5BUPA

Crystal structure of the zp-c domain of mouse zp2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
172
structure length
159
Chain Sequence
b'PLVLVLQTYPDQSYQRPYRKDEYPLVRYLRQPIYMEVKVLSNDPNIKLVLDDCWATSSEDPASAPQWQIVMDGCEYELDNYRTTFHPAGAHSGHYQRFDVKTFSSLIYFHCSALICNQVSLDSPLCSVTCPASLRSNAEANKEDTMTVSLPGPILLLSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Zona pellucida sperm-binding protein 2
publication title A structured interdomain linker directs self-polymerization of human uromodulin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 28
structure length 159
sequence length 172
ec nomenclature
pdb deposition date 2015-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5bupA00
3NK3A 4AJVA 3NK4A 3QW9A 5BUPA
chains in the Genus database with same CATH superfamily
1QX1A 2HLFD 3MPCA 5CCKH 4RGND 4JHAH 3F7VA 3GB7A 5FWQA 2IBZX 3NIFF 3QJOA 2WB1A 2LU7A 3EYVB 2DWEA 5EN2A 3T1FB 4HSAC 1QKZH 1G7PA 1HYRC 5CJ5A 4GEIA 3BQUC 1DN2A 1M53A 2OYPA 3U6RA 4KXDA 3TO2B 3ULAB 2NXYD 4LCCA 3VFMA 1CU4H 4L9LA 4ZMPA 3CE1A 3NA9H 4X7TB 5GRWA 2XTJE 2BNQB 4ZDHA 3OHXB 1SVCP 4I2XE 4HX1B 4KTDL 1T66C 2APBA 1M42A 5L2KE 2JK5A 3QUZC 1OL0A 4IBQA 1JZDC 4BUGA 4O2EA 5DJYB 4NT6A 4AQ1B 4EAEA 2XPGB 4FQ1L 3CPLB 4ICXA 2CUIA 4G9DA 4IKJA 4BUHA 3MBEB 1HYSD 1JGVH 4OVUA 3QI9C 4ABVA 5IMOB 1EJOL 4L2YA 1JZFA 2XZAL 3D0AA 1T5XB 2C9QA 3QS2A 4YAQA 3WUZA 2GFBB 5T3ZH 3OMIB 1INDL 2J6EA 1JHLL 3FU0A 1DE4A 3GK8H 5K1VA 3X14B 4QAMB 1WD8A 3D3VD 3HFFA 4X9IA 5J4MA 5K9QI 5CIPB 5FO7A 1ZY9A 3UG5A 2CHNA 2YEQA 4TMPA 1T03H 1ZK5A 5LJYH 3NGBC 5FYJH 4OF0A 4H5SB 3B3BA 4JFDB 4OGXH 5KSAB 3WNKA 3F2LA 2UZIH 4C56B 5D1ZC 3V55A 5ITFB 1C08B 3LVEA 1B6UA 4HD5A 4XMPL 2MCAA 3RGBA 4PGCA 2HP4A 4YC2B 3A6BL 3VXQB 3SE8L 1O7DC 2R1WA 4NO3A 2ZX6A 4EZLA 3CVIL 1V5JA 2VXTL 2XNAB 4N8PA 4X0KB 5D72L 2Y1VA 4XZUB 3V10A 4N86A 1IC7L 1R5WA 3FBQA 4N2LA 5C08A 4BCYA 1G84A 4RGNB 3AG1B 1J0YA 1JZIA 2P8LA 3NABH 3NTCL 4ZYKA 5J6GB 3NCBB 4HALA 3GJFB 1Q90A 2XWBA 3DK2A 3C60C 3D5OF 3WTXA 2YGPA 3WDJA 3DPDA 5DEFB 4AVIA 4IMLA 2DQMA 3A4FA 1UFGA 2AC0A 4P3CL 2EO7A 5F7HA 4Y1SA 1MF2L 2YD2A 4N0FA 3O41B 5BW7A 5KS9B 