5BUPA

Crystal structure of the zp-c domain of mouse zp2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
172
structure length
159
Chain Sequence
PLVLVLQTYPDQSYQRPYRKDEYPLVRYLRQPIYMEVKVLSNDPNIKLVLDDCWATSSEDPASAPQWQIVMDGCEYELDNYRTTFHPAGAHSGHYQRFDVKTFSSLIYFHCSALICNQVSLDSPLCSVTCPASLRSNAEANKEDTMTVSLPGPILLLSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zona pellucida sperm-binding protein 2
publication title A structured interdomain linker directs self-polymerization of human uromodulin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 28
structure length 159
sequence length 172
ec nomenclature
pdb deposition date 2015-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5bupA00
5BUPA 3QW9A 3NK3A 3NK4A 4AJVA
chains in the Genus database with same CATH superfamily
4N5ED 4F15C 3K5SA 4NNPH 1B0GA 4YSPA 2K1MA 3KBHE 4AYDC 5CD5D 4GG6F 3CJJA 4FXTA 1V54B 2QGEA 3CH8A 5FV2A 5B22A 2NY5L 1WBZA 3CD4A 1HKFA 3IGAB 5L4FA 1E8YA 1QO3A 3GBDA 3VXSD 4I0PD 2P24B 2YPLB 1RZJL 3OXRA 4Y19E 3K8LA 2YXWA 3H9SA 4KOBA 3UAJA 1AP2B 1YN7A 3BP6B 2E56A 3NSCA 3U1SL 3L2LA 4DW2L 1N0XL 4D7PA 3MZTA 5FA4A 1AH1A 5F7WC 5DJ8B 1ECZA 4NQSB 1YDPB 1QPKA 4JFYB 4AG4H 2Y7MA 2ITDB 3QG7H 1DEEB 5IWLC 3CIAA 4D7BA 2Z65C 1MN4A 2C9VA 3IS0X 4PI0A 2Y36L 4WLCA 3GSVA 1F6AA 1JZEA 4FQ1H 1E9QB 2YFNA 4IMKA 5D7KD 4D3CL 4LOUD 4XPAH 3UX9B 4EIZC 2JTDA 4NZ8A 1G9MH 4F9LC 1TU2A 2OK0L 4F7TB 2RA1A 2C9UA 4A2EA 1DQDL 1G1OA 1DVFD 2WQUA 2O5YL 3VWJD 3RUGA 2CRIA 2PW2B 1RZFH 1PZCA 4FNTA 1HSAB 1U3HA 3BW9A 4PS7A 3KYOA 4CU8A 1I1FB 4G1MB 1F1GA 4Y8DC 5FKPA 1E2WA 4DVBB 3C5JB 5FW7A 4H26A 4XO4A 1F4YL 1S9WB 4F2FA 2CWRA 4YGAB 1HC1A 5KBPA 4N8UA 5D1QB 5DZ9A 1X9QA 1E27A 3GSRB 1JF5A 1Z9SB 4JN2B 4Y7OC 5DUMH 1YJDL 1V7NH 1DTUA 1ZANH 2DYSB 4YHPB 1GMEA 3RU8L 4X5QA 3VFUA 1TETH 3VGBA 1K6QH 4R0LC 2FD6H 4F20A 1KULA 3VXNB 4XODA 5HYJA 1RUKH 4PJIE 4YC2B 3BEWA 1AQHA 2K6ZA 5E8EB 1QLRA 4PJ8B 2FWSA 4HG4K 1FP5A 3FCSA 2OJ1A 3UXFA 3L3DA 2B8OT 32C2A 2W94A 3M07A 1AAJA 3GNMH 2AQRA 2F54B 2PCYA 4G9DA 2IDUA 2BERA 4RGND 3CFDA 2X4TA 2GJZB 4N2GA 3R8BB 1YN6A 1XSKA 2EYRB 2AEIT 2HRPL 3OD3A 5JHLL 2KT6A 1LLAA 4N0YL 4RWYH 4N1EA 4OFDA 3RIKA 3GRWL 1WISA 1YEKL 2WNGA 4YDLB 1I53A 2V2WB 4ZPTB 4IOFC 3TT3L 3QZMA 3QS3A 3WEBA 5FUOL 3U9UB 3ARFB 2BHUA 3MNWB 4NQEE 3FS9A 4KK5D 4UQ2B 4ZS6C 4GQPH 3SCMA 3PHSA 5FXCH 1W0VB 4LCYA 3M1OA 3SDCD 3B4NA 2VDRL 1T1YB 4UDTA 4CDHA 2HLFC 1HHHB 1CYWA 3GT6A 2NW3A 3U4BL 1IAOA 4JQIA 4KXBA 4UOW0 1BOGA 3PYCA 4HIXL 4JRXA 4UM9A 3U36A 1O6SB 1UA7A 3QJHA 4UINH 2WZAA 5D96C 4JJHA 2PR4H 4YHZH 3WFCH 2Y1YA 2QJDA 1QAWA 2Z1KA 3FN3A 5KS9B 3U0PA 2AK1L 2ZKMX 5ISZA 5F6HI 1EDQA 3LDBB 1OE2A 4JFPA 3EH4B 3BPCB 1QWHA 1XAKA 4PV1C 5TFSH 2IPKB 3ZGHA 2JJSA 1PZBA 2X4RB 3B43A 4IBLT 4NGHH 4LBEB 1A1MB 4NQXB 4PRIB 5HHVL 5C09A 3RL1B 3BGAA 1OCCB 3LKPB 1Q72L 2WYHA 5FUZL 2F5AL 4HKJB 4EDXA 3B3IB 2XV6B 3Q2VA 3GMMA 4JHWL 3WFEL 3LNIA 4LHUG 5I8CB 2JKTM 1UKQA 3FH7A 1HSBA 3P73B 4J27A 5LAPA 3O45A 5DHYB 4WKZA 2VLKA 4G6JH 2R1YB 4ZO8A 3BP4A 4NI6A 4RH4A 1QRKA 4WNSA 2MJWA 4IDJL 1UZ8B 4EXKA 2QSQA 1BIIA 1S9KC 3ZBMA 2X87A 2AJVL 3PREA 4O2CA 1F4XL 3TVMB 3EH3B 3X14B 3X1NA 4GJTB 4DGWC 1U33A 1ZDQA 4U1MB 4UUJB 5DYFA 4Y2DA 4M5TA 2BINA 4GRWH 1UB6B 2BJML 4DKEL 2Y7LA 2A83B 4P5TA 2APXA 4RAHA 1UQSB 4JG9A 1PG7W 5D5MA 4PGZA 2F1AA 2R0WL 1BECA 4XMKL 2WAHA 1EO8H 1UM6H 3L95B 2OMXA 1A4JB 5T5FA 3POCA 3OF6D 1E3FA 2CCLA 4OQTL 4WDIB 5SV4A 1I9IL 4GMSH 3F7VB 5B3JF 4YWGL 1JZHA 4PJ9A 4DOHB 2VXQH 3BSHA 1B9KA 4XN7A 1NC2B 4YDJB 5FWRA 1AGFA 2I9LA 4PRBA 4HUVB 4P59L 1VZIA 4JY5H 2AMGA 5DSCB 3ECUA 5TE6H 4EZMA 4KRMB 1WIUA 4BA8A 2CKBH 3WEOA 3OKOB 3VXSA 4PH8A 4I0PA 1LO5A 1Z1WA 3GSOA 1F4WH 5E4EC 3ZE0E 4YHNB 4LCIH 3GSQB 1A7QH 4HUWB 4LEXL 5L0QB 1NDMA 2Y4SA 1WP6A 5IVZA 3UTTA 3WYRA 3TZVB 2ESVB 2OM5A 2A9CA 2PR9A 3ESNA 1IZJA 4U0RC 4UTAL 1FNGB 3QEUB 2H3NA 3LY6A 1ZE3C 3GLZA 4Y2OA 5F1SA 3OPUA 4PP2B 3BXNB 3LV3A 1FO0A 3IJYA 2VMDA 1KDJA 4G71B 2H32B 2A5UA 1ORSA 1QTYT 3DK0A 1Q94A 2B77A 1F2QA 3T0WA 7TAAA 2X4QB 1T1ZB 1OWRM 5F7KC 1S3KL 5I5RA 1J1XH 2OSXA 2ED8A 5HHMB 3O2VH 3AACA 2N0KA 3CVHH 4LU5L 3ZK0A 3N43B 3LD8C 4I77H 5DUPL 4M1GH 4OLEA 4GAAA 1MI5A 1NM9A 4JCLA 3L8QA 3VWJA 1NH6A 4QF1B 2NUPB 4JG0L 4LLVB 3GBNH 1Q9LB 3MLUH 1WEJL 1FNSL 5D7SL 1HK6A 3BCDA 3K2MC 1AMXA 3N06B 4TULL 4YMPA 4EOWH 5BQDA 5AENA 3D85B 4GG6E 1KV7A 1JPST 2Y07L 3L13A 1EAPB 5I18H 2F68X 1CF8L 1I9EA 2VZTA 3L4UA 3PP3H 1M1SA 6FABH 3I9IA 5E2VL 3FUNA 4LAJH 2OTPA 4U1IB 3AADB 3DSFL 3P9LB 3QQ4B 4F27A 4O51A 2J57A 2JELH 4HGKC 3BH8B 2FGWL 2MSPA 3KPOB 5FM5M 4H1LA 4GY4A 1OEZW 3OM3B 2B3RA 4PEEA 3FCUB 1SNRA 1DJWA 1W91A 2WWMD 5E6YA 2LOEA 1ILSA 5DQDH 4ELKA 1G9NH 4X7FC 3WAJA 1UM5H 2W5PA 1L9MA 3V0EA 2BWQA 4TNWF 3UBXA 1G5GA 4B9IA 1U41A 2XOTA 5D2NB 3HG5A 1OAKL 4HK0A 4GFXA 3ARBB 4FLSA 4N2CA 3KDMA 2D7MA 3LB6C 1OTUC 2Y72A 4QT5B 5E1IA 3T8XB 3VGAB 4HJ0C 4Z77A 1Y0LB 1AY1L 2WSPA 4F15B 4MWFA 1KB9J 2A9AA 4HETA 4UQIM 3VRJB 4Z3HA 4FQJH 5E6ID 3THML 1WPCA 3Q3GB 5KBDA 2A3TA 3SDCA 4TUOB 4JUTA 5F0JB 2BHZA 4OZFA 1XFPA 5CZXC 3L5WA 2XVGA 3V4PH 3MLRL 4GH7B 4NM8L 4JRLA 4N2KA 1OP5K 4B50A 4GXFA 5JHDE 2B16A 1PX8A 2EE0A 4CADA 4L8BB 4B7LA 4QXTB 5IMMA 3HLAA 