2I24N

Crystal structure analysis of the nurse shark new antigen receptor pbla8 variable domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
113
structure length
113
Chain Sequence
RVDQTPQRITKETGESLTINCVVRDSRCVLSTGYWYRKPPGSRNEESISDGGRYVETVNRGSKSFSLRINDLTVKDSGTYRCKPESRYGSYDAVCAALNDQYGGGTVVTVNAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords New Antigen Receptor PBLA8
publication title Maturation of Shark Single-domain (IgNAR) Antibodies: Evidence for Induced-fit Binding
pubmed doi rcsb
source organism Ginglymostoma cirratum
molecule tags Immune system
total genus 31
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i24N00
1U58B 4I3SL 5KVFL 3ZYOA 4FFWC 3ZDYF 4JFQA 4ZXBC 2F58H 1U0QA 4QTHA 3IAGC 4YC2B 4LCIL 1HH6A 3FQUA 4YEFA 4JHZA 5E2TL 2AXJA 4PP2B 1A9BB 4NQXB 3MBEC 4QRTA 2OSLA 2R15A 5D70H 1MHCA 1YJDC 3K8KA 1ZLUK 2IPUK 5ESVB 2VLRD 2FR4A 5C6PB 1CDHA 2CDGA 5CEXA 5K9OA 3OKOB 5EUOA 4YHIA 5BZWA 1I3VA 2Y06L 3KPQB 4KI5C 4XAKE 1CLYL 2N7BA 4HCRA 5DFVC 2CIIA 3MLRL 5E8NA 5EIVA 4OQTL 1G6RL 4C59B 4FFVD 4L3CB 5KN5B 1EEZA 3O3AB 4QNPF 2F5AL 5ANMB 2J3SA 1U95B 4HQQH 4X99B 4Y16A 2D03L 2WNGA 1HINH 1O7SA 4JRYA 2B1AH 1IGFL 1HILB 4LHUB 3NBNA 1X7QB 1MRDH 5D71L 2WUCH 1J1XH 2CRIA 2W9EH 4U31A 3W39B 4X6DE 2XYCA 3PGCB 2PNDA 3TT3L 3NFNB 2F9BT 4XVSL 3R8QA 3TH3T 4LVOB 4MCZB 2E7LC 4Z7NF 4RMVA 3HE6D 5C09A 1GH7A 1KN4L 3P0YH 4N0UB 1ZT4B 1U2HA 4D0DB 1X3DA 3HMXL 3VG9B 2YPKA 2ZPKL 2GCYA 4LSQH 3DBXA 4OLUH 4CMHC 1MEXL 5DA0B 3E6HB 2E6PA 2E6QA 1CE1L 2E9WA 4M8QB 4EOWH 2VLRE 3DVFA 3ETBF 3MYJA 1KTDA 1TZHA 1QEWB 3Q2CA 4IMLA 4NT6A 3ESUF 3F58L 1AO7D 1RURH 4KKCD 4OZFG 4IIQA 3BQUA 4DW2L 2N1KA 4X9FA 3M8OH 4QXTA 1BQHA 3KYMA 4BSVA 2P8LA 3O4OC 3UPAA 5DTFB 1KLGA 1MCRA 4JHWH 1I1AC 5F3HA 2B4CL 5JIIA 4D8PA 4PJFB 3CLEH 4EI5B 2FWOA 4GSDH 1KTLA 1U8KB 2VZUA 3MRKA 4HULB 5IWLC 1RIUH 5SWSD 2OTUA 3NACL 3B9KD 2V6HA 4K9EL 2NZ9D 5GZNC 4XHQA 4PS4L 3T4AB 1DCLA 3V5KB 5HI5D 2P47B 5JW4N 3THMH 5E9DB 3MNVB 5CJQL 4JFOA 5FYJU 4ZAKD 3KVQA 4PRNA 4FQQA 2FBJH 3X12B 1J8HB 1CFSB 4U6XA 1UG9A 3O8XD 4L4VA 4DUXA 2VLKA 1ZLWH 1ZA3A 1WV7T 3VXPB 4LL9A 4HXAH 1OTUC 3EO1A 4NRXA 5I1AB 4K7PL 4JANB 1Q9KB 3LN5A 4M3JA 4YDIL 4NN5C 1EA9C 2DLHA 5H2BA 4PJXE 1EO8H 4EUPH 5H37G 1KIRA 3VRIA 5IB3B 3P0GB 2FO1A 5CIPA 3HUJE 2FJGB 2DQFB 5JQHC 1UVQB 1NEUA 4K8RH 3RDTD 5IHBA 4PPTA 1YYLL 3HCVA 3JTTA 1QBLH 2FL5B 4G80B 2D9CA 2LU7A 4IHOB 3RWJA 3S37X 3D9AL 1OTSD 3LH2H 3ZTJG 4JN2A 1W8NA 1RUAH 3QFDA 3OB0K 5GS1A 5JXAH 3UJTL 3CMOL 8CGTA 5I1KL 1U8IB 3QUZC 2DYPA 4JGMA 2MQCA 2M1KA 3HZKB 1CTNA 5DGRA 2VXUL 4GMTH 2XWJB 4LCCB 1IQWH 3V0WH 3L3GB 4FQXD 4PG9B 4O4YL 5GRJL 2R23A 1QA9B 4OF6A 5FYLD 1NBZB 3GSNH 2I60H 1HNFA 1C1EL 1TVHB 3BUTA 1HHGB 1R5IB 4KTDH 3H42L 3GI9H 4PRHB 2QQKL 4D3CL 4Z0XB 4LDOB 1HHJB 4JPVH 5C0GB 3VG0L 2IBZX 3VFUB 3MNZA 1WGOA 1A7OL 4G6KH 3KYAA 4UTBH 3CDYA 3HLAB 5EO9A 4LVNB 4E5XB 4N5ED 1I3UA 4YHML 1VACB 4U1JA 5FHBH 3GMOA 1MQKH 1XGTB 2WBWB 4AH2B 2R39A 1TNNA 1HQ4A 1RI8A 1AGBA 3C5ZD 5E1AA 2XA8H 4XB7A 1QTYT 5GGUB 1SEBA 3S3PA 3RWGB 1QFUL 4GG8A 1DQDL 4J4PC 4H0GA 1VFUA 3S34L 4I3SH 2ADIA 4NQDB 5KVFH 2ITCB 3D39D 2X4TB 3FTGA 5I1IL 4NQSA 5A3IC 4LAQL 5IKCA 4LCIH 2NNAB 1T4KB 1MWAB 3LKSB 2VKXA 3H9SD 5BOPA 4UNUA 3QBTB 2Z93A 4PJHA 1W72L 4R4BB 3O6MH 1I85C 4OD3L 5AEAA 1OAKL 1R5WA 2QR0A 3VXSA 2VQTA 2ZUTA 4FQPA 1ORSB 3HG1D 3OKDA 4G8IB 5C9JA 5MERB 2WV3A 2Y06H 3WLBA 5F9JA 4HG4J 1CLYH 2AVGA 3ROOA 3L9RA 4Z5RB 4BQ8A 1EZVY 2R2EA 4D9QD 4HF5H 4ELKB 1G6RH 2DJSA 4GMSL 4FFWD 2BNUB 4P4KB 1MI5B 5FA3B 4AY0A 3MXWH 2D0GA 4M5ZH 1XGPB 2F5AH 5FM8A 2NY1C 4XPHL 2D03H 3QDJD 3FRUB 3P2TA 3GSVB 1IGFH 3MBED 4ENED 1CXHA 3PJSB 5B8CB 5T1KD 5D7JA 2GJ6E 4FMFA 1S9VA 4GKZB 1WC7A 4BKLB 1YYMH 4WU7A 1MJJA 1FVCA 1BX2B 1NCBL 1A6AB 3BDXA 4XVSH 4ZMAT 3L7EA 4KI5D 2EE3A 4HDIA 4CADB 1YMMD 4P2OB 4WTWA 1LO5A 3IDJB 2NY3D 5C1MB 4KV5F 4OF0A 1JF1B 1V8HA 3HMXH 3HR5B 3NCEB 1JPGB 5F1IB 2DKMA 1MEXH 4O58L 3OR6B 4GS7C 5TPWL 3T2NL 4TSCL 1UXWB 3DECA 3QPQC 1CE1H 3B8SA 3MRNA 3VXMB 4P3WA 3IF1B 4L8CA 3FQXA 3HZVA 2XZZA 1TQBB 3GSRA 3STLA 4OGZA 4I18C 1WJ3A 2HT2C 4Q6IB 1KF9B 3QZWB 5EOTB 4DW2H 5FDWB 1G9MH 5KOMC 3MRIB 1JHKL 1GZQB 3U46B 5I66B 3RZCD 5JHDD 4OUOA 4HFUH 4YX2H 1T7ZA 4LLYB 5HI3D 5TJWK 5I19H 4YR6A 2A83A 1HI6A 1BBDL 1LILA 1RZ7H 3U83A 2ZUQB 1YEGL 3V0VB 4PJBA 4F37F 4NZUH 3HPLA 4GH7B 5BW7A 3KYOB 2ZCKH 3VI3F 5HPMB 1MCPL 1BWWA 4PP1C 3VFPB 4LGPB 2LV4A 1LEIA 3W82A 4OLYL 3OKKA 2C1PA 4I5BA 3LKQB 3S36X 5GGRA 1F90L 4N8CL 1AD9A 1YMME 1CGSL 4HLZG 2CSPA 2BVEA 15C8H 1PG7L 3PWPE 1R3IH 1JF5A 1I1AD 3KLSA 4ZO9A 2QQQA 4X6BA 3U79A 4XPGL 5DMGC 4K7PH 1ZHKA 5LGKA 1MLBA 4XVUC 2XKNB 4PJ8B 4XNQA 1X6LA 3C60D 3L5WA 4YDIH 4NKOB 4L8DA 3X3GL 2MCG1 3PWJA 4S1DC 5C0AB 1B0WA 5E2WL 4YHNA 2KKQA 3P77B 1I7ZA 1FSKC 4XRCB 3VFRA 1PD6A 3IDIA 4ZFFA 3CFKB 1KB5L 2PXYC 1P7QA 4QO1A 5T5NG 4U3XA 4TSAH 1DEDA 3GSQB 3MV7A 1IAIM 3OJ2C 1YYLH 1UFUA 2CRYA 1JF6A 3JTSA 5EBMA 3D9AH 5ID0B 4C83B 3QQ3A 1WLHA 3SBWA 3DXAD 4R8WL 1CF8L 1ERNA 4M00A 1F6FB 5KSUA 1OTUD 4YLQT 5I1KH 1KIQA 2VC2L 3MMEB 1I7TA 3HRZB 1A3QA 4XPFL 4HT1H 3RY5A 2OJEB 2XTJD 3V52L 5ABDE 4X7TB 4N0RA 3UEZA 4WWID 5IESL 3T09A 