2R23A 1U91A 2VE6A 2JKXA 1E6OL 1RUML 3ARWA 4IDJH 3WFDH 5GZND 1E27B 3VDAA 5C0FA 5D7LE 2FX8L 4APQB 1JHTA 1BD2D 1JWSA 3L3KA 5DD0L 1A14H 2X5PA 3GM0A 2A83A 4PB0L 4PJGE 4F9LC 1M71B 1ZXQA 3MREA 1GHFH 4MAYC 1TVDA 5AYUH 4UIMB 2AKRB 1F58H 1KTDA 3QRFM 2Y06L 4LQ1A 1TCRB 5I1DA 3ARBC 4KC3B 4B41A 2AXGB 3VWJD 3IJSA 4ZXBC 3HFMH 5ISZD 2G75A 4U1MA 4Z7WA 2XQBL 4GMSH 3LQAH 2D9QB 2H45A 2YUVA 5FXCH 4QHUA 3HZVB 2W0FB 1JWMB 1JK8A 5GIRB 2CUIA 3M1BB 1CDJA 3JWOH 1JNLH 4OZIA 1OSZB 4G9FE 4IOFC 1T0PB 4LVOB 5ID0A 3VXOA 1H8SA 1HE7A 2GJZA 2PCPB 1FYTD 2NMSA 5CHNB 1L6XA 4LQFH 3QDHA 3DUUB 4M02A 2FZ3A 1G7PA 5ADPH 1Y6KR 5CIPH 4JRWA 1AJ7L 1CLOL 2XXCB 3VFTB 5LG1A 2GSGB 4NN5C 4LSVL 4RX4D 5FB8A 1WIUA 1S9YA 5I71C 3ECBA 4P2RE 3VG0H 2AJZA 3H9SE 1T1ZB 3RQ3A 1D5MB 3FO9A 1JGLL 1H3VA 5IOPB 3HC0A 1INDL 3AC0A 4YIQB 5I1IH 2A1WL 5I0ZA 1NC4D 1A2YA 2EXWC 1BBDH 3O45B 1C5CH 4CN6A 1KT2A 4JVWA 4MX7A 4U1LA 5KN5B 1E6OH 5MI0B 1AGEB 5HGHA 1KIQA 2NPLX 4PJXF 2D0GA 2IGFH 3EJYC 3VG9B 4MZ2A 4R0LC 4LCCC 3BKJL 1YQVH 2C4FT 1NAMB 3P4MA 4PGEB 4KK5C 1ZA3B 2QV2A 5EIQA 3CGTA 1MCOL 4OKVA 2NYYD 5J8OA 5LWYL 4XCCL 1QSFE 2AJSL 3FJTA 1TQCB 4J3OC 2EH7H 3MXVH 5FYJD 3KYKH 4NBYB 4NHCH 4G43A 3MCG1 3V7AE 5EC2B 4IDJL 3LRGA 2JELH 4PJCB 3KPRB 5J12C 1AGBA 2WZPD 1BF2A 3FONB 4NC1C 1ZSDB 1REIA 1JHKL 2Q3ZA 1RZ8A 2WBJA 5I6XC 3QIWA 4KY1H 5A43C 2DKSA 4JQIH 3VW3L 5DHVA 4MX7B 4AMKL 4U1NB 1RVFH 3OPZH 1UG9A 1LGVA 3NFSL 1KCSH 2OMNA 3TO4D 3VWJC 4J2XA 3V6ZA 1KC5L 1JGUL 4P2RD 5AYUL 2PNDA 5GXBB 5ESQA 1QO3B 3O6KH 5CD5D 5FGBC 1BZ9A 1ORQA 3S35L 2EE6A 1ITCA 5EOCL 3W11C 5DJZB 4V1DD 1AR1C 3RWCA 3VH8B 3QFJD 3ARSA 4KK5D 3WEXA 3ZYOA 1K2DB 3S7GA 4LAQL 3FOMA 5DJAA 1HQ4B 1KEML 5IHLB 1QBMH 4WI6A 3S34H 1AJ7H 1CLOH 3IDNB 5E7BA 1KB9J 2YS4A 4PRHA 1PYWB 5D1XB 2O5XL 4PJAA 4H26B 3GUTA 5D71L 1OHQA 4LPVA 5HYQB 1XF4B 4P23C 3SDDC 1A6PA 2ED7A 1CQKA 4PJEF 5DRWB 5FA3A 2Q86B 4OF0A 2R0WH 2P8LA 4XC1H 3GSOB 4A2MA 3WL9A 2ZPKL 4PRIB 2WAHA 3V0VB 3DX6A 3QO1A 1UWGL 1IKFH 3ESVF 2APVA 2FL5A 2FGZA 2JJWA 2E7LC 5EOQH 1FYTB 3ZE2F 4PIRF 1LQSR 3BXNB 4NM8L 3FOLB 1Y6NR 2YN3A 3UTTE 3MRGB 5C71A 3T2NH 5TE6H 3R0MA 1CDYA 3OAYH 1A1NB 5DMKB 5DJ8A 4CNIB 2AEPH 3KPNB 4K55A 1VPOL 1U58B 3S4SG 1RUQL 1Q9KB 4HH9A 3JV4B 1KFAL 5FF6A 1DBBL 5HHOD 5GQBA 2VZTA 5HYIA 5I71B 3G6JF 5B8CB 2YC1B 3BKJH 5ACMA 3ABZA 2EDJA 3VXMB 2P24B 4O2FA 3BD5A 5BZDB 2E7LA 5GGQL 2R23B 4Z0BH 1MVUB 4ODVL 2X09A 4ISVB 3G5VB 4Y4HC 3QNZB 3U7WH 1N0XL 1CFSA 4ODSL 4XP4L 3TPUB 2EDEA 5MERA 1F6FB 1KPUB 4RQQA 3ILQC 2VAAB 5GGVL 5I74B 1HCFX 1FO0A 1XCQB 4C83A 4G6FB 4KI5E 5CZVH 1M4KA 1T66C 4OLUH 3B2UD 5I66B 1YNKH 4TPRH 3LH2L 4RA0C 2VLLB 1NMAL 4BSWB 1BM3L 4RFNC 5B21A 3RKDD 1AR2A 3QNYB 1IC1A 1IILE 2YK1H 5EO9B 5DJYA 3BN9D 1RIVH 3S35H 3OBAA 1G0XA 5C0NC 3U0TB 4X7SH 4NT6A 4D0DB 3FB6A 4N0UB 2GAZB 3MRPA 2FATL 4XI5C 4OQTL 2PXYB 4U6YA 3IDGB 1NLBH 4HUVA 1CFNA 3W0WE 3EYQD 5GS3A 1OP9A 3CSGA 4R4NC 4XCNB 5IB3A 2APBA 4WFHD 1JPST 1RJLA 2XXMB 1CD1A 2WBWB 2P8MB 5GGRB 5KVEL 4LHUA 2VL5A 4JZJB 5FUCC 4NKDB 5HHOA 4P2QA 1EJOH 3RVXC 2ARWA 4JM2A 2VZ3A 3MJ8B 3OKMB 5E4EC 1XH3A 1OP3K 1DQJB 3B5GA 1KFAH 4K07A 3SPVA 4Z7WF 3ALXA 2VQUA 3C6SA 4G6ML 3HC0B 4JO3L 1K8IA 3OKKB 3DO7B 5GRXG 4P5KB 1KIPA 1MVFA 1T04B 4GAYB 5FV1L 2VXQH 2ICEB 4AEEA 1MHCB 4U6XA 4G8GE 3ZDZF 1XCTA 3D0VB 3FZUC 4NM8H 1C7TA 2OCFD 3D9AH 5FO9B 3V6FB 2AAVA 3CVHB 4KK8C 1WAAF 2AEPL 3P2TA 1FORL 4LPCA 4XP4H 3UPAA 2JJUA 3RVVD 1BVLB 4UDUA 3AU1A 5T33H 3MRFA 4KROD 2CLZA 2ZUSA 2Y1VA 5CBAB 5ID0B 4NQXB 4R4FL 1TZHA 3TZVB 3LV3B 2MJWA 1P9MA 3QO0A 2DM2A 2QR0A 4IRSD 5C2BL 3LH2H 3MRHB 4D9QE 3MO1A 5DD5H 1D5ZB 3QUYA 4XVSH 3OXSB 3KJ4B 1X5AA 1EAPA 3U7WL 4PRBB 1KJ2H 1CGXA 3P9MB 5E8EB 5FGRA 2VUYA 2VLRB 2QSCL 1U8IB 5SX5K 1W72H 1JZ8A 1BBJB 5C70A 2HP4A 1KBGH 3T8XA 5JOPD 3LKSB 3ZDYE 5F8QC 1YZZA 1MJJB 4P5MB 2PTTB 5CP3H 2AXGA 3T0AA 1WFOA 1QSFA 3KLHD 3SGKC 2ICES 3NTCL 1BJ1H 2B2XH 4PY7B 5GRWA 4EI6B 4PGCB 3ISWA 1NMAH 5KSBF 4PRPA 1LILA 1HHGA 3TN0A 4UV7H 3QRGH 1NMBL 5D1ZD 4ZS7L 4WO4D 2PW1A 1LO0H 5ETUA 3V0AC 4C55A 1QD0A 4W6WB 1K8IB 5EU6B 3IDYC 5DZNA 5D7JA 3UTTA 2IPUG 3PWLB 4I4WA 5J1AA 3T2PA 3H42H 3DYMA 2K7QA 1HDMA 3TZVC 2ICWB 4I5BA 2GUOB 4ZFZB 2J8OA 3K0WA 3LOWA 3CFDA 5I18H 4HGWB 2BDNL 2YRLA 4AEHH 4UTBH 2M1KA 3MJ7B 1FVEA 