4HZ1A

Crystal structure of pseudomonas aeruginosa azurin with iron(ii) at the copper-binding site.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
ECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Azurin as a Protein Scaffold for a Low-coordinate Nonheme Iron Site with a Small-molecule Binding Pocket.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 27
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hz1A00
2DWTA 3AG1B 2EIJB 1QNIA 2VW4A 2VSKB 2DY2A 3CZUB 3CVCA 1JZIA 2CBPA 2FJSA 4GP4B 4YVUA 1KBVA 2IDFA 3NP4A 3C75A 1MZZA 2HZHA 2XV0A 3NJGA 2UX6A 3BQVA 3QQXA 2EILB 1ETJA 2H3XC 1B3IA 1IUZA 2DYRB 2VN3A 1SFDA 2GBAA 1M56B 5ANHA 1MG2C 1E65A 1CURA 1J5DA 3IEAA 4L0PB 1YLBB 4GYBA 2IWKA 3OQRA 1M57B 4YSEA 2AZAA 3T9WA 4DPAX 2B08A 1ASPA 4AZUA 3ASNB 1GSKA 1OV8A 2LLNA 4A67A 1F56A 5I5JA 3UADA 2BP0A 1NZRA 4BWWA 6PAZA 1A65A 1OF0A 3G5WA 3FYIB 2BWIA 3QJRB 5AZUA 1ET5A 2P80D 1AOZA 2IH8A 2W8CA 3AZUA 4G70B 5AKRA 2JFCA 2FWLB 3SBQA 1T5KA 4PCYA 2Q9OA 4WTQA 1ZV2A 1AG0A 2BHFA 4G71B 1BQ5A 1SJMA 3FPYA 1AS8A 2P80A 3AG3B 2XUWA 2CJ3A 2HRHA 2BWDA 2MTAA 2WO3B 1J9TA 4YSRA 3QJSB 1PZBA 4BDVB 3RYMA 3WNJA 3H56A 3QPKA 3UGEA 1GS7A 3HEIB 4AKQA 2XX0A 4E9VA 1AACA 2QDVA 1PLAA 2BZ7A 4NB7A 3U25A 2FT8A 2YAFA 5AFAA 4DP1X 2Y1AA 3NSCA 1W6WA 4ENZA 3T6VA 1V54B 1IKOP 3NSYA 2YAOA 3ABKB 3EH4B 1URIA 1PMYA 3NJFA 4A2DA 3NJKA 4DP4X 1FA4A 4N4YB 2VSMB 1QLEB 1X9UA 2GIMA 1ASQA 2X87A 3DTUB 1PF3A 2YAQA 3WNIA 1CYXA 1OCCB 3WKQA 3X2QB 1GW0A 4PAZA 3V9CA 1W6LA 2XX1A 1NINA 5PCYA 1ZDSA 1SDDB 5I28A 4JKNA 3FQ2A 1MDAA 1L9TA 2FT6A 3IBOA 1GR7A 2QDWA 1NIFA 4A68A 4AI7A 2NRDA 4GXFA 4WKXA 5I5IA 1BYOA 2JXMA 2QPEB 3D12B 3WG7B 1E30A 3FPXA 3TA4D 3T71A 2R7EA 1SFHA 1GS8A 1KCWA 2PCYA 3N2JA 4YSTA 5D4IA 4BXSV 3KW7A 5B3SB 1HFUA 3PAVA 2J57A 5B1KA 4A2EA 3PAUA 5B1AB 1OCZB 2WO2B 4DP8X 4CSZA 2IDSA 4Q8BA 3DKHA 1NICA 3TASA 3OMIB 3TBBA 1BYPA 1TU2A 2GHZA 2ZONA 1BXAA 3FQ1A 1OE3A 3FSZA 3FU7B 4G7QB 4KO6A 2BP8B 3FSWA 3CDZB 1J5CA 4GP8B 2YXWA 3ZBMA 1ET7A 6PCYA 3X1EA 3FS9A 1AIZA 2UXFA 4FAAB 1PAZA 4F2FA 5B1JC 1PZCA 1JERA 2YAPA 4KOBA 2DYSB 3X1GA 3PAZA 5B7FA 5FC9A 1RKRA 2AZUA 3QJTB 4YSPA 5B7MA 2BW4A 2CUAA 2PPFA 3FU8A 1KGYE 3ABLB 4NERA 1A3ZA 1AZNA 3UAEA 2XV2A 4BWUA 4YVNA 1SF5A 2PLTA 4DP9X 2FT7A 4HAKA 4A2FA 4E9XA 4E9WA 4E9YA 2XYBA 2PP7A 3UACA 5F7BA 1E67A 1AANA 2J5WA 1AQ8A 1JZEA 2FQDA 4HCFA 3EF4A 2CAKA 3UABA 1TEGA 3IN0A 2PPCA 3FU9A 2BW5A 4HCGA 3OMAB 1A4BA 4KNSA 4P5SA 3IE9A 3H4HA 3HB3B 4M4RB 1J9RA 4DP5X 2Y69B 2ZXWB 2FNWA 1L9QA 4KOCA 3AY2A 4HZ1A 2BZCA 4YSOA 2XVBA 3KW8A 1AG6A 1JVOA 2E86A 4P5RA 3ABMB 2H5UA 2PPDA 4NAJA 5EHFA 1PNDA 3T6XA 1AZBA 1OCOB 1GYCA 1V10A 1SHXA 5E9NA 4A2GA 3X1NA 4YSAA 1MZYA 1WA2X 1BXVA 1JXGA 2B3IA 2UX7A 2BO0A 1AS7A 1BXUA 1PY0A 2XU9A 1XMEB 1JZGA 2IDUA 1AZRA 4N8UA 3OMNB 2IDQA 4FA7B 5LDUA 2XV3A 5I26A 3SQRA 2DV6A 3ZX1A 3TBCA 1A4CA 1WA1X 3X1BA 1ET8A 3AG4B 3PCYA 2TSAA 1AAJA 2I85A 3NJMA 1AZCA 3ZDWA 4A66A 1NIAA 1J9SA 4UF7C 1XB3A 3T6WA 2CCWA 2FQFA 2GB2A 2XXFA 1OOWA 1E5ZA 4HALA 1AR1B 5D4JA 3NP3A 4KO5A 2GI0A 1JZHA 4ZK8A 1WA0X 1XB8A 3AW5A 3ZIYA 1IC0A 2MRYA 1L9OA 4KNTA 2BP0B 1ZPUA 3GYRA 1PNCA 1KDIA 1JOIA 2I7SA 3NSFA 3EHBB 2HRGA 2YAMA 1AS6A 3FT0A 1I53A 4YSSA 2VM3A 2OJ1A 1BQKA 2XLLA 1VLXA 1ZDQA 2J56A 1L9SA 1DYZA 1BEXA 3GXUB 2IWEA 4E9SA 4RH4A 1E5YA 3CG8A 3T6ZA 4F7KA 4UAHA 4QLWA 2FQGA 3JT2A 1TKWA 1R1CA 3PPSA 2W88A 1NPJA 4G72B 4KO7A 4QKTA 4DPCX 1OCRB 4MFHA 1NIBA 3UAAA 5B7EA 4BDVA 3IN2A 1NDTA 3X1FA 4DP6X 1RZQA 1JZJA 2YXVA 4TXVB 1XB6A 5TK2A 2ZWNA 1OE1A 2OCCB 4CSPA 5I6PA 2IAAC 3GDCA 1DZ0A 4HHGA 1SHWA 3N55A 3NT0A 2OV0A 4F2EA 4YSUA 3H4FA 2UXVA 2IWFA 2UXGA 1HAUA 2AVFA 3CVBA 3ABGA 2PP8A 4AX3A 1SF3A 3WKPA 2FTAA 2CALA 2XXGA 2QT6A 3ERXA 3S8GB 5IY5B 1JVLA 1KCBA 4HCIA 2VM4A 1JZFA 1JXFA 3DIVA 5I6OA 2Q5BA 3QJVB 2FQEA 2YAHA 1V55B 4DPBX 4AKPA 4KO9A 2IH9A 1SDDA 1ILUA 1ZIBA 1PZAA 5B1JA 4YL4A 7PCYA 1ADWA 2YAEA 2XWZA 2YQBA 4E9QA 2UXTA 4UANA 4JHUA 5I5MA 1J9QA 1FWXA 1KDJA 3PLYA 2TSBA 3NJNA 4W1TA 3FYEB 1ASOA 5I6MA 1WAEA 4GY4A 5I6LA 3S3DB 4AKOA 1ILSA 2R7EB 1NTDA 5B1BB 3NSDA 1IBZA 2N0MA 1KYAA 1KV7A 2PP9A 4X4KA 5F7AA 4E9RA 1W8EA 3S8FB 3OM3B 2EIKB 1PCSA 2GC4C 4Q89A 4DP0X 1PLCA 3JTBA 3ASOB 2I7OA 3AG2B 2A3TA 9PCYA 1RZPA 1M9WA 3FU7A 1CYWA 2BP8A 1QHQA 3NJJA 1L9RA 3CDZA 4JHVA 2ZOOA 5A7EA 1WS7A 4G7RB 2EINB 2PPEA 3FSVA 2JKWA 1PLBA 5I6NA 1KBWA 1OE2A 4DP7X 2AFNA 2VW7A 2VW6A 5PAZA 4YSCA 1JXDA 3S3CB 1GY2A 5I6KA 8PAZA 2QPDB 3OD3A 2AANA 2HXAA 1N68A 1ZIAA 2VMJA 1L9PA 1X9RA 3EH5B 4M3HA 4HHWA 2EIMB 3EH3B 3S3BB 4W9ZA 1UATA 3MBWB 1CC3A 2IDTA 1GS6X 7PAZA 1NIDA 4E9TA 1BAWA 4GP5B 1A8ZA 3WIAA 3NYKA 1N70A 1WS8A 2DWSA 3NJLA 1NPNA 2PPAA 2J55A 2HX9A 5D4HA 1CUOA 1EZLA 2X88A 4YSQA 3L45A 3NJHA 3V9EA 2GC7C 4DP2X 3FQYA 2RACA 1NWPA 3BVDB 2YARA 4G7SB 3PXLA 1FFTB 4EF3A 3NJIA 3TU6A 2HX7A 4KNUA 4A2HA 4BWTA 5TK4A 3QJQB 1A4AA 2HX8A 2WSDA 2HLEB 1EHKB 1TEFA 3QJUB 3WI9A 2GSMB 3MX0B 4YSDA 3FSAA 4K9JA 3SBPA 1NIEA 1RCYA 1GY1A 1IBYA 2H47C 1AZUA 3SBRA 2PCFA 4BXVA 1ID2A 1HAWA 4BK5C 3CVDA 1SNRA 1MG3C 4HIPA 1BQRA 1NWOA
chains in the Genus database with same CATH superfamily