4IKKA 4L8CB 1IEAB 2K0RA 3GSWB 5CP3A 1AXTH 2WBJC 2GB2A 4LQFL 4Q9BA 1JBJA 1GY2A 2V3FA 5FO7A 3DLQR 4XCNA 3LZQA 1AACA 2WLLB 4JQXA 3AT0A 3HW7A 5DJYB 3VFPA 2HJFB 1J5OH 4JDZA 4FMKA 4CVWA 3SDYL 5KG9B 3V4UL 1PU0A 3BDYH 3NESA 2CO6A 2QGDA 2Y2YA 4F9PA 1MNUH 1XXDC 3ULUD 5CR1A 4NO2B 1U95A 5J13C 1E8XA 3F05A 2VR5A 2XWEA 1JPGB 1I85C 1TZHB 5I74C 1IT9L 5IMLB 1XB3A 2RB8A 1MJ7L 5C6TL 4G8FB 1QHQA 5B39B 2HYMA 5C08E 2ZXBA 1VGEL 5MI0C 2VW4A 2UX7A 1L9QA 2IQAA 4RFEA 3AWEA 3Q2NA 4U2ZA 1KT2A 1MWAB 4YEFA 4LL9A 1DVTA 4PYHA 3VGGA 1TEFA 2ARJB 1L0XA 4JM4L 4NKMA 3MRCA 1FGNL 4F7KA 1TJHL 3U83A 3FSAA 2CLZA 2AEQL 3D39D 3DIFB 4EI6B 4XVUD 3TJPA 4I3GA 4YHIA 4NJAH 2HT3D 6PCYA 3OF6A 3FB8A 1NBQA 2CLVB 2CR6A 1ITBB 2RD0A 1IGIL 4LCCA 4QTHA 3OAZK 1NCWH 5C0JA 2PWFA 3VD3A 5G55A 2D31B 4R0LB 5IV2B 1T83A 1P7KB 3WSQH 5F0MB 4EBQH 5J89A 2G75B 2QADD 5CBAB 4A7VA 1A6AB 2VLMD 4XR8C 1AG0A 4HHGA 4NFDA 3PJNA 2ZF8A 1GOGA 4OJYA 2XFXA 5GGSY 2R0LH 4WWPA 3D25B 1Z5LB 2JKLA 4JE4B 3N85H 3BQUD 3AU1A 1SXAA 4AIOA 2ZKXA 2IH1A 3AU0A 4FX5A 4HQQL 2IC2A 5I19L 2NY0C 5TDNA 3SGKC 3MOAH 3V6ZA 2J44A 5DRNA 3US1A 4IW4C 4CVXA 1JXKA 4OLVH 1Y6NR 5ECJE 1RLBA 3PV7A 1FL5A 5FYJU 3CPLA 4K2UH 5H37H 1KIQA 1UXSB 4KQ0A 2AERT 2ICES 3QUMH 4O4YH 1AKJB 5C0AD 5TQ0L 1FG2A 1IGCL 5SWQB 3VG0L 2YFOA 2X53A 1IKNC 3IEAA 5SX5K 3FRPB 3PGCB 4MCZB 3AQYA 4WU5A 1WS7A 4LVHC 4X6EB 5ALCL 5FCUH 4J12A 4BK8A 4AJ0A 4A37A 2JB5H 5AKVA 4E9VA 5D96B 3BAIA 2QQLH 3W5NA 3DBSA 3PPEA 4MMXA 4D9QE 4GIPD 3CDGA 4S11A 2BP0A 4FNLL 1U8PA 1S7XA 2HB0A 3B7SA 3HHMA 4MAUH 1B2WL 3QZBA 5HGAA 4N0FB 1LP9B 4G6FD 1CFTB 1EPFA 5LLIC 3P11L 2W9DH 3CLWA 3ABLB 5DURD 5HI3C 3P1VA 1NLDL 2R9HC 5B3JE 2WB1A 1ASPA 1DSFH 3O41A 1I3UA 4KKLC 2GFBB 5D7IB 2AABL 5CN3A 3JTSA 1PY9A 2LVCA 5D1ZD 2BSEA 4XBEH 5CWSA 1X5MA 1I31A 1VGKB 2X41A 5LAXA 2FEDC 4JZNA 2MKWA 5ILTL 4KKCD 3Q8AA 5AWNH 4IKNA 3ZMNA 4G8GB 3A67H 5DTFB 3MV7B 2FX7H 3GGWA 4R96A 4PY8I 5FYLE 3FQRB 2RQEA 1Y07A 3QJVB 1S5IL 3GMLA 3ESPA 4IS6A 3X1GA 2YJQA 5EUOB 4BE6A 1MVUB 4N9GA 3MUGA 4PGJA 3GS0A 1OAZH 4PD4K 2MNUA 3QDJE 1Q4NX 3WTVA 1JCVA 3PGFL 3D08A 5CHNA 5CEYA 4KUZH 2FYYA 1UOKA 2CHWA 2VJXA 5KYYA 4H8QA 1GA2A 2IALA 3PAYA 5DJZA 4GW4B 4D2NA 4QRPB 5H94B 1TJIL 4CNIB 3GZOA 4QRSA 4BFIA 2C1OA 2DM7A 1FFTB 2ID5A 2VUOA 4JG1L 4Z7VB 1U36A 5I1JL 2QV2A 4ZXBC 1DCEA 4EKXA 5MENB 5IW1B 3DX1A 2ZD0A 2R59A 5EU4B 5I1IL 1YY8B 4L9LC 2DQCL 4DK6A 1WV7T 4MVBC 2NZ1A 3O2DH 1AKPA 2L0DA 1SDDA 1X4XA 2VLJD 5E6IA 2WHVA 5GGUB 3B37A 1IARB 1QR1B 3JQOB 4KY2A 4NUPA 2R51A 4NHUB 1QSZA 1OPGH 1OGAE 2BFGA 5FECA 3W5MA 4RLDA 4I7ZC 5BQ7B 4RBPH 5FHBH 4NQQA 4LCWE 3FONA 5E4EB 1JPSL 2R0ZH 2B4CH 3WNMA 3U7WH 4X6DF 5DDHA 1OSZB 3QIUD 4OIIH 4U0RB 4FQQB 5MEOA 5LCVA 4ZFFB 3ZT7A 3VXMA 1FE8L 1INDL 1CE1L 5ICUA 4X98B 4YNYB 1ZTXH 1PIFA 2WBKA 5DWUL 2AF2A 3FRUB 3SOBL 4KY1H 5EZIL 5F9JB 1CD9B 2NTFA 4JFDE 4H40A 1AQDA 2QVMA 1XVSA 3OSKA 4MHHG 1IO4C 5I2IB 5ANME 3LD8B 4AC4A 2VXUL 2E27L 5GGTH 1MHHB 2PPAA 3VRIB 1DE4B 3OR6B 5J6GB 3NZ8A 1RUQL 1T6VN 3CAFA 1UZGA 1QD0A 4LP4A 3DX9B 3ZOAA 4A39A 5D5MF 1BWMA 4AEFA 1QFPA 3M7FB 3NCEB 4MNGE 5FOBA 5GGQL 3GRBA 1L9RA 1XGYH 2EIBA 2YMXH 4P2QE 4ZD3L 4IHOA 2HKHH 4MJ6A 4Z3TA 3D39A 2B20A 3PHOA 3BRGC 1MCFA 4ZAKD 2JJVA 5I9QC 1JN6A 1C7TA 5IR1A 5JLZB 2NR6D 1W15A 3Q2LA 2N1KA 4F7MB 2DMBA 3DOHA 4PRAB 3LH2L 2P28B 3GSUB 1IGML 5K9QI 2YA2A 3WLWD 2BNUB 4PJHA 4F80A 2DQFB 1AHWC 1Q0YL 1FGVL 1U8CA 3P77B 3E80A 4FQXD 2K3HA 4J1UB 4KTEL 5F97E 2FO1A 2VMEA 3UBXI 3CUPB 1KYOK 3WEAA 5E1GA 3EW3B 1N0LA 1BYOA 4UANA 3L7FA 2FNWA 3AREA 3PL6D 1P5UA 3ESUF 5FK9B 3TPUA 4U2YA 2KQNA 4UT9A 4BIKA 3EXLA 4BHUI 2Z4QA 2V2TB 3BQUA 2QMJA 3ALWA 4Z7QF 2SEBA 4ODHL 2VAAA 2EDBA 2ZJSH 3KYMA 3S8WA 2EVJA 4PRDA 3CU7A 3HG1B 2PWDA 3D7PA 1YMMD 3G9AB 2FJGA 3NIFB 2J1WA 1EHAA 3DWTA 3KBEA 3P0VL 4WI5A 3W11D 4J8QA 5ID1A 5CSZA 1N8ZB 3F6LA 4N2NA 4PLNC 3HI5H 5C0AA 3VWKC 1U6AL 2A6IA 2Z8VC 3FAXA 2DLGA 3KYNA 3SGJC 5I6OA 4Y8AA 1A7RH 3PP4H 3BAXA 3QNXB 1QEXA 3QQ9D 2WTRB 2H3KA 5JXAL 2GTZB 2XVLA 1JMZA 2PCFA 5JYLA 2R4SL 4JMNA 3T6QC 3U25A 1UCTA 1MHCB 2C8NA 4OKDA 2VDNL 1BD2D 4I9XA 3J2PA 2WBJB 4F33B 1B6DA 4ZMVA 4UTBA 4K94C 3VXQA 8FABA 3P30H 4OBSA 3DGCR 2V3EA 4DETA 1F56A 4LPUA 3VNZA 4Y1SA 4KH2A 1ZLEA 3SPVA 1ZAGA 4G3YH 3UFIA 4Z7WF 2Y6SD 2ZOKB 4TSBH 1A6ZA 4V1DE 1HQ4A 4E9RA 2QL1A 1JWSB 2VXTH 3LN5B 4ONGH 4AMKH 5KBNC 3MXWH 3CE1A 5D1ZA 1DBMH 4WFHE 1U8KB 3PFQA 4PW3A 3EKCA 5J13B 2MQ0A 4YE4L 5JDSB 5MERA 4X5XA 4GQRA 3H9SE 2QKIC 2XT1B 1OAJA 3AG4B 5H4ZA 1H0DA 3U4EA 4JL2A 5IB3B 5I74B 1Q9KB 3D0AA 4L1BA 1MVYA 1KEGL 2V4LA 1RKRA 3HVNA 3FU8A 4QRUA 4U6HB 4G7VH 2VIRB 5MI0B 2CO4A 4A66A 1I7RB 3FUFA 5JHMA 1AQ8A 2BOBA 3SSGA 3TCTA 5IFHL 2AQ3A 2CHZA 3DURB 4DP1X 3JVGA 2IPUG 1CFQB 5EF0A 3B7UX 4CMMA 3U6XS 1YEHL 4JBSA 4ZPVA 5CGYD 2E59A 3E3QC 1EHNA 4FJYA 4JRYB 4PS4H 1DN0B 3FUMA 4L4VB 3AFLA 4QRFA 2G5BB 5DHEA 2F7IA 5LNEA 4XVTL 1K5NA 2WCSA 5B38G 1T6BX 5DD0L 2X2IA 3LS5H 2IGFH 3T3MB 1EZUA 2XPGB 3OMZA 1H5BC 4JKMA 1CF1A 4XPBL 3M1BA 1CU4L 1M42A 2FJHB 3CHSA 3LMJL 3V95A 4AGQA 4BFFA 1BG1A 1F58L 4DP7X 1QRND 3U6XA 3K81A 3L3HB 2VLJA 3EYUL 4JFZL 1Z9NA 3VNYA 3LNEA 1A1OB 1E4WH 1CK0L 1CFNB 2PO6C 3HNVL 4Q9CA 4XMPL 3WTWA 1C8QA 3BSZH 2ZOTA 1CL7H 3EDEA 3LXCA 