3TJHC 1OGAA 5DJXB 1MAKA 1I8MA 1NGYB 2F8XC 1HSAA 2W9LA 4IRSD 1D5IH 4OBRA 3L95B 4O4YH 4HIXL 3ARFD 2DQUL 1TZGL 5FYKU 2Q20A 5E4EB 1WBXB 4DZBB 1C1EH 3HI1A 4JM4H 4K7FB 3H42H 5JUEH 1FPTH 2QQKH 3WDIA 3D85D 2P5WD 3LHPL 3GMNA 3CFEA 2FZ3B 3ECBA 2OMNA 2ZOKB 4YHMH 4Q97A 2BOCB 1FP5A 4YIQB 1XFPA 3QUZD 4MVBC 1XF5B 4QWWC 4WHTA 4KPHL 2YD4A 3OZ9L 4TSBH 3GSNA 4GW4A 3WLWC 4CU7A 2V7HB 1DUYA 1LP9E 1R5VB 4QHKI 1DQDH 4QRRB 3WIFA 3I3DA 3S34H 5J12B 4C4KT 5D93B 3MXVL 5TDNB 1FZOB 3CZFB 1DLFH 1SY6L 3DXAE 3TZVB 4LAQH 3U82B 5IFAH 4ELME 1FCCA 4PRAB 1CZ8L 4NO0A 4L3EB 2EEAA 5MEQB 1E4XL 2XTJE 4H1LH 1S9WA 1OAKH 4M8VA 3EIFA 3HE6B 5FEBA 3C6SB 2ZZUT 2BNQD 4RDQF 3VWJB 2A74B 1Q0YL 3GK8L 3QHFL 3RNQA 1RJCA 3QCVL 1VEOA 1KPVB 3ZHLA 2QKIA 5EC2A 1NL0L 4LSPL 5KJRL 4JFEA 4NRYB 1ZHNB 1XR9A 4GMSH 1M05A 3R4DA 3V4UL 4YGVA 4OGXL 1JN6B 2P5WE 1ORQB 3TA3C 1DUZB 3TBVA 1AO7B 4NP4L 5CCKL 1QLFB 3SKJH 1EGJA 1T0NA 3CH1B 4PJGF 3GFUA 5FOJA 2LFGA 4BQBA 4P2CG 5I1EH 3EYVA 3MUY1 4HWBA 4Y4HD 5ESAA 5F9AC 2VWEE 2Z31C 2E27L 2L7JA 5I16A 1FL3A 4OAWB 1B4JL 2DQEL 2NY4C 3SDDD 3OF6D 3OAZH 1BBJB 5FYJH 1T66C 2V2XB 1FVDB 5SWSB 4G5ZL 4NO2A 4FN0A 5J9PA 4UAOB 4BFIB 1BMGA 4WEMB 1N64H 1J18A 4ZSOA 4YHZH 4HJ0C 3KGRA 3NCBB 1RQ5A 2X5PA 3FN0H 5HHOB 3MV9A 3ZDYE 5TPWH 3EYUH 3QB7C 4TSCH 3UTTD 3TO4C 2DIJA 2KZ1B 1M6OB 2BNQE 5T1LD 2BHYA 1KXVC 4FP8L 3O8XB 4HWZA 1ACZA 1U36A 3JVGA 4FTVB 4G8FB 3W5NA 4OCLC 4GG6A 1QFOA 3ET9F 1JHKH 1AXTH 1Y0LA 1U8MB 3SJVB 4M02A 1GIGH 3F12A 5BO1L 2X4RA 4K71C 1HN1A 3L3IB 4G9FB 4JJHA 5GHWL 3RY6C 1I8KB 2PYED 4FXKA 1D9KA 3HA0A 1MCPH 1FGVL 3L6FA 3VWKC 1ADQL 2DQTL 2G75A 3QPQD 4X4XA 4QNPE 32C2A 5DJCA 5F9DC 1C12B 4Y5VA 1F90H 1QLEL 4WGVB 4PFEA 4XCCL 5EU6B 5I1JL 5EU4A 1G0YR 4WI3A 1CGSH 5IQ7H 5I8KL 1U8NB 2Y5TB 4XXCA 4UB0H 3DX9B 4JVWA 1OAXL 5D1XC 3LQAH 4XPGH 4M61B 4WW2A 4Z7NE 1YPZF 4PRID 3X3GH 1JUFB 4YUEL 5HD8C 4S2SA 3U36B 3VXRD 2AJ3B 3QWOA 1SEQL 1V05A 2OLDA 4N5UA 2VZTA 4G9DB 3L3DA 4KK6C 4PP1D 3QUMB 3TIEB 4R7NA 5GRWA 3DROA 2HJLB 4KKLC 1UWGL 1MF2L 1K4DA 5I18L 3B2VL 5IW6A 3JUYA 1YEEH 2AJUL 2YSSA 3NIDF 2OMBA 2RBLA 4LCYA 3CX5J 4PLJC 4P2RE 3SDCB 3JWDC 3UTSA 4F9LA 1JIBA 3NPSB 5HHXL 4OGAC 5J13C 4R8WH 5CMAB 5EBGA 2PYEE 5GRVL 1M71B 4CVZA 3TJEH 4P23C 3QFJA 4XCYB 3WE6B 2HJFA 3V52H 4S1DD 3HC4L 3D39B 1RZKL 5IK3A 5ICZA 5IESH 1FFOB 3MGTA 3FQNA 4MJIA 4L4JA 1KEGL 1S5HA 3RPIB 1WSST 1JHTB 4XMKL 2VZSA 4HIXH 1EEQA 4OLVH 2PXYD 2DL2A 5HGAA 1YEKL 4PB0L 5IBLC 3H9SB 4MXQC 3O3EB 5IHLB 1S78C 4LCWE 2ICCA 1OF2A 1QLRA 4ZO6A 1EX0A 3RTQC 1LGVA 1IEBB 1RZIA 1QSVA 1IKNC 3LHPH 4PJ9A 3RGVB 2R2HB 2EDKA 2XXMB 3KXFB 4YHYB 5MEOA 4RBPK 2FRGP 3VXRE 2HMID 2ZUUA 3DWTA 1B4RA 4AM0B 4KPHH 3OZ9H 2X4OB 1LK3L 4ZXBB 3QULB 3VFSA 7FABH 5HYJD 4KHTL 1LDPL 2N56A 2V2TA 1IC7L 3BP7B 4H25B 1OPGL 2BSTB 4TPRL 3KPNB 4GRLD 3MXVH 2AK4A 1NJ9A 3L7FB 3VFWA 5FO9B 3MBEB 5AAWA 3IGAB 2DQDL 1SY6H 2DLFL 2NW2B 2XWTB 1CBVL 2OQJA 4LP4A 5DS8A 3GBLA 2IQ9L 4PTUA 1XCQB 5DT1L 4Z95L 4KK8D 3L3JB 1FIGL 1AJ7L 4GLRI 2R0LL 3WUWB 2Z9TA 1E4XH 2NX5B 4GKSA 3N1FC 2BY1A 2Q76B 2OI9C 3SEPA 1CFTB 3BKML 2UYLA 1Q0YH 3QHFH 5EFIB 1NAKH 1J1PH 4QWWD 4XMPH 4Z78A 3P11L 3GJFH 2AK1L 4P5KB 4QOKB 1W0WB 4U1HA 4Y5XA 2IFFH 4YAQA 3BMVA 3QUYD 3LSOB 2J6EL 3VGFA 3MLVH 1U8LB 5BQ7A 3RGHA 3INUH 5K9JH 2PKDA 3HI5L 4PLOB 4JE4B 4CDHA 4OGXH 1MHHB 3U0WL 2JIXD 4X9HA 3L1OL 3SE9L 1FRGH 1I9JL 5F96L 1JGEA 1KCRL 4L1HA 5MENE 5LBSL 2FSEB 1MAMH 5FGBC 4HV8B 2RIKA 3QNYA 4M6ML 4PJCE 4XX1G 5JHDB 3MLPA 3TN0C 2DM7A 2E27H 4TVSa 4JO1H 1B4JH 2DQEH 5HYJE 1MJUL 4XI5D 3W81A 4OSUL 2IGFL 3U6RB 4N9OB 3WD5L 3GJEA 1KACB 4MNGB 1FAKT 1HZHL 2XTLA 3B4NA 4G5ZH 1T04B 4XPTL 1IC1A 4CMHB 3TYGH 4PV9B 4P46A 4QHNB 2A9MH 1DFBL 2E9IA 3H9YA 4EDXA 3ZE0F 5KAQG 5IVZA 1ULVA 1DL7L 5DUBA 4DQOL 1F3JA 5ADPL 5IJVA 1MWAL 2HVKB 1C5BL 1NCAL 3FT2B 2FYYB 5MI0C 5DJYA 5C7XL 4NM8L 3NPZB 4HXBL 3ZKNC 3O4OB 1WT5A 4KK9D 1ZHLB 5IB2B 1I1AB 4G3YH 2A1WL 4P2YA 4QXUL 2NY4D 4HZAA 1X5GA 3A6OA 5TQ2H 1Q72L 1T66D 3T0AA 2JF1A 1LD9A 3RVTD 2YUWA 5C0CB 4NNPL 4FQJH 5BO1H 4MAUL 2FJFA 1F5WA 3KPMA 4YHLH 3LQMA 3G5ZA 4KTEH 4MDJB 4QRPD 1G7QB 1CLOL 4CU6A 5GHWH 1LO4H 1UCBH 5JW5A 4K7PX 1NDGB 2BVQB 2IANA 5ISZA 1HCFX 1ADQH 2MNUA 1OSPL 1MFAL 2DQTH 3TO4D 1FLTX 3VRLF 5IJKA 5AG9A 3MQIA 3P4OA 4LPUA 1QLEH 1YNTA 1TJHL 4HKJA 1XCTB 2I9TB 4HMDA 5CGMA 4CN6A 2YEZA 2XZAL 5I8KH 1C5DA 1A6PA 2IFGA 3DX6B 4NN5B 1OAXH 1ZK9A 4OJFL 2ITDA 4NQCD 4QY8A 3D5OF 4LBEA 4GRWB 4ZNEA 1SYSB 3O6FC 5DDHB 1D6VL 2D31A 4Y1AA 3RKPA 4FZEL 3IVKA 1JHLH 3MRHA 4P9HC 1C5CH 1N8ZB 1OSZA 1T20A 4KV5E 3EUUA 1NFIA 1MHPL 4UIMB 2R0WH 1NEZA 3O2WL 3UP1A 4I48B 2I9LB 1MF2H 3QO1A 1DQTA 5I18H 3CDCA 3I6GA 2AJUH 3ILQC 1S7SA 1T80A 2JB6A 3QUZB 1F4AA 4QRQA 1II4E 4UU9A 5IHUH 4HWEH 3D0LB 4OLWL 5ENWA 3SPVA 3OXRB 1RUPL 3I2CL 4X7CC 1QPPA 2BRQA 3RZWA 4G43A 1T89A 2WUBH 4O9HH 5DVOA 3MOQA 1IGYB 4KK6D 5IGXL 3VI3E 3K8LA 1BVKA 5BRZD 1YEKH 2FDBP 4RGND 1I8IA 4PBXA 3QRFM 2PR4L 3PP4L 1EJOL 1S3KL 4GJTB 3T1FB 4X4ZA 4TTGA 3TCXA 4WFED 3MRMA 4PLJD 4RMSA 2VZ1A 1UJ3A 3O0RH 4OGAD 1EEYB 5B3JF 2D7TL 2PW2B 3KLDA 2YPLD 2LAGB 3K4AA 1LNUA 4P23D 2DLEA 5DK2A 2E8YA 3HI6L 4NIKB 1N0XL 3NZ8A 3MRQB 4WO4A 1JZ8A 1LK3H 3MLWL 2ATKA 