1E4KA

Crystal structure of soluble human igg1 fc fragment-fc-gamma receptor iii complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
216
structure length
216
Chain Sequence
CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVDGVQVHNAKTKPREQQYNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FC FRAGMENT OF HUMAN IGG1
publication title The 3.2A Crystal Structure of the Human Igg1 Fc Fragment-Fc-Gamma-Riii Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4kA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1e4kA01
2R15A 3I02B 4LQFL 1OLLA 3VJ6A 4CJ1A 4MQXC 1A7NH 2VXVL 3U7YL 5A43C 5D2NE 2OL3L 4KK8D 4B0MM 2VYRE 3MJ8B 4I4WB 3SO3C 3STLB 4XCCL 3QWOB 4YEFA 2KDGA 1QEWA 5SWSD 4K3DH 4Y2DD 2EH8L 4XP1L 1Z5LB 4N0FB 4MQ7A 2F9BT 3DRQB 4ZUWA 1V3LA 2EICA 1TQBC 3FFCB 5D1QD 5JQHC 3AREB 3VFOA 5CSZB 3UYRL 1UH4A 3BI9X 3GSWA 1RMFH 3HZKB 4K3GA 1WCBA 5D7SL 5IT2H 3DROB 1NMCB 4MJ6B 5C0RL 4GRLB 2Q7YB 3P77B 1UEYA 4P5TD 2F53D 5D1XD 2IWGA 2PN5A 5B4MD 1VKXB 5C3LD 3OX8A 4GG6A 3RY6C 4B50A 4ODHH 5CGTA 2BNRE 1EFQA 2V5RA 4ZO9A 2EC9T 4LASH 5HDOA 3QDMD 2NY1C 3PDGA 2Z31A 4M6OH 4EBQL 1NC4A 1QFOA 1H8OA 4ONFH 2NMSA 5EU3B 2EC9U 4W4OA 2W38A 5AAWA 5C08D 1XFPA 4O2CB 1MHCB 3NAAL 1D5XB 1QACA 4EQ3A 4JO1L 4X7EC 2HN7B 2VUOA 3JV6B 4F7EA 4BZYA 2FBOJ 4NQSA 3O4LA 5FOBA 3QNZB 1INQA 4HIJA 5JW4Q 3OGCB 3K46A 3O2DL 3GHBL 5C0AA 3V5HA 5C0GA 5IW3A 4XP6H 1BVZA 4BFGA 3FOLA 1KEGH 3EO1A 4K3HA 4M7KL 1A6ZB 4HKZB 4N0YH 4NCDA 1JCKA 1CG9A 5EBMA 1DVFC 1ND0B 1GSMA 1CTOA 2J6EL 5C09D 6FABL 3H7BA 1JGUL 1G9MH 5I1CL 2BSRA 5DEGA 5IV2A 2YD4A 3CVHL 4X5WA 4I0PD 4LLUA 2VDKH 3PP3K 5EOCH 4X0KA 4XX1G 4TQEH 2KZ1B 4YGVB 3BRFA 2V17L 3PV6B 3BQUD 1G7MA 3RVVC 2YA1A 4ZAKB 2F54B 4L29A 5KVGL 2GJ6E 1RUAH 2H8PA 3WSQH 3TN0D 5I17A 1AKJA 1ORQB 2DM2A 1EERB 3WNNA 1WEJL 1X7QB 2D7TL 2FIKA 1AO7A 5D72H 1J10A 4ZXBC 2A9MH 3MREB 3ZE2F 4IOFD 3CDCA 3GBMH 3TVMC 2A74B 3BT2H 1P84J 1FORL 1NGWB 3U4EB 3RDTA 2H3NB 1OB1B 2WMPA 3VXOA 1NAKH 4LSVL 4FQ1H 5L7XH 1IL1A 5HGDB 4OCWH 1JPGA 1P4LA 4XC3L 4L8BA 4N90E 3MA9H 3C5JB 1XF3B 3SPVB 1CFTB 1GOGA 1S5IH 3RL1A 1WICA 1EGJL 1YNKL 3HI5L 5E5RB 5HY9B 2Y6SD 1Q72H 4XCNB 5F7DB 5JUEL 1C7TA 4OQTH 4I18A 1AXSA 3PWUB 1LVEA 3LEXA 4JZNB 4M4RA 1RZGB 2AEQL 3CUPA 3LDBB 3LKRB 3MZTA 3MV01 4IMKC 1F4YL 3QXTA 2FL5B 1EZVX 5C0BD 2R4SH 1MY7A 3ULVC 4M1GH 5TDNB 2HG5B 4PJFB 3TA3A 3QFJD 3I6LD 4S2SA 2FHBA 3P9MA 3EO0B 1U36A 2OI9C 4GKSB 5IMMA 2ZOLA 3MC0A 1KCVH 5KZCD 5AUMA 3ROOB 3U30C 3ES6B 3TBWA 4MD4A 2ARJA 2R0ZH 1AIFA 4R26H 1OGAB 43C9B 2DWDB 5IKCA 1IAKA 2EDTA 1FQ9C 2NX5B 1BD2D 3DV4A 5K9OA 4XXCC 4PY7A 4RZCB 4XP9L 5IM7A 4OB5H 4LLDA 4AYFA 1R3LA 3CMGA 4YDVB 5CBAA 4PB9H 2CGRH 3WXVL 2P24B 4FQ2L 2ZUTA 1SYVA 4PJCF 3DYPA 4XNMB 1ZVSA 5EO0B 2UUDK 4L3EA 4Z0XB 1HCFX 5F7NC 5BMFH 4LNRA 1AGDA 4U1GC 4BH7A 3HI1A 1OAXH 3L5HA 3K80A 3FRPG 4NKQB 4PLKC 4RNRA 4ZSOA 1P7QB 4BQBA 5IIEB 1GPOH 4PG9B 3SGJA 2RGSA 4Q6YA 4LLQA 4N0RA 4YDKL 2DQFA 3L3IB 4RBPK 1CZ8H 3IU3A 3V9FA 1G6RA 4LSRH 1R5IB 2ERJC 1JYWA 1KN2L 1FE8L 2LQRA 2VR5A 1FRGL 3EYUH 4OBRA 3T3PE 2WBKA 4OZIE 1MFDH 4YHNA 4EDXA 1INDL 2FJGA 3PQYD 4GKNA 3JBG7 2GSGA 3IFOB 3T2NL 1T1XB 1QLRA 5LQBH 4Q2ZB 4JG0L 1UEMA 5SV3A 2AXFA 3LKSA 3HZMB 1MAKA 2UWEA 3QFDA 1QRND 4NWTH 3MJ7A 5EU6D 4FFZH 4V1DE 5GGSB 4LSTL 3AM8A 1IAIH 4OLVL 3ILQC 4DFHA 4ERSL 2NXZB 5BW7A 1U8JA 2FD6L 2YXMA 4X6DE 2N56A 5KSAA 1A1NA 4CNIB 3BSZH 1MFBL 1AD9B 1UZ6E 2J4WL 5C9JA 1BQUA 2XZAL 4MMXC 1RIVH 3FB7B 4BJLA 4KQ4L 3CK0L 4G42A 3FB5B 3KPRD 4CBPA 4PJ9B 4AMKL 4GBXD 4UMGA 5FYLE 3PDOB 2Q20A 1KPRB 3UJTH 2RJMA 3UZQA 2OJZH 3E6HB 1UB6B 1BBJB 4YDIH 3NCCB 4PRPB 4WJ5B 5F3HA 3RBGA 4Y19A 1KXVC 3VFNB 2VSCA 1MLCB 5I19H 4CVZB 1S7VA 4KGJA 1U8PB 5FIEA 1TZIA 3RWIA 1OTSD 4PJEB 5EO1B 2XQYK 3VFMB 3FB6A 2PF6A 3T4AA 3WXWL 1FVEB 1K8IA 5ESQB 4CRPA 1PYWA 4OZ4A 1S78C 3R1GH 4M00A 3QWRA 2C4XA 1KIPA 4Y4FC 2E6JA 3FQUB 4OM1H 4HFUL 2A77H 2XY1A 4HUUA 4KMLB 3VFUA 3SJVD 2VLKE 4OF0A 5EA0H 3D2UB 1OARH 4PYHA 4QXTA 5CMAB 1YYMH 2V9TA 2IFFH 3T77A 1U41A 3N1QC 1B88A 1ZHBA 2NY3D 5JW3L 3KJ6H 1EV2E 3AB0B 3RVWC 4BUHA 5C07E 4G8FA 4PRDB 1TJHH 1FL6A 3NMEA 3IXTA 4KV5F 3QUXB 3HCVB 2R29L 3QDGE 2W9LA 4IOIB 4POZC 1T5XB 4WO4C 1G1YA 3HNTH 5EUKA 4L3CB 4Y5VB 1NLBH 1BJ8A 2O5YH 1B2WH 3KR3L 3F5WA 3RIAK 3ARFA 4PJHA 2HTLC 2DTMH 1IILE 3TBYA 4XRCB 3UTSA 3B9KB 1JGEA 2WM0A 3R06B 1XGTB 1WAAF 1JNHA 4FTVA 4JRYD 4QRPA 1QUNA 5EB9A 2BHYA 3VDBA 1DBMH 5TH2B 1HKLH 4U4BA 2YEZB 3WDJA 1A8JH 4IMLB 3W9DA 4LCCC 5KG9B 4CVUA 4ZOAA 1MFEL 5EUOE 1KTDB 2EXYD 4WHDA 4M1DH 5T1MA 3BP6B 2Z35A 1AQDA 4Z8FL 1K9TA 4R0LC 4KRPC 1ZLSL 1I7ZB 1KJ2B 2WAHA 4LPUA 4Y5XB 4EUPB 3CH8A 4YEEA 1JHTA 1HEZA 5F8RC 3JTTB 2I5YL 3JUZA 5KN5B 1JHKL 3QJFB 4G6JH 4U1LB 3K4DA 4QNPF 4PIRF 5ERWB 4PJ5D 5L8JB 3QCVL 3MLRH 3M1BA 4DGIH 4JPKL 4ZUSB 1VESA 4NP4L 1AR1D 5IOPB 4KUZH 3IKCB 3BESR 4Y4HC 1AC6A 3IVKA 5HPOA 3SDXA 5JQ6L 5ISZA 1A6WL 4J3TA 2FYYA 5E1AB 3RX7A 3BZFA 1BFVL 1GGIL 3BPNC 3P4OB 3Q6GH 4IHOB 1P53A 1T2QH 1S7WA 4WCYH 3BP7A 4WI2A 1I7TA 4XMPH 1ACYH 3BD4A 4QHKI 2C1PB 1VCAA 3RJDA 1VB9A 4WWKD 4M9PA 3IFLH 2AJ3A 4AT6B 1ZT1A 3MYZA 3FQRB 3T0EA 4LEOB 4YIQA 4YBQD 4NJAH 5J0BA 