1HE7A 4N1HB 4N8CH 1SGKA 4I48A 5HYFA 4NX0A 1BJMA 3HC0B 5ANHA 1G9MC 4N2HA 4AQEB 5I15H 2GTWB 3ULVC 2NY0B 3CLEL 2V33A 3AY4A 4QJ5B 1JZ3A 3QIUA 4BQBA 5D7JC 2IH3B 2QPFA 5EZLB 3LN4A 3O3DB 4YGVB 4FG2A 5TPWH 3WS3A 2XVBA 3F01A 2X0UA 4Z76B 1WZ1H 4OCYL 1FIGL 1INEL 2CDFA 4LVHB 3FO2B 4HIEB 1WCBA 3TBYA 2OFQA 4X99B 5IEKB 5AVRB 4UT7H 3C75A 2FYVA 3EH2A 5CFAA 2B15A 1FN4B 5MP6H 1CDJA 4YIQA 4MAYC 2MTAA 3GHPA 4XPFL 1BQHA 2WLKA 1JZ7A 1PS3A 3V6OC 1JP5A 2MQGA 3EJZC 4TVPH 3GIVA 4BK5C 4ATTA 3DRTB 4KTGA 5L2KD 3CC1A 4LNRB 4QHNA 4XX5A 3QPQC 4X5WB 4AYFB 3SIKA 2V7NB 4JKNA 4ZG1A 2L04A 1RHHB 1MH5B 3QUGA 3REWB 2JF1A 2YAMA 2OCCB 1XDTT 3N1QC 3MRLB 3UC0H 2BVYA 1LQSR 3KVDD 3QI9D 4KOCA 1HXYA 1ZEAH 2HWZL 5AL0A 4YFLI 2DD8L 4PU2A 2F7OA 3VDAA 1CFVH 5IJDC 1KPVB 2LFEA 3KLDA 4OJFH 2H5UA 2IH9A 5ISZE 3T2LA 5HHOA 5E8DH 5DO2D 4WI6A 1DDHB 3UBGA 3W9DB 2BRRL 1RIHH 2H6OA 2BCMA 4MDRA 4RETB 4Q89A 4X6DE 4O9HH 4ATWA 1QBLH 2ZOOA 2Z4TA 1G7HA 2OZ4L 3DIVA 4FQXA 4JZOA 5C09E 1SQMA 4TLTA 5CGBA 3ZQWA 4CMHC 4DNLA 3VYOA 3GTVA 4U3SA 3HI1A 1OP4A 2CK0H 3LZFH 1G87A 4KNSA 5GISL 1IQWH 4GT7A 5KYUB 3PL6A 1GY1A 4KQ3L 3VXOA 3Q5TA 4QHKI 1U2YA 2IANB 2DQUH 2C3HA 4OGYL 1VKXA 4LCUA 3FFDB 4MCMA 4YBQC 1WFNA 3HFML 2VLKE 1OOAA 4NNYB 4AXWA 5DZLA 4J3UA 4NYLA 3HAEH 3Q1SH 5LG1A 2CMRH 3D09A 3QISA 4GQ9H 4ZXBB 1CD1B 1T89A 3TONA 3UO8B 4HAKA 5C1MB 1YMMA 3RWEB 3UP6A 5BRZD 6PAZA 2WJ7A 1KGUA 1JZIA 3RNQA 1G7JA 4BUHA 2WZ0A 2VH5L 3HNSL 4YH6A 4F7PA 4L9LB 5JOFB 2HH0L 1GGBL 2B1AL 1KC5H 4JO8A 3RY6A 5T3XE 3BWUC 4Y9EA 4I18A 1N5YH 2A6JB 3MLVH 2A9NL 3HS9A 3LEXA 3D50A 3Q48A 3ZHFA 4K5NA 4Z5RA 3T0XA 3ZKSD 3GBLA 3D0LA 5D5ME 3GHEH 2EXWC 1QSFD 3OB0K 4LFHD 2DQMA 3L1GA 3OG4B 4NPJA 4QLRA 4WWKD 5DJCB 4A1RA 5IJKA 3FO1A 4E2OA 4BYHA 1QASA 4I3RL 3RWFA 1KZYA 5GS2D 1BD2A 1THAA 5I1EL 2EXTA 3IXTA 1PLGH 1PAZA 3WLBB 3P4MB 5F7BA 3APDA 3OJ2C 5EN2B 2OMWA 4TUKH 3P2TA 3V0VA 4L1LA 4NN5C 4K3DH 2EIJB 1OANA 3TNMA 4J3OH 2J73A 4Y1AE 3GMRA 1A5FL 4M8QB 4JM2C 3QIWC 3VXSE 1PD6A 4CC4C 3GYRA 3LEVL 3OJMB 5AVYB 4Q0XL 1OM3L 5I1CH 3C8HA 1EZSA 4YHOL 1KEMH 3GS4A 3IE9A 3P4OB 3FQXA 4O5LH 4POUB 3UTTE 3VRLF 2Q86A 4HUUB 1CURA 1OWWA 4LSPL 4KROC 4OF8A 1BVKB 3OKNA 1FRGL 3IFLH 4Z7QE 5BOJA 4ZJ9A 3QFGA 4HT1L 5HPMA 2XACC 3MPCA 4TNWK 4QXUL 4OD3H 3E9UA 5A16B 3SKMA 4UI2A 1M2VB 4HCRA 2QPDB 1PCXA 3AQXA 3R8QA 1ZLSH 3D3VD 2IMNA 5CBEB 5L7XL 2WK2A 1GMIA 2Y06L 5GGRA 3O8XC 1CI3M 4ICWA 2P43B 4HA1A 1XF2A 4MNHB 5ADOL 4GBXD 3MBEC 2VGLM 3CXDH 5I9QB 1K8DB 3CN2A 5CFHA 3FU5A 5AVTB 4MD5A 5I6NA 1AZVA 4NWUL 1MI5E 4NO3B 3CZKA 4UV4L 3P69A 5ABZA 5I1JH 4YN3A 1R3JA 1AHWB 1QRNA 2QPEB 5B1JC 5I1DB 2VMCA 2W59A 5SX5H 1KLUA 4AM0B 4Z7WE 3GSXA 2HKFH 4ZFOB 1N2RB 1RPKA 3O4LD 3OJDA 3PIQA 5ICZB 4MJ4A 5HJDA 4WFGE 1ZGLM 4WO4C 3Q8BA 1ASOA 1H3PH 2WP3T 3PABB 5FGSA 3OKLB 1CVSC 5A1AA 4XWGH 1H19A 1HAWA 1YPZA 3GJEB 4UIKL 1TZOA 1NCAH 2VLRE 4QAWA 5C97A 5IFAL 2BVPB 2VC2H 5KSUA 1T7VA 4WEEA 1M6OB 4M4RB 2PTVA 4H13C 2OLDA 3FFCB 4HHWA 3VWKB 3LSOA 3ILQD 4OZGB 2ADFL 2CJSA 2VUYA 2PWHA 1TIUA 3UEZA 3U0WL 2X3BA 2WVVA 3PNRB 2H26B 3IDJB 1KBPA 2OJZL 5EH1A 1QLFB 2CLRA 4ZMNA 2OMBA 5KJ7E 4NP4H 5SWZD 4D9LH 4RGNE 1QABA 5DD6B 1NEPA 4AUJA 5CEZL 3BE1H 4JFED 3ZQXA 4XN2A 3ZGIA 3IETB 3T2NL 3BZ4B 3RAJL 1LEKA 4MCYA 5JW3L 1G7MB 4KMTH 4M1DH 1Q1PA 5D1ZI 3B7YA 2WOBA 2DI8A 1NAMH 2GW5A 4N24A 2X70B 5L2KA 2J6EH 4KJWD 3QJRB 4JVUA 1CVRA 2AQ2A 3JWDH 1HT6A 3U9PL 5K9OA 2ADJA 4N2LA 1OB1B 3QZLA 1E5AA 3Q8FA 3V0WL 5GRWA 3QI9A 1Q9OB 1ADQL 4PJCA 1L7TH 2QKIB 3D18A 4L4TE 3PWNA 5BO1L 5E5LA 1ZSDA 4ODUB 1NGYA 3IYLW 3NCBB 3QK0A 2HKAA 1XAUA 3BAKA 1JHLH 4HF5H 1P53A 2A4EA 3O81A 5HHPA 3FTGB 3DVNB 3T09A 2KLRA 2DI7A 1W0WA 4P5KA 5D71L 5C9JA 3FTYA 3E9TA 3K2UH 4NHCH 4TN9A 2R8SL 2AQPA 1R5WB 2ZX7A 5GSRA 5IBTH 3IU3B 4GSUA 3TV8A 1YMHB 2OV0A 3VFSB 1RZIA 4DKDC 3G5XA 5FS5A 5IT2H 2DM2A 1CWVA 3DMMD 3E8UL 3KL5A 3FQTA 2CDEB 3OZLA 1UVQB 2FL5A 3QARA 4EXPX 3TH2T 1DL7H 5CJ8A 3W56A 3GSNB 1QPPA 5IHZB 3IF1B 3TWCH 3HR5B 5F70A 5BRZA 1MDAA 3WNJA 1DQJA 1H5BB 3E1F1 5GJTL 1UWGL 1MQKL 4OZ4A 4AI7A 2IDTA 3QJQB 4N6RB 1R3LB 2BSCA 3EIFA 2XVKA 3JTBA 4AGLA 1D5BA 3FOMB 5AOKA 2PO6B 1MCOH 2FAUA 3EBHA 3A6CH 3GO1L 4ALAL 4H1LG 5SWSB 3K7UA 5HYEA 1K72A 1LTXA 4PWKA 1D5MB 1HS6A 1ZY9A 2KQMA 3I6GA 5C0BA 1RZ7H 2GVYA 1J8SA 5K9QG 4KK8C 2G2PA 3N04A 2AI0L 4PB9L 3CIQA 3AUWB 4MXQD 2QFRA 1QLEH 3MJ8A 4NSKB 1K2DA 3FN9A 1J05A 3NDYE 2WGXA 5KVEL 1R6VA 3I3EA 1KJ2H 5D7JB 4DUWA 1TQUA 3H7BA 1U42A 4WK4B 3C6SB 2VUKA 1EO7A 3HFFA 5CM1A 1CLYH 1JGUL 2Z34A 3IAQA 4D0BA 1EO5A 4PJBB 5JPNC 5D7HA 4PQXA 1A6WL 3TASA 3VD2A 1S7VA 2FHCA 2Q5BA 4L5FL 3J07A 3MRGB 3OGCA 2V6HA 2WKOA 3BUBA 2OJEB 2CGZA 4BWUA 3X12A 2WWOA 1AGEB 1ZA3A 2L3BA 3HB3D 4GMTH 1M57B 3RZCD 1MFAL 4OZFG 2X5PA 3MRFB 4NFBA 1HHJB 4S1DD 1HQRA 2J72A 4EO5A 2YEQA 3D4GA 1D5ZB 2H2SC 4MAYB 3ZRCC 5KSAD 1FAIL 3LH9A 3MR9A 4WNQA 3HNTH 1BGXL 3SGEH 1RLWA 1TFHA 5HVWA 3CHXA 1HH9A 4MJ5A 4PN6A 1NCCH 4GSXA 4RMVA 1HXKA 2HG0A 4H8UA 4GINA 5I23A 2D3LA 1LO2L 5I8EA 3QXTA 1PYWB 3VH8B 2VDKB 3ZL4L 3MA9H 1QWUA 2JJUA 3QT2A 4PGDA 5IK3A 3KG5A 2GUOA 2XWTA 3D3VA 3S5LA 5DFVC 1RUAH 3LKSB 1UWYA 1PKOA 4JY4B 1XGQB 5GS0L 4IGBC 4NNXA 5DC4B 1JWMB 2CA4A 1EANA 3NOIA 1NGWB 3CZJA 4GBXA 1SJEA 4YDVA 