4HZ1A

Crystal structure of pseudomonas aeruginosa azurin with iron(ii) at the copper-binding site.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
ECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Azurin
publication title Azurin as a Protein Scaffold for a Low-coordinate Nonheme Iron Site with a Small-molecule Binding Pocket.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 27
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hz1A00
2W88A 3OMAB 3EH4B 3FPYA 3X1EA 5FC9A 1AOZA 4GYBA 3S8GB 3UAAA 1AZUA 1GY2A 1TEFA 2BW4A 2YAQA 2GB2A 3NJJA 3ABGA 1SHWA 2R7EA 3BQVA 1KDJA 4E9RA 1PLCA 4K9JA 5I5MA 2YQBA 1I53A 2W8CA 3T71A 3NJIA 2BO0A 2ZXWB 5F7BA 2IAAC 3EH5B 1N70A 2BWDA 4BDVA 3OMIB 2PP7A 3NP4A 3PAZA 3DTUB 1ET5A 2GBAA 2HRGA 1JZGA 2UXVA 3AY2A 4G70B 4DP1X 2OV0A 1M56B 2CBPA 3FQYA 5D4IA 2IDUA 4MFHA 3T6ZA 1FFTB 5PAZA 4TXVB 1AZCA 1TU2A 4G71B 5I26A 3WKPA 4E9WA 3CVCA 5AFAA 3CVDA 3WKQA 1GY1A 5TK4A 2GI0A 1CC3A 1AZNA 3S8FB 3WI9A 2AVFA 1EZLA 1WA2X 2J55A 3X1BA 4AI7A 3NJKA 4L0PB 5PCYA 3IN0A 4G72B 2YXVA 1NWOA 4UANA 2DWSA 5B7EA 2OCCB 1IBZA 3QJVB 1J5CA 2BP0B 1XMEB 5I6KA 1WA0X 2EINB 2HRHA 1GS6X 2XVBA 4YSQA 1NICA 3FU8A 2BP8A 4X4KA 1KBWA 2YAHA 4DP5X 4KNSA 2BHFA 4P5RA 5D4HA 4F2EA 1AAJA 1X9UA 1PCSA 4DP7X 1KYAA 4Q89A 4PCYA 3AG3B 4ENZA 2FQFA 2FQGA 4A68A 2FJSA 4NERA 4GP4B 3AG2B 2PPDA 2ZOOA 1NTDA 4FA7B 3UACA 2P80A 4YVNA 2AANA 2XUWA 1X9RA 3X2QB 3BVDB 1E67A 3NJHA 2DWTA 1NWPA 4PAZA 2EIKB 2AFNA 3QJUB 1OE3A 2IWKA 2PPCA 2QT6A 1BAWA 3AZUA 2H3XC 1BQRA 1L9PA 2AZUA 2H5UA 3EHBB 4WKXA 4AKOA 1ET7A 4A2EA 2IH9A 2P80D 3D12B 2CJ3A 3FYEB 1JXDA 4N4YB 2UXFA 3NP3A 2JKWA 5AZUA 3S3BB 2EIMB 1AIZA 4HCFA 4M4RB 4AKPA 1W6WA 1ID2A 1KBVA 6PCYA 4GP5B 1CYWA 2WSDA 4YSRA 2XV2A 2YAPA 3GYRA 4YSPA 1GS7A 4NAJA 4BXVA 2HXAA 1QHQA 2PCYA 5B7MA 1SHXA 5I6PA 2VW6A 2PPAA 1BQ5A 2X87A 3MX0B 3TU6A 2FT6A 3T6WA 1OV8A 3HB3B 3T9WA 2QPEB 1BXVA 2BZCA 3TBCA 1HFUA 1KCWA 5ANHA 4FAAB 1RZPA 4Q8BA 1ZIBA 3NYKA 3ZX1A 4F7KA 2FT8A 2VM3A 1OCZB 1JXGA 1SDDA 1ETJA 1NDTA 2HLEB 1J5DA 1AS8A 2J56A 3G5WA 3U25A 1V10A 4DP8X 4YSSA 2XYBA 1PMYA 2HX8A 2XLLA 3CVBA 5B1BB 4KO7A 3CDZA 2VW7A 1KV7A 3NSFA 3OQRA 3WNJA 4E9SA 1ADWA 1E5YA 1NIFA 1PLAA 4DP4X 1NPJA 5EHFA 1NZRA 1MZZA 2CAKA 2Y69B 4G7QB 3MBWB 1WA1X 5B1JC 2BP8B 3H56A 4A2FA 1BEXA 4YVUA 3TASA 2FNWA 2XX1A 1AANA 2QDWA 2I85A 4A2HA 2B08A 1JZHA 3QJQB 1MG2C 2YAEA 3FS9A 1SF5A 2UXTA 1JXFA 1IBYA 2E86A 4BWUA 1JERA 3NJFA 1YLBB 3ABMB 1AS6A 4E9VA 1ET8A 1ZPUA 2CCWA 4DPCX 1IKOP 2DY2A 2YAFA 2GC4C 2VMJA 1OF0A 1NIDA 3QQXA 3HEIB 3CZUB 1PNCA 5I6MA 3ABLB 3L45A 1GSKA 5B7FA 2EIJB 2ZONA 3ZBMA 1BQKA 1AZBA 3DKHA 4QKTA 2BW5A 2FT7A 4DP2X 3SBRA 2PPFA 4DPAX 2FQEA 3ZDWA 1XB3A 3ZIYA 4BWTA 3JT2A 2VW4A 2Q9OA 2GSMB 3C75A 2IDSA 3T6XA 4GY4A 2Q5BA 2NRDA 1JVLA 3PLYA 4E9XA 1OE2A 2FWLB 2WO2B 2DYSB 3T6VA 3PCYA 3NSDA 4A66A 3N2JA 1DYZA 9PCYA 3SQRA 1FA4A 3FYIB 1VLXA 4KO5A 1ASPA 1SJMA 4QLWA 2GIMA 3OM3B 4YSUA 3S3CB 4YL4A 3UGEA 3JTBA 1OCOB 4NB7A 2BZ7A 4HCIA 2QPDB 3FU7A 2MRYA 5A7EA 4AX3A 2B3IA 2TSAA 3AG4B 4KOCA 4CSZA 1ILSA 1GYCA 4G7RB 2X88A 4KO9A 1OE1A 1GR7A 1UATA 3NJGA 1SF3A 4UF7C 2LLNA 4HIPA 2XU9A 1AACA 2IDTA 2OJ1A 7PCYA 5AKRA 1DZ0A 1ZV2A 4DP0X 1SFDA 3TBBA 1V55B 1ASOA 2R7EB 5E9NA 2XXFA 1PZBA 2CUAA 4W9ZA 1URIA 1T5KA 4GXFA 1L9SA 1AR1B 4YSOA 2IDFA 2I7OA 1EHKB 2YAOA 4JHUA 2XX0A 1GS8A 2J5WA 4BXSV 4BDVB 4KNTA 1WS8A 3PPSA 1GW0A 4HAKA 2IWEA 2GHZA 1ZDSA 1XB6A 3X1FA 1KDIA 1OCCB 1J9QA 8PAZA 2BP0A 3GDCA 2IWFA 5I5IA 1R1CA 4YSEA 1E5ZA 1NIAA 5TK2A 2I7SA 3DIVA 1JVOA 1PLBA 5IY5B 1A8ZA 1OOWA 5I6NA 1PAZA 1QLEB 2Y1AA 2XV0A 1L9QA 5B1JA 1A4CA 1AG6A 4BWWA 4YSDA 5B1AB 3UABA 4YSAA 3EH3B 4DP9X 3X1NA 1N68A 2PP9A 1RZQA 4P5SA 1NPNA 3IN2A 3EF4A 5I28A 3AG1B 1RCYA 3NSCA 4HZ1A 1JZFA 1AS7A 1SNRA 1FWXA 2ZWNA 4G7SB 1JZEA 4KNUA 4N8UA 1CYXA 2DV6A 4A2DA 4F2FA 3ABKB 1PZCA 2IH8A 3NJMA 2PPEA 1PZAA 3KW8A 4HALA 1KGYE 3H4HA 1L9OA 2PLTA 2VN3A 3OD3A 4ZK8A 4EF3A 1V54B 1AZRA 4KOBA 1TKWA 3FU7B 2VSMB 1PNDA 2FQDA 2JFCA 3N55A 3NJNA 5B3SB 2HX9A 5F7AA 1L9RA 3H4FA 4E9YA 1BYOA 3ERXA 6PAZA 4W1TA 3PAVA 3UADA 1M9WA 2UX7A 1WS7A 1A4BA 2YARA 3ASNB 4M3HA 1QNIA 1BXAA 3RYMA 2UX6A 1HAUA 1M57B 3QJSB 1IUZA 1BYPA 5LDUA 4JKNA 3S3DB 3QPKA 3WNIA 2RACA 4E9TA 3CG8A 4DPBX 2HX7A 3V9EA 2PCFA 3AW5A 3UAEA 3WG7B 1ZDQA 1TEGA 3FQ1A 4HHWA 2TSBA 4JHVA 3WIAA 3KW7A 2HZHA 3OMNB 1JOIA 4BK5C 2CALA 3TA4D 3FQ2A 4AZUA 2H47C 3FSAA 4GP8B 1W8EA 1NINA 3FSWA 4UAHA 5D4JA 3NJLA 1SFHA 1RKRA 5B1KA 1CUOA 1B3IA 3FU9A 3QJTB 1KCBA 2IDQA 2XWZA 1SDDB 4KO6A 3IEAA 4RH4A 1E30A 1JZIA 3FSZA 4HCGA 1E65A 2DYRB 2GC7C 7PAZA 3CDZB 2EILB 2YXWA 2VSKB 1A65A 3SBQA 3GXUB 2UXGA 2JXMA 2A3TA 1J9TA 1A3ZA 5I5JA 1J9RA 1BXUA 1JZJA 1A4AA 1WAEA 3SBPA 3FT0A 4E9QA 2MTAA 2XXGA 1F56A 3PAUA 1XB8A 1MG3C 1ILUA 4A2GA 2VM4A 1W6LA 2FTAA 5I6LA 1HAWA 2WO3B 1AG0A 3QJRB 3IE9A 3NSYA 5I6OA 3PXLA 3V9CA 1AQ8A 4DP6X 2N0MA 3IBOA 2J57A 1PF3A 2PP8A 1PY0A 1NIEA 1ZIAA 4WTQA 4A67A 4CSPA 1IC0A 1MZYA 4YSCA 1MDAA 1NIBA 3ASOB 1J9SA 3X1GA 2YAMA 2XV3A 1ASQA 4HHGA 4AKQA 3FPXA 1OCRB 2BWIA 2QDVA 3NT0A 1CURA 2AZAA 4YSTA 3FSVA 1L9TA
chains in the Genus database with same CATH superfamily