1FGNL 1W0VB 4ZTOL 3SQBA 4MD0B 4P4KC 4MWFA 4WW2F 2XXMB 3S36H 1IMHC 2H26A 1WIOA 4PREA 1S7QB 5K9KA 3HAEH 1A6TA 1Z6JT 5CLWA 2VDNH 4OCYL 4LRIC 4ODVH 3H3BC 3C09C 1AC0A 1YECL 2HFFA 3Q6FA 1CIUA 2KL6A 5DTFB 3AGVA 1KPVB 2P7TA 4NYLA 1MH5A 4P46B 1XAUA 3NACH 4S1QL 1TZHB 2J12B 3SE8L 3GKWH 2AEPH 5D6DA 4JR9H 5KSBB 4HIHB 5DMKA 5L9DH 2IPTH 1M71A 3S96B 1L7IH 3BO8A 4NNPH 3GJEA 3UXFA 2BX5A 5J9PA 3IJSA 1UWXK 3OXSA 2G75B 5JW5A 5E8NB 3MMEA 4WFHD 3G6JA 3JWOL 2O5XL 1XT5A 5KS9B 1U58B 1JRHH 2DN7A 4NO5B 5EIIA 5A1AA 1KB9J 3U0PB 4Q6IA 3VXSD 1FLTX 1UXWA 5DJ2A 5BS0A 1MOEA 1KGCE 5TDOA 3U46A 2QQQA 3TP4A 2QSQA 2CRZA 2EDJA 3DSFL 4ENEC 1RULH 4HFWA 3FFCE 4JO2H 5CEZE 3VXQA 2R1YA 3P9WB 3K8LA 5GS1B 3G6DL 1KIRA 2N1KA 5DJ0A 1EIBA 2QSCH 4PP1C 1BWWA 3WHXB 3QIWD 3RL2B 4JHAH 1A7PL 2AS5M 4UU9A 3SDCA 3NCYS 3T09A 3BN9D 7FABL 5INCA 3LVEA 3GSRA 1FPTL 3BZDA 3DGCR 1P2CB 1BVLB 2Y07L 5DMGC 1A7OH 2YPKB 3HZYA 5F7HA 3AROA 3CZFB 5I1JH 2VLJD 5J11C 1R3HA 4OD2A 1N26A 2EDLA 4LPWA 2BVQB 5C0DA 3RHWK 1AFVH 4HZAA 5KAQG 2GITA 3MRFB 5T3ZL 4UTAH 1ORSB 5E70A 4HCRL 5A2IH 4ZFOL 3HB3C 2BY2A 2NYYC 4UT9H 2BCKB 3DRTA 1ZVYA 2I26N 3O6FA 3PABA 4NC1E 3SQOL 4MCZB 4GW1B 3BRDA 3SDAB 1QSFA 5JXAL 5FYLL 2ZUVA 1DQJB 2R1WB 4XGZA 1ZT4A 5D7IB 5H37G 1DQDH 3QDJD 1CD1A 5C70A 3ARGD 2IANE 1R3KB 4YNYA 4Q9BA 2VC2L 3BVNB 2GK0B 3MA7A 2G60H 1D9KA 3L6FB 4R3SA 3C9NA 2DQEH 3QUZB 4ODBD 3WLBB 1C12A 3RVUD 4L5FH 3TJEL 3N1MC 5ETUB 3LRSA 1DQTA 3S37L 4YXKH 4RWYH 4OGZA 2LU4A 2RFXA 2I60H 3FTGB 1QRKA 1L6XA 4BZ1H 4XNXL 2AEIT 4X7SL 4X9GA 4U1HB 5BOPA 4U1KB 4NDMA 4UIKL 1A9EB 5JORA 2XN9A 1YEKL 1AGFB 2F54E 4X6EB 4JM2B 3TZVB 1GHFL 4J4PC 5GSVA 4MA1C 4ZUUA 3ULVL 5DUML 4W4NA 3T0AA 3CSPA 1KJ3H 3E8UL 3TH4T 2XKNA 4Z7OF 3LMJL 1N4XL 1H5BA 3CSBA 1MEXH 4WI8A 2RQ8A 4Z18A 2RCSH 1MF2H 3KPLA 1LE5B 1ZS8B 3CU1A 2ZCLH 3AUVA 2EDNA 5IR1A 4JKPH 5T3XD 1C7SA 4RDQF 4X6FA 3STZB 2P8PA 1PKQA 5I8KH 2PYFA 5ABDE 1INEH 2XV6B 3QO1B 1MCIA 4PG2A 2Z31D 1H3VA 1FO0L 1H3GA 4QHMA 5I16A 15C8L 4L8DA 3TO2A 3VDAA 1NC4D 3FO9A 4HPOH 5C6TL 3EDEA 2DQGH 4IRSA 3B2UD 4KY1H 5EOTB 1S7SB 3O2DA 3UBXB 2XKSA 4IBLT 4KHXH 1JZ3A 4MSWA 3P4MA 4K3EL 3WFCL 5CD3B 5L0QB 5BVJA 3GJFH 3ZT7A 3ZYZA 4DWHA 1MCPH 3QG7H 1MFAH 1QPXA 2QR0B 3AFLA 1S7UB 1FL3B 2J6EA 4JB9H 2Y72A 2QTEA 4PJFE 3ZSTA 3CVHA 1TNNA 5E2WL 5IVZB 3HE7A 5ADPL 3OAYH 4PRBA 3AY4A 3WUWA 2L0DA 2VL5B 1CFSA 2F5BL 4YFDB 5IROA 1N6QL 2ESVB 2VXTH 1MNUH 1OGAE 3N9GH 4D9LL 4LVNC 4R4ND 1Q9WA 4L8SB 4ZPTB 1OAUL 4C57C 1SBBA 2FRGP 3FFDA 5CWSB 2NX5E 2Q76B 4QCIB 4DN3L 3DXAD 1NFDF 4JEGB 4NZRH 1DQML 4KZEH 4FFVD 1FVCA 3D5OF 4WDIA 5KVEL 3TIDB 1MCOL 4Z77B 4NO2A 2ZWLT 1R5VB 1ZHNA 3B6SA 4QRRD 3T8XB 2PETA 3NTCH 4F7TB 5GRVL 3VG0L 5DVLA 1EGJA 3IF1B 3MJ9L 1DANT 3IDMA 4XPGL 4QXGL 5BRZA 3DVIA 1TQBB 2ZSWB 3MRJA 1PG7X 2HVKA 1DDHB 2Z92A 2PYED 1S3KH 2XNAA 1I3VA 4F57H 3QT2A 4H0GA 3UTPD 5DRXA 3EBAA 1DANU 1O7SA 4W6WB 2IH3B 3Q1SL 4G7VL 3JWDC 3PWPA 3CD4A 1U8HA 4JRXA 1N7ML 3RWFB 4MB5A 1T22A 1DUYB 1MAJA 4FXLA 2FSEA 4Y4KA 2XQBL 3O0RL 5FUOH 3SCMC 3EJYD 3I85A 5JNYA 4HS3A 5HJ3B 5IQ7L 4NCC2 3MRDA 2MWCA 3M17A 1YEEH 5EC1A 5GRVK 5I76A 3OAUH 2FX7L 4RWHA 3BKJL 5J1SC 1GAFL 2SEBA 1EJ6A 3BUTA 4TTDD 2XWJB 4JZJA 3VWJC 1BEYH 1EFXD 4M6ML 2NY1B 1IEAA 2BVTA 1IGJB 1G7IA 4MHHI 5DFTA 4Z7WF 2WK2A 4X98A 1A6VL 3DX6B 3BFOA 3VFTA 4KI5D 2OXGA 1MFCH 2HFTA 4LSDA 3V6FA 3QEQD 1LGVA 4KROD 2F19L 1F8TH 4NQDA 3NPSC 2AGJL 1TVHB 3MLSL 4G3YH 2CSPA 3RTQC 3GKZA 3FMGH 4X6CB 1A7NL 3UO1H 4U1MA 2A1WH 4I5BA 4IJ3C 5GS0D 5IEKB 4AL8H 4LHUD 4K3DL 5I1IH 3GO1H 5CEZL 3VE0A 2NR6D 4NQCD 4U6XB 3UTQB 2WBJA 3BX7C 5IMOB 4XMKH 4Y5YC 1BWMA 3O8XC 5D6CA 5HHNA 3X3FH 2BVOB 2DQTL 4PJEE 4NZUL 4YC2B 4K7PX 1RMFL 1DN2A 3HZVA 4HKBB 2EKSA 4HX1A 4TOYL 4YDLC 1T04B 4P5KA 2DS4A 3MV7A 3UDWC 3U4AA 3VXUD 2G2RA 3ARPA 4HWBL 5DUPH 4RFEB 5I1LA 4J8RB 4KDTA 3VG9B 3OBAA 1N5AA 1OT2A 4OZGF 4ZXBB 1JF5A 2CK0H 4LLYA 4LASL 5JR1H 1AH1A 3TVMB 2VAAB 3MACH 2YK1H 1ETZB 1YN6A 1Z2KA 1HQ4B 3DYMA 3OZ9H 4Z7QF 5F1IA 1MRFH 5D2NA 1TTGA 3D0VB 5EO9A 1TQCC 1XIWA 3RKDC 2DMBA 5I0DA 1KYOJ 5DEFA 4YHIA 4W6YB 4PV9A 3VFWA 2CKBH 1H8SA 4JFFB 3PF2A 4NC2B 2BSED 2O26U 1G6VK 2MHAB 4ONOA 3OKMB 4G8IA 2CLRA 1MSPA 4YHYB 2BOBB 3P11H 4H5SB 3DWTA 1PQZB 1RUQH 2HTKC 3LKNA 3CFCH 2UVEA 1I1YB 3X12A 2V2WA 2X89D 3U0TA 4Y19D 3X13B 2X4SA 4N0YL 1F4WL 2E9BA 3L3KA 1RV6X 2J88H 4XPFH 3SE9L 4GKZB 1A1OB 2JCCA 5EZIL 3T0BA 4KK9D 2AK4D 1VHPA 1G9ML 3VXRD 2AJUH 5DT1H 1A1MA 3IFPA 5ICYB 1ZA3A 1CT8B 5EOCL 2BNRA 3TJHD 3V6BR 3QWRD 4JQIH 1BGXH 1OAZH 1MWAB 1YEHH 2HJKB 4MDJA 1RUAL 3VRJB 3WSQL 1JNNH 2NY4C 4LDOB 3TPUB 3JVGC 3BE1L 3I3EA 4MJ4A 3T08A 2FJHA 5D72L 1F3JB 1P1ZA 2VZTA 3TIEB 3EHBC 1EAPA 5F6HI 2BY3A 1U2CA 3C08L 4Y1AB 1AJ7H 2JJSA 3GBML 3VFPB 1YPZB 3GMPB 1L7TH 4PRID 5EZOH 4U1GB 4MNGB 1GGTA 4GAYB 3VWKC 1I4FA 1RZIB 1T2JA 1NAKL 1WISA 3WKNA 4FQ1L 5L7XL 4KJWC 1VERA 1TZGH 1L0QA 3UAJD 1ZTXH 1CD9B 1FSKC 1QR1A 1C08A 2H2SD 2X10A 4JFDD 3MA9L 5DHVA 3DVFA 1J1XH 3KPQB 1QSED 5D7KE 1S5IL 1HI6A 5LWYL 4XNZB 5DK0B 3ZE1E 5GGUB 1IGYA 1KXQE 1Q72L 4D0CB 2FBJL 3BP4B 1E28B 3ARFD 1HHHB 3EFFB 4OKDA 4RMTA 3D39B 4OQTL 2P5EB 5IMKA 4OCXH 2CLZA 4AIZB 3RI5F 4NKMB 5DJ8A 