1FZOB 3T0BA 4PD4K 4XNXH 2BXYA 1FNSL 2QEJA 4X4XA 1RURH 3IRPX 3U7YL 4FP8L 5C0CB 3QI9B 5IROC 2LFGA 2M2DA 3QQNA 4HGWA 4CMHB 3P4OA 4HKZA 4YDKL 1U6AH 3MLYH 2QADC 4WV1B 4JHAH 4L1HA 3VMNA 3MGOB 1OB1A 3KDMB 3MA7A 2VDKL 4LSRH 4MXVE 4OZHB 3ROLA 1EGJA 3VFGL 4QXTB 2QQKH 1B4RA 3OJVC 1VACB 5D96B 3LDBB 2XFXA 4NPYA 3TJEL 3D85D 5J1SC 3BZ4A 4M62L 1B0WA 2HT3C 3UTPD 1YEKH 5JZ7C 2WMPA 1RULL 3MFFB 2JIXA 3RUGF 2X9YA 2YWYA 4TNVF 1FCCA 1INDH 4UDTB 2YD8A 1XFPA 5F88B 4NQDE 3HPLB 1YQ2A 1EFQA 2A9NH 4F7PA 5E8DL 3MTRA 3JWDH 3I50L 4LLWA 2OM5A 4GKSB 1IM3A 1NGQL 5D1XA 3OJDB 1RY7B 1YECL 2X7LB 1ZOXA 5I1CL 3O3DB 1BZ7A 4AENA 3KPOA 4I8DA 5D2LE 5DUBB 3FFDA 3SE3A 1S7RA 2ZKHL 5JXAL 1RHFA 4PJBF 1F6LL 1I8IA 5K9KA 3CK0L 4NRYB 5TPWL 3B8YA 3WFBL 1LEIA 2DMKA 4XXDA 1UXWB 4TNWF 5TF1H 1I3GH 3IJHA 4RMTA 5IK3B 4MGXA 4LPUA 1K4DB 5DUMH 1A6TA 4BKLA 3UO1L 5DEZA 5FO9A 2VC2H 5GS2H 3HRPA 4M1GH 1DBAH 5HI4D 3MROA 2C9AA 4X7CC 1T7YA 4IRSB 1JBJA 5ANME 2XKNA 4XPBH 4XNZB 1GZQB 1SM3L 3LHPH 2FEDC 5AZ2H 2B20A 5IVXB 3IJSB 4CVUA 2Q7YA 4WHTA 4NOFA 5F44A 2C3HA 4HBQA 5HHNB 2BVOA 4B53A 3H9YA 4OCWH 1PJ9A 4PJ7B 3IDIA 2QQLH 4H8WC 2VDKH 1ZLWH 1JHLL 4RFNB 1CXLA 5HVFB 4LSUH 3C08L 1Q0XL 3KPQA 4NQTA 4P3CH 3V5DB 3L7EA 4IOFD 1AHWC 4PJIF 5E8PB 1E27A 1ZGLP 4PS4H 1I1YB 4PJBE 1RURL 1IZKA 1AGCA 1ZTXH 3C2SA 1U91B 1YEKL 3D39E 3GBML 3THMH 1KIQB 3V52L 2WBJD 3REVA 5L7XL 2OR9H 3DUUA 1YEIH 1FP5A 3TC9A 2FD6H 5E6ZA 1N8ZB 1R5WB 1CGSH 1ZGLB 3BZEB 3OAZH 1GL4B 1OPGH 4I0KA 3ECBB 1CWVA 4F7MB 3JTTB 4HPOL 4IBLT 1OSZA 1R3LA 2P5ED 3L5IA 4YUEH 1X5IA 5F7WC 5A2IH 5F6HI 3LD8C 3BKML 3EOAA 1B4JH 3TO2A 4HJJH 3HB3D 4U1SB 5DYOB 2CUMA 2D31B 4IS6B 5DA0B 3X14B 4U33A 2CR6A 5F9OL 3VXPA 4NZTL 3HZYA 1CR9H 4LSTL 4AEFA 3OGOE 4ONHA 3DX9B 4H25B 3GMQA 3JTTA 1UWEH 4FTVA 4ZFGH 2ESVE 4EIGB 2A9NL 5I6XB 4N8CL 5HYEA 1H5BC 4HLJA 5C0IA 5CEZL 3DUSB 4A6YB 4UT9L 4MLIA 4S0TD 2H26A 3BP6A 3VXTA 4D2NA 4XPBL 4YX2L 3OKNA 4Z7UA 2IALA 2XTJD 4NC2B 5H94B 1NBVL 3RWJB 2AK4A 5IROA 1PZUB 3LS4H 5IVZA 3JXAA 2R1WB 5CD5C 2MMXA 2J12B 2JCCB 1TIUA 4NCDA 1F5WA 4DWHA 3V4PL 1KJVB 4G5ZH 1BEYH 1KB9K 4DN3L 1I7RB 3HB3C 1LHZA 2OXGA 4Z6AT 3BO8B 3VXRE 1Q0YH 2AJVL 4JO4L 1FNFA 1X5HA 1ERNA 3KHQA 4UQ3B 5BQ7B 5IFJA 4QKXB 5D9SA 4X6BB 5BS0A 4X4YA 1BM3H 1N3NA 1PVHA 1NLDL 1XF5A 4K7PY 5TF0A 3EAKA 5EUOB 3SGEH 3THML 2NW3A 1HYRC 3M45A 1JV5A 4NGHL 3RDTB 1U3HA 4UNTA 3CFKB 1RMFL 3X14A 1MCHA 2FD6L 5GHWL 2FLBT 4RGMB 1CGTA 5AD0B 3SE9L 1DVFC 1UFUA 4D9RD 1LNUA 4MQTB 3V5HA 2Z9TA 2PCPA 1T6VN 1ZHKA 1X5ZA 2OTUA 4PG2A 5D72L 4L3EE 1SEBB 1S7WA 2PR4H 1IEAA 1VFAA 3PIQB 3GBMH 4OI9A 2OZ4L 1MY5A 4CN1A 2OL3A 4P2YA 4AG4L 4XBGB 4K2UL 5IJKC 3WLBA 2EXYD 4HKXA 3L3GB 3NBNA 4NZRL 1RZFL 5I0DA 2C4FU 3KWWA 4ZO9A 3B6SA 1ONQB 3O4OB 3QXAA 4R26H 1DL7H 5ESQB 5A16B 2I07A 4R9HA 3CU7A 2EDWA 3C2AL 4ZFOL 3EKCA 4MQXC 3QEHB 5ECJE 4P3DB 1QFWI 2HH0H 4LSVH 1T5WA 1L7IH 5EZLB 1EK3A 3SGEI 1J0HA 5BRZA 5CGMA 1CF8H 1Q9WA 4N0YL 5KSAD 5EZOH 5T5NF 2A83B 4ZTOH 2G9HB 3DLQR 2NTFA 2LQRA 2P5EA 1J12A 4Z7NE 4NUGL 3GGWA 4JFOA 1QBLL 3ME0A 2GTWA 2JELL 3S5LG 2WINA 1ZLSH 5JMOC 1LDPL 1PKQE 4YHPA 3LAFA 4HKZB 4MA7H 3SCMC 2ZCHL 4JRYE 4YO0A 3MNVA 1AGDA 2XQYK 4ZS6D 2P8LB 1FV1A 1L0YA 1JPGB 1ZT7A 2J7LA 3F62A 5FYLD 5F3BA 1LP9A 5HHQA 2EDDA 3EOBA 3KJ6L 1NC4B 4IRZL 4GRWF 1RZGA 3PABA 3DUHA 4K3GA 1P4BL 2QSCH 4ZNEA 3VWKB 1SHMA 5TGBA 1HSAA 3RI5K 3BIBX 1JL8A 3GMPA 3DXAA 3D87B 1QRNB 4S1DD 4TRPL 4QHKJ 3MRLA 2GK0B 3HC3H 3CD4A 2DBLH 1IGFH 2XY1A 1A7PL 3PHQA 2BNRE 5D72H 2FSEA 4WUKL 5T1MA 3DURB 1S7UA 4OGXH 5C09E 2KZWA 3R1GH 4LCCB 5KSBA 1RK0B 3RWIB 1G7PB 5JQHC 4XH2A 1DTUA 1MJJA 5HDQH 1U0QA 1T4KA 2GT9B 4WJ5A 1J05B 3RVXD 2RAMA 1K5NA 2FIKA 3UTSE 1WBYA 5IKCA 1DEEA 3OAYK 3HKFA 4DCQA 4KJYB 2Q8BL 4LEOB 1HH6B 2XACC 2EDKA 4LAQH 5MEQA 3MO1B 1MFAL 1IBGH 1FNSH 3R06B 1I8KB 4KUZL 3QWOB 2CK0H 1M7IA 2DQJL 1RZJC 3ARFA 1RZ7L 4R90H 3ZE0F 1JI2A 3MV7E 4NO0B 4TVPH 1OTTD 3KNBB 4PJ8C 4FQPA 3JWOC 3K46A 4L9DA 3GSNH 5D8JL 3UEZA 4F58L 3IS0X 4F7CB 4APQC 2F15A 4MA1B 2AV7A 1LVEA 1R5VB 3VG9C 5EFIA 4Z7UF 3O3EA 3QXUA 3KYNB 5E2WL 4ZPTA 1J8HE 1IGTB 5IW6B 1CFQB 5CJOL 3MA9L 1PG7L 4K94H 2EDFA 4Z9KB 4XXCC 4FXGB 4XNUL 4HF5H 3RIAK 3MYJB 3HAEB 5E0QA 3HMXA 5C08B 5D2NB 3IAQA 2BVOB 2L0DA 1JI1A 5JMRA 4PJCE 3D0LA 3IDMB 