3RB5A 2DM3A 1MCDA 4MD4B 5FGRA 1K4DA 1K8IA 3JWNH 1TTBA 3NFPB 3OKNA 4QD2E 2PNDA 3RWEB 3US9A 4E68A 2C3WA 4GW5B 3MRCB 3IFNL 4OSUL 4PJCF 2ZUQC 5FCSH 2WGNB 4GMTH 5D93B 4EDWH 4YZFF 1Y7VA 4KZDH 5I73B 3BFOA 1QP1A 5DYOA 3L2NA 2NMSA 5BRZE 2V4LA 2YD6A 5KANI 1FO0B 4GH7B 5DJCB 4UV4H 2IAMA 3HC0A 5J1SC 3UOAB 3H7BB 5DK0B 4UTBL 2ZTBA 4Y1AE 3EFOA 2BHZA 2KH2B 5C08D 2VLMD 3LJ3A 4F9PC 1T6VN 2UZXA 4QXUH 4JM2D 3P3SA 2LU4A 4P23D 3KLHD 2VR7A 3ARWA 5I8CB 3QQ3A 3CN0A 4WHTA 1PU0A 3J8F7 4IDJL 5AAMA 3WTVA 4UI2A 2QGDA 4NO0B 3MLSL 3O3EB 2IDUA 5AAWA 3DOHA 4FYTA 4MFHA 5K1NA 1A66A 3MO1B 1YMMD 1N0LB 4GIPD 1IZKA 4E9WA 4MQSB 2ZCHH 4H5SB 1U3NA 1RULL 2ZCLH 1GTFA 2GI0A 4PRHA 5JNYA 4L4VE 4LPYA 1U9KA 2FEJA 3D69B 2BM3A 3LZFH 3WTTA 3Q6GL 1Z9PA 3THMH 5PCYA 3AUVA 3IN0A 3RHWF 5JIIA 4QYOB 3UEZA 4X4ZA 2FBRA 5T8IA 3ZTDC 4FI7A 2L3BA 1CXHA 2R2HB 4YSQA 2WLLA 1NICA 1BREA 1WBYB 3FU8A 3MOBH 4P4KD 5D2NE 1YMHB 3HZKA 4LNRA 3LIZL 1BJMA 5EIVA 3NGBB 3LX9A 1UEMA 5D96B 1AAJA 1T1YA 1RZFH 1MJJB 1R5IA 3RI5F 3LVEA 2Z31D 1G6RH 4L29A 3V4VA 3V6OC 3QDGB 2AXHA 2VO5A 3H53A 4DZBB 5CD3B 15C8H 2NNCA 5FLVA 3UBGA 4DK3A 2YPKA 1OM9A 4NBXB 4R3SB 3KDMA 3KXFB 5L88L 1B4JL 4U1IA 2YLKA 5HHPB 2GVYA 1TTGA 3V79C 4H8VA 2PN5A 4P2RE 3T4YA 2IWKA 2VMFA 4PJBF 5GGQH 4B9YA 4NO2A 1OAKL 1BAWA 3ALPA 5DWUL 1DBKL 5GXBB 1G7JB 2X0UA 3IMRA 4LEBA 4AZ8B 1GZHA 5ERWB 2CWRA 4YR6A 4FQJH 2PR4H 3SE9L 4TQIA 3PQYE 3V5KB 1C12B 4JFOB 3ZKNC 4AQOA 2EQDA 5HHOB 4MCNA 1I3GL 3HFFA 4H0HB 4HXBL 3P69A 2YO3A 4N3TA 2CKBH 1IBGL 5FYJU 4GQRA 1FC1A 1OHZA 1TKWB 4NJ9L 4POYA 3P0GB 4NQVA 4X4XA 3Q0HA 4LRIA 2F7OA 1UXSB 3VWKA 2ZKXA 1PG7L 3GIZH 4KAQL 3C2AH 3RIKA 3D85D 4PJFF 4NZTL 5B8CB 1J8KA 1MFBH 3GZKA 4ZMQA 2WP3T 4C55A 2NY1C 1GA2A 3VU2A 1EFXA 2DW5A 4IBYA 4M7LH 1FPTH 2VW6A 1KTLA 1Q0XH 4FQHB 4GI6A 3MRMB 3QB7C 5IBLC 4XCCL 3BUYA 3RTQC 4E5XG 2QSCH 4PY8I 4XHJC 2A74B 3C5JB 5LXGH 1NFIB 5F97E 4XB7A 2FAUA 4JPSA 1ID5I 4ZW7A 1DBAL 2ZXBA 4H26B 4BFEA 2FL5B 4CC4C 2GI7A 4N87A 1V10A 2P4AB 4KHTH 4ZW6A 2XYBA 1NGQL 1XGTB 2VXTH 3CSBA 2ICWB 1E27B 1YN6A 3QEUA 5FCUL 5IROA 4BZ1L 3U6RB 1QSEB 2HVJB 4JRYD 4CMHC 3D7PA 4Y7OC 3GRWL 2BMKB 4G8FB 4N22A 3PJSB 2YPVL 3MJWA 1GJIA 2WXFA 4G7VH 4GAYB 3SPIA 4PJGF 3FO1A 4XPFH 2DLFL 2J73A 4JDZB 1FUNA 3UYPA 4TULH 3A6CH 3BGMB 2P1YA 3QJQB 3ZRFC 2E56A 3KPQA 3VX0A 4ZUUB 3MNZA 2QVMA 3ALXA 3Q9PA 4RSVA 2VXUH 4G1EB 4ZXBC 3KAAA 1E4KC 1ZVSA 2LVCA 2I9LA 3N43F 5CLZA 4A7UA 3LQAH 5JOFA 5D2LF 5K9QG 1U93B 5G55A 3ZE1B 4DT2A 3NAAH 5MEPA 2NZIA 2C9VA 3CHSA 2IG2L 2OW7A 3NIFB 5E94B 1P6FA 1BQKA 3GM0A 3HI5L 2XTJE 4QOKE 1E3FA 1Q9KA 4Z7VE 5MI0C 5DD1H 1MN4A 5MEND 3U4EA 3ZGHA 1OTTC 2VERA 5DVNA 5KSUA 3DPDA 4LVNB 1RZ8A 1ZT7A 4XZUB 4K3EH 1W72L 2JCCA 3BGAA 3FC8A 4JNXA 5J5EA 5H8DA 1GL4B 1JDCA 2DM4A 3VXMA 1CWVA 4WW1B 4LGPB 4JGJA 4LQFL 1HDMA 3EJJX 3ZR5A 1QFWI 1KBGL 3HBPA 1OGTB 1RHHA 4P2QE 5ICXA 2C4XA 5H4ZA 4HIQA 4ODWA 3RPKA 2WUCL 1AE6L 2EYTB 3IPFA 3A4AA 1IJNA 3TYFB 4DF9A 3L81A 2WQAA 4JG5A 1SN5A 4YL4A 1INEH 5IFHH 4LBAA 3MOQA 1OAQH 1GGIL 4LCCB 4PG9A 3AM8A 4GW4B 4Z7NE 5CU5A 1F4YH 3Q6FA 5ABAA 4G7RB 3TLRA 3X12A 1P9MA 4ADJA 4MJ5A 1P1VA 4FFYA 5IQLA 1KTJA 3B5TA 2NY5L 4FQCL 5F1OB 1E9PA 2IDTA 2ID5A 2VDML 43CAB 2PO6D 4UNTA 5ICYB 4GSRA 3GZOA 4NS0A 1INDH 5LO7A 3TBBA 4MCZB 3ZKND 5L0QC 1V55B 2GUOB 3O45A 5E9NA 3A6BH 2YEZA 2ZOKB 2X2HA 4WHYH 3TNMA 2PTVA 4AIZB 5GRWA 4XRCA 1G84A 3VDAA 1I1AA 4WI7A 4APQC 5LNEA 4DGVH 4OQTH 3WFHA 2LU5A 3PPSA 5CP7A 2F61A 4E42A 4N8VB 1NAMH 3HRPA 2NY1D 4PYHA 3H9YA 2CJUL 5AAPA 5I0ZA 5FHAL 3DYMA 1OAZH 4TTDC 4MS8C 2WSKA 1K72A 1MQKL 1A6TB 2GIYA 4G9FE 2BNUB 3RTQD 1TVHB 3SYCA 4AGMA 1XGPA 5I1JH 2QQNL 5JHLA 4XP5H 3RWDA 4PJXF 4JQIA 3UDWA 1KMGA 3VFUA 4ZMNA 5IB2B 2X28A 1AG6A 4D8OA 4M5TA 5B1AB 5C0CB 3SQBA 2NUPB 4F9LC 4LSSL 3MRHB 3UZQA 4PJBE 1N6UA 3WY2A 1MQ8A 2A6IB 5C0FB 5IEKA 3R0MA 5KYYA 4KTDL 3DSNB 1HCYA 1C7TA 3RQ3A 1TJXA 3TV3L 2EDHA 3KLDA 5I28A 3WJMA 4FA6A 3PREA 2ARJB 1KGUA 4WVRA 1XTMA 2OR9L 5DJ8A 1U8MB 3WGVB 5IESL 1BF5A 2DWDA 3EFFA 3O3DA 1OHQA 2IH8A 4Y19E 4J6RL 2C4FU 2W9EL 4NPYB 4AH2B 3KWXA 4IOIA 1RJCA 3N42B 3MRRB 2FATH 4EIUA 4PJFE 4ZXBD 1LD9A 5JO5A 2Y3AA 4Y4KA 5FKPA 1TFPA 4WGWB 4K7PL 1AZRA 4FNSA 4L1SA 1BF8A 2ICWJ 4BKSC 1CDIA 3FU7B 1OAUH 3U7WL 2E59A 1G9HA 3MNDA 2AEQH 3VFOA 1DEDA 3CX5J 5AW5B 4DVRH 4I2XA 1N3NA 5FFLA 4N2KA 4IBVA 3UP6A 1G0YR 1I7TB 3M8OL 4X7DC 2QSVA 2YA0A 1LWJA 5J13B 3CN4A 3L4TA 2K45A 3D48R 4M5YL 1OTTD 2Y6TE 3PIQA 4EUPA 3WL9A 3CBKB 4JQVC 5E1QA 1X5KA 2OW6A 1IUZA 5GS2H 5LDUA 3M17A 4MGXA 4X6FA 2H2PC 1RMFL 35C8L 3VXPB 2DEWX 3J07A 3IRZA 1KWKA 2G9HB 3I75B 4X4ME 3QNZB 3PNWB 2R59A 1O6TA 1FJ1B 2V9TA 5FEBA 3WG7B 1VSCA 5F7MC 1MI5E 4ANXA 1A1MA 3F5WA 3QFJA 4JFDB 3NCYS 4HS8L 3UGXA 4K7FA 3SZKC 1JBJA 4JFED 2Q76A 3HPLB 1ZS2A 4LPWA 2CALA 2CUMA 1A6AB 4X6EA 5E2UH 1NCDH 1IIKA 1NCJA 2HFEA 5IHUH 1S7QA 4AQ1A 2PW2B 4G43A 3MJ9L 3GMRA 5D4JA 3ARFA 1CZ8H 2OZNA 2PYEE 3KPMB 1NBYA 1MVYA 1QLRA 2NY0B 4HGWB 1WHPA 2CBQA 5ECGA 5D7HA 4Y1AB 1X5IA 1M9SA 4W9FC 4DGIL 3RGBA 4PB0L 3GRBA 1C1EL 4GI9A 1NGZA 1FFPB 3B9EA 1V7MH 3IJSB 1F4WH 2XG4B 4S10A 3DPBA 1UD5A 1EHLH 4NZDA 3UPRA 1YC8A 1SY6H 4OZIA 2AJVL 4PUBL 2EILB 