4HZ1A

Crystal structure of pseudomonas aeruginosa azurin with iron(ii) at the copper-binding site.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
b'ECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Azurin as a Protein Scaffold for a Low-coordinate Nonheme Iron Site with a Small-molecule Binding Pocket.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 27
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hz1A00
3FU7A 3GYRA 2J56A 3MX0B 3FSAA 5I6OA 3NSCA 1M9WA 3S3DB 4AZUA 2EILB 4YSTA 2FTAA 1VLXA 3AZUA 4RH4A 2TSBA 2J5WA 2DYRB 2YAPA 4K9JA 1IBYA 1PLAA 3JTBA 2VW7A 2VM3A 1A65A 3OM3B 3FYEB 1WA1X 2HX9A 3NJNA 2XVBA 2AFNA 1ADWA 3N55A 1AZNA 2B08A 2IDTA 3T6VA 1ILSA 3EH4B 2EIKB 3DTUB 4GYBA 2PPCA 3PAUA 1E5ZA 2BP0B 2YAEA 1CC3A 5FC9A 1NIDA 2HZHA 4YSAA 5TK4A 2FQFA 3TU6A 3QJSB 1ZV2A 1AG6A 3UAAA 1NTDA 2FWLB 1V10A 3ZX1A 2J55A 1ILUA 5D4HA 2UX7A 4YVNA 2OV0A 1ASQA 1QLEB 5B1KA 1NINA 1GS8A 2QPEB 4GP4B 1ZIBA 2ZOOA 1QHQA 3WIAA 4BXSV 2QDWA 1J9SA 1L9QA 1R1CA 1XB6A 1JZGA 2QT6A 1A4BA 1NIAA 4DPAX 1N68A 1X9RA 4HALA 5I6MA 3UACA 1JZFA 2ZWNA 4A66A 3CDZA 1E5YA 4A67A 2PCFA 4TXVB 2AANA 2E86A 4KO9A 4KO6A 2CUAA 3T6XA 3FQ1A 3JT2A 3QJUB 4G7RB 1ZIAA 4HZ1A 3SBRA 1ET5A 1ET7A 2HX7A 4HHGA 2GSMB 3FU8A 2ZXWB 4Q8BA 3FS9A 1BYOA 4AKOA 4AI7A 2GBAA 2FJSA 4JKNA 5ANHA 4NAJA 4CSZA 1SHWA 1ZDQA 4UF7C 5B1AB 1IKOP 2CBPA 1PAZA 3H4HA 2DWTA 2J57A 2PPFA 2Y69B 4HHWA 4EF3A 1J5DA 5I5IA 2EIJB 3HEIB 3SBPA 4DPCX 5B7FA 4YL4A 2R7EA 4HIPA 4JHUA 3G5WA 2H47C 2IDFA 1NIBA 3T9WA 5TK2A 4M3HA 3OD3A 3U25A 1NZRA 3CVCA 2JFCA 1JXGA 2XXFA 6PCYA 1NPNA 3T71A 1A3ZA 1CUOA 1MG2C 1SNRA 1BEXA 2GC4C 3NJKA 2GI0A 3ABLB 1KCBA 1OCOB 2CJ3A 5I5MA 1IUZA 1BYPA 3NP4A 4WTQA 3ZDWA 1JXDA 2H5UA 2YXVA 3ABMB 5E9NA 4G7QB 6PAZA 3NJFA 3NSYA 1GS7A 2XLLA 4P5SA 1WA0X 2X87A 2FQDA 3FSZA 4YSQA 1QNIA 1TEFA 2RACA 4KNTA 3X1GA 2VM4A 2HRGA 2WO2B 2Y1AA 1TEGA 3QPKA 4A2DA 2YAFA 1OOWA 3CVDA 2BP0A 2CALA 3SBQA 2AVFA 3FPYA 2WO3B 1JZIA 4L0PB 2XU9A 4QKTA 3AY2A 5AKRA 1TKWA 1GR7A 4FA7B 2BW5A 3EHBB 3EH5B 1JZJA 2OJ1A 1NWPA 1GW0A 4E9YA 2TSAA 3TBCA 4E9QA 3C75A 2DYSB 3TASA 1V55B 5EHFA 1CYWA 1JERA 3FU7B 3WNIA 3PLYA 1NPJA 3FYIB 1GY2A 1WS8A 1CYXA 1MDAA 3NJLA 4YSCA 4G72B 1JZEA 3ASOB 2YAQA 3CG8A 4PCYA 1JVOA 1TU2A 2CCWA 3IN2A 1BQ5A 1J9QA 2VSMB 5F7BA 3WKPA 3X1BA 1AR1B 1ETJA 2HX8A 1AACA 1E67A 2HRHA 5PAZA 1ASOA 3SQRA 4DP0X 1ZPUA 2GC7C 5I6KA 2FT7A 1NDTA 1NIEA 9PCYA 1URIA 2UXTA 2VW4A 4GY4A 4DP9X 3RYMA 1EHKB 5F7AA 4CSPA 3AG2B 1AZRA 3ERXA 2X88A 2VMJA 1SF3A 3NT0A 5I6LA 1PMYA 1BXUA 1JXFA 2XXGA 4BK5C 2YARA 3FT0A 4A2HA 5B7MA 1ZDSA 1E30A 3UADA 4NB7A 1SF5A 1M57B 5IY5B 5I26A 4KNSA 2IWKA 3NJIA 4NERA 2XWZA 1JZHA 1L9RA 2PLTA 1NWOA 4HCIA 4ENZA 1OE2A 2YAOA 4PAZA 2PCYA 2GB2A 2JXMA 3ZBMA 4BDVB 3FU9A 1FWXA 4UAHA 2FQGA 3AW5A 3S8GB 3BQVA 3FQ2A 3PCYA 2DWSA 2QDVA 3EH3B 3WI9A 3AG1B 5AFAA 2BWIA 3FQYA 3NJJA 3TBBA 3GXUB 3ABGA 2IWFA 4P5RA 5I6NA 1W6LA 3NJMA 4N8UA 3IBOA 3NJGA 1XMEB 2AZAA 3N2JA 3OMNB 3WKQA 4KOCA 4KO7A 4DP5X 1T5KA 1AZCA 1X9UA 2VW6A 1SJMA 1SHXA 1RKRA 4HCGA 1SDDB 4DP1X 2W88A 1NICA 2IWEA 2B3IA 3FSVA 1OCRB 2IDSA 1WS7A 1PF3A 1GS6X 4E9SA 4X4KA 3NYKA 2BWDA 3L45A 1W8EA 2PP9A 1KGYE 2P80D 1AG0A 4W1TA 3ABKB 4F2EA 1PLBA 4G7SB 4E9RA 3BVDB 3S3BB 3QJVB 2FT6A 4JHVA 4YSSA 2BP8B 3PXLA 1BAWA 3CZUB 1KV7A 3X1FA 1XB3A 2YAHA 2LLNA 4AKPA 3CVBA 1PNDA 4DP4X 2W8CA 2N0MA 2XX1A 2MRYA 3OMAB 2DV6A 3AG4B 3FPXA 2AZUA 5B7EA 1AQ8A 2HXAA 3ASNB 3WNJA 4YSRA 2CAKA 5PCYA 3WG7B 1PZAA 3MBWB 1UATA 1SFHA 2FT8A 2BZ7A 1PNCA 3IEAA 4KO5A 4BWTA 7PCYA 4FAAB 1OV8A 3KW8A 2EIMB 3X2QB 1B3IA 4W9ZA 1L9TA 1BXVA 1I53A 2BW4A 2OCCB 2BZCA 3DIVA 4A2EA 1KBWA 2P80A 3QJTB 2IH9A 3NSDA 5B1JC 2I7OA 1SFDA 1W6WA 4KOBA 3IN0A 4KNUA 2ZONA 2UXGA 1IC0A 4UANA 1M56B 2UX6A 4AKQA 3X1NA 4YSOA 1XB8A 1PZCA 1BQRA 2QPDB 3NP3A 4A68A 1OF0A 1MZZA 1FA4A 2DY2A 4BWUA 4HAKA 2YQBA 1L9SA 4GP5B 3QJRB 3S8FB 1L9PA 1AANA 2YAMA 4G70B 2PPEA 1HAWA 1FFTB 2FQEA 1PZBA 1MG3C 1AZUA 1AIZA 3D12B 2XV3A 2VN3A 1E65A 1OE1A 1KDJA 1WAEA 3NJHA 3EF4A 1AAJA 5D4IA 1AS8A 1AOZA 3UABA 1DYZA 4DP2X 4MFHA 1JVLA 4F7KA 3KW7A 1AS7A 1YLBB 1OCCB 3NSFA 4YVUA 3IE9A 2UXFA 4F2FA 5LDUA 1GY1A 2I85A 2XV0A 5B3SB 1JOIA 3V9EA 4DP6X 1GSKA 3AG3B 3PAVA 3X1EA 4BDVA 1ASPA 1EZLA 3HB3B 1RZPA 2XV2A 3QQXA 1RZQA 2NRDA 4YSUA 1OCZB 5AZUA 1L9OA 3UAEA 3H56A 2IH8A 1A8ZA 3UGEA 1J9RA 3PPSA 3V9CA 1OE3A 2XX0A 3ZIYA 2YXWA 1KDIA 1MZYA 3QJQB 2PP7A 3T6ZA 4BXVA 1ET8A 1A4AA 4E9WA 3H4FA 4M4RB 2PPAA 4WKXA 4YSEA 3CDZB 4YSDA 2EINB 4E9VA 3PAZA 1SDDA 1F56A 4AX3A 4BWWA 3OQRA 1BQKA 1GYCA 2MTAA 2HLEB 4A2FA 2PPDA 2Q9OA 1HAUA 4GXFA 4N4YB 2GHZA 4A2GA 4YSPA 1NIFA 1PLCA 2I7SA 2Q5BA 2H3XC 1KYAA 3FSWA 7PAZA 2WSDA 2UXVA 2IAAC 2BP8A 4DPBX 1AS6A 5I5JA 1ID2A 5I6PA 5B1BB 1DZ0A 2BO0A 1PCSA 2BHFA 3S3CB 1KCWA 3T6WA 1KBVA 4E9TA 2IDUA 2VSKB 4E9XA 2XYBA 1PY0A 2IDQA 2R7EB 4Q89A 1N70A 4DP8X 1CURA 1HFUA 3GDCA 4DP7X 1BXAA 2A3TA 2FNWA 5B1JA 3OMIB 1IBZA 5I28A 4QLWA 1J9TA 1A4CA 1V54B 1RCYA 1AZBA 2PP8A 4ZK8A 1WA2X 3TA4D 4G71B 4GP8B 8PAZA 5A7EA 3DKHA 1J5CA 2JKWA 2GIMA 2XUWA 4HCFA 5D4JA
chains in the Genus database with same CATH superfamily