3MCKA 1KG0B 4JO2H 4LSUL 4POYA 4HH9A 3DUHA 1LDPH 2D7NA 4KHTH 3TVMD 3VFNA 4RMTA 4M4PA 1IC7H 1S7XA 1NCWL 1R3JA 1OPGH 4Y88A 5BV7L 4C58B 3WKNA 5IG7A 4HIIB 1GGUA 2DQDH 3X11A 5GS0C 2DLFH 1CBVH 1VSCA 2IQ9H 3QXTA 4I0PC 1FYTB 5DT1H 4Z95H 2GK0B 1FIGH 4X6FA 1AJ7H 2P7TA 4HMCA 4HIEB 5C08D 4BFBD 2ZUXA 2R0LH 3HE7A 1LK2B 3SY0B 1BD2B 5IEKB 1ED3B 2ED7A 5AZEL 3QXUA 3FQTA 3BZFB 4RAUB 1CXFA 5AWNL 3TBTB 4GT7A 2YPVL 3P11H 5D2NA 2EKSB 4M6AA 4Z7UF 4RGNE 4J23A 2J6EH 4UQ2A 2NY1B 1QO3A 1S7QA 3UTTB 1DBBH 4MA3B 4OCSH 4ZFZB 3LKNB 4XP4H 3CSYA 5HVGB 5DQ9B 5GIRA 3BVNA 3SE9H 4LRNL 5DJDA 1ZTXL 4MJ5A 1I9JH 5F96H 4ORZC 3H3PL 4WIQA 5LBSH 2YPLE 5CP7B 1IC5L 4OF3A 3WSQL 4JM2F 3VI4E 5EDXA 4H0HB 4C4KO 3CK0H 5GGSB 5GGRY 2VN4A 3VXME 4QHMA 1MJUH 3QCTH 1WAAF 2WBJC 3IETA 4UTAL 1DJSA 3G6JA 2JE8A 4YBQC 2APWA 4MNQD 1Y6NR 5IMOB 3O3DA 2IH3A 2YC1B 5KVDL 4XPTH 3UZVB 5E94A 4GS7B 1ZT7B 3FB6B 5JOPD 1U8JA 1SMAA 5L9DL 1KIUA 3V5HB 5C08E 2HVJB 2BSRB 1DL7H 3ZMRA 4DQOH 4I18B 1ZS8A 3MJ9A 5TH2B 5H35A 1MWAH 2JELL 3RIFF 1KEML 2V7NA 4R7DA 2E3VA 1FIEA 5HJ3B 5C7XH 1FO0B 4WFHD 4NM8H 4HXBH 2ESVD 1YC8A 3LV3A 2Q86B 1CDJA 5I1HH 1IL1A 1U58A 2A1WH 2JCCF 4NCDA 2VSCA 5C3TA 5GGTH 4F7PB 3NFSH 3S3SA 4PRIB 4J3UA 3R0NA 3LS5L 4NNPH 4PP2A 3QXVA 1A9BA 2F54B 1IAMA 1CLOH 5IW3A 3PG2A 2B39A 3DX7B 4CU8A 1R3LB 2AJVH 3WCYA 5DZNA 2V2WB 1FV1B 4OZIB 5EU5B 4I8DA 3ZKND 3LB6C 3FN3A 5DRZB 4MNQE 4PJGE 3JWOL 2DDQH 4DGVL 4M43H 4L3CA 5KN5A 3O3AA 4NKIL 3FQWA 5JOPE 4TN9A 4E9LA 5ANMA 1U95A 2ZWLT 1F6LL 1BWMA 2FX9L 3ULVC 2APTA 3WKMH 2GSGB 3FFCB 1B90A 2MOVA 1FSKB 1IFHL 2Y25A 1DSFL 1HILA 4U1SB 5KSAC 2J8OA 1D6VH 1X7QA 4FZEH 3LKRB 2PXYB 3W9DA 1ZA6A 2DQGH 3KPLA 3G5XA 2ESVE 4L4TA 3OKMB 5FUOH 4QT5B 3PGCA 3L5IA 3QA3B 3NFNA 2Q8AL 4BH8A 3O2WH 1JBJA 2AGJL 1FZMB 2X4SB 4AL8L 4C56B 4N0UA 1ZT4A 3FO1B 5C0NC 5JA9A 2VUOA 1A5FL 4D0DA 2EIZA 1ZSDB 2CGRH 1EHXA 4JQXA 3UBXI 1EFXA 1GGCH 3E6HA 3QJHA 35C8H 5FGSA 4OLWH 1OP5K 2FB4H 4UZGA 4M8QA 5FA4B 2CUMA 1RUPH 4UILL 3IFPB 3AUVA 3RIAK 2GFBB 3AREC 2YKLH 5FM5M 3FHQA 4IDJL 2A2QT 3G5YB 3MREB 2I25N 4G6JL 4EBQH 2UY6A 1EO5A 5GSVB 5I1LB 4L8SC 5IGXH 1RPQA 2NY5C 3KPSB 5DTFA 5J57B 2VXTH 1MVUB 4PJFA 1DVFC 3PHQB 4WFGD 4DVBB 3PP4H 1EJOH 5M95B 2YD1A 1U8KA 1K2DA 4DUVA 3QXDA 2CLRB 1J88A 1JJUA 3T4AA 5KS9A 1RK0A 4U6HB 4JKMA 5BVPL 5KTEH 3WS3A 5DD6B 5E9DA 2IMMA 1JRHH 4RRPA 3KHOA 1IT9H 1N0XH 3F65A 3MNVA 1AP2A 3DI3B 3SE4A 4OI7A 3MLWH 4LSUH 1YPZE 3SN6N 1QVOB 3X12A 1J8HA 1NCWH 1CFSA 5DO2C 3P0VL 1HHIB 2NXYC 3VXPA 2H9GA 1X5HA 3KDMB 2XKSA 2YK1H 3MLTB 5HYQB 4OZFB 1KT2A 3NN8B 4JANA 4LLVB 3QDAA 1RZJC 3B3IB 3VJ6B 2R4SH 2VL4A 5HGBA 4U6VL 3NIDE 1HKLH 5IB3A 3DPBA 2BVOB 4OZGB 1ZVYA 1XIWC 4ZUSB 1NLDL 3KLAB 5EPMB 2BHZA 5AWNH 2FJGA 2DQFA 1QACA 3V5DB 2J5LC 1UVQA 2C3VA 2VMFA 2E7HA 2BDNH 3GMMB 2FL5A 4G80A 4IHOA 4JM2C 2X7LB 3BD5A 5MEPB 4WFGE 2I26N 2FEEI 3TA3B 1P4LB 4FQHB 1NKOA 3CGTA 2H3NB 4JDTL 4XWOD 1PQZB 1QRNB 4NKMB 2VQ1B 3EOAA 4RGOH 2F5BL 4YO0B 4LRNH 4PY7B 1U8IA 1ZTXH 1FL5B 4HPOL 2AXFB 4I0PD 3DGGA 4K23L 4NO3B 2Z31B 5T33H 4IRJD 3HZKA 2NY4B 5LGHL 1IC5H 2XWJA 3STZB 4LCCA 1P5VA 3V8OA 3L3GA 2XACC 3DV4B 3CFCL 4PG9A 5HY9B 4WENB 4UTAH 5DK3A 3PE9A 4QRPB 5HHMB 4EXPX 2P49B 1D5ZB 1HHGA 1R5IA 5EA0H 4PRHA 4GXVH 4Z0XA 1L0XA 3BUYB 5C0GA 4WUKH 3VFUA 5HDQL 2AQ3A 3SJVE 5IT2L 4HX1B 4JPIA 5BS0D 4LU5L 3TO4B 4E5XA 5L9DH 2EECA 1SJEB 1VACA 1OY3B 5E6YA 3LRGA 1XGTA 1ITBB 5CZVH 2JELH 4GUPA 5I30H 2NLJA 4XNYL 4FQ1L 2IPKB 3BEWA 5GGUA 3RWGA 1ZLVK 3W0WA 4HEPG 1AC0A 4L1DA 4OKVA 4RFNC 4RFEA 1RZGB 4K7PY 4NQDA 4NQCB 2ITCA 3RRQA 1P84J 4YJZL 2X4TA 4PJ7B 4K71B 5K9QG 5DC0A 3GGWB 3QIUA 2XNAB 3ARPA 2R9HC 3VXOB 1GPOL 5ESQB 2NNAA 4QKXB 1T4KA 3VWKB 3LKSA 4KHXL 1TMCB 4W4NA 3LEYL 4R4BA 3IAPA 1UT9A 1A7NL 1PVHA 3C5JB 4U1NB 4ZTPL 4E41E 2VUYA 3NCYS 1TJGH 2J8UF 1OWWA 1RJZA 3BDYL 1ORSA 3FB8B 4G8IA 5GGTA 1AH1A 3DMMC 5MERA 2AJSL 5CGYD 1DANU 5E8DH 4CW1B 4F3FB 1IZJA 2I24N 2IG2L 4Z5RA 4Y4FC 2DF3A 4B41A 4ELKA 1EK3A 5D1XB 5FKPB 4P4KA 1MI5A 5FA3A 1HDMB 1XGPA 4KWUA 1CL7H 3D25B 4ODXB 4PJ5A 5DYOB 2FX9H 3FRUA 4DOHB 4WGWB 3GSVA 1DSFH 3VGEA 1QQDB 4I3GA 3PJSA 5B8CA 2W0FB 5BRZB 3IU3B 3EJYC 4GKZA 3KYNB 4BKLA 5DD1L 1F00I 3MRGB 3O6LL 1A0QH 3RIFK 1BX2A 1ES0B 3O9WC 1A6AA 2Q8AH 1MY7A 3MGOB 3HZMB 4OZHF 2AGJH 3EYQC 4CADA 3SDXF 4AL8H 3WS6C 3IKCB 2LE9A 5J13B 4P2OA 3B2UC 3IDJA 1A5FH 4YEEA 1TJIH 1JF1A 1YNLL 5D1QA 3HR5A 4P23B 4Z76B 4JZJC 4ZUUB 1FNGB 4Y19B 4Z77B 3N1MC 1JPGA 4IS6B 5F1IA 1KN2H 1S7WA 3OR6A 2GAZB 4HC1L 4WU5B 2FHBA 5KSAD 3KXFE 3LN9A 4UILH 2FH6A 3B9EA 3RVXC 5SX5H 4P0DA 1NEZG 5A2FA 1GGIH 3MUZ1 2VLJE 4Q6IA 3MZGB 1V7NL 2EXWD 5EOTA 3NTCL 5FDWA 1QFWL 1IGML 3MRIA 5M94B 1GZQA 1RUKL 3U46A 3QQ9D 5HVHC 3QNZB 5I66A 3RTQB 4H8WC 5DURD 1INQB 4DFIA 3ARQA 2AW2A 5CJ8A 5HYEA 5C0ND 2B20A 3VRLE 3O4LD 3V0VA 5IB1B 1LQSR 4POZC 1WEJL 3NIGF 3KYOA 3TV3L 2FECI 2LQRA 5GSRB 5HPMA 8FABB 4KTYA 1WIOA 4PUBL 3VFPA 4KVNH 3DETD 3BPLC 1ZLUH 5CBEB 2BP3A 4JFDD 4JFHD 4P49A 3QEQD 2Z35A 2JJSC 3ARED 2NCMA 1JVKA 5KW9L 1TQCC 5DRXB 3HC0B 4WDIA 3QUMH 3GSUA 1X5LA 4QOKE 2I5YH 4M1DH 2HJKB 1NCCH 2G9HB 2P24B 2YD3A 2JTDA 3ALXA 5DQJA 2H2SD 2OZ4L 4PJ8A 2OI9B 4NKOA 3OR7A 4NQED 1INDL 1REIA 5DLML 