2I24N

Crystal structure analysis of the nurse shark new antigen receptor pbla8 variable domain
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
113
structure length
113
Chain Sequence
RVDQTPQRITKETGESLTINCVVRDSRCVLSTGYWYRKPPGSRNEESISDGGRYVETVNRGSKSFSLRINDLTVKDSGTYRCKPESRYGSYDAVCAALNDQYGGGTVVTVNAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords New Antigen Receptor PBLA8
publication title Maturation of Shark Single-domain (IgNAR) Antibodies: Evidence for Induced-fit Binding
pubmed doi rcsb
source organism Ginglymostoma cirratum
total genus 31
structure length 113
sequence length 113
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2i24N00
3CMOL 3I84A 3RVUC 5EUKA 4OCXL 5I1AB 2E7LC 4L1DA 1RPQA 3DX7A 3FMGH 4NO0A 2D4FA 4GAJL 4QRQB 2Z35A 5C0AD 1GGYA 3VXRD 4EQ2A 3SN6N 1MRFH 4QYOB 4JFYA 1PGRB 4OZFA 5FGRA 5E2JA 4LLVB 5BQ7A 4WWID 1E4KA 1AO7B 1OW0C 1DBKH 4YXKL 3JV5A 2FGZA 2FECI 2UWEB 1IILE 2CO7B 4OM0H 5IVXF 2OZ4H 3KS0J 2IAMA 3BPOB 2AKRB 5KANG 1SJEB 2J8OA 2Z92A 3KNBA 3FN9A 5ILTL 4X6CE 5FUZH 3T3ME 4TSBL 1OSZA 3GRWL 1YEKH 3PWVA 4NFCA 5D2NC 4Z0XB 3VFVB 4OZGF 5E6ID 3WNKA 2VKXA 3EFFA 1I9JL 3D3VD 3WN5B 3S36X 1UJ3B 3KLSA 1LEGA 2NNAB 3MYJA 1FNLA 1A47A 4MD0A 3WFEH 5IW6B 5EH1A 2COQA 4U6YA 1UH3A 1NCCH 4NN6B 3QYCA 2ZCKL 5T1LA 1E4XH 3TT3H 1BF8A 2AERT 5KSAB 3V0WH 5D8JH 3UJJL 1G6RB 2CGRH 4HEPG 5E1HB 4UU9B 1NAMH 1Q1JL 5DJZB 5T3XH 1IJ9A 2VB5A 1YN6A 3ARRA 2F5AL 1U6AH 2VSCA 2A73A 1ZANL 5CEYA 5FYKH 5LAXB 4PJAB 4PJEE 4CAGA 1ODAA 5KSVB 2CXKA 1PX4A 1NMBL 2GTZA 2R69L 2NR6C 4I18B 2AXJA 4X0KB 4WO4A 3R0NA 4DGYL 4J2XA 1TLKA 4JGUA 2ZKHH 3FT3A 3NFSH 4YNYB 2XN9A 2WAHA 2F54E 3G5VA 3KPRA 4X7DC 2FBJL 3AREB 3VGAC 5F6IC 3C87A 1GC1H 2CR6A 1BWWA 2HKHL 5TQ0H 1TXKA 5KTEH 3QDME 4HJ0C 3DETD 4L3EB 5DUPL 3T4YA 1WGOA 3MNVB 3LZFL 5EUOA 2MPAH 1XR9B 4LEXH 2WANA 4OF6A 3O4LA 1QEWA 5CS7A 3GSOB 2BVOB 2XTJB 5I73C 1Q9KB 4M7KL 3GKWL 4LLUB 1AQKH 3QI9C 5FDWA 2ED7A 2AI0L 1F4HA 4K23H 1HHGA 3BHBA 2VQ1B 3C60B 4F58L 4NGHH 3F7QA 5DS8A 3UMTA 5D4QA 1R3JA 4LOUD 2MOVA 1VSCA 3NN8B 4LPVA 3B9KC 3SDCB 5DJDA 2WINA 2BOBA 5TFSL 2JKXA 4WFGD 3GGWA 5D1XB 3FRPA 4QXUH 1WFNA 5IBUG 5EOCH 1NFDA 3RWHA 5IHZA 4WWKB 5E1AA 5FK9B 3LEVL 2CDGB 2GFBB 1E0OB 3CSYB 4GH7B 5F7UA 1MFCH 3HAEB 2VR9A 4G9DB 3FOLB 4JFFB 4Q74A 3SE3C 1FZOB 3HI1B 3TBSB 2F58H 3QNZB 3BQUB 4W6WB 4QRRE 4ZOBA 4L9DA 1BQLL 4LQ1A 2W0KA 5JHDB 1JP5A 4PJIB 5I15L 4XC1H 4ISVB 5ID1B 1ROWA 1QVOB 1KENL 1KLFA 4TVPL 3RKDC 5GRUL 5I30L 1N26A 5J9PA 4JFHD 5FM5M 3VRLF 3STBA 1MCSA 4EQ3A 3TN0A 2NX5E 4U1GC 5DQ9A 3VDAA 2QR0B 1WFTA 3SKOB 2GSGA 4FRWA 1DQML 4OBRA 2DQFB 4ERSH 3T2PA 2V17H 4NQUA 9CGTA 1OQXA 3CUPA 1F11A 4NM4H 1WBZB 5LBSH 2Y06L 5JDSB 2CDEA 2NMSA 2E7LA 3U7WH 3WNOA 3DIFA 5I9QB 4CN4A 1FORH 1UXSB 1J8HD 2LE9A 1OCWH 3VU2A 5HBBA 3WJLC 2HJFA 1DLHA 4MNQA 5FIEA 1A6PA 3QQ4A 5FYJU 4KTDL 1OW0A 2G75A 1A5FL 5EU6D 4NQCD 5E94A 1JRHH 2DL9A 3CXHJ 3HC4H 5CKAA 1L7TL 4XMPH 1Q0YH 5IVOA 1P4BH 2FD6H 4AL8L 4HC1L 2ZSWB 4WU5B 2NY1B 4H5SB 5F89B 2PTTA 4MQ7B 1D5XB 3NABL 3RWGB 2ZSVB 1E6JH 4HWUA 1HCVA 4R2GC 4HIJA 1MHCB 2BOCA 2Y5TA 2XZAH 1GGUA 2CLRA 3UC0L 3RU8H 1LE9A 5JIPA 1J05A 1TPXC 3ESVF 3S36L 4RWHA 5FYLL 1J0JA 1UACL 1F13A 1F3JA 1L7IL 3QIUD 4LPYA 2DLGA 5E99H 3ARFC 4F7EA 4WY7H 5AG9A 4GW5B 2X4RA 3H9SD 2GI7A 3NA9H 4J6RH 1GIGH 3PQYE 2IQAA 3RGHA 4JFDA 2HTKC 4LARL 4YR6A 1HDMA 3X14A 2OTUB 3C5ZC 4XVTL 2EXWD 4XPTL 2QHRH 2X44D 1HEZB 1Y18B 4NKDB 1KIQA 5CJOH 2LTQC 4RSVA 3OQ3B 2GSIA 2BRRH 3E0GA 4N0RA 1OTUD 3E6FA 4LFHD 5GS1C 2JIXB 2HT4C 3DNKA 1AJ7H 4EBQH 2CRYA 3BAEH 5ECJE 4HC1A 3VFWB 1F6LL 4CDHA 3SKNB 3RIFF 1S7WB 5BV7B 1Q72H 4TUKH 3VXQB 2FLRT 3FT2A 1Y6NR 4PJBA 2E6QA 3Q48A 2NY5H 4ZFOA 4KTEL 2YPLB 1RAMA 3EYFA 2XPGB 3QI9A 1CGYA 3LRGA 1KACB 3FCTB 4WTWA 3DV6B 5BVJA 4XP9H 5C0EB 3LN5A 3D39B 4DJMA 3T0WA 4FMKA 2AEQL 2J8UB 4KKBC 4ZFFA 3EOYG 4X7TB 3FT4A 4KDVA 3HG1A 5F96H 4K7PY 1G0XA 5TJWK 3B9KA 4N5ED 3EHBD 5FYJH 4FHBD 2HFGL 3EO1B 4TTGA 3LKRB 3OKDB 1UWEL 2DQGL 2R23A 1T22A 4W6XB 5GIRB 3TH3T 5KVEH 3ZYJA 4PJHB 4NQDD 3ZO0A 1RJCA 3WSQL 1W0WB 4G6JL 1YNKL 2HJKA 5SWQB 3H2WA 3AS0A 5FHAH 1WQVT 4WUKH 4QRPA 3SE3A 2C3WA 3RL1B 4JO2H 4L8CB 3L3OA 4HDIA 3CVHL 1S5IL 3L3GA 3X3GH 2XG4A 4I2XE 1DUZA 2W9EH 1VFBA 3P0YH 3U7YL 3UAJD 3BO8B 3BI9X 1Z9OA 3N50A 1QSED 3RY6C 5ELIA 2D7OA 1EEZA 3UYRL 5MENB 3BPOC 1S7XA 2P8MB 2ERJB 3AC0A 4J23A 5L0QB 1M6OA 3S98A 1B0GB 2FHBA 3DRTA 4Z5RB 4PJGB 3RGVB 3QHZH 4UILH 5ABDE 3NCYS 3IDGB 3W5NA 3WN5C 1UJ3C 5EBWA 2P49B 3GI9H 3VDBA 5FGCB 3LQAL 2E5EA 1LP9B 2FB4L 3IF1A 3KYNB 4MAYD 4UUJA 3U2SA 1I1AD 4YWGL 3DHMA 3NMEA 3P77B 1EHNA 5I1EH 1K4CA 3WJLA 3JBG7 4HUUB 4NP4L 5JR1L 1KCSH 3MRQA 3QQ9C 4E41B 2VDQL 3CH8A 3V4VH 3O3EB 4XMKL 4TPRL 1NCAH 5E95B 3SE8H 3MRFA 4QRTB 3VRJA 4RA3A 4XT1C 3HMXA 15C8L 5GS0L 1N59A 1EZVY 3K4DA 4TTDD 1WBXB 3KPSB 3LKSB 1UM4L 1ZV5A 1A9EB 4LIQH 1MHHA 3TPKA 3DSFH 3BKJH 1Z5LB 3QUYB 4I18C 3JUZA 1RZ8B 4Z7QE 2ZCHH 1TCMA 4UIKL 3S96A 2DQUH 4U3HA 4ZD3H 1HZHL 2X4UA 3AREC 2BVPB 5F3HA 2R2EA 1U3HB 1IZKA 1LO4L 1EVUA 4Y1AD 5HI3D 2IEPA 5T5NG 2B4CH 1H3UA 3RIFK 4DZ8A 3PWNA 3FB8B 3ARFA 5I8EB 5GGQL 5IV2A 4YDKH 5LGHL 1T0MB 3FB7A 4MZ2A 