4HZ1A

Crystal structure of pseudomonas aeruginosa azurin with iron(ii) at the copper-binding site.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
ECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Azurin as a Protein Scaffold for a Low-coordinate Nonheme Iron Site with a Small-molecule Binding Pocket.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 27
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hz1A00
1JXDA 1IKOP 3RYMA 2PP9A 2VW7A 3PPSA 1AS8A 3X1BA 1BAWA 1DZ0A 1XB3A 1ASPA 2R7EB 1NPNA 1GS8A 1AIZA 2XXFA 3X1GA 3FSAA 3TA4D 4A66A 3QJRB 3QJSB 2BO0A 4N4YB 3X1EA 2YAHA 1W8EA 4BXSV 1L9SA 1OOWA 2EIMB 4G71B 3G5WA 4F7KA 4DP4X 2I7SA 3EHBB 4A2FA 2JXMA 5I5JA 2XUWA 3FPYA 3V9CA 1E65A 1MG3C 1URIA 2BP8B 2W8CA 3OMNB 1V10A 4W1TA 3H56A 4PCYA 1HAUA 3OM3B 2UXVA 3U25A 4A68A 2PPFA 5D4HA 1WAEA 1BXVA 2Q9OA 2YAFA 1BQRA 4ENZA 2BWIA 1KGYE 1J9TA 4P5SA 4TXVB 1KYAA 3T6WA 1JXFA 3SBRA 1XMEB 5I6KA 1QNIA 1JZIA 1AR1B 2HLEB 4ZK8A 1NWOA 3GYRA 4GP5B 4YSPA 1WA1X 2BW5A 2Q5BA 3QJQB 1QHQA 2ZXWB 2ZONA 2RACA 2YQBA 4YSAA 1RZPA 2FT8A 2XLLA 2DYSB 3MBWB 2FNWA 2VM4A 3AZUA 3WG7B 1ASOA 3ASOB 1V55B 3ABGA 3FQYA 1NPJA 4HALA 1BXAA 4DPAX 3CG8A 4GY4A 2ZWNA 4EF3A 3WKPA 2JFCA 1A3ZA 2ZOOA 1GS7A 1PNDA 5AKRA 1RKRA 4DP1X 2GI0A 1WA2X 1E5YA 4AKOA 3ZIYA 1W6LA 3WI9A 3FU7B 4GYBA 3IEAA 2A3TA 1AZNA 1MZZA 3JT2A 3NJMA 3QQXA 1FA4A 1A4AA 5E9NA 2R7EA 1ZIAA 2E86A 2JKWA 3AG4B 3NSCA 2H3XC 4BDVB 2QPEB 5I6NA 5I6MA 2YAPA 5B1AB 5F7BA 1AQ8A 2BWDA 3S3CB 2GBAA 2BP8A 6PCYA 1N70A 3AW5A 1ET5A 3N55A 1BQKA 2IWFA 1OCOB 3EH4B 4YVNA 1PZCA 4G7RB 3IN0A 3DKHA 4KOCA 3FS9A 2GHZA 1NICA 1L9PA 1GSKA 4YSQA 1V54B 4A2EA 1OF0A 2HX9A 4UANA 3EH3B 3X1NA 1NTDA 1AOZA 1SNRA 1PNCA 4UF7C 4AKPA 1JERA 2BHFA 3QPKA 3WNIA 5LDUA 5AZUA 3T6ZA 2IDUA 2VSKB 4Q89A 2YAMA 4A67A 4YSEA 2AVFA 3PXLA 1J5CA 2VSMB 2PCFA 4KNUA 2IWEA 3EH5B 2GIMA 4BWUA 1A8ZA 2FJSA 2HRGA 2BZ7A 3CVCA 1PLCA 3OMAB 2XYBA 2AZAA 4RH4A 1PLAA 2EIKB 4MFHA 1BQ5A 4NAJA 1HAWA 1JZEA 2HXAA 2FT7A 1FFTB 3BQVA 2PLTA 1M56B 1OE2A 3ABKB 1HFUA 2IH9A 4WTQA 1L9TA 5I5MA 4E9WA 2DWSA 1SFHA 3GDCA 1NIAA 1JZHA 3NJLA 2CBPA 1RCYA 1GR7A 4UAHA 2XWZA 4L0PB 1TU2A 2XV3A 2PPDA 4AKQA 3T71A 1NZRA 1TEFA 1BXUA 3S8GB 2OCCB 2BP0A 3GXUB 4E9RA 3CVBA 2P80A 2IWKA 4FA7B 4KO6A 4F2EA 6PAZA 1KBVA 1ET7A 1NINA 2IH8A 1JVLA 5B1JA 3NYKA 2QDWA 2YXVA 1J9QA 3KW7A 1UATA 1AAJA 1A4CA 3AG2B 3T6XA 1E67A 5B7EA 3NT0A 1PLBA 4X4KA 3NJFA 1OCCB 3HB3B 4HHGA 1X9UA 4DP9X 1TEGA 3X2QB 2X87A 5ANHA 1L9QA 1OE3A 4KO7A 5EHFA 4E9XA 3DIVA 1QLEB 1J5DA 2DYRB 1PAZA 5PCYA 1AZRA 4M4RB 4DP6X 3CVDA 4NERA 4HAKA 4HCFA 2QPDB 3NJKA 1E5ZA 2CJ3A 4E9VA 3NSYA 3PAUA 2XU9A 1PCSA 4QLWA 4PAZA 2DY2A 4DPBX 2AZUA 9PCYA 4K9JA 1SF5A 1ASQA 1JOIA 4KNSA 5F7AA 3UAEA 3FSVA 1SDDA 2GB2A 4YSDA 2EILB 3TBBA 1NIEA 4A2HA 1SJMA 3AG3B 2UXFA 3X1FA 5I28A 1GS6X 3V9EA 1F56A 1PMYA 2YAQA 3NP4A 1RZQA 1BYOA 2DV6A 1CYWA 3C75A 1WS7A 2P80D 4HCIA 2HX8A 1A65A 5I26A 1W6WA 2N0MA 3IN2A 3FT0A 2XXGA 2HX7A 4G7QB 4A2DA 2XV0A 2CALA 5TK2A 2IDQA 1SHWA 2H5UA 1KV7A 2J55A 5D4IA 4KOBA 2I85A 1JZFA 3OD3A 1AZUA 3FQ1A 4FAAB 3EF4A 3T9WA 2PPCA 4YSSA 2B3IA 1AS7A 4CSPA 1NDTA 1NIBA 1WS8A 1XB8A 2CAKA 2H47C 2CUAA 3ERXA 2PP7A 1TKWA 2WO3B 1X9RA 4YSUA 4N8UA 3BVDB 5D4JA 4P5RA 4W9ZA 1ID2A 3ABLB 1L9OA 2EIJB 2IDTA 3NJIA 2W88A 1ILSA 3TU6A 5B1BB 3N2JA 4HCGA 4DP5X 1AZBA 2MTAA 5I6PA 3H4HA 1GYCA 3S3DB 2IAAC 3TASA 3S3BB 1VLXA 1KCWA 5AFAA 4BDVA 5I6OA 1MZYA 2IDSA 1JXGA 1OCZB 1YLBB 2NRDA 3SQRA 3L45A 4DP8X 1CURA 5I6LA 2OV0A 3AY2A 3MX0B 4AI7A 1SF3A 4BWTA 1ZDSA 1A4BA 2EINB 4YVUA 2FWLB 2BZCA 1E30A 3FSZA 2FT6A 1AG0A 1R1CA 2BW4A 4DP0X 1XB6A 3CDZA 2VW6A 1WA0X 1ILUA 3SBPA 4DPCX 3NSDA 2VW4A 2YAEA 2J56A 2Y69B 5B1KA 3ZDWA 1J9SA 1ZIBA 3PAZA 1BEXA 4JHVA 2GC7C 3OQRA 4YL4A 2HZHA 1L9RA 1IBZA 4DP2X 2FQGA 2IDFA 3FU9A 2PPEA 1KBWA 1GY2A 1PY0A 1JVOA 4JHUA 5B7MA 1BYPA 2BP0B 2YARA 2YXWA 2LLNA 2UXGA 2HRHA 1M9WA 1NIDA 4YSRA 4HHWA 2PPAA 1ET8A 1OCRB 1FWXA 3PLYA 4HZ1A 4AX3A 5IY5B 1MDAA 1SDDB 3FU7A 1JZGA 3ZX1A 1CUOA 3NP3A 3KW8A 1OV8A 2VMJA 4HIPA 3FU8A 2YAOA 3D12B 2FQDA 2CCWA 3JTBA 4E9QA 1AACA 1KDJA 3OMIB 4A2GA 2AANA 2MRYA 2I7OA 3NJGA 1PF3A 3QJTB 4G70B 1N68A 4JKNA 2TSAA 4G72B 1CYXA 1T5KA 4GP8B 4GP4B 3CDZB 1M57B 1ADWA 1J9RA 3NSFA 2PCYA 5A7EA 2QDVA 5FC9A 2B08A 2TSBA 3NJNA 3S8FB 3FPXA 2UX6A 1AS6A 3UGEA 4E9SA 4YSOA 1ZV2A 1KCBA 5B7FA 2WSDA 3UACA 3UAAA 1NIFA 4GXFA 1EZLA 2J57A 4NB7A 2UX7A 2XVBA 1B3IA 1PZBA 3WIAA 4KO9A 4G7SB 4BWWA 2J5WA 2GC4C 3IBOA 3FQ2A 4E9TA 1I53A 1MG2C 5B1JC 2FQEA 3ASNB 7PCYA 5B3SB 4F2FA 3UADA 3FYEB 1AZCA 5I5IA 1GY1A 1JZJA 4Q8BA 1IUZA 3WKQA 4YSCA 1ETJA 4YSTA 3T6VA 3ZBMA 8PAZA 1SFDA 3FSWA 4M3HA 4QKTA 2QT6A 4KNTA 2XX1A 2PP8A 2DWTA 4DP7X 1DYZA 2GSMB 1AANA 3QJUB 5PAZA 1SHXA 1NWPA 3AG1B 3NJHA 3DTUB 1OE1A 2OJ1A 2UXTA 2XX0A 3IE9A 2Y1AA 1KDIA 3TBCA 2AFNA 5TK4A 1ZPUA 3NJJA 1IC0A 2FQFA 2FTAA 4BXVA 3SBQA 2X88A 1AG6A 1CC3A 3HEIB 2WO2B 1IBYA 4KO5A 1PZAA 2VN3A 7PAZA 3UABA 3H4FA 4CSZA 4E9YA 2VM3A 3PAVA 3PCYA 3WNJA 4WKXA 2XV2A 3CZUB 3FYIB 1EHKB 3ABMB 1ZDQA 4BK5C 4AZUA 1GW0A 3QJVB
chains in the Genus database with same CATH superfamily