1U8QB 5GGRY 3SDDC 3UPCA 3HMXH 4HIXH 2FCBA 2FH8A 2ATKB 4M1GL 4NHCL 1GGUA 1TJGH 1ED3A 1CFNA 2BRRL 3MGTA 4WV1A 4LDLB 2GJ6A 2NY0B 2QJDA 4I3GA 3FB8A 1CFBA 1KCVL 1WTGT 2D3VA 1QHOA 3AU1A 3VI3E 4U6YA 2ZCKH 3OKYA 2F5AH 4QHNB 4R4BA 3MJGX 2DQHH 5FF6A 5C0IA 5KSBE 4X4XA 3BEVB 2F58L 4J3UA 3WN5C 4G6FB 4OB5L 1Q9LA 3G5XB 1BQHG 3EOAB 5DJXB 5JDSA 2FR4A 4PB9L 3BIBX 4K07A 4UILL 5ACZB 4LL9A 1MIEH 4BQ9A 4G5ZH 5KS9E 4LCIH 5BCAA 5FGSA 2AJXH 4BKLB 1MIML 3ZDZE 5BMFL 5ISZD 4YX2L 4TULH 1G7PB 1KT2A 3LQZB 4MNQD 5D70H 2YKLL 4RGMC 3K8MA 4ELKB 3KXFB 2DDQH 4NM4H 3WLWD 3OKOB 3TT1H 2IF7A 3Q3GA 4GXUM 5J1AA 5HI3C 2DLFH 1QO3A 2AV7B 2BHUA 4P49A 4GW4A 1WBYA 2DIBA 4YHOH 5IEHA 2ICCA 1CE6B 5DQJB 4NM8H 4KDWA 4H1LA 4JE4B 3OB0K 5H8DA 3KPSD 3ME0A 5E9DD 1FHGA 4HH9A 2Q3ZA 3F58H 3GRWH 2QQLH 1JYXA 2WW8A 5LQBL 5DRWB 1QYGH 2D0HA 3GMNA 4APQA 4S1RL 1Q0YH 1F02I 4OKVB 3VD4A 3QXVA 2WWMC 1ZEAH 1UCTA 3HPJA 5ID0A 4AEIL 5MEOB 3CXHK 1IAIL 3MUGB 3E6FB 3NIFF 4HKXA 1IGTA 3FZUD 2N4IA 4XCEA 1DSFH 1AE6H 2HVJA 3EGSB 4Z7NE 4KK8C 1XR9A 1ZGLB 4Y2DC 3MX0A 3RUGB 1WV7T 2L7UA 2YRLA 4JGUA 1G9NH 4N8VG 3HRZA 4F2MA 1KCKA 4WO4B 4FQIH 1U3HD 3O2VL 2AKRA 3OKLB 1MCNA 5J6GB 1A7RL 2F74A 5D1QC 1A3RH 1NGXA 2HKHH 5D7IE 4JY4B 2VZUA 5H2BA 2C4FT 1RZ8A 5BO1L 5JHLH 2OJZL 3X11B 1L0XA 5K9JH 4WTWA 2Y5TA 1H0DB 4ZPVA 2AJYH 3FRUA 5FM5M 3WNOA 3DX8B 2W07A 2AJVL 3ARBD 4I2XB 4Z95L 4OV5B 5I19L 5D1XC 5HYJB 1T7YA 2GUOB 2C4FU 4NQED 4RGND 4OFDA 5FK9B 2B0SL 1FAIL 4KDVA 5IHLB 1GL4B 4DAGH 3KPMA 1HXYA 1NL0H 2CDEB 4YR6B 4K8RH 1R5WB 3DBXB 1UQSA 1C5BH 1U8MB 4HJJH 3U0WL 1DLHB 4JVUA 4R0LB 3RBSA 4V1DA 4KRPB 4Z7VB 4OM1L 2DKSA 4MD5A 4I0KA 1NDMA 1HQRB 2DAVA 5EA0L 4X6DA 4KRNA 2O5ZL 1EO8L 1LNUB 3C6SB 1BFOA 2IFFL 5JLZB 1BREA 4J3SA 1ONQB 5FUCC 5GRZA 3WFEH 4JDVB 2QKIB 4ZFOA 1JV5B 3KPPA 5DRZB 3HNVH 4CADA 3PE9A 2ZNXA 7CGTA 4BA8A 1U8LB 3VRIA 1FG2A 3CX5K 4KRMB 5D96B 3QZWB 1D5MB 5I1AA 2UYLB 4FFYH 3KYMB 2PW1A 1JNJA 3E3QC 3OGOE 3O6FD 3EYFB 2ZPKH 2R8SL 2CJUH 1MVUA 4M03A 3SE4C 4P4RA 5EU5B 3V5DB 3D6GA 4QTHB 5FA4A 1U93B 4PJXF 1LEKB 1P9MA 2OQJA 4NO0B 1CE1H 5ELIA 4I0PC 1QFWM 1A47A 1LE9B 1DBML 3MCKB 3VD9A 1I9RH 2WIIB 1IEHA 1LO3L 1IAMA 2VLKA 4G8EB 4M1DL 4ZFGH 3ZDYF 1T1YB 1J0IA 3D48R 5GSRB 4KWUA 2FIRT 1BQLL 4IOFC 1BFSA 3WL9A 3TH3T 5JTWA 1HINL 3L9RB 3RWEB 4YPGB 3SKNA 4F3FA 3LRHA 2A6KA 5GHWH 5KSUA 4A6YH 1NC2B 4MNHA 2FECI 2P5WB 4DGIL 1WQVT 3ALPA 4HHAA 5CHNB 4R7DB 1E6OL 3PUCA 5HYQA 4PBXA 4P57A 3QDGA 3SE3C 5CIPA 5IB5A 2ATPB 1FNEA 1VSCA 4O2FB 3TCLB 1JF1B 4ORGA 1XEDA 2H1PH 2NZIA 2WP3T 4KI5F 5TQ0L 5ILTH 3Q6GL 1T2QL 5IJKA 1OSZA 4WNQA 5HHQA 1AGBA 1GJIA 3MRQA 4RDQG 4XMPL 4XXDA 2MQ0A 1HHKB 5EZLB 4PS4H 1EBPA 3MRGA 1AD0A 5IUSA 2B4CH 1XGPA 2C1OA 3R8QA 3TYFB 1MQKH 3IFLL 1QBBA 3F8UB 3MQIA 2K3TA 3MNWB 2E9WA 3AXLB 2ZOKA 5EUOA 4KRLB 4M61B 5HGBA 2GAZB 3S97C 5DK2A 2QADC 2ICWA 3HFML 3BKYL 2DTSA 1RURH 1I7RA 5B8CA 1S9WB 4WUUD 5TPWH 2AW2A 2BXYA 1REIA 3WFHA 4G9FB 4UBDC 3HLAB 4LSQH 4CN1A 4TUJB 4KI1A 1IC4L 5DD1L 2OP4H 4LOUC 1LO2H 1P7HL 4TVPH 2YWZA 3GKWL 3CX2A 5F6HJ 2AEPL 4EN3C 4FQHB 4JR9L 5FB8A 2EH7H 5L9DL 2UWEF 4NRYB 4ZO6A 2X4RA 5L2KB 2P48B 4JCLA 1KTLA 5C2BH 4ZUTB 4K7FA 5JO5B 2FHFA 3OKDB 1FNGB 4ZFZB 1JRHL 4X6CE 3MJ9A 1VPOH 4KKAD 1VADB 1QBMH 1S7TA 3FO0H 4JJ5A 3HMWL 1G1CA 4MZ3A 3ZKXC 4JVPA 3OR6B 1RULL 3GMLA 4M8QA 4Y16D 5MEPA 5SWZD 4JFYB 1PZ5B 4PLJD 1Y18A 3HS0A 1WBZB 1J11A 2QSCL 2CDGA 3ZDXF 2R0WH 3EYOA 1VGKB 3W0WD 1XGYH 2DQJH 3OG6B 5TE4H 4I0CC 1BECA 3CFIC 2VQUA 3EO9H 5DMIL 3SOBL 3U1SH 4DZ8B 2YA0A 1T20B 5KBNC 4OGXL 2W0FB 1KCUH 3EZ8A 2QQKL 1NBZB 4P2CG 4QOKE 3BMWA 2DYPD 5ACMA 3IGAB 4ESKA 3DVGB 2CQVA 3H3PL 5IBUG 4GBXC 1AHWC 3SKMB 3C6LA 3I02A 3MR9B 2IAMA 3DETC 2Q86B 4QF1B 4XX1E 5IFAH 3MJ8A 4I4WA 3N06B 3QWOA 1CQYA 1D5IH 3OAZK 1U0QA 1R3JB 1Z5LA 4LDEB 4N0FA 3DRQA 4JFFE 1OTSC 2VXSH 1X5AA 2DBJA 2ZUQC 3FFCA 1CI5A 5KANI 1M4KA 3HC4H 4OZFG 3G08B 5IB1B 4LVHC 3JXAA 3AREA 2VL4A 5CSZA 3DX9A 1ZV5A 5FYKE 4QHUB 1N0XL 5DVNA 3HZKA 2G60L 1C8PA 1NGQH 2D9CA 3GM0A 1KEMH 3DROA 3QIUD 5LVEA 4MJ6A 2HJLB 1AI1L 2EE9A 3SGEI 4M7ZC 2Q7YA 4GRLA 3U9PL 3P77A 1T89A 3ZTNH 5C6WH 4N8PA 4PJHF 4YXKL 4QYOB 4RWYL 2FGWH 2E9IA 1X5HA 3W9EB 4BZ1L 1VKXA 1N6UA 3OL2A 4HWBA 2XWBB 4P23C 4XP4H 3ESUF 2K7QA 4LVNB 5CCKH 4DKFH 4WFGE 3GSXB 1JPFB 4QRTB 2D7OA 2GJJA 4WW1B 3O9WD 1MRDH 1J8HD 1T7WA 1KCRH 3MUZ1 4DGVH 1B9ZA 1G9NC 5T5NF 3GHEH 1LHZA 2EDEA 1H8NA 1FFOB 5EU3A 5DVKA 5T1KB 4UT7H 2CO6B 4EIZC 3G9VA 3QUMB 4JKPL 4Y1AE 4WEBH 1YPZE 4O2CA 1MHCA 1Q1JL 3S5LG 5I8KL 1D5XA 3LQAH 2LE9A 3BPCB 4MNGE 1GZQB 4YDJB 5EULV 1X6LA 3TO4C 3ALXA 2HN7A 4MXWH 3JV6A 2PTTB 2VLRE 1MLBB 5C0CB 4HV8B 2HLFD 3IU4H 3AS3A 3QNZA 3OGCA 4KJQD 4P2QB 5TE6H 1XH3B 4MAYD 3SDXF 2DQGL 1TCRB 4QTIL 4KY1L 5CGYC 4MHHG 5JIIA 4C4KO 1HSBA 2EXYC 4OUUB 4HKZA 5D7LD 4UQ2B 2EC8A 5EIVA 3FOMA 1ND0A 3D39E 2P5EE 4D0DB 1LEIB 1LO4H 1MPAH 1ERNA 3ZKMC 3D9AH 2CMRH 3J7HA 4JB9L 4YXLH 1KB5B 4LLMB 4YGVA 4G43B 1QBLL 3PV6A 5LCVH 1EZVY 4ZAKA 1D5ZB 2F54A 1NGZB 1AR1C 2WUCH 3RA7H 1W8OA 1ORQA 4U6VH 1X7QA 3VWJB 5F9WB 2VXTL 1MNUL 3N9GL 2MJWA 1DLFH 1A4KB 3NN8B 1QLEH 2A74A 4F7MB 2APTA 3U4EA 2H3NA 1CDGA 1MCHA 5MP6L 3GDBA 1ZOXA 1OB1A 1BF2A 