5ERWB 4JCLA 4HWZA 4GKNB 4KC3B 3KPNB 4RIRA 4KK6C 2NY3D 3WS3B 1G1YA 5EU5A 2XTJC 2FATL 3IU4L 1V7ML 3QG7L 3LKQA 4X6DE 3L3DB 2P5WA 3C08H 3WO3B 1L0QA 3C5ZA 1P4LB 5C0BA 4NWTL 3RQ3A 3C60C 1PQZB 5EZLB 5AUMB 1QRNE 2UYLA 5BS0D 1F4YL 1ZGLB 3X13A 1UKSA 5BW7C 4F15C 3VFPB 1H8OA 1UZ6E 2IH1A 3PP4H 4RRPG 3SDCC 1YQVH 1FYTB 4AM0A 5F44A 4BZYA 1V05A 3KYKL 5D1XC 3ALXA 1A21A 3WS6C 4YHZL 3V5KB 1KYOK 5HHXL 2APTA 2IAND 5ALCH 5JZ7C 5HHMD 3O45A 5GGTH 4PLNC 5A2JH 2W65A 4U7SA 1WVZA 1LO3L 3MNZA 3V7AE 5T3ZE 3WKNA 2HN7A 3CZJA 1MFEH 1FFPB 2FJGB 4L1HA 3BQUC 3PWLB 3MLYH 1XF1A 3BFOA 3PGCA 2NXZD 3WXVH 4KMQA 1ED3B 3O6LH 5C0AB 3VXRB 1G6VK 2MHAA 4HIHA 5DJ2B 1EDQA 3PWUA 3TBWB 4R96B 4POZC 5C86A 1JHKL 2NY4C 3F7PC 3TV3L 4FTVA 1SYVB 4BSVB 2VQTA 1UEMA 5LGJB 5MEOB 1QFHA 5JOPE 4XBGB 4P5KB 2LABA 4IRZL 3DO3A 5E6IB 5JW5A 1KEML 2ARJQ 4Z7UF 3JV6B 4XXDB 2GW5A 5I1JH 5I1AA 2DF3A 3QCTH 3D3VB 5I9QC 1T1YB 5BMFH 4I3RH 4QRQA 3RNKB 5B38G 1YEDB 3IAPA 4HFWB 2E27H 1KCVL 4FP8H 4LLVA 1KCUL 43C9B 1AO7A 4M5YH 4HPOH 1B90A 1OL0A 1NGPH 2UWEA 1EMTL 3H9YA 4OTXH 2VLJD 5FO8B 1JWSA 3RY6A 1EAPB 3KPLB 1FP5A 5HGHB 1FL3B 5DD1L 5GS2H 2HT3D 2MNUA 2AKRA 1SJEA 3GMOB 3IDYB 2VLME 1RK0B 4JPWH 4Z0XA 3VFVA 2ICWJ 3IS1X 4I5BB 5SX4I 4HZAA 2XY2A 1JTOA 4XWGL 1UJ3A 3ELAT 3WN5A 1GPOL 4WNQB 2NNAA 5E8DL 4OF8A 2BJMH 5IW6A 4GSDL 2VXTL 5CEZH 4KROD 1MCRA 3HR6A 3RP1A 3E8UH 3DI2B 3NCCB 5KSAA 3N9GL 2MQCA 1BVLB 2KUTA 2O5XH 1G6RA 2EE2A 1E6OH 5FUCE 1YC7A 4UU9A 1F4WL 4BSJA 5DJZA 3UO1H 5IGXH 5FM8A 3UROR 3NIFE 4BQ8A 1LO0L 5D7IB 5LAXA 4PJAA 1IGIH 5KSVA 1X5AA 3OPZL 3RWFB 4UT7H 5KVDL 4I18A 1QFOA 4X0KA 1AR2A 4DUVA 2GJ6E 5I74B 4YNYA 2XQYG 2B1HL 1DQJB 3KYMB 4FQIL 4NZJA 1A02N 3AREA 2MCPL 1W72L 4O51B 5E6YA 5I8KH 4HKZB 1EPFA 4KRPD 4X6CF 3T3MF 4PB0L 3MREA 3BPNC 5GRYA 1QYGH 4QTHB 1GOGA 4L3EA 1P6FA 4JQIH 4CVUA 3MNVA 4FNLH 5BV7C 5JUEL 5ETUB 1XR9A 4LEOB 25C8H 5DVNA 4G8GD 3GSOA 2BVOA 4LLUA 5C6TH 2JELL 2HTLC 3MRLB 3BDBA 2OJEB 2VQ1A 3MR9B 3C60A 2ATKB 2WLZA 2P44B 5GGSB 4NFBA 1MI5E 4CBPA 5BW7A 5HXMA 1QSFE 3JWNC 3MCKB 2AJ3A 4KI5C 1JF1B 4ONFL 3NN8A 4Y2DD 2H26B 3SDCA 3T77B 2NY0D 3N1QC 4PJEF 5GRVK 3I9GL 5D1XA 3WS6A 1EO8H 2Y7QB 1D5MB 3M8OH 1MIEH 3QDGD 5FK9A 2CDGA 2GFBA 3CSYA 3HAEA 4ELMB 5EFIB 3EO0B 4G9DA 4Z0BL 3FOLA 5E08H 3MZTA 5IOPB 3W39B 4YBLB 3IFNH 4XVJL 3F7YB 4I13B 1FZOA 3HI1A 3B8SA 5F6HJ 3QNZA 2R4SL 3U30C 3BQUA 4Z95H 2EO9A 5HYJD 3SGDI 5JHDA 1J8HB 4WI2A 2AK4E 4PJIA 4XP6H 2NTSP 4Y19B 5F1IB 4ISVA 1VFUA 5ID1A 1QVOA 3MRRB 4YEFA 1TJHL 4JY5L 2DDQH 5C0CD 1MFBH 3RVWC 2ERJC 2QR0A 5EU6B 3SKOA 2NZ9D 4NQCB 5L9DH 5L0QC 5IR1B 1PAMA 5L88L 3WE6A 2DQFA 3GHBH 4ODSH 4YBHA 3RGVC 3LEXB 3BT2L 1WBZA 1RMFL 4ZS6D 1F3RB 5JDSA 1OTTC 5AZEH 4FFWC 2Z9TA 2X4SB 4M5ZH 4GRWH 3ULUL 1UXSA 5HI4C 4X8XA 3VFOB 4Y8AA 1P2CB 1SHMA 4ZFGH 1FPTL 3F5WB 3AGVA 3O4OC 1XF2B 3GIZL 2X4QB 4P9MH 1CD9B 3MUHL 1E4JA 5IVXB 2B1AL 1CI5A 1GZPB 1K2DB 2IG2L 4F57L 3QIUB 2VN4A 4N8CL 4KY1L 1U58B 2KDGA 2EDDA 4MLIA 2ZSWA 4WU5A 5HDLA 4ENEC 5F89A 4OZGB 3H9SB 4JZJB 1D5XA 3RWGA 4DKFL 2ZSVA 4NC1E 5DD5H 5SWZD 5FB8B 4OZIF 5D93B 4TULH 4K9EH 1MHCA 4U6VL 5ICYB 1GXEA 4Z18A 2IGFH 4K8RL 3W81A 4NZUH 3SDDD 3H3BC 5BRZD 4PJXE 3QEUB 3BXNB 4NNXB 2R0WL 5C08B 5FCUH 2XT1B 5LCVL 4DUXA 4LLAA 5A3ID 1R0AL 3BZ4B 1K6QH 4GW5A 3RL2B 1D3CA 1SM3H 4NO3B 1U8MB 5INCB 2K3TA 4RQQB 35C8L 2OTUA 4Y88A 1KTKE 1HEZA 1Y18A 4M6MH 2EH8L 4Q9BA 1ZEAL 4OM1L 1FV1B 5DMIL 4HWEH 1YYMH 3S97C 4TRPH 4O9HL 4PRPD 5E5RB 1R3KB 4HGWB 5DQDH 5E9DE 3VFWA 3SKNA 3QEQB 4L3AA 1S7WA 2ZPKH 4IOFC 1LDPL 3VXQA 5HDBF 4DOHB 2P8LB 4FQ1L 1XR8B 2YPLA 2FX9L 3P4MB 2P1YA 2XPGA 4NQDB 4WTXA 1V5JA 3QEGH 3RX5A 3DV6A 3WLWD 2Z31D 5C0EA 3D39A 3D87B 4G6AD 1UENA 3KPRE 4E0RB 2J8UA 3EOTH 4X7TA 2RBLA 4A6YB 3KDMB 1G9EA 1N0LA 1DP0A 2IMMA 2A83A 1C1EL 5E2TL 3EO1A 4GOSA 3FAXA 3LKRA 3OKDA 1QLEL 2DI8A 1QSEB 5GIRA 5EUOE 2AV7B 4MMXC 4GMSL 2Y72A 1U2HA 1RZKH 3GK8L 1P4IL 2OJZH 4R97B 1MVUA 1W0WA 5E6IC 3LKPB 1I1YB 5SWQA 1WT5C 2R0ZL 1TETH 4X5WB 3RL1A 3ZTNL 4H88L 3SE9H 4L8CA 2HVJA 4NUGL 4MAYB 1I1AB 5I19L 4XX1E 4QF1A 3BO8A 1G9ML 4OSUH 3ILQD 5MENA 4W81A 1U42A 3JUYA 2P8MA 5CUSL 5CJ5A 1WISA 2X09A 3IDYC 5MP6H 2BCKA 1B0GA 4Z5RA 1FQ9C 3OKOB 3QQ3B 1U3YA 1IEAB 4LAQL 4PJGA 1GL4B 3RGVA 2F54D 2X1QA 4GQ9L 1O5DT 3IDGA 1I9RL 1RJYB 5JLZB 4MSWA 1FRGL 5TF0A 5C0GB 5KOMC 1LP9A 4JN2B 2FR4B 1KJ2H 3MCLL 2AEPL 2ZUWA 3P77A 3QDMD 2DJ4A 4N5UA 1F6FB 2Y9RT 5T3ZH 4DZBB 4HUUA 2ZOLB 1I7UB 2Z8WC 1T0NB 2VDPL 2IQ9H 2XZQH 3ULVE 1NUNB 4EOWH 3V9FA 4E41A 3O3EA 1BFOB 4Y1AB 4UINL 2WBJD 4M6NL 3NAAH 5CEXB 2J88L 1A6VH 4QRTA 2VRAA 3P30L 4GW4B 1FGNH 1ZXQA 1ZVSB 4FQJH 3DETC 5F70A 1WBXA 3LMJH 3KPSA 1LWRA 2N7BA 1CFVH 1A9EA 5CBAB 5KW9H 6CGTA 2NY3B 1Z5LA 1RZ8A 3C09B 4KRLB 4OQ1A 3A6CH 4KKLD 4PLKD 2DQTL 5IESL 4LCWE 5CGMA 4QXWA 1EEQA 3KPTA 5I74C 5DJXB 4QGTA 4U1SB 3L5IA 4MNQE 2BVPA 2V7NB 5BS0B 1U3HA 5TPWL 5C0DB 4F33B 1H8SA 2P46B 4LOUC 4OFYD 3LSOB 5E5MB 1BM3L 2PO6D 3FB8A 4WGVB 4OGAD 5I8EA 1FN4B 3FFDB 2IPUK 3IXAB 1ITCA 1F00I 3F7RA 4HBQA 1WSST 1DQDL 1T0MA 5ICZB 5ERWA 2JTDA 4GKNA 3KPNA 3WS3A 5ITBH 1IQWL 4OKDA 4X80H 4KMLB 5D2NE 4NRXB 2IANB 5HHMB 3L3DA 3HFML 2VMFA 1P4LA 5DVKA 1J1PH 1PQZA 5EZLA 5AUMA 2BVQB 