2XNAB 4LSTL 1WV7T 4B9YA 2GABA 4M6NL 3RZWA 3ALWA 4QXGL 1XB3A 1DZ0A 4I87A 2G5BB 1AP2A 5MEQA 3TA4D 5IG7A 2ZTBA 1YUKB 3EYSH 3ARED 4P2OA 2QVTA 4N4YB 1KPRA 3QDGD 5CINL 1OOWA 2EIMB 2W80C 1J8HA 3F5WB 3D85B 4FNRA 5I75C 2OJEB 1UXSA 3NABL 1U3HD 4W9LC 2X1WL 1FG9C 5J12B 3KYMA 3GM0A 4PGBA 1XMWA 1HWHB 1J88A 4OF7A 3BH9A 1OL0A 1KG0B 5DD3L 1NAML 1UG9A 5KSVA 4C4KO 5ETUA 1UA3A 3WIFB 1BFOA 5JZ7C 2LT9A 3SCMA 2V5TA 4XNMA 3W3BA 2D3NA 2EYRA 3MV01 5BZZA 1RZKH 5LO7A 5I1AA 5GJSL 4XE5B 4QJ3B 1BQRA 4F3FB 3CLEH 5IVXE 3DC0A 4HKBB 1SY6H 2VTFA 5DI8A 1FNGA 4TLKA 1N5AA 1QNIA 2VL5A 3EADA 3Q2WA 2VLKB 3MO1A 1P5VB 4OBRA 4ZK8A 3QCVH 4PWGA 2FD6H 1YYMH 4JFWA 4KAQH 5BZDA 2EJ1A 5IHWA 2AEIT 1RZPA 5FO8A 4JZNA 3HZYA 4MDIB 3OKDB 2EYRB 4PS3A 2HFEA 3V6OA 2OSLB 4OLUH 1U6AL 5BOZG 1QQDA 4XH2A 2VH5L 3QQ3B 5KVEE 1UQSA 3ORJA 4XCCH 1QFWM 1AC0A 4FQHA 5KYWB 1S7RB 4PVLA 3U7WL 1KN2H 3VFSB 2ZWNA 2CNZA 5C0AB 5D7HA 5IESL 3P77A 4PJIB 1MIEH 4GG8A 5F88B 2FX7L 3SKOB 3K6OA 5MEND 1V3JA 3MOAL 1DN0B 1ZT1B 3HLAA 4NQEA 1E2ZA 4KPHL 5DJ0A 1AZNA 1OB0A 2IBZY 4K3DL 1MLBB 2VZ1A 3G08B 4P5KA 3WTSA 2Z91A 1CFMA 1T0NA 2VLMD 4PJAE 4OU3A 4Y4HA 2DKUA 4B0MM 2QPEB 4WW1A 3CQQA 1M7UA 4X6FA 1EA9C 3SZKC 3AW5A 4G6KH 1OCWH 5JPNB 2ICES 4NUGH 3GNMH 2O93L 3RWGA 2XTSA 4YVNA 3BD3A 2WQUA 3EO1B 1FC1A 3GIZH 4Q6YA 4TUJA 3HMXA 4FGMA 4KOCA 5CUSH 5C92A 1NICA 3L9BA 1NLDL 2A6IA 4U3SB 4ZO8A 5D1XE 3SB3A 1I9JL 3BUYA 2IBZX 1XL4A 1AXIB 2DMCA 3CSPA 4NQCE 3V8CA 4UANA 1MRFH 3R7RA 4DESA 3M1CA 1PX3A 2XJLA 1A7RH 3ARDB 3QPKA 4IW4C 2A9NL 2A2QT 1P84J 1V3LA 2VSKB 4RFEA 2CM5A 3RGHA 1R5VB 4MQSB 1UA7A 3UTOA 5F72S 1C5BL 2JKXA 3U9UA 2WQSA 4BWUA 3OX8B 4J3TA 1B4JL 1WZKA 1NGXB 1XGPA 1KYDA 1ODAA 4MJIB 3LIZA 1WHOA 5FGSA 4Z7QF 1KNOA 1WWCA 2DYPA 2NCEA 3LHPH 5AENA 5IVXF 3AB0B 2NY6D 1BFVL 5DFTA 5FYKD 3HW7A 2ROXA 2YSSB 3U0PA 4ALAL 1NCOA 2FX9H 1T22A 1EO8H 3S5LB 4AMKL 2DQDH 5C2BL 4Q0XH 5DHXB 3POCA 4JQVA 1IT9L 2BNUB 2Q2EB 2QPFA 4P2QD 4L5FH 3PUUA 4LDEB 5IW1B 1TVHA 1QFOA 1RZJC 2DM7A 1NFAA 4AKQA 3E6FA 1QNZL 3LZNA 4MZ3A 2F1EA 25C8H 1MPAL 2Y06H 3R0NA 2F53A 3MREA 4OFKA 1RVFL 2OCCB 4FFWC 2XWBA 1GZPA 1OALA 4FA7B 1U30A 4MA8H 4WGWB 5ACZA 3BKCL 5DT1L 4XNDA 1PFOA 4MD4A 4QR7A 1DR9A 1YDPA 4B7LA 4Z0XA 4OLYL 2H6OA 4G7VL 1J9QA 3MNWA 3KW7A 4R96A 1UATA 1CQYA 5J1SC 1CLCA 4M7JL 1P5UA 1Y18A 3UPAA 4BFKA 1XZ0A 1GCFA 1D6VL 2RQEA 2V4LA 3G5YA 4LPTA 2H3NB 5DYFA 1KIPB 2MCPL 3NGBC 5CLZA 4MJ6A 4LSQL 3T65A 4L3ED 2ATKB 4KJQC 3UO1H 4CADA 2V7NA 3VD2A 5HVFB 3TL5A 3ARDA 2COQA 3QXDA 4EE2A 3HJ0A 3D25B 2Q76A 5CKAA 3IF1B 3MV8B 4KX7A 1EJ6A 1FVEB 1VEMA 4M6NH 5A6MA 3P0VL 2B8OT 2ZUQB 2JCCB 1CT8A 5CCKH 3LZLA 5BJTA 2X9XA 2ALAA 2C3VB 4EZKA 5AVVB 2WWMD 5DJZA 1BF2A 2VDOH 1MQ8A 2CLVB 4XWGH 1QFPA 1SEQH 3D69B 2NTFA 4QRSA 2GVYA 2LOEA 2WWOA 1SVZA 2KPWA 4K9JA 3D08A 5TQ2H 3EJZD 5JHAA 2ZKHH 3M7OA 2JKSA 4I77L 4NJ9L 3D25A 3VXSA 1AXSA 5LWYL 2BRRH 3CDGB 4HEME 3ES6B 1S7WB 3PJLA 3RGVA 5J9PB 4G6KL 1UZ8A 3FH5A 4DO5A 2E9GA 3VXQB 4HS3A 2NY4B 3GD1C 2FWSA 5J6GB 3AXIA 2VO5A 2V17L 1SEBA 3U48A 1OPOA 2P5EA 3ULVD 1WITA 2E76C 2Q6WA 1JV2B 2VDKB 1T2JA 1S3KL 4JZJC 1QLRA 1RD6A 3UPCA 1CDBA 1DDHB 3A47A 2CDEA 2ICWJ 1SLXA 4O2EB 2F08A 3EJJX 2HFEB 3OD3A 3U0WH 3WFHA 5IQ9B 1ZHBA 3DV6A 2XZCH 3F00A 4M7KL 4QF1A 4R5XA 4RMBA 2YPLA 2VH5H 3ESNA 5K1NA 2B3IA 2YGNA 1J12A 3QR2A 5SX5H 2AEQL 2PWDA 5FKAB 4Z95L 1KB9J 4CKVX 4NZTH 5FECB 4U0RB 2YPLE 4GJTB 4JFTA 3WL9A 1TEYA 2P43B 1K6QH 1BQSA 2FGWH 3F3HA 3KYNA 4N8UA 3U4BL 4AGMA 4DKAA 1BPVA 3LRHA 4GBXD 2BVTA 2BJML 3C6LD 3WHE0 1F02I 1QLFA 2V6HA 3ESPA 4XPFH 3AY4C 2WNGA 5DU7A 3DGDA 1T2QH 4YDLB 1RHFA 4J4PA 3TZVC 4WJG3 4ODWA 3LNFA 4EN3D 5I6OA 5H94A 3MAWA 4KBPA 2OQJA 4JHBA 3RWEB 3NCJL 1JTOA 2Z1PA 3WKNA 3MV11 5AQ0A 4KK9C 4LGPB 1YPZE 3QYCA 3DUUB 4RFOL 4E41D 1MI5A 4IMKA 1P6FA 4WNSA 5DJYA 5DWUL 5I73C 5GJTH 1YPZA 5DEGB 4M1GH 5LXGL 4KQ3L 3NSDA 3HBZA 2YD0A 1AI1L 2VR9A 4A1RA 1J86A 2HAZA 1ANUA 2WK2A 5FM5M 4C4BA 3K2UH 1SMDA 4E41E 1DLFH 2AJ3A 2FLRT 2AMGA 5JOEA 3DRTA 1AGFA 1L7IH 3P54A 5DHVB 5KAQG 1UZ6E 2EUWA 3AU0A 3LN4A 5IIEB 5F9OH 1GY2A 3DIFB 3CSGA 2KL6A 2IAMD 4ODTL 3O3AB 5GSRA 2LLNA 1AFVH 1UT1A 3NCEB 2EDTA 3TBVB 4FZEH 1MUJB 1T0NB 4CUCA 1M9WA 4F80A 1MIEL 1QVOA 1WP6A 4XP6H 3CFJA 4U33A 4YSRA 1UA6L 3QUHA 3QDAA 1T83C 4JNXA 1I1RA 2NUTA 2EXWD 4QPEA 4X0NA 4M5TA 3UROR 4XO9A 1NGYB 1TZ8A 2WXHA 4FG6D 4OD1L 5F7NC 5T1LB 3V4VH 5SWSB 4LPXA 1XTLA 1UZ6F 2IH3A 4F33B 1NFKA 1ZANL 3HMWH 1HS6A 2CIIB 5EU4B 3DBSA 2F5BL 2IXQA 1MUJA 2ZG2A 3FUNA 4PP1C 3WU1A 4BSWB 2OR8A 3LPPA 1CD1A 5GISH 2TSAA 4PRNB 1GKEA 2CGRL 5DK3A 4W93A 3F7LA 5CLWA 2Q76B 1AO7B 3GI9H 4XVUC 4GI9A 4OLYH 1XSOA 1GAFH 4X6EB 2ZNWA 3EJUA 3ESMA 3TJHC 4YDLC 2OMUB 2B08A 5C0EB 1D9KC 3S34L 5I0XA 3BPCA 4IMKC 4QAWA 3APCA 3BZ4B 1SOKA 4D9LH 1N59A 3DIDA 4IRJD 4JRXB 3LN9A 3HE7C 1R33A 2VCOA 4XGZB 5E8OA 5SWSD 3BWAB 3V4VA 3ZE0B 4LFHD 4N2BA 2VC2L 1D7BA 2UUDH 1I1YB 2XQYK 3BPNB 3WCYA 5DMGC 1THCA 2FWOB 3T8VA 5HXMA 3LN5B 2G75B 1PG7X 1SXSA 5IB2A 2WBXA 2NZ1A 1INDL 1N0XL 4LAQH 2ZX7A 3TN0A 5I2IA 3BUTA 3U7WH 1MNUL 3V9FA 4XC1L 2BVYA 1HC1A 2BMKA 3MLPA 2HJKB 2WQWA 2AP2A 2YMTA 5J57B 4OT1L 1KB3A 4OJCA 3RDTA 2VLLA 1TOXA 4P3DA 3T6VA 3MQIA 