3FU7A 5JHMA 4GG8B 5T5NF 3O3EA 3O9WA 3INUL 1Q1JL 1HSBB 2DH2A 1ORQA 2EILB 1BQHA 2JK5B 3MRNB 3ECWA 5D2NE 4U3SB 3VXMA 3TO2A 4PJIB 5JIQA 3OWEA 2YKKA 2C26A 3T5WA 2YAPA 5DJ8B 3CFEA 5AVYB 4QOKA 2APWA 4AUJA 3ARBA 3ES6B 3MRIA 4UT7L 5ITFA 1AGDA 4OY9A 3F00A 2OSXA 3NJNA 3WFZA 1KXVC 4ESKA 3LSOB 2EH7L 4OLXH 1MN4A 2JTDA 3N55A 1GOHA 2QKSA 2AKRB 3LTVA 4WIQA 3G6DH 2V5RA 3EH4B 4OCWH 2DKMA 4P46D 4JN1L 3D9AH 5JTWA 1C7TA 4F58H 1MFAH 1U8KA 3HR5B 1NC2D 4GSUA 5FW7A 4YNYB 5A6LA 1JRHL 4YSAA 2QPUA 2QJDA 2FQFA 3VH8G 3QG7L 4B9FA 3Q2WA 1IILE 5E6ZA 5C0JA 5KBMA 3KGUA 4I2XE 2WCSA 4ZW8A 5KSVA 1CMOA 1F8TL 1TYJA 1WD8A 3HRZB 4FE9A 3IFLH 5CEYB 3BHBB 1LQSR 1SRDA 1UADC 2E6QA 3G6AA 3WJMB 1UJTA 1XIWA 2ICWB 4AL8H 1F5WA 1XAKA 3MFGB 3QR0A 1WEJL 3GMLA 3LN9A 4YC2C 2H0JA 4QWWD 4BXSV 3V6ZB 1NIAA 3NESA 4XMKH 1E28B 3K91A 1E4XH 2CJTA 5DLLA 3WFCL 1N0LB 1D6VH 5HDWA 5I6MA 2HA1A 4M4RA 4FYRA 3VFVA 4MMXA 3U79A 4Q9CA 4AQ8A 4NZDA 1LEGB 3DX2A 4JR9H 4DN4H 3F6LA 2UYLB 2C5DC 3RWJA 4LHUG 2D3JA 1RURL 1DJSA 5GZNA 3PNWB 4XZUA 3KBFA 3N06B 2GBVA 4K8RC 1MCPH 1QG3A 5AD0A 4WQOA 3NPZB 4X9BA 4I0KA 3MOAH 1HH6A 4P5MA 3SYQA 5LBSL 4X5RA 3D87B 4AH2B 1K2DB 4OV6F 1YJDL 1RP9A 3NFPA 3WBDA 3ZRSA 3TL5A 4OAWB 5DHEA 5B7FA 2H32B 1TQSA 3IWVA 1I8LA 4F93B 1UOLA 4Q2ZB 4NFBA 5TFSH 3DBSA 1E43A 3S7GA 1T20B 3R19A 4NM4L 4H2AA 1AIFA 3U25A 1UD8A 2DWDB 3ESOA 3A24A 4Y19D 2E47A 4LK4A 2I69A 4V1DA 4PJ7B 3QUXD 4Z7QB 4M1GH 3C09B 1CDHA 3ARGD 3GI8H 3QPQD 4KTEL 1RSFA 1EHXA 5DF0A 4IS6B 4OTXH 1LK3L 3PL6C 4Y1TA 1U8HA 1JXDA 2H5UA 3KDMB 3O6FD 5EF3A 2NY3D 3LV3A 2CLVB 4ZXBD 4YSQA 1QPKA 4WY7L 4MTMA 4MDJA 1M6OA 1NKGA 1YMMB 2RACA 4YXKL 4JDZA 4XNMA 4CMMB 5DT1L 1X7SA 3TV3L 3PV6A 2E46A 2A38A 1FBIH 4U33A 3F6IA 1ZKAA 1T2XA 5FOBB 2DJUA 3B37A 3OLGA 3I2CL 5TDPA 4GG6A 1A02N 3ULVH 3LRSA 1FORH 4FQQA 4GRWE 5C86A 2QSVA 4XRCB 1OTUD 2WO3B 4Q9RL 2QADD 2XU9A 5D1XB 3ULVD 1TZ8A 4U1SB 1KGCE 3OAZK 1YEEL 3LVEA 3H2WA 1ZT1A 1BECA 5CJOH 2R59A 3HLAB 1JNHB 1BFVL 1FI8C 4C56B 2EDMA 5HYJD 1A4KB 3MA9L 5D93C 2CGYA 3UYPA 4NKIH 4DN3H 3MXWL 1QRNA 2UVEA 4G6KH 4AQAA 4N0YL 1AGFA 4FNLL 4Y7OC 4WI8A 4F37K 3D25A 1NPJA 3PFQA 4NBXB 1QHPA 3NH7L 5EZOH 2WNWA 1KPVA 4K15A 1LEKA 4PY8I 5AVXB 1F3DH 1K4DA 1WZ1L 3H3KA 2NSMA 4N6RB 5I16A 3OTTA 2B5IC 2P5WD 4ZZFA 1JZEA 3DETC 1MCEA 4Q52A 3X14A 3W3BA 5I1AB 2K0RA 4LKCB 1KT2A 1BQ5A 1P1VA 2VR5A 4GQRA 4PP1C 3SE6A 5IF0A 5D7LB 1BGXL 2NW3B 4R4BA 4KBPA 1YMME 4OJFL 3ZKXC 2LAGB 4JREB 1IZKA 1ZHBB 1B4RA 1E6OL 5HHVL 4G9FE 5E99L 2BSED 5F89A 1K8DB 4N8CL 4L8SC 3VFSA 4F7PB 3ETBJ 2L3BA 3PWJB 1JWSB 1N67A 5AOMA 4YLBA 1EHKB 1GYUA 3IT8D 2PO6D 3CLFH 4JO4L 1IM9A 2A1WL 1LM8V 4O4YL 1G7QB 1KTBA 1J8HE 5D1XE 3NEOA 2YBRA 1BQLH 1EFXA 2CBOA 5C3TA 5C71A 5AVVB 2VJ0A 3GWJA 1ZDSA 1CVRA 2VUYA 3ZKQD 2O5ZL 1SQMA 4C56E 3WS3A 1MPAL 4AGQA 3V7AE 2DLEA 4WO4B 6FABL 4PJXB 3HC2A 3VRIA 1IBHA 3T3MF 2DLTA 3U2IA 1JPTL 3IJ8A 4I3RL 4P23D 4F2MB 4UM8B 3QWRA 2A9DA 4BDVB 1NMAL 3MRBA 4M00A 1C5CH 1O75A 1UB6A 5A40E 3AW5A 1KV3A 4GIPD 1CYGA 1R6VA 2YD0A 3MUZ1 1FAKT 4W9LC 5FUCE 2DM2A 4ERSL 3P0VH 1PJ9A 5IHLB 3EJPA 4OCYH 2MWCA 3NJMA 4N8UA 2C9RA 1RV6X 3WFBL 1R3IH 1ZLUK 1JZ3A 2XDHA 1EWHA 1SJMA 2DQHL 4L8CB 2IWEA 4A6YH 3AREB 1GGYA 2CLRB 3O3UN 1GXEA 4M8QA 4NO3A 4FQLH 3RG1C 3V4LA 5F6IC 4NNYB 3VXSE 4ZMYA 3ZDYB 2WBKA 2EECA 5CSGA 3OGCA 2XOTA 3W39A 2G2RB 4HWBA 4KNQA 1E9PA 4ETQA 3L3KB 1G5GA 3A4EA 1QFWH 1U33A 3RVXD 2O6CA 1OANA 5HY9A 4OV5A 3DOHA 5IREA 1U8PB 1BOYA 1QLRA 1UD2A 1KV7A 1U21A 5IFAL 4RMTA 4AKPA 4QO1B 2Y5QA 2G9HB 4YWGH 1HJBC 3OAZH 4MX7A 3QFDB 2XCMC 5EIQA 1JE6A 2BK8A 4J4PD 2K6WA 1MCLA 3KPLB 5JXED 4FTVD 2CHDA 2XWXA 2RCSH 2CGZA 1S5IH 5F96H 2WUBL 5IIEB 2F53E 4BRVA 4JFPA 5E51A 4FAAB 4Y4HD 3WD5H 5SWQA 3B2PA 1KNOB 4TOYL 1HZLA 1GMEA 5GGSB 3IS1X 2OLDA 3THML 1L6PA 3S0PA 3VXUA 1BYNA 3NQIA 2FH8A 2MQ0A 1IC0A 1KCVH 3O3EB 2UX6A 1CFVH 4YSOA 4AC4A 5DJCA 5LGKA 1BQHB 3IGAA 3F5WA 3TO2B 2MJWA 1KFGA 1P7QA 5D1ZI 4Z6AT 2X1QA 3AT0A 1ZTXE 2XA8L 4Z7WF 4QOKB 4HXBH 5E24E 3ARBB 3MRIB 1C5DA 1IT9L 2OI9B 1EUTA 1AGDB 3C2AH 3IJEA 5ITFB 1QFOA 4L9DA 2WY3B 1F1GA 3QEUA 1ZSDB 2JKSA 3R06A 3DGDA 3U36A 3O6KL 4HUCA 3EGDB 5KG9A 1UOVA 4JFQA 1RMFL 5IG7A 2EYSA 2HRPL 1G1CA 2X9WA 4U1NB 3CC1A 1YY9D 1B0GA 4I9WD 4M43H 3IPBA 1U8KB 8FABA 1I8AA 4A63A 3LZLA 1CXLA 3ZHFA 2NY5L 3DUSB 3KPSD 1A7BA 5C0JB 4WHCA 4F2FA 1UZ6F 4YHNA 1QW8A 5KSVB 1JNLH 4OD2A 3KL0A 5DQDL 1BD2E 2VR6A 3ZQ9A 2ZCZA 3G6AB 1XIWB 4R97B 1NPUA 2XFGB 1DCEA 2PCXA 3HB3B 3MXVL 4Q6YA 1RXLA 3RU8H 1EBAA 2DMGA 3ARWA 4LOUD 1OY3B 2KYIA 5DEGA 4ODTH 1OP9A 4HJSA 4U2YA 2XY1A 4OZFB 1MLCA 5I9QB 2J4WH 2EEAA 3DXAD 3TO4D 5JOFA 3T6ZA 4MXVE 4BXVA 3VXME 3FH8A 1A6PA 1Y18B 3IDIA 4M4RB 3VFVB 4MMXB 5LN4A 4HEME 1ZLUH 4ZPVA 2O5YH 1A6WL 4W9HC 3OL2A 2Z7WA 4J3OG 5E5UB 5I6XC 1A7RH 2ZUTA 4TSBH 2WZPD 1KCSH 1IEBA 3RWJB 5JZ7D 4YSPA 2H3XC 3GB7A 2ZUXA 5KYXA 2WKOA 1VEMA 3GMRA 2H0FA 4XZUB 3UAJD 5F6HJ 2H2SC 2ICES 4PRNA 1KPUA 3O6MH 5AD0B 4OQTL 2BIPA 3S8WA 4QRTB 5I6PA 1DZ0A 4P5MB 3ARDD 2JKLA 3F12A 3IM1A 1G43A 2IVFC 3NFPB 2QGEA 3EYOB 3MCLL 5GGQL 3R18A 5JMRA 3KR3L 4ZJ9A 4PCKA 3QIUC 3SJVD 1OAUH 2NTSP 5D9SA 1IGCL 3VMNA 1UD5A 3MBWA 3P0GB 4DP7X 1BXAA 1AHMA 4LRNL 3L3DA 