3PDGA 3GSNH 2H1PL 1ZGLA 3B9EA 1ADQH 3BD3A 4JKPH 4Y89A 3E2HB 3QWOB 3ARGD 4X7SL 3VFPA 4GXUM 5C9JB 1WICA 2M26A 1DBAL 2NXZB 3OF6A 1Z2KA 3QXVA 3RPIB 1I9EA 5CBEB 4P59H 1CCZA 3EZ8A 4RZCB 3BPLB 3O0RL 3Q6GH 5TE7L 3U0WH 2R1XB 3WIHH 3HI6L 3V5KA 3TWCL 1A7OH 3VGFA 3BH8B 4JFDE 4Z7QF 4P49A 2BY2A 3TESA 1D6VH 5E24E 3BDXA 2XTLA 2AAVA 5CIPB 3IDUA 1FFPA 1LNUB 2FJGA 3GHEL 2CD0A 2BY1A 5D7SH 5F7EH 5F3BB 1HSBB 5C0AA 3VXRA 1OSPH 1YY8B 1UWGH 5DJ2A 4RGNE 1J7VR 2GK0B 3TBWA 4R96A 5DFTA 4XAKE 3ZKXC 1DR9A 1RJZB 3BIKB 2VLJB 1SYVA 4BSVA 4PP1D 4XB7A 1DBJH 3CFKB 2WM0A 5LGJA 4X6DF 5CP7B 5MEOA 1KEGL 4XP5L 1I9IL 2WWMD 1ULVA 2CUIA 2NCMA 4KRMB 4XBGA 1T2JA 4P5KA 1ZLVH 5E6IA 2A9ML 3JV6A 4XXDA 1BQHB 1QBLH 3TJHD 1DSFL 3D3VA 3NCYP 1T1YA 4GLRH 3H42L 3K8KA 1UZ6F 2UZIH 3RNKA 3I85A 1YEDA 4HFWA 3LVEA 4WI3A 1CZ8H 2QTEA 43C9A 1GAFH 1TJGL 4KROB 5HYSB 3PQYD 4N0FB 4TQEH 1T1WB 3PV7A 2VOTA 4HS8L 1CWVA 5FO8A 2DL2A 1EAPA 4RMRA 5HGHA 1FL3A 3QIUC 4KV5E 5EIIB 5FDYA 1IGMH 4PGBB 4ZO8A 3WD5L 1RV6X 1TFHA 1U0QA 1RK0A 4ZQKB 1IT9L 3R4DA 3NFPB 3S7GA 2P8PB 2GEEA 4I5BA 4JZJC 3V0AC 1C12B 4V2CB 1QKZH 1T5XB 3BYTA 4WNQA 4OV5B 1MPAL 2AJXH 3WFDL 4P9HH 4CGTA 1IAII 2EXWC 2YN5A 1QRKA 1FNHA 4L4VD 4LSTL 4S2SB 3IT8D 3KPPB 2H32B 1KJVA 3RIAF 1DBML 1FDLL 3TBTB 1UB6B 4P46D 1BVLA 5CGTA 1RHHB 4DVRH 5D7KD 4JZNB 3V79C 2EDXA 1OTUC 3GBML 4KRPB 4R8WH 5D7IA 4LDEB 5GISL 5F1NB 3NCMA 3X12B 4NZRH 3RWFA 1D6EB 3IAQA 2VJXA 4J8RB 2W38A 3RBGA 4NQXB 4Q9QL 4G8GB 3GNML 2AJSH 4PJFE 1KIUA 3DVIA 1FAIL 2ORBL 4OD3L 1ZA3B 1PLGH 2NY6D 1DQJA 3KYMA 1MCOL 3QUXD 3NCJH 5LQBH 1ZLWH 4AG4L 1AHWC 1PEZA 4O51A 1RVFL 2OL3B 4HKZA 4U1MB 5I1KH 4HWBL 3HCVB 4J3VA 4Y2DB 5F9WC 4N5EC 3EHBC 1CE1H 1VCAA 3WXWH 1F4XL 1RFDL 2NY0B 3TIEA 1CDHA 3FZUD 5DLML 6FABH 4JO1H 4R26H 4XHQA 1A7RL 4LEOA 4O02L 3HZMB 1KULA 3EYUL 3QDGB 4RNRB 1U8JA 5I1CL 4Z6AT 4YDVB 3MRLA 2HT2D 1JYVA 2EE9A 3QCUH 2OJEA 1NL0H 3MR9A 2ATKA 4UMGA 3UTTD 3K46A 3LHPL 2ZNXA 1NC2D 5IEKB 1TZGH 3MCKA 1IC7H 5EC1B 3G6DL 4QXTB 1JF1A 4JO3L 4UT9L 5HYJB 2H26A 3U1SH 4HPYH 2ARWA 3NIFF 3T77A 5KVGH 3UAJC 1MQKL 1CLOH 4M1DH 2YPKB 2Y7QA 5C0CB 1D5MA 4XPAL 1RZJL 3PWJB 3GM8A 4W4NA 4R97C 1CGTA 3MLWH 1L0XA 4XB8A 4ELMA 4CU8A 2AK1L 2IPTL 3EO0A 2P5WE 5IOPA 1RURH 4XRCB 5C0BE 3W39A 1YJDH 3F7YA 1UKTA 4U0RC 4DKEH 4MAYC 3PXHA 4LDOB 2FX8H 1YEJH 4FXGB 1J8HA 5F1IA 3GJFK 2VDNH 4ZUVB 3EFDL 1NGQL 3MLUH 3DGGB 3MRRA 4XCFL 4GKOA 3GMNB 2O5ZL 1UCTA 5DJYB 1NAKL 4HUKB 5EU6A 2FJHB 3U46B 4A2MA 2FYYA 3C6LD 4NQCA 2AGJH 4OT1H 5IR1A 3AS2A 5DK3A 2VC2L 4YIQB 3FQRB 3LN9A 5GGRB 2CRIA 3OZ9H 3LEXA 4TTDC 1T83C 1T5WB 3VFMB 4UTBL 1RIVL 2EKSB 3EJYD 5HVFB 1CR9H 3D5OF 4MD4B 4Z7UB 4BFBD 4HF5L 2HRPH 1S7RB 4FG6D 5SWZB 2X4SA 4ONGH 3VFOA 1P2CA 5IHLB 2VXVL 5TE6L 1KSRA 4WI7A 3SDDB 2IH3B 3F5WA 3R06B 3WJJC 1XF2A 2O5YL 5BRZB 2X4QA 4DK3A 4R3SB 5HI3C 4YXKH 5IVXA 2X1WL 5KJRL 4D0CB 3PDOB 4QNPE 1GZPA 1K2DA 4ZNEA 3MLVL 3QIUA 1I4FB 4ZODA 1U58A 1T20B 5C0ND 5EZJB 4X6FB 4OZGA 3GRWH 3H9SA 4U1KB 3O9WD 4WIQA 2A6JB 4JZJA 1DQTA 4LF3A 1QPPA 2JJSC 5FB8A 3C09C 4WW1B 4WW2F 2EDJA 2YRZA 5ICYA 2WBKA 5DI8B 3VD4A 2BDNL 3ZYOA 3MO1B 1WTLA 3FO0L 4URTB 3QEUA 4W6YB 3BXNA 4NNXA 1AO7E 3RVVD 5J3HD 3QEHB 4G6KL 2ZCKH 1UADC 4O5LL 2UWEE 5ADPL 4ONHB 3Q2CA 4OGYH 2C1PB 4EKXA 5DD0L 3BZ4A 1GH7A 1Q1JH 2PXYD 2HKFL 4L29A 3RL2A 4PRPB 1YNLL 1X7QB 3OHXB 3JWOL 4NO3A 4OD1L 3X17A 2KKQA 5INCA 4ZSOB 5GJSH 4NBYB 4RQQA 3VH8B 1JNHA 3UTSE 1N5YH 2OM5A 4W68A 4DGYH 1JVKA 4ZDHB 5IF0B 4K71B 4AT6B 4KGJA 1FV1A 2AXGB 1RK1B 3E2HC 5AZ2L 2Z31B 5C6WH 2FBJH 2XZCL 2NXZC 4IDLA 1IGTB 5JOPD 4M02A 5FA4B 3BPLC 3SGKC 4X6CB 1CGSL 4OCYH 4NSKB 1R3KA 4QO1A 4HGWA 1OY3B 4HIEB 4PD4J 4YZFF 3LZFH 3RZCD 5EC2B 5C09D 4NT6B 2P8LA 5JXAH 1XR8A 3FQNA 2W0PA 1MRFL 3P4MA 4M7KH 2DLIA 3GKWH 4JANB 4NQDA 5DYOB 2VWEC 1EJ6A 1CD1B 2ZUSA 4PJXF 2DQJL 1Y0LA 3KHQA 1DBKL 1EV2E 5IB2B 4LSVH 4F58H 4E0RA 4WFHE 3LAFA 1ZLVK 2Q8AH 1IGFL 2ZJSH 1HSAB 3IS0X 4A6YA 3KDMA 2VLMD 1YEKL 1N6UA 2ICWB 2YA0A 4PJEB 5EB9A 4XNQB 2GY7B 5TFSH 3QDJE 5L2KE 1CF8H 4L3EE 3UPRB 1QSEA 2OMBA 2Z0BA 3WFCH 2AV7A 2FX7L 3X11B 2HT3C 3MRPB 1I1FB 2W9LA 3TCXA 2XTJE 4AK1A 4E5XB 4OIBA 3LEVH 2DLHA 3U82B 1XMWA 3G5XB 1I1YA 1NCCL 3LKPA 4PJ7F 2F54B 3DGCR 3TT3L 1W0VB 4MDJB 3SGEH 1N7ML 4MD5B 4X5WA 5D8JL 3EYQC 4MAYA 2G2RB 1I1AA 2KL6A 5CILH 3QDMB 4I0KA 2NY2D 1BQLH 1U6AL 5D96C 2P4AB 4KROC 3RA7L 1MAJA 2DTML 5I15H 1N4XH 5FYKL 1KENH 5HPOA 3IJSB 4HXAL 5GRUH 5I30H 1ND0B 5C0JB 3EJZD 2WBJB 4I77L 2DKSA 3DTXB 2GJ6D 1DQMH 4H1LB 3OKOA 3QQ3A 5DFVD 3TC9A 1IEAA 5E2WL 3GIVB 3NFSL 4U2YA 1T83A 3DJ9A 1RJYA 4U1LB 5JLZA 2BY0A 5C0GA 1CLZH 2Y06H 3TT1L 1P5VA 2FR4A 4UNVA 1GC1L 3WMSA 4U3XA 4UDTA 5TQ2L 4HD9A 5KTEL 1GSMA 2VITB 4DZBA 2ZOLA 1I7UA 5JHDE 1T0NA 4LL9A 2W91A 4JQXC 3WJJA 4U6XB 5KSBE 1BFOA 1A5FH 4Y1AA 5J8OA 2PR4L 1M1SA 2LV4A 1F8TH 5D72H 4KRPC 2C1OB 3MODH 1ZLWK 2PO6B 4YK4B 4GW4A 1M05B 5F9DC 1ZVSA 4AL8H 1TTUA 1KT2B 4HC1H 1IQDB 3CFBB 1MI5D 2WLYA 5CBAA 4KQ3H 2CQVA 4LLQB 3CFEB 2APBA 1I7TB 1VEMA 4Q97A 2JJSA 4NGHL 1QSFD 3NABH 3ZE1F 1IL1B 4P5MB 5EN2B 4QRRB 1ZE3C 4M48H 1AY1L 4WEMB 5FV1L 1TQCB 3EOAB 5T3XD 5DJXA 4BYHA 3MRIB 4U1SA 5IWLC 3QXAB 1J1OL 2V7NA 5BS0A 5C0DA 2GJJA 3DURB 