3G6AA 3HMXA 4KRPD 3MRMB 1S9XB 4B9FA 4GAGH 1A6VL 3FTVA 1RJYB 4PV8A 4FFZL 4A6YA 2YGNA 2ZYIA 1MWAL 3DVFA 2VN6A 4N8VB 4NS0A 3UZQB 2CHNA 3MBXH 4HKZB 1OD9A 2F54E 1MLBB 2I5YL 3F65A 4PCSA 5E6ZA 5TGBA 1UUSA 3MJWA 3RWDB 3AMKA 1T22B 3LZOA 1UASA 3M1CA 5I71C 3N40P 4M3JA 2P47B 1F6FB 3QDGD 2GITA 4PGBA 4CMHB 5AZ2L 5AAMA 2WAQA 2X10A 5AB1A 4JZJC 3GJFA 3ASNB 3ORJA 2VJ0A 1XSOA 2HFEA 2FUQA 3MRNB 3O4LA 3UJTH 4G5AA 5IGXH 2OX5A 1T03H 5TTRA 7FABH 1IKFL 3QFJD 4FE9A 4E5XB 3MV9B 1SEBA 1QATA 4JO3H 4NO5B 5ICXB 3R1GH 4JKPH 3EOAA 4DGIL 3BIBX 4M5SA 2Y9RT 3VRLE 1U8QB 1X9RA 2BXZA 2AK4B 2C7FA 3H85A 3NRFA 5DRZA 4ZTPH 3ARDD 2UZXB 5IESH 4OIFA 1U3JA 2WTOA 4FJ6A 4I2XB 3BJLA 3AMLA 1SFHA 4GKZB 2YRPA 2Z7WA 1IBDA 1NJ9A 2VOTA 2A6KB 3QHFL 4P49A 3Q7JA 2XTJC 3QFDA 5EDXA 2W88A 4KTDL 2QGBA 3RFZC 4HJJH 5SWZA 2K9UA 1NSNH 1T66D 2B59B 3MDJA 4N3TA 3QP3A 4JFEA 4UDUA 1CT8B 1L0PA 3WFDL 2WSKA 4WSKA 5CEXB 4IU2B 1C5DB 3KVQA 4IK7A 4P2RD 1RUPL 4ZZKA 5MEPA 4HZAA 3QIBD 3VVVA 3CNKA 1I75A 2YSTA 5L9DH 1RZKH 2J88H 2BIQA 3EFFA 4L23A 1LO3L 2Q9OA 4XP9H 5KVDH 5C0IB 5J3HD 3QXAB 2APFA 4NN5B 3HEIB 3ZHLA 4GRWB 1TKWA 2V2XB 4UT6H 2BWIA 1G6RA 4L0ZA 2ENPA 4AQ1C 2E7HA 4CUCA 1YC8A 4JM2B 3CBKB 3QIWB 4ZSOA 1PGRB 4FXLA 3O3BA 4RRPA 2HPOA 5J7CC 4XPGL 4HC1H 4YSOA 3MGOA 5FX3A 4P9ML 3V4VA 4U7MA 3QCUH 5AOZA 2HVJB 4KROB 4L0PB 5CUSH 5JZ7D 1ASQA 2E9JA 4YHMH 1OT4A 3HZKA 3IGFA 3ARYA 1CMOA 3HR6A 1VFBB 1VCAA 3PV6B 3VXME 2ZXEB 4U49A 5JW4Q 1BQKA 2PWGA 5LBSL 5B1BB 4P2OC 1A14L 4YDNA 4IBQA 2B3IA 1GYUA 1EHXA 3GB7A 4A7TA 4XCEB 1W72H 2J3SA 2WMPB 2FO4B 5HDBF 2CKBB 2YWZA 3O8XB 5D7IF 5C0FA 2VERA 3DMMA 4C57C 1ZK5A 4KVNH 3MBEB 2UWEB 4IBSA 4QWWD 2P8PA 4RFOH 2B4CC 4OIAA 4KRLB 1UB5B 3TO2B 4XP6H 5DMYA 3C12A 3C6EA 2XZAL 3NZSA 1SOQA 3VX0A 1VADB 2R2BA 2I60L 4Q6KA 1NGQL 1E4KC 4M7JL 3D9AH 4RMRA 4S10A 3PGDA 4DJMA 2OW7A 1AZZC 3LS4L 4BUQA 5FW6A 1BBJA 3MV11 4QRTB 5F2FA 5CEZE 3MJ9L 1KYAA 4FQIH 2WIIB 2VR6A 5FLUA 1TLKA 5EUOF 3OC8A 2WN2A 5J57B 3S36X 3B8YA 4XPTH 4WO4B 1CS6A 3QJTB 3S96A 3UTQB 2CALA 2B0SL 4LDLB 4I1NB 1F00I 4QUOA 3TURA 2WCGA 1NMBH 2ZWNA 4X4XA 2WCPA 3LXBA 2J8UB 4DN4H 1IM3D 1KJ3H 3D48R 2QDVA 5AZUA 4HKXB 4KKRA 3O3AA 3QNYB 3SYOA 3HG4A 4HJGA 2FH6A 1LEIB 2WXNA 1VEMA 2ADGB 4F57H 2GSMB 1NLBH 4F93B 1U9KA 3OX8A 3ECBA 4EUPA 4ANXA 3SY6A 2WINB 3D33A 1A7PH 4XAKD 1JGVL 3ILPA 3ABMB 2EYSB 3CZLA 3LKOB 3ZDYB 3DXAE 3C08L 1ZCRA 4EN3C 1G84A 1DVZA 5KSAA 4DHLA 1BZ9B 1GPOL 1CUOA 2DH2A 4NC1E 3F7QA 5J56B 2ZYRA 5CIPH 5I8OH 4LLMB 5FYLH 4MD4B 5CJOH 1OGSA 5ALBH 3LIZH 2VNCA 4B6ZA 2AJUH 1PNDA 4PJGF 4QXWA 3RWCA 3VGDA 4HMDA 3EOYG 4EN2A 1FYTB 5AZEL 1A3RL 2I07A 2RCSL 2Y24A 3KXFB 2AMUA 3AJ7A 3OSVA 2H45A 1XTLA 2P8MA 2X42A 4PY8J 5AW7B 5G5DB 1Z0NA 1FLTX 5DJDA 3UYPB 2ZSWB 1VB9A 1A22B 5E2UH 4AQ8A 4LSUL 4F24A 3SDDA 4FP8H 2GJRA 4FZEL 5KVMC 1S7QB 1Z66A 4TMPA 2A0LD 2G3ZA 4PWEA 5IQ7L 1L7IH 2MCAA 4WW2A 3QDGA 2BC4A 1ZHKA 3KWTA 2AXGA 5D2NE 4ADGA 1A4CA 1DLHA 4A04A 3V4PB 1PDKA 1U2HA 3EJPA 4ODXA 3VFWA 4UU9A 3CGTA 5ID0A 4DQAA 1QNZL 4EIBA 1DQIA 1BA9A 15C8L 2AQQA 1NKRA 3BVNA 3QFJA 2FATL 1XX9C 2QT6A 5FYKE 1F45A 3DETC 1JHTA 3CX5J 2H0JA 4AQAB 5DRXB 1H15A 2OTWA 3JZ7A 3WIFB 1JFQL 1AGDB 1HHKB 1YEDB 5D1QD 3AY2A 3ULSA 3OHXC 3WGUB 1TMCB 3IPFA 3MKGA 4KJQD 4RESB 2IG2L 2OSWA 4DVRL 2PUQT 3WCYA 3BT2H 3F64A 2YPKB 3ARDA 4YXKH 3VQMA 3CFUA 3MZGB 5IJVB 5IZ7A 2F74B 3OGOE 5EC2A 1JL8A 2XJLA 4A68A 1RJLB 3MRHA 2R23A 2WYZA 4UNTA 3ZL1A 3FUJA 4NEHB 2YJLA 5DEGA 2Y7QB 4HIPA 3TJHC 2EVFA 3MRQB 4Z0XB 1T1XA 4E9WA 5HI5D 1RZGB 4DO5A 3HUJB 1FZKB 3KPNA 1IGJB 4JPIB 4G8EB 5TE7L 1OSYA 2LGNA 1HE8A 4P2RA 3MRRB 3KLAA 3L5IA 3T5WA 2E9WA 4LKXB 1HXMA 3QIBA 3HRPA 3LKRA 5LGHL 4HGWA 5EBLA 2OMTA 5A43C 3CDYA 4LIQE 3WG7B 1DQLL 4PLOB 5DHXB 5DK2A 3VE0A 5GGVL 3FTZA 3JTTB 4YDKL 1KELH 3HG0A 5JPNB 2X9YA 3B34A 3WFBL 1ZT4A 3LQZB 1UWEL 4AEEA 3PWPE 5D72L 3ARFD 3EO9L 1XXFC 3QYNA 5DR5H 4DUXA 1PX4A 5I75C 1B6UA 2YN5A 4QJ3B 1O7DE 3GBML 3WIHH 3O2WL 2ARWA 4ACPA 4IRSC 4UAOC 1YG9A 5TH2B 1JE6A 1NDGA 4YSUA 1XZ0A 3IMWA 1E5YA 1BMZA 2AEPL 5DRWB 4M5YL 2WP3O 4JANB 2I27N 1MCBA 3UTPD 4OGZA 1GHFH 2EECA 2EDHA 4NQCB 4XMLL 1FNEA 4Z8FH 5E8PA 4KZDH 1XL4A 3FBKA 2EZ0D 3GPEA 3VFRB 3I6LE 5H35A 4AK2A 4IGBB 5HHXL 2AV7B 3M86A 1N7ML 3QDHA 3BKMH 2NY6B 4EF3A 1YVLA 2R29L 5AD0A 4WJKB 1URZA 2DEWX 3F12A 1UD3A 2BCKA 3JWNH 4OGXL 1AO7A 3K4ZA 1KXTA 5JO5A 2HMIC 3MCYA 4DGYH 4TUJB 3TEZA 4U6TA 4TQEH 2ZYHA 3PAUA 1IGTA 3QUMB 5I71B 1BSIA 2HN7B 2D7TH 3MLZL 3TBVA 5KYWA 1WFTA 3CQPA 4JZJB 4L8SA 43C9A 3TVMD 5JQHC 1NANI 3L5XL 1TSRA 1QOKA 5KVGL 5B8CA 3QCTL 1JWUA 4BDVA 3QEGH 4MZ2A 4WAFA 4UQAA 4FLRA 4GEIA 1IU1A 4WCYL 4HCFA 5BZWB 5HHOE 2NCEA 2AW2A 3IMSA 4HDIA 1X5JA 4S1QH 1IM3A 1CICD 2XY1A 4PGEA 1IC5H 1P5VB 4OLWL 4P4KD 5IVOA 4E0RA 5F96H 2WUBH 3RVTD 1KACB 1UYWL 4AUUA 3OKDB 5MHSD 2WKOF 2H2PC 3KPSE 2CBMA 4R3SB 2YC1A 3RB5A 1W0YT 1B0RB 1ETJA 2AEOA 2VISB 2X4PB 5IEHB 2J2ZA 5JW5B 2XTJB 4TSCH 1NC4B 3RFZB 4DZBA 1Q0XL 5HDBE 5TK2A 4WSJA 3VI3A 4P3CL 4G59C 4V2BA 2DKUA 2BP8B 5CXPA 3M7OA 1BZ8A 5D7IE 2RFXB 2KPNA 3IGAA 1AXSB 5DJ0B 1HESA 3EDJA 3N41B 4ZMYA 1YMME 3IJSB 1KTJA 3CZFA 1M9WA 2RH0A 1F3DH 2BSTB 5KSBB 1SMAA 2NXYC 2XWDA 2VO8A 2F0CA 3DX8A 3IMVA 4TRPH 3TZVD 2ESVD 4L9DA 