5HGDA 4WWKC 3EJZC 3C5JA 3P0GB 5GS2H 3SPVA 1CFTA 3BAEH 3VD5A 5GRXG 3NTCL 5HY9A 3O11B 4XCNA 5F7DA 3KXFE 4YH6A 1UA6H 2H9GB 4HJGB 2H6PB 2DLHA 3PWUA 4PGJA 3G6JF 2UZIH 4JZNA 4NUGH 1VFBB 1RZGA 2NY6D 2B1AL 2A2QT 2FL5A 3G5ZA 2CUMA 5TDNA 2HG5A 4PJFA 4KQ3H 4XPAL 3QIBC 4DKDC 1G6RH 5D8JH 3MLXL 4YDLB 3IJHB 1IE5A 3EO0A 2OJEB 4GKSA 1IQWH 4JFQB 3ROOA 3OPZL 3ES6A 4R6UA 5AD0B 1OGAA 43C9A 2DWDA 5KSVB 1FV1B 1YNTB 1IZKA 4OCMC 4FQXC 2NX5A 4N68A 4G6AC 4RZCA 4FZ8H 5HHOD 1KLGB 5FXCH 4YDVA 3UCRA 3V7AG 3WFDL 2GJ6D 2P24A 1BEYL 4HAGA 4XAWH 2Z4QB 1EBAA 1KF9B 4XNMA 5EO0A 3ARVA 4OD3H 5CUSH 4Z0XA 2APWA 3V0AC 3RUGE 5HGGS 4FQQB 3V4PL 2DM4A 2B4CC 1P7QA 4MJID 5IIEA 1UFUA 5JXED 4PG9A 3GNMH 3F7QA 5IB3B 2XRAH 3RWDB 4HEME 3L3IA 1QNZH 2DI7A 2X7LB 3WO4C 1R5IA 3UO1L 1FFPB 4XZUB 1EPFA 4AL8L 3HPLB 4I2XE 5I1IL 3GO1L 2NXYD 5HYJE 3WDIA 4ZQKB 4JQVC 2B7DT 1T1XA 3FN0H 4Q2ZA 3X3FL 2ZUYA 3DHMA 3HZMA 3WO3B 2UVFA 3MBEC 2OYPA 3BMVA 3QRGL 4Z7VE 4KU1A 3AVEA 3N1FC 1IKFH 3FHAA 1OD9A 4YZFE 2GTZB 5DUPL 5HDQH 2IQ9H 2VNCA 2VDRL 2NY4B 4JFOB 2I9LB 4CNIA 4APQD 4IRZH 1AD9A 2HFGH 2G5RA 5D9SB 2Y23A 2OR8A 4OSUH 2CK0L 1A5FL 2CRYA 5JR1L 5DRNB 3FB7A 2VH5H 3FB5A 4K9EH 4PJDB 4PJ9A 1UM6L 2YK1L 3ARGC 4WTZA 5HHVL 4GRWB 2QV2A 3PDOA 3OZ9L 1BAFH 1KPRA 3LQMA 5CZVL 3E6HA 1UB6A 4JLRB 1BBJA 2W9DL 4GAFB 4PRPA 4DKEL 1CICB 1FSKB 2Z9TA 3RVUC 5INDB 4HC1A 1XGUB 1MLCA 2HWZH 4CVZA 3MXVL 3SGKA 4XNYH 2CKBL 1FC2D 3QH3B 1U8PA 2P49B 1QFUH 4UUJB 1UXSB 3RP1A 5FYKL 1KPUB 3MV8A 5SX4H 1A9BB 3DURB 4YPJA 4PJEA 5EO1A 1WVZA 3VFMA 4UNVA 3P11L 4WI3A 1FVEA 5ESQA 1RUQL 3TWCL 1DEEB 1GIGH 2LTQB 1JJUA 1U3YA 4Q7DA 3FQUA 4L4VD 5E94B 4KGLA 1T4KB 5MI0C 3I3BA 5CMAA 5KVDH 3BEWA 2AJUL 4GFTB 3T4YB 3BJLA 1MWAL 1KCSL 4E41B 4PRDA 2Z31C 5J3HC 1F4AA 1P69B 5EU7C 2P5WE 1DVFD 5E2TL 3QUXA 4HS6B 1FNLA 3HCVA 1F3DJ 1EDQA 1HH9B 4F80A 3RJQB 3HR5B 2J8OA 4W4OC 4FG6D 4IOIA 4JKMA 5T3ZD 5DK3A 4PGDB 1T5XA 4L3CA 4EVNB 4Y5VA 1C1EH 2QSTA 5EZOL 2YSSB 4MYWB 3RVVD 3BZ4B 1YDPB 2MQCA 4XRCA 3B9KA 3R06A 4RGMB 1XGTA 1NLDL 1JGLH 5BZWB 4M02A 1YUHB 5FYLD 1OLZA 4GG8B 3LKQB 1X44A 1J1XL 5TH2A 2OR9L 4LEXH 1BQHB 4IMLA 4I8DA 1QLFB 3SGDI 5KG9A 4V2BA 1KTDA 3CCHB 3IDYC 4G8GB 1OWWA 4K3JL 4XPBH 4NGHL 3VXMB 3BP6A 2EKJA 4R4NC 1NBYB 2DQCH 5CJ5A 1MRCH 5JA8B 2X4TB 1I7ZA 1KJ2A 3HMXL 4EUPA 5L88H 3QNXB 5I8EB 4LSSL 3N1GC 3O41B 4JREC 3JTTA 5LBSL 5DJZB 5KN5A 3QJFA 4U1LA 5ERWA 3QSKB 2YMXL 4TNWK 4G9FE 2APFA 3PL6B 1T6WA 4ZUSA 3MGOB 2VLKD 3IKCA 4WY7H 2WIMA 2F5AL 3LQAC 2JLLA 2A6JB 4GMSH 5E1AA 3ULVD 1MAMH 5SWSB 4MZ2A 1QP1A 3P4OA 4PD4K 5L2KE 4IHOA 3GUTB 5E8DH 4QO1A 3D85D 5K59F 3BKCH 1UB5B 3HUJF 4NQUA 2C1PA 1BP3B 1OM3L 3A0OA 4WW2B 1OCWH 3P4NB 5DR5L 4QY8B 1FIEA 4W68A 4TULL 1DFBH 4DUWA 3FQRA 4LEOA 1I8KB 4M1CC 1PJ9A 3V4VH 4P5TB 2F53B 2DDQL 4S1SH 4I18C 4CU8A 1FNSH 1SEBB 1V8HA 3UZVB 2DLFL 4PRHD 5E6ZA 4TNVK 5JOFB 3LAFA 2R2EB 4YHOL 4OV6F 3MPCA 5T1DH 3CNKA 3TA3C 1S7QA 1C16B 5DJAB 2BVUA 2VITB 2X42A 5CZKA 3FT3B 4PTUB 1UH3A 1T80A 3RGVD 5DJYB 4PLKD 4HXAH 3QDMB 3ZHDA 1TDQA 1PEWA 3HAEA 4LHUG 5F9JB 1KPVA 2CD0A 1MFNA 2CRIA 5HXMA 3LSOB 4P46A 3BZEB 3W82A 5IFJB 3KYOB 4KI5C 3V4UH 3TBVB 4HIHA 2BC4B 2PW2B 5C08B 2HLAB 4KROC 3S96A 3NFPB 5JIKA 2D2OA 1OVZA 4BFIA 4OJFH 2G75A 1GOHA 5E8NA 2Z93B 1DSFL 1VFUA 3ZO0A 3T0VA 3LHPH 3JWNC 4OIAA 4PV8B 3CZJA 5KS9A 1U58A 3BPOB 4NO5A 3ZMRA 1M05B 2VQ1B 3U0PA 2R9HD 3RWGB 5D1ZB 4Z7UA 1BZ9B 1TPXB 3OQ3B 5E08H 5E7FA 4FQPA 1GC1L 4GXUN 5F7LB 5K33A 3H9ZA 3ILQD 4ALAL 4NFDA 4LQFH 1DBKL 1KLUB 3QWQB 2XACC 1CN4A 2VXVH 5IBTH 5C09B 3DX7B 1G7LB 2CH8A 2Z8RA 1IT9L 3QHZH 5GS1A 5B3NA 5K9JL 4OD1H 3EAKA 3IXAB 2AJYL 3WHXA 2EH8H 5F71A 5IQ9B 3RL2A 3FT4B 1M7DB 3BQUB 1NCDL 3O81A 3NA9H 4U1IB 4M93C 3TN0B 2YPVH 1P2CA 1BVLA 3VD3A 5JPMB 1OP5K 3UYRH 2YPKA 3L3DB 3QI9B 2VDPL 4K8RL 3V5KB 3O2WL 4FHBD 2V5MA 3CZFA 1FFRA 4LHJB 2BVQA 3AM8C 5GPRA 5DD5H 3MRFA 4XTRD 1ORSA 1KUMA 1EEZB 1CGXA 4HW6A 4HWNA 2BCKA 1IC5H 3MRCB 4X9BA 5I73C 2JCCF 5DD6B 4HUNB 1S78D 3L5WB 3OKEB 4MCZA 5EZJB 1SBSH 2G9HB 2BDNH 3SDAA 1E27B 4Y4FD 5L8KB 4O5LH 1DQJA 2JIXD 2R1WA 2DBLH 5A2LH 2P43B 5B21A 5C0CE 4K23H 1R3KA 1I3GL 2FNBA 2VTFA 2IAMD 3MYJB 4FFYL 1AR2A 1NCNA 1FNAA 2JELL 3BVNA 2GK0A 3L6FA 4BK4A 2X40A 2DM3A 5C0BB 4KH2A 2ZPKL 3QUZA 1IBGH 3PP3H 3WLBA 3RVWD 4NOBA 3QFJB 5ETUA 5CBEB 1UKTA 3UJIH 6CGTA 3FTGA 5KZCB 3O2DH 3FFCD 3GHBH 3T2PA 5J13B 5I71B 3QA3B 3BYTA 1CR9H 1X5YA 4M6NH 3SY0A 1J0JA 4U1HA 3QP3A 3ZE2E 1N2RB 1A9EA 2EE2A 1BD2B 3IAGC 2D0FA 1I9RL 1AGFA 1VEPA 4X6EA 4XP5H 2J6EH 4JM2A 4G6ML 3TLRA 3TZVA 3U2SB 6FABH 4KTEL 1LDPL 1JGUH 1UVQB 2ADGB 5I1CH 8FABB 4ZFGL 4RMQA 1MJ7H 2XTJC 3CVHH 2VDOH 3ZE0E 4K9EC 3KPOB 1QFPA 1LE5A 1WT5C 1A64A 1ZS8A 3GSVB 3AAZA 5KVGH 3STZA 4FXGB 5GHWL 3MRKB 4A6YL 3QO1A 4HUVB 3OKKB 1PG7H 5IJVB 3DIFB 4UNTA 3GB7B 1K3IA 5T5NG 2VE6B 2DLTA 1FORH 2ZNWA 5EOTA 1S7SA 3UBXA 3ARFC 4BUGA 4LSVH 4DN4L 5CJXA 4J3XA 3PQYB 1HHJB 4GXVH 2E7MA 3ZKXB 4XC3H 1UYWL 2ARJQ 4PS4L 4Y4HD 4ZUVB 1P84K 4CJ0A 2QR0A 5L2JB 1S7UA 1FL3A 1PDKA 4L9LB 1QRNB 1BJ1J 3PG2A 5EU6B 5F7WC 1YEGH 4NQTA 5JUEH 1NFDB 2Q6WB 5IVZA 5MHSE 5E95B 3WE6B 2VL5A 4MXQD 3W39B 2ESVA 2VZ1A 1I9EA 2UUDH 4L8SA 2HT3D 4ZPTA 