3B3IB 2CLZA 3BYTA 2K0RA 2XYCA 5BZWB 4ZX4A 3MLZL 4X7FC 5L4JA 3V0WL 1U6AL 5E7BA 5F8QC 5KVDE 2FEEL 4OBSA 4APQD 3U4BL 4BFRA 4L4VB 1CF8L 1MEXL 1LYQA 2ZAIA 3IDYC 4M62L 4Z7QF 1UB5A 1I4FA 3FT4A 4JRXA 3LNGA 1BIIB 2R27A 5EO9A 1W6LA 4TTDD 3K6NA 4ZDHA 4MS8D 2VR8A 4UUJB 1G87A 1HYSC 2MOVA 2E7BA 1WH0A 4PWEA 5DJ6A 1TJMA 3BP7A 3RFZC 4JG9A 5EULV 1P4LA 5BUPA 5HYSA 1E9OB 1SJVA 4OD3H 3PJNA 4OFYA 2EYRB 1SJHB 4PJAF 5HVHB 5I5RA 1Y18A 3C6LB 1OSZA 2KHAA 1ZS8B 3S37X 3D34A 4WKZB 3QS3A 4P59H 2A1WL 3SO3C 3DDFA 1GGBL 5KS9A 4NQCE 4Z7UF 5ISZE 3WJLC 2QKIA 2PCPB 4MD0A 1R5VB 4FG6C 1ADQL 3KHOA 5B3JF 3E80A 5AZ2H 4UWQB 4P2RB 3QDME 1CG9A 5L2KD 3QUKB 5AVUB 2PW1A 2FGWH 2FJHB 4LSTH 2QGCA 4N85A 4XXCC 2I32A 5EUOA 2OI9C 3LY6A 1GY2A 5C3TA 1T4WA 5KJRL 4ANWA 1BPLB 3SGKA 3S2AA 3CFJA 5AYUH 2NY3B 4XT1C 2A6KA 2GJZA 1QR1A 2JKXA 3IE4A 3KEDA 1GZQA 2AJSH 2X0VA 4AC2A 4YBQC 1EUUA 3CFTA 5EF1A 3L3IA 3BIBX 1A6VH 3PAZA 3FCBA 1ZRUA 2ADIA 4IHBA 4M7KH 2DMKA 3PWJB 1IFRA 4PRPD 2CBPA 4KKQA 4NSKB 4UDTB 1B0GA 3T6ZA 1CE1H 3RX8A 3L4ZA 5D7SH 5KW9L 3IGAB 4LBEA 5DUPH 1JF1A 4XBGB 2G60L 2EKSA 5TK4A 5IT2H 2C9AA 4GAGL 3ZUNC 1AXTL 2BINA 2ED9A 3GK8H 1WFJA 3LKSB 4N1CA 4WEUD 3TT3L 4ZMWA 3G5YA 3E8VA 3QIBA 5E6RB 2Z65C 3N04A 1MF2H 1SDYA 2KT6A 2DQHH 1MWAH 3Q2VA 3F2LA 3LB6D 4GKNB 3S3SA 1GMIA 3HUJA 2Y3NA 2X6CA 4J3OC 1KYOK 4LSPL 3BISA 2F74A 3VQLA 5KJ7E 4KI5D 1AD0B 4OLZL 4ZMAT 5DD0H 3L8QA 3LSOA 4UNIA 3BD3A 2AV7B 2RD0A 4LQ1A 4P5RA 4P99A 5E5LA 4F2EA 4F7MA 5IHZA 3RZCD 5EO0B 1T89A 4HPOL 3U36A 1TLMA 2FX9H 5F93C 1G4RA 2WLIA 1JPFA 4JN1L 3S96B 1FAKT 3VSUA 5DJAB 1CU4L 4Z76B 1NKRA 1KCSL 4P2OC 1CDYA 2XRAL 4CC1A 3SOBL 3IPBA 3WHE0 1O7SA 1KJ2A 3ULVL 1JTOA 1JV2A 4JFSA 2ZPKL 1UA3A 4WKXA 3HAEG 1NCIA 5C2BL 2Z6FA 5F6HI 4OCWH 1CL7L 3CZSA 3E8UL 4HJTA 4HW6A 3ZLQC 5HHQB 3QZWG 4ONOA 5JDSB 1J87A 2ZOUA 4L2YA 2H41A 4XPGH 4TL4A 4YHIA 3OKLA 2GTZA 5JW4Q 3NP3A 1JZ3A 4BM7A 3F58L 2DJ4A 1HYSD 3ZSTA 1UT1A 3L3OA 4UQ2B 5SWZE 1A02N 5F9WB 1EXUB 4N0YL 5KN5B 4XGZB 1MCCA 3FF8A 3KLQA 1CLYL 4J7RA 4N90E 5G2NA 5J0BA 3N3EA 4AEIL 4OLWL 1RH8A 5JQIB 1IT9H 2O4EA 4ZZKA 2AJZB 2JQAA 4Y2DB 2B2XL 2OK0L 4P2QB 4XO5A 5F7DB 3TJEL 4K3JL 3L4UA 2EVIA 5JW5A 5EO1B 4HIXL 2NXYB 4H1LB 3QSKB 3B2MA 5JIQA 1TYRA 1UWGH 1JWMB 3D09A 4MJ4A 4NKDA 2DIAA 1HFUA 4JVPA 4NT6B 2OMXA 5D1QE 3W11C 1JWSB 4XXDA 1ZLUH 4FS0A 3ZGIA 3DXAA 4Z7NB 4FG6D 4FEMA 2VRKA 2A9NL 1WBXB 1IU1A 1DJHA 1QI3A 2NW3B 3DIFA 4FG4A 4IJTA 1IEAA 5DMGC 5C97A 2WYZA 1GTNA 4GSUA 2I60L 3BDXA 3GTVA 4JCLA 1DR9A 1F11B 2R1YA 2D7PA 3U25A 4MJ2A 3GMLB 4AM0A 4C56B 3VD7A 4PRNA 3G6JB 2WZPA 1E6JL 1KV7A 2VZ3A 3NSFA 2DQGL 4KXBA 2N7BA 3AT0A 4U0RC 5IVOA 2W65B 3OB8A 3QFGA 2MH4A 3PABA 4JRYE 4QRAA 1UQSA 3D9AH 4DP4X 3VD1A 2V8LA 4BUHA 1XR9A 3QPXL 5D9SA 1RZIB 3D2UD 1YEJL 3KVQA 2OJEB 4L8BB 3H56A 4HCRH 3MRLA 5AG8A 1B2WH 5JUEH 2DOCA 1TFHA 3OV6A 4M8VA 1PFOA 5CBAB 1JZ6A 5CM1A 4PJAE 2DL2A 4U6YB 1Q72H 2DKMA 1KIRA 1TCMA 1N59A 3DBSA 3QXAA 1UACH 2F08A 1OSPL 4HLZG 1IC1A 3VFRB 1QZNA 3VFSA 3A4EA 1UVQB 1RL1A 3MZGB 4RLDA 2H32B 4Z7UE 1PNCA 3STLB 5I6MA 3ABLB 3QEGL 2J8UB 4X9YA 2EIJB 1I7UB 2G3MA 4TVPD 4UTCA 3O2DH 5B3JE 4HIJA 4XBEL 5JORB 2K6ZA 1D5ZA 3WAJA 1D5BA 1U8CB 4RGNB 3GKWH 3JTTA 4BWTA 3AQYA 3VXSD 1IZJA 3PL6C 2IIJA 3QCTH 1OZUA 4J3OD 4RVBA 3OKDB 4ABUA 4Y88A 2SEBA 3OGCA 1KC5H 4NM4L 4GBXB 2QFRA 4GKSA 4PRIB 5C0NC 1DQIA 4QRRA 3DX9B 2O6EA 2NXZB 4MYWB 4OGQC 1FBIL 3T6VA 3WIHA 3OAZK 4KMQA 4PD4K 2HWZH 1EAPA 4JPIB 5GSVB 3E6FB 1DQLL 4A7GF 1Q9WB 2X1WL 3PHQA 4WI0A 3BVVA 2Z91B 1HINH 1NLDH 1WT5A 1A2YA 4X5QA 5CSZA 4B97A 2EDFA 1TNMA 3VXNA 3O8XA 2VDLL 4NAMA 1E40A 1VF5C 4Y4FA 1UENA 3UGEA 2WV3A 4WUKH 1ZA3B 5EDXA 2X4OA 3V6OE 3VXQB 4P2OD 4BZ2A 1NSNL 1FO0H 3CU1A 4CNIB 3L5WB 4M48H 4PJDE 4JANB 5AEAA 4FQIH 3VMPA 4AJYV 4P3DA 2YGPA 3T0EC 3B8YA 2R8SL 4J39A 1TCRB 1KXTA 4QHKI 4UCFA 5CJBA 5KSVB 1S9VB 1PYWA 3MBEA 2Q87A 1UJ3B 2IVFC 4CJ1A 3LN4B 3QJOA 3CIQA 1FHGA 3B7UX 5DZNA 1SXBA 4OGYH 2J8OA 5I8OH 1TF4A 5DSCB 3DX8A 2B14A 2FJGA 4EI5A 3Q5OA 1YEEL 4YHLL 2B1AL 1DJXA 3FU3A 3PWLB 4ZFQA 4N0FA 1CFNB 3UBXI 5CZRA 5E1GA 1JS4A 3VYNA 1LP9E 5GS0C 1WGVA 1KTDB 1XB6A 2CDFB 4G8GD 5ID0A 4UIKL 2E5EA 4BD4A 3V4UH 2NY2B 4MMZC 1WHOA 1BV8A 1R1CA 3FBQA 1EEZA 1HHGB 3WS6C 3W11D 2PYEB 3JWNG 1I1RA 5JW3L 2WXRA 4HISA 2XDHA 2A7BA 3ATFA 1VFBB 2WBJC 5DMGD 5FV2A 1UKSA 1XEDA 3RNQB 3RIFF 3WD5L 2J8HA 5C9JB 3L7FA 4ZFOL 5KTEL 1CR9H 5DHXB 1BVLB 2A73A 2NY0D 3REVB 4GO6B 4RFOL 2YXMA 1BD2B 4OJEH 1SNRA 3FQRA 2OP4L 2ZX5A 3QHTC 4ZS7H 4HIIA 4NO3B 4X0KA 3HZYA 1WCBA 3RDTB 5IMMA 1U3HC 5TQ2H 2VLJE 2J72A 4Y16A 4UT9A 3TZVC 5IB1B 3WEXA 4DOHE 5TPWH 2ED7A 2N56A 1CFMA 1L9OA 3PHOB 4HS3B 3R18A 5E0FA 5BOPA 3US1A 4MNQA 4KI5F 1V54B 4PJHE 3OKMA 3RAJL 1H5BC 2ICEA 2DI7A 5CEZH 2YN5A 1ZGLM 1DUZB 3HCVA 3SDYH 5C7XH 2Y9RT 2V5YA 5DZ9A 4A6YB 3MCLL 5J6HA 3Q48A 1T0NB 3OF6D 4OCXH 1H3PH 2FEEI 2PYFA 3WFDH 2GJPA 4I18A 5F3FA 1DVFA 5IMKB 1GZPA 2DLHA 4FMFA 1E4HA 1J0KA 4NNPH 3UC0H 2FX7H 3PP3K 4RWHA 1HAUA 5EOQH 5IBTL 3PL6D 4F58L 4NLHA 1CJYA 2WVVA 3TWCH 4CGUB 1FL6A 5TE6L 43C9B 1LO0L 3HNSL 2G30A 5FW7A 5ILTL 3BRFA 3S5LG 3TBTA 3T3MF 5C0ND 3TTSA 5HXMA 3MR9A 4E9TA 4PJ8A 1S9WA 4LLDB 2YD8A 