5LWYL 2KZKA 3FCUB 4PY7B 2NX5E 2HT2C 1U8QB 4OCLC 3G6JE 1DJYA 3NJJA 3PWLB 2ROYA 3ARFA 2GC4C 2IPUK 4M4RA 4PGBB 4YBQD 3ZTNH 1U93A 1KYFA 3MLWL 1VGKA 5AKTA 3HFMH 3L3OA 3HZMB 4ENZA 3T0WA 4ODXB 3V7AG 2PPAA 4P2OC 4XB8A 2G2PA 3FRPA 4LNVA 4F7MB 3RX9A 4P4KA 1I82A 2OW7A 2XWXA 4H1LG 3SE4A 5CEYA 4EI5C 3FT3A 3CDCA 4CC4A 3D3VB 3Q2WA 4XO9A 3RKPA 1RZJL 1YUKB 4Y5VC 3VFPA 1T0PB 1Y6KR 2B2XH 5D5MB 2IALA 5AFAA 1S7QA 4ZUVB 3NG5A 4WWPA 1QEWB 2GI7A 2BZ7A 3VXSE 3V4UH 5IQ9A 2YD9A 4LCWA 3E0GA 5IBTL 1QRNA 5I6XB 3NCJL 2JE8A 5K9JH 3VYOA 3DJTA 3VD1A 5G4MA 3WIHL 5IESH 1PZ5B 2E4TA 3HHSB 1G6RB 1GZHA 3AWEA 2FWUA 3UO1L 4BZ2A 2XIIA 4W6XB 4M7LL 4QXUH 3V0VA 4ODUA 2UX7A 2MOQA 1R19A 1P6AB 4JFQA 5HI5D 2VSKB 4PJDB 3UROR 3UC2A 5IUCA 2C9SA 5F1NA 2AEPH 3BP4B 3AACA 4BH8B 3I2CH 1ORQA 3BLKA 2UZYB 3KW7A 5GZOC 3T4AC 4N22A 2QELA 3PCYA 3UAFA 1OT4A 4GW1B 4E2OA 12E8L 1QYGH 5IR1B 2ZAIA 1GYVA 4YHOL 5DK0B 4L3FA 3GXFA 1K2DA 5D7IA 4PJIE 2H4EA 2EKSB 3PHQA 5HHOD 4CMMB 3SPCA 1AZUA 4KKQA 3CQPA 4X4YB 3MRBA 3MJ7B 4HDIB 4BFOA 3CHSA 2IH1A 2FUTA 4X6BA 4DUVA 5E5RB 5JYLA 2KDYA 5KUMA 2EE0A 4A6YA 3RIAF 2R2EB 1BX2A 5E1AB 5FX3A 3OJDA 4Z3IA 1DLHB 3EGSB 1BZ8A 4HUXB 1CN4A 2R0LH 4PRBA 3F7LA 4G2AA 4X6DE 3LQMA 3CVBA 5TDPB 4G8IA 3VDBA 1T7ZA 4UT9H 4CKVX 3TVMB 1FLRH 2R29A 3FT4A 4L4TD 5E2WL 3IETB 2H2SC 4WRLA 3HAEG 3GPEA 2AV7A 3ELQA 4NBZB 2VDMH 5GZNC 4HJEA 4ODWB 4FQIL 5AB2A 2QGEA 3RNKA 5EO1B 1DBKH 1FDLL 5EORH 3SDAD 4HWBL 3BZDA 5CZVL 1DLFH 1WBZA 5HJGA 4XB7A 4DWHA 1XH0A 1SN5A 3N42B 4G8AC 4NUGL 4HLJA 4LLDA 2FIKB 2VL5A 2XOTA 4TLKA 4D7PA 4MBRA 3D25B 1A5FL 4QD2E 1T0NA 1LM8V 2BY0A 2NUPB 3HHRB 3OAZK 4HUWB 4J4PA 3ZDWA 3LMJL 3MMEB 1ED3B 4JM2D 5TE4H 2YPLA 4U49A 4BD4A 2BOLA 4N2GA 2EXWD 2EE6A 2DBLH 3UACA 4UIMA 3N55A 4F7EA 2OMWB 4R96A 2EIKB 1HWGB 4ORGA 4JVWA 4N9OB 1CGUA 5F9DC 1FL6A 3U2SA 3C9NA 4PV1C 1OGAB 5DD6A 4KRLB 5AB9A 4A63A 4AUJA 5E99L 2YPKB 4ZS6D 5C70A 3TBCA 4AYBA 3BVNA 1WICA 5AOKA 4KTYA 4RAHA 1K5WA 1YMME 3GD1C 1UCBH 2AP2A 1TMQA 3BZEA 4R9HA 2IBZY 5HGGS 5FB8A 2X09A 1TT6A 5DEGA 5IF0B 5EIVA 5CGBA 4ZFQA 1JK9A 1YO4A 1CWVA 3RBGA 2XA3A 3TESA 1IC1A 4IJTA 5CINH 4GKZA 4XAWL 1F2XK 1V3KA 2AVFA 2NNFA 