2KQNA 1KJVB 5CWSA 2KZWA 4KK6C 5KANG 2Q76A 4QCIA 5JOPD 3E2HC 1CGWA 3ZTJG 1LILA 3U6RB 1CL7L 3KPRB 4OT1H 4P4KD 3TIDA 5F21B 4Z77A 1LO2L 4RBPH 4PJGB 2R1XB 4XPTH 4XP9H 1R5VA 1IAOB 3T8XA 1MHEB 1OF2B 4F7TA 3WLWC 4FQ2H 3O3DB 5C2BL 5AWNH 3IF1A 2NW2B 4TPRH 1J0YA 1JPTL 5E1HB 1CDHA 4DK6A 4XAKD 2EDQA 3PHQB 3JTSB 1F2XK 4BSVA 2ZSWA 4K7PH 4Y7MA 2ZUQB 4X4YB 5DC9B 5LKNA 1DDHA 5TE7H 3S35L 1CU4L 5J12C 1JGDB 1RK1B 3PGFL 2IH1A 4U1JB 4MLSA 5IBUB 3T0EC 1MCWW 1CXIA 2IH3A 4OF6A 1I8MB 2H32B 4I3SH 3SJVB 3RWFA 3INUL 1DUYA 3SGDH 4Z7WB 5DYOB 5HJ3A 4GS7C 5DA4A 4HH8A 3EW3B 3U82B 2NY3B 3GMQA 4NRZB 3RHWF 5CINH 2R0WL 3T3PF 3RY6A 3KYKH 4K7PY 4OZFB 4J3OC 2XWJA 3T2NH 3FO1B 3GK8L 3EO9L 1JZ7A 2FLRT 4OLYH 5CLTA 3ULUH 3KNBB 2X09A 1IGJA 3IAQA 1BVKB 4D3CL 3DX6A 1WZ1L 4X7DC 5D6DC 3D25B 2X1PA 2EXWD 1ZANL 3L5IA 3CLEL 1YEDB 3O3BB 1TVDA 4PY8I 5EBLB 4ZO8A 1V7MH 2FD6H 4PJDE 1TVHA 1UKQA 2J8UA 2E8ZA 4GRWE 5DMGD 5E24E 1MFBH 3DJ9A 4JRYB 4X6DF 2GKIA 4X6CA 1S9VB 4Q6IC 5IFAL 1J0HA 2J4WH 4IRJA 3ARBC 4JQXA 4Z0BL 5IEKA 3IDGB 2EDDA 1D5IL 4KQ4H 4RGNC 4M7LL 4AMKH 2VXSL 4U6XA 3UTQA 5IMOA 3PJSB 1UC6A 2D31B 3K4AA 4J1UB 4PTTB 3REWB 4UT6L 3HC4L 4E0RB 2BVOA 3HB3D 1U8NB 2NYYD 5FDYA 5AZ2H 3OV6A 3S5LB 1E4JA 2OTWB 1NGQL 4HKBA 5HVHB 1KEML 1T04A 4NCC1 3SDCC 4PJ5B 3ZTNL 5C6PB 1GCFA 4KV5E 1I85A 3LKPA 2FGWL 4RFEA 2BNQD 3WXWH 3B9EA 3T2QA 3IB4A 1SMOA 2GFBB 4XP4L 4DEPB 3VFSB 1BIIB 1PD6A 4HFUH 4KMQA 4ZXBA 4E41E 4LF3B 3WHE0 3TVMA 2VAAA 5DSCB 4HG4J 1KCRL 5FO8B 1ETZA 3NIGF 1I1FB 1HQ4A 3Q5TA 3QUML 1WAAE 3GHEL 1F42A 5J8OA 3DV6B 3O6FC 5JW3H 1CK0H 4ZMAT 3D0VA 4WWKB 4RQQA 1JNLL 3ZSSA 3ULVF 2E9JA 3V6ZB 2DQDH 3I50L 4GAGL 3QXWA 4JFFA 3C5SB 3VXPA 5D5MB 5JHDD 4PB0H 2VDLL 5E6YA 4XCYB 1RI8A 1ZT7B 2MHAA 3OKMA 4J4PD 2R29H 2BOBA 3H9SA 3QHFL 2YA2A 3CXDL 4H5SA 4LPXA 5I18L 1D9KC 2D7PA 1JI1A 1W8NA 4NSKB 3KR3H 4IMKA 1I1YA 4PRPD 1EHXA 4PJBF 4M8VA 1JZ4A 3X13A 5DHVH 4QNPE 1XF2B 3RZCD 1CTNA 1XF4B 4G8GE 3VXME 4GKZA 3MV8D 1MPAL 1KB5L 5CD5C 4BQCA 3LIZL 1Z0MA 5ICYA 1QFHA 1CT8A 4YXLL 1OTUC 3RAJH 2FATL 5TDPB 3O6KL 4DVBB 1MWAA 2HJKA 3RZWA 5T33H 3CFKA 3VRJA 4UAOB 2WUCL 4UI2A 4Z8FH 3TPUA 4OCRL 3IRZA 3MTRA 1H5BC 3DMMD 3G6AB 1ZLSH 1FAKT 5DFVC 1F3JA 3CFBB 3TIEA 4UNUA 2BP3A 2I5YH 1JHKH 5BOZG 4RAUB 3NZHL 4Y1AA 3VFPA 2APBA 1YPZA 3GMPA 5SWSE 4KJPC 3KVQA 4MNGA 4JPKH 4PG2C 2K7PA 3HC0B 1RZIA 3WS3B 4JHWL 5JQ6H 1A6WH 1JWSB 1EHLH 4YK4B 4OLXL 3LV3B 4E42B 1I9JH 4IRSC 3KPQA 1EJOL 2BOCA 1BFVH 3WFBL 2R23B 1FDLL 3QIWB 5DK0A 3PHSA 1IM3B 3O4OB 5GGUA 3QPXL 4D0CA 3P73B 3BP4A 1E28A 2F53E 1HHHA 3EFFA 1F6AB 4AM0B 2VISB 3D39A 2P5EA 3DNKA 4AIZA 4NKMA 4WFFE 2UZIL 1TTUA 1U8QA 3MRHB 1DBAL 2J3SA 5EN2B 5MENA 1CVRA 5IVNA 4GMTH 3HI6H 3FRPA 2ATKA 1H3PL 2VLJB 2XZQH 3WIHL 4ZTOH 5D8JL 3B5TA 3QDME 3AY4C 1UWXH 3O3UN 2K9UA 1IQWL 4JHBA 5IROC 1XCTB 4H1LH 2GSIB 4QHNA 5FCUL 1UGNA 2VERN 2UV3A 2XPGB 3BEVA 5C08E 4OCYH 5FUCE 4FZ8L 1GXEA 2EYTB 3G5XA 3GSQA 3EOAA 5DJXA 4Q9CA 5CFHA 4URTB 2O61B 4S1QH 5DUBA 4XAWL 5ACZA 1MUJB 3QDJB 3ARGB 1RUPH 3SCMD 4OD3L 5D7JD 5CUSL 3CSYB 1JYNA 4BKLA 5HHXL 5DS8B 5T1LD 4POUB 1G7PA 4Q9QL 4HSQA 3LQZA 2XXCB 3ARWA 4LLAA 4ELKA 3KXFA 4J3VA 4Y16C 2O5XH 3GNML 3V0WH 3OKOA 4P3DB 2UZXB 5GRUL 4M62H 4PLJC 3KJ4C 5C09E 1QNZL 2AV7A 3GI9H 1N8ZB 2APXA 1FFNB 2Z8SA 4U1SA 1CIDA 3VFOB 4IIQC 4DTGH 1CE6A 3F6LA 5DQJA 2AJSL 3DSFH 4YHKL 5JOEA 2P47B 2HJFB 5I1DB 5LXGL 3WV0A 4XBEL 3QXDB 3FN0L 4Y4KC 5DRWA 5HHPB 3RTQD 3ET9F 5HVGB 3PGCB 5MI0B 4OCSL 1P6AB 3KYNB 3JV4A 5DZLA 4OKVA 1S7RB 1R24B 3SKUD 3FONB 5MEOA 4CW1B 7FABH 1FPTH 3ZKSD 3IS1X 3E6FA 3H6JA 4JZJC 2Y07H 5DO2C 1IKFL 2Z31B 3EGSA 3O8XD 2XTLA 3MV11 1ZGLA 1HYRC 1DJSA 2BERA 3RUGA 4KKCC 2DWEB 3HC3L 4PJ8A 5GIRB 4WO4A 5F3BB 2OXHA 3OKLA 3OXRB 4A2MA 3I84A 5J6GA 2G5BA 4LRNH 4UZGA 4JY4A 2MTPA 3OF6A 1BAFL 1BLNB 3SQOH 4CAGA 5BQ7B 3X11A 2HFEB 4O58L 3QIUC 1H0DA 3BPLB 2OM5A 2QBWA 4L4JA 4JKKA 3LD8C 5C0BE 3VRLF 5FYLH 3DX8A 3AMKA 3V5HB 1ES0A 4I48B 3MCLL 4NN7B 3QFJE 2GUOA 2WBJC 3I6LE 4P9MH 2YN5A 1EEYB 4F37F 5FK9A 1XCQB 3CSGA 2VC2H 2HMID 2CDEA 3IDYB 2ZCHH 4N1CA 3SBWC 4YR6A 4Z7OE 3BHBB 1R5WA 2XQYG 3DBXA 3W81A 4PJ7B 5HVWA 1U8MA 1HNFA 4NZTL 4J6RL 1F11B 1DLHA 1GIGL 1X5ZA 1IVLA 4R0LA 3FO2B 1BD2E 3O9WC 3TM6A 1TVBB 4Z7VA 5EIQA 3DXAB 2X4OA 4X7CC 4JREB 5K9QI 1HQRA 3PWVB 4OLUH 2W9EL 4X7SH 1IC1A 1U42A 1LD9B 4NUJB 3RVXC 1LNUA 3C6SA 5KVDL 5JLZA 4P2OD 4UIKH 2HTKD 1ONQA 4JDVA 2QKIA 1F3RB 5IESL 1I75A 2V2TB 2MSPA 4CKVX 1YEKH 4P2RD 2NY2C 3MRNB 5DRZA 4QRRB 3GBNL 1KOAA 1GHFH 4HAFA 1U8LA 2A38A 5DUMH 3QZWA 1D5MA 2HLFC 3RRQA 3E8UH 3PWNB 3LMJH 1N4XH 4PJXB 4KJQC 3H7LA 2Y4SA 2UYLA 1Q9KB 4MAYC 1LO5B 3KYMA 3QPQC 1K4DB 1XIWC 1HHGB 2PYEB 4GW5A 3EYFA 5FGRA 5EU5A 3V5DA 3CDGB 5CIPH 2X41A 2YBRB 4RIRB 5ID1B 15C8H 3MNZB 3PQYE 4QTHA 2W0LA 1U93A 5FKPB 5C6TH 1JGLL 1LEKA 5F96H 3CVIH 4NO0A 1UCBL 4JDTH 1AXSB 1KC5H 3GSNB 1LE9A 3EHBD 4Y0GA 3LOWA 1QRNE 5F6IC 2WLYA 2X6MA 3MCKA 4K3EH 5EU6E 3WFCH 1NFDE 2BNUB 3B8SA 5FAAA 3L3OB 2WIIA 4LSPL 2R0KL 4G8EA 3OWEA 4XPBL 1EFXB 1T1YA 4LAQL 1UZ8A 2ZOLB 5GSRA 3BJ91 2M2DA 1QTYT 4EEEA 4MD4B 4X4ME 1CXLA 5L88L 3L9RA 4P0DA 3RWEA 1IAKB 5CJBA 4YPGA 4GLRH 5BV7H 4WENB 3QEQB 2HP4A 