2WKLA 3CFEA 1HI6B 4OCSH 2IANA 3K2UL 5F9OH 4YJZL 4H4NA 4NHUB 1T0MA 2H2SD 3OMNB 1I8MB 2EDTA 4JY4A 3QR0A 2P5WB 3FFOA 4KVPA 4BK5C 4DGYL 2P9RA 1QPXA 4JFEE 4XVUC 1QFUH 3V0AC 3TH3T 5F6IC 3KNBB 5IV2A 3MBWA 3BAKA 5ANME 1A7NH 3APNA 3QXVA 2L7EA 5GJTH 5CBEB 2H6OA 3M7FB 1DTUA 1XFPA 3B34A 3T0ED 5ABZA 3FUDA 3COOA 1J48A 3CVHL 4G42B 1FG9C 3OX8A 5EBMA 1E30A 3NDYE 4W81A 5FYJH 1KCVH 3U82B 2R2CA 1S46A 1IAIL 2ZX8A 2NY3D 4RGOH 4PLJC 3WN5B 7PAZA 2E9BA 3LKRA 1KCUL 4OJYA 1ZLVK 2P8LB 3SBQA 4KZEL 2HH0H 1TZAA 4OZ4A 4BK8A 4WI9A 1SVZA 1BZ7A 2YSSA 1EUTA 1GPOH 1PIFA 3MROB 4GUPA 3LQMA 2H3NA 5E6YA 3CZNA 1BXUA 4NRZB 1YECH 1WAEA 2AXWA 2Y1YA 1ESOA 3SBPA 4J28A 3T4AB 5GS0D 1AQMA 3ZHKA 3FTXA 5CJQH 1AQKH 2Y06L 2XPZA 3AWFA 3PAUA 4GS7C 5AVQB 1R3KB 4PY8J 4KKZA 4YFEA 1ZT4A 4K5OA 5AWNL 2I25N 4O2EA 2FVNA 2P47B 2CG9X 2FLBT 3GLDA 3IS0X 4S2SA 3TPKA 1AG0A 3MLVL 4LLQA 4QT5B 5E1AB 3IMWA 2WBJD 3V9CA 5E8NB 4M7JL 3NH7L 4DP6X 4YXLH 4ODUA 4GW1B 3EADA 3F64A 1EXGA 1Z6JT 2YJQA 3DJSA 1UCTA 5IJDC 4HJGB 1ANUA 1IC0A 3LD8C 4Z7IA 5AD0B 2Q6WA 2GJ6A 4OVUA 3GUTB 1JD7A 1JMXA 4BSWA 3IXAA 1KTKE 5CWSB 2BSSA 2R0KL 3MACH 3VD0A 1UH3A 3DSFL 3M1CA 2OSXA 2ERJC 2ZSWB 4P3CH 3U46B 1TG8A 5CN1A 4E5XA 2W88A 3VVVA 2EE0A 5BVJA 1PSKL 3NTCL 3OB0H 3FN0H 3L2MA 2X4NB 1U3HD 4B53A 1KXHA 5L4MA 1Q9LB 4G8AC 3V7MA 3D0LB 5L2KE 3S8GB 3W0WD 3QJHB 3B2XA 3SKJL 4J3OF 3RWJA 3CBJB 4M5ZL 5I66B 4K9JA 5ID1A 2OMYA 2LLLA 2DD8L 1CBVL 2DS4A 4ZO9A 1M2VB 4Q6IA 3CDCA 1S7UA 5SWZB 2VITA 1A5FH 4DEPB 1TMCB 2M2DA 2VC2L 3OKOB 1GIGL 3O6KL 4ODXB 1FLRL 3IFOA 5GGVL 3DTUB 2K7PA 1IMHC 1ET5A 1IKNC 4GOSA 3WNKA 4A04A 2OJZH 4MRBA 4OF6A 2BVOB 4OGZA 3R4RA 1EHNA 3TO4A 4DP1X 3FQNB 3AS3A 5FYLD 4LP5A 1JK8B 5EU3A 2NCMA 4PRPE 1CL7I 4PWIA 2OTUB 3P4NA 4FKHA 5CJXA 1UGNA 3MXVH 5I30L 1HL8A 1F86A 1LK3L 2MHAA 4TXVB 4F2ME 4JKMA 5IR1A 3WKPA 5D1QB 2ALAA 2QPUA 3CXDL 2CNZA 3FQXB 3HJ0A 4Y2DD 1JCVA 1WPCA 3NESA 5DVMA 5EFIA 2EO7A 3IJEB 3CZLA 2J55A 4AENB 1I7RA 1XSOA 3DX7B 3RE0A 2P8PA 5A1AA 3ZDZF 4NYLA 1MSPA 3QUMB 4XP9L 4I1RA 3SKOA 3GXNA 4LPCA 4XVUD 3Q1SH 3EKCA 3PV6A 3O11A 3QG6A 4LO9A 4U0QB 5DMIL 5GGVY 1T4KA 3W37A 4UMGA 4U1HB 5T5FA 3KHQA 3SCMA 3D18B 3HZ3A 4QXTB 3VVWA 2CRYA 2GFBB 4HZAA 3D39A 2YA1A 2CH8A 4HGKC 3RLSA 1GGTA 4OZGB 1NCOA 2ZD0A 1KYAA 4UQAA 4YFLF 4GRWF 2WIIB 1P2CB 3BWSA 3KPRA 4MDIA 2DQFA 3APFA 4ODSH 4R7NB 4NQUA 4PLJD 5FDWA 1FGNH 1HEHC 3UACA 4Q9BA 4Y2NA 5D7IE 5L7XL 4KTEH 3CHOA 1O5PA 4F57L 2FSEA 1S7VA 4LEOA 4PAZA 2OZ4H 1WO2A 3ROLB 1OPGL 2G3XA 2OQJA 5KSAD 1BZOA 1CGUA 4NP9A 1CT8B 4Z18A 5ACLA 5B4MC 3EHBB 5AW9B 4KXDA 3T3ME 3BP4A 1UB6A 4P2CG 4PRBA 5EEYA 1F90H 5J3HC 5A43C 1KXVA 4WW2A 5GRUL 5JA8B 3MLXL 1MCOL 5IKCB 1JGLL 3S2CA 3KR3H 3SJVA 1G94A 5I6XB 3ML8A 4LSRL 3CAFA 4EIZC 4AQEB 1GRWA 2QQKL 1E6OL 3OBAA 4EN3A 1HU8A 1BLNA 1L7IL 2QMKA 2QR0B 2ZXQA 4PB9L 4OD2B 2YD4A 4YSRA 4RAHA 3F85A 4IEFB 1GS7A 3Q06A 5FUCC 3HZMA 5DFWH 3DHPA 1T1WA 4KKLD 1JV5A 4HIHA 2HT3C 2JLLA 4FQXC 5I6PA 2OYKA 1XBRA 1IE4A 4H2CA 4ZQKB 3RPIB 3T9WA 4CN6A 4NKIL 3OHMB 3PWPA 4JFYB 3F7VB 4ZYKA 2PXYB 5DRXB 2D31A 2QFPA 4J3XA 3QWOB 1FRGH 2OXHA 1OP3H 1IBDA 1NANI 2WUBL 5F88B 1ETJA 4JPKL 3PGCB 3MA7B 2AMGA 4AQAB 1QRNB 2Y36L 1ZXQA 2BIIA 2AK1H 2XI9A 1KJMA 5F70A 1OGAA 3IPEA 5J6SA 3WFCH 4OLYL 2MCMA 3ROOB 4E9SA 5IQOA 5LLIC 1TTAA 4RFEB 3DHJA 3DV6B 5C0DB 1QBML 2QVTA 3EOBB 5EHFA 1NZRA 4YDIL 5FLUA 1JWUB 4XC3H 5HYQA 3LH8A 1YEGL 5LNDA 5IQ7H 4LVHB 1QACA 2BY1A 4WGKA 2V17L 4ZFFA 2CDGB 2QDWA 3H8NA 3GMNA 4NQSB 1IX2A 3OSKA 3BP6A 3E9TA 3L3DB 4WI3A 2PWDA 3FS9A 2UXTA 5DEJA 3HPJB 1G7MA 2VE6B 3MQIA 4R2GB 3VWJA 2F1AA 5ALCH 4POZC 2EDNA 4PVBA 4HP5A 3L3KB 2ZZUT 4NO5A 4Y89A 4XX1E 2X05A 2YAFA 1UOWA 1TZ8A 3UAFA 3HEIB 4QWWC 3REWA 4UM9A 2HFFA 1P5VB 4IGBB 1S5IH 4N9GA 4IKNA 4M93C 4LSUH 1UZ6F 4TVPE 4RBPK 5FGSA 1J88A 1NCHA 4BFJA 4MTMA 3K46A 4I48A 2YN3A 5IGXH 1RJYA 1U42A 5GRXG 3VXSE 3DUUB 1XF2B 4P5MA 1X4ZA 1T0OA 2AKRA 5ELIA 3VA2C 4AE0A 3BYYA 4WV1A 2NYKA 3I85A 1I82A 4R4FL 4RNRB 8FABA 4P9HL 1UD2A 5AAWC 5HGAA 1FLTX 3GLAA 4GO8A 4GRLA 3EDFA 4U05A 2VMDA 3ZTJG 3WE6A 4DOHB 2QBWA 1X9QA 4POUB 3GSXB 4ZFZB 5D7EA 3BAEL 4PJHB 2ZSVB 4ZX5A 2KERA 2MEJB 4ELKB 4GIOA 3X11B 3DTXB 4MXVE 1GR7A 4UF7C 3NJGA 3U9UA 2BSED 1I9EA 3VFNA 3NCYP 4OUUB 3QORC 5B4MD 3IU4L 2UYLB 3P9LB 3VJ6A 3MXWL 3OLGA 4NP4L 3O6FB 4F8PA 4Y4HB 5FKAB 5J3HD 3MRKB 4FX5A 4AEFA 4UQBA 1HOCA 5D7LB 4GQQA 3T2OA 2N1KA 1QVOA 3VRJB 3ZDZE 4XX5A 3AU0A 3RNKA 3IAGC 4FJZA 4JUSA 5EU5B 1DJYA 3VI3A 3ULUC 2CLVB 4WLCA 1TETH 3C8HA 3GSRB 4KJYB 2J5WA 4MCMA 1RERA 3SBWA 4BKTC 5C2UB 4XVTL 4J8RA 1CICB 2AGJH 5ESVA 5EU6A 3QXDB 1HCZA 3RWIB 2HVKB 1CLOL 3US0A 3G04A 3FFDB 4X50A 2HT3D 3DRTB 4FQXD 4ICWA 1UM6L 4OM1H 4P5KB 4G8GE 3ULUL 3MODL 4ETYA 2VISB 2VDQL 2O72A 3V2AR 4ZAKA 1ECYA 2VDMB 5TF1H 3V4VL 1XHHA 4JGNA 2QPFA 4DETA 2XN9D 4D0CA 4A55A 1RXLA 1A4CA 1GZHC 1B3JA 4F1ZA 4CVXB 2EZ0C 1Y07A 2LLGA 1L3WA 1YY8A 2KZKA 4C58B 3C08H 2P44B 4L37A 4XCEA 1MUJA 1RU9H 3FOLA 5FGCB 3L1OL 1T2XA 3CD4A 4HKJB 3QZLA 1GC1C 1JZFA 5IG7B 1OO2A 4LRIC 1BVKB 1CD1B 4WZ9A 4RMQA 3U7YL 3O4OC 2D3LA 3WFEH 1GAFH 2D03H 2YXFA 2DDQH 2YPLA 1BZ9B 2QVKA 5E7FA 1SRDA 3DBXA 4PV8A 2AQ1A 2CIKA 5BVPL 