1CXIA 2JB5L 4XRCA 5CUSL 5GRZA 4NCC1 3QIBD 3CFKA 3D0VA 5ERWB 4OGYL 3EZ8A 4LFHD 2J12B 1T2JA 1I1FA 3GSQA 4L5FL 1KCVL 3MJ8A 5JTWA 3T8XB 4NQVA 1G7IB 4X6CE 2RFXB 3FN9A 1J0KA 5GS2H 4C83A 1UM6L 3LIZL 4JEGB 5DO2D 1BEYH 3LMJL 4WRLA 3PV6B 2WW8A 4YXLH 3WYRA 1YMHB 3MMEA 3T2PA 3TN0B 5F3BA 3HRZA 4LHQB 2OJEA 2G60L 1BZ9B 4B5EA 4JFHE 4JFDE 1NGYA 4APQD 1NC4D 3GBNL 3DYOA 2X4NB 2M8XA 3CFCH 3L95A 5F1KC 1NLBH 2XG5A 2B2XL 5B3JE 1WBXA 4DZBA 2D0FA 2ZSWB 4JM2D 4MLIA 4KDWA 4ONFL 4GKNB 3ARBD 1EPFA 5IT2H 4DZ8B 2LVCA 4R4FH 2FZ3A 4LU5H 4JZOB 5C0CE 4NQEE 1YEFL 2ZOKA 5MI0B 2CKBB 1YJDH 2BOCA 2PETA 2P8MB 5HGDB 3QH3B 1XF5A 3OSKA 2H32B 4FQ1H 2OXHA 4KJPD 3DGCR 4IJ3C 4GXUN 4KQ4H 2V7HA 1S7VB 3IYLW 4KROD 4QRRA 4XC1H 1KENL 1LO2L 3WNKA 5TDNA 1TZIA 3CZFA 4G42B 4Q9QL 5I15H 3TZVA 1H15B 4HH8A 5EH1A 1S7TB 4Z7VE 1GPOH 1AQKL 1MH5B 1P7KB 1J0YA 1WWCA 3GZKA 4L3EA 4ORGB 2R8SH 4F7TB 5MEQA 1X5JA 4Z7UE 3BZDA 1MCWM 3BJLA 1A64A 1A7NH 4PRPD 3HE6A 3OKNB 4R2GC 4UMGA 3C6SA 5GJSL 3VXQB 5A1AA 3P30L 3VWJA 2A74A 5FCSH 1WWWX 1IILE 1MCEA 1G7JA 3SDAD 2AJSH 1KPVA 3BW9B 5TE6H 1QD0A 4QF1B 4XBGB 4NRYA 1ZHNA 5EZJB 4KZDL 4KXZH 2QQLH 3O6FB 1JN6A 4O51B 1ZEAL 4Z7WB 1ORQA 1DUZA 1BZ7B 1AO7A 3WEXB 1WAAE 2E5EA 1QLFA 4NUJB 3OB0H 5EB9A 4YPGB 1CK0H 5EULV 2OCFD 1DANT 2FJHB 4G6AC 4LLDA 3G9AB 4OAWA 3MRFA 3ARGD 4P3CL 5K59E 2P5EB 1KJVB 1FNAA 3DMMD 2V2XA 1L7IL 1FVDA 5SWSA 5J7CC 5D1ZC 2YD6A 3B9KA 4H20L 3WFBL 1F4YL 5FXCH 4WVRA 2ICEA 4MA1C 4LRIA 4Y4FD 1MJ7L 3OQ3B 4BFIA 4PD4K 3MA7B 1ZT1A 5SWZD 2GT9B 1FBIH 2JCCE 4OM1H 2R2BB 3GBML 4UNTA 5HHOA 1VB9A 4ZAKA 3S7GA 4QTHB 4HC1H 4PRPE 4LGRB 1M6OA 1OLZA 4ZUTB 2J1KA 2NQCA 3O8XA 4HKXB 3BPOC 2UUDK 4HFWA 4XWGL 3EJYD 4QRTB 4UV7L 5DUPH 1V7NH 5E99H 3GIVB 3CXHJ 3NTCH 1JZ3A 5IR1A 4S0TD 1QFWH 1IGMH 2YOCA 5J56B 5L8JB 4V1DD 2X4UA 1RUKH 4OV5B 3G04B 1U8MA 4OF7A 5T5NF 5AAMA 1F6AB 3EYQD 2CDGB 5CEXB 1X5YA 5K9OB 5EUOB 4YHIB 1YDPB 2YWYA 1I8KA 2ADFL 3TV3H 2ILLA 5E8NB 2J8HA 4RQQB 2HFGH 1KV3A 2EH8L 2BXYA 4G6FD 4JR9L 1Q9WB 5HTSA 4OFIA 5IROC 4GRWH 2BVUA 3BKYL 1CU4H 1JNLL 2DM2A 4YQXL 1P7HL 4Y16B 1C12A 3GB7A 5ACZB 1X44A 4O2FB 3RVXD 1BFOA 1MQ8A 1T0PB 2X1WL 1N5AA 4WW1B 5EU6A 5KW9H 3VA2C 3FL7A 2NY6C 4TVPL 4I0PB 5E08H 3IFOB 4JFXB 4H0IA 1U8NA 2Y5TA 5EZOH 3WIHL 1FFRA 4G7VL 4BYHA 1A7QL 3N1GC 4P5TC 2DLTA 3MACL 4ODHL 4QRUB 4M61A 2OZ4H 4JFFD 3WNMA 2VOTA 3DX8B 5DMJB 4FQXA 4POZD 1JUFA 2EDTA 3BSZL 2E6JA 4LASL 3QG6B 5DLMH 2AJ3A 3U36A 1PGRB 1MAJA 4RRPG 4ZOCA 5CUSH 4G9DA 3QUMA 4HGMA 3AFLA 3TIEA 2GCYB 3SGDI 2HJLA 5CAYB 4OGYH 4M3KB 1FYHB 1P69B 5BS0B 4L5FH 1KCVH 3MYJB 3W2DL 5JORB 1G9NC 3GSOA 4PRDB 3SDCA 4NT6B 1T5XB 4U33A 1L6ZA 3SOBH 2Z91B 3LMJH 4BK5A 1I1RA 3KYMB 1M71A 3Q6GL 5E2JA 1WT5C 3E6FB 4U6TA 4XCYA 3WE6A 3MRDB 4D8PB 2UWEE 2G60H 3QYCA 5D7IF 3D39A 2WBJB 5HDBF 3LKOB 1FFOA 3MRKB 5J3HD 4YFLF 5I1CL 3RPIA 1NBYB 2AJYL 2BVYA 3GBNH 5L8LB 2N7AA 1JHTA 5K9KB 2BNRD 3LD8C 4HIJA 3H9SA 4EQ3A 3O3EA 4NGHH 1JYNA 3IDYC 1V7MH 3H9HB 3UBXB 3VXNB 5ITFA 1AR1C 1OWRM 1IEBA 2HFEA 4N1EA 4PJEB 3HG1A 2DM4A 2R2HA 1YEFH 4O02L 1U3HC 3F7QA 5A43C 1ZV5A 1JCKA 3ARYA 3R0MA 2AI0L 1WBZB 3ARWA 3EO1B 3VXUE 4AM0A 3TBYB 2X4OA 5C3LD 1PDKA 4MAYC 3QULA 2AXGB 3LN5B 2VDQH 3BP7A 5H2BB 1KENH 2BSTA 3QDJA 3KPNA 3GKWH 4ZTOL 3L7FA 5FO9A 3MBEA 3IGAA 3ZKXC 4YHOL 5I8OH 2XWTA 5CIPB 1PY4A 5SWQA 4B0MM 5B3NA 1Y6KR 1ZXQA 1H5BA 2CH8A 1AQKH 1XCQA 2HTLD 5D5MF 4PJAB 1IGJB 1P6FA 3L3JA 4LARH 3MPCA 5CEZL 2P43B 3QG7H 3DUSB 1BREA 3GMPB 5D6DC 1JYWA 3K81A 3VW3L 3M17B 2NX5A 4MZ3A 3U7WL 1CFTA 1YMMA 3P30H 5CJOH 1D6EB 5F6HJ 3RUGF 2EDNA 5EFIA 5F8QC 5JMOC 2FX8L 2FEDC 2BNRE 4P5KA 2DYPB 1FH5L 1RJLB 3KYKL 2K3TA 3KPRE 3MLUL 1RHHA 4FFYL 4TVPE 1CGYA 3JBG7 4WUUD 5ACLA 4NZTL 3X14B 3BT2H 3UJJH 2WIIB 4W81A 5HYFA 1MHHA 1RFDL 3W11D 1KLUB 4R96A 5TF0A 5KZCB 2DWDA 1TENA 3IJSB 4HV8A 1CDUA 3RZCA 5JHDA 1CIUA 3NH7L 2W07A 3VCLB 4NBZB 2VXQL 5F7DA 1D5XA 1EFQA 3U6RA 1GSMA 3O4LB 4U1JB 1TIUA 4RFOH 1Q9OB 3MTRA 4MNGA 5IOPA 1UJ3C 3EYFA 1NMBH 2EDQA 1HQ4B 1T04A 3RA7L 4PV9A 1U8HB 2GKIA 4QHNA 1JNNH 3V4PL 3RL1B 1C8PA 4RX4D 5B4MC 4GQPH 3K2UH 2ADIB 1MLCA 2CXKA 1UB6B 3GBMH 2HVKA 2UZIH 5CLTA 2Z8RA 3HMWL 3FT2A 3FTGB 1PKQE 4M03A 4L8SB 5JDSB 1QOKA 2ARJB 4HUKB 3ZTNL 1ZHLA 4JFYB 4XWGH 1I1AA 3D3VE 5IB2A 1RAMA 2Z93B 4UV7H 1DVFB 1H3GA 1NSNL 2QR0B 3F7VB 3BE1L 3GSWB 4LDLB 4WUUE 5D1ZD 2R0KH 3HE7C 4BZ1H 1NFDB 2F19L 1G7QA 4U1LA 3QRGL 4GBXC 3ROOB 3EO0B 4EIGB 4WTZG 3RWDA 1NDGA 2BVQA 4JY5H 5GRUL 3SKNB 2DMBA 3EO9L 4JR9H 1UM4H 3TCLA 3QIWD 3EDKA 2NXYB 1XCTA 2I9TA 1U2CA 4TVPH 2DQIL 1S9VB 5JIHA 2W9DL 3JWDL 2V5RA 4G7VH 3DX6A 5F7EL 4XPAL 4WU7B 4AIXA 1FVCB 4M7JL 1GGBL 1MRCH 4MB3A 5CEZE 1SYSA 5DDHA 4ACPA 2JJWA 5D7KD 2C3HA 4HDIB 1XIWB 4OZHE 1OL0A 2BFVL 3BSZH 3WMSA 3SDXE 4LASH 2J5LB 4F8QA 1N8ZA 2BX5A 3TPKA 4MQSB 4UIMA 5GS3A 5C92A 1JPST 3M1BB 4JM2B 1AGDB 4M48L 1MFBL 3T0EC 3UTPD 2EIBA 3D6GA 4PJIB 3C2AL 2MPAH 2KH2B 1ETZB 4ALAL 2Q87A 4JO4L 3QUZA 1N4XL 2NY6D 4ODBD 3VD7A 2VJXA 4CN1A 2O5YL 2OL3L 3GMLB 4KJYB 3C5SA 4P5TD 5F7HA 3VXTB 3D0LA 3OXRA 1IGIL 1NGPL 4TRPH 4ERSL 2GTWB 1HI6B 4OFYD 3RVVD 1UQSB 2BCKB 3E0GA 1LO3L 2HRPH 1SJHB 3IRZA 5I1CH 3P4LA 3NIGE 4TUKL 3ULUC 5TQ0L 1I3RA 1KB9K 3ARDD 