5C0IB 2DQTL 3DX8B 1IKNC 2FR4A 1KENH 1II4E 1N64L 1D7FA 2YEZB 1AE6L 5L0QC 3HRZB 1TXKA 4NN5B 4IRZH 3C9NB 1JZ3A 3BP5B 3N50A 5T1LB 3OKOA 5E08H 1AHWB 3NAAH 5C0RH 5F7EH 5FOBB 1SMAA 4NNYA 3QULA 2G5BA 5IQ9A 4GW1B 1A9BA 5FKPB 1J86A 5MEPA 3QEQA 3RWEB 1J18A 1ZK9A 4TRPH 4LBEA 4NBZB 1LK2A 5C0GB 2B4CH 1G1YA 5CKGA 4EI5A 5ALCH 4EDWH 2CKBA 1A6VH 2HTKC 5HGBB 5EBMB 3ARBA 4X8XA 4LPWA 2YK1L 5DC4B 5TF1L 9CGTA 4OF3A 1NEZA 2IAMA 5SWSA 5DJDB 5LJYH 4W4OC 2HVJA 3T1FB 4U6VL 5ICYB 1PG7X 4MAYB 2A6IB 3OB0H 3H3PL 4OCYH 1KYOJ 4UDUB 3CJJA 4WUKH 1TJHH 1N6VA 1NFDA 1XGUA 4FZEL 1MEXH 3PDOB 4HS8H 1CE1L 4MJ4A 1FZMA 4DZ8B 1RIVL 2X4QA 3GSXA 4ZNCD 4TSBL 3MV8A 5FECA 1FL3B 3C6LA 4DGYH 5HHVL 1JVKA 1AGFB 3M07A 1QFOA 3RU8H 2ZNXA 3PQYE 3QISA 4QOKD 3MMEA 3BQUD 1MRFL 5C0FB 4KK9C 1W0VA 3MJ8A 1D6EA 4RCAA 4ODWA 2VE6B 5TQ0H 4NN7C 3B9VA 4R90L 3P9LB 1VKXB 3MNWB 4FQQA 3MJGX 3IJHB 4H1LB 4S1QL 5CEXA 1YEFL 4PJBA 2IFFL 5E6IB 1JGVH 3RGVC 1KSRA 4GRLB 4KV5E 2UZIL 3EHBD 4XCYB 5D6CA 2DJSA 4BH7A 1LO2H 5I8EB 1VFBB 2UY6A 3UAJD 5L0QB 1BJ8A 4M7ZC 1HYSC 4QTHA 1S78C 1F6AA 2A38A 2GSIA 3RTQB 4PTTB 1AIFA 4GXUN 1G9NL 1B4JL 3MRNA 3HUJA 1L4IA 1FGNH 4PLKD 5TDNA 1UJ3B 4JZOB 2XTJE 1MWAB 3OR7B 4XGZB 4PBXA 2B4CL 3U7AA 5E95B 4ZUWB 3X3GL 4FOMA 1PBYA 1ED3A 3BI9X 4ELKB 3CCHB 5HI5C 3WL9B 2MFNA 3OKYA 3CFIC 2ATKA 2WIIB 2A6IA 3FT2B 5CEZH 3QZWA 2X9WA 4KRPC 4U0RB 4U1KA 3U9PL 3U4EA 3WN5B 5HDBF 2LV4A 3BGFC 3HTLX 2EYRB 1DBKL 2JIXD 3FQTA 4PRBA 3D2UB 5C0JB 4KH2A 3EDKA 3T65A 3M8OH 1NCAH 3CH1A 2XNAB 4LGRB 1AO7D 1DLHA 3T0VA 4CU7A 5GZNC 4OLVL 1F6AB 1V3KA 4KJWC 1K9TA 2KH2B 4K3DL 1HZHL 2OXHA 5HGAA 5DR5H 4OD1H 1I75A 1NAML 3PGCB 2PW2B 3WNOA 3O6MH 4HFWA 2P24A 3PGFL 5SWZE 4R2GC 4JPKL 1KB5A 3OAUL 2DQEH 2VLRD 4IRJD 2APXA 3RU8L 4YJZL 1SYSB 1OL0A 4Z77B 4N9GA 3P77B 1KN2H 1T89A 2MCG1 1LEGB 3IFOA 5SX4H 1KCUL 3GB7A 4FQJH 3MRJB 5DFVC 1FG9C 3ARDD 4NGHH 5I8EA 3TFKD 3BKCH 5D7IE 1IAMA 5I8OL 5GSVA 3AS1A 1UT9A 1AQKL 2HFTA 1FRGH 2CH8A 1J0ZA 1A3RL 3B9AA 3M17B 4XCEB 4DQOL 4U7MA 5B39B 4G6KH 4EI6A 1J88A 3GBNL 2VZUA 4HBCH 3O8XA 2P5WD 2R0ZL 4XNXL 4FQHA 5L2JB 4F7EA 1RUAH 3QXAB 3KPMB 3U46B 1RJCA 1A1MB 3FQTB 3ZT7A 3L9RA 4MD5A 1KLFA 3X3FH 5LVEA 3UJIL 4E9LA 2Y7QA 4XCFL 5IB1B 4TULL 4HMDA 4M5YL 4OCLC 5I8KH 1B90A 1VFAB 1WWAX 2IEPA 3SDCC 3T04D 1SY6A 2CK2A 4XMPL 4K3HA 2HFFA 4L29A 3RWDA 2HT2D 5FYLE 2BHUA 4M62H 2KZ1B 4RFOL 5H37H 3QDME 4O2EB 4PP1C 2AK4D 1NGYA 3ZTJH 2ITCA 4FQ2H 3C8KB 2X4SA 3UROR 3X3GH 1UJ3A 5KVMC 1IQWH 2G5BB 3MRIB 1MCNA 3ALPA 5IQ7L 4JQXC 3BH9A 3LN4B 2NTSP 4P46B 4U1NA 3RNQB 3STLA 5F7LB 4G9DB 5FAAA 3PHOB 3NPSB 2F5AH 5DC0A 3QAZB 5A3ID 1S9VA 1AP2B 3DMMA 3QG6B 4HIHB 2EZ0C 2XQYG 4Y5VC 4DAGL 3C8DA 1DBKH 4MA1C 3MJ9H 3PWVA 2XRAL 3GJEA 3GHEL 2JB6A 2XZAL 3HE7A 4JN2B 3V6OE 5CSGA 5ISZA 1HEZA 5GS1B 3W9EA 2BOCB 1MF2L 4PJ9B 2KPNA 1KELL 1NSNH 2R0KH 4LNVA 5KSAB 3CPLB 3QYCA 1DUYA 2KL6A 1FRGL 5J3HD 3U79A 5E9DA 2R2BB 4FQ1H 5EWIH 4G6KL 2BCKA 3E2HB 2VR5A 4EUPB 1TVHB 4M1GL 2EKSA 4PB0H 4Z18A 3ILQD 2P45B 2P5EB 1XF3A 4PJHE 1OP5H 4I3RL 4KHTL 3HNTL 4YE4L 5ENWB 2CMRL 1LE5A 1LO3L 3IFNL 3TNMA 3BRFA 2XKNB 2NYYC 4YHMH 1QLEH 4MNHB 1QEWA 1DVFA 3MLVL 4OCSL 1A7OL 1B6DA 5EU3A 4Q6IA 5HYJE 4O58H 2VLKB 2HT4D 4YUEL 5KSBB 5F7DB 5BO1H 4J23A 4P57A 1YMME 4Q2ZB 4DOHE 1BECA 3Q5OA 5HGBA 1TJGL 5EZIH 4HDIA 4N5UA 1DQDH 4Y19A 1ZLWK 2IADA 1P84J 1T7ZA 2B7DT 2BOBB 2A6JA 4CVXB 3ROOA 4M6AA 5HYSB 1I4FA 2NY7L 3PABB 4XNUH 1NC4A 4L4TD 1VFMA 3TBVB 4M43L 4AIXA 1S8DB 8CGTA 1EHLL 3OHXB 5J6GB 3DGGB 5JQ6L 5T1DL 4KXZH 2QLVB 3P11L 4P99A 4OUOA 1PG7W 4ONOA 3VXNA 4NKMA 5E00A 4ESKA 1N6QH 1YYLL 4JDVB 4JFED 1QHOA 4JHWL 5F9WC 4S2SB 1G0YR 2EE3A 3SDCB 3HAEA 1DE4B 4OLZL 1A64A 5C0RL 4M5ZL 1F2XK 5MEND 3GMRA 3IU4H 4GG6E 1A7QL 3MX0A 4NN7B 4WTXA 5IBTL 4NN6B 5HYJD 1P7QD 1VSCA 4IEFB 1U3ZA 4AMKH 1GSMA 3S3PA 1DLFL 5DJCA 2DQUL 1BREA 4EDWL 5DVNA 2DWEB 4NQDB 4NQVB 1KCLA 4HV8B 4NCC2 2Y07L 1ETZA 3EYVB 1KLGB 5DXWA 1XIWC 3GEWB 4V1DE 5ALBH 1KUMA 2ITDA 5DQDH 5BRZB 4QHNB 4PGBA 5IIEA 3H0TB 4RAVB 1EO8H 3GB7B 3RNQA 3STLB 4JKPH 3EZJB 3NZHH 2Y23A 1NCWL 4PLJD 3QI9D 4OIIL 3GRWL 3ESUF 4GJTB 2DMCA 3LRSA 2CKBH 1VEOA 3QA3A 5DWUH 1D6VH 4J4PC 2NXZC 3CC5A 3C60D 3FCTB 3H9SD 2VLKE 4JANB 3SBWC 3UJJH 4NZRH 1TCMA 3MFFA 4QHLA 3L3DA 5C0CD 4WTZA 