4MAUH 1NC2A 1ACZA 5IM7B 2ZJSH 4KROB 4LLDB 1NGPH 2P5WA 2WNGA 3KPRE 1N6QH 4HGMA 1L9NA 1IAII 2CIIB 3QG6B 4R7DA 4UOW1 4WY7L 5CHNA 1OAUH 2ATPA 1X5GA 2DJUA 4O2FA 4PJGE 3S4SB 3TCLA 1JF1A 3SDDD 1ZVSB 3VGAB 4DN3H 1RAMA 1MAML 4LHUB 1DQMH 5B22A 2GW5A 2N7AA 3V0VB 3UPAA 5FECB 4NQCB 4P48A 1MCOH 3BKCL 4RA3A 3MLUH 1HHKA 1UM5L 1ZWIB 2X1WL 5EZLA 5ITFA 1TTFA 4R96B 3TYGH 3ARSA 4JPVH 3LEYL 5TFSH 3TYFA 3TC9A 4RX4A 3VG0H 3MNWA 1KULA 3AXLA 1IRAY 4JFEA 4EDXB 3MJ9H 3V4VL 4XPGH 5E6ID 4QXGH 3VXUB 3SJVE 4M61A 4N1EA 1FNSL 1JN6B 2GAZA 1SJXA 4YHLH 1MI5D 3WS6A 4M93B 4Z7WE 1PY4A 3BD3A 5FYKU 1HH6B 1ZLWK 2HT4C 2WWKT 2UWEB 4G7VH 3MRPB 4XVJH 1S9WA 5ICXA 1WUNT 4WV1C 3UTZB 4HXAL 4LP5A 1IARB 1LWRA 4G9FA 3HLAA 2YUWA 2XQBH 3O0RH 4TUJA 4G7YH 5IQ7H 3ARDB 1EMTL 3FQTB 2ESVD 5DJDB 2FX7H 3G5VB 4FQHA 5I73B 3ROLB 1T03H 4NRYA 5ECJE 1YQ2A 5L2KA 2ZSVB 2GY7B 4M6MH 4OJFL 2WWKO 4ZUTA 1WJ3A 2NY5L 1L4IA 1XGRB 1RU9H 3B3IB 4G42B 4DW2L 3D69B 5JO5A 1A6VH 1UM4H 4JRYE 3OKDA 4H1LG 1FNGA 4ZFZA 1W0YT 1VADA 5HYSG 3V8CA 3T0DA 2WWMD 2NXYC 3MFFB 5E08L 3N50A 2F19H 3RKPA 4WI4A 2VR4A 4PUBL 1O7VA 3MLSH 3GBLA 3OR6A 4R90H 1HOCB 3Q48A 2ADJB 5IBTL 4DK3A 1PZ5A 2EIDA 2AK4B 3QHZL 3VXRB 4LU5L 2CRMA 2VIRB 1BOGB 4OD1L 1WBZA 4C56D 1JPST 5CEZH 4AEHH 1AGEB 3ARRA 4U0RC 4YHPB 1VGKA 4CMHC 1WF5A 3EKCA 3NA9L 3WKML 4PJ5E 2YOCA 3LRGA 4JJHA 2YPVL 2DQTH 4ZNEE 4NZUH 1UWEL 3VFUB 4APQC 2FEEL 1BZ7A 4Z7QE 4DZ8A 3ALWA 1T20A 5ADOH 2W0FA 3S35X 4TOYH 1HZHH 1NBZA 3ZL4L 2JK5B 1LO0L 4RGOH 4PRIB 5FKAB 5BVPL 3IGAA 4QRSB 3DVGA 5DD5L 4HWBH 3VW3H 3SKMA 1G9EA 1VACB 3MR9A 4LPYA 4FRWA 4AQ1B 1KV3A 2Q86A 1IC5L 4ETYA 4QF1A 3JWOC 4JFDB 4ODWB 4OF3A 3KG5A 1SBSL 1QSEB 4ZYKB 4HWEH 1CDBA 2BDNL 3OTTA 1EHAA 1R3JA 1I8LC 4O5LL 5D5ME 2DBLL 2IPUG 1WTLA 2X1QA 3G08A 5IB1A 3L3HB 4K23L 3OHXB 2FHCA 2JJVA 2W92A 4QHUA 2BK8A 2E3VA 4IRJD 3MODH 1E6JH 4EDWH 1IBGL 3VGBA 4FXKA 1OSPH 4LIQE 5GQBA 1WGOA 1JHLH 4HS8H 3UJIL 4QYOA 2IANB 1KYOK 4O4YL 1YMHB 3W9EA 1K2DB 3HG1D 2DMCA 5HHMD 5GS3A 3MO1B 1CR9L 4M6NL 2XWBA 1AP2B 1F4WH 3KLAB 4QRTA 2QHRL 4WW1A 4XP5L 4OZHF 3SE9H 1OTTD 5EZIH 4WFHE 3PWLB 3WCYA 4FG6C 4WU5B 1MJ7L 1NCCL 1MREL 3GMOB 3IYLW 3T2OA 2VDOL 3MRIA 1FFOA 4L9DA 3IVKB 5T1KA 3VXSE 1CGVA 3QUMA 5ISZB 2PO6D 3MUY1 4MNQB 3DSNA 1NEZB 3P0VL 3K7UA 3BPCA 4YDJA 1GZQA 1S7WB 3BE1H 2PTTA 2B8OT 1MLBA 1PG7L 5C0CA 2X4UB 4P2QA 4XH2B 1XH3A 3C08H 1F2QA 3QAZC 1TCRA 1JRHI 3V7AE 5D93B 3CH1B 4OUUA 2WV3A 3WEXB 3KPSB 4GXVL 2E7HA 3NIDF 5E9DB 3MLPA 3QXUA 4D0DA 1LEIA 3MRMB 1P9MC 3FCTB 1PKOA 2GI7A 3V8OA 1A6AB 2UY6A 4UDUB 1NANI 3H9SD 3Q2CA 4Y8AA 5LWYH 4XPHH 1IQDB 2B5IC 1KB5A 2VLJE 1RPQA 5E0QA 4ACPA 4LLWB 4LLMA 4G43A 4GS7B 2FBJH 4GJTB 5FDWB 1BFTA 1YEGL 1D5ZA 2IG2L 1NGZA 3T3MF 1PBYA 3VGFA 1MCJA 3VWJA 1WITA 5E00B 3BDYL 3SKOB 4XNQA 2WQRA 3IFNL 2CLVB 4P5MB 4NHCH 2LVCA 2BRRH 1A4KA 4OFYA 3NN8A 5E03A 4OF7A 4WHCA 3UJJL 1U3HB 5F1NB 3A6BH 4R2GC 3VD7A 4OT1L 5JW5B 3QDJE 3G6JB 1ZK9A 1U8IB 4Z9KB 3C2AH 1NDGB 5IF0B 2QADD 4XPTL 2F58H 3KDMB 3ILPB 3CPLB 4ELMA 3ARBB 4NQXB 3SEPA 1S5HB 5IJKC 2FDBP 4UILH 4D9QD 3C8KB 3OB0H 4NQEB 4RGNB 5AWNL 2H9GA 4UBDD 4HJGA 1QSVA 2H6PA 2YS4A 4LAJH 4TPRL 5HYEA 3RU8L 5LGJB 4NWUL 4LOUD 4K7PL 1XR8B 1MIMH 5ALCL 5TE7L 5I75B 4YX2H 5KS9F 4M43L 4EN3D 1ZHKB 3RGVC 1T1WB 3W5NA 5DJ0B 2YKLH 1I7UB 2YPLD 3BN3B 4Z7UF 3E0GA 3IJHA 2OJEA 3WIHA 4LK4A 4I3SL 2OTUB 4JFQA 4R97B 4QT5B 4F7CA 5AD0A 4NC0B 2EZ0C 3K2UH 5EWIH 5KSVA 5MEND 4F8TA 1AGCB 1FV1A 1YNTA 1OAKH 3NBNA 5T3XE 1CF8L 5CINL 1KLGA 4GQ9L 4U0QB 3KYKL 4FMKA 4HKJA 4F58L 2NY0D 3ARXA 2EECA 2Z4QA 4S1RH 5KVMC 4OLYL 3ULUL 5DURD 2R4RH 4XI5C 2R9HC 1N64L 3R8BB 4JO4L 3OJ2C 2AI0H 5JMOC 3PP4H 4AEIH 5BZDB 4KXZI 3O6FB 1QPPA 1CDJA 4FQQA 2OL3B 1V7ML 4MCYB 5IB3A 3RWDA 4YHML 1TLKA 3H2WA 4QLRA 4Z7NF 2X7LA 2IMNA 1U3JA 2VRAA 4PJIB 3RX5A 1ZLUK 1FFPA 4XZUA 2EIBA 3MA7B 1WIUA 3O2VH 3HPLA 3UBXI 4R3SB 3C9NB 1A7RH 3V7MA 2BVEA 4U7SA 3RQ3A 4ZQKA 4KVCH 5BO1H 3DO3A 4HC1H 2BXZA 5FO7B 2XY2A 3DETD 5AZ2L 4H0IA 2DD8L 1QFWH 2AJVH 4Z95H 4PJ7E 1WC7B 3D3VD 5D2LA 1AY1H 4XTRC 5I1EL 3LCYA 4W6XB 5C0JB 1JWMB 3DXAE 2B0SH 1FAIH 5IW1B 1K85A 3K2MC 2GTZA 5C0ND 1GH7A 2B39A 4JFOA 1NPUA 3U0WH 2MKLC 4YWGH 4TUKL 5D9SA 2I27N 4RRPG 5HD8C 4QRRE 1I8IB 5DLML 5DRNA 4U1NB 4JN2A 1T0NB 2P8PB 2Y36L 4PJDA 3C6LC 5MERB 2O5ZH 1EO8H 2IAMC 4JM2F 4L4TD 4PJXE 2OSLB 3I9GL 4LKCB 4GO6B 4MS8C 4EJ1C 4JLRA 1CK0L 2EDRA 3LS4H 3TPKA 2DKMA 4JFHD 3QQ3B 1CICA 2PYEE 4P23D 4ODSH 5DMJB 5H35B 1QR4A 3UTPE 1XGUA 2DQDL 3QH3A 5IK3B 4PJ8D 3EDJA 4P3CL 4KVNL 3IDIB 4UUJA 4WVRA 1UXSA 4PB0L 1KPUA 4JHZA 4GUPB 4PGEB 1A9BA 1CFQB 4E9LA 3AREC 3DURA 1B6UA 3DHJA 1FJ1B 4B7IA 1MJJB 2R8SH 4LIQL 1DEEA 4FMFA 1NMCC 4C59B 3NH7L 4GRLC 1KELH 5KJRH 2MMXA 4WUUB 3O6MH 3S3SA 3OMZA 5E94A 2ORBL 3TF7C 1T4KA 4FQCH 2EDFA 2XA8L 3TO4D 5B39G 3TT3L 4M5YL 4JO3L 5F70A 4NIKB 4ODXB 1H3UA 3U9UB 3T4YA 4EZMA 5DWUH 35C8H 1CDIA 5E4EB 4E41A 5CGYD 3RAJL 4KKBC 3QEQE 5I74B 2Y06L 1LO3H 4K8RD 5HTSA 4EI6A 4X8JB 2ZZUT 5T33L 1KJ2H 1ZA6B 4EUPH 4U49A 3T65B 5I1GH 2ADIB 4U33A 4HS6A 2YWYA 1WAAA 1BQLH 3U7WL 3UTTD 1HH9A 3ZKMD 2V6HA 3HR5A 1HINH 4M7JH 5F44A 3VCLB 4NC1C 3ZLQC 1J8KA 3QUKB 4CVXB 4LARH 4F9LA 