5C7XL 3PWJA 3MCKA 4KVPA 5DI8A 1FO0B 3QCTH 3SODB 3WDHA 4HQQL 4MJIA 3B7TA 1QSFD 1TNNA 5FHBH 4JKPH 2PUQT 4S1RH 2Y36L 3F58L 2YLKA 1CR9L 5EH1A 5E99L 4JFED 3PL6D 4R8WH 3D2UD 2UX6A 2H9GA 4GT0A 3TV3H 5LBSH 1DSYA 3GSRA 1ZJBA 3LN4A 3NFNB 3VFSA 1KWGA 3BGMA 4NC1C 1OAYL 4U7MA 3E80A 4XNXL 2Q87A 2UZXB 1XIWB 2XQBL 3L9RA 2GY5A 3KYOB 1OGAD 4GBXC 4FABH 5IG7B 1GVIA 7TAAA 4YXHH 4HGKC 4EI5C 4KX8A 3KYNB 1WSST 5I0DA 3VTAA 5DS2A 3ZKSD 3O6ML 1U41A 2XPGB 1TJGL 1XGYH 6PAZA 4XMPH 5T3XL 1J18A 3OB8A 3N1GC 3R0MA 1ZANL 4NKMB 2Y25A 4ZO6A 5DLMH 5CSGA 4DO6A 3QUXC 4J8RA 4U1NB 3EYUH 3UGXA 5HYSB 1IBBA 4AIZA 2FWLB 4KQ0A 4IU3A 1RERA 1E28B 4Q14A 2FH8A 1Q9OB 3BYYA 2CQVA 1FUNA 4NKOA 4IBUA 3FN9A 3F04A 4IGBB 2CJ3A 2XTJB 4Z7UF 5HGBA 3J27A 3ZRSA 1IM9D 2WANA 4DZBB 3L17A 1MN4A 2ICWI 2W9DL 3T0XA 5DCCA 3RYMA 4XMXA 5F7FA 3MNWB 2WO4A 4E9VA 2YEZA 2F1AA 2YD7A 3SQOL 3T1WA 4N87A 5SWSE 2E6PA 3AWFA 5DMJB 2NSXA 5AFAA 1HEZB 1A4KA 1NMCC 3GXTA 2VKXA 4PWJA 3T65B 1QLRB 4G8GE 4DUXA 1NCWH 2R39A 2IXQB 1T2QH 2O6PA 5AKSA 2V5TA 2X0VA 4DP4X 1INDH 1KGJA 1CDIA 2YUZA 1BG1A 2OMUA 3MV8A 4FQQA 4LKCA 1PF3A 2FSDA 2YAQA 3B9KB 4P23D 2NXZC 2AITA 5KG9B 3QJZA 5AD0B 1CYXA 1HCFX 4M6MH 5HHOD 3MRKB 5JMRA 4G9FD 1HESA 5F1SA 3V9CA 4A7GF 4M8VA 2WNKA 4JFUA 4IK6A 3QWNA 5T3XH 1AE6L 1ZA6A 2P8LA 5DZPA 2A73B 1QZ1A 5D8JL 1XCQA 4JFDD 3QR1A 3RWEB 2EVFA 5F8RC 3PUCA 4HGWB 4WUUB 1HSBA 5EOQH 3C5SA 3RGVA 3HS0A 3C5JA 3ZZSA 3O3DB 3U7YH 1UB5B 5GRUL 1T66C 2VN5A 4Y1TA 3WG7B 2P3YA 1IAOA 3T71A 1QX1A 1YDPA 3FKUS 3LD8C 3OKNB 1KYFA 1L7IL 1YNKL 1DO6A 3QQ4A 2CO2A 5DJCA 3X13A 5JHLA 2IQAB 4CC1A 5L88L 2CJUH 3M1CA 2IDSA 3NCMA 2EDOA 4LSQL 1FFPB 3JWNH 5T33H 4HIXH 1HH9B 4LP4A 1OKEA 4NBXB 4X80H 4XX1G 4FG2A 1F00I 2BP8B 2CJUL 2YN5A 3K8MA 3QP3A 3VXRD 5I71B 5C09D 2OCJA 3DXAB 3VI3F 5DS8A 4WWPA 5DHYA 2ADGA 1H3WM 1YA5A 2Y5TB 5CO1A 1MH5A 3I6KB 4XNQB 3V0WL 3DHPA 3DX7A 5IBUG 1K2DA 2ZE0A 2R2BA 3FC8A 1V5JA 3PUUA 4NKDA 4I2XE 2Q8BH 3VDAA 3QJTB 4O51B 1QSED 2YR3A 3MJ8B 4Z7WF 3ABLB 3EGSB 1FZJB 3EJYC 3FCSA 3VNYA 2YBGA 2F53D 2PLTA 1LO3L 3FQUB 4JDZB 1VADB 3QDJE 2J71A 5C0JA 5FO7B 4OV5A 2DQJL 4WI3A 3CVHB 3P3UA 3EF4A 4FFZA 5I1HL 1CLOL 4MMZA 1P4LB 3W9EA 3PFUA 1BPLB 3WY4A 4WV1B 3IE9A 1QHOA 2QADB 3O81A 3QWRD 4N85A 3O2VL 5SX4I 3N9GH 3U4EA 5E1GA 1LWJA 4B27A 3S35L 4NUJB 3BUQA 4W9HC 3Q2VA 1BIIA 1UA6L 3KW8A 5IROA 5LCVH 2WKOA 5K9QI 1G7PA 3VFUB 1XIWC 5AUMA 3HE7C 2COVD 4ZXBB 3J7HA 1PBYA 5IVZB 1XF3A 1ZS2A 3P0YH 1KENL 1URZA 4X4MA 3TWYA 3X1NA 2H2SD 3AUVA 4PJAA 3EG9A 4FULA 2EDHA 2F53E 1USZA 2NLJB 2CGRH 1BXUA 4YXLH 3C6LA 3V4UH 1GIGL 3PWJB 4X9YA 5DI8B 1FLRL 3U1PA 5LUMA 3OPUA 4QKXB 4G7YL 5E1QA 5IBTH 1Z3GL 4JFSA 3EW3B 5FYKL 2KZBA 4PJEA 2F7IA 2VLKA 1I1YA 2Z6FA 4YE4L 4GJTB 2YPVL 1H9DA 1MJ8H 2N59A 4JVPA 5ICXA 3SZ6A 3NFNA 4DN4H 5TF1H 2K9FB 3CXDH 4JHAH 2CCWA 3C9NA 4AQZA 2XWBB 3DV4B 2CLZB 1FNSH 2WKLA 3QNYA 3LKQB 4P4RB 5D4JA 1RJLB 1E5CA 5E9DE 4ZK8A 1UWYA 1IAIH 1HH6B 3S35X 2XN0A 3WXWH 5HYIA 4U6YB 1F42A 4X4XA 1F6FB 3OR6B 4HXBH 2QQQA 3BCFA 4NWTL 1GGCL 1X7QB 3VRJA 3D39E 3U83A 1E4JA 4WEBH 3T08A 5E08H 2RB8A 1A7RH 2WXJA 3CFCL 4Y4HB 1UWXH 1IZKA 3TV3L 3VSTA 4I0PB 3WELA 4W9EC 5IESH 4YGAB 1NFDB 4GIPD 1Q8MA 2E9JA 1QTPA 3WBDA 1S7QB 4MD4A 2ZUTA 4CU6A 4EBQH 2VISA 2X4PA 1A66A 2VERA 4KX7A 3ZHLA 1YY8A 2E7CA 3BWUC 1IFRA 3GXFA 4N1EA 1QR4A 4YZWA 5LXGL 1E9PA 2O5XL 3O4OB 3RP1A 4GQZA 5A7BA 2W9LA 5J56B 3QEGL 2KDGA 1OCRB 1H5BC 4G9FE 4LRNL 3IDJA 2QQLH 1T80A 4KNQA 5FCUH 2FUTA 1I9IL 3NTCH 2ZWNA 1ZGLM 5SWZB 3FHQA 4CSSA 4TLKA 1YYML 1T20A 3HNVL 3UJJL 1SBSH 2YEZB 5CS7A 2WB7A 4L1LA 3BKJH 3CNKA 3ZXAC 2VR4A 2NTSP 3ALXA 3FTXA 3MRCA 3O2DL 4FNLH 4J7RA 4PS7A 3MOQA 5DD1L 1JMZA 4HJGA 3NRQA 2QKIC 4HUXB 2I9TA 1D5MA 3V0VB 1B9KA 4YDVB 1GGBL 4ODWA 3V6ZA 1OF2A 5TDNB 4LKCB 1OXYA 3MTRA 1BIHA 3PGCB 5DURD 3UMTA 1DJSA 1ZEAL 1IB5A 3O4LE 2JCWA 5CILH 4OW6A 5DQJB 4NWTH 4JAMA 3U1SL 2J6EA 3VFNA 3VXOB 2K6WA 1QRNE 4X6CE 5GHWL 1EBAA 3B3BA 1KYOJ 4NJAL 5LVEA 2ZCLL 2UY7A 2XWZA 4QO1B 1YEFH 1Z5HA 2HFEA 4Y16C 1G94A 3BI9X 3RWEA 4PSPA 3P9LB 2OK0L 2WMPA 2XG4B 2GTWA 4GUPB 4NQTA 3HS0B 2TSBA 4L8BA 3R0NA 1ADQA 3BPNB 4ODUB 2ZJSL 1IAOB 2DJSA 2YKLH 3LZNA 4ZUWB 3W39B 5D70L 4AQ1B 4HWEH 2NT1A 3HPJB 3BKML 3TS8A 1NLBL 3GMMA 4XCFL 1MAKA 3SPGA 2EDEA 4EE2A 1NCCL 3QQ4B 5C0BD 1F11A 3D3VD 3UTQB 5J5EA 5F7AA 4BZ1L 2FZ3A 4DESA 1A1OA 5FUOL 5TF0A 1F4WH 2Z7WA 3VA6A 5KVFL 2Z0BA 3FO9A 3SGKC 5GGVH 1SBSL 2VWEC 5F96H 4UQ2A 4KJQC 5JQ6H 1XCTA 4WY7L 2BP8A 2OW7A 4Y0GA 3SE9L 1HSAB 5F0MB 2DBJA 4FOMA 1MNUH 2ZOTA 5F6IB 5C0EA 4OIFA 5C0FA 2Y5TA 3C12A 4Y89A 1GW6A 2P46B 5F7MC 1XF4B 1QEWA 2R2BB 1RU9L 2C9RA 2VLJE 4ZD3L 3AT8A 2EABA 4Z7NE 3FCUB 1QR1B 2Y6SC 1MREH 2ENJA 4LPTA 3ARFB 4Q4IA 5GRZA 2BMKB 4JS7A 3TVMB 2AJSL 5SWSD 1TMCB 7PAZA 3PYCA 1F8TL 3ZDZF 4XWGL 3BAIA 3BLKA 4NNYB 2E7BA 5HHPB 4LCCA 1RH8A 3RIAK 2ADFL 5EU6D 2C3XA 1R5WA 2ZIDA 1E3FA 3KXFA 4OJDH 5F7NC 5CZXD 4D0DA 3D85A 4RMQA 1KCRL 5LO7A 1FGVH 3NJHA 4MMZB 2JELH 4N25A 4Y2OA 1LMKA 3IYLW 4JG5A 3BP5B 2V2WA 3QCTL 3P9WB 1LO0H 3U4EB 1DDHB 3C5ZD 5FGCE 5DFTA 5DR5L 4YOKA 2VCOA 3RY6A 1FFTB 3MKKA 1Z9SA 1RD6A 3JBG7 3PABB 4OZFA 3GRWA 4NM4L 4ZT1A 3LXCA 2ODIA 2ZCHH 3DOSB 3ARPA 