3IT8D 2NW3B 2KKQA 4UOW0 2QKIA 1IKFL 4WO4A 4M43H 3P9MA 1I1FA 3EJZD 1TPXC 3TO4B 5IIEB 5F7NC 2IANA 3RTQC 1W72B 1UM5H 2NY0D 1X5FA 1V7ML 1WIOA 3LKQB 5HSFA 5JA9A 1ZLVK 4J3WA 3UBXB 1QSFD 3BDXA 4PJXB 1RPQA 3V5KA 2YUZA 2I9TB 4JPIA 1RZFH 3DECA 1OY3B 2OI9B 4FNLL 4U49A 4NQDA 4MD0A 4QGYA 4OLEA 5E8PA 4R26L 4YH6A 4YHOL 2GITB 5EOQL 1KTDB 1L7IL 1IKNA 4JREC 4ODVH 2J8HA 1HDMB 4LASL 4JFXA 3W5NA 1CF8L 3S4SA 2DLEA 2YKLL 4NNPL 2VZOA 2OLDA 1MCLA 2H1PH 4XNZC 3QQ4A 1P4BH 4KKLD 4XNYL 4L9LA 1H15B 2CIIA 4O02H 1ZLSL 1U3JA 3QWRD 2AK1H 4ONHB 1FE8L 4PY7A 2GTZB 3Q2CA 1BHGA 1ROWA 2VLJE 3QFJE 5IBUB 3DVFA 3RGVB 5ISZB 1KGCE 4YDVB 3CVHH 4JGUA 1WEJL 3FB5B 5CHNA 5I1GL 1ZAGA 2H9GB 3LEVL 4PGDA 4RMUA 2ADFL 5BOPA 1QOKA 1D6VL 5BV7H 2G2RA 1UJ3C 1VGKA 1T2XA 5A2JH 3DVGB 3FTGB 3W2DH 5GGVH 4B5EA 3LMJL 3U4BH 3L6FA 3WD5L 1A7BA 5D5ME 4E42A 1QLFA 4KK9D 4BSJA 5SWZA 1WQVT 3GI8H 3EGSA 2ZNWA 1HXYB 5DC9B 1NKOA 2N1KA 3QR2A 1IEHA 3BYYA 4MJ5B 1CL7L 1YN7B 2JCCE 3SHSA 1ZGLA 3AXLB 4LSSH 1P4LB 1A3RH 4DQOH 2ENSA 1FAIL 4TUKH 3EO9H 3PWPA 4FQLH 3BO8A 3UJJL 4QXUH 4EOWH 3VXSA 2JJVA 2EDBA 1HILB 5F9AC 4R0LA 4HWEH 2DS4A 3ARUA 2YN5A 1MPAL 3C60B 1G7JA 1WJ3A 4WUUE 4MDIB 1TNNA 4R97B 2D4FA 43CAA 2XY2A 3QCVL 4MNGB 4AQ1B 5JOEA 3JUYA 3I9GL 4LASH 3QDAA 5E9DB 3F65A 1T2QL 3UPRB 2UVFA 4LK4A 1NMCC 1LP9B 4ENED 3BPNC 5LCVH 4KPHH 3MA9H 2Z8RA 1LDSA 3F12B 5B3JF 5I9QC 4OLYL 2K9UA 2XYCA 2R2EA 3ULUF 1MUJB 2A73B 4JG1H 4WNQB 3PNWA 4OF6A 2ZOLA 5TDOA 4KDTC 1KCRH 1WV7T 1PX4A 1EVUA 2I60H 4UILL 3JVGA 2WLZA 2VDQH 3QPQD 1V7NL 2GIYA 4GKZA 1J1XL 1M05A 1K4DA 4HXBL 4NT6B 5I74C 5HHME 4YFEA 2EO9A 5FYLL 4Y2OA 5MEOB 4JVPA 4JDTH 4DN4L 2ADFH 4PGCA 1S78D 2DLHA 5CSZB 1FZKB 4QXGH 5I75C 4HEPG 4Z7UE 1Z2KA 3G6DL 1N8ZA 3DETC 1CDCA 3B8SA 5CINL 1X3DA 3VRIB 3PWUB 1T0MB 4JFQB 3O6LL 1JN6A 2XRAH 3DSFH 4PYHA 4JRXE 3SDXA 4F37K 4U1IA 3EO0A 3KLSA 4H20L 4X5WB 2BHYA 4KVNH 3UTTD 3H0TA 4X0KB 3KPMA 3PWUA 3MGTB 3VE0A 1FN4B 2NY1D 3FOMB 5FA4B 32C2A 4P23A 4QRQB 3G6JA 3U30B 3GI9L 2YXMA 3VD5A 4XPFL 5D5MA 2AQ2A 2WW8A 3VD4A 1JNHB 3IXAA 4X7EC 5ESAB 4D3CH 1WTGT 2VDML 5IJVA 4L4TB 1HWGB 3O3AB 2WIMA 1ACYH 1OVZA 3HZKA 3HN3A 3TIDB 3FO1B 4BK4A 4POYA 2E6QA 4FP8H 1QHPA 1B3JA 4KTYA 2CMRH 5D2NE 3MBEC 1U6AL 2DI7A 2NY5L 1KIUA 1RSFA 1JGVL 3VI3F 2AXFA 3HG1D 3QIWB 5D70H 3EO9L 3WS3A 2V9RA 3O9WC 4R6UA 3HAEG 4QXWA 4S11A 4DGYL 4HJGB 2NY6B 3R0NA 2GJJA 3D3VB 2DN7A 2EE2A 3QG7H 3VCLB 3U6RA 1DDHA 4JM2F 4W4OA 4S0SD 3MACL 1MRFH 4XRCB 3U2SB 4LCWE 3VRJA 4L8SA 5GS0C 4PFEA 5HHOB 1XMWA 1R3IH 4DW2H 4RBPH 5DJ6B 3ARGB 1C5BL 2FBOJ 4DUWA 5B8CC 5FYKU 4GLRI 2J88H 3RZCB 2AGJL 5FV2A 5IHUL 5JNYA 2C3XA 2ENYA 2ORBL 3TT1L 4JR9L 1H5BA 5DHXB 2W9DH 1IEBA 5D1QA 4ELME 4PJAB 3GUTB 1G84A 3BP6B 2LTQB 3BGMB 4D94A 4OLYH 3N1GC 1FNLA 1NGQH 4S2SA 2FB4L 2R0LH 3FT2A 3QWRA 1UZ8A 2D7OA 1YEJH 4Z7NF 3HMXL 4U1KB 4LLMB 2IJ0C 5I1KL 2ZKHH 5JXAH 4JFZH 1ZT1A 2MTPA 1JYVA 4WFFE 5JLZB 3QJHA 1MI5B 1QSED 1MWAL 25C8H 4EI5D 3VGGA 4OI7A 3W9DA 3CMGA 4P2QD 2AQ3A 2VLJA 2FX8H 3EJJX 1ADQA 3WUWA 1YA5A 3OKEA 5C08E 3BJLA 3GDBA 3RL2A 1P1ZA 4MJID 3QNXA 3ULUH 5I73B 4PJFA 4FQIH 3BPCB 4CJ0A 2HFGL 5GGSA 2BOBA 4PJAE 2VAAA 2GJZB 2ADJA 1HSBB 2DQUH 1NANH 1CIDA 3AMLA 3ZYIA 4G8FB 4QEGA 3TP4A 3R4DA 2Y5TA 3VU2A 1AI1L 2QSVA 3T08A 4H20H 1OOAA 3PUCA 3EFFA 5F3HA 5J9PA 5JIKA 5I8OH 3VXQB 3VRJB 2DIBA 2CR3A 4OCWL 1H0DA 5F9DC 4PJHF 2AEWA 3RKPA 4CU6A 1EEYA 2BVEA 3ZTNL 1I1YA 1HHJB 2BSTA 5CEXB 3VMPA 4HLZG 3GI9H 1OAKL 1BIIB 3VWKD 4LSUL 4JPKH 4FFZH 2C5DC 1AXTL 1EGJL 5EU7C 4EN3A 3C09B 1NC2A 2GEEA 1RJYB 3GNMH 2HFEA 4NO0D 1EEUA 3O4LE 1ZTXL 3ULVE 1U58A 4HUVB 1FDLH 1IC5L 1RI8A 4QRRA 3S9DB 1S9VB 2HT4C 2HRPL 4D9QD 1OCWH 4X9GA 3Q6GL 3KVQA 5DQJB 1GGUA 3L7FA 1P2CA 2YZ8A 5FO7B 5CLTA 2DKMA 3WO4C 1N5YH 3QT2A 32C2B 4P23B 4QRQA 5D7LD 2IMMA 3VWJB 1HEZB 3F7PC 3VFSA 3BX7C 1B88A 2ZSVA 4MD0B 1IAIL 3IDGA 4LCWD 1FBIL 3CLFL 4Y16A 1HXMB 1EZVY 4KKBD 5I8CB 5E1AB 1UGNA 1A02N 3QUZD 1F3RB 3CFBB 3HR5B 4L4JA 1GHFL 3BDYH 4J1UB 4JY5L 2DLIA 1A6UH 4GXUM 4HXAH 1PLGL 3LKOB 4FNLH 3WJJA 1X4ZA 3OX8B 1R3JA 4ELMA 2DJUA 4LBEB 3HFML 5DMGD 3VFSB 2VQ1A 1HCVA 4OGYL 1A7NL 1F45A 3BH9B 1KCVH 4RMRA 1A1MA 3E8UH 4BUHA 1CYGA 2ED8A 3VH8G 4JGMA 3HLAB 5E4IA 1XZ0B 1OGAA 3VH8A 4RFOH 1CD0A 3L7FB 3FHQA 4L1DA 2P47B 