5TF0A 4EVNA 4P2YA 4ZOEA 5HGAB 2YSSA 4XVTL 1RHHA 3BZ4A 1YDPA 3GZKA 2H41A 4NQCE 3FHQA 1E6OH 2PNDA 3T1FB 2A6DB 4LCWB 1I1RA 4ZDHB 5BZWA 3MLZH 3S9DB 4Y16B 1YUHA 3MV9D 5SWZB 1EHLL 1FL5B 4GG8A 3KJ4B 2V7NB 3LKQA 4M7LT 4UOJA 3VFRB 1I9JL 4HK3J 2HVKB 3GSUB 5TQ0H 1BQHA 5IVXF 4HWUA 1QLFA 4X5XB 2MOVA 4IIQB 4YUEL 3W0WB 2CR3A 2NPLX 2AERT 4YO0B 4MXQC 3L7EB 3CCHA 3MFGB 3UC0H 2A6IB 4G8GA 3VXUE 4NN5C 1DQQB 3VXMA 1D5BB 3BRGC 1NBYA 2EIZB 2HT3C 1OAYH 4X7TB 4NHUB 2X4TA 3EJZD 4GMTL 1MQ8A 3HI6L 3QNXA 5I8EA 3RI5K 1PX3A 1G9MC 5GGTA 2XZQL 3O41A 1IM9D 2UWEE 4PRNB 5DJZA 1HN1A 3M17B 4ZAKC 3WNLA 2DYPB 4ETQB 4WTXA 1B0RB 1MJUH 2WLZA 3PL6A 4U3HA 3HUJB 1IKNA 3MGOA 2FEDC 3HFMH 1KSRA 4U2YA 1B0GB 3BKYH 3U79A 4CL7A 4G6KL 1BBDL 1QZ1A 2A6JA 1UACH 5EH1A 4TRPH 5SWSA 2XG4A 4YBLB 2VDQL 3QIBD 3GUTA 4Y8DC 3MGAA 1I1AA 1IC4H 5DD1H 5SWQB 4R7NB 1UB5A 3UZEA 3NZ8B 4AJ0A 4WW2A 1FVDB 1RUPL 3P4NA 3QUYD 5K9QG 4QY8A 1V05A 4NPYB 4U1MB 3F7VB 4FQXD 4XVSH 1IEBB 1NFIB 3QIUB 4G6AD 1CXKA 4Y19E 1I8KA 4E5XB 1PAMA 4P5TA 4AZ8A 1F00I 1A21A 2IADB 3V0WL 1MCLA 4M62L 1SEBA 2J8UF 4HQQH 4GAJH 3GI9L 2AK4E 3VXRE 3HMWH 5JOFA 2R2EA 4M6AA 2V5YA 2VZVA 3KHQA 1PGRB 4DTGL 1C16A 1MCDA 5DJAA 2VITA 4TSBL 3FT3A 4MA8L 4PTUA 4X7FC 4NRXB 1DZBA 1J9CT 5DJYA 1PW3A 1NANH 2E27H 3QDMA 1ADQH 3O9WB 4JFED 1D7FA 1J8HB 4G9DB 5F9JA 4X9FA 5HGHB 3LSOA 3MCG1 4BSWB 3L1OL 3N85H 3BZEA 4Z76B 5IFJA 3KYOA 2EXWC 3TBVA 2BC4A 2PW2A 5C08A 2HLAA 3NFPA 3OAZH 2AABH 2PTVA 1WFOA 2IBBA 4PRIE 4H25B 5DMIH 3SOBH 3WHE1 5IB4B 2Z93A 3J8F7 2HA1A 1JBJA 4PV8A 4OGXH 3LKOB 4JKLA 1M05A 2QQKH 1YEJH 2DQUH 2VQ1A 4JFDE 3RWGA 3C60D 4MAYB 5D1ZA 1BZ9A 1QSEE 3MBED 1EK3A 1HCVA 1MHPH 3H3PH 3CU7A 3HNSH 4TVPD 5D7LB 1KLUA 4BH8B 3NGBB 4LRNL 3QBTB 1BM3L 1WLHA 5C09A 2D03H 5DC4B 3DX7A 1G7LA 1KXTB 1XGQB 3C8HA 3ZYIA 1FGVL 1ZKAA 1P4IL 1JI2A 3IXAA 2QHLA 4M3JA 3L3GB 5F89B 3FT4A 1M7DA 4XBPB 3BGFB 4EXPX 1RZJL 3BQUA 2V2WB 5M94B 4P9ML 4U1IA 3TN0A 5JPMA 3FQWB 3L3DA 1N0XH 2ZCHL 1J86A 3QI9A 4XVUC 2JCCB 3V5KA 3Q5YA 5I9QB 2VABB 1AI1H 4WHYH 2ENSA 1FN4B 2BMKB 3U9PH 1CVSC 2HRLA 3RY5A 5I66B 4UTBL 3C8DA 2X9YA 3HHRB 1EEZA 4N5EC 4OLUL 3MRCA 3GI8H 2FX9L 2DKUA 3LN4B 5DJ6B 3L5WA 3VGHA 5EZJA 2X70B 2G9HA 1NCBL 1E27A 5ISZE 4MNQE 2YN3A 4PJ9C 4XMLL 1J5OL 4KXZH 4AIOA 1UADC 1I4FB 3AC0A 2MFNA 2NY6B 4N0UB 4LVEA 1Q1JH 4MDIB 4NKIL 3SGKC 5TQ2L 4XHQA 3RZCC 4O2EB 1CGSH 2Q8BL 3QFJA 4PP2B 3HRPA 4RCAA 5J4MA 5J3HD 1KCLA 4UIMB 3KPSE 3K74B 5CBEA 2C3WA 4XWOD 5E9DE 3GSNL 4DVRH 4EXKA 2IPKA 5F96L 1T83C 5T5FL 3CVIL 4JDTL 3QA3A 1KC5L 4PJAB 4QTIH 1U2HA 1WSST 1VEOA 5FUZH 2IBZX 4YQXL 1CWVA 3U7AA 1N2RA 1V3KA 4ZODA 1BD2A 3VGDA 4PBWD 5DQ9B 5HHOB 5H94B 2Z0BA 1CFNB 3MGTB 3U2SA 3BW9B 4JAMB 3DMMC 1GGBL 1UVQA 2ADGA 2XWTB 4PGCB 3O4LD 2BSSB 1F4XL 1LMKA 2ZG3A 5C0AD 1J87A 3KPOA 1QBLH 1QG3A 3GSVA 3AS2A 2A0LC 1BOYA 4FXGA 4X4XB 5I2IB 5BV7L 3T0XA 2J5LB 4ZO7A 4MAUL 4IS6B 2ZJSL 3X17A 4MJIB 1NGPL 1Q9LB 3QUXC 4LBEB 3OKKA 5JDSB 1T1ZB 5A3ID 5IJVA 3TNMB 5BXFB 3G6JE 4MXVE 2YC1B 1NAMB 1V5JA 2VE6A 4Y5VC 5CEYB 2ID5A 4YGAB 1P5VA 2IALB 5MP6H 3AS1A 4OAWB 2X4PB 2J8HA 3PQYA 4NQEE 1HHJA 3B9KC 4RGNE 1AKJD 4O00A 3MLUL 4X99B 4TNVF 2CUHA 4ZUVA 1AO7D 1I1CA 3TYGL 5HYIA 5L2JA 1E4XL 4P2QD 3SO3B 4JPVL 5TFSL 4L9LA 1QRNA 3PHOB 2C7UB 2D9QB 3GMMA 5EU6A 5I0ZA 3MOAH 2Q87A 1NKRA 1NFDA 4TUOB 1EHNA 2Q6WA 3RDTD 4YFLI 4H8WL 4WGWB 4U0RB 5K93A 2NW3B 1XZ0B 2IQAA 3WE6A 3P30L 4OGAD 2B1AH 5HYSB 4EI5A 3ELAT 3W39A 4YHLL 1MCWM 1CCZA 4F9PA 4X4MA 3RY4A 3S3JA 4XPAH 3A67L 1KJVA 5E2VH 5LGHL 1KG0B 3MLXH 4XVJL 3MROB 3CDFA 3U6RA 2R56L 4M1CD 4GRMB 3F12B 3OPZH 3KPRA 3IJYB 1IGTB 5E56A 1A4JB 4LCYB 5D7JC 4G7YL 1FYTA 4PJGA 2R1XA 3VFGH 3B5HA 4LPTA 2QSVA 2YUVA 3QCUH 3TA3D 1T03L 1IAOA 1MHEA 1OF2A 4KAQH 3WFDH 3O3DA 2NW2A 1RU9L 1KFAL 4D8PB 1UM4L 1YY9D 3PHQA 3JTSA 4MA3B 4X4YA 5ENWB 3MLTA 3HAEG 4PJIE 1JGDA 3V4PH 4NT6B 2VOTA 4U1JA 2FB4L 3CGTA 3FRUB 3RUGF 3DI3B 1ZSDB 1I8MA 3B2VH 4L4VB 5GS2D 2H32A 5E99H 3DGGB 1LP9B 1VFOA 1UJ3C 4QHKJ 4R90L 3SJVA 2Y5EA 4HUWB 2D0GA 1KNOB 4LSUH 1ZVHA 2Y25A 4Z7WA 4DCQB 4L3ED 5DYOA 1HXYB 2DB8A 1YN7B 1M7IB 4NRZA 5M7QA 4AEHL 3A6CL 3GM8A 2FO4B 5LGKA 4OZFA 4ZS7H 3RGHA 4YFLF 4LLVB 1NDMB 1DVFB 3KNBA 2NTFB 1CXFA 4BM7A 3B4NA 1BVKA 5ADOL 1BFOB 4Y89A 1HZHL 3D25A 3QRGH 1NGYB 4JZOB 2KQMA 1NCWH 4P9HL 4RGOL 1YEDA 3G5YB 3O3BA 5EBLA 3FT2A 4OIIL 2OK0L 3VW3L 1MCKA 2VDRH 4PFEA 1NH6A 2OTPA 4YZFF 3PIQB 1LK3L 4JRYA 4B5EA 4EQ2A 4LMQI 1S9VA 3THMH 3QULB 4QOKB 3PXHA 1A5FH 3IDGA 4HWEL 3O3AB 1A0QL 4AEFA 5AG8A 3PV7A 3QAZB 3VFVB 1UM6H 5HHVH 3MRBB 3PJSA 4UINL 5CZVH 2HMIC 3V6OE 2D31A 4PTTA 3REWA 3LN9A 4F8QA 1PLGL 1MCCA 4E0RA 2CIKB 1KLFA 5GS1C 5KSAD 2W9DH 1U8NA 4DKEH 3K0WA 3S5LA 1TETL 2OTWA 2M8XA 3MODL 3MXVH 1E6JL 4EDWL 4PR5B 4K71C 4EOWH 4J7RA 4WUUE 3EFDH 5FYKH 5A2JH 1OSPL 4PJ5A 1JHLL 4HS8L 5KVFL 4ZNEA 1FFQA 3CMOH 4P2OC 1JTTA 4AENB 3TWCH 3RX8A 2A9NH 3VFSA 1BIIA 2EO9A 3IDJB 3K1DA 4LF3A 2KPNA 2VKXA 5DSCA 3SKNB 1R3IH 1SJHB 5FO8A 5KSUB 2OI9B 1I1FA 1P6FA 1EXUB 3D85B 3NFSL 3OJDA 4WFED 5DD0H 3U30B 3G9AB 1RJLB 1CL7I 1MWAH 1KCSH 3DV6A 4JG1H 1Y0LB 5EG6C 1FO0B 4GSDH 4ORGB 1TNMA 4ZG1A 5IFHL 4PJBB 1NJ9B 3V6ZA 5CP3A 4H20L 