2HKHL 4YEEA 1UZGA 1AIFB 1WFNA 1HWHB 3TT3H 2X09A 5I8KL 4ZK8A 1X9LA 5MP6H 4A04A 4IBYA 3FFCA 4J3UA 3LKSA 4PIRF 4V1DB 4TTGA 1J5CA 5FYKU 3L8QA 5D4JA 4PJCF 2G3ZA 4Z7AA 4RSYA 4NO0D 3O6LH 2CJUL 2HWZL 5HGAA 1U8HB 5D1ZA 5J3HD 4K7FA 3LV3B 2X89A 5L4MA 3VQMA 1GJIA 3BSHA 3ZL4H 3DJTA 3BCFA 1T0OA 2VN5A 3Q7JA 4AITA 5CJBA 4MDJB 1M6OB 3PNRB 3OM3B 4JDZB 4XNMB 4JGUA 1IMHC 2XIIA 3LX9A 1M7UA 3PV6B 2X4QA 1KYDA 4FEIA 4IYKA 2KMWA 3ZYJA 2EUZA 2VLME 1FP5A 2DJSA 4KVPA 5LB1A 2Q86A 3QCTH 3BYYA 5TDPB 4WLCA 1E5ZA 3LRSB 4FQQB 3SPVA 4YDZA 1DL7L 1L6ZA 4JQIL 3TJHD 2HLFD 3OXRB 1EJ8A 2VGLM 3KPRD 3Q48A 3CSFA 2OZ4A 3UMTA 3I6LD 3VH8B 4KY1L 3UROR 1TZGH 2HN7B 4YC2B 4XN9A 3ZXAC 4NQED 5C0RL 1QSFA 1W2KT 1EERB 4Q6KA 3UYPB 4R0LC 2XFXB 1QRNB 3AQYA 4KI5D 4R7LA 4AQAB 2BOCA 1FZMA 1AGFB 4PMEA 3F7PC 4BCZA 4V1DE 3M17A 3D25B 3B2DC 1I9RH 1F3DJ 2FGWH 1UM4H 2CO4A 3S2CA 4M6AA 3DYMA 1KPVB 2EKJA 4U3CA 1LEKB 2WP3O 3TIEA 2WAHA 2A9ML 4N26A 5I16B 2BH0A 1X5KA 4TSAL 5CWSA 5ISZD 3BESR 1AQDA 4TNEA 1RZFH 3UACA 1A9BA 1Q0YH 1SZNA 1YPZF 2D3LA 3DHJA 1KT2B 3CFCL 5KSAD 4HUMB 3CZJA 1TZIA 4MGXA 3QXAB 4R4BB 3OSKA 4M6OH 3ALPA 2CHNA 3MJWA 4HF5L 4KO9A 1FLTX 5IQLA 4PJ5B 1MFBL 1SM3H 4PI2A 3Q2CA 1W0WA 1JF1A 4PY7A 5F89B 3BJ91 4KTYA 1HNFA 3VFSB 5AVRB 4FNTA 5BS0B 4GG6E 4GO8A 3G3LA 2XICA 4X9IA 4C83A 1IM9B 4KRMB 4FKEA 3ZTJG 4AW4A 3IFNH 2GSMB 2X4NB 2EDKA 4XO4A 1P4LA 2YBRB 1EFXB 4FQJL 2DLFH 4E41A 2JKIS 1CGSH 4Y89A 3OKKA 3BJLA 2FJSA 3QORD 2B9AA 1SN5A 3QIUA 3QQ9D 2EZ0C 4JKNA 1PY9A 3K8MA 3MV01 3GSNA 4MB1A 1R17A 1PAZA 3WS3B 1QEWA 2VAAA 1WIPA 2Y69B 4XPAH 2IGFL 2PTTA 2YGOA 4J3BA 3C6LC 4FZEH 4X5LA 4BZ2L 3B9KC 4HJ0C 1UWEH 2XN2A 5JOPE 4XN8A 1HHKA 2KZKA 4M3HA 1JGDA 3MRBB 4UINH 3KGSA 1UB6B 2P44B 4DEPB 5JHLH 5DS8A 1KYOK 3MRFA 3OKYA 5AW5B 1ZT4B 3K71A 4PSPA 2BNRD 1PAMA 4S0SD 1EZSA 4Y8DC 7CGTA 1KC5L 2FBOJ 5FA3A 4OD3L 1HS6A 4LSQH 3ARPA 4Z1PA 3RVUD 2OYPA 3A6BL 4YHZH 3HMXH 1IC4L 3DOSA 5INDA 4AQEA 3DIDA 4YOKA 2DQIH 4M8QB 3O2WL 4QCIA 3RZWA 5LCVA 2COVD 1C5BH 4RX4D 1JMZA 5BRZD 3OGCB 4FI7A 3CK0L 4TN9A 5ALBH 4LLMA 4PV8A 4RMQA 1WFIA 3W39B 1E9PB 4A2DA 5LNGA 4XCYA 1NOAA 2WSKA 2ZIDA 3LS4L 2P43B 3CZNA 1ZPLA 3C2SA 5HY9B 2OSLA 4IRJD 4OV5B 4NQDB 3IDJB 4XP5H 1QLRB 5FB8A 1X5FA 3CXHK 1ACCA 4MZRA 5D93B 5C07E 4WSJA 4MX7B 2YQ3A 2EC8A 2B4CL 3SPHA 5DC9B 2DJ4A 3WLWC 4PYGA 3STLA 2CRIA 4PJHE 3VFGL 2DYSB 2A9CA 2CO6B 2HUEA 5E5LA 1BW8A 4FYTA 4QXGH 2AXFA 4JFPB 1ZS8B 2N7AA 2Q2LA 3QDJE 4LLQA 4XN4A 3WTWA 3UOAB 4S2SA 4EAEA 5SWQB 2WYZA 3FH5A 5IJKC 4HFUL 2E9JA 1TQUA 4JG1H 1ERNA 4G72B 2D03H 1JFHA 2MHAA 1WD9A 2MCPH 1WISA 5HP5A 4PCYA 5JIDA 4IIQC 3DURA 2EDNA 2R9HC 1BQUA 4XOBA 5I19H 2K7PA 3D39A 2IJ0C 4UYQA 1AACA 3IGAB 3CE1A 3F5WB 2ORBL 4JZJC 1RIHH 1YEIH 2ENPA 5F7HA 1IFHL 1P7QB 4DP0X 1S78D 1CGUA 3V0JA 2EDWA 4I3SH 1SMOA 3RWGB 4CC4A 2P45B 3IJEB 3M8OH 2CLZA 4G8IA 3QEUB 2VW4A 3R06B 1BG9A 1DVQA 3U36B 1GAFL 4JJOA 1E7UA 4RBPK 4U4BA 4BCYA 5KG9B 2YPVH 1SF3A 5LAXA 5IG7B 4XMPH 3US9A 1U36A 2GK2A 3LD8B 4KVNL 4M6NL 3CPLB 4TMPA 3NQKA 4BQ9A 1E30A 3C6LA 3FT9A 1FPTH 2NX5A 1B0GB 2XA3A 3B9KA 8FABB 3VXNA 1BREA 1VADB 1JZHA 2DQ6A 2ZX9A 4GAGL 4HS3A 4WNJA 2FX9L 3WENA 1P9MC 2E56A 4YHNB 5F70A 3TGXA 1IGJA 3L08A 1QQDA 4ZO9A 3SYAA 2VWEC 1RY7B 4G42A 2Z0BA 4GUOA 1NEZG 3NVQA 1N6QH 4NEHB 3CN4A 4I0PC 3BWZA 2FQGA 3BSZH 4MAYC 3VXUE 5DEGB 4XNUH 3V4VA 4C57C 5L7XH 4XP1L 3W0WE 2FWSA 3TBBA 4AV5A 1MLCB 5D1QD 2VLJD 1I75A 1TPXC 2IWFA 3ENEA 5JOFB 1NDGA 2BSDA 3IE4A 3P2BA 2DLIA 3EHBD 1HK6A 3N2JA 1ANUA 3IDIB 4TSCL 4ZFFA 1FSKC 5CGYC 4AXWA 4ZPVB 5F6IB 1RLBA 1T5KA 4DO6A 2DQCL 2NUPA 3CMOL 4HCGA 5C08D 4DP1X 4K3JL 4Z77A 5IMKA 3TX4A 3K0YA 5B3JF 4NUGL 4ABWA 1IIKA 3UTTD 5DLML 3T3PB 1IEBB 4E9SA 4EI6A 2BVYA 4X4KA 1HCZA 1OARL 5J57B 4O02A 1W8EA 5KYXB 3APMA 3H6JA 1KTCA 2R27A 4YBLB 3FB6A 1O6SA 3GMRB 5J6SA 2RIKA 1JNNH 4PRDA 5CEZH 2ENYA 2XRAL 5GS0H 1EAOA 3F01A 4K94C 1KPUB 4IOIA 4PRNB 4WUKH 5I2IA 3TFKD 3RZCD 3K2UH 5CEZD 4WI9A 5AZEH 2MMXA 4L2YA 1KYFA 3V5DA 4QEGA 4H8QA 4RMBA 4N2OA 3F12B 4DP4X 2V7HA 4HQQL 4JJ5A 1RJLA 4JRFA 3FUFA 3ULSA 4L9LC 5ERWA 3PS6A 1O7VA 5D9SB 3QR2A 4DW2H 4YSRA 3K80A 5CP3H 1J86A 3MBWB 3MV9A 1PCXA 1GPOH 3L3DB 7PCYA 4ZX3A 4YDKH 2QMJA 2NR6C 4PJ9B 1QACA 2V17L 1J1XL 5KYNA 4UQ9A 1Q90A 3FFCB 3W37A 5TE4L 1V7MH 3HG5A 5CZVL 4JPWL 1THAA 5D70L 3FN0L 3SE3C 5TQ2L 5DRXA 5HJDA 4BFFA 5DD3H 4JFFA 5HGAB 5JIHA 3MLWH 5D1ZB 3QEGH 1U3HC 2IAMD 4K7FB 3X3FH 4A68A 2LHAA 3FQRB 1XGQB 1JGVH 4LVHB 3P1VA 1X9QA 3L9BA 4P5TD 1CLVA 4NI6A 2NY0C 1K8IA 1HC1A 1B9ZA 3PJLA 4ISVA 3WIIH 2FQEA 1E5BA 4IOSA 3BZDA 4RBPH 2F9BT 1WZMA 2LR4A 1CLZH 1AZUA 1CPUA 3AADB 3N0AA 5DYOA 3ESPA 1OZTG 4Y4FD 4K5OA 1MFCL 4FF9A 4P2RA 1QFHA 1P9MA 2Q86B 4OI8A 4HPHA 3SPVB 4CJ0A 5D4IA 1AS8A 3CX5K 1PIFA 3FT2A 3GJEA 5DI8A 1GZPA 1JCKA 1GCYA 1EJOH 2R0WL 2DLGA 1BEYL 1AE6H 2HFGL 1CICC 3F7RA 1U8LA 1YNLH 4YVUA 2UXFA 4I0PA 1UYWL 3HBPA 4MAYA 2NZIA 4KC3B 3H42H 1QSFB 3BUIA 5FK9A 2VDPL 2A7BA 4XC1H 1SOXA 2BOCB 1FZMB 2IDCA 2A4ZA 2NRDA 2PYEA 3M17B 5FA4A 4O2FA 4F7MA 1TQBC 3KWVA 2OW6A 4KDWA 4LL1A 5GJTL 3U2JA 4OFYD 1EIBA 3D52A 3WUZA 2ZXEB 4ORGA 3V9CA 2BOBA 5CO1A 2OMUB 5EUKA 3ATBA 2ZUQB 1SN2A 5CWSB 1OGTA 