2ICWB 4Z0BH 3R1GL 2VDOL 3T1FA 4I5BB 5CWSB 5DWUH 2BNQA 5DD0L 3ZT7A 4OZFH 1QSFD 3WFEL 1PSKL 4PJHF 5EIQA 5CD5C 2AI0H 4J4PA 2HYMA 4RFNB 5BMFL 2EIEA 3KAAA 3MRQA 3HNSL 5B22A 3UTPE 1JTOA 1KG0A 4L8DB 4I4WA 5E5MB 3GRWL 4KGJA 1FJ1B 4R97C 4UNVA 5LQBL 5DRWB 3VFRB 3OAYK 4HIIA 2IBBA 2IAMC 2EE9A 4NPYB 5CEZH 2GK0A 3D2UD 4HIEA 1KJ2L 1H3PL 1JWUB 3JTSB 5EBMB 5KAQF 1LK2A 3SY0A 1BD2A 2EDWA 4DOHE 5IEKA 3U7YH 1ED3A 3U7WH 1P1ZB 3BZFA 4RAUA 1FC2D 4Y4FB 4ZPVB 4U1KA 4N9GB 1MJ8L 2YD8A 2C4FU 1GHFL 3FAWA 5SWZB 1FH5H 4JQXC 3KYKH 3WNNA 4N0YL 3OG4B 4NZTH 3UTTA 4MA3A 4YFLI 4ZFZA 3LKNA 1HSAB 5C6WH 2HLFC 5DQ9A 5H37H 1RFDH 3PP3K 3IAQA 1MFEH 1QSED 5JR1H 1QSFE 4K2UL 4WI7A 3WJLC 2R29L 1T1ZA 5IUSA 3O9WB 1FORH 3H8NA 5GGSA 1K6QL 2HA1A 2VXQH 4CBPA 3GMNB 3OJVC 3ZTJH 4PV8B 2NTFA 2PYEA 4JZJB 5IMOA 2VDRL 2YC1A 1U91A 3RA7H 4G6FB 1ZT7A 3FB6A 5EIIA 1P53A 2PUQT 4WWKC 5FM5O 1DUYB 4ZO8A 3V5HA 1R3HB 4KVCL 3WIFB 2HVJA 4X9IA 2DQJH 2BSRA 4PJBF 4EVNA 4UV4L 4I18A 2B1HL 5TH2A 3WHXB 3LZFH 4RMRA 5SX4I 3WDHA 5HJ3A 2IBGA 4S11A 4P2QB 3VDCA 1HQRB 1B6UA 1FO0A 5C0RL 3ZTNH 5T1MB 1P4BL 4Z6AT 4U3HA 4NO0B 5HVHB 4WCYL 2Q86A 5CJBA 1QZ1A 4XP6L 1NSNH 1S9WB 4M6OL 1KIPB 1H8OA 1J87A 4F7PA 5JW4R 4JFFB 1SM3H 4PRIA 1E27B 1INEL 4OF8A 3PF2A 4N0CD 4WHYH 2F54A 1UZ8B 3BD3A 3QRGH 3WHE0 3BPLB 5LWYL 4LK4A 5B4MD 2XN9E 2RQ8A 4UUJA 5GRUH 4YGVB 5F7LB 1TQCB 1U9KA 3S5LB 2HT4C 5L2KD 2YD9A 2V2WA 4UT9L 1FV1A 4OZIA 3VGAC 1T0NB 4LNVA 1DQML 5DRZA 2EDLA 4FQLL 1FGNL 3RWCB 2AABL 4PGZA 2EIDA 3EYVB 2W9DH 3JWDH 3MV8B 5C8JB 4M7ZC 4M7JH 2CRMA 5FAAA 2GSGA 3FFCA 4U1SA 3BYYA 1OAZL 2AJXH 1VGKB 5JO5B 5J11C 4NO2B 3LKRA 5HVFB 5J9PB 2PXYA 4JFZL 3OKMA 2WWMC 4QT5A 4MQXC 3OJMB 4UT7L 2GSIA 3QA3A 5I8EA 1MFBH 3FMGH 2F8OA 3T65B 2X4SA 4K07A 4EZMA 4ODVL 4C56A 3C2AH 1QYGH 3FO1A 2DM3A 3ABZA 5GJTL 4OLZL 1N4XH 1ZSDA 5EN2A 4QRSB 1ZGLB 4EKXA 1DN0B 5D72L 2OL3H 2WQRA 1FVEB 3T77A 4DTGH 1UM5H 2NZIA 1Q0XH 4X7FC 5BCAA 1BQLH 4NZJA 1IGIH 1NGPH 4HCRL 5FA4A 3IFPA 5C70A 1NMCC 5L2KE 1X5IA 1LMKA 1JMZA 3G5YA 3MREA 1MCKA 3BRFA 3DTXB 3QIUC 4AIOA 5GSVA 5I1LA 4TUKH 3DUUB 3KPSA 2KL6A 3EYOB 1MVUA 2HKFL 1VA9A 2GK2A 1DQQB 3PHQA 2G75B 3R1GH 3DSFL 4KJWC 4X4XB 4Y4KD 4HGKC 2NPLX 4DVBA 4GO6B 2GYSA 3MCLL 2CMRH 4PGCB 4FABH 3VFVB 5T3XH 1MPAL 2HTKC 4NOFA 5DD0H 2EYSB 4JVUA 3WFDL 2QQNL 2ZNWA 2CLRA 5EU4B 4JRXD 1DBKL 3P9MA 4U6HA 4IJ3B 1IAII 3WFEH 1PSKH 5DD6A 5EORL 1Q1JL 4AYFA 2R1WA 2BC4B 3HNSH 5TF1L 2H2PD 3IFLL 2J8UB 5C07E 2JIXA 5IB5B 3TNNB 3GRWH 1QVOA 4KC3B 4DGYL 3MR9B 3QWOB 4Q9RL 1SJVA 3KDMA 3MLTA 4OZFA 1GGTA 1U6AL 3NN8A 4LLVA 3V6OA 2YXMA 4R2GB 3EJZC 3B3IA 5F9OL 2ZUSA 4BSJA 3E3QE 2WM0A 5C86A 1S9YB 1H3PH 3T2OA 4LCYB 4X8JB 3V6FA 2BVOA 2JJUA 4ZUSA 1VADB 3HUJF 3QI9C 5EPMA 4HLZH 5CD5D 4AK1A 3V5DA 4NFCA 1MJ8H 4MCYB 5C71A 2R69L 1O7VA 3QPXH 5D1QC 4D94A 3QJFA 1YC7A 4BZ2L 3BGMA 2X7LA 5MEPA 4A6YB 2MMXA 1DEEA 3TA3A 1P4LA 2BJML 4FQHA 4N0YH 5FIEA 1DTUA 2VXSL 3CD4A 4UIKL 5HDBE 3LEVL 1ZHBA 1TPXC 2NXZC 2W0KA 3CXDL 4NKMA 2VQ1A 4YO0A 3QQ4B 4XTRD 2QSTA 2IAMD 2AXFA 4JRXE 4NO3A 1A7PL 2Z31A 4QYOA 2ENSA 1OF2B 2BMKB 2R29H 4H5SB 4LVEA 1QLRB 1UB5B 1Z9OA 3STZA 3PWVB 1H9VA 2C4FT 3BIKB 2CKBH 3QHZL 3U0TB 3ZDZF 2HG5B 2NY0C 5C09D 5EU3B 1K6QH 1T1WB 2CK0L 3DV4A 4XP9L 4MA1B 1WZMA 5HY9A 2O61B 2H32H 5J6GA 1DP0A 1KELH 2QHRL 4QRPA 4WV1C 2YUZA 4Q9CA 1D5ZA 3B9DA 3QDMB 3TP4A 5FOBA 1FAIH 2VDRH 1NANI 1DBMH 3BUYA 4GAGL 5ACMA 1J05B 4HX1A 6CGTA 1WIUA 3TO4A 1SJEA 5EUOE 4KVCH 1F58L 4OCWL 3QEGL 4UV4H 2B1HH 3BPOB 4AQOA 5L6YL 3BEVB 1E4KC 3TEUA 3BQUD 2VZ3A 1OAYL 1BVZA 4TTDC 4P3DB 1J10A 2IPKA 5DS8B 1OM3L 2X40A 5C0RH 3EHBC 4UBDD 4ODTH 3VFMA 2GY5A 4WCYH 3LS4H 5D5ME 3MC0A 1NPUA 4QLRA 1KJMB 1RZGA 4HBCH 4NQCA 3FKUS 4M6OH 4PJ7A 4JRYE 4DGIL 2VERN 4X0KB 3GGWA 3RP1A 2UYLB 3WNLA 1INEH 2A73B 3RY6A 2XNAA 5ESQA 4IOSD 1A3LL 3VWKA 4UDUB 4LKCB 4U1HB 1XF1A 4WWKD 3ULSB 1XGYH 3S88H 2JJTC 4WW2F 3K46A 4U1NA 3AB0C 4P9HH 5C09E 1ZE3C 5JLZB 3FB8A 3IDGB 2H8PB 3RVWC 4D0CB 2VE6B 2A0LC 2NY6B 4ZS6C 2VLKD 4F3FA 5TGBA 1DQMH 1JGLL 4X8XA 4P5TB 4FQLH 4HHAB 2AABH 1Z3GL 2YA0A 3I50L 3VD9A 1U8OB 5D1XA 4Y89A 5FKPA 3MROB 3CDFA 1DR9A 3BYTA 1HDMA 1PEWA 2X4PB 4EQ2A 5DYOA 4KRPD 4IMKC 1UEYA 4PLKD 1N2RA 3NFPB 1OAZH 1QQDA 2W0FA 5BRZA 4R6UA 3IU3A 5C2UB 1H8SA 4JFZH 4YHPB 5DHYB 2Y6SC 4HJGB 3KYNA 1HKFA 4RAHA 5IVZB 2HT4D 3BH8B 3FT4B 4HUNB 3HZMA 5IJVB 4JPWL 4JB9L 2FD6L 5AG8A 1K4CB 4ODVH 4AENB 3IKCA 4D0BA 2APBA 2DWEA 2R0ZL 5CP3H 2OP4L 3MLSH 3QDGB 4UOW1 4M6NL 5GJTH 4OLZH 1WISA 4P23A 4Z76A 1FNGA 4Y19A 5CILL 4IS6A 2GAZA 2F58L 5CZXD 5HHVL 3B6SB 1TVDA 1NAMA 3LKPB 3TVMA 1LD9B 1IC4H 4OCXH 4WY7L 2XKUA 4IBLT 3LD8B 2FJFB 3F7PC 4L4VE 4U3CA 2VLKE 4Y0GA 3G5ZB 2YRLA 3IDYB 1B2WH 3FRPA 2IMNA 4MQXD 4XC3H 3OGOE 4G8GB 3PDGA 3QNZA 3RTQA 1INQA 3D2UB 1Q9LB 1A6WH 4D9LL 4OBSA 1IKNA 4B7LA 5GS0H 5F9WC 3A6BH 1U3HB 3MCLH 1NBQA 2W0PA 1PBYA 4L3AA 2XFXB 1MPAH 1YNTB 1RZJL 3SCMD 3WFDH 2QQNH 8FABA 1BJ1H 1J0IA 5TDPA 4MAYB 4R9HA 4ZQKB 1MCDA 2AEQH 3SQOH 5CBEA 3ILPB 2WBKA 3PUCA 4OM0L 1Q1JH 5FM4A 1PZUB 2X70B 3F5WB 5TF1H 5CKAA 3IFLH 3ZKXB 5DRXA 3HC0A 2FNBA 2WUCL 4DAGL 1QSEB 4H88H 4KKCC 1TETH 2W9EL 4Q9RH 1MCHA 2HJKA 2G9HA 1L0QA 1NEZB 3RX7A 4KJWD 