5EUOE 1EVUA 3JWDH 3EJYC 3OMZA 4E9SA 1JHTA 3MLTB 2LV4A 3BD5A 3ZDYB 4BHUA 1OTTD 3ISRA 1T21B 5ETUA 2H8PB 43CAB 2BNRD 4M7KL 4TVPH 4KI5E 4PJGE 4XCFL 5BZDB 3HNVH 4FQXC 4RGOH 4K9EL 1UJ3B 1F58L 4FYQA 4AGPA 1L6ZA 4GUCA 43C9B 4ZXBD 5E0QA 5F7NC 1L5GB 1P1VA 2CR6A 5FYLE 3U46A 1GGCH 3LKQB 4U6YB 2VR7A 1BMZA 4BBWA 3ZKQD 4PLOB 1JE6A 3PP4L 1P4BL 4KQ3L 4B41A 2N01B 3SDAB 3FFDA 4E5XB 2P47B 1NBVL 1K8DB 3DC0A 5I1AB 2HKFH 5E5MA 3U4EA 2AZUA 2CHWA 2IAMB 2ZUUA 1KGXA 1KNOB 1P4LB 2WP3T 3JT0A 5HHQA 2ATPB 3VXOB 5MEOB 3CAFA 4JM2B 5SX5K 5LUMA 5C0CE 4DVBA 3KS0J 2R2BA 3CHPA 1RLBA 4ZODA 4BKLB 1R5VA 3OF6D 3CLEL 5B3NA 1BW8A 4M03A 1HHIB 3L3OC 1CFQA 4V33A 5DZVA 3VM7A 1CZ8L 4Z7NB 3UZEA 1OPOA 1DDHA 1PIFA 5GRXG 1OGPA 4N0RA 4L1TA 1KXVA 4P4KC 5D2LE 1ZLSL 4LXFA 3SE4C 4YS4A 1LMIA 3DWTA 1NWOA 1RKRA 3QIWD 3TOPA 5A3IC 4YFDB 2AXHA 4PREB 3DJRA 4WO4B 3WHE1 5B3JF 4GIOA 4X6FA 3MV11 3V0WH 3BPNB 4OTXH 1DBJH 2R9HD 4KVCL 4ZPTA 4AV5A 1AGEB 1KT2B 2E3VA 3K4DA 1A14H 1BLNB 2GTZB 4E9XA 1F4YH 4WWNA 4L4VE 2MRYA 5EC1A 3PAYA 3QDME 2B1HH 2NTFB 3UMTA 4F8OA 1XGPB 2Y5TA 5EEUA 5J6HA 5KOVC 3CFBA 4CGUB 1GZHC 1BYNA 4GQZA 5BO1L 1MCRA 4B9JA 4Z7QE 4U4BA 3LEYL 3NUKA 4AJVA 4JO4H 3QUYD 2AXFB 2EZ0D 4ZXBB 1YAZA 3K6OA 4LVNB 1ES0A 3E1F1 4KOBA 7FABH 5CKGA 3BSZL 3PE9A 4Z3TA 5AB0A 2BWDA 5IHBA 5F7EH 2P48B 3P9LB 2AQQA 4XAKE 5K39A 1OP5K 3WIIH 3C6EA 3GXNA 1FL3A 3N1QC 4AC4A 4JPKL 4HFWB 1OP3K 4F58H 1KIUA 2VQ1B 3GMOA 2J8UF 5FK9B 1IAOB 1ZT7B 4XE5B 4EE2A 3EXJA 2TRYA 4YXHH 5MEQA 3TS8A 2VR3A 3FMGH 3MUJA 3VSQA 3L6FA 4ZTEA 4QDGA 1F1AA 1T22A 4GPVA 4KDWA 5IHZA 1UXSA 2R1XA 4UTCA 1IQWL 5ADOH 1JGEA 2WTRB 1MCWW 1EO8H 1A0QH 3RPBA 2VZUA 1JHKH 4I77H 2DLIA 3TP4A 4PJCA 4BZ1H 3ZHDA 4JE4B 1DP0A 2VC2L 3CSBA 3E3QE 3S36H 4I0CC 1KJ3H 3NCFB 3WEMA 3VFVB 1BFVH 2OKMA 3NRFA 4R90H 5JIQA 1ZV9A 3CK0L 2G3XA 2XTSA 4N28A 2ZJSH 1NC2B 3QIWB 5DSCA 2ARJB 2R7EB 1UKSA 3GMNA 4W1TA 4GQRA 2X1PA 1RIHH 5EZIH 5MEPB 5M95B 1IL1B 4N0CD 1JPFA 4UYQA 5FV1L 3WV0A 3OPZH 5DCCA 4MVBD 4C4KO 5A1AA 1FZMA 1IZKA 3PGCA 1L9NA 4P04A 4PJBF 4XC3L 2CR0A 4YDIH 5T3XE 4O58L 3CZLA 1J86A 1NZRA 4URTB 4J4PC 5HD8D 2DQJH 1A7OH 3LKSA 1VFAA 5EOQH 1FYHB 1KULA 