1AQDB 3II1A 2XQ0A 3BVXA 2XIDA 4E9WA 1A9BB 1ESOA 1OAXL 3D4CA 3EOTH 5E70A 3SDDC 4YHYB 4PHXA 4GW5B 2F7RA 1TZIB 1SUJA 1UM5H 3PAZA 3MLVH 1KJ2H 1TYEB 3L1OL 2CKNA 3A0OA 1WPCA 4IM8A 2IQAB 4HJEA 3GXDA 1W0WB 3FRPA 3MACL 1JF1B 1PY4A 4PY7B 4XNYL 3PAYA 3WIHL 7FABH 1F6FB 1G87A 3F62A 2JCCA 4C83B 3FSWA 2F54A 4TVSa 4PLJD 4RAVA 4ZMVA 2VCOA 4HLZH 4KTDL 2ZD0A 1P4LB 1BA9A 2VLRD 5DWUL 4E41B 3CSGA 3OKKB 1MCHA 4L9LA 3QIUB 3E2HC 1AQKH 2DMHA 4PW4A 3RL2B 1F3JA 4OB5L 1F4YH 3GSNB 3RX9A 5CCGE 2CE6A 4Z7NB 1DQMH 4M6MH 4M8VA 4E9TA 1NAKH 2IDUA 5GPRA 1FIGL 1OB0A 2NR6A 3ALXA 4QRRA 3BFOA 2OXHA 3FN9A 3MZTA 1J5OH 3LEVH 4ZI8A 2F5BL 4ZUSA 4F20A 1HHKB 1TVHA 4N5EC 1T66C 3VQLA 2QV4A 1Z9NA 2RTTA 3G08A 3T1WA 1EGJH 2YD7A 2AEOA 3KXFE 3SE3A 5DS8B 3MRFB 4YHIA 3AXLA 1YEWA 3WO4C 3QH3A 1GTNA 3U46A 3K71B 1U3HA 4HGWA 4KDVA 5FM5O 1NL0H 2UWEB 2DQJH 2EDLA 3QBTB 5FA3B 3OZKA 3VTAA 1M53A 2CZNA 2XBZA 3VFUA 5E08H 5AB2A 4BELD 4ELMA 2NY1C 4ONOA 2NY6B 3DOSB 1HYSC 2VDPB 4P3CH 4XBEL 4AQEB 5INDB 4J23A 2X3AA 2MNUA 3MOBH 4O58H 3TVMC 5JW4N 4QCIB 5I1IL 2HKFL 5J7CC 1IU1A 4KQ3H 5KVGH 1JZDC 3QGVA 4E41E 5FUZL 3CAFA 4K7PH 2X4SA 2N1KA 4LLMB 4PV8B 1MFEH 4XCYB 3C5ZB 1DN0A 3DTUB 4HJGB 1WWBX 2R8SL 4UQBA 1CGYA 5FB8B 2WYIA 4MZ3A 1NJ9A 1QD0A 2NDFA 2X1XR 2N59A 3JVGA 5ABZA 4TQPA 4Z7OB 4M61A 5K69A 3WFEL 1N5YH 3ZE2E 3C08L 2QMKA 2Y0SA 3STLB 3IKKA 2F7PA 3ZTDC 3BP4B 3RHWK 2ESVE 4WGVB 4AJVA 1J9CT 1CFQA 3NIGF 3QHFH 1LDPH 2AXFB 1FRGH 3HS8A 4LLQB 3SD5A 5IGXH 3RFZA 4F3FA 3OC8A 1J7VR 3AQZA 4J28A 4O02L 1KGCD 4RWHA 3S35X 4S2SB 5MENA 25C8H 1V8HA 2W38A 2OTUA 3SDDA 4HLEA 1IB5A 3E8VA 3NEEA 2EJ1A 1X9RA 1LO5A 4P5KB 3WFDL 2IAND 1DBJL 2GK0A 2MHAB 5BVPH 3ETBF 2ZWNA 3JYBA 4YZFE 3DURB 2OKMA 4IIZA 3BPOB 3FCGA 3D39B 1E90A 4XAKD 5ICXA 4IKNA 4H88L 1MFMA 3LJ3A 1DVFA 5AL0A 2R1XA 4MCZA 5D7HA 4ICXA 4X99A 4LDCA 5A2JH 4Z95H 3P4NB 2AI0L 2DOCA 2CLZB 4G8IB 5L9DH 2D7MA 4F33A 2BNQB 2FRGP 1ZV9A 4Z3JA 4OSUH 5C0CE 3ZE1F 4F24A 3HVDA 1ET7A 4P9ML 4OUOA 3LNDA 5LAXB 5AUMA 2A77H 4FYSA 2CPUA 2YGPA 5CF3A 3SE9L 4YZWA 4XVJL 3WS6C 2NX5B 1OZUA 3B9KB 2ZXCA 3FO1A 4G9FD 3WNOA 2YFNA 1NLDH 3VXNB 3HA0A 3MNZB 1BOGA 2PPFA 1CTNA 4HS3B 4JRYD 3UG4A 1OT4A 3LH2H 2RGSA 4W6YB 4GW4B 4TQEH 4YL4A 1IGJB 4AQ1A 2JE8A 1QQDB 3GXMA 1J8HD 4G42B 4UMGA 2FUTA 2DBJA 3UAFA 1LO2L 3EYUH 4Y5XC 4L0ZA 2A73A 2WXJA 3UFIA 2R0LL 2F5AL 1KGJA 1KYOJ 3VFTA 2XQYG 3CVCA 3KLLA 3V4VB 2VR9A 2ZOKA 1DVXA 3Q1EA 3ZTNL 1AXSA 2YPLE 3WNKA 3MC0A 4D94A 5CLXA 2Z8VC 4KQ4L 1NDGB 4LCIL 1FNSL 2DDQH 3ROOA 4O5LL 2X9ZA 3TVMA 3DMMD 4AVKA 1QSEA 3ABMB 4UQEA 4AXWB 1M3JA 4G7QB 2NUPB 4XP4L 4Z77B 2QQKL 2GW5A 1MUJA 2B1HL 2HTKD 3DSFH 4R7DA 2EUVA 5C0GA 5EULV 3RAJH 2XPYA 4EI6B 1FVEA 5L2KD 4O02B 1TEGA 1U8QA 3FB6B 2QHRH 7TAAA 1O6SB 5I0VA 2VXSH 2CKBL 4HWEL 4YFDB 5D7IF 1GZHC 3V2AR 4IOIB 1P84J 5T1LA 3CXHJ 1VJSA 2JJTC 2N4IA 4H0LC 5T3ZH 3WNPA 4WCYL 4XP6L 1J48A 3V5DB 3AY2A 4MD4B 4FQCH 4NO2B 1R0AL 2V7HB 4JJ5B 4GUCA 1KB3A 1IC1A 2OJ1A 1RJLB 2JSFA 4YQXH 3ULSB 4OGQC 5ERWB 4GRMA 1YYLL 3BE1H 3CFJA 3MV9B 2APVA 4L3ED 1CYWA 2ZWYA 3VXPB 1BZ8A 2FO4A 4TPRL 4BE5A 1EHLL 3UBGA 2EIDA 5C70A 1DO6A 1FLRH 3K8KA 3NDYE 3VD4A 2F8OA 3LRLA 5E6UB 5K9OA 2ZXQA 2WINA 4MCNA 2R29L 4K23L 4NZRH 3PABA 4ADIA 3BLPX 3CFIC 4UAOC 3QEQA 3S88H 1G9NH 5DRXB 4KZEL 5EZJA 4J27A 2VDML 5F7BA 3WKPA 3MJ9H 2F53D 3LXUX 4U7MA 4XPGL 3ZVVA 2HRHA 4Z7WA 1L0QA 1D2OA 3PWVA 3VU1A 4HZLA 1KTLB 2GI7A 4ALAL 1NIEA 4YIQA 2VZUA 2BNUA 4DJMA 1K8IB 2Z92A 2NY2D 4ISVB 5F7AA 1DBMH 4FMFA 3BKMH 4Y1AA 5CIPH 3WS6A 4XX1E 3WUWG 3ATEA 4BZYA 3NACH 1G7HA 5GRVK 4ABQA 4IBZA 1JXFA 4F8NA 4BK5C 2WXIA 4P2RB 4CVXA 4WNQB 2CRZA 3EGSA 1MNUH 5F9WB 1JIBA 1OHQA 1PEWA 2WVTA 1K85A 1IC5H 2R1WA 3FT2B 3GJEB 1GZPB 5DI8B 1RP8A 2QLVB 4Y5XA 1B2WH 1AD9A 1U8LB 2WXFA 3GLZA 1NWOA 3TWCH 5IBLC 5C0BA 2J12B 4GOSA 4QYOA 4CJ1A 2CHWA 4IRZA 1GZQA 4BH7A 1XBDA 3D85D 1JHLH 5FK9B 1PZSA 2GB2A 3BUQA 1RUQH 2AK4A 2A4CA 3VXOB 3O8XB 4IKKA 1CI3M 2BWQA 4WHYH 5GHWH 2AEIT 4YPJA 3PCYA 4O2FB 4PBWD 2EP6A 4QR7A 4XBMA 1PYWB 2XQYA 3MLPA 5EU7C 1H8NA 1HHGA 3RA7L 2BOBB 4UU9B 2R23A 4LPVA 4JFFE 4M3JA 3CN3A 5B1CA 4TNVF 1ICTA 1VAHA 4R9HA 2DYPA 1OGTB 3H9SA 4L1DA 1BD2D 1JSYA 5CCKH 2ZP9A 4Y9BA 4S1QH 5D7JA 1JZ2A 4KKBD 1DVZA 5BOPA 2NY7H 1M7DA 1RZJH 1CTMA 3VW3H 1FL3A 1GZHA 3S96A 3SYOA 5BV7H 2JJTA 2JCCB 1VGEH 4MMYB 3QYMA 1TTUA 2CNYA 4U0QB 1OLLA 2P80D 2F54B 4YWGL 4GI6A 4RAVB 2XTSA 1INQA 3QDMA 2XY2A 3TZVC 5FYLE 2FT6A 1X7QA 2F58H 1XXFC 3ORJA 1X5LA 1CDUA 4L9LB 1JD7A 2VDMB 5F96L 2ZOUA 1UHVA 3ULUH 1Z0MA 4ZTPL 1F3JB 3AU0A 2X6UA 4HOWA 2OW7A 2VL5B 3ULUD 1G7LA 4P2OC 3QIWC 2ZWZA 1ACYL 4JZNA 2CMRH 4YDLC 1SLVA 4QRRB 3EH2A 2OXHB 2PYEE 3TURA 2PTUA 4L5FL 5I8OL 4ZUSB 1UATA 1MSPA 1HXYA 2FT8A 4KK8C 3PQYD 5BO1H 3G08B 1FGVH 4H7VA 1C7SA 1K4CA 5D8JH 2DBLL 4YHIB 3DTXA 3AXLB 3QH3B 3KM2A 3U46B 3QJTB 1ED3A 1T6BX 5F88A 4HGWB 2ZUVA 4PW9A 1WGVA 2BY0A 5F8QC 3T0EC 1M56B 2XV6B 4LVOC 3T1FA 1FA4A 4BWUA 3ULVF 3QNFA 2YGQA 2Z6FA 2CQVA 1OGSA 2JJSC 5HJBA 2F54E 3GRWH 2JQMA 3QR1A 4P48A 2AGJH 2D4DA 3SBWC 2BIIA 1A14H 4BK5A 1JF6A 3SOBL 2O30A 3F04A 4KH9A 1L6XA 3MV8A 4OJCA 3IRCA 3KPMA 1T3FA 1KLGA 4XI5C 5FYJE 4HWNA 3PP4L 5CJQH 