5F3BA 1RK0B 2IF7A 5AW8B 1YQ2A 1U8OB 4BHUI 4N25A 3RL2B 5FO8B 1PQZA 5AUMA 3VXUD 1JDAA 5TGBB 4DKFL 4HV8B 1GC1L 5FA3B 3U1SH 2PLTA 4PS4L 4O02A 3FZUC 1Z3RA 5M94B 2YC1A 4L4TB 1BAFH 3V4PA 1T1XA 3QW9A 5LHDA 2VSMB 4DESA 5G4MA 2HX9A 4U1JA 4L9LB 3D08A 2JB5L 3VI4B 4QWWD 4PGCA 4EDXA 2JQZA 3EFDH 3MKGA 3G6JF 3EGSB 3H54A 4PV9B 5T1DH 4ZMLA 5I1AA 3GT6A 4NQED 4N2NA 4R0LA 5IROC 3S88L 1IGCL 1YJDC 4M8QB 3VGGA 4Z3JA 1D6VL 4CA4A 4L8CB 3UGUA 1P5UB 1RPQA 2G2RB 1NMAL 1VEOA 2HT4C 2NY7L 3K8LA 2B59B 4H1LH 3FO0L 3ZZSA 1OANA 3Q9QA 5L2JA 4OLXL 4JDTH 4LE8A 3MN8A 1EDQA 2WTPA 3QPKA 4M43H 3T1FA 4NNYB 5DJDB 3AW5A 2R2EA 4YLBA 4PU2A 2EEDA 5I1KL 3V5HB 4LEEA 4NKMA 2VERN 5I1HH 5MEQB 3TF4A 4ZTOH 4JO1H 2J6EA 4PVMA 3V0GA 1A4JB 2HZHA 2RBLA 2YRBA 3UBXB 3NIGF 4U49A 1YEHL 3FSWA 4I9WE 1E43A 2J8UF 3NJLA 3ZE2F 4KJQD 4LCIL 3O4LD 4FXGC 2FIKB 1CUOA 2K6WA 1C8QA 5H2BA 2XNAB 1KIPA 5CINL 1KCBA 4YAQA 1YY9D 1KULA 3FT3A 4HEPG 1M1SA 4LB8A 4M4PA 5F6HJ 4AYMC 3QUYC 5J4MA 5CUSL 4OFKA 1QD0A 2NTSP 3TNNA 3WEAA 3QORD 4OF0A 5CIPA 3T0EE 3AWGA 4L23A 1AQDB 4MWFA 3B5HA 3SY6A 5SWQB 3RIAK 1NAKH 5JR1L 4XNXL 1UZ6E 3U83A 1E28B 3UXFA 5IJKA 3BKMH 5IUSA 1KB9K 2O61B 2F8VA 3GXUB 3TYGL 2NY4D 3H9HA 3NCJL 2WYHA 2BHYA 4Q7DA 4R8WH 1RIUL 4TUJB 3STZB 3ULUD 3BSZA 1KLUA 4U1NB 4XN2A 4Z95L 4Y5XC 3UTZB 2LTQB 3V0JA 3FT0A 2F8IA 2MTAA 3CQQA 4OB5H 2C34A 3HAEA 4NENB 4W9IC 3KYKH 5IEHA 1OW0A 2X40A 4Q2ZB 4G6JH 1RZ7L 4F7TA 1R75A 3RUGB 2FTAA 1NC4B 3HBZA 4FADA 3QZWA 1NOFA 3HRZA 1CFTA 3E6HB 4BSJA 3P0YH 3QHZL 1J1XL 1P84J 4QLRA 5I6OA 1CTOA 5G4NA 4C47A 3FT2B 1JUFA 4G6ML 4OGXL 1HTYA 5AVTB 3BXNA 1BGXH 1I1FA 4A67A 4U6VH 5AG9A 4Z7OF 4G6AC 3WY4A 5GS1A 5GSRA 3LPOA 1JFQL 4LRNH 5GRVK 3ZIMA 3CFBB 1NCCH 3HLAB 5BRZA 4FFYL 3CQPA 3GMMB 3DHMA 1LO3H 2YBRA 4JCWA 5EC1B 2OSYA 1JPSL 1L9TA 3OXSB 3RWGA 1AGBA 2R4RL 1JZ7A 3ELAT 4TLKA 4FQ2L 1A64A 3I02B 4S1DD 1QHOA 4FFZA 2X10A 3V52H 4AQZA 3T8XA 1ACYL 2D4DA 5FUOH 3KS0J 1YEDB 2DQ6A 4LVOC 5EZPA 3VTTA 1TEFA 1DE4A 5D1XA 3MC0A 3VNZA 1JMZA 2VDPL 1OAYL 3FZUD 2XWXA 4LIQL 3W0WE 2CK0L 2WD0A 2QZ5A 2C7UB 1AHKA 3WIFA 2ARJQ 3B2VH 5IFAL 2HRPH 4KRPB 1VEMA 1DVXA 3HOGA 2ZUYA 3TPUB 1Y1DA 1F3RB 1QUNA 3I6GB 3KE0A 4HHAB 1RSFA 2GBAA 1KG0B 3NJVA 4H8WC 2KL6A 4DKDC 1HEJC 1NC2B 3UJTL 1GSMA 2OV0A 2ENPA 4QRPD 5TQ0H 2BNRD 1C16B 1QTSA 2HT4D 2WTRA 3ZJAA 2XOTA 5CGBA 5DUML 4ZMPA 2RB8A 5FYLE 4JQIL 2VL4A 5FK9A 4H8QA 3RVVC 1TU2A 2F7IA 4H0LC 4BFBD 1K2DB 5EH1A 4P57A 3BT2L 5D2NA 2RMNA 3FB5A 3CC1A 1SEBA 3FDWA 4H8WL 4EOWH 1O7VA 5J9PA 2FH6A 4HUVB 1G9MH 3CXHJ 4Y5VC 3ULSA 1XSIA 4QHLA 1VFOA 5EN3A 3X1BA 5I1CH 1BFTA 1IC5L 3L3HA 1DDTA 3N1PC 1ZK9A 4N9OB 3ZT7A 5SX5K 3CH1B 3DMMC 4Y4KC 2OCFD 2V7HA 3L3JA 4NWUL 3BDYH 4G8EB 1YNTB 1ONQB 5D6DA 1KEML 3BDBA 1MNNA 4D9QD 2VSCA 3FO2B 5T1MA 3X3GL 3ABZA 3QIWD 2IC2A 1PG7W 5C8JA 4X4KA 1IGJB 3CCHA 4QHKJ 5LVEA 3SOTA 1I3RA 3QUYD 4DP5X 4RX4D 1VGEL 1SZNA 1ZE3C 2WLMA 3O0RL 2EUVA 4BBWA 3B4NA 5JQ6H 4YO0A 4V11A 3TBYA 2IPKB 4JHWH 4ONHB 3IJYB 3PQYA 5T3XL 3ME0B 1X7SA 3BP5A 5HDWA 1BA9A 1QFWH 5GHWL 3CV5A 2PPDA 1FZJA 3I6KB 5A3ID 3FCGA 4FF9A 3MFGB 1U2CA 1MAML 4OF7A 4YXHH 4UMSA 4A6YH 5IB4A 4S1RL 2DH2A 1JHLL 2V3FA 1FL3A 2ZAHA 3B9KC 1TTFA 5JPNA 2YGVA 5LGJB 2FBJH 1T83A 4ILDA 4KHXH 1JRHH 4I3SL 4AQ1C 1FNSL 2X44D 2P80D 3FYEB 2ZP0T 2WOBA 5EB9A 4JFHE 3WJJA 1BWMA 3APCA 1OT2A 4IRJA 3A47A 1L6XA 2EXTA 2EAEA 4M4RB 3HC2A 4XMPL 2X4PA 4PJIB 2QHRH 2P5ED 3D07A 1ID2A 1BOGA 3ZE2E 1RSYA 2R1XA 4YDVA 2XZZA 3WTYA 2GT9A 3LH2H 4B5ZA 2YAPA 2VCOA 3PAYA 2BS9A 4MMYB 5KVEL 4HKZB 4F92B 1TJHL 2XETA 3EOTL 4WWOA 1ODUA 1R17A 3G6AA 4G6AD 4WU7A 1F02I 4Z3FA 4P46A 5DJYA 4OLUH 3AAZB 4Z6AT 2ZX6A 2BZCA 3D3VB 5F96L 4KZCA 5ANHA 2NSMA 5DEFA 1TVBA 4XNQB 3N1QC 3FU5A 2KLRA 3P3UA 3K80A 1LK2B 4S1SH 1JXGA 5CCGE 2ESVD 4DN4L 4UILL 2V7NB 1RZJC 4FA8A 4WFEE 1BPVA 2Y0SA 2DJUA 2DQTH 4TSAL 3ZHNA 4YSSA 3IGLA 2IADA 3DK0A 1MPAH 1F1DA 4JFUA 3RL1B 4YHNB 3CVBA 32C2A 4FHKA 3D50A 2ZKWA 2FO4B 1I75A 4EZLA 1DQMH 1IAIM 3LRKA 3QISA 4O58L 5D7JC 3SDAC 4BFIA 3QRLA 3HNTH 3P3TA 5C0AA 4IBUA 5HYIA 3LNIA 4GNKB 3RKPA 4LHUB 1JN6A 3VRIB 1X3DA 2WNGA 5I16B 1N26A 5E9DB 3BZDA 4MNGB 2YGQA 4FNLL 4QOKA 1N67A 2D7QA 2XX1A 4Z7VA 1AJ7H 5I1GH 1HVXA 5H37G 5FB8A 1MHHA 5D7LD 5JOEA 3DVNA 4PJ9C 3TIDB 3P4LA 4NC1C 4UT7H 1SF5A 2E74C 2E86A 1FN4B 1CTMA 5CSBA 3JXAA 3RVVD 5A2CA 2XWEA 4D7PA 4E9VA 1OLZA 4LMQI 1TZHA 3DX0A 2DY2A 1R4XA 5CP3A 4OI7A 1K6QL 1F00I 2APWA 2BOBA 2X53A 2AC0A 2CJSA 4X5XB 1OSYA 5CMAA 3DLQR 3RX5A 1DQJB 3KL0A 3KYNA 3U0WH 2A4EA 3DMMD 1MCEA 3SGKC 5KWYC 1H6TA 5FYKL 4HWZA 4HZLA 4UDUA 3C75A 3L16A 3EJTA 1JZ4A 4J27A 4MJHA 2VLKB 4I0PC 4PLKC 2KYIA 1A3RH 3ULUF 4UZGA 1W0YT 1OE2A 1T5WA 1XAKA 3OR6A 2VKXA 3KPNB 5K39A 1J7VR 1AXIB 4A66A 3C60B 3S5LA 1DYZA 3QZBA 4MJID 2I27N 4LCVA 2CBMA 3NQKA 4M9OA 1QO3A 4NGHL 2V9QA 2OYPA 3KYMB 2JJUA 5LGHH 1OQXA 2VR3A 5JHLL 4P5TB 3OAYH 1RAMA 5F89B 3ZKXB 4YSUA 2EDWA 1XZ0A 2CHXA 3TO2B 1UCBH 1FVCB 4JHAH 4H7VA 2GHWB 1GYCA 1ZA6B 3P11L 1CYGA 2BSBA 1I8IA 2H9GB 3B9KD 4IRSB 1LDSA 1H0DA 3GSNA 5DFVC 2ADYA 2XU9A 3QRGL 5FOBA 2UVEA 3NABH 4AMXA 2WAHA 4XMUA 2O1AA 4YGVA 4X8JB 5AL0A 1G7IB 1NKOA 4B0MB 1UM5L 1HKLL 1PDKA 4G9FA 4ZUTB 