1FCGA 4KKBD 4PCTA 2BOCA 4Y1AD 1FNEA 3GINA 4L4TB 4PCSA 5IJKC 3VM5A 2VDLH 3RVWD 4ZTOL 4YPGB 2WQUA 1OGAB 4LQFL 4NXSA 4WK2B 4W6WB 4PJHB 1RCYA 3N1FC 4JM2C 5IB3B 4L4VB 5KSAC 4BUHA 1AXTH 1EFXA 4AZ8A 2W0FB 4XMLL 3KJ4B 4Q52A 2ADYA 4MA3A 3BUYB 4FFYL 1CICD 2FX7H 1A1NB 1PSKL 2V6HA 3K0WA 1ANUA 1T6BX 3MJ7B 4ZYKA 3RTQC 3RVTC 5DQDL 5DJ6A 3EH1A 5GGRB 2VLKB 5KANG 1KTJA 3BSZL 3W5NA 3IJYA 4KVCH 4GKNA 3N40F 2CR3A 4NWUH 2JF1A 3P2TA 4ZUVB 5AVVB 1CURA 3H9SB 3RG1C 3V8CA 2EH7L 3QNYB 4IGBD 2IWKA 1E9QB 2Y72A 4YSEA 4LOUC 5EC1B 3V4VB 2NY6B 1KCLA 4ODHH 4HPOL 3F7PC 4YFEA 3UADA 4X5QA 1KFGA 3D30A 4TUOB 4ODVH 1KJ2B 1RURH 3FH8A 4FA8A 3SHSA 1J0IA 2ZPKL 3LVTA 4NKIL 3DYOA 4WNSA 2BVPB 1N5AA 2O6FA 4OZHF 4M9PA 5H2BA 1BQHB 4NO0D 1SEQL 1AOZA 1U6AL 3UO1L 4HGMA 4TTGA 2DQFA 1A14H 4JEGB 3P02A 3BP7A 4XXWC 3P0VL 2OJZH 1HCVA 4AV4A 2G2NA 2VSCA 2KH2B 1BQ5A 1OY3B 3BUDA 3L9EA 3MRDA 2XKUA 4LQFH 4XB7A 4GG6E 5IMOB 2BHZA 2WQSA 4QXVA 2P80A 4YDJB 4O4YL 2XWXA 3MYZA 4R96A 2R8SL 4G9FB 3E1F1 5EWIH 1PZBA 3IKKA 3S88L 4BDVB 4C4UA 3QJFA 4RWHA 5GS0C 2QDVA 4G8EB 3SIKA 3SBWC 1CTMA 4JFDB 4A37A 1V27A 2P4AB 2YAFA 2WAQA 1BJ1H 4FQHB 3BPNC 2WHVA 5IOPB 4GSXA 1XFPA 2OCFD 4KK5D 4N0FA 4OT1L 1BLIA 3LQAH 1DDTA 5B8CC 3RFZB 1P6AB 4PWKA 4NHCL 1EJ6A 2OBGA 3D08A 4QJ4B 2R29H 4GQRA 5D7HA 3BVXA 4ODWB 2M2DA 1A6ZA 1G4RA 4PLOB 3V6ZB 3KWWB 3DTUB 3K2UH 3MCLH 1OCCB 3WKQA 2W60B 4UQ3B 1PZSA 2D31B 3FTWA 3U2JA 1G9MH 3A21A 2H6PB 4X6CB 4UQEA 5A2KH 1C8PA 1K85A 2YUVA 1L6XA 4JDTL 4QXGL 3P77B 1E50A 2B9BA 2VXVL 3GPSA 3O2DH 1D7DA 4FNLL 4H88L 4QO1A 4YUEL 5IQ9A 2A1WH 4B0MM 4FLRA 2QVKA 1D5IL 2Z8VC 3SGDI 3VW3H 1IIKA 1A7BA 3IGUA 4WJ5B 3NEEA 2Q0ZX 3LRSB 3SYCA 2B59B 5J6GA 3QAQA 3IFOA 3ULAB 5H94B 2H26B 4R8WL 3DJSA 3BESR 3WEXB 5TGBA 3GMMB 5GZNA 3HE7D 1MJ7H 3KW7A 4K4KA 4F80A 3DIFB 3IJEA 1AIFB 3SQOH 2QSVA 4LPXA 1AFVL 3UAJA 2R56L 3CFQA 4CSZA 4Q8BA 4U1MB 4X9IA 2ARJB 3QRBA 2PW2B 5H37G 4AYFA 2XY2A 4H13C 5D7SH 1SHMA 2CHZA 4NNXA 5IB5A 4KI5D 1E9OA 1JGVL 3C8HA 4H8WL 4LSDA 4G7QB 3UDWC 4M8RA 5JNYA 4LNVA 4YBHA 2YSTA 3LOWA 3WLWD 5CLZA 5D93C 1UVQB 2CLRA 2IH3B 5BV7C 4GQ9H 1DJIA 4QY8B 2DBLH 1YN6A 1JPSL 4ZDHA 3PIQB 2F54E 4OFYA 3GZPA 3MBED 1X6NA 4L8DB 2BIPA 4PW9A 5BUAA 1X4YA 2Y7QA 5C09A 3DO3A 1DVQA 1A9BB 3ARFA 4PJGE 3PWLB 3Q13A 1VGEL 4JFZL 1WFMA 2AMUA 3OZ9H 4G7VH 2MHAA 4LCWB 4I4WA 3WMSA 2FWOA 3VFRA 1AQDA 5E2JA 2X44D 1H3GA 4LCCB 1FVDB 2XRAL 2IBZY 1GGIL 2F08A 2PXYA 2X4UB 4K8RC 1Z9PA 4UDTB 4NSKA 4AENA 3UL4A 2SEBA 3OAYK 4JFTA 2EO7A 1O6TA 3D85B 3O6MH 4Q7DA 4R97C 4QHLA 2HJLA 2BW5A 5E9DB 2PMZA 4M7JH 4Y2OB 4TNVK 3GKWH 4WFFD 1OSZB 2VDML 4NN7B 5C8JB 4LKXA 2ITCB 2OMYB 4M43H 1P7QA 2YD5A 3D18B 1N64L 2R23A 3I3EA 3ROOA 1O7VA 1N7ML 3LS5H 1CR9H 4J3OH 2WWOA 4OF8A 4OZFB 3ZQWA 5LN8A 3DXAE 5HVFB 1Y0LA 2WC7A 3TYFB 5DZ9A 4OFPA 5CUSH 4YPGA 2MNWA 3L16A 4EDWH 5B4MC 4ZPVA 5IBLD 4G5ZL 4JPVL 5EG6C 1ZJAA 1UUSA 5IJBC 4Y4HC 2W0FA 3CHSA 4LF3B 4UINL 3SDAC 2D0HA 5JIQA 4HJ1A 4JGNA 4MA3B 4U6TA 3UTZB 5M95B 2IDUA 2F0CA 1IE5A 2OR9L 1PGRB 3OKMB 4JPKH 4Z78A 5IP4A 1RAMA 3DLQR 5IFAH 3DWTA 5DJ6B 4MCYA 5FYJU 1QHPA 4BSVA 4I0PD 2NY0C 4BK4A 2GUYA 1TZGH 2PWHA 4GKNB 4BKTC 1NIAA 3EOBA 3RNKB 2DLFH 3TURA 4DVBB 5F1IB 3UPRA 2FJGA 1OLLA 1NCAH 3AQZA 4IGBC 3GMPB 4N2EA 1OD7A 4UMGA 1VFBA 1E9QA 1KUMA 1MIMH 4MDIA 4NKIH 3WV0A 5C0AA 1NMAL 4B9FA 1BMWA 3PWNA 1W72L 4WSKA 4NKQB 2MRYA 2BSSB 3JVFC 4FTDA 4OLVL 4PGBA 3UPAA 4MXVE 4PWHA 3QYCA 1GPOL 3I85A 1KJ3H 3SDXF 1K72A 2ATPB 2FLBT 2BVPA 2FO1A 4GINA 3VQ2C 1CXHA 2ESVE 4AM0B 4PM1A 5CJOH 5GJSH 4BQ8A 2Z31C 2VC2B 2XBZA 3L5HA 1LXMA 2EAEA 3NUKA 3IMRA 1UEYA 3UO8B 1SVZA 2YRLA 5I1GL 1FJ1A 5JIMA 4P59H 4PEEA 3HG3A 4YN3A 4R96B 3MREB 1CLYH 4WCYL 3RTLA 5DMKB 5ISZD 4XMLH 1NIBA 2ITDA 4NI6A 4MTMA 1JZJA 4TXVB 2WXOA 4MASA 4CSPA 2J8UB 4BFBD 4ZFZA 1JFQL 5H37H 2OI9C 4F9LC 4F8QA 1IM9B 5I19L 5D8JH 4KDTA 4GOSA 1VIWA 2GCYB 3AU1A 2Q10A 3T0EC 3OLDA 5DWUH 2XPZA 2GSGB 4P9ML 1FVEB 2VLRD 2R9HC 3TL5A 5JPNA 5F6HI 5I1IH 2ZJSH 4HJTA 3IKCA 1CIDA 4I5BA 1A6ZB 1JXJA 4PGCA 4TVPH 4P57A 4WU5B 4UT7L 3I2CL 5KVEL 1WIPA 2B77A 4G7VL 1PEWA 5EB9A 1OP5K 2E7HA 3GEFA 2DI9A 1QQDB 2BOBB 5DHEA 2OXHB 3EJJX 3S36H 2CPCA 5BOZG 4HEPA 2LT9A 5H35B 3IJ7A 2V2TB 3VWJC 2AJSH 2ARJQ 1DVUA 4H8WH 3FCBA 1ZCRA 4CBPA 5HHNB 5I6MA 3FYEB 1WAEA 3LRSA 1GKEA 1BBDL 2B59A 3SGJA 1FFNA 2MTPA 1PG7H 2XVKA 3S98A 1WAPA 4LLMA 1NA8A 1JYXA 1FO0H 3L2MA 5INDA 2CKBA 2UWEA 5C97A 3APNA 3M17A 4PRPD 5D1XA 2EIDA 2X41A 3KZ8A 4YH6A 1WZKA 5HI3C 4X9GA 1X5KA 5CR8A 2VDPB 3FUHA 3OMZA 4HUWA 2ARJA 3W57A 4YLQT 1RV6X 5ADPL 4KDWA 1NM4A 4POYA 1A6VL 3L5JA 4EIUA 2H7WA 1B4JL 1RZPA 3A67H 3EGXB 4JFWA 4NRXB 3RWHB 4A39A 1AMXA 3WLWC 4N2DA 5ANMB 1IGFL 1MI5B 2AK4A 4PR5A 4UQCA 3MI6A 1AP2A 3ZO0A 3CBRA 2R0LL 1UWEL 3HG1E 3MV7A 5DSCB 1BZQK 5DZJA 3WL9A 2NW3B 1KBWA 1KNOA 5LLIC 3CU7A 5AL0A 2EDNA 3QIUA 5SWQA 2BNQE 3C5ZB 1NKGA 4EBQL 4RWYL 5J4MA 3EYSL 2EDFA 2FYYA 2ICEC 1ZIAA 1N2RA 3MCLL 2VN6A 1U4FA 3RLSA 4XH2B 5LXVA 5IROD 4N2NA 3G9AB 4NZTL 3BAXA 1YG9A 3BUIA 5IWLC 1T0NA 2W95A 5DF0A 4V33A 3TBTB 2FWOB 4ZMOA 1TFPA 4WDIA 1VZGA 1AQDB 3LN9A 1ONQA 2DWSA 2E3VA 3U9PL 1GA2A 2HPOA 4GSQA 1RY7B 1QSEB 4L4VD 4PW3A 1QUNB 