2CO7B 1VF5C 3WUWA 2BRRH 3L5XH 1DN0B 1AR1C 1KDJA 1A1MA 2YWYA 3N1GC 5E4IA 3ROLA 1NJ9B 2CUHA 2DM7A 1Z3GL 2EIBA 1WF5A 2XT1B 4QRRE 3S35L 1FFRA 2J25A 4F8LA 1LD9B 4M61B 1I3UA 3SDAC 4HK3J 1JV2A 3R0NA 2J4WL 3FUEA 2AV7A 3EJYD 4FZ8H 1CFQB 1EZLA 3KG5A 1G6RA 3DVIA 2ZSWA 4YSUA 3RFZB 4WFFE 1MCKA 2E7CA 2YD3A 4F3FB 3O3BA 1LE9A 3IPEA 3WLBA 5MENB 3MV7E 4HIXL 2WXLA 2D7NA 3UGEA 3QFJA 4OM0L 3SDDB 4PBDA 2L7JA 2M8XA 2PP7A 4NWTL 3DO4A 3S36X 1UTDA 1UD6A 3WO3B 2ZUWA 1EPFA 1JG9A 2GK0B 4ELME 4Y2DA 4JFOA 3FTUA 4Y4KA 2BS8A 1UD3A 1O6VA 1TZHA 3NK4A 4LFHD 4DWHA 4B9PA 5ICXB 3G5YA 1DVFB 2R1XB 3CC5B 4PR5A 4UZSA 3ZKNC 4Y5YB 3VD7A 4P2QD 2PPDA 1YC8A 4X99B 3TZVA 1CR9H 4ZMWA 1KB9K 3TXAA 4OGXH 2ZG3A 3LZOA 5DUBA 4NQCD 3WXVH 4DUXA 1XCQA 3V4PH 4ZQKA 2ZP8A 2CBMA 1WWAX 2BXYA 3VGBA 4ENED 5AUMB 4P8QA 3SKOA 2HFTA 4P2OA 5FM5M 5HVHB 1GGCH 5EBMA 1MCWW 1U0QA 4R4FL 2YKLH 3MBXH 3TA3C 3FO1B 3AU1B 4G80B 4G5AA 4PW3A 5GGVH 1BM3L 1PCSA 3V6FB 1PIGA 3H2PA 3GBML 1BOGB 2BFGA 4GRLD 3MRGA 1MXGA 3V0IA 3MODL 5B8CC 4AQ1B 4RIRB 4HVBA 5DS2A 1TENA 1CURA 3SZ6A 3WN6A 3BKYL 5EO1A 3FMGL 2MFNA 5GRXG 3FTZA 4LASH 4OZIF 3QWNA 2A73B 3LIZL 2XIBA 3C87A 4XBGA 4DIXA 5AB0A 4AGPA 3VFTB 1J9TA 1RCYA 3T0EA 1XGZA 2ZOKB 4M7JH 2CA4A 4BKTC 5F1OB 2QZ5A 1BAGA 1I1CA 4OI7A 3B6SA 1K9TA 3B5HA 2QSCH 3FH7A 3ROOB 2E7HA 2JJSA 4IJ3B 4P59H 4ICWA 3SBWA 3TVMB 1JK8A 2W60A 3WNLA 1QSEB 2FTAA 4Q97A 1NOFA 4QXTA 3AZUA 3NRFA 5LQBL 5EU4A 2J5WA 3ZKMC 1MUJB 4R7DB 4IRZL 2QL1A 3QCUL 3EUUA 5C0GB 2X4UA 3B7SA 3PE9A 1MW0A 4FL4C 1NCWL 4A7UA 1KBPA 4J6RH 4LPTA 1FVEB 4JO3L 2P24A 3AAZB 2OMZA 4LDEB 3BT2H 2AFNA 1U8QB 1U93A 5KOMC 3UL4A 5HDBF 4XHJC 2VDNH 3KJ4C 4ZYKA 3VA2C 1JGEA 5DRZA 5T1LB 4PJ8A 4YUEH 2ADGA 3SDAA 4WWKC 1CXKA 1X5GA 2AQRA 4JM2D 5FC9A 5KYUA 3T3ME 4F37F 4CKQA 4PRAA 4H8WL 4PG2C 2FJGA 1SYSA 4X98A 1N0XL 4MHHG 3UP1A 2WQUA 5F7KC 1EEUA 3HHSA 3AITA 4GRMB 4MHHI 5GGTL 4K9EH 2OV0A 4BJLA 3CFJB 5FYKL 4YHOL 2H41A 1HKFA 3BZFA 1SEBA 3GHEL 5D7SL 5HD8C 5AB9A 3OHXA 2ATKA 3LB6C 5C07D 3ARSA 3CH8A 5HYEA 1XH0A 3MLYH 2VR8A 4PCSA 5TD4A 5K9OB 1JYNA 4N1CA 4RQQA 1QSEE 4Y16A 3RBSA 3PABB 2JF1A 3S98A 3PHOA 3QEQB 4QXUH 3PXHA 5G5DA 2XG5A 4M5YH 5EZJB 2Y2TA 4FC3E 5DHVA 3QDJD 3MUGA 1HIML 4PV1C 3PWVB 4ZS6C 2P7TA 4QTHA 5D4QA 4HZLB 5GSVB 5KVDL 4MAUH 4EI5C 5T33H 4YIQB 1I1AA 3TCLA 1KN2H 2Z92B 4LSUH 1MREH 4HCRA 4Y1AB 1KJMA 3UIZA 2DQGH 3F2LA 3FHEA 1DEEA 4QD2E 1LWHA 3N44F 1G7HB 5CP7A 5HVFB 3M1BA 4CU7A 4F57L 4FZEL 4CVXB 1KG0A 3EGSB 3WDJA 3HFML 1CE1L 4W9IC 5D2LF 4RMSA 2ZT9C 1Y1UA 2R1WB 2R4RH 3OZ9H 1WICA 1I85C 4Y5XB 1AD9B 4W9DC 5IOKA 1YG9A 5C0BB 4XNXL 4L1TA 1JGUH 1QUPA 4BH7B 4D3CL 2RD0A 4UQIM 5DMIH 3V8CA 5KUKA 1NIBA 5JR1H 2AK4B 2A9AA 5LXVA 4FHJA 1G0XA 4BQCA 3ZHLA 5L6YH 4JN2A 3IDUA 2YA0A 1SJEA 1WBXA 1VFBA 1HHGB 4G43A 1MCWM 4XWGH 3P69A 4Y9GA 3RWHA 2R23B 3QNYA 5I75C 5K9JL 2GBUA 2NZ9C 4Z7WE 4ZUVA 1SXCA 2DYPB 3AY4C 3S5ZA 4Z3IA 3ARFB 3H9SB 4QNPF 1SOSA 5C0AD 2VOTA 1CGWA 4X5WA 3BKCH 1N10A 2WGXA 4QRUA 5IESH 2R56L 3EDJA 4AEEA 3Q9PA 5D7JB 3ATDA 1QBLH 3ZDXB 2XLLA 2X87A 3FSZA 2P49B 2W0LA 4Y1AE 5DTFA 3DRQA 1M7DB 3HG2A 4KNTA 4N8PA 1FL3B 1PBYA 3S96B 5D5MF 4B7IA 4WWKA 5EOCJ 3JWOC 3M7FB 3SQOH 2VC2L 3REVA 4PG2A 1INQB 3HAEG 3QDMB 1R3JB 5H4ZA 1X7QB 3E6FB 2B3RA 4JRXE 3CVDA 1UZ6E 2BP0A 5DUMH 5CUSL 2OQJB 2F2HA 1JZIA 5C0BE 3WKNA 3L2LA 1NANH 4PTTA 1ZRUA 5EEZA 1CXFA 2BW5A 1TSRA 2BHUA 1G7LB 1CS6A 3OKDB 1U30A 4JZNB 3H54A 2ZJSL 3WNMA 5AVZB 3QNXA 1MHCA 2HJKA 4L0YA 1HXYB 4FG0A 2AMUA 1TJIL 3K0WA 3WTUA 4ODXA 4JG0L 3VI4F 3I9GL 4N24A 1QABA 1IE4A 5ID0A 4ZAKC 1HILA 4D9QE 1ED3B 5F88B 4U05A 4B95C 1D7CA 3B1TA 3JSSA 2ZXAA 4EI5A 2ICCA 1HE8A 2LU4A 2P26A 3FO0L 5JPNC 3T1FB 1TZOA 3C60D 5IFHH 3UPRA 5E8DL 2C3XA 4YR6A 4OLWH 1JDCA 3D51A 3STZA 2EEBA 1R5WA 2GFBA 3BAXA 3MV8B 1UUSA 3KPMB 1T3FB 2G75A 3EAKA 4KRNA 3HG1A 1FNHA 1DCLA 3SDCC 3D5OF 3WUWB 4A2HA 5FO2A 4P3WA 1A1MB 2X3CA 4NQUA 5I1GL 2LABA 2VABB 1IEAA 5E1IA 3JWDH 2IWKA 4FQ2H 5I30L 2I07B 5FO9A 4HCIA 5E2VL 3J7HA 2H1PH 4N0RA 1IVTA 2X9YA 2W5PA 1N9PA 3GM0A 4M9PA 2ZXGA 2GAZB 3DNKA 4R8WH 3S36L 4M93C 1JV2B 4WI5A 4TNWK 2AV7B 3NFSL 1G6RB 1T89C 1BXXA 1XD1A 4ONFL 2LFGA 2ZSWB 1KB5H 4PLKD 4PJCE 3OZLA 4JFED 3P0YL 3S5LG 3WLBB 3LYRA 4FLQA 4LT7A 4OCXH 4IBQA 3QFJB 5FCUH 2HTLC 3UO8B 32C2B 4U2ZA 4HISA 2W81C 5E4OA 4Y2DB 4HKBA 4JFOB 3MTXA 4Y4KB 5EEYA 4NKDA 3NZUA 2PCPB 3G5YB 1SHXA 3MA7A 5E7FA 4DOHE 1GJWA 1TETL 3GJFK 4GMTL 4PR5B 4RETB 1WSST 2UY7A 3TZVB 5IUCA 1NC4A 4K5PA 1GS6X 2DMBA 2FECI 4DVBA 1PG7H 4FFWC 1MHPH 1OTTC 3SDYL 2YHGA 5DUBB 2DQDH 3WEAA 3OAUL 3DX8A 2AQ3A 1HHHA 1XCQB 4XO5A 2R83A 4H13C 4ZQKB 3HZYA 1HL8A 4F5CA 1YYML 3QJVB 4MVBC 5ESAA 4JHVA 2VE6A 4W9EC 3PXLA 3HAEA 4M7ZC 3NABL 4P2OB 3SKOB 1O5DT 5GRYA 4CW1A 5C7ZA 4YDLB 3BP5A 1MEXH 2NY4C 3GS7A 5C09A 5I0XA 3I50H 3CVBA 3A5VA 1PNDA 5ETUA 2DB8A 5DJXA 1YEJH 3C8HA 3LCYA 5DYFA 4YK4C 2OMWA 4BQ6A 1J12A 4X8CA 5E2JA 2XWEA 4Q0XL 4ZAKA 5EO1B 4N28A 3KHQA 3E3QE 4AGMA 1PNCA 3QFJE 5EC2B 2EO7A 3N40P 4XBGB 1ZGLA 4WEUD 2EIMB 1B3IA 2JH2A 1F58L 4XN5A 1L9TA 5DR5H 4OD1H 5DRWA 5HHMD 2DEWX 4RA0C 2ZX8A 3T0EB 4LVOB 4A2EA 4ODHH 4NCC1 3LNFA 4QHLA 5JPNA 2IH9A 4FA6A 3B6SB 4JMXA 4MJ6A 