1A14H 3RU8L 3AREC 4JZJA 4M7LT 2XWCA 5IIEA 4PBVC 2BC4A 1AR1B 4WWKB 3MLTB 4EEEA 3VD9A 2WJ5A 2XX0A 3EYSL 1J8SA 3LKOA 1C5DA 4BDVB 1J0YA 5FA4B 4IOFC 1CI5A 2AK4B 3QP3A 1UUNA 2GHZA 4WJG3 4PJBA 2ATAA 4A7VA 3X1FA 5HVWA 4ZTPH 4HUWB 3QUMH 2E4TA 4JO3L 3MGTA 4ZO6A 5EG6C 1D7CA 3DO7A 4UOW1 1D6EA 3WTWA 5C07E 1KGJA 1RUAL 2I7SA 1HIMH 4HAFA 3ORJA 5E6IA 1DANU 4IDJH 2ITDA 3U0TB 3FK3A 2DYPA 3N40F 3TM6A 5TFSL 3D0VB 1EJOL 1VADA 3WNOA 3MLSH 2C3VA 4F15C 1AXSA 4Y19A 2D73A 5F7KC 5EIIG 2F5AL 2WNWA 2XN9E 3B9VA 2XQYG 3Q01A 1BZQK 3EGDA 2JI2A 4N0UA 2PWFA 4FCAA 1KJ2L 1RULH 3KLAB 4PJFA 1DN0A 2VXQH 5EU7C 3UTSE 2DIEA 2JKJA 2BVQB 1YYMH 2ZG3A 3NG5A 5D7JD 3RRQA 3SDAD 2BJMH 3Q6GH 4IRZH 1RD6A 1GXEA 4JDVB 2EEFA 3MA9L 1ZGLP 3QZNA 4PS8A 5LUMA 2CXKA 3BLKA 5DHYA 4GEIA 3QWRA 4E41B 4FL4B 1PZAA 4PJ9D 1EO7A 1KN2L 2NY6B 2NOYA 1ZEAL 1UOLA 3AWEA 3LIZH 4J3OG 2HMID 3FCUB 3KJ6L 3F6JA 1W8NA 4ZFOB 1YPZB 4X4MA 2APBA 1IGTA 3GMPB 4P05A 4PGEB 2XZCL 5DWPA 4UOQA 2OL3A 4M29A 2Q86A 1MI5A 4E0RA 2QTVA 4OFIA 2CIIA 2V8MA 1WUZA 3SDCC 3ETTA 3H9SD 5ESQA 4K8RC 5CFAA 3C09C 4PJGA 2XT1B 1M6OA 3GLZA 1B4JH 4XC1L 1NC4D 2A38A 2X1QA 1CDHA 6CGTA 4MD5A 3VH8B 4BGDA 4QTHB 1BFVL 1OAKH 3HBQA 1QA9A 3O2VH 4I0PD 4PLKD 2JKSA 1DBBL 5D71H 4DVBB 1DLHA 3D2TA 2RACA 4K8RL 4N8CL 5D2LA 1ZDQA 2BOCB 3A4FA 1I3GH 4HHWA 3I3BA 3UEQA 3EH1A 3RVTC 5A2IH 2W5PA 4WSGA 1IBGH 5BMFL 4AJWA 3LQZA 1RUQH 2BRQA 1HX0A 4ANVA 2ZCKL 2VKWA 3G9VA 3EOAB 4GP8B 1PG7H 2VUKA 3V6FA 3WLWD 5JXAH 1B3IA 3NN8A 1S7WA 5IF0A 2TAAA 2R2BA 1NCAH 1VAHA 1EK3A 2G75A 2DWXA 1IBFA 1UURA 2XC8A 1TMQA 4NHCH 4X6CB 4KO6A 2AXGA 1W91A 4JFFB 4U7KA 1X5FA 1RQ5A 4XCCH 5D5MB 5L9DL 1T66C 5TE7L 1TR7A 1RUML 1E65A 2DYRB 3DURB 3HI1B 5IHLB 1QZ1A 3JTSB 4CRPA 3TA3B 3HNVL 4YDLC 2J44A 3PE9A 1DBAH 2YXWA 4AYGA 3NA9L 3QUXC 4DFHA 1PTZA 3ARED 4NFDA 1Z66A 4B27A 3V0HA 1DVYA 1NGQH 3BE1H 1U91B 1VCAA 5FCUH 3O3AB 1Q8MA 1OCWH 3MV9D 4EQ2A 3ULUE 3O3UN 3IXTB 1NAMA 4IOFD 2OR7A 3DYOA 5BJTA 4QGTA 3NOIA 1N6QH 3EW3B 3HE6C 3V0VA 3BUDA 1E5BA 4XH2B 5HYEA 4NQCA 3WIHL 3TEWA 1GCFA 4FXLA 4FG0A 2DLFH 2WO3B 4MAUH 3HG1B 2WWKT 2A6JB 4E2OA 4TTGA 5DU7A 2XBTA 3VGDA 1S3KH 2B0SL 2E46A 3IE9A 5INCB 1F13A 1EAQA 2XKUA 3WENA 5F7FA 1NGPL 5AKVA 4QRFA 3MRJA 3WO4C 5CJ8A 1PY0A 2AJYL 4YBLB 4BZ2L 3BW9A 4IMLB 5I75B 3V0DA 3DTDA 3C8KA 2CJTA 2H26B 2Y7SA 1Z9MA 1G7LA 3FPXA 1PJ9A 3LN5A 2O5XL 3HI5H 4MSWB 4N6QA 5CGYC 3VU1A 4EI6B 2XTSA 2J5LC 3E1ZA 2X7LA 4UINL 3IBEA 5DDHB 4DHLA 1AO7B 5JHBA 3OXRB 3IFPB 3HMXA 3IDIA 5C08A 1NCBL 1CVSC 4KQ4L 4MB4A 4JM2A 4P23A 4PJXA 3FQTA 1UKQA 3NCFB 4NI3A 1ZSDA 1AZUA 2A9CA 5DRZA 3RKDD 2NNFA 3P4OA 3CSPA 1KPUA 4QO1B 4LQFH 2MOGA 5I2IA 1KBGH 1R3HA 1YMMA 2XY2A 3RY4A 3QEQD 4B9JA 4MXWL 1FVDB 1BWWA 2WUCH 1U8KB 1AE6H 4WY7L 3BN3B 1N70A 3CE1A 2ADJA 3WV0A 4B3EA 5I1DA 3ZMEA 3SDCD 5AW4B 1L3NA 1ZOXA 2HT2C 1ZTXL 3QYCA 2Z35A 4K8RD 2K4AA 4XVJL 3AY2A 3RHWK 3S3PA 4QRQA 1GGIH 3ZQWA 3MDJA 4K2UL 4D8PB 2JVUA 2FDBP 3T0BA 3WCYA 5HPOA 4R7LA 2C3GA 4AV0A 2YK1L 2JH2A 2Z8WC 4JJ5B 2GY5A 1UD6A 1AZCA 2BNRE 5I1IL 2EE9A 3LRLA 2NY5H 3PXJA 2BH0A 2EYSA 3PU7A 2DLGA 5E2WL 3HN5A 4FE9A 3VFMB 5AVVB 1NGXB 1LNUB 4XP4L 3KS0H 1T3FA 2ERJB 2CGRL 2Y07L 1WG3A 5BW7C 4R7XA 4N3UA 4M6MH 5JXEC 1VGKB 3RI5K 4G72B 1CDJA 1X7QA 1I8KA 5DO2C 5LQBL 2VC2B 2X1XR 1NBCA 2Z31A 3DGGB 4WU5A 1J5CA 2JJSA 4IS6A 4OIIL 5I17A 1MCWW 2YEQA 1E0OB 1E4WL 4FN0A 1CD9B 1QYGH 4UT9L 4Y9GA 4OZFB 4M5SA 4NZUL 2YKKA 2GK0A 4AW4A 5KVGH 3K2KA 1JXKA 3GIVB 3VFVB 4BKLB 4I18C 1IM9D 3FBKA 5GIRB 1GYAA 1DVFC 4AVKA 1SVCP 3DECA 3T04D 3O3BA 3LMJL 4KGLA 3TOPA 4XMKL 4Y5YB 1X9UA 4DP7X 3SPVA 1MQKH 3FHQA 4U1KB 1XIWC 1N64H 2DI9A 3QAQA 4AIXA 2ODHA 1VDGA 1T66D 3QAZC 4KROC 1BIHA 2QQNH 1RZGB 3AB0B 4PV1C 5BRPA 1EBPA 4U6TA 4WUUB 3HFML 1Z7JA 3QUXD 4GXUM 3MBXL 2JCCE 3SEPA 3IMUA 3MRDA 3OKEA 3TEXA 4TOYL 4UQCA 2UV3A 2L8AA 4LSSH 2HFTA 4H44C 1AGCB 5FWRA 3TBWB 3TH4T 3VXME 4GMSL 1FGVL 1ZKAA 4KTDH 2AABH 1JGDA 3MGOA 4KDTA 3D85A 1QUPA 4X4YB 5CEXA 3HE6D 1QSVA 4YHPB 1KB3A 3BAYA 4A2EA 2ZE0A 3BKYL 2OR9H 1MH5B 2NPLX 5DQ9B 1AHWC 1TQWA 2C9SA 5IESH 2Z7ZA 4KK6C 3HA0A 4QKXB 3L9BA 3QIUC 2BVEA 4HCFA 4PLOB 5DGQA 5E2JA 3SKMA 1AYRA 5DR5H 3TWYA 4YDNA 3KH4A 4GP5B 1XXDC 4ALAC 1BFOB 4I85A 1AYOA 2CLRB 5H35A 2Z92A 2P5EE 4I5BB 3IVKA 3FW6A 4K7PH 3CWGA 1SQ2N 3FU0A 2DQIL 5EBWB 1KIUB 3MNVB 1HHIB 5BS0D 2AQQA 4JRYA 3NIDE 4IIQC 1QSFD 5HDBF 1HE7A 4J2QA 3KPSB 3L3GB 4HJ1A 3M8OH 5CGYD 2VQ1A 2AI0H 2O5YL 3UTTD 5F0JB 1OCZB 2CU9A 5MERB 2YKLL 4LIQE 3L48A 1JGEB 4I3RL 3QUHA 2ESVE 4L3FA 5E8OA 3RUGF 4DNLA 3OJDB 35C8H 4PJAA 4YIQA 4FXKB 5D1ZI 5ITBL 1YDPB 4OCYL 4ISVB 4X6DF 1UXWA 4X5WA 3LKQB 1JGVH 2VAJA 3BH8A 1IEHA 1VZIA 5FECA 4O2FB 5EC2B 2RJMA 3EO1B 1BXXA 4UV7L 1NPJA 2Y69B 2V6HA 2FZ3B 4G7QB 1OP5H 4HS8H 3WXVL 4Z7UA 2ISDA 4PRAA 4Y7MA 3IGFA 4Q9RL 2HT2D 3JUYA 5HGHB 1JZHA 5KYUA 3MGAA 5KJ4A 4XNAA 4ZOEA 1CO1A 2BCMA 3LHPH 4NZ8A 1ZHLB 4WO4B 4BH7A 3CDGB 5MENA 4XNZC 4LPVA 2GCYB 1MVUA 4WWKD 2P7TB 5DMJB 4DGIH 3QR1A 2XFXB 1C1EH 4GQ9H 2KQNA 5C07B 3I3DA 2VDRL 3GMOA 3LCYA 3QQXA 1OP9A 1XXFC 4F5CE 3OWEA 4JL2A 4WF7A 3L9RA 4AL8H 2AJVH 1DVSA 2HYMA 3DV4A 4TRPH 5JXED 1NBVL 1DUYB 1ML0A 2OXGB 4LLWA 4LK4A 3MLZH 5HYJD 