4IRJB 4JRXD 3O2DA 2KT6A 4M3HA 1PZ2A 3UZVB 5SV4A 1TYEB 3JWDL 3FUFA 2WSKA 3QEQE 3SJVB 2IPKB 4DP7X 4XVSH 3S3JA 1M6OA 4AJYV 3SE8L 4JO4H 2HKFL 1CL7H 2JLLA 3A67L 1BLIA 4X6BA 3N43F 1QFWI 2NY4D 3MRFA 1DQIA 5AOIA 2C1OA 2DWEA 4MA8L 3UO8B 3UZEC 4ZX3A 4BQCA 1BD2E 4X8XA 3DSNB 3QI9C 2ITCA 1KDIA 1MHPH 4HIXL 5I17A 2E59A 1V3MA 4AQOA 3TBSA 4PRHE 4NXSA 3DXAB 3HAEA 1BD2A 4WEUD 1Q0EA 4XNZC 3RI5K 3KM2A 4YXKH 2WN2A 3NEOA 3KGSA 3Q9QA 3VX1A 1KJVB 1FJ1B 1RUML 2VN3A 4CJ0A 2KZWA 4NUJB 4DEWA 4E9YA 4FERA 5IEKA 1EGJL 1OAYL 3QNYB 2ISDA 1PKOA 2APTA 2WTRB 5AW1B 2DH2A 3ZTNL 4RMVA 3ABMB 2FRGP 1IZJA 1U95B 3SDAC 2VAAA 2IMNA 2PW2B 1FLTX 1NGQL 2D7QA 5J89A 1A6WH 5JMRA 1MJUH 1CO1A 1YMMA 3L9RB 4JPWL 2OL3H 4EBQL 3NIFB 4W4OA 5IJKA 1IKNC 1GS8A 2PUQT 1XGTB 2G0LA 5BQDA 3A21A 5CKGA 4HJ0C 5J9PA 3ZL4H 1NAMH 4MCMA 2WYHA 1MEXL 2DQDL 3HG0A 5FDWA 3QS2A 4HEMA 3MYZA 3MRIB 5AKTA 2XUWA 3FPYA 3V55A 4B9FA 4BCXA 3RFZC 1ORQA 2YOCA 4N2IA 3VTTA 4L0YA 2UXVA 4OJDH 3CIQA 2D2OA 5D4HA 1WAEA 2ZYIA 5GZOA 4HSAC 1IU1A 3GUFA 3PNRB 3BP4A 1FNFA 1JPTL 4NRYB 3T4AA 1B3JA 3T3PF 1EXGA 5DUBB 2IGTA 4K71B 3B2VH 3LZPA 4CMHB 3O6FC 3JZYA 4FYRA 3WXVL 3CSYB 3P4OB 1NDGA 1YJDL 4XNYL 3D0AA 5C09D 4MNQE 2R0KH 5I17B 1TZIA 2ZONA 4R4BB 1E5CA 4ZX5A 3HR6A 2ARJQ 5JNYA 1J0KA 3DX7A 4LRIA 2X12A 2HG5A 2ZXCA 4PEEA 1J8SA 4JFQB 1OARH 3BP7B 3RTQB 4OZ4A 3E1ZA 3G6JB 3VJ6B 1F97A 3WN6A 5D2LF 3LYRA 4Y89A 4G7YH 1CDIA 2YD4A 3CG8A 3RY5A 3BQUA 3FKUS 2AJXH 1AGCB 5DTFB 2O5XH 2M1KA 3KPTA 5CINH 4PUBH 2X9ZA 4FCAA 2BJMH 3B5HA 4BRVA 1E2VA 5MP6H 3C6SB 1ZD6A 2IDCA 4X5QA 3ZU8A 2G2RB 2Y72A 3PHQB 3NIDE 1S7SB 4PJDF 4WK4B 1YQVL 5IUSA 4WW2B 4K9EL 1T4KB 1AXTH 1WFNA 1ZANH 1I8KB 4F20A 1AMXA 2H32A 3MUY1 4W9DC 3NMEA 4JO4L 4NT6A 1G7PB 3U82B 4YZFE 1X5JA 4TQEH 6PCYA 1U3HA 1VEPA 1ET5A 1VADB 2PCXA 3JWOH 1I3GH 3Q6GL 3K6FA 4HHAA 2E9WA 4ODUB 5ENWA 2CRYA 5I18L 4NKOA 4CL7A 3K72B 3BAWA 4YHNB 2NY1D 1P6AB 1QX1A 1XGPB 1T3FB 4KJPC 3SBWA 5KBDA 4BZ1A 1I82A 4JFDE 2BOBB 5IHZB 4GXVL 1MREH 3ARFA 4E0RB 1AP2B 4UM8B 5AD0A 2Z65C 4P2RE 4KKRA 4W6XB 3CN2A 3HJEA 1EO7A 3N91A 4MJHA 5EEZA 32C2B 5C0CE 4OZFH 3MTRA 5DJCB 2GYSA 1NCAL 1VFMA 1GW6A 4TL4A 1BFVH 2HRGA 3N44F 5IHLB 1U8NA 3WIHH 3B2XA 3T2QA 5F9WB 3N40F 2HXAA 2MMXA 2XVKA 2CG9X 2FT7A 5T1LA 2R23A 2HG5B 2HJFA 4QHKJ 1CT8B 4OQ1A 1HFUA 1UA6H 3DTXB 2VR5A 4FQIH 3WFDL 4KWUA 1YHPA 4QI3A 5I8KL 3GWJA 3ZL4L 4PJCA 5ESAB 1CFNA 4GRLB 5FA3A 1WZ1H 4G9FE 5TQ0H 3NSXA 4OD1H 3FB8A 2M26A 1TJXA 3GDCA 3LIZL 4X9BA 5F9DC 2P8MB 3OKMB 2CBPA 2DQCL 2HLAB 4F9LA 4X4YB 3FTZA 3WDIA 3OB0K 3GB7B 2HKFH 2DWDA 3A67H 1NZRA 2XY1A 3PAYA 4PJGA 3QRBA 4BUQA 3HE7A 1K3IA 2A9BA 2Z92B 4UAOB 1G7LB 4K3EL 2BS8A 3KPNA 4UOW0 2GT9B 1H5BC 3B1UA 3L3DA 1NH6A 3OKOB 3VD4A 1CDGA 3BJLA 3N9GL 3O6LL 1QQDB 1TZGL 3CHOA 3Q5YA 2F7IA 3GI9L 2N0KA 1ADQL 2RGSA 4XBPA 1SYVB 1QPXA 4ELME 2IAMC 3V5DA 1XR9A 4DFIA 3L5WA 1I7UB 3C09C 4Z7WF 5KEZA 1ZSDA 3LKPB 4JGJA 4MDIA 4OLXH 5FDYA 4XBGB 2V37A 1B4JH 1H3TA 2GSGB 4UU9A 4PI0A 4DQAA 3E8VA 3FTGB 3GLEA 1ECZA 5F89A 4MQXD 1RZKL 3ARGA 2VDPH 3BEVB 1TJIH 2PYED 4E5XG 2FATH 3SJVE 3OJDA 3ZTJH 1MHCB 4FXKB 3PJNA 2IG2H 3MCKA 1S9VB 2FB4H 4ACPA 5ANHA 4PB9L 3TH3T 4JAMA 3L54A 4AL8C 1R5WB 3L81A 4G11A 1Q4NX 1R6VA 3ECQA 2I25N 1H8NA 1JXJA 4Q0XL 5L2KD 4JFED 3KCWA 3G5XB 4LCYA 5I0YA 4Y5XB 1F6LL 4PJ5D 1U4EA 5DK0B 3MYJB 4QRUB 2FVNA 2VDLH 2ADYA 4B5ZA 1ZSHA 2AHIA 5EC1B 1CXKA 3LEVH 3PWVB 4BV1A 4XNXL 4MAYB 2EVJA 4PRAA 1SLUA 2FEDC 2DJSA 3QIUC 3FU5A 5HD8C 4PJCE 3DSNA 3QJFB 4ZT1A 2G3XA 2FYYA 3IAGC 2FO1A 3KXFE 1WBXB 2FHBA 4OZHE 3E8UL 1OM3L 4C4KT 1BVOA 1ZHLA 2WLLB 4G83A 1DBBH 2CDEB 1GS6X 4PS8A 1F56A 1LNUA 5I19L 4MX7B 1NUGA 1RAMA 4GW1B 2Q0ZX 4JFEB 2O6CA 1TTGA 3RG1C 4DGVL 3HI1A 1MY7A 4G7QB 3ILEA 3S34H 1WPCA 2AEQH 1E9PA 1DQJA 1YUHA 2XIDA 1S8DB 5JHBA 4KOBA 4OVVA 1I7TA 3IRPX 2DQUH 1KT2B 4XPHL 2P8LA 1I1FA 3FQ1A 4XXWA 1CVSC 1VKXA 4J3VA 3CDGA 4RAUA 5F3HB 1KFGA 2FDBP 3P2BA 4GINA 4QEGA 2W60A 1JPFA 2CE6A 4LHUA 2AQSA 2HFFB 2XACC 3OVUB 4N5ED 2VDOL 4QNPF 5C0FB 4YSUA 3WSQL 5HHNA 2V2XB 3GS7A 2VGLM 3MPCA 4IOFC 1TTCA 4MMXC 5DJAA 3T4AC 1KMGA 2HRLA 4Y9EA 3CLFL 2X05A 4DP5X 2G2NA 4KGLA 4IJ3C 1TG8A 4JDVA 1DJIA 1IGTB 1CE6A 1GYCA 2DLGA 4P99A 5KSBE 1KXQE 2QV2A 1G7JA 1H9DA 3G6DL 2IDSA 1OCZB 4WWKB 4JZOB 5B39A 4NHCH 4FABH 3KYKH 4NAQA 1JTTA 2AJVL 2NY6C 3LHPL 4YFEA 3WTWA 2F0CA 3VU2A 4ZAKD 2IADA 3RKPA 3QXWA 4Z7VE 2HPTA 4AW4A 1CD1B 1IGCL 1D9KD 1JMZA 1UH4A 2N4IA 3N9GH 3Q6FA 1AG0A 3PGCA 1SEQL 1AQDA 5DD5H 1JRHH 2K70A 4RQQB 2QBWA 3TJEH 3IBEA 5D7SL 5T1MB 2VW6A 2I9TB 4U05A 4TNWF 3B6SA 5C3IA 1IVTA 2F8VA 1DQLL 2A6KB 1MWAA 3I02B 3VE0B 2MQCA 3CX2A 5SWZD 2ZAGA 4JHVA 1G7IB 1XCWA 4PV8A 2A7BA 3CFKA 2BSCA 1FYTB 5TDPA 1S9YA 2YEZB 5I76A 4IU2B 1P7QA 4OUOA 4RBPK 1Q94B 1TTRA 1JVOA 4Y4KD 1NL0H 4YHZL 2JB6A 4HJJH 1EEZA 3C6SA 5CZRA 1RIHH 3SDAD 3O4LE 4JB9L 1QSEE 2A9AA 5KSAD 3ULUE 4OD2B 3AADB 3BXNA 3ARBB 2EVIA 4ZW5A 2GJRA 3GZOA 4PIRF 3ULUD 5I1JH 4AQEB 3TURA 1RHHA 1QEXA 3EJYD 2XN9D 4XO4A 1ZVYA 2VMDA 2VMJA 2ICCA 3FU3A 5HDRA 3OKLB 5ITBL 2V9TA 5EU6A 1FZKB 4KZCA 2YGOA 2CCWA 2X89D 4J4PD 3W1ZA 3I3DA 4EI5C 3QI9D 2EEDA 4EN3A 3DGCR 4B9CA 3EYUH 2AANA 5F7HA 4KRPD 2Z64C 