4XHJD 4X80H 5T1LA 3ZO0A 4F7PB 1QLRB 2XN9A 1QSVA 1I7ZA 5KTEH 2LVCA 1PX3A 3TVMC 1QNZL 4X6BA 4R2GB 2H1PL 3HS0B 1PY4A 4NM4H 5EN2B 5B39G 5LAXB 4P5KA 3LRSB 4MAUL 1MSPA 5BW7C 1I8LC 5EORL 2YBRA 3A6CL 2DM7A 4I0PB 5IMLA 4HPYH 3REVB 3LZFH 3MREB 1CGUA 2CLRA 2I5YH 1RZGB 2VXVL 1CICD 2VWEC 1V3LA 4LIQE 3QEQE 1TQCC 2P8PA 5ADPL 2V17L 1HOCB 5EC2A 4Q9RL 2R1XB 3SN6N 1KXQE 3EDEA 3LEVH 1AI1H 1NUDA 5GSRA 3O6KL 1MF2H 3FQNA 3CSYB 2WWKT 5TFSL 1GZPA 5EBWA 4XAWL 3MBXL 4NDMB 1V5JA 4MA8H 4MJ2A 3ARDA 5EUOF 3U4BL 2R4RL 4PJXA 3LKNB 5E6ID 3SO5A 3UP1A 2F74A 2APTA 1DLHB 4UIKL 1CK0H 4XAKE 1C12A 4H25A 4QLRA 1VB9A 5FGCB 1GGTA 1WSST 2GFBB 1DVFD 1RK1B 2CDEA 4J3XA 4OJFL 4XVJH 4XPTL 4PV8B 4YBLB 1R3KA 1FAIH 3RJDA 1HXYA 5HGGS 4K2UH 4CVZA 4QHLB 1NBYA 1OCWL 4HWZA 4PRPB 5SWZB 1IGCL 1OP3H 4MCZB 1MY7A 1RK0A 4QWWC 4MWFB 1S7RB 5FM8A 2BVPB 2N7BA 2X4TB 4O58L 4PG2C 3JWDC 3SE8L 2F19L 2DQDL 3KPRE 4QOKB 2G2RB 4WWID 1HQRA 4GUPB 4TVPE 2HA1A 5FO8B 1X5LA 5EU4A 5HYSA 1FBIH 3CLFH 3WEXB 4UTAH 2BVPA 5E8EA 2Q20A 3MRMB 3WN5A 4Q2ZA 4YDVA 2X4TA 1LO4L 1MH5B 4OLZH 2IF7A 5E2VL 1FV1B 1ZT7B 4NUGH 3B9KA 3MLRH 4HDIB 3S36H 4U0QB 5EOCH 3TEUA 1A4JA 3PL6B 5JIHA 2NY2B 3RDTA 15C8H 1H3PH 5BV7B 2KUTA 4MJ6A 2CDGA 5T1DH 3FFCA 4M93B 1FJ1A 4F80A 3AU1B 4PJ5D 1QBML 4MB4A 2DB8A 1AGBB 3O2DA 3S98A 1CT8A 1V05A 4OIBA 4GRLD 4JDTL 4NSKA 5KTEL 2XIDA 4U0RC 1NCDL 3PQYB 4L3AA 1T20B 3SJVA 4MAUH 5ILTL 4MA8L 4IJ3C 3T0EC 2Z8WC 3LPFA 1NH6A 2BY3A 4QWWD 1JZ5A 2ZCHH 1IAOB 1ZLUK 4N1EA 2XN9E 4K94C 4OGAD 3TBSA 4RZCB 3LEYL 3RWJA 1FG2A 5LXGL 1OGAE 3K8LA 3FZUD 4WFHE 4MXVF 4X9HA 4Q9RH 1B0RA 5JZ7D 1HWHB 4ZFZA 3GRWH 4KJPD 2Z8VC 3QXDA 4Y16C 3VGBA 4DEPB 3PDGA 2IPKB 3DO3A 5DF0A 5DJAB 4YXKL 3WJJC 2Q76A 1Y6MR 5GJTH 1MFEL 5DJXB 1T0MA 2EKJA 2FATH 5D6DA 1CD8A 3P73A 4D3CL 1QFWL 3O8XD 1QYGH 4NWUL 5F88A 1IAII 2YD4A 4WI7A 1EBPA 3UBXI 1RJZB 2HJKA 2FH6A 3KYAA 3GSNL 4Y4FA 5D8JH 4ZTPH 5HPMA 3NH7L 1MJUH 1M05B 5KJRH 1MAML 1N0XH 2H3NA 4HX1B 1TDQA 4OT1H 4E41B 5JHLH 4Y5YA 5C0ND 4XP1H 4O2EA 2BNUB 5I8CA 3AB0C 5CLWA 4P0DA 4J1UA 1RZIA 4IRJA 2LABA 5BZWB 3CX5J 1WFUA 3L9RB 2R29L 5JTWA 2ZCKH 3RX5A 1I7RA 3TCLA 4TPRL 5D93B 2VR4A 1S7SB 4KRNA 4FMFA 4A6YH 4Y2DB 4NOBA 4R7NA 2OZ4A 3T4AB 1FG2B 3GKWH 3ZL4H 3C8HA 4WI4A 43CAB 3LKPB 3TCLB 5CMAB 5IV2A 2ZUVA 5JA8B 1YNTA 2M8XA 4PJ9A 3HC4H 2FB4H 4PP2B 1FE8H 4WHTB 2Q7YB 3UTTB 2R0LL 3ZHDA 5BVPH 1KULA 5ETUB 4WEMB 3BYTA 2CO7B 3HI5H 4RRPG 1Z6JT 5LXGH 4WV1C 2BNUA 4WI3A 4LLDB 3O2VH 1X5JA 1UH2A 1D9KB 2NR6D 2AABH 1RIUL 1WIPA 5J6GA 4DVRL 3L3OA 1YEEH 2YD1A 4C4KT 4UAOB 1F42A 4M93C 4YEEA 1RJZA 1D5IH 2HJKB 3RVVC 3MUZ1 1MCEA 5DO2C 3MJ6A 3ULUL 4Z77A 1FNEB 1I8MA 5K9KB 1GPOL 4S1RL 4KUCD 3IFPA 4LSQL 5MP6L 5KVGL 5HGAB 1QUNA 2NXZB 3CXDL 3IXTB 1S5HA 2AERT 1VGKB 1OAZH 4C56A 5DUPH 4L4VB 5EG6C 5HHXL 2W0LA 2OJEB 2WWKO 3WUWB 1NFDE 4ZTPL 4FTVE 2QADD 2HRLA 2W0FA 1MCWM 3QNXB 3HNVL 3BMWA 4H26A 5D2LB 4L8BB 4V1DA 5BW7A 1AXTH 1P6FA 3LN9A 3MLTA 4XH2B 3REWB 4P49A 4N0FA 5ADOL 1OF2B 4UT7H 5IESL 2AP2A 3GNML 4LCCA 4CVZB 5TQ0L 2BVTA 5T3ZH 1TJHL 5J12B 3B2VH 5ID1B 3O4OC 3QCVH 4IIQB 4YHKL 3SGDH 1YEFH 4CGTA 3BPOB 4P23D 3QFDA 4X6EB 2I25N 2HYMA 1UYWH 4JZOA 4NHUB 5L2KD 4TSBH 4YNYA 3V2AR 2HJLA 1OAYL 3VGHA 4KPHL 3U48A 4CDHA 2EC8A 3DRQB 2OTWA 1AD9B 1YPZF 2X1QA 3EO1B 1MPAH 5GZOD 3IDUA 1JNJA 5I30L 1KNOA 1EXUA 4Z0XB 4HMCA 1S7VB 2CJUL 3D3VA 2VSCA 1QA9A 3T0WA 4YHZH 4F3FA 1GAFL 2LU4A 4NN6C 1K6QL 2FJHB 4BA8A 3ZKMD 4UINL 4ZS7H 5C0BB 3KXFE 1OTSD 5E8DH 4ZDHB 5TE7H 3FAWA 3SDAB 5IWLC 2BHZA 4K3JL 4MXQC 3G6DH 4M7LL 2X4QB 1CVRA 3LN4A 5DMYA 3H2WA 2EIZA 5F9WB 3DNKA 4JZJC 3HE7C 2X4PA 5ICZA 4MWFA 4JFFA 4I18B 4LF3B 1CLYL 3V5HB 5DRNB 2F8XC 3CK0H 4DN4H 2E3VA 2I07B 2O5YH 5HYJB 1FFNB 2JJSC 3A6CH 2FJFB 3BZ4B 4WW1B 1E4KA 4LSRL 2JIXB 1JE6A 1TITA 4JFFB 1UEMA 3CFEB 4U1IB 3K2MC 4HJ0C 1ND0A 4LSQH 5EUKB 5GZOC 1V3MA 5KVGH 4PJDF 2GJ6B 4PJIB 4RGOL 4PV9A 5FKAB 1ACYL 1BZQK 3MV9D 3ULUE 5T1KA 4FQJL 2BVUA 3B2VL 3FKUS 3FN9A 3I6GB 3RTQA 1AQKH 4QNPF 1U8PB 4TN9A 4WTWA 1PAMA 5D70L 2RFXB 5CJXC 3M1BA 3O6ML 1F4WL 3KPPA 1GXEA 3GMNB 5JXEC 3F7VB 3MLXL 3S5LA 2FEEI 3ARGD 1BOYA 2WP3T 2DYPA 3RVWD 1R6VA 3HRZA 1T83A 4YHLH 5C0EA 4EKXA 4I0PA 5IMLB 1KIPB 2OR9L 2MQCA 2ZOLB 3RJQB 3LEXA 4WU5A 1F11B 1FNHA 1RJYA 3TCXA 5L2KE 3DXAD 