2NX5B 3LSOA 4QXUL 2C26A 3S36H 2EICA 4GW1B 5EOCL 1UACH 3ARGB 1L7IH 4O00A 4F7PB 3FFDA 4X4ME 3IXAA 4NN5B 3GBNL 3B5GA 1IAKB 2NY0C 4HUVB 5ACLA 2G9HB 5ICZA 1QHOA 4LLWB 1N8ZB 4AYFA 1U2CA 4O4YH 4NRXA 2IANA 2C9AA 2AK4D 3MJ7B 3D18A 3T2QA 3T0ED 3RFZC 4XVTH 2ATPB 2BVQA 3U4AA 1CGUA 3TO2B 4Q2ZB 3TP4A 1YEIL 5KBNC 3QWOA 2H2SC 1BD2E 3PHSA 3T2NL 5C9JA 2MMXA 2NW3B 5CBEA 3RPIA 2O61B 4RZCA 1RJLB 3SGKA 3MA9L 2R1XA 4M1CD 4ALAL 2UVFA 4DKDC 5SX5H 3BH8A 1YEGH 2NZ9C 3U7WL 4CJ0A 4XMLL 4KRNA 3HI5L 3MRNB 3P4LA 4XPBL 4KJWD 3NGBB 1FC1A 3ARWA 4HUXB 2BZDA 5CIPA 1QOKA 3MBXL 1LNUA 2D9CA 3JWDC 4UOJA 2AJVH 4WFEE 1A1MB 3G04B 2X89D 5F3BA 1A3RH 1HSBA 1YY8A 4IOSD 2J3SA 5K59F 1TTGA 4F80A 4G5ZL 3T04D 1RJZA 5DO2C 5M94B 2HFGH 3PQYB 4KPHH 4YQXL 2XFXB 2VLJA 4AY0A 3CFKA 5C7XL 5CP7A 3HMXH 2XZAL 1GGIL 2Z91A 1V8HA 4AEIL 4R6UA 4DN4H 1A4KB 3MYZA 1BQHA 1MUJA 4LK4A 2LVEA 1I3UA 2PW2B 3CGTA 5DFWH 5E99L 4JN1H 5IFAL 3CVHH 3SDDC 3DV4B 5HYSA 4N0FA 3U7YH 4Z78B 3NA9L 3UTPE 1GIGL 5HI5C 1ZT1B 4P46B 5EIIA 3CVIH 5A3IC 4KUCF 4PGBA 1JV5B 2CMRH 4PG2C 4ZQKA 3BGFC 3NFPA 2P8PA 4CMMB 1C12A 2EXYD 5CJOL 3BZEB 1IAMA 3SY0B 1T5XA 4F7MB 1CGVA 4OV5A 1BOGB 1NEZB 4NC0B 3STLB 1NMAH 3LQAH 2FB4H 1EUTA 1KIRB 3HR5B 5HJ3B 1WIOA 2X4OB 5MHSE 3UEZA 4ESKA 4S2SA 3KPPA 4IS6B 3BAEL 4NP4H 2H32A 4U05A 2Y23A 5JR1H 3TBTA 2NY6B 2DIJA 1UB6A 2DKUA 4JQXA 2AJUH 3KR3L 4JZNA 5B3NA 2VDQH 5IB4B 2RGSA 5MENE 4XMKH 2NY5L 5HHPB 4Q9CA 1B3JA 2ICES 2R0KL 1UA6L 4HJGB 1CE6B 15C8H 1PY9A 5F1NA 2VLRE 3WFZA 4G7VL 4PJGE 3MUJA 1UM4H 1RZFL 1D6EA 3T65B 1G7MB 4J8RA 4UT6L 5BO1H 1MCNA 4F8QA 4G8GA 1LP9E 4I2XB 1RUPL 3FFCD 4GUPB 4K71C 5T5NF 3V5HB 4UIKH 1ZA3A 3LY6A 1RZIB 3WLWC 3NA4A 5IWLA 2Z31C 4K7PX 3UTTB 4G6AC 1CU4L 2OL3A 1XAUA 3J8F7 1LO4H 1NC2B 4KV5F 4U1MA 4E41E 1L6XA 2H8PB 5C2UB 4NZTL 5J57B 4HK3N 3HCVA 4X7FC 4BM7A 4N8VB 3R1GL 4Y2DA 5GGQH 2J1KA 1FVEB 1YN7B 5FHAL 2JJWA 4RMTA 1Z3GL 1U93B 1FG2B 3HZMA 4JO2L 5GRVL 3QDGA 3ECBB 4RNRA 1L0YA 3IU4H 3QG7H 4YDVA 2I60L 2W9EL 3BP6B 5J1AB 1AKJD 5DEFB 1BREA 5LVEA 1WV7T 1NANH 5IEKA 1NKRA 4UZGA 5EC1A 4QXTA 5ICXB 5HYJA 4EI6B 2DMBA 5DC9B 4GG8B 3VD9A 2CPCA 4N1HB 2YPKA 2APWA 3SDXE 4Z7OE 3ILQC 5C0CA 5DC0A 3PWJA 3C2SA 3FB6B 2EE3A 4R4ND 3C6LB 4PJFF 5I1EL 3BVNB 2WP3T 4XRCA 1KCSL 5FYJD 4OCSH 3PP3H 1OHQA 4LSUL 1Q9OB 2J4WL 1X5LA 2WQ8A 2C3VB 4OJFH 3EIFA 1HINH 4FXGA 3WDHA 4ZUVA 4NHUB 3DGGA 3UZQA 3GMNA 4UQ2B 3OGOE 5DJYA 3HB3D 4YHKL 3TV3H 3BKJL 1LE5B 2FJHA 2WBJC 3U46A 1Y6MR 4X4XB 4X6DB 4YIQA 3FQRA 4WTZA 1AR1D 5GGRA 3IXTB 1T5WA 3BIAX 2DQUL 4ZD3L 3VFMA 2K1MA 2EKSA 4MD4A 4Z7UA 3O9WB 3KG5A 4IRZH 5BZWA 1M7XA 1FIEA 4OFPA 1KEMH 4IDJL 1S7RA 4N8PA 5SWZA 3ZE0E 2B4CL 5C3TA 4KKLC 4PLKC 4YHPB 3FJTA 2XACC 4YDKL 3SDDA 2IH3A 3R06A 1YQ2A 5BRZA 4R3SA 4HIXH 1EMTH 3PDOA 4MWFB 4D0CA 3WDIA 3BEWB 1X6NA 3U9PH 2PO6C 1I4FA 3GJFB 4YK4C 5DD1H 1INDL 4OGAC 3MGTB 4HG4K 1T20A 4JZOB 1JHTB 5EZJA 3T4AB 3O8XD 2VXSL 1NFIB 3K1KC 2PXYB 4PG2A 4X6FA 4LAJH 4U1KA 1LGVA 3TFKD 2FSEB 1IEBB 3N1GC 4WW1A 3WL9B 5DF0A 2D4DA 1TQCC 4UOW0 3PP4L 5D7LE 5E8DH 5DI8A 4BUGA 3BISA 4GSDH 3MQIA 3CIQA 3MO1A 3MV9E 1JGEB 2VXTH 1RUAL 4PJ9D 1JBJA 1AP2B 1F6AB 3QEHA 2JE8A 3ARGC 2FGWL 4ONHA 5ALCL 4KUCD 4KMTH 3WO4B 2C1PA 4G42B 4PY7B 1U36A 4NN5C 1F4WH 2R39A 2GT9B 3MJ8B 4PRPA 1SVZA 1LO0H 1X7QA 5AYUH 5KSUB 3OHXA 2QKIB 1TIUA 5BOPA 4I0PD 4ZSOA 3VH8A 3MLYL 2Q76B 5KVDH 4RGND 5C71A 5SX5K 3HAEH 5DJ8B 1NJ9B 3REWB 3MGOB 3V8OA 2HLAB 4ZDHA 4HZLB 4LVHB 5IF0A 1NLBH 4AT6A 4M6OL 4XAKD 4PGJA 2AXGA 1RK1A 2B1HH 2Z31A 3PF2A 4IMKC 4FQIH 1LD9B 2MCPH 4J7RA 1C5BH 1IGTA 5DVOA 5FA4A 4TNWF 4X6CA 4NSKA 2YK1L 4PB0H 4HIEA 4K7PL 5D7IE 5EOQH 3NIGE 5I1JL 3W0WE 4I9WE 5EC2A 3WUZA 4PP1C 5JUEH 1HIMH 4I3RL 5KVMC 4MCZB 2E27L 5JNYB 4JANA 1H3GA 2WWMC 3NGBC 4FP8L 2JELH 1CD1A 2C4FT 4M1GH 3ZKQD 3QFDB 4M5YL 4HPOL 1NGPL 1T80A 5IB2A 3TJHC 3TBVB 1IKNC 2A38A 1R3LB 4PRHE 4H0GA 1QPXA 1UWXH 1HSAA 3GDBA 3S34H 4ZO9A 4ONFH 3WUWG 3IU3B 2ICWA 2NY2B 4PJEA 4XNQA 2F53E 1JHLL 3BZDA 4PGEB 3I9GH 4WFGE 3UPRA 1EHAA 1Z0NA 1EO7A 3X11A 4O2EB 3DHJA 3MRPA 4RX4D 4Z7NE 3IDXL 5J6HB 5DJ6B 3TEUA 1I1FA 1BWMA 3BJLA 1S9VB 4L3CB 4K2UH 4E5XA 2GJ6B 3BN9D 1R5IB 2CR3A 3G5XA 4HKJA 3E8UL 2F54A 4Z0BH 1QACA 2XI9A 1W0VA 4MDJA 3FO2B 1NGXB 2GHWB 4MD5A 4NZDA 2IADB 1E6OL 1JGDB 4JPKL 2G2RA 4L8BB 3HMWH 2YPVL 3UO1L 3QDMA 5IGXL 2W92A 4MJ4A 1B6UA 1B4RA 1DVFD 5K9JH 1TJHH 4JY5H 1NH6A 1ORSB 3V6BR 1NCWH 1ND0A 5C0JA 2WBJA 2X6MA 3T08A 3DTXA 4H1LA 2DLFH 5L88H 1PSKL 3N06B 3HHRB 1BZ9B 2VZUA 3GIVA 4KGLA 1JCKA 1MI5B 1SEBB 4RAHA 4U1LA 1OLLA 1RMFH 1T7ZA 1QSFB 3AB0B 5I8KL 3GKZA 2OR9L 4NOBA 2DS4A 2VXQL 1NAMB 4G43B 2VITA 1H15B 3L7EB 3LDBB 4R4FH 4EN3D 2NY6C 3QUXC 4FNLL 2E7BA 2J12B 4U6XA 4JG1H 3S3JA 3GIZH 2B20A 1IAOB 1QLRB 3G08B 5F7MC 1I3VA 4OFYA 25C8L 4JFPB 2QQQA 4OZHE 4MZ3A 2C1OA 1MLCA 2IG2H 5EU6E 2PO6A 4C4KT 4NQCE 5T1KD 5C6TL 1M05A 4N8CH 3LB6D 3L5HA 1GGCL 1KT2A 5CEZD 3TZVD 1IQDA 3CFBA 3NH7L 3FZUC 2EYSB 4LLQA 3CFEA 5T33H 1I7TA 3BKML 3RTQD 5BV7H 4OZIA 3E3QE 4I1NB 3NFNB 1IL1A 1NEUA 4DKFH 4JPIB 4Q9RH 4P5MA 1JWMB 3MXWH 1QBML 4IRSD 5I8OH 5DD3H 3EOAA 2AK4B 2HT2C 3MRIA 3T0EB 4WUUE 3DURA 4QHKI 4JHWH 4WHYG 4GW1A 1WZKA 1F3DH 5LCVH 3ARGA 3MOAH 