1KULA 1U6AH 3H9ZA 5FGCB 4LMQI 3P0YL 4XVTL 2HTKD 5DR5L 3CVHB 3N1PC 3ROLB 4HD9A 3SGKC 3LEXA 3B9KC 4RMUA 2NZ9C 3QNXB 4LSQL 4NHCH 4UU9B 4LRIC 4PGDB 5ERWA 5HI5C 1NFKA 3SPVB 4CRPA 3T8XA 4EOWL 3FCTB 3EFFB 5D7SL 3M45A 5CZVL 1RURL 4ZAKC 3LEVH 3PV6A 4MA8L 4X7SL 3GM0A 1YMHA 5DHVB 1K8DB 4QEGA 1A7PH 3H7LA 4YH6A 1EMTL 3AGVA 1C7TA 1BZ9A 4P57B 4JDZA 5DJ2B 2I27N 4GSDL 4M1CD 3MRMB 2RGSA 3QHZH 1RIUL 2C1OB 1UJ3B 1TNMA 1WZKA 2X4NA 2CK0H 3X17A 5IQ9B 1WFTA 2FO4B 4UOJA 2QHRH 3BN3B 5KSBB 5E8PA 4PJHE 4UINL 4F9PC 1VFMA 4W6XB 3VXSE 3RDTC 4GKNA 3BHBB 5J1SC 4DZ8A 4JZOA 3VFNB 1OTSC 5CIPH 1S7XB 2B4CC 2CKBA 5TFSH 1F58H 3PWNB 5HGDA 5IG7B 3QH3A 2Z4QB 1OAYH 3X11B 2H32A 4HXAL 3G9VA 4HK3N 3T1WA 1OM3H 1JFQH 4K9EC 3NABL 1LP9F 3QUXD 1NCUA 4JQVC 4OIAA 1YEJL 2NY0D 2P7TB 4FXGB 3HE7B 3OG6B 4JY4B 1L4IA 2F53B 4G42A 4DGIH 2H26A 3IJYB 4GBXB 4FQXC 3FQTB 1A8JH 1S7TA 4DEPC 1P7KA 1JZ6A 1A3LH 3ULVH 2OM5A 3U2SA 4ORGA 4OIIL 4PGJA 4UQ2B 1KGCE 4AEHH 3VD3A 1RUAL 3VXQA 1HHKA 5EOCL 4N5EC 3RI5F 1QSZA 1EERB 4TTDD 5LCVL 4MJ5B 2FX7H 2Q3ZA 1F8TH 3BW9A 5F89B 4YHKL 1OD9A 3C5ZC 4QF1A 4XBGA 4RZCB 1Z3GH 5FO8B 1G6VK 1WF5A 3CSBA 3I50H 5EZJA 1FE8L 1KXQE 5IBTL 1BFTA 3O6FA 3V0WL 2NR6D 4O51A 5D9SB 1QNZL 4ZFOA 1BZ7A 4U7KA 3WEXA 4PR5B 4NUJA 3GSNL 1GOFA 1VEPA 4YPGA 2I60L 4K94C 3N06B 1P7QD 1A7BA 1AQDB 4MNHB 5D6CB 3T0EB 4M7LH 2FJHA 4HK3J 1A1OB 3FZUC 5DJ8B 1RU9L 5D2LB 5D7IB 2DMKA 2P5EA 1KJVA 1ZS8B 5H35B 2A0LD 4PJBE 1MQKL 4JB9H 5JW4Q 2XA8L 1VKXB 5L7XL 4TNVK 2HKHL 3AAZB 5T3ZL 1E0OB 3MA7A 5JIKA 3G6AA 2GT9A 1IL1B 3HZYA 5CILH 3WFCH 4K8RD 1EUTA 1OGAD 2R2BA 3LRSB 5HHVH 5C0BB 3BH9B 4ZUTA 3OB8A 4WY7H 4HKXA 4M4RA 2X9WA 5FF6B 2Y6SD 5CKGA 4ENEC 3T3PF 5CP3A 3GIVA 3O6ML 1JI1A 1H5BC 2YHGA 4OV5A 1ZLVH 3G04A 2PYFB 1F6AA 1EGJL 4OCRH 1OVZA 4D9LH 3MODL 1NBVH 3SKMB 4B53A 2AEIT 1YDPA 1U42A 1CQYA 4U1MB 5FHAH 4KJQD 4HWBL 2B5IC 3TIDB 2UY7A 1BQUA 1RZJH 4Y2OA 2NY3C 4HF5L 3HS0B 4RQQA 4TNWK 1A4JB 4G7YL 5F88B 1MFDH 3MV7E 1Q9WA 2YWZA 1CICD 3MXWL 3FQWB 4M5ZL 1DDHB 5I71C 3OGCB 5ACZA 4OM0H 4R97B 7CGTA 4NN6B 1CG9B 4O2FA 4WW1A 2WANA 3S98A 2QSVA 2ORBL 3RUGB 1X4ZA 5L88H 2IAMB 4I0PA 4M9PA 4DAGH 3IFOA 4JFXA 3W9DB 1ZA6B 3KPLB 1K3ZA 4AZ8A 3G5XB 1YYML 4L4TB 3O2DH 5DD3L 3B8YA 2XZCL 3U1SH 2PF6A 4HWNA 4NSKA 4BH8B 3RZCC 4QRUA 5TE7L 1F11B 1OGAE 3CDGB 5HI3C 5ICYB 3DX8A 4XVTH 1BJ1J 3QG6A 4LMQE 2KDGA 5DR5H 2ZJSH 1LO0L 2EIZB 2QSCL 1ND0A 2A6DB 1EFXB 1I9EA 4I2XB 4JFED 2EC8A 1MIEL 3QJHB 1ZGLP 3WO4C 2R4RL 3RPKA 5BS0A 5JORA 3OL2A 3G6JF 5D7SH 4PRDA 1T3FB 1KJ3H 5E1HB 3VD5A 1T5XA 5IB4A 5BOZG 1DE4B 2R2CA 1N0LA 4OQ1A 2BSED 2Z91A 1G9ML 4X7SH 4MA8H 3T04D 5FO7B 2XZQL 3D1MC 4HFUL 3PIQB 3E6FA 4YX2L 1HH9B 3MRDA 5I19L 1EMTH 1T2XA 1RZ7L 2WBJA 1J0JA 3LKOA 3C60C 4NO5B 4NZUL 4FQIH 1K2DB 2ZCKL 1NBYA 1CDYA 4EDWH 3QXDB 5K9KA 4DKAA 5KS9B 1JWSB 1RK0B 1BLNB 3H9HA 4WWKB 4RSVA 3UBXA 3PWLB 1WVZA 3WS3B 4UINH 3VXNA 1CT8B 5T3ZE 4N8PA 3MV9D 1AP2B 1WICA 5E2UL 1ITCA 4GQ9L 4PJEA 4HKZB 4JN1H 2VZOA 1GOHA 4FXLA 2HH0L 3I6LD 2GHWB 15C8L 1X4XA 2W60B 5DEFA 1R3IL 3PL6C 1K3IA 2H9GB 1WBZA 4Y2DD 5J6HB 4JFEE 3TBYA 1KT2B 3NABH 4J1UB 2AXGA 2XTJC 5C0IB 4NFDA 1YEJH 4N8VG 2CJUH 5HGBB 2G5BB 3PQYB 1MREL 2R56L 5AD0B 3MO1B 4IRSC 5AUMB 3CFBA 1D9KD 3ARFC 5IF0B 4M62L 4BH7A 4PJAA 1IGJA 4TSAL 2C3VB 4KU1A 3G6DL 2MHAA 3DUSA 3GMPA 4QHUA 5L2JA 4OIIH 2V9RA 3M17A 3QO0A 4OCYH 4RA3A 3LQZA 3U0PB 3VGAB 5KVEH 5EOCH 1D6EA 2MQ3A 3EOAB 3ZDXF 3MOBH 3OKLB 2EDHA 3IS1X 3FOLB 5LCVH 5HYIA 3CU1A 4S10A 2HT3C 1RJLA 3DGGB 3NIFE 4ZSOE 4YHKH 4HT1L 5BVJB 4X83A 3OAZK 1S8DB 2VWEC 4M7ZB 1OP9A 3CSPA 1SQ2N 3X14A 1FE8H 3MV9E 5IBTH 4O2EA 5KSAA 2WIIA 2DBLH 3EOTH 1NMAL 3CSGA 4ZOEA 3ZDZE 4XNXH 5J11B 1D5IL 2MKLC 1QNZH 1OAUL 1Z9SA 3AM8C 4J3VA 3I6LE 2XQYK 1MNUH 1OW0C 1AY1H 1L0YA 1KLUA 25C8L 4JY6B 4JM4L 3IJSA 4PJCF 2OR8A 5JNYA 5JUEL 1FPTL 4MSWB 3UZEA 4GG6E 4E42A 4YDVA 1BHGA 2C7UB 3VCLA 4XBEL 3ARUA 3SGJC 3FB7B 4MJ6B 3GM8A 4CN4A 4JPIB 1FZKB 1RU9H 4AIZB 2DQCL 4WI9A 3O4LA 4WHYG 1F3DH 1Q9OA 5C0FB 4NNYB 1T03L 4GUPB 4H8WH 5CBAA 2NLJB 4QGTA 5IMMB 1A2YB 4TSBL 2GJ6D 5L7XH 1U8HA 1EAPB 2HKHH 3BEWB 3T08A 4PJFF 5T3ZH 1UC6A 3RL1A 2AERT 3W0WB 2BOBB 4PJDB 4RIRB 4OKVB 4JFDA 4RFEB 3HHRB 3QEQA 3AREA 4CUCA 1NMCB 1UB6A 4W4OA 3H2WA 3WO3B 1DLFL 2EDJA 2VAJA 3QIUB 5E2VH 4U6YB 5IFAL 4L8SA 5JDSA 2DTSA 2ARJA 2VLLB 1W0VA 1J5OL 1R24B 4JFYA 4F7CA 4W68A 3FZUD 2CIKB 1DVFA 1T6VN 4Y4HC 3F7VA 4Q2ZB 1T7XA 3GSWA 4WJ5A 5IMLB 2GTZB 4PJ9D 1S7UB 3SDDC 3JSSA 1EGJH 1CLZH 1RJZB 4HPYH 4WEUD 1FDLH 3MODH 2V9TA 4HS3A 1NFDA 1IM9D 4F33B 4HWBH 3G5VB 3N0PB 4N68A 1W0YT 3VFOB 3EO0A 2R1YB 2YZ8A 1I1YB 2X6MA 4MZ2A 3SKNA 3BGAA 1BVLB 4G7YH 1BOGB 3AY4A 4PJ5B 4MD0B 3FRPG 3SKJL 3UTSE 4WI2A 3V7MA 4XBPB 3ZKMD 2ORBH 5I1EL 1H3UA 4AEIH 2YRZA 3QFJE 3RWHB 2UZXB 2UV3A 5DD3H 2XZCH 5FYJL 1AKJB 5TE7H 1T21B 4MJIE 1XIWA 3QI9B 5F44A 1G7LB 3TESA 1N64L 1EXUB 3I6KB 1LO0H 3K4DA 4YHZL 3PWPD 5D1QB 3MRBB 3NCYP 2QSCH 5JHLL 4JM2A 3M1BA 1AGDA 5CJ5A 2Z8SA 1S7WB 1MIEH 1JGDB 3FN0L 1DLHB 3ARBA 1I75A 3KG5A 3EYUL 4PJIA 2ZOLB 4RISH 2R4RH 3O2DA 1TPXB 5IVXB 2NXZB 5LGJB 1ETZA 2ED9A 4MD5B 4Z7OF 2WMPA 4I1NB 4TUJA 4ZS7L 3DV6B 3GMLA 1KYOK 3DSNA 4KJYA 3VXTA 5MHSE 1BP3B 2XZQH 