4NSKB 4AENB 4FXTA 3VD3A 5EO0A 4XO9A 1L6PA 5CCKH 1CICB 3VMPA 1WF5A 4B9PA 1M3IA 1FHGA 4FQJL 3E6FA 2ITCA 1DSFH 3OAZK 4O9HH 5DHVA 5C7ZA 4XNAA 2AXGA 3ZGIA 4HEME 4KV5F 3T3ME 3TU6A 1EFQA 3FB8A 5I9QC 4JFOA 2XIDA 2V9TA 3RIFK 3V7AG 3U36A 2WSDA 1GSMA 4DK3A 1UM6L 3H9SD 2G9KA 1S7XA 1Z0NA 4FFYA 3ARBB 1RJYB 3MX0B 4P48A 4FQXC 4ODSH 4K9JA 5KN5A 4ZPVB 2NNCA 4MJID 2F1BA 1U6AH 3LH9A 1GY1A 43CAB 1JYWA 3GK8H 5I1KL 2YXFA 5H8DA 1SNRA 4TKWA 5I1LB 1GXEA 2E9GA 3QUZC 5DO2C 3GGWA 1HVXA 2VABA 2CBPA 3VFWA 2MOVA 3LS4L 1MVYA 1XR9A 4NO0B 4BSVB 2GJZB 3PU7A 4YNYB 3BQVA 1DQDL 3C2AL 2AABL 4G6JH 5E6ZA 3STZA 4WO4C 3EOBB 1M05B 4KPHL 1BZ9B 4PS3A 5I66B 5JOEA 2CDFB 1E65A 5EBLA 1BYNA 3GMPA 1R3KB 4IW4C 2QR0B 4N2MA 1G1YA 3CFJB 5C0AB 4JHZA 4ENED 4LPWA 4UQBA 3ARYA 1ASPA 1XSJA 4GAJH 5IMKB 1II4E 4BH7B 4PGBB 1F5WA 3LZPA 3G5ZB 5DEGA 1NCHA 2ATPA 2YC1A 2OTUA 3FUKA 3ESOA 1FPTH 4DGYL 1A22B 2BWIA 4QAWA 3WN6A 3QJRB 5KVGE 5AQ0A 5AW4B 3V6OE 1N59B 4D0BA 1P4BL 5MP6H 1Z1WA 2Y2YA 1FZKB 3P4NA 4JFYB 1Q9WA 5CXPA 1IBHA 5D9SA 3X3FH 3WSQL 4KV5E 3T3MF 1PD0A 2IQ9H 2ICWJ 2H1PL 3LQMA 3EDKA 2JSFA 2G0LA 4MVBD 5D7JD 5CGMA 2JB6B 4DN3L 3P11L 5L7XH 3PXJA 4MWFA 5GGUA 4UOZA 3V0IA 1BPVA 1KN2L 1CCZA 1TJXA 3QJSB 3QNFA 5ITFB 3VXUB 5G4OA 4AYEC 5A6IA 3QPKA 3WEOA 4RX4D 3HEIB 1HXKA 4HZAA 4QTIL 3F62A 1TG8A 1WFIA 1A7NL 3CSGA 3QZLA 5I0WA 3U25A 3TBSB 2VN4A 2X5PA 1PEZA 5E6IB 3WE6A 4GKSA 4H8VA 1H3PH 3MRBB 3LPPA 1BF2A 1OL0A 4J3OC 2ZYSA 4KY1H 5FYKD 4K23H 4H8WC 5TE7H 4M43L 3L5XH 3M1BA 2ZAGA 4OQTL 5JA8B 2HJKB 1J7VR 4XPBH 1HILA 4MS8C 1S7SB 2YRZA 2DJMA 5FKAB 2XQYK 2Q6WA 4L9LC 4P57B 1OAXL 4WU5A 5GS2D 2GITB 1DBAH 4XBGB 1OAZL 3QEHB 4KK8D 4MAYD 4Q97A 1UWGH 3UBFA 3EJCA 1YQ2A 2OZ4A 2WCPA 2X70B 3V4PB 3FO2A 4FNPA 2OXHA 2GABA 4WFHE 1ZDSA 1SDDB 4PGJA 2XTJC 2KL6A 3TIDA 2ZF9A 4OM1H 4N3UA 3IBEA 3KJ6H 4RGMC 4M6ML 3DOIA 4QXTA 5EN2B 1E6JH 3PE9A 4APQD 3ULUH 1F3DH 4KX9A 5SX4H 4UTAA 3KVPA 4UV7L 5C2UB 4B7IA 5CEYB 2DQGL 5HHNA 3ZE1F 3I84A 3KPSA 1MWAA 3RDJA 5T5FH 1C1EL 3MNZA 4OM0H 1SFHA 2BSEA 2BSTA 4J3XA 4YSTA 3V5HA 4G8GA 2FYVA 4ES8A 4UV4L 3PAVA 2A6IB 3A22A 3E6HA 4DP8X 2Z4QA 2Q86A 1IGIH 1MPAL 1UCBH 1EIBA 1S7VA 3TBBA 3HR5A 4FYSA 1S5HA 3LJ3A 1OGAE 2NXZB 1KGCD 1GZHC 3D0VA 3I6SA 4N0UA 1A7PL 3S37H 2IO5A 4KO6A 1W0YT 3MBEC 5ANMA 3FOMA 2G9HA 1S7UB 3OGCA 5AEAA 5B3JE 5L4FA 1I7TA 3FS9A 2AV7A 4KQ3H 1AIZA 2VDNL 1PAZA 3T77A 2L4OA 3WD5L 1U9KA 1I8UA 3TN0C 4P5TC 3TO4C 3X1GA 4HH9B 5FUZL 1OW0A 1SY6A 3C5ZA 5B7FA 2HT4C 1CBVH 4PYHA 2DQEL 2PYED 3KLLA 3OAYH 1TO4A 3FU8A 4ZMTA 4NUGH 3H3KA 2HG0A 4R83A 4H26A 1NMBH 1G9HA 5EZLB 5DK0B 1IV8A 2CHDA 4AJYV 2FX9H 5CJXA 5IVXA 5E2UH 2ZKXA 4KH2A 5B3JF 1AXIB 3BQUC 4JZNB 4U6VL 2X1QA 2JI1A 2XV6B 3ARFD 4FABL 3HCVB 3RHWF 1OB1A 1WAAF 4HOXA 3VD4A 3OKYA 3GMRA 4PJ5B 2OFQA 5DJXB 2AQ2A 3FQXB 2AJ3A 4XE5B 3ZDXB 4PRDA 1OTSC 4RFNC 4QRTA 1BVLA 4ESKA 2VN7A 1J9RA 2QHRL 1JF1A 3C60D 2GTZB 4BFIB 1OB0A 2CK0H 5CIPA 3L3OA 4Y5YB 1HJBC 1RHHA 2IAMA 5I0VA 3MGOA 5A3IC 1JVOA 1MPAH 3CX5J 4P2QB 2E6QA 3B5HA 5F72S 3QWQB 3C6LD 1W16A 4N68A 5ICZB 5E8EA 1PNDA 3L1EA 1IGYA 4RCAA 4NFDA 2DQHL 2PW1A 4BZYA 2MCMA 1YUKB 2Q3AA 1SHXA 4LCUB 3OLIA 3BDXA 4XP1H 3PWVB 4XBEH 4R2GB 3HI6L 2NDFA 2R8SH 1JXGA 2O5ZL 4L9DA 5ID0A 1G7LA 1B0IA 4CC4A 2CCVA 2E9BA 1TQUA 5I1LA 1UOWA 4OCNC 1BX2A 2Z31B 3K0YA 3OHMB 1J8HD 3RHWK 4OLZH 1R5VA 4OD2A 1URLA 1M6OA 2ENQA 2VGLM 3JTSB 3RWGB 4E5XA 1PIGA 4P4KA 5DRZB 1XWVA 2GJZA 2OULB 4YNYA 1DEEB 4GW4A 1RL1A 1QYGL 2CMRL 4GRWF 4EIZC 3TFKD 3QH3A 3MLTB 2O61B 4TTDD 5D7KD 5L9DH 1JNLL 3EF7A 3NCYP 4PJBA 5E2UL 1XBRA 4K9EL 4UOQA 1U95A 3WXVL 1JYNA 3DGDA 2HFFB 3STBA 5C07A 3ARVA 1LK3L 1I8LC 2AQ1A 1C7TA 1LO4L 3AW5A 4RAUA 4XPTL 5ISZB 4XNZB 1Q9LB 1UM4L 1LP9B 1CFQB 3O4LB 1GZQB 2YD2A 5FWQA 1SMOA 5EZIL 5KYNA 4UMSA 4KKRA 1ADQL 1XH0A 3TYGH 2EEFA 2FX8L 3AS2A 1FRGL 5BCAA 5T3ZH 2YC1B 3ZR6A 1RLWA 2HRLA 5D2LA 2AKRA 3PS6A 1J86A 4YSSA 2VM3A 2E7LC 2JJVA 1RXLA 5C0DA 2VL5B 5FO9A 1EEZA 1I7RB 3VG0L 3R1GL 4R4BB 4CVZB 1QLEH 5KOMC 3BO8A 5EIIA 1JYVA 5D1ZC 2WBWB 5JW5B 3T6ZA 4UAHA 3T4YA 2D2OA 3DYMA 1I8AA 1N67A 2FQGA 1SUHA 3DC0A 1TKWA 2DQTH 4UV4H 5HYJE 4HDIB 4JVUA 4JQVC 3MO1B 4PU2A 1F58H 4X6DE 4ISVA 3IN2A 4DP6X 4BFEA 1XX9C 2OCCB 1M7UA 4Z7VA 1HTYA 1RK1B 4PJXF 2CBMA 3FCTA 7FABL 3WE6B 4NT6A 3WIHL 2O30A 4G1EA 2LV4A 3DJZA 2OA9A 3K4DA 5KSBA 1HAUA 4ZOAA 5I71C 5DK3A 5T1MA 1AYRA 3LNDA 4N2GA 3ML8A 3DUUB 3E8UL 3O9WB 1R3LA 3VFPB 1S7SA 1Q0YH 4XN9A 3S8GB 5IY5B 1PQZB 1PZ5B 4TOYL 1YEDB 1WQVT 2WCGA 5F1KC 5LGHL 5CP3A 2AQ3A 4OTXL 5DXWA 4XWGH 3K6NA 4Z77B 5I75B 4NZDA 2D8KA 4QTHA 3TH2T 4UZGA 1YEJH 3LQAC 4BFNA 2Q7AA 3MOBL 1JHLL 5DA4A 4AJVA 1TTFA 3NJNA 4PVNA 1T83C 4NDMB 5C08A 3F8UB 2Z91B 3QEUA 4AVKA 4UQIM 4BQCA 5EZJB 5FF6B 2O1AA 4Y4KD 1SOSA 3MNZB 4UNTA 2VMCA 2IANE 1NCGA 4U3CA 5JXED 4F91B 2ZCKH 5AAWA 3KLSA 3P54A 1WIOA 1EMTL 1KV7A 1VERA 3NN8B 3QEQB 2Z4QB 3BZEB 4WY7H 4E9RA 1PG7X 1WFTA 2LE9A 4BK8A 3QWOB 4LVOB 1N6QH 2ZXBA 4O2FA 3US9A 4XP5H 3WTUA 1PLCA 2VDLB 1Q0XL 1BFVL 2JJWA 3HUJF 1C16B 3O6KH 4ZMYA 3L6FB 1IC5H 3D0VB 2VRAA 4YC2B 4FZ8H 1A64A 4P06A 4BCYA 1RK0A 4PJXE 3LY6A 2EO9A 3WTVA 3QZWA 3HZ3A 2EINB 3LXBA 5DD5L 3VXRE 2VW6A 