5EIQA 4N0YH 4F7PA 2BXZA 1XF4B 1IAKA 4HUVA 1UC6A 2G9HA 3D25B 4QRSB 5T1MB 4LLWA 1N8ZA 4DTGL 1U41A 5E6ZA 1NQBA 3C8DA 3H9SE 1MNUL 4YFDB 2WSKA 5DSCB 1WTGT 4Z95L 35C8H 3MJ7A 4XPHH 4WU7B 1E4XI 1H5BB 5EIVA 3ZZ1A 2HT4D 3F6IA 2ATPA 2EH8H 3VFGL 3KJ6H 3TO2A 1ZEAH 3K80A 3OBAA 4Q2ZA 5KSBF 5IJKC 2VDRL 4OM1H 2JJUA 4IMKA 1MFBL 3QIBD 1P84K 5DMIH 3VGHA 1JNNH 5L9DL 4YHLL 3MLZL 2NW3A 3L3HB 2O61A 4Y4HD 3GSXB 5F7NC 4LSRL 2I27N 4WHYH 1RJLA 4ODSL 5ENWB 3MV8E 3FQWB 4O9HH 1CFSB 5GZND 3VGBA 4DKAA 4DW2H 2P47B 3CX5K 1MELA 3VGGA 3C6LC 4M5ZL 1KB5L 2DJUA 5K33A 3VMNA 3MRNA 2V2TB 1PG7W 4FQ1H 2WWKO 5DJCB 4JY4B 2YC1B 1K85A 5T1DL 4PJXB 3EJYC 4HUXA 4XI5D 4JJHA 5ID0B 4YDJB 3T0BA 3AFLA 4FG6C 1A1MA 4MNGE 3G04A 1IKNA 4M4PA 5HVWA 3TYFB 1EERB 5E8PB 5A1AA 4WDIB 5SWSD 1C1EH 3SKMA 1BVKB 3PQYA 2VZTA 2XFXA 1QLEH 5IB1B 2GKIA 4K9EL 4IHOB 4K7FB 3I3DA 4GMSH 5C0NC 2IGFL 4HUMB 4NZUL 1CDJA 1FZMB 1P4IH 3GK8H 5I0ZA 1I3GH 3BN3B 2R4RL 1A4KA 3O9WC 4PJ7B 5CINL 2Y36L 5FCUL 1TZHB 5IFJB 2PW2A 1O0VA 3ZKND 5I19H 1K6QL 4L4VA 3DV4A 2E9WA 5E9DB 4U7MA 4Z78A 1HCFX 1LHZA 3RVVC 4NKMB 1G9MH 3OL2A 3VD3A 1K8DA 1ZT1A 3HNSL 4P46A 2DM7A 3UTSD 4P2QE 1SY6L 1QSEE 2ENSA 1JV5A 5CUSH 1IBGL 2PXYC 3MTRA 5C2BL 4CMMA 4M7JH 1PFCA 5F9OH 3BZEA 1EX0A 3SY0A 1I9RH 4LCIH 4F7MA 1VERA 1BOGA 1NEZA 3UDWC 3QQ9D 3STLA 3RRQA 3HR5A 2HMID 5HJ3A 4DAGL 2AEPH 2OX5A 2X4OA 1Z9LA 1JNJA 2PN5A 3FFCB 2B7DT 4IS6A 1BQSA 5D2LF 1E27B 1ZVYA 3U0PB 4HBCL 2Q6WB 3VRLE 1LQSR 3WO4C 5IB4A 1MCJA 2RAMA 5HHPA 4M6NH 2JB6B 3NIDF 2J88H 3U0TB 3P30H 4HJGA 1ZA6B 1CE6A 3DWTA 3V6ZB 1WC7B 3CLFH 4WRLA 3QEGL 3QULB 3RZCC 1QNZL 4JFOB 4WFHD 3T65A 1G7MA 4KDTC 1IM9D 3SDAD 5DS8B 4I2XA 4OQTL 4LVHC 1FVDB 2DQTH 4GUPA 5IESH 4FFYH 3N85L 3QDJD 4QT5B 3V5HA 1JRHI 5L2KD 2BOBB 1LEKB 1RZIA 1AKJB 5C0IB 3UTTA 4BZ2L 4NKOB 3HKFA 4X4ZA 1NC2A 2H8PA 5HGDB 5J06A 4PJ5E 4F3FB 1BX2B 1F42A 4P0DA 4N8VA 4LNVA 1SY6A 5GSVB 1TTFA 1T2XA 1BM3H 2OJZL 5JW4N 2WW8A 5FF6B 1FJ1B 3C2AH 1DQDH 1FVEA 1UWXK 4M7LT 1YN7A 1TETL 1U93A 1FG2A 3TNMB 2OTPA 5IMMB 3DRQB 5B8CB 4NFDA 3IFLH 2D0HA 3BP6A 4HJJL 3WKML 5J1AA 1A7QH 4DN3L 3BMVA 4OIIL 4WHTB 3ZT6A 5DEFA 4JDZB 4OSUL 4GG6E 2H1PH 2G5BB 3CXDL 3GMRB 3CNKA 1BFTA 5ACMA 5ICXA 4X7SH 5MP6L 2A6IB 4EI6A 4U3CA 3OAZH 2NY2C 4NBXB 1HHHB 4QKXB 4Q7DA 4GG8A 3DX8B 3O0RH 4ZAKD 1NBZB 3CUPB 3HI6H 2Q1EA 4R4BB 2CO6B 2APXA 5F88B 4JY6A 1I8KB 3EJZC 1KJ2L 3C6LA 4J3SA 4LCWB 4RFEB 3BVNA 5DFVC 1BFSA 5T3ZL 5TF1L 3N1FC 5IW3A 4OQTA 2IQ9L 2XZQL 1CTOA 2AXHA 1SEQH 4EOWL 1CIUA 1Q9OA 2NY4D 2C3VA 3GHEH 3ZL4L 1MFAL 1A6VL 2AQ2A 1L6ZA 4ETQB 4NHUA 2VZSA 1D5IL 3LMJL 4UQ2A 5GZOD 2B2XH 4GT7A 4HMCA 4OI8A 5D2NB 1LE5A 1PW3A 2CJUH 4NO2A 1QFWM 4OFDA 5CLWA 3S88H 2AW2A 5I76B 4X4XA 4X6DA 2X9WA 2MKLC 1ETZB 1BIIB 3Q1SH 3IXTA 2Q7NA 1XIWC 1PDKA 1S7UB 1I9IH 2XKUA 4KWUA 5F9AC 3UCRA 4OD2B 1FIGH 1DQQA 4JM2F 3O9WA 1AFVH 1A1OB 3AB0C 3ES6B 1YDPB 4YHPA 3BJ91 1A0QL 1RUML 3LDBC 4OLZL 2MJWA 2OI9B 4YDIH 3BKYL 4LPWA 4BFGA 3HNTL 1BJ1H 2A1WH 4PJ9B 4K3EH 3SDXF 4Z7OF 3K74B 5ITBL 2IFFL 3D0LB 4MWFA 4HS8H 1QG3A 4OI7A 3BEWA 5C70A 4XCYB 4PJ8D 3GJFA 3MGTA 5KS9F 4JZOA 1JHTA 1FCCA 1G7IB 2YKLH 5DUMH 3T4AA 1NFIA 2PXYA 3L3JB 3TNNB 3GSNL 2FSEA 2W9DH 1IEBA 3GMPB 4WW2C 4I0PB 4G9FD 3WL9A 2OS7A 3HPLB 1BD2D 5CJQL 5ACZB 3UDWA 1MPAH 4AMKH 3T0EC 1X5IA 4RGNB 4P59L 2UVEA 1OAYL 1KCLA 1JGEA 2VE6B 4LSTH 2B5IC 1F5WA 1AP2A 1F6AA 1DBMH 1FDLH 1XZ0A 2AJZB 4G42A 4PY7A 4MYWB 5I1LB 1RZ7H 5TDOB 1D6VL 2GT9A 3MJ8A 4LHQB 4OV6F 3I6LD 4M1CC 5KSUA 4PUBH 2PTUA 1S78D 5GISH 2QKIA 1R5VA 1QQDB 1MH5B 4RDQG 3WHE0 2ZUYA 3DX9B 4P3CL 3T0VA 2Q76A 4KDTA 5C09A 2RHEA 1H5BC 1OSPL 4XZUA 2VR5A 1UWGL 1X5YA 1NJ9A 5DJ8A 3MGOA 2HLAA 4HZLA 1OD9A 3QPXL 1A6UL 1L9MA 4OD3H 4NNYB 3RI5F 5B39G 1CG9B 1MCOH 1HKLH 2WUBH 4AG4H 2NTFB 2ZUTA 3HLAB 1DBJL 2VDMH 3DUSB 3PHOB 4DGVH 3SO3B 1F4XH 5H94B 4PGZA 1RFDH 1GGBL 5KAQG 1QBLL 1I1RA 4P2CG 3M45A 4OIAA 4L8DB 2UZIL 3MOBH 4MCZA 3EYUH 5JNYA 4PP2B 3GSWB 3LQMA 1VA9A 3QFDA 1OB1B 3UTPD 4MB3A 4TQEL 3T0XA 1T2QL 2P43B 1NGZB 5I1GL 3TBVA 3W11D 1R3LA 4G8EA 1J1XL 1RSFA 3G6DH 4AZ8A 4MGXA 2C4FU 4JO3H 2OXGA 3IU3A 4DK6A 4O2CB 4HK0B 4PGEA 4LFHG 1MQKH 1S8DB 2V9RA 1DVFB 4QHLB 4O2EA 5J6HA 1RZJH 4P9HL 5DJ6A 1A14L 1JFQH 3QJFB 4H8WC 2OSLB 4P3WA 4PJFB 2HFFB 1S9VA 4L3CA 4LKCB 5DEGB 2GJ6A 3NCEB 1R5IA 2ZOKB 2VUYA 3OAYH 2EXYC 5CMAB 3FO2A 1NGXA 4YGVB 4ORGB 3UTZB 4DVRL 5AAWA 1A6AB 2IADA 3UPAA 3VMOA 1JGDA 4L8BA 4K94C 5HVGB 1KELH 2OP4L 1OP3K 1MWAB 4X9BA 4MQTB 4DVBB 4IOIB 5HYJE 1J86A 4TUJB 2VLRD 3P3YA 4NRZB 1X5ZA 4XCFH 4EN3B 4QHMB 3DYPA 3NIGF 1ORSA 4NZRL 5EO9B 1LILA 3K8MA 4IEFB 5DDHB 1OTTD 2W1NA 1FLTX 3CFJB 2AJSL 3P9LB 4XVSH 4UNTA 5T1KB 5D7JC 5IVNA 4NKIL 1BZ9A 1R3IH 3I75B 4MS8D 3P4OB 2RB8A 3TZVB 1FE8H 5B38B 1MI5A 1SEBA 5CZKA 1RIVH 3VXTB 3NCJL 3RTQB 4NO5B 1QSFA 3O6KH 2PW1B 4LCCB 3IAGC 5I1KL 4DZ8B 2I24N 4S10A 4IRSB 1NAMA 4G43A 1H15A 3L7EA 4M43L 4OCMC 1NSNL 5DURD 4X7EC 1BEYL 2VXVH 4M61B 5TE6H 2PTVA 2A74B 4ENED 3FB7B 2O5YH 1IAOA 1QLRA 4R26L 4RIRB 4JFPA 1XGTB 5KJRH 5E8OB 1TCRB 1G9NC 4N1EA 4H0IA 2SEBB 3ZDYF 3MLVH 4UV4L 1T03H 3HRPA 4GRMB 1CICD 1N2RB 2F8VA 3T3PE 1M7DA 1NL0L 2FRGP 4JM2D 1WAAE 1O7VA 4N0CD 3C6SB 2EYSA 4PTUB 3JTSB 