3QUYD 2VDOB 3VD3A 3LPOA 2DQFA 2FIKA 2XZQL 3GSUB 1QOKA 3LN4A 5C0IB 1JK8B 2W60B 2ZXDA 3T4AC 1FO0A 1BQRA 5ESVA 3RGVA 4H20H 4QXTB 4AVIA 2W9DH 3KXFD 2IQ9L 4U6VH 4Y7MA 1YECH 1NAMA 1IC7H 5I1JH 2GJ6B 3M07A 3E1F1 5H8DA 3RDJA 4GPVA 3RI5K 3QJRB 2X4UB 3EYQC 3SDCA 3V52L 2O61B 5CZRA 4NM8L 4JKLA 2P24B 4PYHA 2OMZB 5DK3A 5BCAA 3K6SA 4U6YA 1XGPA 4ZOCA 3HC0A 1U93B 2FLMA 1OSPH 1YNLL 2ID5A 2Q20A 3MUUA 3QAQA 2GTQA 4ZYKB 5DRZB 4MA7L 4PJ8B 1XF2B 3EF4A 3H3BC 2ADGB 1NGPL 3MJ6A 3SDAB 1BIIA 5KYUB 1SJXA 1CU4H 1M4KA 1UT9A 4PRAB 3MRRA 1JVLA 1JPST 3KW7A 1AS7A 4JVUA 2FJGB 2MPAH 1SYSB 5FM8A 3GC3A 4X98B 1T89A 4TL5A 4EN3D 2H2PD 4MSWA 4JFDA 1OALA 4X80H 3SE8L 1HYRC 3HHSB 2ZX5A 2WPGA 4PGCA 1BAFL 5DCCA 1N7ML 4XB8A 4YN3A 1OCZB 3BZFB 4PIBA 1F4XL 2O4EA 4L8BA 3OHXB 4L4VD 2ATKB 4HSQA 4ZOEA 1QYGL 3I02A 1WE5A 2IH8A 2XWCA 3QUHA 4GSRA 2Y06H 3Q6FA 4IW4C 2IALA 4MWFB 3IDYC 1BQSA 1KDIA 2R69H 3HG3A 4RQQB 4Y16B 4IK7A 2FK9A 3OJVC 4GI8A 1A4AA 2AQQA 3PHOB 2WSPA 3INOA 3OPZL 2ESVD 1LO4H 2QKIC 2XG5B 4M62H 5G5DB 1AHWC 1VESA 4OCSL 1SDYA 2MIZA 1LK2A 5DHVB 3CLEL 3MUGB 2LLGA 1EDHA 5AW2B 2P7TB 4QTHB 3GJFH 4YGAB 1KB9J 3VGEA 5L8JB 4ONGH 4P46C 1KMGA 5IEKA 1I1AB 5D6CA 3TCLB 2FIRT 4BZ1L 4XAWH 4B96A 3KWWA 4ANWA 5I1HH 1DEEB 5KWYC 1PZ3A 1F86A 2BC4B 2WB7A 2VZSA 1OSZA 1ZLDA 4X6CF 4K3DH 3M1BB 3RY6C 3D05A 3UYRH 3U9PL 1AS6A 3E8UH 5G55A 1KG0B 3FCBA 3DV6A 3L1EA 2V6HA 4FNSA 4N2GA 3SGJC 3GHPA 3DWTA 5AOKA 5DD6A 2VDQL 3S3CB 1HKLH 5IZ7A 4AL8C 1MIEL 5IUSA 4KDTC 5GRJL 5C0CD 4GAAA 2OTPA 4HULB 4F7TB 2Z31D 1VPOH 1RH8A 3EKCA 4LCWE 4WW2B 3VTMA 3EBIA 2EEFA 1IBZA 3OV6A 2D31B 4PG9A 1IAOA 3CZFA 3N85L 4MNQA 4G7YH 4PRID 4YHKL 4JN2B 1WA2X 1IIIA 3V7MA 5E08L 1YEKL 1ZVNA 3WY2A 3T4AA 1SJEB 1WBXB 3B2XA 1VFBB 3HTLX 4G43B 5IVXA 3RWHB 2GIMA 3QNYB 1GGBH 2H8PB 5BUGA 2K45A 4UDUB 4ZUVB 3QWOB 3V0AC 3TLRA 1UG9A 4JKPH 4FJ6A 2X4PA 1M9WA 4X5WB 2W9EL 4MDRA 5T1DL 4FFYL 1OM3H 4KX7A 2LU3A 4QRUB 2ZYHA 4L3FA 3S2AA 3IGKA 3RX8A 1QZ1A 4WUUE 5ADOH 3F7LA 3NN8B 3WV0A 5DTFB 5LGHH 4MCYA 2GIYA 2DKSA 1A65A 1MWAA 2YD2A 2YPLD 3WOVA 3FYEB 2WGNB 2JI3A 4MNHB 5B3NA 4MKTA 3QS2A 4F8OA 1UENA 3T8XA 5L4IA 3REVB 4ABUA 3GBLA 1FF5A 1RK7A 3T6VA 3T2PA 5KN5A 3Q8FA 1RI8A 1E0OB 2BP0B 4UV7L 5LBVA 2B2XL 2VQUA 4NJ9L 3BAIA 4PTTB 3UC0L 5TK4A 3KPPA 2GBTA 3JTTA 4WEBH 5AVSB 2QQNL 4UTAA 2OL3H 1ZV2A 2EVIA 1NTDA 1FG2A 2C3WA 4G6FD 3VXTA 3AXHA 2MOVA 3QUXC 1MLBA 2IG2H 3ARGC 3V5KA 3QPQC 3C5SA 1MHCB 4LARL 2HJKB 5T1KD 2EH8H 5IB3A 1BWMA 1OSYA 2XWTB 3DV4A 4MMZC 1YQVH 3O6FC 3WMSA 4XVTH 3SCMB 1R1CA 2NY3C 2PF6A 3ZW3A 3B56A 4RFOL 4ZXBC 5ID0B 1VKXB 1AHWA 4FQ1H 1HILB 3G9VA 3O2DH 4JNXA 1RZ7H 3QO0A 2PR4H 4APQD 3O11A 1JDDA 2VDQB 4C47A 5B3JE 3WAKA 4XOCA 3A6CL 4P46A 4R83A 4EI5B 1CL7H 2BVOA 3EBAA 3DYPA 3GGWA 3WMPA 4YMPA 5DDHB 4QY8A 1NC2A 4KZ0A 4H1LG 4FG2A 4EEEA 3P9MA 4M1CD 3KVPA 1TDQA 2VDKH 4P9HH 3NJXA 4YR6B 3E9TA 4PI0A 4WW2F 3STZB 1OTUC 2QADC 3ULVC 1RQ5A 5HHQA 2GFBB 2KDGA 4O2CA 1R75A 2G75B 1HHIA 1IV8A 1BWWA 1QWNA 1TOXA 3HG1B 5I82A 3K6DA 3QT2A 4OF8A 5KZCB 4UT6H 2PWGA 4JHAL 3D2UD 3LNIA 3VNZA 3OQ3B 3V6OE 1IGTA 4KDTA 5FM4A 3SGEH 1XSKA 4N6QA 2VZOA 1T4KA 4IDJH 3U7YH 1IEAB 1SHWA 4UF7C 2WIMA 1NCNA 1C1EH 1H3VA 5FO9B 2ZQKA 1OAJA 2CHZA 5BJTA 3TN0D 3PHQA 1GIGL 5EU3A 3NFNA 1KCUL 3KJ6H 1OVZA 5D71L 1KWGA 2GSGA 1CFMA 3LZNA 3G6JA 5I75B 4HYTB 4JO2H 5EF2A 3KVQA 1HQ4A 4LGPB 1NPNA 3U48A 4I77L 4DZBA 4FXGC 3WJJC 3AT9A 2AJ3A 1BEXA 2GC4C 3GQFA 1TLKA 3MX0A 4GT7A 1QR1B 3AS2A 2OR9H 1BYPA 4WTQA 3V6BR 3X11A 2PO6C 4ZFOA 2CGRH 1MJJA 4NKDB 5EUOF 5CHNA 3U4BL 3MA7B 3NSYA 5KVEH 1PSKH 2V5TA 2Z0UA 1NCDL 1TCRA 2A6IA 4JO1L 4OKVA 4ZFGH 4M7KH 4XC3H 2X2YA 4IKJA 1IBGL 2UY7B 1NC4B 1Z7JA 3WEBA 3S3JA 1TJHH 1VFAA 3KL3A 1MJ7L 1NSNL 4W9JC 2Y1AA 2J8UA 3DX8B 3L4ZA 3CPUA 1HHHB 5DJYA 1P5UC 3JYCA 4XODA 3HZYB 4G5ZH 1AJ7H 3WXWL 5ESAB 1IQDA 2OJEA 2VE6B 3CLWA 5LGJA 3TBWA 3HAEB 1MXDA 4Y19A 2VITA 5E95B 4P23C 4CW1B 4QKTA 3SPCA 3BP5B 4Z7VF 3QUXA 4NC1C 5C09B 1TIUA 3ARGA 5ETUB 2ITDA 5DJXB 1RPQA 3BUYB 3RWEB 5GS1C 2ERJC 4OFDA 3SO5A 2OMWB 4E9QA 3O6FA 4HX1A 4ZXBA 4JPSA 1PZ2A 5H37H 1V3MA 1DQVA 2FECL 4JO8A 4QHNA 1FE8L 5FGCE 1G9NL 1QTPA 1XL4A 3RLSA 1ZGLB 5IHUL 2AJSL 3CFBA 5DRWB 3SKMA 2EKSA 1D9KD 2IXQB 3P9LA 1U3NA 4JL2A 1F6AA 2X4OA 4YDNA 5J9PA 3EZ8A 1A5FH 3D69B 2FIKB 2P8MA 4H25A 4Z3FA 3IN2A 3LN4B 4AEIL 2AJUH 4ZD3H 1Z66A 1ZWIA 3OR7A 1FO0B 4KZCA 5DJDA 1RJCA 1UB5A 1OIOA 3I6SA 3LPPA 5CGYD 5ESVB 3RGVB 3RVXC 4ODWA 1S2EA 1NAMB 4HWZB 4G6ML 1R5VA 1NDTA 2H26A 5SWZE 3SDCB 1A3RL 1UQSA 4KITB 5E6ID 2EEDA 4F5CE 4LBEA 4MNGB 5MEOA 1AZRA 4CVUA 3K6SB 1ZK5A 4U6YB 4ODSH 1XGPB 1B2WL 3FB7A 3BQUD 4J4PC 1CK0L 3ESVF 4FABH 4HOZA 3CX2A 1H8SA 5JXEC 3WDIA 1BP3B 4XH2A 2W65A 1S3KL 1M57B 4UWQB 4XVUD 4HIQA 1BIIB 1DUYB 4M93B 4BIKA 3G5ZB 3MRRB 2FBRA 1FHGA 4Y4HC 1H8OA 3AB0B 1R34A 1ZV5A 2N56A 4JFDB 4IMKC 1F90H 2VDLL 5DQJA 3CQPA 3UTPE 4PGCB 4U6XB 5DRNB 4D8PA 2BSEA 3K2KA 5FFGA 1NANI 4FXGA 4OIIH 3WJJA 1MWAL 2WXQA 4HBCH 3FT4B 4F9LC 4L8BB 1CFTA 3I02B 2PO6A 3VXRB 3A4FA 1CE6A 2OULB 3Q6FB 3S5LB 2IALB 5KAQG 4BQBA 3ABGA 4F92B 1RZKC 4E5XA 3IBOA 2D9QB 1RUMH 3RIAK 1F2XK 4TLSA 1LK2B 3IDXL 5HDQL 2OZNA 2JI1A 4WFFD 3ECUA 