1QW8A 2DJMA 5F44A 4X50A 4HBQA 2C9SA 4HIIA 3CV5A 3PUCA 4PCTA 1X5AA 3MX0B 4AQ1B 2LHAA 2YLKA 1IFGA 4Q8BA 1JVOA 1G4MA 1NM4A 4WI0A 3ROLB 3ZZQA 4Z7IA 4N2OA 3WJJC 4U3CA 2ADIB 5EUOE 2F5BH 5FYJL 2J4WL 2KZWA 2YR3A 2L8AA 1BD2E 3Q43A 2GJ6E 1P7HL 1NBVL 5JR1H 4RIRB 2KDYA 3EJJX 3DX6A 1NUNB 1MJUH 1E9QA 2VQTA 5HHMD 3OZKA 3B9VA 4NRZB 4FABL 1KFAH 4M6OL 3TJEH 4QRBA 2EDTA 5AQ0A 1BQHG 3QA3A 5ACMA 1SVBA 2E47A 3KPRB 1ZHBA 4P2OB 4HH8A 3TBSB 4OZHB 1UA6L 3DKHA 1HWWA 5EA0L 1L9OA 2OKMA 3NCYP 2G60H 2OL3A 2QKSA 3R19A 1XH3A 4S0TD 4I5BA 1SLUA 3OKMA 1XSIA 4JGNA 2ENQA 1JI2A 1U8OA 4IJ3C 2QSCL 4U7SA 1S9WA 1PBYA 3TYFA 1AD0A 1P0SE 4D0CB 5EU6D 3US9A 3FT2B 4ZO7A 1M7DB 3GSRA 5DS8A 1E3ZA 1Z9SA 4X9YA 3AITA 4JN2A 2FHBA 5KVFE 4YDIL 2FQFA 3KLHD 4MS8D 3BQVA 3HS8A 3DX7A 1KGCD 3TEWA 4UIMB 4AVHA 4Z6AT 1RERA 4IMLB 4QEGA 3NFNB 4WHTB 3VXNA 4PJGE 3A21A 3WNKA 4F58L 2C3VB 3QUYD 2EDKA 2XWJA 4M1CD 3IXAA 5IW6B 1NCBH 3AG2B 3QDAA 3SPIA 1AD9A 2CO2A 3SE4C 2WQVA 2W95A 1DVXA 3MFFA 2Y7SA 3VW3L 5EU3B 4B9KC 4UBDD 1KTCA 1KXQA 3ZKXC 2XIIA 5AKSA 1MFEH 1V3KA 2GJZA 3BP5B 5I1LA 4P2CG 4H8VA 5JW4N 1R0AH 1QRNE 1FF5A 1KB3A 1ORQA 1P1VA 4XAWL 5K1VA 4G6MH 1I82A 4PSRA 2V2WA 3E6FA 4M7ZC 2WUCH 5I16A 2YEZA 5HY9B 2UUDH 3NEEA 4N4YB 3MNWA 1KCSL 2VDPL 3Q5OA 4UQ2A 3TFKC 4HFUH 1AANA 4PGCB 5KAQG 4WW1A 1GZPB 1E9PB 1MFNA 1AGCB 4JQIH 4H25B 1T1YA 4FD0A 4UNVA 5BW7C 1LM8V 1HHHA 1U8NA 5ESAA 4EN3B 3N0AA 2WPGA 1WC7A 1A3LL 1SEQL 2E9IA 2X2HA 3CZSA 1KIPA 1OAXH 2E75C 3D6GA 4F3FA 2C7UA 1N12A 1ES0B 1E5CA 2R1WA 2EH7L 3VXPB 1OHZA 2CG9X 1LILA 2HG5B 2OXGB 1J86A 3QXDB 4ZTOH 5DMIL 1YLBB 4OM1H 4RSVA 3BRFA 3FUIA 4G9FD 1E8WA 3DV4A 5DJ2A 4LHJB 3HKZA 3SKJH 3DDGA 3OKYA 2XV3A 5BJTB 1EQWA 5GHWL 3D05A 1T6WA 3B9KC 4Z1PA 2WXHA 2PP8A 3VJ6B 1NKGA 4WU7A 1V27A 5FO8B 3TH3T 2P5EB 2OCJA 3B3IA 2WBWB 4YR6B 5HJ3B 5I8CA 4GEJA 1HL5A 4H8WC 3S2AA 5I76A 2CRMA 3H3BC 4N68A 1D5RA 2ZYSA 5DHYA 2LR4A 2OR7A 3MN8A 2B2XH 1OCWH 2QLYA 2YO3A 3VXUB 2AFNA 4QHMB 4ETQB 4CBPA 5L2KE 5E1HB 1G7LB 2ZWYA 3K74B 3I75B 1S8DB 3G5VB 3PWVB 4LLWB 2DBJA 3HG1E 3IJ8A 3QS2A 1UWFA 2X4NB 5J1AA 1N70A 4QHKJ 5T3XH 1SY6A 1DVYA 3IT8D 3OMNB 3T0ED 3W9EA 4QIRA 1ETZB 3B2VL 3FU0A 4QHPA 4C58B 1TZGL 4AEIH 2GQHA 2R27A 3HI6H 3QORC 4QCIB 5DEJA 5AAWC 4OW6A 4DGVH 3O6FC 2G2RA 4NM4L 4HBCH 3CH1A 1Q1JL 3NA4A 4GKLA 2VR8A 2W0FB 5T5FH 3NACL 4Y5XA 2ATPB 4MNQB 3S3DB 3OHXB 1CICA 2HTLC 2VMFA 4G2AA 3L95A 2E0PA 4P4KA 1OALA 2F58L 2GHZA 4GSQA 4XWOD 3DROB 2ALAA 1XGTB 1M7IA 3PDOA 3A4FA 4Q58C 5C8JB 2YIHA 4KUCF 3ZO0A 1E4XI 2ZUYA 3F7VA 4ZFOL 4CDGC 4LBAA 3VU2A 2XZQL 3R0NA 2GUYA 2FQDA 3O6KH 4HCIA 5IROD 2W92A 1I9JL 4HUVA 3KYKH 1OF0A 2JB6A 3JV0A 4ZOCA 4NKOB 2NX5B 4AGNA 4ODWA 4K7PL 1BVLA 2MIZA 5AW1B 3HS0C 2IFFL 4ZMAT 4KMQA 1Q9WB 4ES8A 4XBGB 2XG5B 4PG9B 4TQIA 1PQZB 1CDGA 3LJ3A 5BVPH 3LHPL 1Y7VA 3FQ1A 1I1AC 4I9WD 5A2IH 4K8RD 1N6QH 1C7SA 5EO0B 1YEGH 3KW8A 1PFCA 3CZNA 3TZVA 2EH8L 1I1YA 2ESVA 4QTFA 4FXKC 2YPVA 2ORBL 2YEVB 2E7MA 1O7VA 1BF8A 1MCLA 1NGXA 3HE6C 1A6UH 2BNRD 3ZIMA 4U6VL 3UACA 4YJZL 2D03L 1E7UA 1FLRL 3DPBA 2UZIL 4U1HB 2AZUA 4OUOA 2A74C 2E9GA 5C0BE 5DFWH 5I75B 2D73A 4BSWB 4B97A 5GRUH 1S7RB 3MLPA 4O00A 4MYPA 1JZ2A 2HLFD 3WJLA 5SV3A 4IRSB 4K94L 4UAOB 4W9JC 1DBKH 4FLQA 4GI9A 4LCVA 1ONQA 1FQ9C 2F18A 3SE8H 5DS2A 5F1NB 1JJUA 4JRYE 4WRLA 2UVFA 4TNEA 4J2XA 1N3NB 1KTBA 1NCDL 3VTMA 3WIIL 4I1RA 5KVGE 4Z95L 2EABA 3BAEH 4QF1A 4V2CB 2DQTL 3FB7A 1V8HA 2BVOA 3OR7B 4HH9B 4PJ7F 3AS0A 3KVPA 2J1XA 4IEFB 4P46D 4HWEL 5EOQH 1FC1A 2ZP9A 1HNYA 4NRXB 4UWQB 4X9FA 1PPIA 4E68A 1DFBL 4TVUA 1AS6A 2IBBA 4N2EA 3UJJH 1SF3A 2M1KA 2VCOA 4LRNL 4H0HB 5E99L 1HI6A 5EO1B 5EU6A 1NCNA 1F41A 2VN7A 1BDYA 4JDEA 1DUYA 4LLYB 5DZNA 3TT1H 2LQRA 4AYEC 4EIGB 2R2HB 4GXVH 4NNPL 2XN1A 4G8GD 2F1EA 3MV7D 3S36H 4Y4FC 3NJXA 3RY5A 5DCCA 2KERA 1J5IA 3K6IA 1JYNA 1BQSA 5TE4H 2NYYD 3QRFM 4YAQA 4R4FH 4H1LH 2XA8H 1HAUA 4UQ9A 2X6AA 1KG0B 4AMWA 2F53D 3QUYA 1D6EA 4G72B 4MB4A 5ENWA 3ZHKA 4QY8A 3TEUA 4HS6B 1TT6A 2VLLA 4IRZA 3WD5H 3EJQA 1BP3B 4EZJA 2AAVA 3IDIB 4AG4L 2KMWA 1FFPA 2E4FA 2ZZUT 3K6SA 2B9BA 1KGIA 1XCQA 4M29A 3N40F 3CZEA 1ADWA 4B0MB 3D2UB 3ZKMC 5FYJE 4CN1A 1MFBH 3EG9B 2DPKA 4K7FA 5GZOC 4FQ1L 2JCCA 5H8DA 4W4OC 4XPAL 3QZOA 1G9ML 4OZFH 3STBA 4TUOA 4WWNA 3MRIB 3ULVL 5F7NC 4PFEA 2P45B 3I9GH 3BRDA 4LFHG 2V9TA 5DU7A 5LHDA 1RZFL 4P3DA 1XBRA 2ZE0A 5CP3H 2YK1H 3H53A 4RMUA 4YHKH 2NXYB 2GBTA 1GJWA 4Y5YA 3P3YA 4AJYV 1LO4H 4Q7DA 3L1EA 4AGPA 4G9FA 2BXYA 5FA3A 1FJ1B 1YEFL 3NSXA 3SBWA 3NUKA 1OTSC 5DJYA 2HJFA 2DDQH 3NFSL 4BH8B 2PCPB 1H3XA 3VXRE 5SWZE 1QHPA 4PJBF 3D69B 1I4FB 1V7NL 1ZANL 3CFJA 4FS0A 1CLCA 5IB2B 1FA4A 3R7QA 4Y19B 4FQLL 5D1XD 3O9WA 3K8KA 3MV8D 5DD5H 2CM5A 4HU2A 1K6QL 3KGSA 5CLXA 3HPLB 2FD6L 1NBZB 3ARXA 3CFKA 1RUKL 3QDMB 5IMLA 2VDKL 3AT8A 3CC5B 5B39A 4TNVF 2I24N 2DICA 2WANA 2GT9B 3T0EA 3K4AA 3IAGC 3GTNA 3GNML 4D8PB 2PXYC 4ZSOE 5AW6B 5IQLA 3FW6A 2LFGA 1YJDC 3CDCA 1C8PA 3HCVB 5D7LD 5IQOA 4IJ3B 3S5LG 4RWYL 4FADA 5KEZA 4LSVH 2XFGB 3WUZA 2NY4C 5F7DA 4PP1D 5L2JB 1RZKC 3FQ4A 1SQ2N 4N2FA 3LZPA 2FBJH 1CXLA 1QZNA 4CJ0A 4WO0A 5J6HB 3HC2A 4HV8B 4OB5H 2VDOH 4Z18A 4LHUB 4KKQA 4PG2A 3BFQG 1VPOH 2V7HB 1GJUA 5IOPB 1KYOJ 1YYMH 3VI3F 3NCFB 3KLSA 4YHYC 4DCQB 