2AFNA 1OGSA 4QNPF 3U46A 1DLHB 5BZWA 1P7QD 2YJLA 3ARBC 3BIAX 5HYEA 1YQVH 3WHE1 1ZTXH 3G7TA 4M61B 4LB8A 2OQJA 4NN6B 2VMJA 5I6XB 4PBWD 3RL2B 1OAZH 1Z5LA 2BNUB 2EIZB 2Z92B 4H26B 4D9QD 5GGVY 3REVB 4N9OB 4R5TA 3SQBA 5IUSA 3CZEA 4AITA 2WN2A 5AVRB 3A3YB 5F3BA 1KJMA 5F3HB 4KITB 3NAAL 3QGVA 3SDCC 2FR4A 4XCYA 2H6UA 5AYTA 1V7MH 2Y6TE 3VWKA 3SKNB 4CKVX 4AW7A 2Y07H 3FT2A 4PJ5A 4LCWD 4MD0A 2DWYA 3E3QC 2XICA 1EA9C 5FOJA 1AO7A 5DD3H 1OP3K 2ICWA 4RGNC 3S48A 5IV2B 1M7DA 2AAVA 3H0TA 1N10A 1E4WH 1F3DJ 4FLSA 5EFIA 5J1AA 3HC0A 3WTTA 1LDPL 3AMKA 3K2MC 3KYMA 3SYOA 2V2XA 5EC2B 2RD0A 3K71A 4D9RE 3QJQB 2Y5QA 1G4MA 1JPGB 1LE9B 1EHKB 2NXYC 2CUHA 4AQEB 2HTKD 5LWYH 2KLRA 4JO2L 1DBKL 1SJXA 3QIBA 4JMXA 3SBPA 5AB2A 3S4SG 4G6AC 1QSVA 1VA9A 3POHA 4YEFA 2BIHA 2XXCB 3IT8D 1OPGH 3EJPA 4HIIA 1LO4H 2MCPH 4M7ZB 3O4OC 2VSKB 2AJUL 2DY2A 2A6KB 1OANA 3U82B 3ZK0A 5D6CA 3DI3B 1R5VB 3LKSB 5ACMA 1NANH 1HL5A 1WLHA 2EE3A 4B9ZA 1W0WB 2WXRA 4PJ6A 4TTDC 2EILB 2O61A 1NGQL 5I15H 3FOLA 1OOAA 1MG2C 3OKLB 5D7JB 4DKTA 1UJ3A 1I75A 3MA7B 4TVPL 3ZY7A 1ZA3A 3IJSB 3HG5A 1F86A 1VENA 1NGQH 3H7LA 1IC7L 1OZUA 3D39A 3VCLB 1LP9A 8FABA 3SYPA 1PU0A 1S3KL 1AKJB 4GH7B 4ELKA 1BZDA 1J88A 1KB9K 4HUMB 4LIQH 3CFDA 3RFZC 2AQNA 2BVQB 4YE4H 3FYIB 3HB3C 5CSBA 3WE1A 5E6ID 4Y4FB 1YEIH 1TCMA 1XL4A 4PD4K 1YEEL 5JQIB 4WAFA 3C6LC 5AKVA 3NH7H 2CIIA 1AD9A 1YEKH 5F97E 3W81A 5IHZB 5E70A 2D7TH 4GG8B 2CGRL 3GM0A 4HC1L 1NUFA 3MPCA 1SJMA 2R27A 3T04D 3T4YB 1A6UL 5AZ2L 4MXQC 3ZE1B 3WCYA 3OXRA 1TKWB 1AR2A 4TNGA 4TNVF 3HZKA 5AYQA 5I1JL 3FRPA 1TZ8A 3FH5A 3FFDA 3Q0HA 4EN3D 4KRPB 1NL0L 4WVRA 1DJWA 4H0HB 1ZLVH 4A6YH 4D7PA 1KCSL 4U6VH 4X5WB 4YBLC 3FU0A 3L7EA 1WUZA 4XXCA 3DVGB 2XX0A 4Z7VB 2YMOA 4AQ8A 5E9AA 1CJYA 1QSFE 5F70A 1OARH 1KF9B 2FT8A 4NCC1 2NX5A 1JGLH 1EAOA 4MS8D 4JY4B 1NGZA 1G7HB 3CAFA 5DJ2B 3SDYL 1P1VA 4KUCF 4EI5D 2YAOA 1JGEB 3N9GL 3O3EB 4FQ1H 4XNMA 5T1MB 5KTEL 1SYVA 3DUUA 5FV2A 4A2DA 1JNHA 1YQVL 1MFDH 3STLB 2EH7H 2JWYA 2UZYB 1FHNA 1YNTF 2J20A 4DGWC 2DTMH 5K9JL 3NRPA 2W07A 1LK2A 3K72B 5FEBA 4NZFA 1Z0MA 2LU5A 2ZOKB 2QQNL 4GG6A 3IPFA 5DZOA 4X6FB 5E94A 4R3SB 5DO8A 4ODXB 1SUJA 1F18A 3DPDA 4XP6L 5DRNB 4TQIA 5I23A 3FQ2A 5A2LH 4OIAA 3PWPB 4HCRA 1HHJA 2D7OA 1GR7A 5J9PA 1MAML 2NRDA 4L29B 4GXFA 1IC5L 1N0XL 4MKMA 4DHLA 4AYDC 1RULL 4N2CA 4Y9GA 4NEHB 2EDTA 4AOFA 5LDSA 4LGPB 2ZOUA 1E90A 4GPVA 5EZJA 5FF6A 4PBDA 3GXIA 5AZEL 2QKIB 4LARL 3RPIA 1JZ2A 2VDNB 2FDBP 4JCMA 3U7WL 2VXSH 4AG4H 1Q0XH 3O3AB 4E41E 2QFRA 3US0A 1J8RA 2O72A 5KVGL 2D4DA 4IKKA 3AXLA 3IM1A 3VFTB 1KGWA 5HHOB 4Z7UE 1CF8H 5CINL 1L5GA 1DCLA 3DKHA 1NICA 4YO0A 5JXAH 3IGAB 2AK4E 4LHUG 1YMHB 1C16A 3MODH 3NCXA 5BVJB 3K2KA 2E76C 3LZLA 2CZNA 2K8QA 4Q2ZB 3VH8A 1WRFA 2R69A 4OLXL 1DBAL 3ZDZB 2BK8A 1ZV9A 3KPPB 4P2OC 4U3SA 1T5XB 3HS0C 3QNZA 4F2FA 3MUHL 4Y19D 1HHGA 3U46B 2IEPA 1GYVA 4O02H 1XZWA 2YHGA 2GBVA 1FGNH 1RKRA 1MI5D 4OIIH 1KPVA 4ZUUA 3RBSA 2I26N 4ZFFB 2WIMA 1HCZA 3RL2A 4A04A 1J5IA 1JDAA 4NN5B 2A9NL 4P2QD 4ONFL 2NXYB 2K6ZA 4MXVF 1YZZA 1NOAA 1Y1UA 2XZAL 3GSVA 3V4PL 1KJMB 5F3HA 5F89A 3GBEA 5JHLH 1T21B 2PP7A 5AENA 3HMXH 1P9MA 2YGQA 1DQQA 4K94L 4PB0H 5I0ZA 3SKNA 4X7SH 1LEGA 4PHZA 3DV6B 3O0RL 3QUZB 3M7OA 3KCWA 1FSKC 1UD2A 2R83A 4N8CH 1VFOA 2Q20A 3OMAB 4N3TA 1U8KA 2Z31D 4U1KA 3V0GA 1J8HB 2X4SA 1AO7B 2CRMA 2MNJB 5J13B 2B1AL 4CMMA 1NCWL 2X2UA 4HETA 5HPOA 4NAQA 3CH1B 2E8ZA 2Q76A 1DUYB 1HHHA 4Z7QB 4PS4L 4F33A 3K71B 2XZQH 4GRMB 1NCBH 2APVA 4AMKL 5HDWA 3L3HB 2NUPB 4O2CA 5I0XA 3HC2A 5FKPA 1T7VA 4EZLA 2NCMA 4JJOA 4MD5B 4X8GA 3ZN6A 2WWKT 3LS5L 3MRNB 1OGTB 4YSAA 4JO3L 4YHYB 1WPCA 1ACYL 2X1WL 1NKRA 5L6YH 1QLEL 3FQRA 1HOCA 5IF0B 5IHUL 1UM4H 2K7QA 3BN3B 2F7PA 4YHZL 4HUUA 5G2NA 5EZIH 1BAGA 3BGFB 2XV3A 4MJIB 3ZE0B 4ZOBA 1PZUB 3GSXB 1G7MB 3QO0A 2Y7NA 3HZYA 3ORJA 5GRXG 3FMGL 2GEQA 4OUUA 4K5PA 3GSQA 1WBXB 3I3DA 4G43A 1W0WA 3NJMA 4JUTA 5IFHL 3E1ZA 1YEHH 5IHHA 5D1QA 5MENA 1GL4B 4MJ4A 5FYKU 4MYPA 3BGMB 3D87B 4XXDA 5EZOL 1N5YH 3QFJE 4HIJA 5F6HJ 2XA8L 3VXTA 2EDYA 3VSUA 1UJ3B 4KRLB 1OOWA 3BW9B 2NQCA 5IG7A 3EO0B 1EEQA 5AG9A 3W37A 1W72A 5A6MA 1BW8A 5CBEB 1YNTA 1U3HD 2PKDA 3EYVB 2XPGA 3VXMD 1AKJA 3AY4A 5LCVA 4I3SL 1X4XA 1HC1A 4NKMA 4GAYB 1SN5A 1HXMA 5EIIG 2N01B 1YYMH 4ZMVA 5LGJB 3HZVA 4KROC 2OJ1A 5DD6B 4NQVA 2BSBA 4E0RB 5I74B 3ELAT 4IKIA 2IG2L 2PWGA 2JH2A 1YC7A 4K7FB 5DHXB 5EWIL 1KLFB 1HHKA 4NZUL 3VFMA 2G4GA 1QEXA 5BUPA 1OGPA 3ESUF 2WQRA 4K7PX 5GS1C 1BZEA 4EXKA 3HAEH 5HGBB 1MJ7L 3HZKB 4WI7A 5L88H 1NPJA 4MQXC 2K3HA 1ZVYA 5FB8A 3L5IA 4MFHA 2AQTA 5D71L 1RHFA 4WHTA 3FQ4A 5FYJH 3CFCH 3UBXB 4WTZA 1MFCH 4NHUB 5B21A 4Y9BA 1DQLH 1CLZL 2WJ7A 1WD9A 3NT0A 1S9XA 4UYQA 4NQDD 4G42B 4PJIA 4EOWL 4JY4A 3BRFA 4RVBA 1JV5B 1QFWH 3LEVL 1ZLUK 1TTGA 3VXUD 5MENE 1G7HA 1UXLA 5DJ2A 3T65A 4J4PD 5ICUA 5AW1B 2IJ0C 3ECVA 3EHBC 1JGEA 2XA8H 3O3EA 3O6FC 4PTUB 1UH4A 4LLWB 4OCRL 4XI5D 1IRAY 2PWDA 5TDPA 2ZKMX 1FL5B 3NIFB 1XGTA 1PYWB 2V8MA 4L37A 2PO6B 4WSJA 1SM3L 2J5LB 1JVLA 3B9KA 4CMHC 1GGYA 3MLPA 3QEQD 5I6OA 2AEQH 3WD5H 4M02A 4YHOL 1D6VL 2ICEA 3DTXB 3R4DA 4Q0XH 1N9PA 3WTSA 4R3SA 3QPXH 4WTXA 4CJ0A 3FO0H 1ZA6B 4KO9A 3T2LA 4I7ZC 1U93A 1Z7JA 4K7PL 