3NFNA 4TNVF 4ODVH 3RI5K 4JPIA 4Z7UE 3UJTH 1GHFL 4WW2A 5E7BA 1TZGL 1JWMA 2Y5EA 3UXFA 1IC7L 4KHXH 2QSTA 2CH8A 3U1SL 2AK4A 4HPYL 5FCSH 5GS1B 3T0EA 3A6BL 2BDNH 2IPKB 3FO0H 1JYNA 1K9TA 1CLOL 1DL7H 3MUY1 3KS0H 4LLMB 3PG2A 3BX7C 5FYKU 4O5LH 4X5LA 4BFEA 4A6YH 3MLWL 1XF4A 4Y4HB 5DD0H 2CDFB 1MJ7L 4O2FB 3D25A 3MX0A 4QRSA 5T1MA 1RURL 1YJDL 3HZKB 4OD1H 1MHEB 5DSCA 5HYFA 4R4NC 5B8CC 3I3EA 1YEJL 1YMMD 4WU7A 4XC3L 5E7FA 5L8JB 1H5BA 4NQED 5C0FB 3MLPA 1SMOA 4PBWD 1NUDA 3ISWA 2Z8RA 1U8LB 4MAUL 1R3HB 2DWEB 5I1IH 4OZHF 4X4YB 5F9JB 2AGJL 2X89A 4OT1L 4PY8J 2XZCH 3L3HA 3S6CA 3GSXA 4HMEA 5ENWA 3EGSB 3OKNB 3OZ9L 1CGSH 3FQWA 1HQRB 1KTLB 1CFSA 4OLYL 3KPQB 5SWSB 3PUCA 1CR9L 3HB3C 3VGEA 3WDJA 1RIHH 2RFXB 1SYSB 4ONGL 4P2OD 4ZSOE 1NMCB 4M00A 2HG5B 2V2TA 2OK0H 5DJCA 1AR1C 4JY4A 2YC1A 2VO5A 4PJXA 4XVUD 5ID0A 2CLZA 2DQJH 4W70A 4YDJA 2CKNA 4RFNB 4AQ1B 2IJ0C 4BZ1H 2N1KA 3SGJC 1JWSB 2D7QA 2AQ1A 1IGFH 3TYFA 5E8PA 3EYOB 4WDIA 3D1MC 2E9BA 1BVKA 1NPUA 2JCCE 4P4KD 3O3DB 5IB1A 4TOYL 2XA8L 4P23D 1G9NL 4HCRL 5D7LD 4IHOA 3UTSB 2FX7H 4K7FA 3RUGE 2J6EL 3MV9D 3O8XC 2R2BB 1JF5A 1FZMA 3QH3B 1IAIM 1PZ5B 3I50L 4PJ7A 1CQYA 3TFKC 1B0RB 2R1YB 1ACZA 1TZHA 5IFJA 1N7MH 2MSPA 5MEQB 1OWRM 5DK0B 4U1IB 3VJ6B 5C07E 4OGYL 2OI9C 4FFZL 7CGTA 3UBXI 1UQSB 4XBPB 4PJ9C 5E9DA 3RA7H 4KKAD 2DTMH 2YA1A 2V9QA 3A6OA 4NKMA 2J5LB 4JCMA 4HXAH 4FN0A 5GJSL 5EBLB 3VI3F 1VHPA 4TNVK 2G5RA 4PJBF 4I77H 4PLJD 4LSSL 1N5YL 1CFBA 3S35X 4RAUB 5E2WH 3IVKB 2XN9D 3VFNB 1YUHB 3P11H 3UJIL 4I0PC 1NBYB 3P9MB 4CN6A 5TGBB 1IM9B 3SDAB 3TT1H 4RGNC 4HGMA 1JYWA 4OCYL 3FFCA 5TQ2H 4DWHA 3ULVL 3MREB 3QDJB 1E27A 5L2KB 3W0WD 3U0PA 2X7LB 4I9WD 2Q6WA 3FQTB 4PJDF 3MGAA 2PR4H 5JXAL 2JB6A 1P1ZB 3AS3A 1Q9WB 4HCRA 3U0TA 1ZA6A 2J6EA 4Y16D 2BSED 3V6ZA 1H0DA 1WC7A 4IRJD 3QULA 5E5UB 4JFOA 4LSVL 4PRHD 3HN3A 1NGWB 4D2NA 1JPFB 2Q3ZA 4H25B 5EPMB 5D1ZD 2Q8AL 2J8HA 3B8YA 2ZJSL 2RCSL 4I3SL 4F15B 1BJ8A 4AH2B 2VTFA 2AJ3B 2P5EE 1AY1H 4PG9B 1FVDA 3K1DA 2F53D 3AROA 4QT5A 1N6QL 1LEKA 3I2CH 5CIPH 1HHKB 1AKJA 1B88A 2VAJA 5C0IA 1J1OH 1CF8L 3DMMD 4NKOA 5GGRY 3WFCL 5HGDA 4F3FA 1BX2A 2HYMA 2DKMA 4YE4L 5GSVA 4FZ8H 4P5TD 1BOYA 3SO3C 5FF6A 1FJ1A 3GBNH 5F1OB 4HLZH 4ZAKB 5I0DA 1GVIA 1JGUH 1HNGA 3KJ4B 1ZS8B 5DJ0A 4OZIE 5CZXD 3TNMA 3DARA 5IMMA 3DRQA 2CK0L 5D70H 5B8CA 1HH9B 5D5ME 5CILL 3DXAD 3FKUS 3BN9C 1KPVB 1N4XL 3K81A 4WHTA 3D85D 4JDZA 1AXSA 2YRPA 2G5BA 1PG7H 5KSBB 4F9PC 2NY4B 3ORJA 3GMRA 1YEIH 3OAYK 5E70A 1D9KD 2A6IA 1INEH 3T2NH 1W0YT 1X5HA 5DGQA 4MA3B 1II4E 1HHHA 3WE6B 3DX8A 3MA9H 4JRWA 1NBZA 3W9EB 1DVFC 4ALAH 4WI8A 4R4BA 5F88A 1CLZL 1R24B 1I8KA 4U1JB 3NCFB 3ZKSD 4LCWA 4RFEA 4XMLH 4YEEA 3HI5H 1JI1A 1FCGA 4YHIB 3BP4B 1H3PH 1KC5L 4UQ3B 4XPBH 3T0DA 3SQBA 3KVQA 3I3BA 5INDB 3MBXH 1ZMYA 1F8TL 5D72L 1RUQL 3SGJA 1FHGA 3MODL 3X3FL 1E28B 2LAAA 4ETQA 1HK6A 4LGPB 4EN3C 2VKWA 2H32H 1FC2D 1I8LC 3BD4A 4G5ZH 1GYAA 1HYRC 4KQ3L 5D2NA 1ONQB 4MA8L 4YQXH 1BLNB 1A7PL 5I76A 4YHML 4M48L 4DGIL 4PJ8B 2ZWLT 1JMXA 2R2HB 4ZFOL 5C7XH 5HDBE 1ETZA 1T21B 3LB6C 1BIIA 1HYSD 1MJUH 5DD6B 3T0AA 1S7UA 3TZVC 1KPRA 3O8XA 4J3XA 1GGIH 3I6KB 4OD2A 3LOWA 4WUUD 4AEIH 1U91B 3EDFA 4XXCC 3RTQC 4TVPD 5EU7C 4GG6F 1A1OA 3ES6A 4M9PA 4LCCC 1UVQB 1YDPA 1UYWL 4G9FB 1BD2B 4IRSC 4E42B 5IFAH 4XHJD 2LVCA 1IGYB 4JR9H 4PJ9A 5I16B 2OL3H 3D0LA 2VDLL 4XPFL 3ARDD 2ZNWA 4O4YL 4P2RD 4XCYA 4PRIE 1RHFA 1G7IA 4DQOH 2EYRB 3L3JA 4CADB 3TNNA 3RVXD 3GMPA 4F7TB 3ET9F 4I0PA 3HPLA 1X4ZA 4JFZL 5ACZA 4M7LH 5DT1L 4JKKA 2EIDA 3MV8D 3S35L 2VE6A 4JDTH 1ZLSL 5D2LB 1HWGB 4L4VE 5HGGS 3BPNB 3QA3B 5DGRA 5DWUH 4MCYB 1IGCH 4G7YH 4JKWA 5FAAA 3QDHA 3QIBC 2AJYL 3W9DB 4JHZA 1YEGL 1P7KB 3KR3H 3UTQB 2AJZA 1A3QA 3U83A 5D7KE 5I1LA 4UDUB 5TDOA 4HUWB 4Y4HC 4AEFA 3TJEL 1JN6B 1UM6L 2R0KH 1UA6H 3QFJE 5GZNC 4X83A 5EORH 3BOVA 4RGOL 1QQDA 3V52L 5M95B 4G7VH 1MH5A 1SJVA 4WTZG 3DX9A 2AJVL 1RZFH 5FYLD 1QUNA 1A3RL 4UT6H 1J0HA 3OB8A 3V4PH 1RUPH 4QLRA 4JHBA 5F7DB 4XI5C 2A83B 1S5HB 3QXTA 3ABZA 4NNYA 4CRPA 4KPHL 1CG9A 5DVLA 2NTFA 3JWDH 2FWOB 2Q8BL 1CU4H 3HLAA 5IP4A 2QQNL 3DUSA 3PHOA 3HMXL 4NZTH 2XYCA 4J3OC 5GGTA 3R1GH 1VENA 3R0MA 5JIHA 1TJIL 1MVUB 4DN4L 5HYQB 5H94A 2DAVA 1G7JB 1NMCC 4L8DA 1Z3GH 2VNCA 3K7UA 4RX4A 4KJYB 2HVJB 4JN1L 1AE6L 4JVWA 5CP3A 2ED9A 3U30B 2D7NA 4PP2A 3GSWA 3N1MC 1JTTA 4QF1B 2I60H 1OB1A 4RRPA 4RFNC 3QWRD 1NGZA 2D7PA 4YXHL 4P2QD 3UTTE 4F9PA 3CVIL 1ZHLB 3AM8C 3ARUA 3ZKNC 1FVCB 3ETBF 2CMRL 3HTLX 4I0CC 1KCKA 4B7LA 1CDYA 2BCKB 4O2CA 5J12B 2VLRB 4HK0A 1S8DA 4MVBD 1DVFA 4PRNB 4QHLA 2XRAH 1EFXD 4MSWB 5DK2B 1JK8B 3QJFA 1NMAL 3D9AH 4HX1B 2OSLA 4PJFA 2HFFA 5DEGA 4LKCA 3K8LA 4X99B 1U8PB 3UYPA 4ACPA 2ZOKA 3ZDZF 1QA9B 1N5AB 1AD0B 5CMAA 3TCLB 4IJ3B 3F6LA 4YGVA 4ORGA 4YX2L 5TDNA 3UTZA 4LRIC 1A6AA 3O4OB 2AJUL 3NZHH 4ZUTB 4LSUH 1TVHA 3QISA 2J4WH 2HMIC 1MWAA 3CJJA 3B5TA 4DVBA 4IOIA 2EEAA 4KFZC 4TUJA 5DURB 4NRZA 2BVEA 2J5LC 4EN3A 4QHMA 4D8PB 2K9UA 3MLTA 3RY5A 1I8LA 2KH2B 2VZ1A 5BXFB 5GGVL 5EO9A 5EZOH 5DDHA 4YHKH 5BO1L 4LP4A 1KLGA 3CFJA 2D0GA 5DHVB 3P9LA 2V5SA 4EVNB 5T1KA 4OLVH 4C56E 2EDBA 3I75A 4EXPX 1CICB 5CLTA 3P4OA 1OD7A 3TZVA 1OAKL 5B38A 1KN4L 3VXTA 1FAKT 3D69B 3RTQA 4NO5A 3SDAC 5AEAA 3ZKMD 