1AXTL 5JIPA 2NY0B 1BGXH 1GIGL 3NA4A 2GTWA 1UQSA 3MNWB 5D7LD 2BCKA 4U1GC 5FDYA 2AK4E 4WV1B 1SJHA 5DEZA 1Z0MA 4P46D 2UUDH 4YDLC 2ICWA 1E4JA 4Q58C 4P59L 1MFNA 3PGFL 5ID1A 5CWSA 5GRYA 2Z35B 3BN9C 2E9JA 5E2UH 4GQ9H 5FYJD 1Y6MR 1CE6A 4WDIB 1MRFH 2HH0H 5IQ7L 3GSUB 3QEUA 3MZTA 3UXFA 4UB0L 2X41A 1U41A 3LQAL 1E4XI 4ZUWB 5DQJB 3OR7B 5E5MA 1FJ1A 3TH2T 1MREH 2R56H 5DRWA 2VRAA 9CGTA 5KANI 2HP4A 3D0VB 5ISZD 4M62H 4A6YH 1YNKH 3BPCB 4S1RL 4NPYA 1I1FB 1NUGA 3AB0B 2OX5A 3MJ8B 1S9XB 1YEEL 3G6DH 4NQVB 5FUZL 1JWUA 4L9LC 3DMMA 1JZ5A 5D7LE 4EUPB 5JW4M 1J0ZA 1P1ZA 4Y4FA 4ZPVA 3PL6D 2HFFB 4N9GA 3MV01 5KVMC 2HMIC 4X6DB 3TJEL 2GIYA 5SWZA 3IXTB 4RMWA 5F3BB 3O81A 5LXGL 3QWRD 3P4NB 3L3HB 3NA9H 3VRJB 1QHOA 5TDOB 5INDB 3AU1B 2Q1EA 4Y1AD 1NMAH 5FYJE 3RHWF 3RJDA 5T5FL 4OLVL 1MCBA 1I3GL 4GRLC 1OAUH 3DHMA 3BZEA 4HZLA 1JZ4A 4HGWA 25C8H 3PHOB 3VI4F 2ID5A 3O9WA 4V1DA 4KK8C 2ZUVA 4L29B 4ZD3H 3T0VA 2VLRB 4NC2B 4XBEH 5EOCJ 3VMOA 1UZ6F 2BRRH 3WS6A 3ARVA 1P5UA 4PV8A 2DQCH 1A4KB 2COQA 1SMOA 1RZKC 2HT3D 1T03H 4JZJA 4OLXH 2O26U 3TWCH 2IH1B 4KRNA 1ZLSH 2IANE 1ZVHA 5ISZE 1LEGB 7FABL 3EYSH 3QUYC 5DGQA 1R3HA 1I7UB 3T3ME 5J4MA 1FCGA 3TM6A 4WI8A 5EU7E 4O5LH 3WHXA 3VE0A 1TZIB 1OHQA 4PGBB 2O93L 2YA2A 2BVTA 4P2QA 1HQRA 1QKZH 5E7BA 1J5OH 5T1MA 1JL8A 3N9GL 1AGEA 1M7DB 4CKVX 1NCTA 1RHFA 4ZFGL 1KIPA 5F9WB 1F3DJ 3BFOA 3V6OC 1P2CB 4ZNEE 4JFFA 1E27A 4IEFB 4FFZH 4Y1AE 5A40E 4XI5C 5C0DB 4HIHB 1NAKL 1FG2A 1J1PL 4XMPL 2QADC 1G7JB 1T2QL 5JOEA 2IFFL 1C16B 1UZ8A 4YWGL 3MLVL 1JMXA 3INUL 5K9JL 2JJSA 1JNHB 4PJXB 1BF8A 5JW3L 5JQ6L 3S5LA 3T0DA 3WFHB 1FRGL 3L5XH 1JZ7A 3UYOD 1F13A 3HFML 3RU8H 1MAML 3HUJB 2DRUA 3RWCA 4X80L 2EDBA 1X5XA 4KK9C 2DLIA 3MJ9L 4JO1L 4LLDB 3MV8A 5C8JA 3MRFB 1QHPA 2DIAA 2RR3A 5DD5H 2WLZA 4NZRH 5J1TC 3RVTC 3B9KB 1VGKA 5JO5A 3N1QC 4GFTB 2ICEB 3UAJD 4XP1L 4EIZC 3TYGL 3FO0L 3OJDB 1YEIL 4DCQB 1JGUL 2A9ML 1RMFL 4WEBH 1ZT1B 4LSVL 3QAZC 3FO2B 5HHQA 5JHLH 5CSGA 3T65A 4ZAKB 2DB8A 1G7MB 2DLGA 4LSSH 4JHAH 4CVXB 1YUHA 4QRSA 4HFWB 1ZGLA 4G3YL 1CXEA 4EJ1C 4ZS7H 1DN0A 3RKDD 1FVEA 3T3PE 5IR1B 2Q7YB 5TQ2L 4OCMC 2X4UB 1CD1A 3P9WB 3LY6A 1ZAGA 4FQJL 5FCUL 2KUTA 4P2RD 1CLCA 2KZWA 4FQ2L 2CDEA 3KNBA 4YHLL 4KTEL 1CFQA 3BMWA 5DJZB 3DTXA 5E70A 1LO4L 2UZYB 1UCBL 5GGQL 5B39G 3DUUA 3RDTB 2PN5A 2X89D 3EYOA 5IMKB 1H3VA 1DQQA 3CLFL 1FNEB 4UDTB 1Z5LB 3MFFB 4P59H 3PGFH 3GB7B 4PGCA 3VFVA 5I2IB 1BFOB 1QUNA 1N5AB 2EYSA 1F3RB 1JK8B 5FYKL 1F4HA 4PD4J 3T0XA 3BXNB 2D7PA 5DJ6B 1DBAH 5D2NE 2DIBA 2I07A 4LCWD 1CXLA 5EG6C 1IM3B 3C09C 3EDJA 2BC4A 1GC1C 2VDNH 4U1IB 3CVHH 2J8UA 2WIMA 5JPMB 4FQXB 5IB5A 3RX5A 3TNNA 1SYVB 1JHLL 3B9VA 1C5CL 3UBXG 1SBSL 4DEPB 3MR9A 4X98A 3ZHKA 2V17H 2R0WL 5E4IA 2ADGA 4DN3L 4RGNC 4S1RH 3NCJH 3BN9D 5FUZH 1S9YA 4X8JA 3G6JE 3GSOB 2GUOB 1YY9D 3B9AA 4WFFD 1VADA 3C5ZB 5IHUL 2GJ6B 3RWEA 4BM7A 4HWEL 4MCYA 3HKFA 4PB9L 3C08H 4RX4A 3E1F1 1HWHB 2OK0L 2AQ2A 5LXGH 4F37K 4A6YA 1P84K 2IBZY 4OZHA 3RQ3A 4LHUD 4ETYA 1WBYB 2WUBL 4O9HL 3TVMC 2WSKA 1YN6B 1UWXK 3QQ4A 5T5FH 3MRRA 1I3GH 4HIJB 4HUXB 4XCFH 1LEKB 2BMKA 4H5SA 1UB5A 3S96B 4B7IA 5ITFB 3PWVA 3BIKA 3U0TA 3AROA 2HG5A 5EU3A 5D1ZA 2HFEB 3O0RL 1OARL 1T1WA 3EBAA 3HG1B 2QJDA 5GXBB 4TUOB 2O61A 3VGBA 1E6JL 3D69B 5BXFA 1IM9B 5MEND 1BM3L 3QDMA 1U92B 2Q6WB 3BKCL 2FHFA 3TNMB 2HN7A 1BIHA 2ERJC 4HS8L 4JO2L 1J05A 4KUZL 3TO2B 3QDJB 2A6KA 2B0SL 3BEVA 3J7HA 3LPWA 4K3EL 2YBRA 3MJ7B 3V95A 1NGWB 2VABB 4WFFE 5SWQB 4P3DA 5B38B 1GZPB 5T1KB 3EOBB 4NDMB 3AXLB 1H5BB 1EBPA 3N9GH 5E6ZA 4EI5D 1CD0A 1N3NB 4YFDB 5ANME 4AQ1B 1KJMA 4ZFGH 3MRPB 2Z8VC 2AP2A 4HUWA 4YDJB 2B5IB 4X0KA 1UH3A 1VERA 2A73A 1YMMB 1HOCB 3MCG1 1QBMH 1UA6H 4NUGH 2NY3B 3ZDXE 5DQDH 2PTTB 1T2QH 3OAYH 3PWPB 5BV7C 4UDUA 4Y7MA 4LKCA 5IROA 5E9DD 5FYKE 4OD1L 3ULSA 1RHHB 4YWGH 5I71B 2IEPA 1W72B 1DBBL 4AMKL 4OCSL 4XP4L 5JLZA 4N0UE 3CC5B 5JW3H 1J8HD 3IDGA 2H8PA 5JQ6H 4D0CA 2VE6A 5FK9B 2CO7B 3DRTB 3HFMH 4R96B 4P5TA 2DWDB 4HHAA 3I02B 4X80H 5CSBA 3NGBC 1U8OA 3A0OA 5ADOL 3CK0L 1NCDH 3K7UA 3RZCB 3MRJB 3MROA 3OV6A 3MJ9H 3VDAA 2X4PA 4OFYA 4X9GA 3QCTL 3ELAT 5F7DB 1D5XB 3SE3C 1EO7A 1RIVL 1CDIA 2QADD 3NFPA 3IDMB 4LFHG 4R90L 5IOPB 5IFHL 2MTPA 1KC5H 3EYFB 2VH5H 2W1NA 4XP1H 1BOYA 4YHPA 3FO0H 5DHYA 5CFHA 1YEIH 4XXDB 3JV4B 4HJGA 3WO4B 1JGUH 4XNMA 2J2ZA 1RMFH 1A7RL 1IEAB 4PJFE 4LSVH 4LNRA 1V3JA 1J1OH 1Z9MA 4NM4L 3BH8A 1MLCB 1PFCA 3FT4A 4HJJH 3ULUH 3BWUC 5JMRA 1K4CA 4AENA 4XB8A 1OT2A 3QDGA 5KS9E 1CXKA 3UZQA 5I1GH 4ZDHB 5I1HL 5E9DE 5TE4H 5GGTL 4OV6F 2VZVA 3NFSL 2X09A 3B6SA 3C60B 4JG1L 3LKPA 1XGUA 1BF2A 3TBSB 4GW5B 5FCUH 1J8HE 4OB5L 4FQ2H 5D4QA 3ZHDA 3GSXB 4U1LB 1CWVA 2EDYA 5ICXB 3CFIC 1B3JA 5GGQH 2AJVL 1JRHI 4G8GA 3RWDB 3TGXA 3J8F7 3D2UA 1Q9LA 4MX7B 3CLFH 3ME0A 4U0RC 1U3HA 4LLQB 1KTRL 3TCLB 2PTVA 3DXAB 2XFXA 1LVEA 1Z9LA 3PL6B 3MJ6A 4ELMB 2DDQL 5FYKH 4LF3A 4M43L 3IXAB 4MAYA 4JO3L 4ZQKA 2A38A 2XTJB 2MCPL 3H7BB 3ILPA 4NQDD 3B5HA 3WKML 1S7RB 4NBXB 5GISH 1WUNT 2X70A 3F5WA 2RAMA 1I4FB 2P48B 4IRSB 5H94B 3ARFB 1HIMH 2AJZA 4LSDA 3WFZA 1QSEA 3P40A 1HSBA 2DQGL 1SBSH 1NUNB 1OD7A 5FUOL 4LOUC 4JDVB 4M93C 5D6DA 1F97A 4DN3H 3JWOC 3D85B 4JKLA 5JZ7C 1WZLA 2GI7A 2P5WB 1OQOA 1XH3A 4MQ7A 