2Z8SA 1N2RA 2MRYA 5HJDA 5KSBA 2NUPA 4Z7OF 2KUTA 5DD1L 4F1ZA 5C9KA 4G72B 3RWCA 1AHWB 5HYIA 4QY8B 2X4UA 3F8UB 3UDWA 2KYIA 1DJYA 3T0EA 4JFDA 4ZYKA 3EOTH 1I7UA 3CXDH 2EAEA 4CMHC 1NBYB 4P5TA 3TBTA 2JKTM 1CF8H 1LK2B 5B3JE 3QWOB 4XI5C 4GUPA 2VLJE 1G1YA 3BIKA 3ZKMC 4ES8A 4WV1C 5IFHL 1N0XH 4QO1B 3T1FB 4DKEL 5TE7L 3B9DA 4X8JA 3IB4A 4Y2DA 3GRWA 5HHQA 2A74C 3HZ3A 4M3JA 3ZE2B 4M1GL 1R3HB 3GSVA 1OARL 4M03A 3AT8A 3BISA 3STLA 3W0WB 3WE1A 3UAJD 3QNFA 3ZDYF 3WN5A 3VNYA 3QB7C 5KUMA 1A6TA 2X4TB 2P8MA 1E2WA 3L4UA 4KH9A 3ETSA 4TNFA 1H5BA 2CKBA 3AXLA 1GY1A 4BCZA 4PJFA 4AIZB 4ZPTB 2PXYC 3CSFA 1FHNA 1PZ5A 1KY7A 2JB5H 2OS7A 4OZHB 5C7XL 2R29H 5HHXH 3T4YA 4MCNA 1BX2A 5KYWA 1Q9LA 2NY0B 3EUUA 1YQ2A 2CPUA 1XF3A 1CICA 1ZLVH 5C0AA 2F9BT 5LJYH 1VFOA 3F04A 3VFOB 1TQTA 3KNBA 5KSUB 2DQHL 1ACXA 3VFMB 1JCKA 3ZUNC 5G4NA 1F4XL 3C60A 3DTUB 4FJYA 5C0AE 2Y25A 4HKZB 3IE9A 1JSYA 4F8OA 1P69B 4GSXA 3UG4A 3MRPB 3NCMA 1KV3A 3CTTA 4BXVA 1R17A 4AGOA 1Q9OA 3KEHA 1LVEA 3GKWL 4ONHA 5GJSH 4PMFA 5DHVA 3ISYA 4FQQB 4LEOB 4QUOA 3P4OA 2NR6A 4LCWE 5JHDA 3X3GL 4S2SB 2NNCA 3MRCA 4FXKC 1R5IA 5IQLA 3K4AA 1C8PA 1MJUL 2FCBA 4RGMB 1TZAA 3SJVA 1NANH 3H2PA 3OZ9H 3D0LB 5DEGA 1QSFB 5EBMB 4TOYL 4UT9A 2EDQA 3BGFC 3QJVB 1JXDA 3NK4A 3KXFB 2BIIA 1IC7H 2NXZB 2J21A 2XWJA 4ZX4A 5JMOC 1HIML 1W91A 4KHTL 3SYPA 5L2KE 2H2PD 1DSYA 2Z4QA 3IFPA 1OPGL 4FNLH 3KPRA 4OLZL 4IOSA 3QCUL 2VDLL 5D1QB 1I4FA 4JFVA 4N22A 1ZK9A 4RCAA 1YAZA 3KDPB 4FP8L 4LO9A 1WO2A 3UTPD 4CDHA 3D06A 1H3GA 5DURB 5E08L 3CZNA 3QULB 3LZFL 4Q9RL 3SDYH 3NIDB 4JRXA 3FH8A 4LSSH 4J2QA 4ODBD 4KVPA 5D93B 3W0WE 4TNVK 2EDFA 1C08B 4X7DC 4Z7WA 2Q9OA 3QPQC 4FJ6A 4J3OD 2KC0A 3HE7B 3TV3L 2DQMA 1NCTA 2VXSL 2A1WH 3DJRA 4KKAC 5EO1A 1PZ3A 3K8LA 4YUEH 1EGJH 2ZSVB 1JZIA 1I7ZB 5IVOA 2O1AA 2PR4L 2NY0C 3TEZA 1WDAA 4BKLA 3MNZB 2FR4A 5I23A 5HDBF 4G7YL 5BV7B 1OTTD 4JJ5A 1IGFL 4X4XA 1RPUA 4QHKI 2WUCL 2F5AL 4GQRA 5CILH 4XHQA 2MEJB 3VSVA 4LLUB 3MV9B 2FIKA 4PJ9A 1V55B 1A6PA 3JWNG 1ZEAH 3GHBH 3TT1H 2VABB 4PLKD 4M48H 2QKSA 1FH2A 3PV6A 2LVEA 4WWPA 3JV0A 5DR5H 4NGHH 1TQSA 3PF2A 1E7VA 3AQZA 3PGDB 4R7NA 3EAKA 5EEYA 3HA0A 4GYBA 2PYEE 4FYSA 2JJTA 1HQ4B 4K5NA 1XF5B 5A6IA 4OV5B 1ZVHA 5AVSB 3LRMA 2R29L 3JT2A 3WIIH 1TQCB 3FUKA 5ABDE 1CL7L 3HC3H 3P4NB 1A6ZA 4M6AA 2JKWA 1KENH 2YEVB 2UV3A 3OTTA 1NCWL 4Y8AA 4PWFA 4Q14A 1BZEA 3RWHA 1XF2B 5I1DA 3KS0J 3P11H 4FC3E 5F7BA 1HEZA 2J1ZA 4OF0A 5FGCE 3TO2A 5JOPD 4HEPA 2NT1A 4EIGB 2ETWA 1JPTH 5IW3A 4GKOA 1S7VA 2WWKT 2B39A 3QHTC 1BLNA 1MEXH 3DKHA 2B9AA 4PGZA 1OWWA 4HUVA 2AXFA 4JFDB 4ZYKB 1GSKA 4XHJD 1WIOA 3TA3A 3SDCC 3EOTL 3VQ2C 3LB6C 5AEAA 2VT0A 3D4ZA 3VWKC 2V3FA 4OJYA 4RA0C 4DO4A 4G8GE 4NQDB 4Q58C 4JN2B 3W2DH 5H35A 5CLTA 3BUBA 5KBKA 2NXYB 1PYWA 1D3CA 5HHVH 3G5YB 3H9SD 3T6ZA 1NEUA 3PWPA 5TFSH 1UJ3A 3VD5A 4YHLL 4KI5F 4K5OA 3ARGB 2XWTB 3KM1A 5C09A 4E42B 4N0FA 3CC5A 3UX9B 1MHPL 3FQUA 4WF7A 1XFPA 4KXBA 5D96C 5FK9B 2QSCH 3OC8A 3SPCA 2WGXA 1RHHB 1JZEA 1XSKA 3C60B 1FPTH 4KQ4L 4XBEL 4PS4L 1T0MB 4OLZH 3IDXL 4P5TC 4LNVA 5GGSY 1F1GA 3WO3B 2FSEB 3MLSH 1TVBA 1TMCB 3L3DB 2CJTA 2H26B 5EOTA 3S0PA 2CLRA 4H13C 2NXYD 5D2NA 4WK0B 2DIAA 4YE4H 1U8IA 4WO4D 4XVTL 3ZOAA 1DUYA 2AV1B 1RJLB 2YBRA 5EBWA 3Q5OA 4I18C 4XE0A 2AJVH 5DJ2B 1KCLA 1S7WA 1MCPL 1EPFA 1GYWA 5C7ZA 1JD7A 2VXUH 5GSRB 5JIKA 1TZHA 4DH2A 4OV6F 1ACCA 3L3GB 1WG3A 1F6FB 2OXHB 1INQA 1VAHA 4AH2A 4S10A 2C9RA 4NJAH 2BCKB 1XF1A 2C9PA 1S7RA 3K81A 3Q43A 5MERA 4PBXA 2Y2YA 1V7MH 1AQDB 4OGAC 1MKFA 4PRBB 1NGZB 1XF4B 2VN7A 4UUJA 1JWSA 2J12B 1VFBA 3LS5H 4HH9B 1N64H 4OQTL 3P4MB 5EN3A 3IGFA 4XRCB 4BRJA 2N7SA 3T8MA 5JA9A 4PJHA 3K2UL 4J23A 5EFIA 4RA3A 3RWJB 3RGVC 3D2UA 2D73A 2MCPH 4KO7A 1F11A 4POZD 2X4PA 5ADOL 4FTVD 5MHSE 2BX5A 4JR9H 4EOWL 1S9YB 5AZEH 4UQDA 3L3KA 1C08A 5C8JB 1FFPA 4G9FB 2QPDB 4GRWB 1OP3H 1E8XA 4PJAF 1WSST 3BGMB 1QEWA 4HJGA 4JHWH 3Q1SL 2D03H 3OWEA 4JY5L 4NO0D 5AW6B 3UTQB 5GS1B 3D52A 2XIBA 4IHOB 2WLKA 5HI3C 1BV8A 3KYAA 1LEIB 3OF6A 4Y4HC 4FP8H 2YD3A 4JM2A 1HZLA 1DFXA 1G9NH 1QSEA 3O3DB 3UYRL 1M3IA 4M1DH 1TZOA 3FSVA 3C6LB 5ICZA 4KKCD 3FFCB 3GJFK 1B2WH 3AABA 1MCJA 3DX9B 3O6LH 4KDTA 4P46C 1KELL 5IB4B 2M2DA 4FXKA 4H8QA 1CD8A 2QSQA 4IS6A 4B53A 2VN6A 3FRUB 1RL1A 1BYOA 3HB3C 3QWRA 4U1GB 4WJKB 3MV9E 5IBTL 1MREL 4MJJA 2P80D 2NY3D 2P1YA 5DRXB 2PABA 5DYOA 5EIQA 4BH7B 1QBLL 4AUYA 1O7VA 3FT0A 5L2KB 2JK5A 4YFDB 1DJWA 3GSQA 4I9WD 5DMYA 3D34A 3FSOA 4FG6C 4AOFA 1PDKA 4OJFL 1QW8A 1WC7B 5EUOB 5IBLD 4XI5D 3VE0A 5CWSA 1PQZB 3GIVB 4BZYA 4EIBA 1BYNA 4OGXL 4KZEH 3EOBA 4PB9H 1KJ3H 2G60L 2Z35A 1T5XB 5C0ND 4TYUA 5IB3A 2ENJA 1RURH 3HN5A 4HUMB 1CDUA 4PP1D 3WEBA 4YSSA 3KPRB 2OP4H 1Q0XH 2BIOA 3M17B 4I3GA 5D7LD 2OW7A 4Q56A 1NCJA 3CZEA 4XCNA 5HDQH 5IQNA 3ERXA 1XGUA 2E9BA 3IYLW 2J2ZB 2R2CA 3FFCE 3IDXH 2YKLH 5FF6B 4NUQA 1BLNB 2YMXH 3OG4B 1KXVA 3CC1A 3GBNL 4Z7UB 5JO5A 4QOKA 5D7KD 5DRNB 2BVUA 2QHLA 1SXCA 1ZTXL 2IBGA 2NTFB 4QRSB 4ZBJA 4N1HB 3HI1B 3MJ9A 2MTAA 3L3KB 1F4HA 3VFGL 1ETZA 1FCCA 1V3KA 1NC2D 4LHUG 3ZGIA 1NGWA 4XP4H 3ZVVA 5HYQB 4OKVA 5JW3L 3G6JE 5IROC 3GTNA 4WO0A 3ULUL 1SF3A 4JJHA 4U6XA 5E6IB 1ZDSA 3VQ1C 5EUOE 5KYYB 3MNMA 5ICYB 4MSWA 3DDGA 