4EDXB 1EHXA 2JK5B 4PJ5D 2PW1A 4IDJH 4LCCA 5AG8A 4KAQL 2KPNA 4BA8A 4IRSA 4YFEA 1A64A 1MJJB 1WFOA 4M61A 1GGTA 4M8QB 1OGTB 2A74A 1XGQB 3SDXB 3C9NB 5DR5H 1XGTA 5E8OA 1TCRA 1DJSA 4P4RB 3U4EB 2UZXB 1NGYB 2SEBA 5KS9B 1CFQB 1INDH 4GRMA 3CXHK 2V2WB 1N2RA 3OXSB 2APVA 4M3KB 5BJTB 1A3LH 2VXSH 4GLRI 3C6SA 5DRZB 2CKBB 4PTUA 3JTSA 4LSQH 3ZLQC 2DYPD 43CAB 5CSZB 1FBIL 3MRDB 1YMMB 5GS1A 1TQBB 2IPKA 5GS0D 4F37F 1RUAH 3BWUC 1HXMB 1QFUL 4LLMA 4NQSB 1XGRB 3QIBA 2UUDH 2FGWH 3PJSB 4Y4HA 2CDFA 2EYTA 4O2FA 4UB0H 1OPGL 4ZAKC 2CXGA 3HZKA 4OCSL 3VFSB 2OR8A 3KJ4C 4LASL 3H0TB 1RQ5A 1B2WH 1XCQB 2BSSB 5E2VL 3QUMB 2KQNA 1MHEA 3IDIB 4JO4L 3ME0A 1FZKB 4P2OB 2X9YA 4OJFL 1HINL 4UAOB 3V8CA 1CXFA 1K3IA 1S9YB 5C0FA 1N64H 3DX6B 2BK8A 4M6OH 1U8LA 1R3HA 1IVLA 2DWEA 1VPOL 4EDWL 1G6RL 3SOBL 4X4YA 5F9JA 3CPLB 1PYWB 3D0VB 1OAQH 3QHFL 1F3DJ 4I48B 1EVTC 3V4UL 1U8KB 1DDHB 3EGSA 3OKNA 3T3PF 3RKPA 3LCYA 1HQRA 1KTLA 2GYSA 4LMQE 2YK1H 1WAAF 3KPQA 5SWSA 5GZOC 2YUWA 3F12B 2DWDA 3K2MC 4K7PH 2M1KA 3NPSB 4P4KB 1DUYB 3CZFB 3DLQR 2RFXA 4P23B 1SYSA 3FOMB 2MWCA 4BQBA 2DQEL 2HG5A 4Y8DC 5D7LB 4FQPA 1DLFL 5C09E 5L6YH 1CXHA 3MV9B 4B53A 5FA3B 1KXQE 5EBMB 2QHLA 4HIXL 4QXGL 4Y2OA 4MJIE 2AV1B 3U9PL 2A6KB 3P4NB 1F90L 5I71C 2GUOB 3W2DL 3EYOA 4LBEB 5CFHA 1BQUA 3BMWA 1JHLH 5DUBA 5GRZA 3O3DA 1S7QB 3ZTJH 4PJ8C 5JOEA 3UTSA 3B2VL 1C5DB 3EYQD 3IDXH 2B8OT 2R2BA 4K3JL 3QH3A 3ULUF 2V9TA 1PZ5A 2YWZA 1B0RA 2R1YA 5KSAD 2X40A 1KJVB 3FQXB 3VXUE 4LRIA 5MEQA 4X9HA 2HLFD 5DK0A 4U1IA 4KMTL 3VJ6A 3VFTB 5LJYH 1BIHA 4JPKH 3QRGL 3WEXB 3A67H 4WGWB 2YPVH 3VG0H 1UQSA 4XBPA 3VG9B 3WFHB 5AYUL 4AIZB 5A16B 3W0WB 5EBLA 1DTUA 4J4PD 4Y4FD 3ZHKA 3L95A 3CSPA 4RAUA 1PSKH 1NLBL 4XNYL 5DMGC 3IVKA 4Y16B 5CAYB 1S78C 3VFNA 5EDXA 1YUHA 2X4NB 4BUHA 1AI1H 4IRJB 4F37K 3O2DL 2GQHA 1NBYA 3P9MA 4R0LB 5TGBA 1IM9A 4ODUB 4PRHB 3SDAA 1C5BL 5E00B 5D1ZB 2OR9H 5EO1B 2EIZB 5HD8D 2VXQH 2F53B 2JB5H 3QDJA 5L2KA 3P73A 3UBXG 2JCCF 2X7LA 1U9KA 5EOQL 3FQTA 3KHOA 3AS1A 3TIEB 3DMMB 4CU7A 2O26U 3QAZB 1N0XL 5JO5B 1HIML 4LRNH 3RUGF 1P1ZA 4F9LC 5HYEA 1Q9WA 1OTSD 4PJHF 1LO2H 4P5TB 4XP1H 1U8JB 2D9QB 4M1GL 1GGCH 5DMJB 2G60L 4HKXB 3NH7H 4KDWA 4Q0XL 1FNEB 1J0YA 2PF6A 5A2FA 3BKMH 1NGWA 1JPFA 1REIA 4H25A 5EPMA 4U33A 4HS6B 4AH2A 1QBMH 2EDNA 4PG9A 3S34L 4EXKA 3DXAB 1CGWA 3K2UH 3HUJE 3ULSB 5T3XE 1HHKA 4RMWA 1FL6B 3D85B 2R8SL 3V6FB 4PB9H 5FYKE 3W11C 3OGCB 3VD5A 4WWKD 2AQ3A 1D9KB 4PPTA 2ICEB 3DI3B 3OKLB 3MV01 4K2UL 2P7TA 1IRAY 4LSDA 1BGXH 4ZAKA 4OCLC 4JFFD 1VACA 2YWYA 4DTGH 1ZS8A 1MNUH 3O41B 3O2DA 3T8XB 5C9KA 3HMWL 1HH9A 2CSPA 3ARYA 2H2SD 4D0BB 4LCUB 4BKLA 5F72S 2I5YH 3VCLB 1NEZG 1KPVA 1FO0B 3B2UD 4ZUWB 3T0EE 3CK0L 4X8JB 3VFGH 5K9JL 4JJ5B 5KSBA 3VFRB 1NCWL 3ZKXB 4OZHB 2VDRH 4P57B 2FYYB 2DLFL 4YHLH 3MLZH 4MA3A 3O2WL 5J12C 5SV4A 4LSRH 4Z8FL 3W9EA 5T5FH 5J7CC 2YOCA 4RGMC 3VWJC 1R24A 5ISZD 4Q58C 4U1JA 2ICCA 1ZAGA 4KHTL 1KCRH 1KB5H 3L7FB 1CVSC 2YD9A 4YHIA 3BP4A 4R4FL 4MS8C 4UQ3A 4YBQD 5T1DH 3HZVB 4IJ3C 1JL8A 1N6VA 4OLWL 4WUUB 4JG1L 5INDA 5DO2D 4JFED 4YO0B 1CD8A 4ORZC 8CGTA 1JPGB 3MBED 3N0PB 3TVMD 1E28A 4X4MA 1Q38A 2VR4A 2FIKB 2J7LA 2NY1D 3MRMB 1EGJA 1VESA 2BC4B 4AEHH 3K0WA 5T33L 5BV7L 1PVHA 1ONQA 4LF3B 1BLNA 4RBPK 4Q9RL 4ZUSB 3ARDB 4YZFE 1HQ4B 3QIWD 4P2RB 3MXWL 4PJ8A 2R2HA 3AAZA 5I8OL 1WZ1H 5DD3L 5D5MF 1T21A 1CICC 5CD5D 5DD6A 2F19H 1OF2B 2CIIB 4OI9A 3I6KA 4JM2C 5E2UL 3RJQB 4N0CC 3JSSA 3MROB 1U91A 5IHUH 1MLBB 2R4RH 1ZVHA 5CINH 1EBPA 2Y36H 1JPTL 1UVQA 4JHWL 3MNWB 4G9FA 5HI5D 4YC2B 1BD2A 3MOAL 1NKOA 4N0YL 5EA0H 4E42A 3MV8B 1T7WA 1IGYA 1ZHNB 3BGMB 4L29B 4BJLA 1A6WH 4ZG1A 3MZGB 5I16A 3DSNA 4UNUA 1FGVH 3HNSH 1SY6H 3OV6A 1F4AA 4XPHL 3O11B 1JNHB 3ULUD 1IBGH 3SGEI 2EYRA 2UUDK 4CADA 5C2BH 3KJ6L 4PJ7E 4F7TA 4MNGB 1TVBB 5HVHC 1B4JL 1AHWB 1JNNL 2JIXD 2VN7A 1T04B 4YAQB 5F7HA 1TQBC 4DAGH 2JLLA 2A9NH 3DVGB 3QUZD 4C57C 5D2LA 2LU3A 5F9WB 3QA3A 4MCYA 1CDBA 1BJ1J 4DW2L 1HKFA 3W9DA 4HBCH 4PJDB 1P7KA 3UTQA 1DEDA 4UDUA 4HUWA 3GSVB 2WQRA 1JN6A 1QR4A 4F9LA 3FQNB 3HRZB 4GAGL 4K8RD 4PREB 3THML 3U6RB 4KJQC 1Y0LB 1ADQA 1QNZH 4P2OC 12E8L 4UAOC 4WHCA 2OQJB 5JQHC 4G80B 2Q20A 5I1HL 1GOHA 3QHTC 4OQTH 4XVUC 4LSPL 4R90H 5F7DA 2QADD 4GAFB 3LRSB 1S5HA 3FFCE 3N85H 4Z7VE 4D9RD 3WIIL 3FL7A 4LP5A 2FWOA 4P2QB 4BZ2H 2PUQT 3OMZA 1Q94B 3MACL 3B9DA 2PETA 3KLAB 1EAJA 5HYQA 1QO3B 1I3GL 1G7JA 3NPSC 5CGYD 3P0GB 4P4KC 4LGSB 5LXGL 4P23C 2YD3A 4Y5XB 4XWOD 5C07D 4FQCL 4U0RB 1U8HB 3MJ9A 4NKQB 3ZE1E 4KJYA 1ZK9A 4WJ5B 3T09A 4LHUG 5CD3B 2EDQA 4PY8I 5EOTB 4HLJA 4HJJH 3WKMH 4JGMA 1N3NB 4DN3H 4OIIH 4PS4H 4PYHA 3IKCA 3CXDH 1V3LA 1ZHLA 1FVCA 1WWWX 4KVCL 3GI8L 4KKAC 2VLRA 4M7JL 5F9OL 3C8KB 2ZUQC 4PRNA 4LCIL 4KK8D 3ARQA 5DK2A 3GJFH 1JK8A 4HX1A 4GAYB 1CT8B 4PLJC 1CYGA 4X99A 1U8PA 3CVHB 4UDTB 5TF1H 1QA9A 1N5AA 1AD0A 3TCLA 3F7VB 3PWPE 3IYLW 2FCBA 3MRKB 3P0VH 5FYJE 3JV0A 2X9XA 4ZUTA 2DQIH 1VFMA 4PJ5B 1AGBB 5FECB 4M03A 3ZL4H 1MFAH 3DYOA 3WLBB 3VG9C 3I6GB 3HE6D 3OKYA 3PV6B 2ZG3A 2D31B 4D8PA 3CLFL 1D5IH 5CWSB 3DPBA 4QGYA 5BXFA 3WNNA 3QUYD 4MJ5B 5IVZB 1KB9J 1K3ZA 3A0OA 1QFPA 2P5ED 5DHVA 4EVNA 3GFUA 4JEGB 3WBDA 1UGNA 1DN2A 1YEHL 4FFYL 4MA1B 1CICA 4Y16C 3Q5YA 5IROC 5DC4B 