1UYWH 3MUY1 1BD2E 1V3JA 4L29A 4PY8J 1IBGH 1UKSA 5D1XD 2FRGP 2MPAH 5D7LE 3HG1B 2VLMD 5IQLA 4H1LH 3C5JB 4PJGF 4MA7H 3A4FA 3BE1L 1ASOA 3BWAB 4DT2A 5I6LA 1A8JH 4ZNEA 3R7RA 4BFJA 1NC4D 2QKIA 5B8CB 1ILSA 4KVNL 2IH1A 3OG6B 4Q56A 4E42B 3AQDA 5ETUA 1U21A 4G8AC 5E1AA 4KZEH 2ZXDA 4JFXB 1LHZA 5DURB 4L2LA 1UA6H 5I1DB 3TEXA 5KSVB 5DEZA 3Q44A 5KBMA 5I5RA 1XR8B 2QV4A 3MV7D 1XGRA 4EN2A 2H45A 1HXYB 4ZSOA 5I1AA 4V1DE 4PP2B 4RGNB 4GQPH 5BVJA 4Z3IA 5JHLL 1QFHA 3HI5H 4NGHH 1X9LA 2J21A 3G6JE 1QWUA 5L2JB 5ELIA 3HMXL 5E2WL 2CO6A 2F9BT 3UCQA 4JQXC 2DPKA 1ITCA 2BNRA 4UZUA 3TT1H 2EVJA 2ILLA 4HSCX 3GB7B 4ZX3A 1YVLA 2FWUA 4A7TA 4P9MH 3FU6A 2IOOA 4JRYA 4LCIL 3PV7A 4XGZA 5BV7L 3FZUC 4XPBL 4FGMA 3LKNB 1A7QL 3GIZH 3MJ8A 5MEPA 4YDKL 3GQFA 3EGSA 4HG4K 1CO1A 1NJ9A 2ESVA 1E7VA 4P46B 4WGWB 1E6OH 4FDWA 5AVQB 1BAWA 3O6KL 4GQQA 3QDMB 1PW3A 1X5XA 4WO4A 3G6DH 3UTPE 3NYKA 2OZ4L 5MHSE 1G9NC 4RMBA 2H32B 5C08E 2K0RA 2ICES 3LRMA 3TBWB 4EUPB 3JQOB 4GT7A 4NOFA 3W0WD 5L2KB 3TT3H 1U8KB 4U1KB 1P4LA 2Q8AH 3VU2A 2WZ0A 3KMDA 2APWA 1ZVSB 2RQEA 3H6AA 1HQRA 4JG0L 4UI2A 4HHAA 4PJ5D 5K59F 2Q76B 3QDGE 4NUJA 1TQSA 1CBJA 4XPFL 3WSQH 4AC2A 4IRSA 1A4AA 4GRMA 1G7PB 5GSVA 4P3DA 2H1PH 1KTCA 1SOKA 3O2WH 5EPMB 5BO1L 3WI9A 3SYAA 1K5NB 5FKPB 4DN3H 2J43A 5C07E 4I9WD 2OSYA 1JK9B 1IZJA 4LK4A 3B1TA 3T3PF 4HS3B 5HJ3A 1A14L 4XMUA 3CVDA 3EBGA 4GRLC 4LIQE 3AG1B 3C6LB 2OTWB 4I85A 4Y5VC 4Z5RA 2D7QA 3L3DB 2ZPKH 5IJDC 3DOHA 3EJRA 3ALWA 4XPGL 3ZKXB 3BKYL 2ODHA 4RSYA 3ZUCA 2DLTA 5J6HB 4S1SH 4N2BA 2VAJA 2DWDA 3ARDD 2H3XC 5EO1A 5E8DL 5MENB 3CFBA 1NFIB 2OMNA 3FF8A 2ZQKA 1OARL 1FNHA 4YBLB 1INDL 3BW9A 2GPZA 3BPCA 1KC5L 4LLDB 2GAZA 1W72B 1PTZA 2G60H 3NA9H 3T9WA 3PDOA 4EN3B 1A2YB 2LLNA 4F92B 4DETA 3EYVA 1AGDB 1MVUA 2CE6A 1JHTB 5JLZA 1I1AB 2MCAA 3WNLA 4QCIA 4UZSA 1NGYA 3U2IA 1DANU 5IW1B 2P8MA 4FQLL 5I8CA 4A6YL 3RVUD 2QL1A 2FB4L 2VYRE 1ET5A 3CFKB 4XNDA 1HI6A 5DD6A 3S96B 1FNFA 1JFHA 2X4TB 3D39D 4KXCA 3MTXA 1CDBA 5I8EA 5KSBE 1ZK9A 4MD4B 1EHLH 4FFWD 1UM6H 1B6UA 3UP1A 1UFUA 2H2SC 3T4AB 4X6BA 1MRDH 2NYYD 2NY3B 4U0RB 5E7FA 4I13B 3UZVA 1M7IA 3FT4A 4D2NA 3KWUA 5IVXE 1NCCH 4DVRL 4XVUD 5MEOB 2NY6D 4CJ1A 1T0MB 4BRJA 3CXFA 1EJFA 1QLFB 3IFNL 2FD6H 4H0LC 3RL1B 4HWEL 4WHTB 5D70H 4IK7A 3WLBB 2J88L 5BOPA 2PR9A 1NFKA 5CF3A 1TYJA 5SWZA 4DCQA 4LVHC 5DVLA 3N50A 3ZOAA 4ZAKA 3UYPA 1TENA 4L1BA 4YHIA 5CAYB 3WMPA 2HT4D 1KCRH 1BEYH 4FL4C 4WIQA 3DX9A 4G2AA 1IKOP 4OFDA 4ALAL 5KEZA 1P5UC 2VDMB 3RBGA 2AGJH 3EYSH 1OAKH 3VW3L 3ZE0E 5E03A 1XGTB 1QLEB 3KGUA 1ASQA 1AXSB 3Q2LA 1E8WA 5JDSA 4NRZA 2TAAA 2ZOLB 4FNQA 3ZYZA 4PJ8A 2CDGA 2ICEB 4CW1A 4JAMB 3FK3A 5CMAA 1RU9H 1TZIB 5BQDA 3LSOA 1JZ3A 5PCYA 2MCPL 4YHLH 1JPFA 3UIYA 3IU4H 1U93B 3PDGA 5CJXC 2GHWB 1KGXA 4WK4B 4Y5XC 2WWKO 2CSPA 2VAAA 3GLEA 4IOIA 2KQNA 3GJFK 1S9VB 2P5EE 3W2DH 3RZCB 3SBWA 4HWNA 1H6EA 3SE8H 4AI7A 5AOIA 4NNPH 1B4JH 3MQIA 3P9LA 4J8QA 2GTWB 4HKXB 5A3ID 1HEJC 3BWAA 3UGUA 2QHRH 1KT2A 3GUTA 5FK9A 5IBLC 1UH3A 5B8CA 2IH1B 5JOFA 5DZVA 5BRQA 5E6IC 2DMHA 2PCYA 1BVNT 3FUFA 5EZPA 1LDPH 3MCYA 4KDTC 3HJEA 3AXHA 4FYTA 4A55A 4Z7OB 4F2ME 1H15A 2XTSA 3HBZA 1A1OB 2VE6A 2O6EA 5JPNC 2X2YA 3DGCR 4A2MA 4W6YB 1GYWA 2YFNA 5I1AB 2ZONA 1MWOA 1MHCB 1BXAA 2IADB 4PP2A 5ILTH 1YMME 5E6SB 1I9JH 4YQXH 4OIBA 4CUCA 3ZT6A 1U8QA 4DQAA 2FIRT 2CK2A 3GO1H 4LSPL 4OSUL 5HI4C 3BUTA 5ITBH 3OX8A 4X4ZA 1D3CA 5C0EB 2BNRB 4LGSB 4HWBL 1DR9A 2Z34A 5C0IA 2ZUSA 2EDRA 1ORSB 1MCWM 4KBPA 4S10A 2DEXX 3CFNA 4S1QH 2F54A 5JZ7C 2G75A 3G5XA 1A3LL 3S3SA 1IT9L 5BS0A 1IILE 4R2GC 4U4IA 1TQTA 3AUWB 3TVMA 1ZVNA 3UAJC 4GSDL 1JZ8A 3F05A 3UC2A 3ULUC 4Y19A 2WXQA 5TF1L 1CDUA 4FZ8L 1WCBB 2BLFA 4ATWA 5HHPA 3QORB 3GD1C 3S7GA 4UQDA 3MV9A 2H32A 2ZT9C 3DX3A 3ZTJG 4ABVA 1ZTXE 3C60A 2XSKA 4JB9L 4M7LH 3CQQA 2KI6A 1NAKL 3TBWA 3EFFB 1KYDA 2H0FA 4Z6AT 4AEEA 4K9EC 1RZJH 4MZ2A 5L2KA 1U8NA 2FIKA 5I19H 3BEVA 3B7UX 3NIGE 2UWEF 3V6OA 1ZVSA 1JFQH 3AB0B 5T5FL 3VGHA 2VH5H 3VSQA 1XSOA 3FTSA 3BP5A 1F3RB 1HQRB 3MBEB 3CZGA 5IHWA 3I75A 2A4CA 2DYPA 2P5WD 3CFIC 4X98B 1I7UB 3AY2A 4PGZA 5C70A 3SJVB 1P4IH 3OLGA 3CFEB 4LDCA 4NQED 2VIRB 2K4WA 5KYYA 3IF1B 2FL5B 2FBRA 3CD4A 4DFHA 5EPMA 4AJWA 5LB1A 5BMFL 4TN9A 3P40A 4J1UB 1M3JA 1NKOA 3T09A 2X6AA 2HKFL 1WHPA 3HUJA 1Z9LA 5D1ZA 5FS5A 1R0AL 2HVKB 3P4LA 4N2AA 1H5BA 3N1QC 1JN6B 2PWEA 1EFXB 2B3IA 4HXAH 4J12A 4AZ8B 3KXFD 3C6SB 3BLPX 2BVOA 1HWWA 3WO3B 4Z5RB 1FO0A 1ZV5A 4FERA 1E6OL 4E2OA 2WJ5A 3L3DA 3SOTA 3FQWB 5LBVA 4R0LB 3GI8L 3TBCA 1KJ3L 4JGMA 4QRAA 1FL6B 1F4HA 2XN9E 4K8RH 4GSRA 2VZ3A 5DDHA 3ARGD 3L4YA 4V2BA 5T1KA 1T0PB 3IJ9A 5J6HA 1IAIL 5DUBB 3BXNB 4UF7C 3VI4A 3CFBB 1KXVC 4PJCF 3GS0A 5KZCD 4IJTA 4XX5A 3CDCA 2H3NB 2I27N 1NCNA 2DEWX 4FRWA 3KYOA 4KMQA 3SE6A 4M48H 2VZOA 3NFSH 3Q8AA 4H1LB 3BPCB 2GI0A 5FA3A 3LVEA 1RSFA 1MJ8L 1UM5L 1BAFH 2BY0A 5EDSA 4KNTA 2A0LC 4TUOA 1ZPUA 4KH9A 3LCYA 2FNBA 2I7SA 4NP4L 4ZMWA 3EHBB 2I60L 4XO5A 3D8MA 4JBSA 3O8XC 4KJYA 1TVDA 1NMCB 4PJCE 4U1NA 4QD2E 3U6RA 4JPVH 1R4XA 4RBPH 1ES0A 4OCWH 1SY6L 2BFVL 3ESNA 3ZO9A 1TLMA 1E28A 5DFWH 1SLWA 1K4DA 4NPJA 4XZUA 3HNTL 2PCPB 3HUJE 3PHOB 2AF2A 5HY9B 4TM9A 4J23A 3VJ6A 3RVVD 3AAZA 3DNKA 3WMQA 