3IT8D 3OAYH 3GI8L 4X7TA 1YEIL 3RU8L 4HKJA 3S35H 4J3OG 4A7UA 3PDDA 5DHEA 2IGLA 2R51A 5C0RH 4WFGD 1DQVA 3SBPA 3VFMA 2WLYA 4FRWA 1HXMA 5GSVB 3FQTB 2R9HC 4E5XA 2Y22A 2ITDB 3SPIA 3MV9A 4U0QB 2KLSA 4XNUH 3T09A 1KTRL 1SHSA 3MFGB 3RY6A 3N04A 2DDQH 3C5JB 2X44D 1IBZA 3D39D 1LO3H 4ELKA 4OZFG 5F3BA 3VGBA 3GMQA 3RL1A 1RJLA 2WVVB 2E4TA 3L3IB 1KC5L 5G4OA 3VGAC 4OZHF 3RTQD 1CGVA 4NM8H 5AVRB 1AXSB 5IF0A 3DXAA 3L48A 4JRFA 3HBPA 1ZHLB 2WLLA 1IIKA 3ZZSA 1XIWB 1R0AL 4NGHL 4L48A 2OMWA 4AX3A 2FZ3A 2NNAB 3LPFA 3ZE1E 3D05A 4Z7VF 3PFUA 2FATL 2MHAA 2ALWA 3ZE2F 3PL6C 1QI5A 1XX9C 4HIPA 5A43C 1IM9B 4AC2A 4ODVL 2E74C 4UZGA 1IGML 4OM0H 3FU6A 2EVFA 4PG2A 1JFHA 2GJPA 3OMIB 3KBFA 1BBJA 3CDCA 5I82A 2B4CC 2R8SH 4MBRA 4RGOH 1JHKL 4F27A 4WWKC 3VXSD 1G4MA 3S2AA 4DGVH 4HXAL 5H35B 2F5BH 4EO5A 1QLEL 3PWPB 4LAJH 3VMOA 1UXLA 4YHPA 1KBPA 2D31A 5KVDH 3K2MC 4XX1E 3VB9A 1GTFA 5CJQH 3QPXH 2P5PA 2MOQA 3PV7A 4E9SA 2BNQA 1HYSD 1ZV2A 2P5ED 2ERJB 2WY3B 3I6GB 4OCRH 4TQHA 2GJZB 4LLQA 3K6IA 1K9TA 4WSJA 2LU7A 2W94A 4Y5VB 3CBJB 3U9WA 4ZX6A 1AH1A 1G7PA 4JDZA 3OKNB 4G9DB 3RNQA 3UJJH 2WKOF 3JTSB 5A3IC 3UBXI 4RSVA 4E68A 5AVQB 4GG6F 3TBWA 4BWWA 5BCAA 1TPXC 1BVNT 3EYOA 2GC4C 2AQPA 4PW3A 2NW2A 4XMKL 1V8HA 2Y5EA 1U8KB 4K8RC 4XNQA 5ITFB 2HT2C 4F2FA 3QW9A 3HRZB 1HCVA 1YEHL 2A0LC 4Q8BA 1G7MB 3V0GA 2K3HA 1IKNA 4F5CE 1MNUH 4YSCA 1WBYB 2YOAA 1KYOJ 4PSPA 1LDPL 4LU5H 5E8PA 5AVZB 1JHTA 5IFAL 3GMNB 4QKTA 2QT6A 3VXNA 3TYGH 3D18B 3I02A 4PJXE 2FZ3B 2NNAA 4I3SL 4A04A 3L2NA 1I8IA 1C8QA 5T1KD 2XV6B 2E4FA 2YWZA 3HVNA 3MGTA 4JDTL 1UOWA 1SHXA 3KVQA 3WUZA 5C07E 4Z7IA 3GKWH 1XEUA 1A4KA 2D7OA 2WXKA 3LRGA 1G7MA 2F74A 3THML 1EHLL 3HN3A 3X3GH 3MRNA 2QADB 4AEEA 3Q6GH 4AENA 1AMYA 1DE4A 2P4AB 3AXHA 2EZ0D 2X1XR 4FQLL 4Z5RB 4I0PB 4F7CA 5FGBA 4JFDD 4KO5A 2GJ6D 3PXJA 4HW6A 1KPVA 3H4FA 5B38A 4P5TD 5ILTH 3EGSA 15C8L 1ZT4A 4FQXA 4IDJH 4N2EA 5IM7B 3WNJA 2NSMA 4DZ8A 2J44A 1QUPA 4ZMAT 1RURL 3HKZA 1IE5A 2O5NA 3PJSA 4LLAA 4QTHA 5ANME 1DDTA 2BVQA 3MLRH 3VJ6A 4JLRB 4BGDA 3CFUA 4HWZB 3RYMA 2IOIA 3CWGA 5B1CA 3CC5B 3GSNB 3HKFA 1YPZB 5DRWA 2AW2A 4JFPB 4ZMXA 3RWCB 4ZTEA 1L9MA 5FUCC 4JHWL 1KBKA 2F18A 3LZFH 5E94B 1KN2L 4ZFFB 5AAPA 1FBIL 3D4CA 5CGYC 3ETBJ 4P4KB 3TO4B 3C5XA 4FMVA 5KZCD 1SQMA 1BXXA 3BRDA 1JYNA 1RZJH 1WGVA 1S7SA 1OT1A 5DQ9A 4DFHA 1H0DB 1U8JB 3O81A 2I7SA 2ZXGA 4RRPM 4LKCB 2Q10A 3C2SA 3PFQA 5IMKA 1UADC 5DJDB 3TYFA 5AW0B 4O2FB 4OVUA 3V52H 3QHFL 1G7JB 1ESOA 5L4MA 1JK8B 1S7VB 1KIQA 4FJZA 1BXVA 4P4KA 3UTZA 4NS0A 2EEBA 3P2TA 3MR9A 4U1IA 3AQXA 3A23A 3FRPA 1WZAA 1P84K 3OAWA 2LU5A 1IBHA 4YHKH 1NWOA 3BZ5A 2Q3AA 5IQ9A 5HGDB 3TGXA 5I0ZA 1WFIA 4PBVC 1G5GA 3A6CH 3M45A 4LCUA 3QIWD 3RZCB 5FB8B 5TDOA 1KCSH 3T6QC 4LP4A 1GRWA 2RA1A 2ARWA 1NGZA 3L3IA 2VDRB 1SJXA 5KJ7E 1UCBL 4O58L 4IRJA 1TCMA 4UBDD 4W4NA 3UZVA 3VSQA 1E8WA 2HLFC 4DUVA 3SKMA 4QHUB 3VFOA 2D9QB 3K0WA 1VA9A 1GOFA 3WMPA 4JM2F 4M7ZB 2R1XB 1UH3A 3HRPA 4J27A 1CXIA 1SZNA 4AKOA 5LKNA 3T4YB 4K8RH 2P47B 3QZWA 1PBYA 1O5DT 3O8XB 3BEVA 3DPBB 4Q9QH 4J6RH 5ESAA 5FA3B 4IOSD 2IGFH 1I9IL 2ZWYA 3NSCA 1PY9A 5K9KA 2E9IA 2H3XC 4MQXC 1G9NL 1QO3A 2EECA 3PPEA 4N0UA 2OYLA 3TESA 2RCSL 1BOYA 1ZS8A 2EXTA 5HJ3A 5DEZA 1WAAE 3U4AA 1T7VA 4XOBA 2CNYA 1AD9B 5DUML 1Y6MR 3OHXB 5DJZB 4JQIL 5C0FA 3VCLB 4DETA 3NIGE 2Q8AL 4YSQA 1HOEA 1V54B 2BP3A 4X99B 4A2EA 1I3GL 5D2LE 1JK9B 2J88L 5E6YA 4LSVL 2BC4B 5CMAB 1F13A 3A22A 4JL2A 4XBMA 2JQZA 4X8CA 4OJFH 3W82A 1GOHA 1JWSB 2GIYA 2Y7QB 4G8GD 5GGQH 1CFTB 3TEUA 1WGOA 4A67A 2BS71 5HD8D 4NN5C 2OK0L 1DO5A 2H1LM 4N8CL 3BHBA 3O4LA 5BV7H 4PS4H 5DD6A 4HCRA 4N25A 4Y4KB 5CWSB 3P3UA 1ONQB 3VI3B 2Z8RA 3UMNA 4L4VE 2EIKB 3AS0A 3DMMA 3T0EE 5CP7B 2XDHA 1CXFA 2Y1VA 1M7IA 1JYXA 1M3JA 5C86A 2FB4L 4XMLL 4DERA 3H9ZA 4NQUA 4XCNB 5EDSA 3N40P 4ADGA 1OTUD 2VLJA 2HB0A 3SDDA 2VE6B 4GS7C 2ZXAA 3CXHK 2NNRA 2DWSA 1SFHA 4HGMA 3PWUA 2R2HA 4RFNC 2C7UA 4WSGA 4YX2H 4QHMB 2XWZA 5HDBE 4ELDA 4HX1A 2ZF8A 5F7MC 1AO7A 3UG5A 2YGVA 2DEXX 5IB4A 3ULVC 4GW5A 3QZLA 1OAKL 4XN5A 2IWKA 1L3NA 1P9MA 4FHJA 4X9GA 4NKOB 4KKNA 4CRPA 2C8NA 3WIIL 4QDGA 4JFQA 4DGIL 5E6ID 5B1JA 4F7MA 3NYKA 3L7EA 2GI7A 4MGXA 2FJHA 4NPYB 3IJYA 3BGAA 5AYUL 1GYUA 4P23C 1DBAL 4QTIL 2CO2A 2WC7A 3B56A 1F6AA 4A38A 2Z0BA 4PRPD 3QAZB 5L4IA 1W72H 3TPKA 2DRUA 2FX8L 3HN8A 2YS4A 1KJMA 3MJ6A 5DQDL 4CU8A 4WW2F 1UJTA 4BSVA 4PJXB 5ITFA 3TBYA 1DBJH 3W57A 1LEIA 4AK1A 4QIRA 3VG0L 3NZ8B 2Y36H 3N1PC 4LZKA 4BK5A 5TTRA 4S0TD 2C26A 2VDMB 4AUUA 4IRZA 4KJPD 4LASH 5MERB 3PAUA 2FLBT 1FL5B 1XAKA 2XU9A 4HJTA 4Q9QL 4QLWA 3LH2H 3PRZA 2E7LA 3HOGA 2R4SH 1NMCC 4PJBF 3W39B 4KI5C 5D1ZA 3CLFH 4XB8A 4R90H 1I8LC 4WUKL 4YSDA 4XPTL 1NPUA 3ARWA 3GS0A 5EN2B 3D4YA 4B9KC 4C56E 2J1XA 4LCCA 2P45B 2I07B 4P9HC 4PJ7B 4QRPE 3T3MF 5CP3A 1I8MB 1BREA 4NJ9H 4BFJA 2R9HD 1PMYA 3RWDA 4J3XA 3T3PB 4WWKD 2DV6A 4R7DB 1R19A 3C75A 3CQFA 3IGAB 2BNRD 2IQAB 5DLML 2XWXA 1BEYH 4XVTH 3T0XA 5GSVA 4NO0B 2J6EA 1DJXA 1BFTA 4OD3H 4CNIB 5DD0H 2L8AA 4HS3B 2Y5QA 2HFTA 4LCCB 4N0FB 1GL4B 1Y0LB 2W59A 3MODL 4V2BA 4P3WA 2X0UA 4APQB 2A0LD 3UEQA 3JV5A 4BELD 5FK9A 4JFFB 4B9PA 4NDMA 5FR3A 4EZLA 2KQNA 4EUPH 2VLKA 3MO1B 4H8WC 5K9QI 3CD4A 7FABH 