4IRJC 4GG6B 1U3HD 1OP5K 5KZCD 3D69A 4R0LC 4ZTPH 5BVPL 3VXME 4EDXA 2JK5A 3RWJB 5D1ZC 1C16B 5HSFA 2DYPB 2FLBT 3H3PH 4OLXL 1MJJA 1A0QH 1RUMH 4LLYB 4OLZH 4TSCL 1S7VA 4U1HA 4ODTL 1KG0B 4M8QA 2Y6SD 1OGTA 3BKYH 3C2AL 3VDCA 5K59E 3HNTH 1AH1A 1XGQA 3SDXA 4EI5D 3DMMC 5ANME 3NTCH 3C9NA 3QAZC 2IFFH 2O93L 1A9BA 4P4RA 3U4EA 1EK3A 5J1SC 1NGYA 5KS9A 4K3DH 4P5TC 1CFQA 2A0LD 2I9TB 2V2WA 5BJTA 3OXSA 3IFLL 1QD0A 1H3TA 2YR3A 4NOFA 3D18B 5IQ7H 3GO1L 5EU3B 4OLEA 5A43C 1A7QL 5HDOA 5DRZA 1QTYT 1TITA 2CKBA 3G9AB 1WZMA 2MFNA 4N90E 4BH8B 3HNVL 5CZXC 1OARL 43CAA 4XNXH 2EDWA 5CSZA 5CJQH 1FYTD 3MRDA 1YMMA 3RAJL 2ZUVA 1HN1A 4NQEA 3OKKB 1P7HL 3BGAA 3O6FD 1OAYH 1HXMA 4P48A 3MV7E 3PIQB 1UFUA 4NQSA 3ZMRA 2JF1A 1XGRA 3ALPA 1D9KC 3LS5H 4LIQE 3FQUA 5CSBA 4J12A 2PYEE 2XQBL 3PJSA 4RDQF 1HHJB 2C3HA 3VFSA 2HFTA 3BUTA 5CKGA 3H0TA 3MUZ1 3BDYL 1SEQL 1XCQA 1C8PA 2VSDA 2BSSA 3QUMA 4F2MB 2VZ3A 3IDIA 4NDMB 4P3CH 1FZKA 4P2OA 1S9YA 4PJCE 5F7KC 5IJVB 5ESQB 1WF5A 4NCDA 3G6JF 4QWWD 2IBGA 2UY6A 3DX6A 2B2XL 3QPXH 1A6UH 2CJUL 1CFTA 3CPLA 1PYWA 3S88L 3D0VA 4S1RH 4QOKD 4Z7WF 2ZCLH 3KPMB 1RU9L 4JHAL 1JZ3A 4I48A 3DO7A 1U8KA 1DDHA 3KAAA 2ID5A 3Q1SL 3PGDB 5IFHL 2Z91B 3NACL 1FIGL 2C5DC 3F12A 3E3QC 3K3QA 1I85C 2H9GB 4OCWL 4CVZB 1F97A 1AFVL 1GGBH 2R2CA 4P4KA 1DUYA 3CZFA 3TIDB 1MUJB 1WT5A 4P23A 3FOMA 4YHYB 2RR3A 1Q0XL 1EO5A 4LVEA 5D7LA 3LN4B 1MVFA 3J7HA 1HYSC 4JB9H 3MV9A 4YDIL 5FA3A 2BNUB 1OAZL 4BQCA 1QHPA 4JFXB 5EBMA 2A1WL 3PGFL 4RMSA 5D96B 4K3EL 4CKVX 1T2QH 1VFOA 2F8XC 4RWYL 5I1GH 4PRID 4M6AA 2AV1A 3PL6D 3ZHDA 4HWNA 1T7XA 2A6KA 3P4NA 3QJHB 5EZIH 1J1XH 2GUOA 3S37H 1MEXH 2YKLL 4XHJC 5DUML 2Y25A 2IBBA 4LBEA 1RY7B 3CFCL 1CK0H 5KAQF 2W9DL 5EWIL 1S7QA 3REVB 3ARDC 3LH2H 1W8NA 4DCQB 4CUCA 5SV3A 3FTGB 1C5DA 2YUVA 3CFDB 3QPQC 4Y4FB 4AMKL 1A14H 5TE4L 1NANI 1HILB 1M7IB 3S4SG 2FJFB 4OGXL 1NDMB 1FNSH 2WUCL 3RVXC 3SKUD 3FQXA 4YC2C 4RMUA 5K9QG 2YA2A 3QQNA 3VFTA 1RZ7L 3WEXA 2OP4H 4BSWB 3QFJD 2A6DB 3WFHA 2Y07L 4AIZA 4PUBL 3GRWA 4QHKJ 5A16A 3W0WA 4MLSA 1UJTA 3EO9H 4G8IB 5FUOH 1JYXA 4N1CA 2Z4QB 1QFWL 1JE6A 3BRGC 4Z9KB 2LQRA 3S3SA 2DBJA 1FLRH 2YXFA 4Y16A 4NKIH 4QTIH 4NWUL 2X4NA 5IROA 4IRJA 4BK5A 4M9OA 1HKLL 2WUBL 1XCTB 1XGPB 4R0LA 5I75C 4XAWL 1KNOB 5IEHB 4PRHA 4ODUA 2I07B 4OZFG 5E00A 1QZ1A 2VDML 5D1ZA 2DQCH 1FO0L 5EO1A 2EIZA 3QP3A 4DGVL 4M43H 2F53A 4NHCH 1NSNH 2PKDA 1BEYH 3WNLA 1I8MB 3UZVB 3DMMA 1DZBA 3VXOB 3RHWF 5JO5A 5DJAB 2WMPA 4D9QD 3OB0K 3MOBL 3RWCB 3S5LB 4KI1A 4P5TA 4UV4H 4XNUH 4HKXA 4ETYA 5LGKA 5CEZE 5CSGA 1FNEA 5IKCB 4OF7A 1CBVL 3MRBB 5H8DA 1NCDH 5EU7E 1GHFH 1W72B 1KB9K 4HS6A 4XCCL 3B3IB 5KN5B 3ARBD 4IMLB 3TYGL 3DXAA 4OZFH 3FN0L 3VRIB 4YDLB 3ULSA 1MCEA 3A6BH 1FL6A 3D85A 3V6FA 4MA7L 3C5JB 3OGCA 4EUPB 1IMHC 1CDGA 1MCBA 5D6CB 1JFQL 1D9KA 2ICEA 1ZTXL 3OKLA 3QXWA 5I18L 1FL5B 1MRCH 4N0UB 4I4WB 1FFQA 1MJ7H 4HHAB 4MVBC 3HPJB 4Y5XC 1C5CL 1YECH 5ISZB 3O41A 3MMEB 3T8XA 2XV6B 1KELL 1LO5B 4H8WH 4D0BA 4LCUA 4Y19D 3VMPA 4XC3H 1AD9B 3VCLA 1FO0A 1T7YA 4ZUWA 4GRLD 4G6FD 4X8JA 4JJ5A 3VFRA 4MAUH 4XCNA 4OZHA 1MCDA 4FQHB 4JFEB 3UPCA 1OM3H 5M7QA 4P57A 4ZMAT 1MF2L 4K94H 3TH4T 3MBEB 1YEFH 3TVMB 4C56D 1JNLH 1DQLL 4XVSL 5EOCJ 3JTTB 1R3IL 4O58L 5DZOA 1MFNA 1FE8L 4OLYH 3MSPA 2OXHA 4D3CL 1I85A 1SJXA 1YMHB 5TDPB 1VB9A 5BZWB 3RIAK 3O6KL 5IBTH 2W59A 5JTWA 3QIWB 4LNRB 4B50A 2QV2A 3L7FA 4PRAB 2BNRE 2ZUUA 2HJLB 3FB5B 4X5XB 3HUJF 3HZVA 1J0ZA 1KYOJ 4WUUA 2ZP0T 1YPZE 4XX1G 3ZKMC 5E8EB 4YO0A 4GBXD 3WUWB 3IGAB 1JPGA 1T1XB 3MLSH 2QQLH 5LWYH 1T03L 2LAGB 3U79A 3RY4A 2FIKA 3MRMA 1XF5B 4S1DD 2NQCA 3FRPG 1NBQA 3BGFB 2BC4A 4K3HA 5IBLD 1BAFL 2WV3A 4BK4A 5SWSE 4ODVL 2DIBA 4ZUSA 3ARDA 4HAGA 3UJTL 1HQ4A 4TOYH 2XA8H 3MRHB 4P2RA 3LQAC 4KHXL 1G9NH 4HCRH 4MA1C 3NPZB 2J6EH 1OF2A 3L9RB 2CIIA 4JRXE 1MCPH 5TH2B 2E7HA 3MROA 1DL7L 3I50H 1MLBA 3LPGA 5C08D 1J87A 4FQXD 3MNWA 5IMLA 1INQB 1VKXB 1KV3A 4ZOAA 4A6YL 3RHWK 4MXQD 1DFBH 4FFZH 3MV8A 1ZHNA 3BGMA 5GS0C 3QUZB 4PBXA 3U9UB 4LKXB 4S0SD 1PG7X 2PNDA 5JA8B 2JJVA 3KXFE 3O11A 2X70B 3WCYA 4EJ1C 2F74B 4LSSH 4CJ1A 3HC3H 4GRWE 3GSRB 2I26N 4NUJB 2CLVB 3UJIH 4KUZH 4MNGA 4L8SB 1TVBA 4YFLI 5I1IL 1AHWA 1FFOB 1FH5L 4U2ZA 1T04A 4YAQA 2FL5B 5J4MA 3ZDXE 3DVGA 3KLHD 4FXLA 3ULVH 2QADB 2JCCB 3IJHB 3QEQD 1IZJA 1MCWW 4PJDA 1RIHL 1FZJB 1M71B 3IJYB 4KTYA 3RUGB 3GSVA 2OK0L 3HRZA 3RWIB 3CX2A 5J56B 1WUNT 4PREA 3U6RA 3W5MA 1LK3L 1AC0A 4MJID 4X98B 4BZ1L 4WHDA 4UTAH 5C07B 2OQJA 1ITBB 4G80A 4YH6A 2RCSH 4I3SH 1JPST 1IARB 4GJTB 3LRSA 1N6QH 1IC1A 3QWRA 4R7NB 4P2QA 2W0FB 1Q94A 3KYOB 3F8UB 1JMZA 4YE4H 4GFTB 3KLAA 5AAMA 1QO3A 1F02I 4WFFE 1EEYB 4XH2B 4HKJB 4WI5A 2R15A 3VXUD 1D5BB 4YHYC 1S3KL 4Y5XA 3U36B 1BBDL 1EFXA 1U8HA 1PKQE 4WJ5A 2CK0H 4PYGA 3SBWC 5CD3A 5EOTA 3SJVE 2BSRB 4MQXD 4NN6C 3QZWB 5KSAC 1N3NA 4YXLH 3V2AR 4RA0C 3EDJA 4MXWH 2HLFC 1MAKA 1IM3B 4WI4A 1HNFA 3HE6B 1HHIB 3C8KA 3P11L 3K4ZA 4JM4L 1AGEB 2EEDA 2DM4A 4J4PC 5E03A 4Y4FC 4GAYA 1CT8A 3B6SB 1MFDH 2P5EB 4ODWA 2F5BH 3CVHA 4ZUUB 3H8NA 5E8NB 1KC5H 4Z7VF 1Q9LB 3F7VA 5GGVY 3CSBA 4HV8B 3MRKA 3MXVL 2Z8VC 4YPGB 5E4IA 5JW4Q 5KOVC 5KZCB 4ZS7H 4L4TE 4PJ5A 1AGBA 5FECA 2VDKL 3VXPB 3S9DB 1RUQH 3WLBA 1MLCB 2EEBA 3I6GA 3X3FH