5EOCL 1P5UA 4HKXA 4AEHH 3CFDA 3IGFA 2B3IA 2NDGA 3T6QC 2PKDA 4A7SA 5GJSL 2XTJE 4K7PY 1YY9C 5LG6A 1ETA1 1JGIA 3QUKA 4PRHE 4DUWA 5EBGA 1SYVA 3VG9C 4P23A 4RFEA 5DA0B 4W1TA 3KWWB 2K1MA 4RWYL 3DVGA 5KBLA 2EIZA 3PU7A 4KK9C 4PRPA 3WE6A 3K72A 1JTTA 4EOWL 1UEYA 5JIIA 5DD6B 4AIOA 2R0ZL 4P4KA 4LOUC 3NIGE 4XPBL 4ZNCD 5GGRY 1GCFA 3FF8A 1F0LA 3OG6B 3VYOA 3IU4H 2C3GA 2HXAA 3FUHA 3MGOB 4DGUA 3TO4C 3WG7B 3VXRE 3RNKA 3O4OB 5CD5D 3TONA 4NHCL 4PG9B 1IAOB 3CZFB 4MNQB 1LP9F 4FMKA 4RGND 1FHNA 4N2FA 1KBWA 3T4AB 3NSDA 1C8PA 4CGTA 3L4TA 4NP4L 1FL6A 4PWGA 4NGHH 5IVXB 1UA6L 4UQ3A 4KNUA 4R5XA 5KSBF 4KMTH 1QI3A 3SPIA 5JZ7C 3IRPX 1MRDL 4CMHC 3INUH 1Q1JH 1BFSA 4IBLT 2DMCA 3PY9A 2XZCL 2WBXA 2HT2D 3UAJC 2QPDB 5CJQL 5EZIL 1OF0A 3ZE1E 2VDLB 2YQBA 4YHPA 5DMYA 4UT7H 5K59F 4J4PA 3AFLA 4HEPA 4IRSD 1U95A 4MDIA 4MCYB 1MWAB 5JXEA 2X28A 3KPOA 4HUWA 1DDHA 3UJJL 4AZ8A 3GMNA 3QQDA 1E9QA 1X3DA 2ZKHL 4TLUA 3PPEA 2EH7H 1S9XA 5AKSA 3T8XB 1QW9A 1AIZA 2DEYX 3D12B 2E8YA 4Y4HA 5TH2A 5KN5B 5AKTA 5BVJA 5ACZA 5BZZA 4G82A 4TUOA 1E4WL 4JN1H 1AAJA 2F1EA 3OBAA 1O5PA 4IMKA 3HNVL 2LFEA 1DYZA 5JPMC 1JRHH 1NBCA 2J1WA 3KPPB 2I9LA 3QG7H 3IE9A 1FFPA 4ACTA 1FG2B 5D55A 5F1KC 1F8TH 4MQXD 3VXTB 4F9LA 1JBJA 1F11A 1MLBB 3I3BA 4HV8A 3V5KB 1AOHA 2IEPA 3BMWA 3C5SB 4HUNB 3GMQA 4UBDD 3NSJA 5IB3B 2ICEC 1WEJH 3QHZL 1Q0XL 4JPQA 5IVXE 2IH1A 3DV4B 5K1VA 3VXRA 1C9SA 5J3HC 1HE7A 3H56A 1YAZA 2WLNA 4GJTB 1AHWB 5H94A 1GC1L 3ZIYA 4LSVL 4OZHA 3PIQA 2OXGB 3WFCH 3O11B 4P06A 5FF6A 5T5FA 4P46B 2BVOB 1G9MH 3GGWB 4QY8B 1NC2B 3P9MB 4LIQE 3MUJA 1GHFL 1GYCA 3KPSA 2HLEB 4Y9FA 3Q13A 1MCQA 4ZTEA 5D7IE 1RURH 4OLUL 5HHQB 3N42F 3TJHC 1QLEL 1TJGL 2HLFC 4O2CB 1TEYA 2B1OA 1HHIB 1O7DC 3FSOA 2H3NA 4B60A 1N8ZA 2NT1A 2RJMA 2MQCA 2IGLA 1ID2A 1CDCA 2UZYA 4KI5C 1AY1L 4QKXB 5LBSH 1T4KB 1DFBL 3DXAA 3NIFB 3TO4A 4DFHA 1YJDH 3TCTA 2X1PA 3CFQA 1SLWA 2Y7SA 3UJIL 4AQOA 5BJTB 1JI2A 2Z9TA 1E9OA 3PHQB 5EU3B 2IDQA 3ZGIA 5D7LD 4KXZI 4UTCA 3CD4A 2RBLA 3D3VB 2EO1A 2VUKA 2GSGB 2X05A 3G6JB 4NM4H 5KSAC 4L2LA 1DBAL 3EYSL 2WZPA 1V54B 2X38A 4UTAH 1PKOA 4TYUA 5JHDB 3TA4D 2HG5A 1H3WM 2GG1A 1HQ4B 3V0GA 5DMJB 2B15A 1XTLA 1WFJA 3H6AA 1IBDA 4ILDA 3GYRA 3MX0B 4HD9A 5EOQL 1G7MA 1LK3H 4N8VG 3S3DB 3X11B 4AZUA 1JGLL 4ZFOB 1QBML 1MJJB 1IKNA 3ARDA 4ACPA 3VFUB 5CHNB 4JAMA 5JNYA 4PM1A 2G2NA 4TLKA 2A6IB 4WY7H 1RPKA 4OU3A 3QORC 3QQ9C 5AQ0A 3SJVA 3ULUF 4YXKH 1OP5K 1WA1X 3SYCA 1HH9A 2COQA 2HFFA 1MAML 4NI3A 3ZZ1A 2E7LC 1F2QA 5DT1H 1BIHA 2J8UB 3TV3H 2QSQA 4XMWA 5DJYB 1F6LL 3U30C 4ZW5A 5JPMA 1OAZL 3ME0A 1YA5A 2IDTA 1P69B 1TZAA 3I2CH 1UXSA 3L95B 1IQDB 2EIKB 2OJEB 2B14A 3U82B 3TBWB 2K6ZA 4Y19B 1ZXQA 2VITB 4MQ7A 4Q9RH 4CNIA 1INEL 1YEEH 4KZDL 3RBGA 2ITDB 5AKVA 3VGGA 3ZT7A 3I84A 3E38A 3UAAA 5IOPB 1BFVH 2XZAL 4QF1B 3O6FB 4XZ4A 5EU6D 3HUJA 3ZL2A 1BG1A 4HX1B 1UOKA 2WM0A 2Z35A 1LNUA 3MA9H 4ZXBB 4MA8L 2VR4A 3MXWH 1OAKL 1QLEB 2D4FA 2GJPA 4FNLH 1FZJA 1CXIA 1WAAA 4N0YH 3JWNG 5B1KA 4YO0A 1ZIBA 3VDBA 3CFBB 3NH7H 1L9QA 3SKMB 3FAXA 3KBPA 3RVUC 2QT6A 2Y4SA 3B2VL 4HXAL 4RAHA 3PP3H 1A6UL 4Y2LA 4KKZA 4LSDA 1WZ1H 1NM4A 1MCNA 1F6AB 2X4OB 1QP1A 5E2UL 5IQMA 3A3YB 5J9PB 2K3TA 4OVUA 3FFDA 2P8MB 5E00A 4KROD 1KN2L 4LDLB 3TC9A 1BGXH 3MN8A 1MCDA 2QADB 3TIDA 3ZGHA 3OR7B 1ZWIB 4DKAA 4OJFH 5DJDB 1NGYA 1UB5B 4HSCX 2AANA 1UWGL 3LH8A 4ODWB 2BOLA 3T2NL 3KPRA 1DFXA 1E6OH 4IRJC 5E99H 5HHVH 1R5VB 2HJLA 2H26B 5E5MA 3RILA 4N8CH 4D9QD 4FP8L 4NQEA 2D0GA 1RZGB 4LBEB 2O1AA 5MEOB 4JO4H 4O4YH 1QLFA 4S1DD 4M03A 4R2GD 2Y9RT 4Y19E 5CM1A 2WQSA 3FB7B 4NNPL 2EACA 3FU8A 4RMVA 3QE5A 4APXA 3P4OA 3FXIC 3IF1A 4O9HL 4XH2B 1KJVA 2W65B 5A16A 1ECYA 4OZGF 4ZW6A 2F7OA 2VMFA 2ED8A 4OR1A 4P07A 2O5ZH 3HG4A 3WN5C 1CD8A 5L0QC 5ISZA 3KYKL 1MPAH 4D0CA 2EYRA 1J5DA 4XOEA 4IOFD 1J05A 5KANG 4AMWA 6FABH 5KSAA 1I1YA 5IROD 4KV5F 3TJPA 2GYSA 2Q3AA 3UJTL 4MYWB 3LH9A 5DQJB 1JPTH 4I3RH 3KLHD 3QI9D 5CAYB 2WLZA 4UQCA 1Y7VA 2DLHA 4D8PB 1NMAH 1QKZL 1NZRA 2ITFA 1KEGL 4R96A 3OJMB 4ERSH 2CXGA 2LLLA 2WWKT 1CFTB 3GSQA 4NZ8A 5AOZA 4D0DA 2JLLA 2NNXA 1RU9L 1GTFA 1CE6B 1S78C 3ULVE 3AWFA 3MMEA 4RNRB 3TNNA 4E5XB 3QEHA 2M2DA 4Z8FL 2WLHA 2MOGA 2ZKXA 3WFBH 3QORA 2X10A 1ZJBA 2IV8A 4N8VA 2E7LA 1YRKA 2IFGA 5HYJE 2H6OA 1P5UB 4HKXB 4XMZA 3CFDB 5BQ7A 3OG4B 4BQ8A 4UTBL 3FT1A 1JPEA 3AABA 1H15A 2ICWJ 2BSSA 1OP5H 5TGBB 2VZ3A 3QUKB 1SXNA 4P23B 4RFEB 3DVGB 2EIZB 1A7NL 1T80A 1OOWA 4G9DA 2P5WE 3AMLA 4OZFH 3HZKA 4PRPB 2ERJB 3K72B 3WE6B 2YC1A 3O4LD 3C6EA 5JHLA 5IFAH 2V9UA 2BNRA 3BWUF 3PGCA 1GR7A 2YOCA 4P4KB 1I3GL 4Z9KB 5EO9A 5T5FL 5FW6A 4HAGA 5CCHE 3LKOA 3C75A 2Y23A 5D1QC 3BP7B 3FONB 3TASA 2ZPKL 2P8PA 2WUBH 3EHBC 2P52A 3GPSA 1A6AA 3RNKB 1QSZA 1SJVA 2GEEA 5JMOC 4WFED 3HMXA 1LEIA 1SVBA 4RX4A 3W5MA 5BRZA 2IFFL 3UG3A 4TOYH 3NJLA 3JV5A 2X2JA 3NK3A 4KRLB 5HBBA 1FL6B 2AK1L 3THMH 4UQ3B 3EJJX 4KY2A 5DVLA 4YAQA 1Q72L 3L4VA 4IRJA 4WWOA 1TU2A 1RJZB 3AUVA 5LXGL 1PQZA 3X1BA 3GZKA 1SUHA 4M5SA 1BHGA 2R39A 1J8SA 1I7UA 3FTWA 2QVIA 2NSQA 5J13C 2XA8H 3TFKC 4KKCD 4Y1SA 1ZPUA 4YHPB 3RZCC 4UCFA 1ZTMA 1IT9H 3NCBB 2C8NA 4NC1E 1U95B 2BX5A 4MDIB 3M86A 4AZ8B 3O6KH 1DDHB 2OS7A 4HUWB 3AG2B 1BLIA 1CQKA 1MWOA 1E9QB 