1ZXQA 3ROOB 3FL7A 4J3BA 4H25B 3AQDA 1HL5A 4LSTH 1MRDH 1FSKC 4G6JH 1HHJA 4HS6A 1VJSA 3PL6D 3LKNA 5BRZA 3L1OL 2W9DH 5BJTB 1L9OA 3MRFB 2VDRH 5DYOB 1UB5A 3VXOB 4EVNA 1U8QA 4GRWH 1HZKA 5CHNB 5AUMB 5I8OH 3TYFB 4FZEL 4Y0GA 2DIJA 4XVJH 5I6PA 3O6KL 1HCFX 3T3PE 2QEJA 4TL5A 3SZ6A 3TASA 3RFZB 1KCUL 3EYVA 3MLXL 5FGRA 5ADOH 3S96B 1IAIM 4OT1H 1DQTA 2GBTA 3TF7C 2OMVA 5DJXB 4UQEA 1A6AA 1T2QL 3K6NA 5HYJB 2VXQH 5EMYA 3K6DA 3OB0H 3VXQA 3DARA 3GTTA 3M7FB 3MLSL 4F5CA 2P7TA 3U0TB 1C12B 4FFZL 4G59C 1X4ZA 1Y18B 4F58H 3DNKA 2FBRA 1WA0X 3HE7D 3GMQB 5D72H 2YD6A 1M05A 1NDMA 3RL1B 2V5SA 1E4WH 4KUCF 2HRPH 2J56A 5GS2H 2B1AH 3RPIB 1YMMB 2XI9A 3L9RA 2IPKA 2EICA 1Z5HA 1UB6A 3M8OL 5LAPA 3HG1D 4XXDB 5H8DA 2AERT 2XY2A 3NABH 1QRNA 3AGWA 3D2UB 3BIKB 5E5RB 2FQGA 3HI6H 4Q6KA 4DTGL 1ZPLA 2A4EA 4HX1B 2WXFA 5DVOA 5I74C 2CR6A 3FBQA 3EJCA 4BE5A 2BP0B 4PREB 4APQA 2YXWA 2EH8H 4QXWA 4X0KB 1A7OL 2PYEA 4YEFA 2CA4A 3HAEB 1JGDA 4FFTA 2UWEB 4S1DD 1FL3A 4CVXB 5GS0D 4CW1A 4FQCL 1BWWA 3MLZH 4RISL 1UKTA 3BDYH 1OCRB 4F2MB 2PF6A 3GSXB 4O9HL 2WXLA 5IGXH 1CFQB 5IMOB 3LH2L 2IIJA 4MXVF 5CN2A 1X5FA 5E8DH 2YRPA 4YWGL 1X5GA 3MUUA 2Q86B 4B50A 2L7UA 3QO0B 4FQJL 3FQRA 5F96L 2R8SL 1KGCE 1NJ9A 2YAOA 1JHTB 4MD0B 4PJIE 2NNXA 4HD5A 5DC4B 2MTPA 4L18A 1MN4A 5DFVD 4JJ5B 4ANWA 4EJ1C 1JWMB 4YAQB 3POHA 3VACA 1T04A 2OSWA 1KDJA 5FOBA 2J25A 2NUTB 5F0JB 3LX9A 3BSGA 1FO0B 1T5KA 1SXBA 1RP8A 2DM4A 4GP4B 4NWTL 5E1GA 3E6FB 4JUTA 3RJDA 2C4XA 1ERNA 2KZKA 2HJKA 1FVDB 2A6IB 4U3SA 3QUZC 3GO1H 3RX9A 5D2NE 4FEMA 4TKWA 4P46D 3NCWA 4PRPB 5DD0L 1EXUB 3B9KA 3VD7A 2YPVL 3BRFA 4G1EB 4TMPA 4ZMVA 4PV8B 1A22B 2X4NB 5KVGL 4MMYB 3IFNH 1OK8A 3UACA 1GJIA 4UM9D 1QBML 2PR4H 1AC6A 4MS8D 2I27N 1CF8L 2PCFB 3TBYB 4WU5B 5DRXA 3BN3B 1E4KA 3MBXL 3L1EA 1TJGL 2I60L 3MBEB 3I3BA 3OGCA 4XNZB 3FO9A 4NT6B 1I53A 1UOLA 3PWJA 4I2XB 4JRYD 7PCYA 1Z9SB 4XAWL 3QSKB 1AZCA 1P9MC 2HVBA 4D8PA 4CBZA 5EO9B 4JZJB 4AYDC 2BPBA 5DR5L 3LKRB 3M86A 4PJ7E 3I2CH 3CMOL 2BSED 2X1PA 2XZZA 4P05A 2WV3A 3HR5A 2ZOKB 3SPHA 3SYAA 3WEAA 4PLNC 2JQAA 1CDJA 2DPKA 3HC2A 4AW7A 4Y1AA 4AUJA 4YGVA 5DJDA 4DVRH 3EOAA 4CVWA 5PAZA 1VGEH 3EGDA 2H0FA 5DURD 1A9BB 4IBLT 1BZ9A 4PJBA 5BVJB 1DBKL 4GRWE 4RNRB 2OJ1A 3QR0A 5D72L 4BFOA 3AJ7A 3OXSA 4TUKL 4UAOC 2FQFA 5F9JA 1BEYL 5CR8A 2JIXD 5GRUH 1DVFA 3ARBD 2H2SC 2WVTA 1T03H 5IT2L 5GZNC 3EJYC 2NX5A 3RVTC 1GGBL 2YRZA 1DJZA 3QFDA 3VYNA 2A9NH 2Q6WB 1W72L 1QNZH 2AJSH 25C8L 1YEIH 1I1CA 2Y06L 3PXHA 1O75A 1PKQA 2KZ1B 1EXUA 5J12C 1U92A 3V95A 3G9VA 1OEZW 3V4PH 5A2IH 3U46A 2Y0SA 4IU3A 2F5AH 5CILL 1A47A 1P6WA 1N6UA 2D8KA 2C3GA 4L1LA 4FTDA 1M05B 2RMNA 3RURA 1AKPA 4TSAL 3OQ3B 1AHWA 1LO3L 2C3HA 4Q6IC 1WH0A 4I3RL 3LNGA 1W8EA 2JELL 3D69A 5FO9A 3UIZA 4CAGA 3LEYL 3G5WA 2JJTC 2ZWLT 4IIZA 3FQXB 5CF3A 4UDTB 2ZSWA 1OTSD 2D9CA 3LAFA 2I5YL 4A2FA 4Y16D 4JM4H 6FABL 2WB7A 1UGKA 3F64A 5LN4A 4PCYA 1OD9A 1CG9A 5EU6D 1WCBB 4LBEB 5L7XL 3GLDA 4N20A 2B1HH 3I75B 2BWIA 4N2DA 1KPUB 1UQSB 3BSZL 1WLHA 4HWEL 4MB3A 4NQCD 2HRPL 1VCBC 1D7CA 2R1WB 2PYFB 1J8RA 1KT2A 1OAUH 1CTOA 3U30C 3BWZA 4PV1C 3M8OH 4ZRGA 4L4VA 4MJ2A 1KUMA 5GS3A 1IM3B 1HEJC 3K80A 2X2HA 5D7JC 4RZKA 2YQBA 2SODB 4YSAA 5BW7C 2OR9H 3WFHB 4EIUA 3TO4C 2VRKA 2CUHA 3JV4B 1OHQA 4OGYL 3TCLA 4OQTH 4KGJA 1IGYA 3BP5B 5F1NB 4XBPB 2DJMA 4GY4A 1KIQB 2IG2L 1SYSA 1KEMH 1KYUA 2CCVA 3X14A 2GI0A 1WBXA 2C5DC 3VXUE 5EPMA 4A7GF 5J06A 1NGPH 1TVHB 3LSOB 1MCKA 3DHMA 3QCTH 2V2TB 2CDFA 1A1OB 2WP3T 2Z8WC 3ASWA 1T1ZA 5H2BA 1S7UB 4KKBD 3D39E 2ERJC 3BYTA 5TH2A 4ERSL 2ZOWA 1HXKA 5DC2A 3SDCA 1II4E 2OTUB 3L3OB 1QZNA 1KB5A 2D0HA 2E27L 1XXDC 1RZGA 2J8UA 4Z3GA 2VYRE 4PJFE 3W0WA 4HVBA 2W07B 3BAEL 3MV8E 1OZUA 3UJTH 4NQEE 3ME0B 4YMPA 2NY5C 1RPQA 1J0HA 2F8XC 4OR1A 3O4LB 3FS9A 3MA7A 1WD9A 4G5AA 5GJTL 3GMNA 1VIWA 1ONQA 1KGJA 4P2AA 3ZDXB 5DLMH 5JDJA 1A6VL 5FX3A 3EGSB 2D7PA 1KBBA 4LCIH 1BWMA 3DECA 2X70A 1XH0A 1HQRB 3WNIA 1EJFA 2WANA 4YOKA 3WFCH 3HAEH 1A6UH 3M1OA 2ODHA 2GY7B 3TVMB 1J5CA 2FL5A 3O41A 1OB1B 1QBMH 3C8DA 3NAAH 3VFRA 4OCYL 1A7QH 3HZKB 4JFHD 2WXJA 2XYBA 2P8LB 3V79C 1PLAA 4MYWB 1G0XA 1W16A 3BMVA 1E28B 3SJVD 4JDZB 2MQ0A 4ONGL 4BZ2L 4FS0A 3S9DB 1M56B 4N8VB 3B3IA 5IVXB 3R4DA 4RISH 5FW8A 3OKLA 4Z7QB 2X6VA 4M3KB 3VFNA 1MCHA 2Z31B 4MD4B 2H0JA 3HC4L 4K7PY 3TT3H 1FLRL 1FG2B 1X4XA 1J87A 1ZA3A 4L4TD 4UNUA 1HEHC 3QQ9C 5ECGA 1N2RB 2ZAIA 1RCYA 5ADPH 5KSBB 3D1MC 1K72A 4L0PB 4OGQC 2YO3A 1YEFH 1DEDA 1OD7A 3O2VL 5D8JL 4F37K 1R3KB 1E5UI 2ZCZA 2FX7H 4YDMA 3O3AA 2WW8A 5CEZH 2BDNH 3OB8A 3D18A 3WTXA 4MMZB 4PLKC 4KK8C 2FJFB 5KOVC 2VZVA 3ARUA 3HC0A 1YEEL 4XCEB 2YEZA 2DLHA 4I4WA 4GUPB 4NO5A 3B2VL 1KCKA 2P5EE 4M4PA 3IF1A 3MV8A 4OFDA 1YECH 2W92A 2ZYRA 4LCUB 2WZPD 2C9XA 3FT4B 3N06B 3KPQA 1MCFA 3CMGA 3QEGL 3B2DC 3OLIA 5AD0B 3LQMA 3NJFA 4EN3C 4F8PA 1OAYH 1OCCB 5A1AA 2P44B 5LHDA 3LPGA 4P04A 4IRSA 4XO8A 2EKJA 1X9UA 2OR7A 4F8NA 1JD9A 2CHWA 2YQGA 4Z76B 4PJFF 4N2LA 5H4YA 3V6FB 2G9HA 4PJGF 3DIVA 3LXCA 1BFOB 3ARZA 5MEPA 5T33H 2J1KA 5KVFH 4N68A 4P23B 4P2OC 1CYGA 3IDGA 3DVNB 2BIQA 4DP6X 5I1LB 1EFQA 4HMCA 2C3XA 1NGPL 2IPUK 3O3EB 2ZZUT 4FTVE 4LQ1A 3DMMD 3GMPB 2K9UA 4WNQA 4K3JH 4WY7L 4PN6A 2B5IC 3FQNA 