4U3XA 1UH3A 4TULH 4X6EA 3JV6A 1U8NA 1XAUA 1F4XL 3TN0B 3OHXA 2K7PA 3D0LB 4V2BA 1BVZA 5CCKL 3Q6FB 1KB5H 1MFCL 4KKCD 1CD1B 2R1WA 3VDCA 1IGIH 2EDTA 3PP4L 1I3VA 3CSBA 1MFDL 3NN8A 2DL9A 2IH1B 2R9HD 1C5BH 4KKLC 5ICYA 2OL3L 35C8H 3EOTH 5MI0C 4F7MA 1U8QB 3T1FA 5IVXE 3K1DA 2GAZA 3MRPB 3O9WA 2AJYL 4NNXB 4R0LB 5C86A 3IVKA 4GAFB 4OAWA 4N90D 1JN6B 3UJTL 3ZDXF 4R8WL 4RDQF 4FFYH 4LAJH 4NYLA 1OTUD 5JORB 5ACZB 3W9DB 4JHBA 3TVMD 2CKBB 5FYKH 2IH1A 4ALAL 5T5FH 4X4ZA 1JRHH 1CICA 4KVCL 3QHTC 3D69A 1T4KB 2A2QT 1CN4A 4JN1L 3BW9B 4MNQD 1UZ8B 2X4OA 1L6ZA 4G5ZL 1S7UB 4DGVL 4BZ2H 5KS9E 3QQ3A 4OZGA 4LLYA 1Z5LA 4D0CA 4HMEA 1D9KC 4HHAA 4HUNB 1F11A 3OZ9L 1O7SA 3LEYH 2RBLA 5GIRA 2BK8A 3SDDD 5E6IA 2PO6D 1HSAB 4K7FB 3F5WA 3GSVA 3TBWA 4AL8L 5EZJA 5BZDA 1U8OB 4MS8C 3K8KA 2EDOA 4PJCF 4BYHA 5E56A 1OWRM 3MMEB 5I1IL 4MNGA 1OTUC 4JY4A 2CRIA 4TSCH 3S4SB 3GJFH 4FQ1L 5C07A 5FUCE 3U0PB 2Q1EA 3VXRA 1JTPA 2IANE 3FFDB 5KSUB 1PW3A 1KXTB 4YLQT 3MJ9A 3ZTJG 1YC7A 1OLZA 4KJPC 4Y16D 3DV4B 1IM9B 5F7UA 2BSRA 3TF7C 4X9IA 3ZE0E 4PRIA 1ZLVH 2G60L 5CEYA 2VLLA 3MRKA 4MAYA 4HC1A 1A6UL 4HXAL 1P7HL 3PE9A 3QFJB 4WI8A 4F33A 2E6JA 2H41A 4DVBA 1DL7L 4UDTA 3WYRA 5DA4A 4X98B 3QIWC 4ZO8A 1ZVSA 5D1ZB 1F00I 3ZKND 1GC1C 2EYTA 4ZS6C 3L6FB 3T0DA 4U1JA 4XBGA 2XZCL 5I1AB 1YYML 5C6WH 3KXFA 4GAJL 1QRKA 2WK2A 3WNNA 4PJ8A 3WN5C 5T5NG 1AFVH 2OL3H 35C8L 4PGZA 4Y5XC 3QH3A 3TT3L 1IM3B 4JFQA 2HMIC 4OV5B 1ZHKB 3D3VE 2R39A 4IOIA 4JHZA 5DTFA 4YGVA 3SE9H 4FFYL 3L5XH 1IQDA 1WITA 4M61A 2QADB 1EHLH 3OKOB 3ILPB 3S8WA 1ZV5A 3NCJL 1C08A 5I1DB 5I2IB 3IRZA 3JTSA 1EJ6A 3EUUA 2GCYA 3KJ6H 4QHNA 3MNZA 1TJIH 1WBZB 3EO1A 4WI5A 4ZOAA 1IGJB 5DS8B 3U82B 4KTEH 3RUGE 4I18C 1UENA 1WZKA 5E9DD 3LZFL 2OQJB 4LPYA 1Z3GH 4UQ3A 1TZIA 1ZA6A 4CUCA 1H3XA 3L1OL 4N0RA 3OZ9H 1D3CA 4LLUB 4NKQB 4YQXL 2HJFB 4UT6L 1R5VA 3KPLB 1U8PA 3BRDA 4OGXL 4TSAH 4ZXBB 1BQUA 1TZIB 1ZA6B 2VDPL 2FJGB 5HDQL 4Z7OE 5TFSH 3SY0B 1IGML 1MIMH 4LRIA 2IANB 2IBZX 2NW2A 1HKFA 4ZTOL 5SV3A 3V4VH 5FK9B 3WXVH 4XP6L 1EAPB 4G9FB 3G08A 5DFTA 3RUGB 3ZHLA 5ADOH 1D5MA 1XF1A 4ERSH 3NA9L 2A6DA 3PIQA 1UM6L 3DX9A 3GMQB 5LBSH 4OM1H 5DRNA 4HX1A 1YNKL 3PJSA 4JFYB 4ZUUA 3RWFB 3F58H 5JW4N 5AYQA 3TH3T 5DTFB 1RFDH 2DOCA 2P5WB 2O93L 1I9JL 4U1SA 3UX9B 4LOUC 4KDWA 4XB7A 4Q0XH 3MRLB 4G42B 3CFCH 5F7KC 4HIXL 5DSCA 3VFNA 5IBUG 3H9SB 3D25B 4NRZB 4OIAA 4CMMB 5CEYB 3V6FA 5CEZE 1D9KA 4HS3A 15C8L 1H3PL 5HHPA 3KLHC 4F57L 5EUOA 1E6JL 2CGRH 4Z5RB 4OAWB 4MDJB 1JYXA 4PJCA 2QHRH 1K6QH 4HS6B 1WCBB 4OFPA 3ARQA 1SVCP 4PP2A 2BSED 1MHPH 4UB0L 4K9EL 1KNOB 4AH2B 3DETD 5E2JA 5IV2B 4APQD 1S7TA 5E08L 3FRPA 2HJFA 3DX7A 1NFKA 4JM4L 1QSZA 4ZOCA 2DTML 1EJOL 5AZEL 2WUCL 1R0AH 4Z95L 1Q72L 1UA6H 2XICA 4D0BA 3KR3L 4KRPD 5IEKA 5F1NB 3AS2A 4ZSOA 3WNPA 1P7KB 3CVHL 1UKTA 3RWGB 3JV6B 2C3VB 4LEXL 5TQ2H 1CLYH 1NUGA 2F53D 4HKBA 1RZIB 3MC0A 2PXYA 1Q1JH 4NNPH 4J12A 4U6YB 4A6YA 4S1SL 1RAMA 3QEHA 1VFOA 5M94B 2XTJB 4XHQA 2BJMH 1G6VK 3OL2A 5IB2A 3MCKB 1DBML 3PQYD 3D85A 2ZSWA 3L1OH 4U1HB 4MMZC 4KKCC 4BZYA 3ET9F 1KXVC 4HUWB 5ERWB 4XBPA 5H2BA 4P3WA 5CIPA 1FYHB 4R96B 3S37L 2FX7L 2XA8L 5JORA 1BZ7B 3IXTA 1MJUL 1K3ZA 3ZKXB 4HUWA 4AENB 5CJBA 2IAMC 4PV9B 5FKAA 4PJIA 1T7WA 1EDQA 1G7QA 2IPKA 1SQ2N 2KDGA 3WJLA 1CU4H 3BN3B 4M6NH 3LKRA 5EU3B 5T3XL 1RZJH 1SYVB 1JV5B 1H15A 2CIIB 1MI5E 3NCCB 2FLRT 3SJVE 1DBJH 3VJ6A 1RV6X 2A6DB 3QUYC 5C09D 2AJ3B 5CAYB 1T7XA 4NUJA 4M48L 5F89B 4K9EH 4MSWA 2WWMD 2ICWI 5IGXH 4OZIE 1G1CA 5FYJE 5FUOH 5D2NA 3VI4E 4RWYL 1VADA 4Z7VE 3NIGF 3LKPA 1N59B 3N9GH 4OD2B 5J06A 4IMKA 3D39D 3OB0K 3HI5L 5I15L 4YBQD 1N6UA 2X1PA 1GIGL 1J1XH 4PP1D 5FDWA 1DUYB 5HHMD 1BIIA 3L5WA 4OM0H 5IFHL 4KK6D 1KOAA 2E7MA 1XIWA 1MEXL 3VXTB 3S37X 1H8OA 4P2RB 4KKBC 4LRIC 3ZE2E 4LLQB 4ZMAT 3ZHKA 3WFHA 2NY5C 1ZHLB 3LIZL 5JDJA 1XF4A 3M17A 2D7QA 3B5TA 1GPOH 4IHOB 1E4JA 5EDXA 5I18L 1JIBA 3TVMB 5ICXB 1NCAL 3PHOA 2FEDD 3U83A 3VFNB 1MCJA 4ODXB 2EDQA 1QR1B 3L3DB 4XWGL 1WUNT 3RL2B 2V6HA 4PLNC 3LB6D 3QO1B 1Q1JL 3B9KB 3EW3B 3HNSH 1CICB 3S36X 3ULSB 1FL5A 4OD1L 2WANA 3HNVH 5IJVB 4ZFFA 4OF5A 1S9WB 3QIBB 2ERJC 5FCUH 4KGJA 3I50H 1X5XA 1XIWD 5T1KB 1INEL 2FECL 4CVXA 5IESH 3TJEH 4KTDL 1T7VA 4I2XA 1CZ8H 1RHHA 4RAVA 5T3XH 1FGNL 4K23H 5K59F 5HHXH 2UYLB 3H9HB 3SE3C 4CAGA 