5DO2D 3V0WH 1U6AH 1R3IL 1N6VA 3JT2A 4I77H 3MCG1 3U4BH 3P0VL 3UTSB 1CF8H 4GKZA 4PJEF 4ZOBA 3VG0L 4LEXH 2YRZA 4MMXC 5BZDB 5T3XE 1WZ1L 1AY1L 3P73A 4XXWC 1DVFD 1D5XA 3N2JA 2EECA 5ITFB 4O51B 1ZGLA 2R4SH 1HHHB 2VLLB 4LGRB 5ETUA 1U3YA 1AZVA 3NZ8B 5CEYB 1XIWD 3M1OA 5CJXC 1AFVL 4D0BB 3WSQL 3CFQA 4NQDD 4G2AA 5DK2A 2NW2B 2PO6A 2FO1A 3T2NL 1HQRA 3BQUC 2GAZA 5DS8A 4QTIH 1N5YL 1DLFL 4PTUB 2MRYA 5A7EA 1JNJA 4CDHA 1YEKH 4MJ6A 1RJZA 5IVZA 4XAWH 2B20A 1FH5L 5F0LB 4B9PA 4JFZL 3ZOAA 3F7KA 4XB3A 1LP9A 4HIPA 2YRPA 1K8IB 3OKNB 4HEPA 4N2HA 4KKAC 3ZR6A 4QRUA 2HJFB 5J6GA 1ADQH 4MB3A 5SV3A 3EUDA 4X7EC 1CIDA 4KK6D 5DYOB 4LAQL 3L6FA 3GZQA 5G4OA 3QIUD 2R51A 5INDA 2OTWA 2IAMB 3HC0B 4MLSA 4LKXA 3RTQA 3TV8A 4HPYL 2ZYHA 1GGUA 2GKIA 2UZXB 2YPVA 1IAOA 3IFLH 4W68A 3U2JA 3FUJA 3AU1A 3QQ3B 3CNKA 4CC4A 5T5FL 9CGTA 2OCJA 3WIIL 1ZHKA 5C0EA 5MEOA 2R0ZH 3V0FA 4OZIE 4PW9A 3MRQA 4HJIA 2FUQA 1YAIA 3GPSA 5CZVL 2IQAA 2UZIL 4Y2OB 3W81A 4KKBC 2AXFB 1TQCC 3DOIA 4PRHB 3U2SA 2QSQA 5JNYB 2Z34A 5D6CA 4BWWA 2APVA 3I74A 1S7XB 1U8PA 4RIRA 4WW2C 2ADFL 1G0XA 1RZQA 3F62A 2WJ7A 4NNXB 4WHCA 2G60H 5E2TL 3H7LA 2YQGA 4JRXE 2HKFL 1HSBA 3N41B 5EEXA 4XPBL 2BSTA 5IP4A 1AXTH 3FT1A 4ZXBA 1U8JA 4LARL 4KQ3L 4GG6B 3MSPA 4HCRA 1U3ZA 2WLLB 4FNPA 4H8UA 3F04A 3K74B 3UJIL 4HF5H 2XXCB 4LNRB 2FYVA 2KLTA 2VDQB 2I26N 4F7EA 1Q4NX 1RI8A 1X5LA 1R5IB 2BVPA 1UFGA 1TQBB 1OL0A 3GTNA 4RGMB 4YPGA 4IIZA 4NC1E 1X5ZA 4PMFA 3ARYA 3IDJA 4AV5A 4ZMOA 2YPKB 2GIXA 4J3WA 1TPXC 3KDMB 4NJAL 5FYKE 3FB6A 1CBJA 4JN1H 2BVTA 4N20A 2YARA 4NO2B 3SGEH 1CU4H 2D3NA 3UYRH 1A25A 2XRAH 2AHIA 3SOBH 1L5GB 3IDGA 5EUOE 3SZ6A 4YR6B 4ZPVB 3ULVH 1L9MA 3BSHA 3QFDA 2CRZA 3LKNA 4RSYA 4U1LA 5HI5C 1X4YA 3GBML 4TKWA 4HIEA 5C2BH 4KX7A 1CL7H 3DJZA 4NQVB 4X4XB 4DPBX 3ARXA 1DJIA 1H9VA 4OI8A 3CHXA 3VWKB 5JYMA 4GW5A 2FD6L 4NQXB 1D5IL 1VACA 5T5NF 3WUZA 3VWJC 2G4EA 2MJWA 4AC4A 1FE8L 3TN0C 1CLYH 4BSVA 3BQUD 1YNLH 3Q8FA 1KTLB 3UO1H 3AGVA 4RA3A 3CZJA 3VCLB 2B2XH 2BIMA 2GSIA 1AO7D 25C8H 3BUYB 1A9EA 5EV7A 2OK0H 1LO4H 4QCIA 4K3JH 1TJGL 1DSYA 2IQ9L 2K9FB 2XWZA 2VLRB 4HIXH 5E2VL 1E5CA 4AYBA 3CHPA 2BSRA 4APQA 4IBSA 2WM0A 2X2UA 4FC3E 5DJXB 1A6WL 4HUUA 1G9NH 4KKAD 3QEUB 4ZMYA 5E08H 1YN6B 4A7GA 1QLEL 1OTSC 3MYZA 1WAAE 3BCDA 1DSFH 4FJ6A 4OQ1A 4P2YA 5DD6A 2YD7A 5DVPA 2WSPA 2QZQA 4PJ7F 3D5OF 4PJEE 1RZKC 1GMEA 4AQ8C 2BFVH 3FO1B 2DQGH 3P9WB 1JZJA 4GRLC 1XL4A 3UYPB 3CQFA 4OZHB 4X9HA 4QYOA 2BZDA 4J3TA 4YGAB 3MNZB 3LDBC 4A2GA 2FWSA 1PZ5A 4QAWA 3U7AA 4YL9A 3U48A 4ANUA 5EZJA 1FQ9C 1ZVSB 2LGNA 2I9LB 1FH2A 5JOFB 1YMHA 3FXIC 4KKBD 1OGPA 1EEYA 4YHOL 2K1MA 5MEPB 3MRGB 2BP3A 2EDYA 4TYUA 4ZOAA 5I71C 3DRQA 1A4KA 1OSPH 5BO1L 1NIEA 1Q9KB 5L2KA 5I9QC 3H3PH 4XMWA 1LGVA 4DZBA 2VDNL 3ESVF 3EYOB 4JKLA 2DICA 1D7DA 3BVTA 5KSUB 5DEGA 4OLEA 1RZ8B 2NZ1A 1ZT7B 3D25A 4R3SA 2G9KA 3KXFA 1QWHA 2JCCB 4XBEH 1V7NL 4ES9A 4PP2A 1OARL 3VXMB 4IYKA 3PP4L 3WE1A 1NGYA 1HDMB 4AZ8A 3QNFA 5ICXB 3WNPA 4PTTB 4ODWB 2BW4A 5E8EB 4WUUD 1NANH 4PRPA 5HHOA 1FBIH 4KFZC 5AKTA 2F53D 4F2MA 1KGIA 4ZAKC 2DEYX 4JQVA 2J2ZB 1DQLH 5F7UA 3RJDA 5F7BA 2IFFH 4PG9B 4EBQH 3Q6FB 5C0IA 2BWDA 3X12B 3EBGA 2Q3XA 2JJWA 4L48A 4MJ5B 1MOEA 1OGAD 4DKEL 4OD1L 3SE3C 3IRCA 3BUIA 1E9PB 3IYLW 2FYYB 3BKJL 5H37A 4I9XA 2YMTA 5E03A 3O45B 5HI5D 3X14A 3NIDB 5IWLA 2R8SH 2YEZB 3PV7A 4RRPM 3RFRA 5JHDD 4K71C 5BV7C 2GTWA 3TNMB 5KG9A 4H26A 1I1AB 2VDPB 1BLIA 3VXRD 1KENH 3WFHB 1XGTA 5CP7B 2XA3A 4F7CB 1NWOA 3RZCA 2DWSA 3UTOA 3VWJD 4BE6A 5K9JL 2B1AH 3QDJD 4XNYL 3P30L 3BHBA 1HC1A 3F6IA 3QJVB 3TN0D 4BQBA 4DO5A 3WOVA 3ZE0F 4RMRA 3ESNA 3I50L 2R15A 3FT9A 4FQLL 2QJDA 5BQ7A 1CK0L 3E3QC 2QSTA 1XGPB 2G3NA 4NRXB 3DK2A 3EYUL 2W60A 2YAHA 4O02L 3RWDB 3VFUB 1F8TL 3S0PA 1SXNA 4HWUA 3QH3A 5AENA 1SJXA 4S0SD 1ZLUK 3SQBB 1KTBA 3AG3B 3PG2A 1EMTL 5JW3H 4G1EA 2OTPA 2QLVB 1OTSD 5IEKB 5KYYB 2ENQA 3AG2B 3L08A 2X38A 3WJMB 3K7UA 1YRKA 4X99A 3P40A 2G5BA 5KTEH 4Z3TA 2AEPH 4JGUA 3ECVA 2NT1A 3HE7C 4NDMA 5DJ8B 3VB8A 3RFZA 3D0AA 4MYPA 2B3RA 2W07A 2DWDB 2FSDA 4RFOH 3O3DB 4QPEA 4EXKA 4PGZA 5HVFB 1J0ZA 2Q1EA 4KXZI 4MBOA 4AKOA 2OP4H 1M05A 1XR8A 1FAIL 3LV3A 5E6ZA 2KPNA 4FRWA 1BBDL 1QAWA 2RCSH 3CMGA 1LD9B 1KWGA 1QPKA 5JO5B 3NFNA 4Y4KB 5FKPB 4IBZA 2QQLH 4X6CF 1SOKA 4M6NL 3P3RA 2H1LM 2J6EL 2IMMA 3TH2T 1MFAH 1KBVA 3VFOB 2IOIA 3BPCB 4DK5A 4I2XB 1N3NB 2WCGA 1HL4A 2E7MA 4EIGB 4RZCA 1MCJA 1FV1B 1QR4A 1UD4A 2DZEA 5B7MA 5H4YA 4XXCA 3QO1A 4K94L 4WSKA 1IQWL 3VTMA 3PIQB 4LOUC 3T6WA 4EUPB 2Y7LA 3WL9B 3SQOL 3ZK0A 3SKUD 2BK8A 5HJGA 3W2DH 3JV0A 2ODIA 3M17B 4X6FB 1ZIBA 4L3AA 3ASWA 3ZPDA 2WZ5A 2VM3A 3D2UA 4FQ1L 5IBTH 4W70A 3ARDC 4KKPA 4DP8X 3RZWA 5ICYA 1B0WA 1A1MB 2D3VA 3F5WB 3QFJB 2XIDA 4QGYA 1LO0H 1E2VA 3CZFA 1T21B 5ILTH 5GJSL 4YMPA 2Q76B 2XQYA 3CDZA 4QRTB 2GUOA 4L5FL 3WNJA 1XF5A 1NDGA 2ZOKA 3BSZL 5C09D 2HFEB 4ZAKD 1ADWA 1S7QB 1ZTXE 4G43B 2E9IA 3GMRB 4JAMA 1JJUA 3ARFB 1XH3A 1NBYB 1QLRB 3EBIA 4PH8A 1O9WA 1WA1X 2BP8B 5FFOA 2WYTA 3C12A 3V6ZA 1FYTB 2FNWA 4A2HA 4N8VA 5GS1C 2LE9A 3DJ9A 3H85A 4BFNA 1MG2C 3DPBB 4XMXA 1XSKA 5HTSA 1P4BL 5FYKU 4JW3A 2ILLA 5F7WC 2NSXA 3WMPA 5K9QI 2BNUA 3DROA 4MA8L 3VXSA 2CLZB 1T04A 2Q7AA 4ZOCA 5JIKA 