3WD5L 2WKLA 4YX2L 2XICA 4BH8B 2WPGA 5D55A 4E9VA 4ES9A 4Z7NE 4XPTH 3LEXA 4AMWA 1U9KA 2VLRD 3V6ZB 1Y6KR 3DX2A 4JFYA 3D85A 2YRLA 1LYQA 1ASQA 1JOIA 2HLFD 4KNSA 4ZFFA 3JWDH 5E1QA 5DFVC 4PV9A 1P5UC 3UIYA 1UM5L 5EU5A 3V7MA 3VDCA 1XIWA 3D5OF 2WTPA 4LCCC 4NC1E 4Z7NF 3B4NA 1KSRA 2IH1A 3FMGL 1UWYA 3DV6B 2NZ9C 1VERA 4QYAA 5SX4H 2G9KA 3AITA 4YDIL 3DMMB 3QUZD 5HGAA 4JKWA 4S1RH 3O45B 5DQDH 4ZW6A 1ICTA 3EDKA 2WNWA 4B5EA 1U8NB 3B7UX 1GGBH 1IEAA 3MA9H 1NBYA 1IX2A 5D7JB 4HAFA 3O0RH 5EZOH 2XG5B 4EI6B 5FFOA 2BK8A 1QVOB 5F7FA 2WOYA 3ZL2A 4Y88A 2XSKA 5MEQB 3RZCA 4Z77B 1N3NA 3ULUC 1TJGH 1L5GB 4PREA 4G42B 4Z7OE 3ARRA 5D6CB 3X12B 2Z9TA 3ZO9A 2O5XL 1BMGA 4U1KA 5ICXB 1SLWA 2YUZA 4GKNA 4ABVA 3PWPE 5EPMB 4TUJB 4EDXA 4JHZA 4CN6A 1ND0B 3KHQA 4G6AD 3N2JA 4HCGA 3HNSL 3O6ML 1EMTH 3MLUL 2Z31C 2KHAA 4OGAD 4H8UA 5EC1A 3ZTEA 4JPIB 3O2WH 5FYJL 2XQ0A 2YKLL 4LVEA 4RAHA 5CGMA 1E42A 1KCWA 2VXTL 3RVWC 1CI5A 4GT0A 1TTAA 2H2SD 2NW2B 5EOQL 4AI7A 4DK6A 1NCGA 5EZPA 5I73B 3FSZA 2B59A 4X6DE 4JFOA 3Q3GB 2XKUA 5A16B 2UYLB 4TUUA 4XPBH 2AVGA 5ESVB 2Y69B 4RGNE 1XD1A 1LQBC 4M4RA 4XH2B 4P9ML 3U1QA 3PAZA 1RJZB 5JIHA 1JGVL 2IPTL 3EJQA 1N19A 3BGMA 3TFKC 4EI0A 2ZKMX 2G4EA 2N01B 3D51A 3OQRA 4HCRL 4MMYA 1M2OA 1ML0A 2YBRB 5EBWB 2Y36L 3F84A 4ZMOA 5K5YA 3KH3A 5I1IH 4W81A 4AQAA 1REIA 5B7MA 1BGXH 5HBBA 5K59E 5K1JA 2X4QA 4BZ2H 1OTSC 4QTIH 1Q9OB 3VQMA 4KTEH 1G7HA 4UTBH 3T4AB 2UZXA 2ICEC 3O4OB 4HJJL 4PRNA 3BT0A 5L6YL 1FO0A 4WU7B 3FU7A 5KYXA 3NEEA 1YYCA 1V5JA 2DBJA 3D12B 3D0VA 5JR1H 2PTTA 4NO0A 4IK6A 4N1EA 3BUDA 3U1PA 3RB7A 1AGBB 5DJ6B 4J7RA 2HTKD 2WJ5A 4ONFL 4URTB 5FYKH 4RZCB 2VQTA 4PHZA 2I5YH 3U2SA 1ZLEA 5ES4B 4C56B 1FAIH 3B9VA 3K2KA 2JKLA 4W70A 4XPFL 3SE4A 2EABA 1JGLL 1RXLA 4P2YA 2WINA 3VH8B 4U6TA 2QJDA 5E9DA 3QEQB 5A7EA 3ZKQD 4PSRA 5I74B 5FC9A 1IAIL 2O30A 3VFTA 4U6HB 1TQBB 2BRRL 2HWZH 3HI6L 4CMMA 4OJEH 5CU5A 2QPSA 3U30B 4EEEA 4I48B 4JREC 5EEUA 4MAZA 1EUUA 2JSFA 4YSOA 4XOEA 2AV7A 2HA1A 5B7FA 1PVHA 3PDGA 2B4CH 2NY2C 2PCPA 3Q8EA 1A6UL 2ZUYA 2R2EB 3HG3A 4JFXA 5C0GA 1A0QL 2BSTA 2J57A 4NB7A 4I0PD 5ESQA 4JPVH 4HUCA 1E4WL 3I9GL 3WIHL 1A6ZB 1FFNB 3QDMA 4XT1C 3RJQB 4P5TB 5E2UL 5I1LA 4BHUI 2CO6A 1OAXL 3EO0B 2YPVA 1F4YL 3Q8FA 5D1XA 4YWGH 3WSQH 5K9OA 2O5ZL 2FQEA 1N4XL 2VDPB 1T3FA 4IOFD 1LHZA 2VAJA 3U0TA 3UADA 5KYYA 5D7LA 3KLKA 4Y16C 4G82A 1TJHL 1Y6NR 5EF2A 3ZTDC 3IDIB 2ITCB 3S7GA 4I1PA 1Q1JL 3QZBA 1ZXKA 3V4LA 1AO7E 4Z6AT 5JIPA 3BP6B 3QUKA 2DZEA 5CGTA 1DQMH 2FIKB 4PJ9B 3TEXA 1FVCB 3MYJA 4JANB 2APXA 1KCRH 2NY6B 3QQDB 3QPQD 2ICWA 2DQIH 1OY3B 3MROA 4J3OC 4F93B 1FN4A 2W9DL 4ZUTA 4ENEC 4EVNB 1O6TA 2FO4B 5LCVA 3HFFA 1G7QA 4LF3A 4N2MA 1XGUB 1U8MB 1HT6A 3QJXA 3RDTB 3GT6A 2EIBA 4BZ1H 3BAYA 4R8WL 4UV4L 5JXEA 4PWIA 1FNGB 2MJWA 3FXIC 4PJHF 3FRPB 4D8PB 1DQQB 3EXLA 1TPXB 2EKSA 1WTLA 3T77A 5GZNA 1LL1A 1PIFA 2LU4A 3NZSA 2PKDA 2VISB 3ZQXA 5IV2A 1FRGH 1IGJB 2WBJB 3PAVA 3IXTB 3BYYA 1JPSL 4XP9L 4R0LA 4MAUL 4ZFGH 2Z7YA 4YHOL 1NDMB 2Q7AA 43C9A 4ZD3H 4UM9A 2XWTA 1QEWB 3F5WA 1OGAD 4ZS6D 3A4EA 3K2IA 3RIAK 4ADJA 3D39A 3IGLA 4ANKA 2VW7A 5TE4L 1D5XB 1T4KA 2NY1C 3EFFB 4JN2A 2Y7QA 4RESB 2L3BA 5AAMA 3SPVA 4N2GA 4DQOH 2XXFA 4LVHC 5AOJA 1IQWL 2AI0H 4EI5B 5LNGA 5IB2B 2CDFB 1EH9A 2BHZA 2EP6A 3MHZA 4ODHL 1C9SA 2N3JA 1KJ2L 3OR7A 3TT3L 1XH3B 4M93C 1A2YB 4XCYB 3VVWA 5KUKA 4X5LA 3SKJH 4Z23A 4GQPH 3O3UN 1BZ8A 2WGNB 1DVUA 1XCQB 5ID1A 2UY6A 3H56A 4FQPA 3L5IA 3QZPA 3QUKB 1OGTA 3BKJH 3DX7B 3T5WA 5AYTA 1ZRUA 5CEXA 2NSQA 3FQRB 4P5SA 5C3LD 2XFXA 2Y1YA 3GSUB 1I1AA 4DAGL 1A2YA 1MI5E 4RSYA 2EYTB 4XCYA 4DUWA 5EBLA 2YSTA 5AOZA 2B15A 3REVB 2ZCLL 2HLEB 2V5YA 1A5FL 3DETD 1G0YR 2XYCA 4KKLD 3WS3B 4QWWD 1F3DH 5INCB 2AQ2A 1T5WA 3QJQB 2DQEH 3VGAB 4KVCH 4KKPA 3STLB 4AJVA 3I9IA 3BD4A 5EZOL 3ZZ1A 5C08E 3US1A 1JFQH 1PGRB 2V2TA 3GXNA 1JNLL 1NCCH 3SPGA 5TF0A 3T3ME 1S7TA 2CXKA 3IJ8A 1MSPA 2V0AA 3GFUA 3UAJC 1QYGH 1BXAA 4DZBA 3KL3A 2CK0L 2UZIL 5T5FA 5BUPA 1PNDA 3CFJB 2ZUSA 5INCA 5IFJB 4JRWA 2CDGB 4ZUUB 3BC9A 3T2LA 3F6LA 4UQ2B 5G5DB 3ZIYA 3BGFB 3W38A 5JNYB 1AR1D 3GLZA 1YJDC 2BZDA 2PWHA 3FT1A 5FKPA 1UACL 4KDWA 4H20H 1IM3A 2ADIA 4C58B 3WFBL 3EOAB 3QNZB 3PP3H 3QDGA 2EO7A 4JFFA 4KNQA 3LEXB 4NAMA 4HKZA 4G9DA 3RNQB 2DMKA 1DHKA 5D5ME 4WFEE 5FYJE 2ZF9A 3ATFA 3QUXC 5FV2A 4YDVA 5KVEL 1J05A 1WT5C 4RX4A 3IN0A 3IJ7A 1UYWH 3WELA 5CEYB 1G9HA 1GGYA 5IT2H 5EIIA 3CXHJ 2ESVD 1MCCA 2WQAA 3QNZA 3GJFB 4L8CB 3TO2B 3RB5A 2D4DA 2VMCA 4NN5B 2IO5A 4PBWD 2H3NA 4Y1TA 3WNOA 4Z3JA 2AVFA 3PXLA 5DS1A 5E94A 1BZ9B 4PJBB 1HKFA 1U41A 3WEOA 2MSPA 4KH2A 4YHOH 2J88H 2EEXA 3RUGB 2YXMA 4FLOA 3FAXA 1FFNA 3MODH 1U3ZA 3QAQA 4MCZA 5GRXG 2XPGB 3ARBC 1BZDA 4EDWL 2GPZA 4G5ZH 3NACL 5I8EA 4JCMA 1URZA 4CGTA 4MMZA 1VACB 4PJXF 5E95B 3BH8B 3L7FA 5IJBC 5JDSB 1A4JA 2VLME 1SGKA 5C07B 3F12B 2R1WA 4NFBA 3RQ3A 4MNHA 4UQ2A 5G5DA 5GGVL 3GK8H 3W5MA 3IVKB 5DO2D 5I76B 1OLZA 2WINB 3V0DA 3T71A 4ZTPL 3FQWB 5BUAA 3AROA 1HILA 4LBEA 3MN8A 4Y5XC 3D33A 2BCMA 4KUZH 3WKMH 3DTXA 1F4XH 1YVLA 2ZICA 4KO6A 4NP4L 1E7UA 2VAAB 2CLRB 4WFFD 1NCBL 1JVLA 1QOKA 3QEGH 4G9FA 5INDB 4Y9CA 4QXGH 5ISZE 3GHEL 4GBXA 4F2MA 3JWDC 4P2QE 4W9KC 4AGNA 3B3BA 1AAJA 