4KK5C 3CVHA 3ROLA 2YR3A 2CGRL 4A2MA 4Z7OE 1XEDA 4WI5A 1GGCL 3QNXA 3KJ4C 3U48A 4PRHE 4PGDA 3C5SB 3CFJA 35C8L 4P4KD 3F8UB 1VGEH 1XZ0B 1HYSD 2BERA 2FCBA 2L7UA 4L9DA 1KB5B 4PB9H 2FB4L 4TYUA 3TFKD 4X6CF 2OK0H 3FCTA 2APXA 3EFFA 5FUCE 2YKLL 3KS0H 2Y7QB 1TDQA 1DBJH 2EZ0C 4EBQL 5ELIA 3DVNB 4EN3C 4JJ5A 1I3RB 4X4MA 3X3FL 2A6IB 5DHVA 1K8DA 2VR5A 2VXTL 4E0RB 1J8KA 3WXVH 4P57A 1KPRB 2X42A 3CFDB 5DJ2A 4NQDE 1MOEA 3JV0A 2BNQB 3BPNC 2C1OA 4P2OD 1OARH 5IQ9A 4YPJA 3P4MB 4KMQA 1E6JH 2FO4A 3BISA 3QDHA 5KTEL 5KSBA 5I9QC 1BM3H 1JRHL 1IT9L 3BKCH 4U2ZA 5HDLA 4XH2B 4MDIA 5F6IC 4HS8H 3BHBA 4MD4A 3VXMD 1ONQB 4I4WB 4KUZH 1A1MB 1VFAB 3BESR 3PWNA 2VDML 4XWOC 2B0SH 3RJQB 1IAOB 2Z4QA 4XHJC 4BZYA 4JLRB 4K3EH 2YK1L 1IAIH 1RUML 4J8RB 1JYVA 4Y4HB 3FHAA 4IRJC 1MI5E 2ZSVA 3F6IA 3R06B 3SDDB 4KZEL 3RAJH 5IHZB 2R4SL 2EICA 4FXGA 4JZNA 4Q0XL 5GRXG 1HKLL 4C55A 4X4YB 4JY4A 2F53A 3AS2A 3IJYA 4GBXA 4Z7VF 4U1KB 2DD8L 5F7NC 4IRZL 2GITB 2BDNL 1F4WL 4OD1H 1RV6X 1CVSC 1YEHL 1FFPB 5DEGB 4GRWF 3OPZL 3EAKA 4AMKH 4XPBL 4RGOL 4LSRH 5T1LB 5EZLB 1G1CA 2ZKHL 5T33L 5F89A 1K5NB 2K7QA 3I3BA 1T1ZB 4RZCA 4W6YB 5FO8A 4OKDA 5ADOH 4PJ8D 1E4WL 3ESVF 3MV11 5C0AD 4F7EA 5D9SA 2DBJA 2DTML 3DVGB 1UZ6E 4JCLA 2WQ8A 4P2RB 4F57L 2OJZH 2NTFB 4PR5A 1EH9A 5DSCA 1RIVH 4WI4A 4R90H 4MXWH 1HXYB 5IFHH 2PYEB 4Y8DC 5EA0L 1AQDA 1U91B 4GXVL 4MNHA 5D6CA 4WUKL 3T0EA 4XAWL 3S5LG 1AI1L 5EIIB 1A1OA 2P4AB 4LP5A 4RWHA 5DJ8A 4O2CB 5K59F 1A7RH 5D2LA 4BSWA 5D7IA 5CHNB 4NM4H 4EVNB 3RGVC 1URLA 2BVPB 5I30L 1T1YB 3MA9L 3DLQR 2RB8A 4JRXA 1VKXA 5CGYC 1DN2A 3AAZA 4LCWB 3R8BB 1KUMA 1WCBB 1AE6H 3UCRA 3LRSA 4U1GB 4F58H 5C0BA 3BH9A 3U9PL 4JG1H 1EHNA 5F70A 4YK4C 3RWIB 3VXRB 4OB5H 5FF6A 4YDLB 2XT1B 5CGTA 4P9MH 1VHPA 2DICA 4WHCA 3OKEB 3WNPA 1CGTA 3MLYL 3WXWL 4UUJB 4I9WD 2VDPH 2PYFA 4HEME 1KTKE 1TJGL 5GZOD 5C0AE 2ZCHL 3SKMA 3RVUD 4HAFA 3BP4A 3FFDB 5E8DL 1M4KA 4U1MA 3CVIH 1JPTL 2H6PB 4Z9KB 3TIDA 1GJIA 2Y36H 3HS0A 1A4JA 5D5MA 2YN5A 5F88A 4JO3H 4XNUL 4QRRD 2VXVH 3MUGB 1DDHA 2MCPH 3TYFB 5ITBH 1CL7L 2XRAL 3OGCA 3VH8B 3QCUL 1CG9A 3O45A 3TZVD 2VQUA 3RUGA 1KCSL 3BX7C 2IAMA 1OP3K 2EDXA 2YMXL 4L3ED 1QR1B 2EXWC 4FQCL 1A0QL 2NTSP 1LE5B 2GSIB 4L9LB 3QQ9C 3IDNB 4HUUA 5I8EB 1F11A 3CDGA 3VWJD 5ICYA 2C5DC 2D2OA 2X05A 2FGWL 1TJIL 3F7YB 5MENB 3V7AE 3NMEA 5EN2B 4JKPL 2A6DA 4XT1C 1T1XB 4I2XA 4PJCB 1Y18A 2VR9A 1KN2L 2L0DA 1UYWH 4Y5YC 3T77B 1DQJB 2X9YA 2ZUYA 1OAQH 5HYJB 3DETC 4I9WE 4F2MB 4LCUB 2BY2A 5EUKA 2Z92B 4PIRF 2P46B 4GRLB 1T3FA 4W4OC 1AGFA 1GGIL 1WFUA 2QHLA 5JXEC 4LAJH 3WJLA 1DE4A 4YNYB 4LOUD 2O5XL 2CQVA 4K3DH 5FO7A 3X3FH 2EO9A 3CUPA 1EUUA 3IU4H 4OF5A 1J11A 4TOYL 3UPRB 3PIQA 2UWEF 1HH9A 5JZ7D 4J12A 4LEOA 4QRRE 4KQ3L 1VPOL 4AEFA 43C9B 2XY1A 2H2SC 4NO5A 2DL9A 1ACYH 4KK5D 1KSRA 3SO3C 2ADJB 2EKJA 1JWSA 5F6HI 3UTQB 3P9MB 4J3WA 1H8NA 3DJ9A 1BLNA 4L3EE 4KVNL 3QUYB 4WWKA 3QIBC 3PWLA 3UDWC 1CT8A 3KS0J 4NYLB 2A6JB 1E28B 3AC0A 5HHOD 1A6VH 3N85L 5EWIL 2R1WB 5FYLL 1EAJA 5CINH 3OKYA 1VFBB 4I0KA 2EZ0D 4HKZA 2JIXB 2MSPA 2FH8A 3AY4C 4OLEA 5J06A 4H26B 1A6UH 3QUML 4EN3D 4FTVD 2W60A 2VDMH 2I5YL 4M1DL 1NCCL 4NQTA 2VIRB 5J6HA 1RUMH 3K8MA 3BDBA 3SJVD 4ODUB 4J1UA 5C0IA 3ZT5A 4CMMB 4OZIF 4KZEH 1JE6A 1AO7E 2G5BA 4Q0XH 3PQYA 1EIBA 2QADB 3V6FB 4G9FD 4APQC 5AD0A 3MO1A 5AUMA 4J7RA 1OCWH 1H0DB 1D5MB 1HHHB 5IF0A 2DD8H 4IRZH 5LJYH 4KXZI 3QJFB 4K94L 5CD3B 3BGMB 1F4WH 1YEHH 4JHBA 3OPZH 1DEEB 1WITA 3ARBC 4I77L 5SWSE 3U0PA 5EU6D 2WWKT 1BEYL 1ZHBB 4XPBH 3PDOB 4XHJD 5EBWA 3OKLA 4EI6B 1DZBA 4YXLL 3FOLA 2GJZA 4FHBD 3SQBA 2ZKHH 1NH6A 5EZIH 4QYOB 5BVJA 1ZWIB 4KKAC 1S8DA 4KJPC 4Z7QE 1A6TB 1FQ9C 5I0ZA 5GGVL 5HHOE 4E41D 1E4WH 3TBWB 4KROC 1G7HB 1T7WA 1RIHL 4XMLH 2DTMH 4JKWA 1NLBL 3OAUH 5J6GB 4F57H 2APVA 2OR7A 3MLXL 1WFNA 4FTVE 4N8VB 4JY6A 3QAZB 1IKFL 5FOBB 4MSWA 3UYPA 2RHEA 3ZE2F 1QBBA 2C7UA 4ZYKA 4BA8A 4XAWH 1AI1H 2DI7A 3FB7A 4MJ6A 1FZKA 4R4FL 4DVRL 4XCEB 5DF0A 1XF2B 4AIZA 4KI1A 3SDCD 1YJDL 1B0RB 4FZ8H 5C0FA 4NNYA 1NGXB 4G9FE 3SCMA 5IMMA 1RD6A 3MA9H 3SDAC 1A2YA 3BO8B 1EAPA 1QFWI 4KQ4L 3VFMB 2BOBA 2XQBL 4PJDA 4RIRA 4XC1L 1H3WM 4F7MB 5A2JH 4X9BA 1EVUA 4LKXB 5I15L 1FN4B 5EU6E 5GS2D 3U9PH 4U6YA 5E2TH 2VLLA 1CFBA 3BWAB 2YUVA 1R24A 2AEPL 3ES6A 2R8SL 4YBHA 2CIKA 3T2QA 4GW1A 3MLYH 4Q2ZA 3Q0HA 5IMLA 3OHXB 3WXWH 2GTZA 1S7UA 1M7IB 3RGVD 3ARGC 3KXFD 4A2LA 3U4BL 2ZCHH 1R0AL 5HI4D 3X13B 5FYLE 1CN4A 5JOFB 5TE6L 3MLRH 2VLJD 4F33A 1BAFL 3G5VA 1JPTH 1MELA 1OGTB 4OQTH 2DS4A 4ZPTB 5TGBB 3VFOA 2R1YA 5I74C 1CFNA 4PTTB 1L7TL 1VESA 1TCMA 3C09B 4ZXBD 1I1YA 2QQLL 1BVLA 1BOGA 3DO7B 4XNUH 4MHHI 1W2KT 1TXKA 3VU2A 4V2CB 2XRAH 1Q38A 4MD0A 4OZGF 4OT1L 3SGEH 3QCUH 1N2RB 2KQNA 4V2BA 5D71H 1CK0L 4XBPA 1KCSH 4RGNB 2YMXH 5ETUB 3RY4A 4XCNB 3TT3H 3RWHA 5DZLA 4MQTB 4FQCH 3S4SB 3GI8L 3D39E 2NX5D 1MCCA 4ETQB 1AKJA 5DFVD 1T21A 1KN4H 5DJ0B 3VDBA 1R6VA 3H6JA 1TCRB 4QCIB 3QI9A 1MCJA 4D0BB 1G7LA 2FGWH 2DWEB 1A6ZB 3CH8A 4QOKD 5INCB 1EXUA 3I6KA 3H9SE 2YPLB 2ZPKH 3MRBA 1AHWC 2AKRA 4JKPH 1FBIL 4YZFF 4OM1L 1JGDA 1DLHA 3VD4A 2ZOLA 1TVBB 4WTZA 1NAMB 3TVMB 3HG1E 5IVXA 5LGJA 2ZG2A 3O2VL 5ILTL 5IFJA 4KMLB 3CCHB 3F58H 4MD5A 3JV6B 1PX4A 1XR8B 4RAVA 1BPVA 1MIML 3LCYA 1P9MC