5IV2A 1AIFB 1P7KA 1SYSB 4UINL 5EU7C 2G75A 5IROA 4J3XA 3Q44A 2PR4L 1A6AA 4X80H 3WFCL 2Z35B 5J12C 5T33H 1MCSA 5E1QA 5IREA 5HSFA 5D70H 1E28B 2ZWLT 2Y5EA 3HMWH 2X9WA 5AG9A 3BZEB 3MRJB 2V5SA 1D7BA 3L3KB 1R3HB 2GSGA 5DVNA 4QRRA 4NGHL 1VLXA 1JGEA 3OVUB 2O5ZH 4ZFZB 2DH3A 4R5TA 1KZQA 1X7SA 1SUHA 1JNNH 4M7ZB 2G3XA 4C83B 4BZ1A 4PJIB 4OM0H 2BNRA 5DMKA 3WKNA 1SBBA 4ZMZA 4AKPA 4G6JL 3FCBA 5BXFA 4A7GF 1QQDA 1NOFA 5SWQA 1S5HA 2BSRA 2A6DA 1I9RH 4PAZA 2QR0A 3MLYH 1F11B 4X7TB 3WS6C 1G94A 1OGTB 3V5KA 2XDHA 1EDHA 3WNOA 4FG4A 4X9GA 4FZ8H 4IJTA 5AYTA 1EEUA 1MXDA 3TL5A 4Z23A 1LHZA 1VFOA 3I6KB 1ZLVH 5JTWA 4RAUB 4FKHA 5JPMA 1AJ7H 2WBJD 1TENA 4N0FA 4R4NC 4AYSA 4U1KA 5DMGD 1Z3RA 1LP9A 4NQEB 1EEQA 4LLAA 2G9KA 2LAAA 4S1SH 4P46A 1EO8L 3KLQA 3B9KB 4IIQC 4CVZB 5DZPA 4J5VA 3IFOB 4Q97A 2UZYB 1J10A 3AXLB 2BIPA 1JV2B 4YVUA 4ADIA 4ZUSB 4X0KA 4JM2F 2IO5A 4TNGA 2FO8A 4UQ3A 1E67A 2G2NA 4GMSL 1EAOA 4RRPG 3EYOB 1KMGA 2VXQL 3FB5B 3NSJA 5E4AA 1JNJA 1N9PA 1NBCA 5C07A 3DSNB 2VC2B 4PJ5A 3TP4A 2YBRB 1KIRA 3T0BA 2YZ8A 4JY5L 2EKJA 1QBMH 4HZLB 4WJ5B 5FGCB 5TE6L 2BRQA 4YL9A 2GC7C 5E1AA 4QHLA 2CKBL 2VKWA 4HFWA 4KKBC 1KWGA 2ZCLH 1NFIB 2XHNA 3AVEA 4OR1A 3RPIB 1F4WL 1MVUA 2F53A 4XXDA 4LCIL 3Q6FA 4XTRC 1A7QL 1O9WA 2MQ3A 3QORB 3FFCE 3O6FB 4GSRA 5ICYB 3L81A 5C0CD 1UUNA 2WQAA 2V5MA 2XN9A 1KTRL 2ZSVA 4U6YA 1NAMB 4X9HA 2UWEF 5IMKB 1TVDA 4PJFA 3IJEB 2L4OA 3GUTB 1RVFH 2FBRA 1AIZA 1WT5A 4R6UA 3MJ7A 1MFMA 2VB5A 4R7LA 2H6PA 4OCSH 3GFUA 3L9BA 3K72B 4D0DA 2NY2D 3CVHL 1QR1A 4PJ7E 2LLNA 2Y5TA 4I77L 4WNJA 5K5YA 1KCUL 3TM6A 3HS0B 3D87B 4M1GL 4WWOA 4AMXA 2X0VA 5BZZA 3IFPA 5EUKB 2VYRE 5IMOB 1A9BB 3CZGA 3IAPA 3GBNL 3ZSSA 1I1AB 5I1HH 3RVWC 1JF1A 4TTGA 3H42H 3BGMB 4ZYKA 4UQBA 3MLUL 2NY0D 3TS8A 1MCRA 3BIKA 2XQBL 2FZ3B 2YAPA 4UZUA 1M71B 2YAOA 4FXKB 2DM3A 3MGTB 4EOWL 5IBLD 4FQQA 2CNYA 2ZCZA 3HE6B 1GKEA 5I18L 3X2QB 4DO4A 1EGJL 2A74B 1VZHA 4P23C 3ULUH 1R24B 1ZVSB 2HX7A 4L3EE 3B56A 1FNHA 4OJDH 4PIBA 4WGVB 4WUUD 2BHYA 1MXGA 1F4AA 4AY0A 4EUPG 1X44A 4P2RE 3I9AA 3BGFC 5DJ6A 5D1XA 5M95B 3ZE0B 3MV8A 5F9JA 2JELL 1FH5H 3ZDYF 2UY7B 2RMNA 1D3CA 1X7TA 4XNXH 1EZVY 5IIEB 1M05B 5AW5B 3VD1A 3ATEA 4LRIC 2CR0A 2DWYA 1WBXB 3BVTA 2Z92A 5DQDL 1G9NL 5HI3D 3DA0A 5I73C 2G3MA 1UM5L 2R9HD 2XPZA 2AXHA 1BJ1J 1XR8A 4KKLD 4ZW6A 4MYWB 5LDSA 3T4YB 1TCMA 1KIUA 4Z7UA 5D7LA 1SOKA 1YAZA 4R5VA 1NL0H 1DJZA 1MFDL 3ML8A 1BXUA 3TFBA 2BY3A 1PZ3A 4X42A 3UAAA 2NZ9C 3DV6B 5SWSE 1IAIL 4LEBA 2O26U 3MXVH 1KDIA 4FQJL 3MLXH 1L4IA 4Y4FB 2BX5A 3GMQA 4F7MA 3TN0A 1JZFA 4PRAA 3H9HB 2EIEA 5EZJA 1CDUA 3V4PL 4NUJB 1J5CA 3UTZB 3TA3D 2QLVB 3OMAB 4X8GA 4A2MA 7PCYA 4WI8A 1E90A 4PWHA 3CDZB 4HEPG 4J1UA 4JDVA 3S6CA 4NJ9H 4WI9A 4DQOH 1EEYB 3KPPB 4RMSA 1AXTL 4AIZB 4D94A 4UT9H 3IDUA 1MJJA 3DRQA 1AO7E 1GGUA 3C2AH 4MBRA 2DQJH 3GMPB 3BSZA 1J5OL 3P2BA 1YNTF 1S4IA 4N9OB 5F9OH 3AM8A 1AYOA 1EK3A 3F5WB 3BDYL 4RQQA 4KZEH 1T21B 2DOCA 5B7FA 3GZQA 3EBGA 1ILUA 4AQOA 1KB5A 2AJSH 1N6UA 2KL6A 1MEXH 2EDWA 2AKRA 4MVBD 4PRHB 4HALA 4X5LA 2WZ6A 4RGOH 3H3KA 3N55A 2WVTA 4ZUUA 3KDPB 1FZJA 3J27A 1S7TA 2GAZB 3CHQA 5KYXA 1JK8A 2YUZA 1JPTH 4UQDA 1RJZA 1SHXA 2NPLX 2ZAIA 3UH8A 1P2CB 4XXCA 4WTQA 1UOLA 1J8RA 2Y3AA 3LNHA 3DUUB 4RAVB 1WJ3A 3UZVA 4UTBH 1BZ7A 2QV4A 4JFTA 3ZSTA 2PYEB 3X13A 4AT6A 2WBJA 1AMYA 4OH2A 5JNYB 4ZUTA 1BPVA 3PDDA 1X5KA 5IHHA 1VJSA 4F1ZA 2DYPB 4IU3B 5FKAB 4MB5A 3UAFA 3HRZA 2DMCA 1TTAA 1COBA 5E8NA 5HHNA 3STLA 4GKNA 3IJHA 2NNXA 1TVBB 1T3FA 2D7NA 4NJAL 2CIIA 3TIDB 2ZG3A 3VI3E 2FNBA 3D30A 5IVXA 3PNWB 5JW4R 3BI9X 5JHDB 3W37A 2WGNB 5HD8D 1NCWL 4JFOB 4ONHB 1PCSA 3WSQL 1DBAH 4PV9A 2X1PA 3RX9A 5IB3A 1Q9KA 2ZOLA 4BFNA 5F7EL 4HPOH 3MVSA 5LBGA 3CSYA 3PWUB 3RNKB 1ZK9A 4GAYA 3L6FB 3EFOB 4KVPA 3SOTA 3UDWA 2R0LL 1XGRB 4QGYA 3W38A 2VW7A 2AJ3B 2B7DT 2PXYB 5KZCD 3N85L 1ZVNA 1I7UB 4CGTA 1Q90A 3F58H 2BFVH 1JZGA 1YEWA 1EZVX 2GI0A 3MOAL 2EKSB 5C0CA 3UMNA 4OLVL 1QI3A 2NY4B 3UAJC 4HOWA 4LVEA 4K2UL 1JZ6A 3OQ3B 1X6NA 2EO9A 3QUML 4O4YL 1OOWA 5C08B 4A7SA 5EPMB 4CU6A 1DBJH 4HSQA 4CSTA 1O7SA 2JCCF 1OKEA 4LIQH 5FCUL 2I25N 3MV01 2GSIA 4F2ME 2LTQB 5A6LA 1RUMH 4YHYB 5IG7A 2QQLL 5BUAA 4NC2B 5EBGA 3PPSA 1SN2A 2NY3C 4G7RB 3CN1A 4R8WH 5J12B 1KN2H 3MOBH 4LAQH 4XCYA 2FIKA 4MAUL 1PJ9A 1OP3H 1TF4A 3IVKA 1RHFA 4EVNB 5T1LB 4LHQB 3LH8A 4JFQA 3BYYA 3NQKA 2JNZA 1INQB 2H0EA 4E41B 2ZCHH 2W9DL 4PSPA 4X8JB 3CZUB 4P5RA 1DSFL 3B83A 3RWHA 3DX3A 4HX1A 5LXVA 5F89B 5BMFH 4AVKA 4LK4A 2PPDA 3B1UA 4XBEL 2WXKA 1EWHA 1U3HC 3MNZB 1KLGA 5F3HA 3OLIA 1QUPA 2IH3A 1MCWM 5D2LA 2QZ5A 2GTQA 3MNDA 4G43A 1D5XB 1A64A 5T3ZL 3STZA 5AWNL 4XNUH 3A67L 5FDWA 1OCRB 2DWSA 1CE6B 4WUUA 1RMFH 3KE0A 4O02A 3FO2A 4BGDA 1KXQE 4HIHA 4X99A 3L3JA 2Z7UA 3IU4H 4GP4B 4O2EA 2DIJA 5FO9A 5D6CA 1OAZL 1P6FA 5JOPD 1TTCA 4KUZL 2UWEE 2WLHA 4NO0B 1HJCA 4W81A 3MRBB 4JR9H 5GIRB 5KSVA 2BZCA 2CH8A 3SJVD 4WIQA 4NQDA 2VQ1B 3MUHL 1DQDH 4IIQB 3B2UC 5EO9B 5DWPA 1WCQA 1OCOB 4DAGH 4HU8A 3T77B 2OS7A 3RDTA 4OI8A 2IADA 1X6LA 4ADJA 3TIEB 4B27A 3N2JA 1E7VA 3CBRA 4OFVA 3O2DL 1XGUB 5E6SB 2Z0UA 2XY2A 5C7ZA 3UO1H 4FTVB 1XCTB 2V8LA 3D12B 3W9DA 3SCMC 1ED3B 2VQ4A 3TA3A 1OPGL 3WY4A 4LLUB 1XSJA 4ZUVA 3RKDC 1NWPA 5FHBL 3HN8A 2HLAA 5L88H 2R0ZL 1T04A 2B4CL 