3MV8D 2YUWA 3FONA 1XGRA 2NY5H 3NN8B 1T22A 1J87A 4MCYA 1TETH 4OZFB 5CBAA 3V5DA 3NGBC 2I24N 4JFDA 5CGTA 5IEHB 1AGDB 3LV3A 3G5ZA 1I3GL 4KDVA 4ZPVA 1H8NA 2NX5D 1XT5A 2UV3A 3BT2H 2ADIA 1YECH 2XOTA 4WW2B 5H35A 2VDRL 2V7NB 5KSAC 2AI0H 4WU5B 5IB4B 2IMNA 2MQ3A 2W9EL 1IGJA 2CJUH 5FHAL 4YHKH 3UYRH 3H7LA 1RUPL 1ZKAA 4HEME 2EDXA 4XBEH 2R2CA 1Y0LB 4JCMA 5C0EB 2J8UF 3TYGH 1T04A 3WUZA 2EH8L 3SKOA 3C6SB 2WUBL 1UKQA 1X6LA 3CDCA 5D7JC 1RIHL 1FIEA 2XKUA 2B1HL 3I2CL 2ARJB 3LQAL 4P46C 4Z8FH 4OCXL 4Q97A 1DBAL 1IMHC 3CPLA 1P53A 3OR6B 1YYMH 3TA3C 1HIML 4KJQC 1I1AA 5KSBE 2FO4B 2NY3B 3C6LB 3DYPA 5E2TH 2EICA 2WP3O 4G6AD 3HNSL 4X5XB 5E6YA 1W0YT 3DVNB 5LGJA 1F2QA 1SEBA 3A67L 5SWQB 1A21A 1ZEAL 1LD9A 2AV1A 5CWSA 1RU9L 2DQGL 2FJFA 4M7LH 2ZCLL 3PDOA 4GS7B 5HYJA 5DZOA 3JVGC 4D0DA 4M3KB 5H37G 4WCYL 2XZAH 4ZO7A 5DJDA 1AD0A 5KOMC 4EIZC 2YPKB 3BHBA 2VSDA 4XX1E 4FZ8H 3N1FC 5BS0B 3LKNA 3TZVD 4KRMB 5JW5A 4Q7DA 5C9KA 5BQ7A 5IFJB 4F15C 1HH9B 5EOCJ 4EI5B 4Z76A 1AY1H 2AKRA 1U42A 1U8QA 5IWLA 1BQSA 1LK2B 5C0GA 3MA7B 3ARBB 4OZHA 5EBMA 5EBWB 3IYLW 3V8CA 4Y2DC 2ZJSH 1U93A 3OV6A 4JQVA 2JTDA 2GHWB 2WM0A 2VDRH 1KPUA 3B9KD 4QGTA 1R0AL 1AQDB 1NFIB 4FQXA 2V5TA 3S6CA 4GAGH 4L8CA 3O2WL 4XB8A 1EVTC 3MNWA 2DQHL 2YA1A 1C5CL 3RKDC 4FQXB 1MIEH 3ETBF 4LVNB 2BY1A 5CCKH 2DF3A 1PZ5B 3OGCA 3T4AA 2D7TL 1YPZE 4UV4L 4X8JA 3TBTA 3QQ3B 5DJ8B 4JKWA 5EZIL 1MCDA 3DBXA 3JV4A 3MV8B 1L0QA 4BFEA 4JG0H 1S5IH 2QQNH 4FXGA 3VFWB 3CAFA 2AXHA 4QHMB 4OUUA 1T66D 3BDYL 5L88L 3ZKNC 5E24E 1M7XA 5TDPB 1I9IL 1GGYA 3C87A 1U8JA 3E6FA 4RAUB 3FFCB 4OCMC 5DQ9B 1ZEAH 5CS7A 5HD8C 1XF2B 5TH2B 1IGIL 4HW6A 2CGRL 3CFJA 4LVOC 3UBXA 2HTLC 3FB8A 5DI8B 1KC5H 4I3RH 4B50A 2Z4QB 3T65B 1HH6A 1XCQA 4HS3B 1G6RA 3RA7H 4W6YB 5IB5A 4YHNA 3T77A 1K2DA 1PYWA 5GHWH 1G9NC 2H9GA 3F6LA 4CMHC 1ES0A 5HPMB 5EOTB 3QEQD 4HK0A 3K4ZA 3KR3H 4ZAKC 3TJHC 3DRTB 4GW5B 4QRSB 3QXDB 4P4KD 5BO1L 4QYOA 4OZFG 3IDJA 3S34L 2FYYA 3DMMD 4FFVD 1VESA 4K7PL 3S88L 3RTQD 4F9PA 4IMKC 1U8KA 5D7SH 2CXGA 5B38A 5B39A 2X2YA 3PF2A 4WW2F 3LDBC 3IU3B 2OTPA 1YEDB 5C3LD 5DURB 5IR1A 4R7DB 4PV8A 2C3VA 4DGVH 1UCBH 2DYPB 5KW9H 4ZSOB 5F1NA 3MROB 5D1QC 4QTIL 5CFHA 2VXVH 1BWMA 4WHDA 1CQYA 3BP7B 5F9JA 2NY7H 5M7QA 2PYED 2F8VA 2V17H 4CN4A 3TJHD 2EYSB 5HJ3A 5F3HB 1CGWA 5J9PB 2A74B 4BFBD 2HH0L 1BQLL 4OJFH 4QT5A 2FCBA 1KV3A 1XR9A 1N2RB 3VFPB 3BUYA 1N5AA 5JHDE 5DFWH 5I1EL 2CRMA 3HG1A 4ZPVB 2BRRH 2OTWB 5DVOA 3JZ7A 4AM0A 3ULVC 4MDJA 2EYSA 2NZ9C 4OKVB 3RHWF 4HGMA 4TSCL 4Z7QF 2UZXB 1DBBH 1MIEL 1F4YH 1YPZA 5C08D 1T5WB 1KACB 4ZSOE 4BJLA 2W38A 1WBZA 4PJEE 3AVEA 5KG9B 1YEGH 3GMMB 3HC3L 5KN5A 2F58L 4UTAL 5E8NB 2CD0A 1DLFH 1MREH 5JW3H 1I1CA 2AJXL 3GSNA 3MV9A 4GAJH 1M1SA 1Z9OA 1S7QA 3FT3B 1SJEB 2FYYB 4X4MA 1IGYA 4QRUB 5C07D 1X7QA 3CUPB 1ZVHA 3QUMB 1PSKH 2OBGA 3SKNA 1NAKL 3UYPA 3TYFA 3QH3B 4Y1AB 2B1AH 1NLBL 1KN4H 2QTEA 4UU9A 3QIUC 3ARFC 4KUZH 1WF5A 1OB1B 1NCWH 3WNKA 3DVGA 3FTGA 3CDGA 4PRPD 1LK3L 4WDIB 4BQ9A 1E4WL 3LKOA 1UACL 3UPCA 4P59L 5AWNL 1K8DA 2VABA 1SJVA 5ERWA 1WVZA 2WWMC 4LU5L 1FNEA 2NY4D 4ETQA 1FVDB 1XGTA 4ODHH 3U1SH 3X12A 3L5WB 1FGVH 1JK8B 1JFQL 4NJAL 1CXEA 4L9LC 3WDIA 4RAUA 3QHZH 1IBGL 4CNIA 4I4WB 5J1AB 3HE6A 3MV7A 5DLMH 4ORZC 1IT9H 1EV2E 5DRZA 5JDSB 4WRLA 4PJDE 3MLZH 1EFXA 1IE5A 5KZCB 5IBLD 2Z31A 3K4AA 1IAKB 5GJTL 3NCEB 3V4VL 3TBYA 2HFEB 2B0SH 3NAAL 2IPTL 2VH5L 3EYOA 4G6MH 2R1XA 3MUY1 1INQB 4I77L 5ITFB 4KTDH 1V8HA 3PL6C 2V5SA 4OM1L 2EDRA 2ILLA 4P9HL 5C0BE 1AXSA 1GCFA 5DJ0A 3QUXD 1JTTA 1I4FB 4ONFH 5HDLA 4E42B 1BJ1J 2XV6B 5F71A 4PB9L 4GXVL 4OF8A 5LKNA 1NUNB 3RIAF 1FH5L 4AEIH 1Z0NA 1NGZA 2VTFA 1X9QA 4OFIA 3WKMH 1S7WB 4B7LA 4G8FA 1RZKH 3I84A 4NQXA 1W72L 3JV5A 1BVKA 5FUZH 1MLBB 5KS9A 3D39A 4PLKC 4RMVA 4P46A 4KMTH 4FXKA 4N8VB 5DFVD 3MODL 5GS2D 1UVQA 2V5YA 2VLJB 5E7FA 4E5XA 4U6HA 4NNYB 2ZOKA 1BVKB 2VQ1B 1I9JH 1QEWB 2X4RB 3JWNC 1MAMH 5KVFL 2ZSWB 3GSQB 2DIAA 4NYLB 5D4QA 3BVNB 1L9MA 2BNQE 1MCBA 4HIXH 2ZUQB 1SBSH 3HR5A 1FFOA 4NQCD 1I8LA 4N5ED 1OW0A 4OCXH 4QRRB 5EU7E 3OKDA 1NAKH 5T3XE 3IJYA 4LPTA 3VXRD 1J1OH 4YZFE 4P9MH 3RY6C 1GRWA 1PKQB 5ESVA 2BCKB 4I9WE 4AQOA 3TBYB 1BQHB 2DI9A 2Z92A 3VGAB 1F3DJ 3IJYB 1RQ5A 4Y89A 4J4PA 1U3HC 1Q94B 4ODHL 4NQEA 4ZQKA 4JZNB 3MCLH 4O00A 2VYRE 5HHVH 2JJTA 