5C0IA 1UVQA 1IC4L 1CLZL 1EBPA 1W15A 3GMMB 1FJ1A 5I0DA 2DQEL 4ZS7H 1D5IL 4K73A 1MJ7H 2WXRA 5I18H 3N85L 3VWKD 3ARYA 2W5PA 5EEWA 1A0QH 3EYUL 4ZAKC 5SV3A 3CVHB 2D3VA 3KMDA 4WEEA 4LDOB 3U6RB 5F9AC 5C0IB 1EXHA 3WXVH 1PKQB 5G55A 1TQUA 1FLRH 4QT5A 5AW9B 3IS0X 4Z0XB 4LP5A 3DJZA 3SE9H 4LIQL 2IVFC 3NSYA 4FLRA 1S3RA 5I1JL 2OMYA 4FCHA 2DW5A 2WNXA 3FUEA 3MLZL 4FDWA 4OGYH 4PG9A 2B77A 4WFFE 3VX0A 3WKYA 3QVAA 4ZNEA 5C0BE 4XXCA 3UAEA 5JR1L 3ZZQA 4L2YA 1GGIL 2AEPH 3OPZH 4KHXL 1TU2B 3U6RA 3ML8A 4ELMB 4RQQA 1S2EA 3E3QC 1KPRB 5CP3H 5AAWA 4ONFH 4PGEB 3AMKA 4A2HA 1P0SE 4CC1A 2LAGB 3RNKA 2VRAA 4ODVH 3P9MA 3BSZA 1I9EA 3IKKA 1U8OB 3QCTL 2F53D 2R0WL 4PJEA 2GUOA 4C56D 2OYMA 4FEIA 4QF1B 1IE4A 1R24B 4OCWH 2NX5E 1HHHA 1JV5A 3GMPA 5CD5D 4UYPA 2DYPB 4WGKA 1FYTA 3E1F1 5TDPB 1F45A 1JWMA 5IQMA 1OTUC 3T2OA 1UH2A 2G30A 2EACA 3NN8A 1KFAL 1O0VA 4NKIL 2WSPA 2X38A 4FQ1H 1YEGH 2YQ3A 5DJ8B 5INDA 5CJ8A 4R4BA 4DCQB 5DJAB 1Q9LB 2MNUA 4IS6B 3VM7A 3OAUL 3IJSB 5C0EA 1DTUA 4ZFQA 4ODXA 3IPBA 1YEEH 1AKJB 5DRZA 4UNVA 1L6XA 4NSKB 1FSKB 4TTDD 1K5WA 2IANA 3K8MA 3LXAA 3FJTA 5CD3B 1KTLB 1NIBA 1R46A 2AQQA 4LCWB 1ZLSH 4BKLB 4JK0D 1BOGA 3BESR 2PP7A 4K4KA 1N9PA 4OAWA 4PB0L 4BBWA 2X6MA 3U6XS 5ESQB 2DI7A 5LQBL 3NBNA 1E9PB 1YUHB 3KE0A 3KD4A 4NOFA 2YJLA 2DM3A 2LTQB 3BKMH 3QXTA 5JHLA 5GHWL 4PRPE 1CE1H 5GIRA 3IFLL 4BQ8A 4XAWH 5SWSA 5LBGA 3AUVA 5I1KL 3S3DB 1Q1JH 2VQ1A 3FCGA 4LVHB 1FV1A 4R5VA 3W9DB 2G5UA 3J27A 4KY2A 4JFZL 4HEPG 4BGLA 3L4ZA 5SWSE 4H26A 3I9PA 5GRYA 5EOCH 5HY9B 5IFAH 1PG7H 2NW3B 2ADGA 3T0AA 3C8KB 4YDIH 5LN8A 3DYMA 1EHNA 3L5XL 4OM1L 4Z8FL 1GGTA 3CSTA 4OM0L 5T5NF 3VH8A 1MCBA 1DL7L 4PRBA 4HJSA 1M1XA 3BFWA 4FI8A 1ETZB 1MCLA 3C5ZC 1ILUA 4I77H 4Z0BL 3RY6C 4HCRH 3GBDA 3V0AC 2DD8H 4R4NC 5HYQA 3GJFA 2A9CA 2O61B 4Y19E 3RDTD 1YG9A 2DKMA 4I48A 3QDME 4N90E 4JEGB 4WUUA 4HT1L 5EH1A 4ZMYA 4OIFA 5JHLH 3PGFL 4UDUA 3QFGA 4FF9A 5AYQA 5TFSL 3WY2A 4KK8D 3O6FB 1UM6H 1CDHA 1C16B 1MPAH 3B37A 4MAUH 4OCRL 3G3LA 5C08D 3ESVF 4ZFGL 1PJ9A 5GRVK 4P06A 4F8LA 1GTNA 3MGOB 2RHEA 1HINL 4WO4B 2VDNL 1BVNP 3VB8A 4RZCA 1L0YA 1NIDA 4LEEA 3ZKXC 5J56B 2PPAA 1ET8A 2FJHB 2E47A 3PLYA 2DQUL 4HZ1A 3LKQA 1N5AB 1CLYH 1BJ1H 4KK5D 1GMIA 4YZFF 3SE3C 4NWUH 4UQBA 4L4TE 1CCZA 4NUPA 4PVMA 4HHAB 5LB1A 1KENL 2VDNB 2YSSA 1KCVL 3EYSL 1IBDA 4KKCC 1QLRB 2F54A 2WKOA 3VRJB 5ABZA 1X5IA 5AW8B 1SUJA 1XEDA 3G04B 4LLMA 4E9QA 4OF6A 3MZGB 5DQ9B 2AJUH 3CDFA 1EWHA 3Q2CA 4LKCA 1KGUA 2D3JA 2F54E 3WD5H 1NFDB 1JBJA 5BXFA 1SVBA 4XOCA 3V0VB 4K94H 4JG5A 2J1WA 5BZWB 1LD9A 3B34A 4MRCA 3UBFA 1AJ7L 1BM3L 3TO4A 4MMZC 4NKDA 3DO3A 2IMMA 2FWOA 4FE9A 4R97B 5GGTL 4IOIB 3TA3B 4HOMA 2BH0A 4O2EA 1GZHC 3EO0A 1Z5LA 2V2WA 3IETB 3BWUF 2GSGA 2KDGA 1UGNA 2P5WA 4EIZC 3QIBB 1TJMA 2AKRB 4JKMA 3VI3A 3KEDA 1F42A 4IKLA 5B8CB 2R23B 4JPIA 1IZKA 3UAAA 5LWYH 4JO5A 1GC1C 1P2CB 3OSKA 1EZLA 4HQQL 1J5IA 3K1DA 4U1KB 4RAVA 1T1XA 2BIMA 3BWSA 5ECJE 4KDTC 4YLQT 1C5DB 2CSPA 1F5WA 2VLKD 1A64A 4HOWA 1D5MA 3NACH 3LV3A 43CAA 4TNGA 3RTQC 4OFYA 4EI5A 2AITA 1S46A 2FO4A 1K5NA 2R56H 3MRMB 4F57L 5JW5B 2XZCL 4Y5YB 2V8LA 1UD3A 3O4OC 5FGBC 1DQJB 4FYQA 3RX5A 3KWWA 4FXGA 2CUIA 2J73A 4I3RH 1CFBA 4MJ5A 3L13A 4GKNB 3RWFB 3VXSE 1HK6A 1HH6A 1NGXA 4ERSH 5JW4R 2XA8H 4A7GA 3L5XH 4OM1H 3J2PA 5A2LH 4X6DB 1OE1A 3I74A 4MX7A 5DJ0B 4BFRA 4BQBA 1G1KA 2XN2A 4Y5YA 3EYFA 5DS8A 2XOTA 3TBCA 3MRQA 5TH2B 4NQQA 2ZOTA 1E9QA 4FQXC 4U3CA 2NPLX 4XMTA 2H26A 2YFOA 3EJSA 4HBQA 4X0KA 5E9DD 5EOTB 1OANA 4DUXA 4MCYB 1NMAL 2XC8A 2W0PA 1FL6B 2ED9A 4GSDL 1NEPA 2BOBA 5BMFH 3CHSA 2PXYA 2ADFL 1JPEA 2C1PA 1JGIA 3CZUB 3SGEI 4MDJB 2VXUL 4YBHA 5KVGE 5DK0A 3UCRA 3QULA 4PTTA 5JORA 3APFA 1DQLH 5ACZB 1OF2A 1U6AH 4NO3A 3ATEA 5I15H 4AJWA 1MVUA 2AK4B 4O51A 4KFZC 3AT0A 4HPYH 4LLYA 4HETA 1UT2A 1AI1H 2DOCA 1ZGLP 2XXCB 1MW3A 1NANI 1BBJB 1HSBB 4NRYA 1FAIL 3P0YH 2JCCE 3MXWL 1OF2B 1JHLH 2KERA 4WI6A 1KEGL 3D8MA 4KZDH 4DT2A 4ODWB 1ETA1 3MRDA 4W1TA 4ZMLA 1I1AC 4IYKA 4A68A 2ZX6A 3QDJA 3EOYG 3LQAL 1JZ3A 2D2CC 3TTSA 1DL7H 3AY4A 1QLEH 2GEQA 1GOGA 3BXNB 3T8XB 4K5PA 2OL3A 3L9EA 3JYCA 1JXFA 2AK4D 5K39A 4N2AA 1KCRL 4PWHA 1MQKL 1B88A 4WGVB 3OAYK 3GNML 2W0KA 5AVWB 3G5VB 2C9UA 2OPCA 5C0BD 1WA1X 2BW5A 4DWHA 4P0DA 1HYSC 3PGDA 3ROOA 5F21B 2J6EL 1BVLB 3MRQB 3CFKB 4OV5A 2WVSA 3WJLA 2XLLA 4KXCA 2YC1A 4AV0A 4HQQH 5IMMB 1XVSA 1RJZA 1EV2E 3B9KD 5AW4B 3U46B 4HALA 4DPAX 3QIUD 1HL4A 4EF3A 4OCYH 1GS7A 1UD4A 1LP9F 4X7SL 1WE5A 1TDQA 3HTLX 1INEL 3CVHA 4YZWA 4LE8A 2JH2A 3P0VH 2XIIA 3REVA 3ZMEA 2A3TA 1WUZA 2NYKA 2ADGB 2R7EA 5EORH 1ZIAA 1YMME 4FA8A 4HIIA 4W9HC 3K6SB 1A6WL 5T5FL 4K8RL 3ELAT 2V7HB 2YAPA 1NGWB 4G43A 2BWDA 4Y4FD 2XN9E 4Y2DB 1E6JH 5BS0D 4HC1A 2QR0B 1KELH 3PWNB 5JIMA 2VR4A 2Y5TB 4KROD 4R4FL 3OZLA 3HNVL 4M00A 4MA1C 1O9VA 4GNKB 4H8HA 3RL2A 8FABB 1QBAA 5F7EH 3DSFL 3CFTA 2VITB 4L1DA 4GFXA 4I88A 5EEXA 3ZT5A 1BZQK 2XZAL 2Y9RT 4WI8A 4Y4HD 2EIDA 2BHFA 1WWBX 3AMLA 3TN0C 2XTJD 1MWOA 4L8SC 2IDUA 5E7FA 4XN8A 4XP4L 1I8KA 2HVJA 5FW7A 3RTLA 3V7AG 4XB3A 3HUJA 1OLLA 4P07A 1LXMA 4N0YH 4ORGA 4BZ1L 3GJFH 5DRWB 4NKQB 2Y24A 4NLHA 3VXPB 4HOXA 1VRSA 3EYVB 2ZCLH 4PJAB 1IJNA 4IHOA 5D7EA 3FF8A 1FNSL 2NXZC 2X4SB