3S5YA 1F8TH 3MCLL 3S34H 3U7WL 3BLKA 1E65A 4K5PA 5CILH 3D5OF 2EP6A 2W9EH 1ZA6B 2MHAB 2RIKA 3VUAA 2PW1B 4YXLH 4HXBH 4IDLA 4N2DA 5CIPB 2OMYA 4UV7H 3T0VA 4HVBA 3U7YH 2GJPA 2VZ3A 2CU9A 5E95B 1CD1A 2DYRB 3RWEA 3ZDYE 2R2EB 1WAPA 2JJSC 3GKZA 4LP8A 4QTIH 1WIOA 2HRPH 4G8IA 4I89A 4K15A 5JOFA 3EHBD 2ICWB 2OMUB 3QDJB 3VGFA 2XUWA 2DIEA 1M4KA 4YDMA 3Q2WA 4Q14A 3RQ3A 4LSDA 4XVSH 1JNLL 4XC1H 2E76C 5GGTL 5GZND 5FHAH 3FQWB 2V9QA 1C12B 5B7EA 4AENB 3H0TA 2VDMH 4GKSB 4HWBA 2DWEA 3FO9A 3N42F 3CFBA 4OKVB 1KBVA 1WVZA 3ULVD 1MHEB 3AAZA 2VSKB 4Y9GA 5MHSE 4R4BA 3RRQA 3G04B 1XGYL 2YMXL 3QC6X 5LN4A 5EC1B 3AXIA 4Y2DC 4POYA 4H44C 4S0HA 35C8H 1YHPA 4P5TC 4P23B 4NCDA 4PRNA 1G7QA 3WHXB 5KBLA 3ZTNH 4PJXA 3ARWA 4KXAA 3T65A 2EXYC 1OGAB 3TBWA 2Q6WB 2OTUA 4M8QA 3BGFB 3C5ZD 4EDWL 5EORH 4LCWB 5ES4B 3WUWA 1PD0A 4ELDA 3DYPA 3HLKA 1YUHA 5GSVB 2VERN 2K3TA 2JTYA 3OWEA 2Z3FA 3KCPB 1YEEH 1RD6A 3BZFB 2XNAB 4MAYD 1HILB 1VF5C 4PJ9C 1LO0H 3HG3A 4IBYA 2HRGA 3EJZD 4LLDA 5PCYA 4H2CA 2BY2A 2W0LA 4JRFA 2EVIA 2YN3A 3ARGB 3IKCA 5I73B 4HCRH 1G9HA 2ZJSL 1S7SB 3AZUA 3DVGB 1BM3H 5FW8A 2ZWZA 4I0PC 3RILA 4JY6B 4PREA 2JE8A 1QBBA 2Z93A 4JFDB 4WSGA 5IQ9B 4PJFF 5CZRA 1YO4A 2BJMH 4DKEH 4QYOA 1JF6A 3V7MA 1XD1A 1BBDH 2ZUTA 1CGXA 2YUWA 3HE7A 3HI5L 3BIAX 4G1EA 4BELD 5C2UB 1JYWA 2R0WH 3NCCB 5D4IA 5SX4I 3FB6A 2Y69B 4APXA 3DHPA 5H2BB 3PP4L 4KPHH 4GW5A 4LSTH 4ZFQA 3H9YA 1SOSA 4ZOBA 1NICA 1JUFA 3DUSA 1TZIB 1U92B 5I1DA 5LKNA 2DLIA 2AV1A 3PHQB 2OXHB 2ATKB 1OK8A 3WBDA 4P2QB 2B1HH 4JHZA 1DBBH 4QRQB 3P30L 1N2RA 4LOUC 2XN2A 1FL6A 3HZYB 2JKNA 4FF9A 3SQBB 3VMPA 3BEVA 1JGDB 4HWZB 3MRPB 4LLQA 5JHAA 2W65B 5LG6A 3GMOA 4QOKD 3W39A 4DGUA 4G3YL 3MV9D 5I8KH 1S7UB 3VWJC 4YQXL 3OLEA 4M7LH 2VXTL 4ONGL 1LWJA 1DQMH 1A6TA 4MX7B 3MXWL 4AMKL 4N3UA 1CXKA 1GYVA 1MKFA 1ZV5A 2XYCA 2FIRT 4YDZA 4AKOA 2X7LB 2Z91A 3QZWA 3N0PB 2ZUVA 1MHPH 4OD2A 1KJ2A 4M4RA 4JHAL 4N0UE 2FTAA 2QMKA 3AS3A 1HTYA 3LQAH 4OZGA 4FFVD 4UTAH 3P2DA 4TNVK 5B38B 1DSWA 4WFFD 5IW3A 2H26A 2P26A 1LE5B 1MDTA 3HHSA 5A7EA 4OCRH 2NQCA 4LEOB 5BVJA 2DLFH 1KLFB 3IETA 2YGQA 1NUFA 1S3KH 1S9VB 4HUXA 5T1MA 3RURA 3WTTA 5AUMA 2IVFC 5CZKA 2NUTB 4HK3N 3DJSA 3L1OH 3SDXA 1VFAA 4LU5H 3SJVA 1ZHLA 1IRAY 4PS4L 2JCCE 1A8JH 4Z7UF 2MTPA 2WLYA 3O3EA 5DUPH 5CS7A 5F7AA 2FLBT 3F7LA 1BV8A 1KTDB 2VL5B 3MTRA 1KPUB 2FWOA 2ZTBA 3LS5L 2IGFL 3KBFA 4PPTA 4RGNC 3QXVA 1RURH 2A9BA 3WKQA 4M03A 1WEJH 2D0GA 1FNSH 5HBBA 5D7SH 1WZLA 3TBCA 4D8OA 1CBVH 3ASWA 1VFUA 3GMNB 5L4JA 5C0GB 2P8LA 5J1TC 2Y07H 3NCJH 2APBA 1E4WL 4F8TA 4KK5C 1IM9A 1CL7L 1B0GB 2WO4A 2UYLA 1TJGH 1NGPH 2K6YA 4N8CL 1MRFH 5ESQA 4GXUN 2R4RH 5CINH 2HX8A 3DX2A 5GJSH 1WBZB 1QVOA 4XXWA 5CKAA 5IUSA 3DSFH 3ZYZA 3HZMA 3EUDA 1QO3B 2A9MH 3IU3A 4UILH 1YMHA 3OXRB 3L3OA 2K6WA 3H9SB 2FGWH 4JAMA 3SKNA 1HZHH 1YN7B 2AS5M 1UACL 1TQVA 4KV5F 2WVSA 4PTTB 2DM4A 2FX9L 5DFAA 3GS7A 3V6FA 3SBQA 3MACH 1R75A 4PJDA 5TPWL 5FA4B 3R06A 4UZGA 4ZQKA 3GSNA 1WZ1L 4GQZA 3IF1A 2WBXA 5ADPH 3EGDA 3NSYA 2N56A 5EU5A 1BLNB 3W0WD 3T0EE 3BFWA 4UT7L 3P3SA 1JIBA 3MBWA 4F9PC 2VQUA 5LGJA 1HDMA 2NY3B 4Y2NA 5MP6L 2P7TA 2C4FU 3GSVB 1F6AB 3U2JA 2OAAA 3RTQD 2EC8A 5GZNA 1CQKA 3RGBA 1TTBA 2UXFA 3THMH 3ROOA 4TVPL 1KXVA 6TAAA 1D5MA 1TU2B 5GS2H 4L0YA 4WO4D 3U1PA 1CD0A 3LRGA 4YS4A 1GR7A 1XEUA 3RUGB 3PXLA 5C2BH 5LBVA 4PVNA 4NPKA 3NSDA 1EJFA 2WKGA 4F7CA 1U3HB 3BW9B 3KYOB 4YFDB 5FKPB 2BS71 3UC0L 4NT6A 1GZHC 4L2LA 1TMQA 1ZEAL 5IVXF 4H26B 4ZQTA 1ACCA 1CFVL 3VFVA 1GZQA 4OJFL 1RCYA 1WAEA 5E8DL 3KPRE 1UG9A 4UT6A 2VXVH 3C5ZA 3MRGA 3U1QA 2RAMA 1RIHL 1LK3H 1AGEA 2GY5A 4QRRE 4O9HL 2D0FA 1QBLL 4HJTA 1HHJA 1QFOA 3FHAA 5KBMA 1BVNP 1TO4A 3KEHA 4NENA 3VFUB 4MAYA 4MRCA 2WWKT 2RALA 1IC4H 2CK0L 1T83C 1IQWL 3FSZA 3EOTH 4HS3A 5EF1A 1QNIA 2DQUL 3BEWB 2XICA 2WLIA 2Y1ZA 1QLRB 4ORZC 4MDJB 1CDHA 1PSKH 3FCSB 2GG1A 3L3DB 3AQDA 32C2B 3Q1SL 4FNUA 2CMRL 4GFTB 4GQ9L 2WXGA 4L8DB 3KZ8A 5E94A 4G9DB 1FYTD 1ZTXE 3CFDB 2X4TB 4NCC2 3QQNA 3KXFD 1YN6B 1SBSH 4J6IA 1W72A 4JM4H 1RZQA 4NQTA 5EIIA 1KC5L 3HMXH 3NJMA 1QHOA 5TF1H 4BFEA 1KWKA 1O5DT 1N5YL 4A6YH 4WEMB 2YMOA 2FLMA 2ZWKA 1S9XA 1BEXA 3RVUC 5DLMH 2ENSA 3MROA 2AJYH 3SCMB 4KWUA 2PF6A 4HJUA 4LCYB 1RP8A 3WOVA 1K3IA 3RWDA 4UDTB 5ETUA 1G7PB 1ZJBA 3GJFH 1ZT7A 1IAOB 3QULA 3CXHJ 4JRXB 3GI9H 3QJHB 4ECNA 1O0VA 4G42B 4MMXC 2FR4B 2IGLA 1PLGL 4A38A 2IPTH 3OZ9L 4YC2C 4ZS7H 1U8LA 1TVHA 5ISZB 2R0KH 2KZKA 4QOKA 3GXPA 4TUKL 1NANH 4PJ5E 5C07E 3CTTA 3MV9A 4NC0B 1KOAA 5ICXA 4JFPB 1YUKB 2ZOWA 5K33A 3AW5A 1QPXA 5D2LF 2JJWA 1LWRA 3HC4H 1JRHI 3KCWA 2E3VA 3U6RB 3VACA 2AJZA 1U8QA 1H3TA 5C09B 5TDPA 3PP3K 1IQDA 4AJWA 4EDXB 2VM3A 3GMMB 5EHFA 5I1CL 5HJBA 4J3OF 1KEML 1MCKA 3ETTA 1EEZA 1HSBB 3L2MA 4FERA 1J7VR 3O45B 3BVVA 4MXVF 3IFLL 1H6UA 3S7GA 2A6KA 4WKZB 4HHAB 2VLKB 4JN1H 4Y9FA 1DDTA 5TQ0H 3X1BA 3BP4B 2XN9E 3UC2A 2PWEA 4B9ZA 4OD3L 1RK1A 1D5IH 2R2CA 2FLRT 4C56D 4PJFE 2E7LA 4ODSH 1BIIB 2Y1AA 3EYVA 4O2CB 3NJHA 1ZLSL 1UGKA 3RX8A 3X3FH 2CDGA 1WGVA 2GYSA 4LESA 4Y2DB 5FR3A 3G9VA 1K4CA 4EQ2A 4P5TB 4HUNB 3OB8A 2WWMC 1G6RH 4IK6A 4OIBA 4ONFH 1HWGB 3CXDL 5D5MB 1E43A 1AFVH 3J8F7 3LVEA 5HPOA 1NLDH 2CKNA 1O6TA 5CD3A 3P0YL 1L9PA 2OMXB 3V4VH 2R1XA 3ZMEA 5E6RB 2MCG1 3UROR 4NN7C 1RULH 