3GMNB 3JWDL 3QQDB 4YGVB 1S9XB 3WN5A 1RUAL 1BZOA 4MXQD 3TNMA 3MR9A 4Y4HB 2HRPH 3H7LA 3FT0A 5TH2B 5BUPA 5GGVY 5ACZB 4P2YA 4LP5A 4TUOB 2X6CA 5I26A 4LL9A 4KMQA 1KYUA 5F9OL 1A8JH 1L9RA 2NY5H 4RDQF 5CD3A 2I9LB 1N18A 4M4PA 1H9DA 1FFPB 1HOEA 2XPGA 1WZKA 1OE2A 3Q44A 1WK0A 1F11B 5DZ9A 2PCYA 2OK0L 5DQDH 1JYXA 2ZUSA 3HNTL 3MKGA 3MXVH 5A6MA 3FU9A 3EO1A 2YUWA 2IH1B 2R2HA 1INDL 2R4SL 4FDWA 4S0HA 2Q76A 3BKJL 1ZJAA 3X12A 4X4XA 5HYQA 2IAMC 4YBQD 3FC8A 3F84A 3FQYA 4PJAA 3FQNB 3EDFA 4LKXA 4OZHB 2CR3A 3PIQB 4P5RA 3KYMA 1UD4A 3L3OC 4P5TC 3WHXB 3RY4A 5FF6B 3PWUB 4KOCA 1D3CA 4BFIA 3GM8A 5GSRA 1A6WH 4FTVE 4Y4FC 2XTLA 5D2NC 4S1SL 2VN4A 1NICA 4BUHA 3FSVA 1TXKA 3KBHE 3ZDZF 2C7UA 5HDBE 2HT3D 5DEJA 2VRQA 5HTSA 4MKMA 3AS0A 3BX7C 3ZPDA 3LNHA 1JUFA 1QRND 1WBZA 2H3NB 1TVBA 1N8ZB 1YNTB 5G4NA 5TE6L 4KPHL 3BSZA 5F7WC 2IBGA 2UZYB 3AUWB 2BVUA 5D1QA 5TF1L 2VLJA 1Z32X 3BDBA 3DXAB 3TO4B 4U6TA 1ZANL 4YX2L 1DBKL 1F00I 5GGQH 3KR3H 3FPXA 5HJ3B 4FG6D 3N9GL 1E9OB 1AKJB 1IGCH 1KTDB 2V2WA 5C08A 5JQ6L 3VGDA 1I9EA 2FYYB 4LRNH 2HKHH 4PJ5D 4URKA 3RWDB 3C9NA 3UTTA 1XF3B 3U0TA 5I8KH 1AGEA 4CMHB 2FBJL 2BZCA 2HG5B 5BS0D 5F9JA 2HVKA 4LHUD 1YEHL 2O6PA 4I9WE 4NYLA 3RKDD 2FJFB 2CK0L 2Z8WC 4UM9A 3RZCA 1L5GA 1F13A 1G7MB 2FD6L 4PP2A 2CJUH 1USZA 2HFEB 2P1YA 1DZBA 3KPSE 2HWZH 3FBKA 4HUXA 4LO9A 4PTUA 4LCWD 4XN7A 3ARDB 4PLJC 4F80A 3BAEL 4JAMB 2DY2A 4FI6A 4GQ9L 4TVUA 2I9TA 2WBWB 4GP5B 1YZZA 4S1RL 5BRPA 5HGBA 1A1OA 4B9JA 1RULL 3KEHA 3SOTA 5AW6B 5F7LB 1HH9B 1NGZA 1ULVA 2HFFB 4LOEA 1M71A 1BF5A 3HC3L 4X9GA 1E8WA 3L5IA 5CP3A 5JPMB 2GVYA 3RUGF 4Q9QL 2XV3A 4ZO8A 1DJXA 1QEXA 4PJGF 2VN3A 1H3XA 3BVTA 4Z3GA 5HI4D 3NIDB 5KAQF 2YIHA 3VFRB 3L2NA 4MQ7B 1DL7H 3VFPA 3L48A 3UABA 4CNIB 4JQIH 3DX6A 4OUUA 2FGZA 3VD1A 2ICWI 3NSFA 4FXLA 5EIVA 3BUPA 5AB1A 1I7TA 2OCJA 4MZ2A 4KY1H 1U3ZA 1H6FA 1U4EA 3HUJB 5C0RH 4O2EA 1BMGA 2IAMA 4BE6A 3VWJA 1JZ8A 4X6BA 1GGTA 2Z35B 4MYPA 1LNUB 2PMZA 3FBQA 4AYSA 1EK3A 3X1EA 1AYRA 1WIOA 1FZJB 3L3OA 4P5TA 3BH4A 4NJAL 4U0RC 4YO0B 1KCLA 2Y36L 4QNPE 4PGEA 4KVCL 3PPSA 3GO1L 4PUBL 3UC2A 2DL2A 2A9MH 2YXWA 2IPUK 4TSAH 4Y4FA 1RIVL 5D2NA 3H53A 3FFDB 2FEJA 1BFTA 5E00B 1FJ1B 3CFCH 4P57A 4NQDD 2ZOWA 3TIDB 4FQXB 1E5CA 2CBQA 3SJVE 1EMTL 1NGYB 5D5ME 4HF5H 5SX4I 3KPRB 5KYYA 1MFBH 4ZMAT 4W68A 3UX9B 4UNVA 2DIAA 3B3BA 2HJLB 5E5MB 3SDXF 3TBSA 1MH5B 1QZNA 3E8UL 4HSAC 4BHUI 4NQEB 1Z5LB 3GXTA 2OMBA 1QLFB 2D73A 4RRPM 3S34L 5C6TL 5E1AA 3KGTA 2YUVA 2OJZL 4MRCA 4WU5A 4APXB 4TVPL 4FQJH 3P4OB 3IF1B 1YY8B 4OFYA 1KJVB 2CDFA 5A16B 4DGIL 4I2XA 4G11A 3L3GA 1EXUA 2IGFH 3GUFA 2EYRB 5ELIA 1J05B 3FOMA 5CKGA 5KSAB 1TTRA 2XYBA 3VI4E 1XSOA 1I1YB 3GXFA 2WANA 3MRHA 4OW6A 4BZ2H 5MI0C 3W11D 2G30A 3KNBB 5MHSD 4K3HA 2YSSA 2XVLA 1QUNA 3I3DA 1NEUA 4OGAC 3DX0A 2QPSA 2V5SA 3S37X 4D0DB 3GSQB 3KLAA 1LO3L 1L0PA 2JKWA 2PWFA 3DHUA 1ZHLB 3K8LA 3MMEB 2VLRA 1UVQB 5F7MC 1KC5H 4PJDF 3QEHB 5E2TL 3TNNB 3CFKA 4OD3H 2M26A 1O7DE 3QORB 3J2PA 4YSTA 4FFVD 4N8VB 4LEXL 4FHBD 4NZFA 3A6BH 4GBXD 1U8OA 3QUMA 4B53A 1IC4H 3U30B 5BQ7B 4ZS6D 3BVNA 4KI5E 3O2WH 3N40F 2A6KA 1H15B 3P3RA 2BSSB 1FC2D 2HX9A 2EVHA 2XVBA 4E0RA 3CK0H 4YDVA 4XPTL 2B08A 5HDLA 2OL3L 3LS4H 4G9DB 1SLXA 2IPKB 4Z7UF 3EJSA 3V7AG 5ISZE 3HZKB 2FL5A 1KTJA 1EGJA 2YC1B 4X6DF 4I85A 1ZHKA 5FYKE 2HPOA 2BNRB 3PGCB 1ORSB 3ZE0B 4AY0A 5A2IH 1BVOA 2CDEA 2QBWA 5EO9B 4F27A 5MEPA 1E4JA 1YQVL 2B4CH 4B9IA 3IJ9A 1ACZA 1QR4A 2JKJA 3LKOB 1FVDA 4AEFA 4PJFF 3VMPA 1NDMA 3L3JA 2P8PB 2BRQA 3I3EA 2UZPA 2Z8SA 1A6AB 2BXZA 3MLZL 3DMMC 1F02I 3ZUNC 3UPCA 4N9GA 1XB6A 1LEIB 1JZGA 4ZUWA 1JD9A 4HFUH 5BRZB 5KBDA 1N68A 4RFNC 3TPKA 2HTKC 5FUCC 1FCCA 1A6VL 3RVWD 3RNQA 3UTOA 2AJYL 4EUPG 2YR3A 4IRJB 1Q9KA 1TU2B 3KLSA 4A66A 2E75C 2EDFA 1PQZB 3KWXA 2YBGA 4OIFA 3ZK0A 2ORBH 1I7UB 2FATL 2Y72A 3P2DA 1YNKL 4I7ZC 5DD0L 1IFHH 2F0CA 3CZSA 2CUAA 4GAYA 2QTEA 1BZ7A 4HMCA 1WUZA 5I1EH 3NCJL 4WI2A 1CJYA 2FB4L 4BKLA 1GAFH 4U3HA 2WZ5A 5FO8A 3WN5B 5L0QB 1T5XA 5FO7A 5GGRA 2QQLL 4KFZC 2ZXWB 4Q8BA 2BNRE 4HA1A 4KVNH 4M6NH 4OI9A 5ESQA 4PJ9D 3TNMB 3VM7A 1BMWA 1VEPA 3K6IA 4OLVL 4X0NA 4YHLL 3MRPA 2F08A 4NAMA 1UA3A 4POUB 4CSZA 2ZWKA 5SWZD 1MI5E 4JGNA 3CU1A 4GAGH 5CD3B 2FX9H 4BK4A 1Z5HA 4XN2A 3LHPL 2X9XA 1H3UA 1B3JA 1U92A 1GMIA 3KDPB 1T2QL 4DPCX 2XPGB 4PGDA 3LQAL 2WXHA 2X6VA 3G5WA 4RISL 5D1ZD 5AW3B 5BRZE 1DQDL 5AAPA 4TULL 3PWLA 2OR9L 3EO1B 4BRJA 2R2HB 4GIOA 2OM5A 2Q76B 3X12B 5HYQB 4XP1H 5TDNA 2D0HA 4NAQA 3RGHA 1F1DA 1Q94A 3VI3B 3RDTB 4LKXB 4NQVA 1S6NA 4QTFA 1OTSD 2HB0A 3KYMB 3BRFA 2Z1PA 3NZ8A 1BPLB 1KCBA 5CGBA 4TSCH 2NY2C 5E8EA 2ARJA 3UTPD 1TJHL 2OCFD 4G9FA 3T04D 3Q1SL 3JQOB 1L3WA 2DQCH 1JHKL 3CMOH 3PDGA 4BFIB 6PAZA 3FU3A 2WVVA 2HYMA 3IMUA 3N5AA 4K3JH 5GSRB 1QNIA 4OM1L 2XN9E 4JRYA 4PJBF 2O72A 4IBSA 4NUGH 5DLMH 4KK5D 1J8HA 2H6UA 1OARH 1OP3K 1QSFD 4J12A 4JANA 1G4MA 4HK3N 3OKEA 4U1MA 4WHYG 2XRAH 5LAPA 1VZIA 2VMEA 4R7VA 1TTFA 1XF4A 2J3SA 3SBQA 3MNMA 3FPYA 5AAMA 2VL4A 2VLJB 4HUUA 2XTJD 4J8RA 4HQQH 3EHBB 4PRHD 2EAEA 2VKWA 4HIJA 4WV1C 3DMMA 3W2DL 2ODHA 3LNEA 2IV9A 4OFIA 2AMGA 2V2WB 5C08B 3EDDA 3AJ7A 4OLZL 3BXNA 4J3OH 4FI8A 1BQHG 4PJAE 1U8MA 3UTTB 5I76A 2V17H 1J1XH 4J3OD