5IFJB 1RUPH 2YRPA 2XZCL 4H44C 4I3SH 5AAWC 2EH8H 5B7EA 1TZHB 3S34L 3GWJA 4I77L 4R7NB 2OLDA 2QQKH 3MNWA 4JFEE 4NBYB 1J87A 2A83A 5BRZD 4FI8A 3UTTD 2P49B 2BNQA 4RAVB 3EYUL 4HHGA 4DTGL 4FXGC 3GIVA 1MCBA 4F37K 4M7JL 4RZKA 1QBLL 3HI1B 2EUVA 3QQNA 1MCDA 3I9GH 1U42A 5L9DL 2ZX6A 5C0ND 1SBBA 3AT0A 1QA9B 2ZAHA 5CJQL 5JPMB 5L8LB 3KWWA 4YX2L 4QHKJ 5CGYD 2VR7A 1J8SA 2MQ3A 4LSRL 1VGEH 4JFZH 2ED9A 1C9SA 3GK8L 3EYQD 3P30L 2W60A 3EBAA 4UQ3A 3DURB 2OMVA 3LH2H 1KTBA 2H6PA 4PUBH 3LSOB 1ACYH 3QUGA 3P77A 4YL4A 3TFBA 4KI5C 2X1XR 1JXKA 4WHYH 5D6DC 5LKNA 3BHBB 4HUNB 1R75A 3VXRA 3I9PA 3RZCA 1X5YA 4PRIB 3WUWG 5T3XE 4PGDB 3SDCA 4JHUA 2VT0A 4PW4A 5I5MA 1KDJA 3PLYA 4HKXA 3OQ3B 3VWKC 4WJ5A 3WENA 1CPUA 1WT5A 3O3BB 3O3DA 4OZ4B 3KWTA 3QXDB 5HHXL 4O02A 5J6GB 5J0BA 2GIYA 5JO5A 3GUTB 2CK0L 5F7UA 3F6IA 4RFNB 1T1ZB 3BZ5A 3QULB 1E4KC 3IJEB 2NZIA 3X13B 2BINA 3BD4A 2CGYA 2EQDA 4JR9H 4KJQD 4C83A 2ZCZA 1H15B 3KLKA 1QSZA 4JRXB 2RR3A 1ZHLA 4X7TB 3RU8L 3NCYS 2BIOA 3I02A 5DZAA 1KB5L 2WQVA 4JM2A 5IB5B 1MCWW 4AL8L 4QOKB 1C12B 4K15A 4R5XA 1GOHA 1D5BA 3SY0B 4ZPTB 4KRMB 2F7OA 3P2BA 4WV1C 4AVIA 3M1OA 3K6DA 4RMWA 4UT6A 1U8IA 5HDBF 5E5MA 5KBKA 3V0HA 1VFMA 5AOZA 2G3NA 1HJCA 1OD9A 3DPBA 4K8RL 1THAA 5I6KA 5EA0L 5IB1A 3G5XB 3AT9A 3HRZC 3LRLA 1ZXQA 2EIMB 3PWLA 3EH3B 1I4FA 4IKNA 2AQSA 2HJFB 3HVNA 5JW4Q 2OR7A 3MU3A 3EUUA 4Y19B 1Z3RA 1N18A 2F68X 3FQUA 4TSAL 1E8YA 1PZ2A 4IBWA 1OLZA 3DX1A 5TQ0H 5E6RB 4YEEA 4KAQL 4W9KC 3TH4T 2VXQA 4YBQC 2SEBB 2VDNH 4PBXA 4PJ9A 3MLXH 3MLWL 2X88A 2EACA 1BVNP 2HJLB 5BNXD 1T2XA 2FIKB 5IQ7L 2DLEA 4I87A 4Q58C 4OGZA 1IGIL 4RBPK 2C4XA 4QXWA 4UQ9A 3FTVA 4MXQD 3PXLA 2DKUA 4Z1PA 2CO4A 4PRHB 1JVKA 3OR7B 5BUGA 1WFOA 1B2YA 1G1OA 5DTFA 3ARDB 3LNEA 1WK0A 4EN3C 5MEND 1KTRL 4PJEE 3VFUA 4QNPE 3IGFA 1NSNL 3VFVB 2IPKB 4PGEB 3K8KA 4XO8A 4NN6C 4PP1C 3LIZA 4EKXA 5FOBA 1G0XA 1Z9MA 1H5BB 1BQHG 4HYTB 1RZKC 1GGUA 4FKHA 5IB4A 2EIJB 2F19L 3IWUA 3UTZA 5CZVH 2VDRB 4JN2A 4L3EE 2PYFA 5DRXB 3OKMA 4EZJA 4Z78B 1XDTT 4U6HA 4XMPL 5HBBA 5CM1A 3A5VA 5F3FA 2GW5A 4LEBA 4AQ8C 4ZJ9A 4ZI8A 1DHKA 4X5LA 3PF2A 3HOGA 1BZ8A 3D69A 1MEXH 2DRUA 4JRFA 1JWUB 1GC1C 2NY3D 4OD3H 3WS3A 1G5AA 3JWNG 5ADOL 4PI2A 1NCIA 4UB0L 1SLVA 2BRRL 4AZUA 1V3MA 2OYMA 5TE7L 4QHNA 4LDOB 3L3GA 4XB3A 1FZMA 2WSKA 3OR6A 3CSYB 2NZ1A 2EDJA 1NEPA 4ALAC 4JM0A 3ME0A 1O9ZA 4S1RL 1SY6H 2BFVH 3VRJB 4B53A 5K1VA 2SODB 3ENEA 4NCDA 4HVBA 1ZWIB 3L3KA 4N2FA 4JHWH 4QTIH 2DL2A 4U05A 4PVBA 2KDYA 5J3HC 2UYLB 4I0PA 3F84A 1U3HB 4PS4H 2W8CA 1WZLA 2KPWA 3GBNL 2ITEA 4NM4H 1EK3A 4X99A 1JPEA 1F58L 1K4DB 3BCDA 1NLDL 3LRGA 2IPUK 3P9MB 2AEIT 3K46A 3ULSA 3FHEA 1VGKB 1SXZA 1CTOA 4OLVH 4WLCA 3ARXA 4W4OC 2BWDA 4UILL 1D2PA 1YN7B 5GGSB 5LNEA 3H8NA 2DQJH 3KBFA 3MRFB 2JIXD 4ELME 4P5TD 3TO4D 3K1DA 1NCOA 4F57L 4OD1H 4KK5C 2HT3D 1T20B 1I8LA 2F58H 3TBYA 4ZFZB 1PLAA 4RAVA 3GI8H 4HBCH 4E36A 3SD5A 1TJIL 3NSCA 2L7UA 5ESAA 5CCHE 3VE0B 3RWCA 5A1AA 4YLCA 3CVHH 1E4XH 4HJGB 4L5FE 4OD3L 4O02L 3EH4B 1N4XH 1PMYA 5INCB 3V0VA 4P2OA 4JFFE 3CPLA 3QXVA 1LK3H 4KKLD 3X11B 4FG6C 5TH2A 3LV3A 1R47A 3NDZE 5FW6A 3MRLB 4LEEA 5C0CD 4FQPA 2J88H 2BXZA 2WYHA 5A2AA 3NIDF 3DURA 3ISRA 2VERN 4NENB 2XQYG 4Y2DA 3FONB 4MAUH 1P5VB 4MNGA 2UY7B 3WN5A 4ICWA 3VWJD 4PY7A 5HDRA 5EEYA 3L8QA 5F71A 1CL7L 3BVTA 3GNMH 3IE4A 4PGDA 3SDCB 5KAQG 4GUPA 4WW2F 4LAQH 1QZNA 2XT1B 3CXHK 4OZ4A 3W39A 2YZ8A 4ZUWA 4AQ1A 5JO5B 1HZLA 2F8OA 2VDMH 2R7EA 3B2UC 1DSFL 4EVNB 4M7LL 4DWHA 2UWEB 4JKLA 3QULA 3MUUA 4I89A 5GSRA 2WOYA 4AGQA 5B3SB 2J57A 9CGTA 2FGWL 2NY4C 4MAYB 3NZ8A 4JRXA 3QXUA 5BQ7B 5CKAA 4X7EC 4L0ZA 1DVZA 4JJ5A 1UYWL 4UUJA 2ZNWA 3BAYA 3LHPH 4Z76A 1GH7A 3RWHA 4ELMA 1EEUA 4BD4A 4H2CA 3SDAA 3UZQB 1EPFA 1BA9A 1D5BB 5D5MB 3SY0A 2OL3L 1J5CA 1J1XH 2BCMA 1HCYA 2DOCA 3PAYA 5E4EC 3MV7B 1M4KA 1E0OB 2J44A 4E41D 3P3TA 4KOBA 4NO2A 5CGYC 3RDTC 1H8NA 4FMVA 4UQAA 3FAXA 4IIQA 2OPCA 1DQMH 4YSPA 5ESVA 1UADC 4L8SC 3H9YA 3JWOC 4M5TA 1KGYE 2BMKA 4NQEB 3Q8BA 2X2HA 1SEBB 5ILTL 4YVNA 4QRSA 4NNYA 5EUOE 3MLSL 5G4NA 4A2FA 1ONQB 4M1DL 3CUPB 1S78D 1IEBA 3FN3A 2W9DH 2WD0A 1ZLUH 3QUYB 3VRIB 1EFXD 4U6XA 3A47A 4XC1H 1KBPA 5E2VL 3KXFB 4HCFA 4PJ9B 4P46D 2J2ZA 3IN0A 2PPCA 3HHMA 3QI9B 4XVOA 5C3IA 1CL7H 1S7WB 1CICA 4OF7A 3QW9A 4Z7NF 1A1MB 2OYLA 3NCEB 3RU8H 3VI3A 3AY4C 4F5CA 1DJZA 4L3CB 1DDHA 4NP9A 2VXQL 2PYEB 1G87A 3FULA 1Z9SB 3GI9H 4FJ6A 5L2KD 4NM8L 4YSOA 3QZBA 4QRRE 3DOSA 2YGNA 1JTOA 2DQDL 3U36B 3CPUA 1G9NL 4YK4B 1SMAA 4FQXD 4NC1E 4TULL 3ARBA 1A7RL 3MX0A 3N40P 4DUWA 4ZW7A 2P5WA 2XWJA 4OAWA 4L4VA 4M8QB 4QUOA 1IFHH 2FATL 5HDBB 4KY2A 1XO8A 4R7DB 5EU3A 1EJOH 4G6KL 5JHBA 4MA1C 1CI5A 3WXWL 3EHBD 1I8IA 3MSPA 1S2EA 4N8UA 2WYTA 5F6IC 2NW2A 3IETA 2ED6A 5LDUA 1A9VA 3BISA 2WWMC 2FLRT 4DNLA 3QRFM 2F58L 2OXGA 4QRBA 5JOPE 3MACL 3CC5B 1Z9NA 5GGRA 4LCIH 1D7CA 3OL2A 4M29A 3TX4A 1DVFA 4TV3A 1NCJA 3CN2A 3PGFL 2CO3A 3PJSA 1KB5A 2A9ML 3ZDWA 1VAHA 3DETD 2DIJA 4A66A 1J9SA 3ARFC 3D69B 4FNUA 5EEUA 4XP9H 1T04B 5FHBL 2CDFA 5E8PA 4AY0A 1HE7A 2WV3A 4D9LL 7FABH 4IHOA 4XBPB 5I1IL 1B3JA 2JLLA 3ARGA 3PL6B 5ALCL 4BSWB 3V52H 5EDXA 3GPEA 3GS4A 4R2GD 4Y1SA 5LJYH 1GIGH 1WICA 5IMKA 1FZMB 3CSYA 2J1WA 