3BWAA 4OF0A 2PPCA 5HDQH 5I1AB 2EDXA 2OA9A 4BKLB 2H2SD 2ZKWA 4H4NA 4PJ9B 2JWYA 1A0QH 1WA1X 1FVEB 2HKFL 4HP5A 3IMTA 2I9LB 4PRBB 5DVMA 5E6IC 1JHKH 5DZAA 3EJUA 3PV6A 3C5XA 2WJ5A 3VGEA 1H3PL 1NKOA 3WL9B 2H1PH 4NOFA 1GW0A 3VXSB 4I0PB 4XCEA 1LO5B 2K45A 1UHVA 3BX7C 2XV2A 4MGXA 3SODB 3G6JF 3GSOB 5DFVD 4BK4A 1NCAL 4OF7A 3TGXA 3IDMA 3MV8E 2VTFA 4IGBD 3VD7A 1NDMB 1Z0MA 2VC2L 3KL3A 4LEEA 3BAJA 5IVZB 3UTTB 3FHEA 5E9DD 4Z7QB 2FJFA 1ZLUK 3OPZH 5I6MA 5FPIA 3KH4A 3B9EA 4G6KH 1LK2A 1BVOA 3SPGA 4Y2OB 3W0WA 3LV3B 1FO0B 5F3BA 4FFTA 3HA0A 2Q20A 2QTVA 3KJ6H 3IJYB 4NP4L 4POZC 2WLNA 4D9LL 1ORSB 3KPLA 4QAMB 3ULUC 2DKMA 1CGSH 2J6WA 5I1IH 2J1YA 2WY3B 1HH6A 4Z7UE 5D7LE 2OQJB 1OT1A 4YBLC 4E9TA 3QWOA 3RTQA 2ZNXA 4KMTL 1NCTA 2YD9A 4M1DL 1FZOA 4FFYA 4XX1E 4RWHA 1UJ3A 4ABVA 1NAML 4Y4KA 3OAWA 2J6EL 1V10A 4P57A 4F8OA 1A6PA 1MI5B 1H8SA 3VWJB 1EXGA 3JWDL 4ZOEA 3CQFA 4BM7A 2J8UA 3NH7H 4QHUA 2ZUQC 5TD4A 3MCG1 4HKXA 1PZDA 2BZDA 5C0NC 4PJXF 1RP9A 1M9SA 1L7TL 2VDNB 3V2AR 3QH3A 3K8MA 4UF7C 2ADGA 1JHLL 4EUPH 2XC8A 5L6YH 3DGGA 1TOXA 2WINA 1QZ1A 1MLCA 2HT3C 5DFTA 4KGJA 4EE2A 5T3ZD 3DHJA 3K2UL 4NHCL 4GS7C 1QFWI 4X6BB 5IBTL 5EZIH 4JO1L 4O51B 4KQ4H 5JIIA 5EOCH 1GXEA 2J5WA 1PZ5A 5EEXA 2QADC 1A4BA 3PQYD 4H1LB 2KDGA 4L29A 4YSAA 4QKXB 3FUHA 5IT2L 3ARTA 3MA7A 4AL8H 3AREC 1CXIA 1MCWW 1DL7L 4CKQA 4PRPD 4ELKB 4OCXH 4Z7NF 1F1DA 3TWCL 1FYTA 4RGNB 3MSPA 3BQUC 1K85A 4UOW1 3QXUA 1QA9A 4LARH 4GO6B 3G5WA 4WK2B 1TFPA 4HK0B 2VITB 2DQIH 3KDMB 4Z77B 5FV1L 1T0MA 1F2XK 1MCOL 3F7KA 1OHQA 1XO8A 3K71A 4MWFB 2WN3A 1PNCA 2QSVA 5I0YA 1MFVA 4AV5A 4MMZA 1RZ7L 3GPSA 1I8MA 1BQLH 1XGZA 4OZFB 4ZNEA 3L5WB 4X6CA 1IZKA 3A6BH 4N85A 3H55A 2IXQA 4FTDA 5IVXE 1Q0YH 1FGVH 1NCIA 2M2DA 1O9VA 3OXSA 3ZLQC 4AEHH 4CADB 2BOCA 1OAQH 5IMMB 3HLAB 3EDDA 4OFQA 1J1PH 2HVBA 2NY1D 3FT4A 3FUDA 4H8PA 3VM7A 1R5VA 1CLYL 5FO7B 5BV7H 4XCNB 1L6PA 4XX1G 1I8UA 2VWEC 4Y4HA 2C9AA 4ALAC 1HHKA 1FWXA 3K6NA 3VFPB 4WGKA 2BMKA 2G0LA 4JDZB 5I0XA 5HI4C 4Z78A 1IAIM 5I6LA 5IM7A 3A23A 1P9MA 1UA3A 2YGOA 1HKLL 3U46B 1P4BH 4GMTL 1WTLA 2CO6B 3KGRA 3T6ZA 2N7AA 3K1DA 5D1ZC 4HD5A 2DWDA 1CO1A 4ODTL 4U6XB 2BOLA 1F97A 3HNTL 5CJQH 3OV6A 4JM0A 1DP0A 3T2QA 3V5HA 1IGYA 1CG9B 1P7QA 1KUMA 1E4XH 3MRQA 4JPWH 4DP0X 1WSST 2P48B 4Z0BH 4C56A 1FFRA 4JPIA 3SB3A 4FQCH 3MRRA 3SDXF 5I66B 2ENJA 3MA9L 2IQAB 4RFEB 5FEBA 4C8XA 1KT2B 2AVGA 4AOFA 1RZ8A 1RUAL 1DZ0A 3JVGC 3UPCA 4NKMB 3L54A 4I4WA 3VDBA 3WE1A 5C92A 2YUXA 1BLIA 2G5RA 1OARH 1QYGL 1RL1A 3DVIA 3QDME 2ZP8A 4QPEA 2W91A 4GAGL 3LQZA 2GKIA 2BNQE 2I9TA 4Q2ZA 3RWIA 3MBXL 4WZ9A 5F8RC 4PMFA 2LV4A 4A7UA 3ERXA 1T20B 4LCCB 4NQVA 4QTHB 4EN3D 3D0VA 5C0JB 2V37A 3EH5B 2O6CA 4GLRI 4RBPK 5GS0C 3UJTL 5DRWA 1IB5A 1BEYH 2XKNA 4NAMA 5D2LE 5IGXL 1T03L 4J4PD 4BZ2A 1J0JA 4PJAA 7FABL 2DWTA 4JFHE 1NFKA 3E6HA 3FZUD 2MOGA 1NCUA 4PI2A 4JO3L 3R1GL 4JKPL 1E50A 5KUMA 1T0PB 2DQGH 2IH1B 2LLGA 1O7DC 4PJDF 4IGBA 4MXVE 4ZTPL 5TDNB 5IESL 3V6ZB 5DRNB 5AW4B 1U8HA 3AY4C 2WD0A 5E9DA 4CVXB 4YSEA 4KJYA 3TF7C 1FL5B 3CPLB 3HJEA 1KIQB 4WF7A 3RVVC 4UOQA 2EQDA 5INCA 1NIFA 1MF2H 3CCHA 2QGCA 2ZP0T 3FTSA 4XO9A 3SE6A 3VXUD 1FG2B 2N1TE 4HJJL 1A4AA 4NQDE 1NSNL 4MD0A 4WU5B 3F2LA 4KNUA 4BFGA 4KI5D 3LMJH 4Z7AA 2E9BA 1F58H 3IMBA 2BWDA 4MMXB 4WEBH 5L9DL 1RZKL 2J88L 3CDGB 2BP0B 1S7XB 5HGAB 1CK0H 4DEUA 2HFTA 3LRSA 2P5WD 4CSSA 1B0WA 3RVXD 1SXNA 4FMFA 1AR1C 1BW8A 1JK9A 4KITB 4MNQD 1JPFA 2DQEH 4H7VA 2CSPA 1ZS8A 3O41B 5KW9L 1JGLH 5EDSA 3JTSB 3V0HA 1NCOA 3WHE1 1BVNT 3HAEG 4HC1L 1EMTH 3APNA 1NUDA 2BVQA 1NAKH 2X4SA 3NZUA 5CWSB 3MLSL 1SXSA 2WLJA 3QCUL 3EGSA 4JPSA 5LAXB 1W6WA 1DJHA 5CUSL 5DHMC 4FYQA 2X4PA 5IEHA 4JZNB 1PJWA 4YHML 2MCPH 3ZX1A 4R7DA 1N18A 2KPWA 3T8VA 3G6JE 4OCYH 2OR9H 3Q8CA 3GGWB 1INEH 1P4UA 3CFMA 5I5MA 3GMLB 3WLWC 4BRJA 4EI5D 4YSSA 3K2IA 4IS6B 2J25A 3ISYA 3ZT5A 4XCCH 2DMGA 1MVFA 4ZMWA 4JFFE 3RYMA 4FQXC 3WEXA 3MUGB 3PQYA 5KSBA 2B14A 1HINH 4FKKA 5CHNB 4YX2L 5CEYB 2FYYB 4XPFH 3ZR5A 1BCIA 4B95C 2EINB 5IHWA 5KYYB 2IALB 4KVNL 2OSLA 3PL6C 5DJZB 4RFOL 4PRPA 5FGCE 5EOTA 4XP6L 3QQ3A 4AQ1A 5J0BA 4ZX4A 4XNAA 1CC3A 1QTSA 2C1OB 4BFIB 4G82A 4KNQA 3D9AL 3WY2A 2NNAA 2EUXA 4HKBA 1GCYA 2ADIA 4NN7B 1T89C 4J3OG 4N28A 3B9DA 3RGVD 4XMTA 1QI5A 3MLTA 1FVDA 4IRSD 2VZUA 4FQIL 3VFOA 3W11C 4AITA 5C3LD 1HHIB 3FJTA 4XNDA 2IAMC 1SDDB 1RH8A 2EDOA 5DZJA 5E6IB 4W9HC 2E6QA 2ZX9A 4M6AA 2MCMA 1MJ8H 4APQC 3LZRA 1FHNA 3B5HA 4XPTL 3K6OA 1DVQA 4PJXE 1ET8A 1NMBL 2OL3H 5FECB 4G7QB 1IAKA 2UY6A 3MKKA 4OZHA 4PR5A 5DEFA 4DN4L 1KJ3L 1XH1A 2O6EA 1DJSA 3S37L 1LDPL 2AHIA 5T1KD 5I6XB 4JFWA 3V4LA 5DDHB 5ACZA 4OGYH 4F57L 1IE4A 1NLBL 5MEOB 4YVNA 2HMID 1MFUA 5JIKA 2VKXA 3VXMB 1E4KA 1GSKA 3FL7A 2J20A 2KZBA 2Y6SC 4P5SA 4W9LC 1BMWA 2R56H 5B21A 1LMKA 5E8OB 2ZUWA 3ATAA 1A7PL 2WWKO 5EB9A 4C59B 1AZNA 1OP9A 4YBLB 1XTMA 1DVSA 2HH0H 3MUUA 4DSYA 4RDQG 1T5XA 1M7XA 3BMWA 1AQDB 5BRQA 1E2ZA 1WD9A 4WV1A 4Z7NE 5I8OL 1P84J 5FYLL 4IBWA 2RTTA 4AYMC 3WJMA 5CJOL 5ALBL 3LIZL 1GL4B 1QSEE 5EU3A 2AJUL 4EDWH 3CK0L 5C0EA 3NZ8B 3GM0A 2ZUQB 3SHSA 1CPUA 4HJIA 3B1TA 1TQCC 1VRSA 1BXXA 1UD4A 1HL8A 1N8OE 3D2UD 1WF5A 5FOBB 2HAZA 2H2PD 3B7RL 4PJ6A 5CGYC 2YD0A 1EVTC 5HY9A 3FC8A 4MJ6B 5E2UL 3D39B 1WICA 3PHOB 4FP8L