3C5SA 5D5MA 5E2TH 4C83B 4XCYA 4YHZL 1ZT7A 5HHQB 1CD8A 2GHWB 2I24N 4LCWE 5DC0A 4NZJA 2XTJD 5SWZE 4PRHB 1JZ8A 4NSKA 1NUNB 3PGDB 1A7QL 2P45B 3W0WE 3RGVB 1GZPA 1XF2A 4RMUA 1NSNH 2VLRB 1NLDH 4HBQA 1XF4A 3BKML 5KTEH 1HILA 4HEPG 2FH6A 2OR9H 5EFIB 4OLWH 4XPHL 2ERJB 5DK2B 3CFEA 1JPSH 5TDPA 2PR4H 3QB7C 3DYOA 1I7RB 5IG7B 4DVBA 1K6QH 4JM2C 4K3JH 3TZVC 4NGHH 2VO5A 5IW6B 4S11A 3UTSD 4WWID 4NNXB 3WFHB 3HUJE 4FTVD 5I1HL 3UBXG 4QRPD 4NKOB 3G6AA 4NFBA 1S8DB 4XWGH 3G04B 4LSSH 3CFBA 5DJCB 3CC5B 4KK5D 2BVPB 5LBSH 1JGVL 2CDFB 4RAUA 3ZYOA 2PXYA 3AMLA 2YMXH 3HE6A 1BZQK 1OOAA 3IAPA 4AY0A 3EZJB 4KMTH 4OGYL 3A6BL 3HC0A 3VXTB 3WS3A 1YJDL 4O51B 1URLA 1JWSA 32C2A 3C2AL 3LV3A 4E42A 3SO5A 3NCMA 2R23A 3QIWA 4KK6D 4RSVA 5E6IC 5CJXC 3P73A 2P8LA 4WI9A 5L0QC 4R8WL 1F6AA 4RFOL 4AM0A 2VISA 1KN4L 3X3GL 1OM3H 2NY7H 5EN2A 3MRHA 1CDCA 4YAQB 5DR5H 4MMZC 4FNLL 4OLEA 2VLJA 1CLCA 2CDGB 2LAGB 3HR6A 5EPMB 4OLZL 3LB6D 4AG4H 1J8HE 1QQDB 1T0MB 3O6LH 5I8CB 1XCTA 5E8EB 1W72B 4L8SC 2GSIA 2AXJA 3K2UL 4LCUB 5EWIL 3WJLA 5F7UA 5L6YH 1OAKL 1CYGA 3P3YA 2XPGA 1Q9OB 3T0ED 4Y4FB 5D4QA 1C5DB 2EYTA 3WIIH 1LK2B 2JIXB 2O61A 1BJMA 1K8DA 3RNQB 1MUJA 3QDJA 1FZKA 2QQNL 2R4RL 3TBSB 3BDBA 2IAMB 3I75A 2AI0L 1BMGA 3PP4L 1PVHA 3CSYA 2A73B 5DS8A 3HTLX 2Y7QB 3D1MC 2D7MA 5GXBB 1VDGA 5I1KL 5D7LE 3HA0A 2Y9RT 2E5EA 3I6GB 1I1AD 4P3DA 3LZFH 1OP5H 1N8ZA 1FFNA 4LQ1A 4MX7A 4GG6F 1SJVA 1N3NB 1GC1H 3DX9B 1WZMA 4ZOCA 4ALAH 1DBKH 4U31A 5B3JE 5ESVB 1DQLL 2HAZA 2HJFA 4LHQB 4LPVA 5I1DA 4KVCL 1A3LH 2PCPB 1IT9H 3NCFB 4HC1L 3QXDA 5HHPA 1T66D 3PGCA 4WFFD 3KYNA 2R2CA 2JCCE 1S7RA 4OZIA 1R24A 1QFWL 4H26B 4Z78B 5BS0D 2MQ3A 3FONA 3SHSA 2X2YA 3DUUB 1AY1L 3DTXB 1NCDH 3RIFF 4CW1A 5E5MB 5CKAA 2X1XR 4LCCB 4WHTB 5CSBA 5AG9A 2VDPH 1PSKL 3O2WH 4HDIB 1B4JL 4WEMB 4YWGL 4Y88A 1A6PA 3IDXL 2DWEA 5ANMB 5GIRA 3UYOD 1YMMB 4JANA 1L9MA 3SDCD 5B39B 5F3BA 5MEQB 3OXRA 4CN6A 5F88B 4OCNC 2VZSA 2BZDA 3RPIB 1BLNA 5BQ7A 4Y4HB 4IRJC 2HFEA 4JQXC 4N0UE 3LS4L 4QGYA 2IBGA 1FIGL 4ODSL 5D1ZD 4I48A 1W2KT 1YQVL 3BPNB 1X4YA 1HSBB 3S7GA 1EEYA 4WUKL 2EEAA 1I3GH 1XCQA 2BSTB 3OKNB 3FOMB 2JELH 4Q9RH 2F8OA 4YC2C 3V79C 3W11D 4NN5B 3BHBA 2XT1B 4PJAE 4PJ7A 2OR7A 4I3RL 1F11A 2FX8H 3FO2A 1QSFD 1TVBA 1KELL 1QBAA 5KJRL 1OTTC 3DXAA 5HHOE 3O6ML 3Q0HA 3SDYL 3RWHB 1I85C 3DUSB 4FQCL 4ZNCD 3PWVA 3ARTA 5IHBA 1LD9A 4NUJA 4P4KB 4XC1H 3QO0B 3VG9C 2DI9A 4HF5H 3QI9D 1D9KD 5DWUL 1UKSA 35C8L 2PO6C 2V2TA 2AXGB 5B38G 5F9AC 3MRNA 4FP8L 4QRRA 5GISH 5GJSL 4G6MH 4KTEH 4J3WA 1LDPH 4LGRB 4ONGH 1KJ2L 3C09B 3QR2A 1K5NB 4MJIE 3IS0X 1CLOL 1U95B 3PWNA 4UQ3B 3S34H 5I1GL 4PJXA 1WWBX 2BY1A 5HI4C 1Q9KA 1JZ5A 4I13B 5CD5D 1LO5A 4M7JL 1K4DA 4QXUH 1HHGA 2PYEA 3RWJB 4LARL 5C07A 3ZE0F 4CVWA 2HT2C 2XN9D 1UG9A 1OTUD 2YHGA 3CDGA 4I77H 1A3QA 4MA7H 3A6OA 2YBRA 4RIRA 5ID1A 3MNZA 3F6IA 5FHAL 5FKPA 2IJ0C 4YHYC 4U3CA 3MLZL 5DFVD 1P7KB 3GSNA 1KTKE 1HYSC 5IGXL 3G5ZB 1D6VL 4DN4H 3VH8G 4ELMF 4KJPD 1BX2B 2BNUA 3L3OA 1UYWH 2VZOA 2MCPL 3UC0L 4CMMB 1EFXA 1FZOB 3RNKB 5I8OL 3CIQA 1OAYL 2ZUUA 3ZYJA 4IRSD 5FYJE 4MJ5B 4D9RD 4P3WA 4LGSB 3C5ZA 3QEQA 4OTXH 4U2ZA 3CLFL 1MJUL 1MJ8L 4K94L 2CIIA 3QG6A 1WWCA 3BGMB 3S4SA 2DIJA 5LAXB 4TN9A 1UACL 4TRPL 3R0MA 5J11B 4L1DA 4NJ9H 5ICZB 5FO9B 4LHUA 1CL7H 1YY8B 2C3VB 3HE7D 3V0VA 4JY6B 5FECA 4NQCA 1P4BL 2E8YA 1J1OL 5A16B 1T21B 1ZWIA 4XB7A 4R96A 4HZLB 1EVTC 4XNZC 4XVSL 1M7XA 3BXNB 3KWWB 1FLRH 5HDBF 4K2UL 4L4VE 1R0AH 2NLJB 1JPTH 4XHJD 1LP9E 2LABA 3VXUA 1JE6A 4V2CB 1CXEA 1CBVH 1JN6A 1ZMYA 2BNQB 4HQQL 3S35H 1CU4H 4GAJL 3PGFH 3MLYH 3EOYG 1HH6A 5SX4I 3P9LA 3MRPA 2VLMD 1JK8A 1RJZB 1U8OB 1YZZA 3H3KA 3UTZA 2NY0C 2E27L 1ADQL 3INUH 4ODUB 1IJ9A 1RIHL 4FQJL 5BRZD 3GIZH 4JGJA 3FN3A 2VUYA 3ARDA 4NZDA 5H37H 3N85L 4EI5D 1DBJH 3FQTA 5DJDA 1WZLA 5T3ZE 2APVA 3G5VA 3ROLA 4NFCA 4I9WD 3CAFA 3D87B 2AABL 5D2LF 2ZSVA 3GK8H 5IWLA 2L4OA 3PWPD 3MRRB 2ZUXA 5JHDB 3H0TB 4JRXD 1XGRA 3B3IA 3D69A 1V3MA 4MA1B 4D3CH 1WZ1H 3GMRB 4Y4KD 1YNLH 1YEJL 2DQUL 1ZANH 1FYTD 3CLEH 2C3XA 3MFFA 5JA9A 2X89A 1MHPL 3KPTA 2IFGA 3D0LB 4OFVA 3HNSL 3VI4E 5DO2D 3RZCB 1HOCA 5JZ7D 4PJDF 2ADJA 5C0FB 2BJMH 2D03L 3MV8B 4GRWF 4MJ2A 3STLA 3GFUA 4Z0BH 2AK4A 4OIBA 4X6BB 3VXRA 2VIRA 1BOGA 4YBHA 5GRWA 4M7LH 1AGEA 4KKCD 4YHPA 4N9GB 4NQDD 5C0NC 4OFIA 4UT6H 1RJCA 3NIGE 2Q8AH 3WJJA 2VKWA 3DMMB 2VXUH 3EOTL 3BEWB 3S88H 2AQ2A 3BISA 4XT1C 2JK5A 4HUKB 3ULVE 4WGVB 1WT5A 4QWWD 5C8JB 4PRIA 5FKAA 2I07B 2B1HL 3W2DL 4QRSA 5EU4B 2WBJD 5IB2B 3OG4B 1U92B 1VACA 4HWZB 2CO7B 3VA6A 2D7NA 3GI8L 4JFDA 4ODWA 1QSEA 2GY5A 4RAVB 4ZYKA 3ULUD 2JJWA 1H15B 4IDJH 4PJ8C 4PJBE 1JFQL 4CUCA 1HIML 2HKFL 3MV7D 3QUMH 1GC1C 3L3HA 4C4KT 3OHXA 1JNLH 3RVXD 4JRWA 4PRHE 4OF8A 3S6CA 3DLQR 3BYYA 4HBCL 4HG4K 3I50H 4GAGH 2NY2D 3RFZC 3C87A 5IMLB 2R2BB 3P2TA 2VDLH 5I30H 1CGSL 4OZHB 2IANA 3QHFH 2ED9A 3CXDH 4DVRL 1YMHA 3MRLB 5FHBH 5I18H 1K2DA 3MBXL 3QPQD 3MO1A 1XIWD 3QZWG 4JPWL 5FUZL 2GYSA 4R4FL 3UMTA 1AQKL 1B90A 1AP2A 1A6ZA 3JWDH 4K8RC 5AYQA 3DPBA 3KLAA 5CZXC 1Z9MA 1CLZL 4JFZL 1KB5H 4OQ1A 3LIZH 3PWLA 4AH2B 4WU5A 3QDAA 3PXJA 3T04D 1ZLVK 3GMOA 5J1TC 3QCTH 3SCMB 5D7JB 2FATH 3ZT6A 3O6KH 5T1LB 4HIIB 5JW4M 1F90H 4DZBB 4UV7L