3GJEB 2WSKA 4XPGH 5L2KA 1MLCB 2BDNH 4KU1A 5MP6H 1UB6B 4OZFH 3LN5B 2W07A 3QXTA 4NQEE 4E41A 4F15B 2F54B 2IG2L 3HMWH 3NCYS 2H3NB 1A47A 1IT9L 3SEPA 4PRHE 3U7YH 5CP7A 2VXUL 1WBYB 1QRNE 1MCIA 4XPAH 1RIUH 4Y5VB 5KOVC 4F7TA 4UUJA 4MNGE 3T2NL 2ADGB 3VFTA 2IFFH 2BNRB 3P77A 1XZ0A 3MV01 1NL0H 4M61B 1CTNA 1NBZB 4JFPB 1MCSA 3AREC 3EFFB 3MLSH 5F6IB 3PJSB 4JFYA 4ZUUB 3RWFA 2VH5H 3QA3B 4OGZA 4HKXB 4M7KL 5F72S 1CU4L 3I3DA 2CLVA 2I60L 1ACZA 3RWHB 4DTGL 1S7XA 3M8OL 2Q76B 5IB5B 3DSNA 3NACL 4Z0BL 4M1CC 3WBDA 3OJDA 1JGDB 5K9QG 1NGWB 2W9LA 4QRPD 5K9OA 4Y19B 2DM4A 1JTOA 1B2WL 3CU1A 3U9UB 3GJFA 2DI8A 5CZKA 5FUOL 3EOBB 5D7JD 3GSNB 3OSKA 3QG7L 4GBXB 1T1XB 3PXJA 1DR9A 1LO5B 2YZ1A 5E8NA 3ZE1F 2GI7A 3P4NA 5GS1C 5DD0H 2J6EL 5DQJA 1K3IA 4CDGC 4QRPB 1CI5A 3BE1H 4HG4J 4HJ0D 1GGBL 2WINB 3PQYA 3VFRB 3BEWA 3GGWB 1UYWL 1GAFH 2PF6A 4P5TD 4BZ1L 4DUVA 2BY2A 4HFUL 3LS5L 5CBEA 5L6YL 1G0DA 4H1LH 3GHBH 4JM2D 2XQBH 2DLFL 4PLOB 4IRSA 4X7SL 5EA0L 3ARGA 2EXYC 3FQNB 4LHUD 5CZXD 1EEYB 5HVWA 3N9GL 1VHPA 2IQ9H 4P2RA 2Y36L 2N56A 3CFDB 1FVDA 3C5SB 3OKLB 3U6RB 1J5OH 2FX9L 3QDGA 4G6FD 1UEYA 3UTSB 4E0RB 4JE4B 3KPOB 1N7MH 3VMOA 3U0WH 4AT6B 4RISL 2LU7A 4HIIB 1AR1D 5EBLB 2A9ML 4LLVA 5FCUL 1FPTH 3W11D 4PG9B 2E27L 1UM4L 3V79C 5FECB 1I7ZB 1SJEA 2HKFH 4QY8A 4W81A 2K3TA 2XTLA 2JB5L 3MLWL 5JLZA 4MCZA 1HHHA 1FHGA 2P4AB 5SX5H 1NBYB 1QPPA 4DVBB 1R3IL 5E70A 4PRHD 4GKNA 1YMHB 4LHQB 5DGQA 3NACH 1F3JA 2VXSL 2MCPH 5KW9L 5BJTA 3KYOB 1K4CA 3AAZB 3MRHA 1CXIA 2RCSL 3ZDZE 3OR7A 4IDLA 4XGZA 4XZUA 5ENWA 3CFBA 4M6OL 2BNRD 3DV4A 4O51A 3VI3E 4JPVH 2W65A 3X13A 2VKXA 3ROLB 4YEFA 3WFEH 3WO4B 3X17A 5KSUA 4JQXA 3DWTA 2H8PA 5HJ3B 5IQ7H 2R56H 2ZUWA 2YA0A 3BJ91 3L7EB 3LS5H 3MRCB 1B2WH 5CP3A 1N5YL 4QHMA 4PLJC 3B9KC 2HKHL 2DLFH 3MLXH 3ZZ1A 1BFSA 5C3TA 4HUKB 4FA8A 1MFBL 1JHKH 1U8OA 4TOYH 1T0NA 1KT2B 3BE1L 2UWEF 4Q9QL 2NY6C 1YEHL 5GGTL 3QUZC 4YIQA 3SKOB 1MCOH 2FHFA 1KTRL 4DGIH 1HIMH 2AJXH 4GBXD 4G9FD 3SDAC 3EOTL 3NPSC 4WY7H 5JHDA 1JYWA 3O6FB 5E2TL 3DGGA 3O3AA 1ZHBB 1JPFA 4GW5A 2YPLD 4GRWE 3IXAB 5GJSL 2PTVA 3VXPB 2VIRB 1GOFA 3WMSA 3QHFL 4J6RH 2YWZA 2R2HA 2P7TB 1BQHA 3HE7B 3BW9A 5CJ5A 5EA0H 3B43A 4D8PB 1CVSC 3SCMA 4L3CB 5HPOA 3MRCA 3O8XC 12E8L 3V6OC 2VAJA 1R3JB 4X4ME 1NKRA 2Z35A 3FQRB 1JNNH 4P59H 1DUZA 1TTGA 3MV9E 1S3KH 1NEZB 4KAQH 3ULVD 3HNTH 3BPCA 3VXSB 4IRJB 4XZUB 3MOQA 3RPKA 3VRIA 1RMFH 1NGXB 5HDBE 2QL1A 1R5IB 1WZMA 2X4SB 2EYRA 4U05A 4WHYG 5GRUH 1FVCA 3GSWA 2PO6A 2H32A 1UWGH 1FFNA 2G75B 4EBQH 4YDLB 3HZMB 4WCYH 5JQ6H 4GW1A 5DK2B 3B4NA 1C16B 1IAIH 4MQXD 3IB4A 1A8JH 4CADA 1N6QL 2WQRA 3C5ZC 1MWAA 4IRSC 2NLJA 3CH8A 1P69B 1CBVL 5D7IB 1NC2B 1QBLH 4G8EB 3DHMA 1JJUA 5DRZB 4CW1A 4WGVB 5IMMA 3QDJD 1LE9A 4TVPD 4ISVA 1BIHA 3H7BB 1VFBA 4QRRD 3CSPA 1PEWA 5MHSE 3B2UC 4NO2A 5TE6L 4L9LB 1RD6A 3O2WH 2DLGA 4WWKD 2YPLB 1WC7B 5A40E 1IGCH 1RUQH 1FC1A 4P2OB 5DK3A 3HI1A 4PTUA 4WDIA 4YDLC 3G6AB 4KMQA 1A7QH 1QACA 1X5KA 2BSSA 2V2XB 4QOKE 3SE8H 5CZVL 2NXYD 2C1OA 4KROC 4Z7VB 7CGTA 5GGQH 3NZHL 4Y5YB 5CBEB 3KYMA 3D2UD 3QPQC 3VD7A 1DE4A 4WW1A 4QRUA 1MCFA 2ZG2A 3G04A 3V0VA 2P49B 4P3DA 5HXMA 5I2IA 1QSFB 2VMFA 5DMIH 4WFED 2W0PA 3EDDA 1OP5K 3MR9A 2FSEB 5D5MF 1P4IL 2VWEE 5HYQA 4TUJA 5E2UH 3SQOL 3MRMA 4P5TA 5TE4H 4HCRH 2BMKA 2ICWJ 1ORSA 1IGFL 1MRDL 3SDYL 4N0UE 3I3BA 5MERB 4ACPA 3STZB 1OARH 5D7SL 5I19H 3TT3H 4XVJL 4WI9A 4M1CD 4HH8A 3MZGB 3MSPA 3KLDA 2PXYC 4HC1H 1SVZA 4EVNA 4POZC 2YSSA 1J0IA 2CLZB 1KJMA 1KTLB 3WKNA 3W81A 2EXWD 3P4LA 2YPLA 3EJZC 4ZODA 4NZDA 2XPGB 1BWWA 1TMCB 2IGFL 1T83C 1NDGB 4JPWH 2OI9C 1C7SA 3MRKB 1RZ7H 4H5SA 3CVHA 2EO1A 1UH4A 3K2UL 2ARJQ 4TUOB 1J8KA 3O2DH 2E9IA 5LWYH 2A73A 4P4KC 3A6BL 2EZ0D 3C5ZA 1BLNA 3FO1A 4KTEL 1NEUA 4ODBD 4C57C 1SY6H 3Q5YA 3I85A 2BNQA 5D7KD 4M7KH 4UI2A 3NIGE 4EVNB 1TTFA 1PGRB 1L7TL 4LHUB 5GRJL 4UNUA 3F58L 5INCA 4RFEB 1VADB 5AG8A 1SEQH 1GGCL 2EC9T 1BJMA 1ZVYA 1WFTA 4OTXL 1CFNB 4C54A 1XGYL 1OT1A 3FO9B 1R24A 3AUVA 3FB8B 4ZO6A 1F4YL 3PL6D 2KBGA 5E00B 4O9HL 3VGDA 1M7DA 3O0RH 3O11B 1FL5B 4OZGF 1YEGL 5D1XD 4KY1L 4XAKD 4X6CE 5TE4L 1K4CB 5JUEL 2QHLA 4HK0B 3WXWH 5J3HC 4A6YL 3SCMB 1OGAB 3BAEH 1A5FH 3O9WD 3VFMA 3MLUH 3EDJA 1CXKA 3EOAB 4GKZB 5DMIL 2XWJB 1QR1A 1PSKL 1G7HA 1JFQH 4TTGA 5HY9A 2A6KB 3SDDB 3LQAC