4G5AA 4F15C 1NEUA 2DQCH 5AW8B 5DYOA 3T1FA 2OTUB 5D55A 1ZWIA 2QZQA 2YAMA 1C5BL 2VO8A 1N59A 3NIGB 5DC2A 5G4MA 4D0BB 4Z7OF 1DLFL 1ZSDA 2XZQL 3P4NB 4JFYA 1E5AA 2A6JB 3BE1H 3ZE2B 2YPLA 1G9EA 3VTMA 3GXUB 4PP1D 4FHJA 4GRWB 3T2NL 4F7KA 1QBBA 3SDDA 2IGFH 4PVLA 3Q6GL 4KU1A 1YEJL 2XWRA 2HLAA 2NQ3A 3JYBA 2VDKL 3PPSA 2RCSL 2W88A 3ZZQA 3GSWB 3UOAB 3C09C 4PJ8D 2EP6A 1YN7A 1UXWA 5GGSA 3TYGL 2NY1C 4LCYB 1J5OL 5E5RB 1NDTA 5TK2A 1UJ3C 1LEIB 2Z35A 5FX3A 1P4BH 5MP6L 4NWUL 1N4XL 4MCMA 1SHWA 4FX5A 4U1LB 2H6OA 4WW2C 4LL1A 1J11A 1JDDA 2PWFA 3EFOB 1CLOH 4ZQKB 5EU7E 1U8LB 1CT8B 4NQCE 4APQC 4FQHA 3BKYH 2UXGA 5FO2A 4HLZG 3QXAB 1N8ZA 3ZMEA 1XD1A 1NCAL 3RFZA 3UTTA 3D1MC 1LJMA 2HJKA 5D7EA 4E9LA 1G6RA 2YWYA 4LSSH 5FKAA 5L8JB 2R1XB 4P2RD 4HCIA 2VM4A 4K0OA 2XVLA 4XVSH 3UAJD 3LV3B 2XZZA 3SCMC 5ECJE 1IKNC 2BWQA 2I24N 2MKLC 4HXAL 1EXUB 3SKMA 2XTLA 1R3IL 1I7ZB 3SGKA 3FO2B 4AV5A 3F7VB 4GLRI 3UMNA 3HI6H 3FBKA 1SDDA 3U9WA 1P5VA 1ZIBA 1ZLEA 4QHMA 3X12B 1YYLL 4LLQB 3IDMB 1XH3B 3RFRA 1S7RB 1IVTA 2DICA 4IBLT 5F93C 2F8IA 1TIUA 3KHQA 1UOVA 4XXCC 1SN0A 2C7FA 5SV3A 1MNUL 3TEYA 2X3BA 2R7EB 5I1CL 2XHNA 2QVMA 3O9WD 3WEXA 4LL4A 3VD2A 3RZCD 4K55A 5GSRB 2OL3A 5C3TA 2CBOA 5FUCC 5ADOH 3LRKA 1AIFA 1R17A 3KVDD 2BRRH 4OZGA 4HWZA 3TJHC 2VH5L 3M86A 1F02I 3D4CA 1E40A 1KYOK 1R3HA 4AYFB 3H3PL 3WGUB 1VPOL 3AG2B 2QJDA 1V7NH 4JO1H 4C57C 1E9OB 4N0UB 1L6ZA 1W0VA 3QUMA 4LLUA 1QHQA 5JNYB 4ZMXA 3U7YL 2C3GA 3CDZA 2G9HB 3OGCB 2EADA 4GS7C 2YKLL 3KPRA 3ZDYE 3VFOA 2QQNH 2G5UA 4GKOA 3FRUB 1BWWA 2A7BA 1NBVH 2HKHH 3ECWA 1T66D 2R0KH 2K4AA 4Q6IA 4Y4KB 3KS0H 2HXAA 5C09B 3VACA 2CUMA 2FH6A 3GBMH 1OHZA 4HIEB 4K71C 3S3BB 2GQHA 1SEBA 5IJKA 2IDTA 4MAZA 1GS6X 3W0WA 4PJHF 3RB7A 2VQ1A 5GGVL 1ZT7A 3UTSE 1CDCA 3ZRCC 4BIKA 3ARED 4C54A 5IVXB 3QHFL 1SRDA 2XBDA 1X5FA 1C5DB 3MRPA 2PXYB 3LPGA 1H6TA 32C2B 2IC2A 2HPTA 3VRIA 3BP6A 4U6XB 1H3VA 3PP3K 3VGFA 3FQXA 3FFCA 2AJ3B 5TQ2L 4X4YA 3ZQ9A 5IIEA 3D48R 3V9EA 1FG2B 2FGWH 2OMWB 2BP5M 1GMIA 3HE6D 4QRTB 5BS0E 2DQDH 1JF1B 3GZOA 3EIFA 4L3CA 1JS4A 1DN0B 4OLYH 1P7QB 3D18A 3NRFA 3VXSB 5CIPB 4EF3A 1NEZA 4L1SA 3MR9A 4WTWA 3BZFB 1KPRB 3NQKA 3EAKA 5DK2A 4DK5A 1D2OA 2E56A 5AAMA 1A6TA 3NK4A 4LRIA 1M71A 1F13A 2MMXA 3CE1A 1TEFA 5TQ0L 1UTDA 4YX2H 4GUOA 1DFBL 1RJCA 3DMMB 4YSDA 1TQBC 4YLBA 2P5WB 2H47C 2XWJB 2PCFA 1YPZB 4MAUL 4WKZA 5I17B 1ID2A 5DJAB 4LSTH 1XQ4A 2ZUYA 5ID0B 1E2ZA 1AQKH 1G7LB 4R7DA 2DWTA 4ZXBD 1MCLA 1GOFA 4K3EH 1I8IB 3LDBC 3RIAF 5A2JH 3DA0A 3SY6A 5TE4L 3BH9A 2D4FA 2HVBA 5F7EL 3NCCB 4P4KB 4PRAB 5DRZA 4CSTA 2QGDA 2WLIB 2WP3T 3T0EB 1DJGA 3F7RA 3UG3A 3IK2A 4ALAH 2FUQA 3L5XL 4K23L 4HMDA 1KIPA 4IHBA 5FECB 4PJBB 4DVBA 1IQWH 1Y1DA 4NC2B 3UPRB 5TPWL 2IV8A 3I2CH 4N5UA 3RJOA 5GGQH 2DEYX 5FYLE 3WUZA 3ARGB 1I3VA 3PL6A 4BSWA 3EYQC 4HIHB 2D3LA 1OV8A 1L0PA 1EZVY 1F4AA 2NR6C 3QJOA 5EOTA 5JXAL 3SEPA 2CGZA 12E8L 3NFPB 3CXDL 3O4LA 4JHAL 4PJFE 2TRYA 1GZQA 1TVHB 4OJEH 4BWWA 3LKOB 2C5DC 1LO2L 2LW3A 2VC2L 4XC3H 1YYLH 5AG8A 3CX2A 1KWKA 1WDAA 3CQPA 5HGDA 5D2LB 5EOCH 4QEGA 5K59E 3ULVD 1UQSB 2F2HA 1CVSC 4AE0A 4H25B 2EZ0D 4AUYA 4R4NC 4C56E 4BGDA 3C8KA 2GFBA 4RMTA 1G0YR 2A6JA 3F65A 4R4BA 3U4BH 1T5KA 3EZ8A 5HD8C 3AQXA 2VZTA 1JWSA 5DO2D 2CO1A 1GAFH 2OW6A 2Y24A 4KK6C 4WI6A 4OJFL 2GUOA 3SDDB 4FFTA 5HPMA 5AOMA 1UHVA 2ZKYA 1KENH 1KG0A 1RURL 4WU7B 5FHAL 5C0CB 3MREA 4H8QA 4YSRA 4OQ1A 1RIHH 3FTGA 4XCEB 3J2PA 4B0MB 2MKWA 3WNJA 3UGEA 4N0YH 1OP3H 4KKAD 3RWDB 1WZAA 15C8H 2DDQL 2J8UA 5GRVK 1AACA 1RK1A 2NX5E 5IMMB 3VWJB 4FNRA 3TF7C 4ZW6A 4Q4EA 3FCTB 1T6VN 4Y4FD 1W6WA 4LVNB 4G1EB 1D9KA 5HDBE 3DX8A 1W9XA 3NCWA 3Q01A 1OK0A 2I5YL 4NQQA 4P5TA 3AU1B 4KPHH 4YDIL 1T5WA 5DHDA 4PMEA 5EBWA 3TO4A 3VUAA 4KKNA 4D8PB 1OWRM 5AW0B 2VITA 1CDYA 3ABKB 4KI5F 4OH2A 5JPNB 1G6RB 5ENWA 4I5BB 1MKFA 2E5EA 5F7YC 2R1XA 5D7IE 1PZ5A 2X87A 5BZDB 2WINB 4LEXH 3Q48A 1J1PH 1AR1C 4K3JL 1KCSH 2XKSA 4HJ0D 4ZOEA 1IAKA 3V9FA 4C8XA 2X28A 2BOBA 1ZPLA 3A24A 2LHAA 3F7VA 4JM2D 3V2AR 5I28A 5GS1A 4JKNA 5DC4B 2YGPA 2VDOB 1PSKH 1JGUL 1BJ1J 1J1OL 3R06B 4HF5H 5AZ2H 1I1CA 4CN1A 2V2TA 2N0KA 4Z7VF 1XH3A 3ATFA 5KYUB 1X5GA 3QIWC 4JQIH 3QJXA 3LKRA 4U1IA 4WKXA 5D7LB 5BZXA 1INQA 4HFUH 2DWXA 3AFLA 1E30A 2B39A 3EH2A 1A6AB 2D73A 2KS0A 4HK0A 2ZUVA 2IQ9L 1FN4A 4HISA 1AGFA 2V7HA 3MFFA 4PJDA 4Y9CA 4U2YA 3VB9A 5ACZB 3PPEA 2IAMC 4FKKA 4HMCA 3CHRA 4P2AA 3M17B 3H9HB 3NESA 5F1NB 5B1KA 2J5LC 3S4SA 2WO2B 4PVMA 3IDNA 5B3NA 1NM9A 4JG1H 3EOAA 3WIFA 1ZHKB 4ONFH 3TASA 4YDLB 3IMUA 2CRZA 3OMIB 1EGJH 1TU2A 2GHZA 1CIUA 3LKPA 3EGXA 4NRXA 3MV7E 3QUMB 4JDVB 4LLUB 3U9PH 5BVPH 4V1DA 4ZSOE 5BS0D 1GJUA 4JRXD 4FAAB 4YDKH 1A3QA 2BVTA 2X2JA 3CLFL 1RZIB 1T7WA 1I9JL 3QIUB 4YQXL 1Q0YL 4QOKD 1ZT4B 3MRQA 4Y4KA 3KBHE 5FC9A 1OT2A 5JXEA 2AZUA 1CD9B 2VMFA 3H2PA 4GKLA 3MV9D 2WUBH 2YK1H 4S1DD 4R4FL 3ZDXF 2DMCA 1Z5LB 2P5PA 4HIEA 4J3OF 3L3JB 3PWUA 4XOAA 5CHNB 4U7KA 3BMWA 2FJFB 3REVA 3GI9L 1ZT7B 4XWOC 4FQXB 4YHNB 2ZYHA 1F1DA 4DP9X 4WDIB 5JQ6L 4KFZC 4N2IA 1CFSA 4WFHD 3C8DA 5L0QB 3SE3A 2FR4B 4U7SA 4XCYB 3HNSH 1QUNA 2YN3A 1TZAA 2R2EB 3JV6B 5TE6L 3U7WH 3QXWA 4XN2A 1SVBA 4YDNA 3IRPX 4YDZA 1AI1L 4NNPL 2TRHA 5JIIA 1KIUB 3ARSA 1P6WA