1J5HA 1KNOA 2YPLD 1HS6A 2NSQA 2NTFA 1I1CA 4R4NC 5B7FA 3GNML 2ZONA 1F3DJ 1UFUA 2XICA 1A6UL 1KCUH 3QO0A 2NUPA 3V5DA 2H7WA 2EEBA 4KUCF 5D1XC 1EO8L 3TONA 1P6AB 3MV11 2PPFA 4TQ8A 1I4FB 3DSNA 3FT4B 2IPUK 3II1A 4PWHA 4ZJ9A 5L8LB 4JRXB 1GH7A 5HYJE 1C7SA 4YNYA 5GGSY 4MNQE 1CPUA 5EO9B 4ZDHB 3TVMC 4PJ5B 4FFZL 3DUSA 4CGTA 4OM0H 4HOWA 5DMYA 2ZOLB 4JBSA 2F5BL 4P2OA 5DJ6B 1RP9A 3BP7B 2ETWA 1RFDL 2F7QA 3F7QA 4XN1A 2Y06H 3NUKA 5HYSB 1WE5A 1P4LB 3L4WA 5AYTA 2NUTB 3FUFA 3RGHA 1OSZB 4PFEA 2QV2A 3MRRA 3NCMA 1R6VA 2VN5A 3MLRH 4QLWA 5DI8A 4DZ8B 2CO7A 2EDEA 1K5NA 3NH7H 2BZ7A 4NQDE 5KS9B 1VFUA 4IJ3C 3FU7A 4O2CA 2VT0A 3AG4B 2A83A 1XV8A 1ICTA 1LEIA 1FSKB 2QKIB 4LL1A 5HJDA 4MD0B 4KO9A 3IDXL 3HE7D 4N2IA 4PIBA 1I7TA 2CKNA 4ES8A 1M7XA 4FTDA 1XCTB 4L1TA 1AACA 4TVUA 4UTAH 2IANE 4MX7A 4BRVA 4Q9QH 3SY0A 2LW3A 2M26A 1QBAA 1PSKH 2PF6A 5GZNA 5KUKA 5L4IA 3IETB 1T5KA 2WQXA 5TE4L 1A7RL 3ZMRA 1T80A 4Z78B 2XZAL 3JVGC 2A6KB 1QR1B 3ZE0E 1FJ1A 2H0JA 1GZQB 3E2HB 4ZSOE 3SKJH 4OLVH 3LPWA 4M5ZH 3L3IB 4MAYC 2HPTA 4M1DL 3RIFK 2DD8H 1CBVH 2ADIB 3O9WB 2Y23A 3RA7L 4X7CC 2B1HL 3HPLA 5HHXL 3C8DA 3C87A 5I0WA 2VC2H 4KUZL 5I76A 1GIGH 2BP0A 2WLZA 3O6KH 3P54A 1FLRH 4LOUD 1ZCRA 5GGVH 3QCVL 3VO0A 2EIZA 1E5ZA 4PY7B 4HGWA 4LBEB 3K2MC 1JVOA 1PX8A 1JF1B 3T0VA 4OZFH 1CXKA 3FU6A 4RQQA 3PHSA 5SWSB 5CXPA 5JPNC 3HS0C 1PZUB 3HI6H 2ZXCA 2JB6A 3ARDD 3C5ZC 1LK3H 1MCHA 4OFPA 3G5YB 2UWEB 3QIBB 3CXDH 1UXLA 3CSYA 3BPLC 5GRYA 3WJJC 4KWUA 5DVLA 2V2TB 3B3IA 4ONGL 4TSCL 2AQSA 1YEIL 1M2OA 5BZWA 3HUJB 4K9EL 4Y1TA 4JS7A 2F74B 3IU3A 1SM3L 2W92A 3K4ZA 1FZOB 4LLUA 1MNUL 1B90A 1J05A 3LSOB 3IM1A 4S1QL 5I1EH 3DVGA 2ZJSH 3OF6A 1P7HL 4FGMA 5DMIH 3RVXD 3U36B 2KDYA 1KGYE 3H4HA 4JE0A 4WRLA 3UL4A 2WBXA 3ZZQA 3BZEA 2LVEA 1JTPA 2F54D 2AF2A 3PL6A 4EMZA 3JWNC 1KBPA 1U8HA 3U9WA 4A63A 4FNTA 3KCWA 3SYOA 1KJ2B 4R4ND 2EDJA 1KLFA 4J2XA 4V33A 1E4XL 2UX7A 1JV2B 3QUZC 4NN5C 4ODHL 1ZS8A 2BRRL 3JYBA 2YRLA 4IKIA 3JWDH 5D1XD 2ATPA 4YC2C 5L7XH 1JPEA 1ZPLA 4TF4A 2B5IB 1BXAA 4F57H 2EIEA 2EICA 3VXOA 1CE6A 1OPGH 1RUPH 1SYSA 5MHSD 4YHIB 3TVMD 2WQSA 1K9TA 1R5VA 1MJ8H 3L3OB 3L7EA 3B2UD 3B7SA 4W6XB 2CR0A 3MLXH 1MCOH 3ZU8A 1EDYA 1F1AA 1U95B 5T3ZD 4JHVA 1MIEH 4TQHA 4LSRH 5AOLA 3ZN6A 4EZJA 1SLXA 1RP8A 2QQKH 5JW5B 4QXUL 1E6OH 3PUUA 4UQDA 1L7IH 4PB9H 5HDQL 2JIXD 3CPLA 4NKDB 2OMXB 1NPUA 3QC5X 3DXAB 1IM3D 3DIFB 4BFOA 1IEAB 2VO8A 2XFGB 1PGRB 5KZCB 2ZCHL 4NKIH 4Z9KB 3BLBA 3LNHA 2BDNL 4KY1H 1B9ZA 2CRIA 4S0TD 4OIBA 4AM0B 1A9VA 4PQXA 3VAEA 2GC7C 2CD0A 4PRNB 3QI9C 3VGAC 3LZFL 3IGAA 3THML 1MCLA 2LHAA 4MMZA 1BG9A 4YHYB 4L4JA 1UQSB 1NCWL 3NRPA 2Y36H 3WS6A 3QK0A 1XR9B 4N2MA 1U2YA 5D9SB 3EO0A 3LKSA 1ZT1A 4PW3A 3H1ZA 4OLYH 4XCFL 1A3ZA 2CA3A 5I5JA 3MRLB 4MAYD 3D39E 3WNLA 4L1DA 3BGFC 3ILQC 3MV7D 2X4SA 2TRHA 2XN0A 4NKOA 4GKNA 4N2EA 1XB8A 5CGMA 2YUZA 1EJFA 3GHBL 1YEGH 4XN9A 3BAWA 1N59B 3QXAB 3RB7A 1RZFL 2E4FA 1BF2A 4KDWA 4HT1L 2V17H 1AD0A 1LO2H 4Q74A 2FLRT 5IHHA 2AV7A 3JWOH 5JQHC 1MHEA 5CR8A 2J57A 5ICZA 1RIVH 1X6NA 5EO0A 5AYQA 3QUGA 3C5ZD 1WISA 5C1MB 1F2XK 4RCAA 3R06B 4CSPA 1U3HA 2J88L 1EJ8A 4MA1B 3Q44A 3GC3A 3S96A 5EZLB 3UMNA 1D5ZB 4NX0A 5GGQL 3WY1A 1D5BB 1J9SA 3JTTB 3IJHA 3W0WA 3X1GA 3W82A 2YAMA 1Q0EA 1ASQA 1ITCA 2XV3A 4P04A 4Z76A 4XNDA 2WLYA 1LXMA 3UP1A 3SJVE 4CBZA 2SEBB 1H5BA 3KPLA 2V3EA 5IFJB 4QRRB 3FPYA 2QV4A 1XGYL 1KEGH 2CKBL 1EAPB 3PHQB 4YUEH 1MW3A 1OK0A 4WI0B 4C57C 1YUHB 2XIBA 5DURB 2YAQA 3BEWB 5CSZB 3R7QA 5HHQA 3L1GA 3GIZL 3NJJA 2DQCH 3C2AL 5JDSA 5C0BD 8CGTA 3O8XB 5E6IC 4Y4FB 4PR5A 2R0WL 4R4FH 5EUKA 2X4OB 5C86A 3UZVA 5KN5A 1HXYA 4WAFA 4XGZA 2ZXWB 3DVFA 4P9HH 5FM8A 2OBGA 1Q0XL 3L5JA 4Z23A 4Y2DA 1C5BH 1MJUH 3QUZD 2QSCL 3IKCA 1GGYA 1KXTB 3BAEH 5LGYA 2WXKA 2BSCA 3SGDH 3P2TA 5LXGL 1XH2A 4K5NA 1PYWB 1OGAE 3MBEB 4GG6F 2GEQA 5D1ZC 1JWMA 4BK5A 5C0AD 1JWSA 1MDTA 2WANA 3H6JA 3QQNA 5DD5L 3RY5A 5AFAA 3IU4H 3DX8B 3ZHFA 2FJGB 3P77A 4NP4H 4EI5B 2EVHA 4G5ZL 4N0FB 5JHDE 3T08A 2NT0A 3TL5A 2E9WA 5LWYH 3G08A 3OLEA 2W9DH 3OJVC 1TXKA 3K5SA 4U1GC 3GMLA 3ILPA 1P4UA 1NLBH 2XN1A 4Q0XL 4PCTA 3LQAC 4HBCL 5ID0B 3RBSA 4AUYA 2IDCA 4I87A 4TULL 4BQ6A 1F6FB 1WA0X 3QDJE 4OV5A 4UU9A 4XVTH 2RAMA 1EEZB 2E7HA 1RZIA 2YR3A 5DZOA 4RRPG 5FHBH 2Q3ZA 2QVIA 2VXUL 1XD0A 4JJHA 4QR7A 1I9JL 2NX5D 5E95B 4G1MA 2QPSA 4KNSA 1UM6H 3LQAL 5CBAA 5KSAA 3G5ZA 3MODH 4BFGA 5B1CA 4U6YA 2VDQH 2HN7A 3HB3C 3L7FB 4P2AA 4PCYA 3NCWA 3GRGA 5HGDA 3QI9D 2WZ6A 4WJKB 2A73B 2OL3L 4M7ZC 5F1IA 1OP3K 5DD1L 3OZ9H 1P0SE 5LN4A 4HKXA 1G7QA 4K0OA 4JPWL 2X89D 2P5PA 3FQRB 4YDJA 2LABA 2WWMC 2J8UA 1M1XA 3AT8A 1I7UA 3BPNB 1OE3A 4HIIB 3K71A 5FR3A 2ZX9A 3N40P 4X0KB 3HZYB 1WCBB 3MAWA 1UHVA 5HHMB 5TDNB 4X8CA 4Y16B 4U3SA 3U7YH 3FULA 1UWXH 3WEXB 2XQBL 3OZLA 2EH7L 4XI5C 4WI8A 4HQQH 3RVWC 4UAOC 2QADB 3OKDA 1T2QL 4MNQB 1MIML 4PRIA 2ICEB 4MKTA 1AIZA 1HZHL 4LSQL 5DQJB 4Z3GA 3HCVB 3DA0A 4PS4H 1Q94B 2P24A 5T33L 3BWZA 1E8WA 2PYFB 4F8OA 1EGJH 4NAJA 1GZPB 1QABA 4BXVA 2EE3A 5KVDL 4PJ5D 1JNLH 2X87A 1I9RL 1BEYL 3IGUA 3VXQA 4KROB 1KCWA 3CMOH 3L5WA 2WVVB 3O41A 1FL6B 4GT0A 3ECBA 3S88H 1IGCH 4Q8BA 2RFXA 1D6VH 3RDJA 3VI3E 4OZHF 3TBTB 4PJ8B 1NDTA 3CLEL 3QC6X 4R97C