4ETQB 2YAEA 1FFQA 5I17A 2P5EA 1KGCD 2GUYA 4BV1A 4IEFA 1ILSA 1PW3A 2Z92A 1B0GA 3FCSA 4LDCA 2EECA 4MMYA 5I0YA 3BKCL 3HZKA 1USQA 3V0EA 2VO8A 2HRHA 1J5OH 2ZP9A 3OBAA 5TE7H 2D7OA 1VZHA 2WZ5A 3RB5A 4MD5B 3AT0A 5JIHA 1TPXC 2XQYA 1V7NL 4MHHI 4V1DA 5DUJA 1P2CA 1IFHH 3QDJE 4OH2A 5A6LA 3VFOB 4W9EC 1IRAY 1CFMA 1R75A 3GEWB 5E03A 2YMTA 4PJ8C 1L0YA 3PDOB 2H0EA 4NNXA 4CADA 5BOPA 4U6XA 5D1XD 1AZVA 3WJMB 2Q2EB 3S2CA 4C55A 4YSSA 4OZIB 3RWJB 4TL4A 3H6AA 3VI4E 3QNYA 1GMEA 1GGYA 2V9TA 5DTFA 1IEBA 3I6LD 3KYOB 3MBWA 4XMTA 2UUDH 5KN5B 5CO1A 3RWCA 4JHBA 4DP2X 1GL4B 4WUKL 4Y4FA 3E3QC 1TQBB 4D8PA 4GKSA 4GW4A 4XCNA 3TO4A 1ETB1 1UGKA 1DSWA 3IE4A 4GUQA 2RTTA 3ALWA 5DK2B 3T0DA 2EYRB 4ZFOA 4KKAC 1BG9A 5L8JB 4QRTB 4WEBH 1SY6H 4YNYB 1UZGA 4TNVK 5KYXA 1KJ2B 3QZWG 2FDBP 1DQVA 4G6FD 3KBFA 1ZXKA 4M1GH 2ICCA 4GAAA 5DQDL 4U1KA 1NKGA 1MRCH 3QQ3A 4KJWC 5FM8A 5F88B 5HPOA 2K6WA 2V9RA 1KIRA 2FEDC 3ZO0A 4WIQA 1ZLDA 4HUCA 3TM6A 1MFAH 2DKSA 5FOJA 3F7YA 1VA9A 2ZAHA 3SO3C 5EU3B 2WPGA 2HTLD 2ADJA 2NLJA 1NOFA 3GLAA 2MQCA 4M7LT 3UX9B 4OLYH 2LLNA 1XHHA 3HMWL 4Z0BL 1FIGL 5D1ZI 1SEBB 3NEXA 2Q5BA 2WQUA 1LD9A 3DROA 3H42L 1M2VB 4U1GB 1YNKH 2QV2A 2QVIA 2H0PA 2WYIA 4OCRH 1A3RL 1IGIH 4TLTA 2WVTA 5IFHL 2H1PL 1DJHA 4X5QA 1D6EB 1WAAF 5DJZB 5E8DH 5AZUA 2MTPA 1G7MA 1CGSH 1YAIA 4QRRD 5EV7A 3UJJH 5SWZD 1PLGH 3MJ6A 3EOBB 3KPSB 4F20A 3MGAA 4YFEA 2Y36H 3FB6B 3L1OH 3S5LG 4Z7VA 4O51B 2FBJH 4AEEA 2WYTA 2V9QA 4J2XA 5AW4B 2BS71 1TOXA 1ZHNA 5B22A 1OM3H 5D1XB 3S35X 1FE8H 1QUNB 1T7WA 2WSPA 4IRSB 2CK0L 2V17L 2WINA 3VI4B 1KCRH 4FFWD 5C1MB 1OPGL 3OGCB 4M8RA 5B4MD 4HHAA 2WXGA 3GJEB 3RWFA 5L88H 4HHGA 3BLBA 4QRPD 1YEDA 4L0ZA 1NFKA 2KLSA 4X98A 2FECI 3F58H 4JE0A 4KRPC 3STLA 2P5WD 2WMPA 5LBVA 1JCKA 2ENYA 3R4DA 1MCJA 4H20H 4G72B 4TXVB 3CXHK 3REWA 3CDGA 2XV6B 1O9ZA 4HWZB 4TPRH 3D9AL 4U1LB 3DMMD 3L48A 1PLBA 5A40E 4OLZH 1BQ5A 4NZUH 4LESA 2EDKA 4M3HA 2XDHA 5HYJE 3H9SA 4HPOH 5LGYA 1ZHKA 3LXBA 4YZFE 3FQXB 3QZLA 5IEKB 3ARDA 2V7NB 1FYTA 2DWDB 2V37A 4F7TA 2WXNA 4S1QL 1TZGH 5DVKA 4EDXB 3D50A 5TF1L 1PG7H 4M1DL 4FQQA 5LCVL 3GI8H 4N6QA 1S7VA 1DVSA 1E2ZA 3BVVA 2XWTB 5EIQA 2WBXA 5D7LE 1JPSL 2EDJA 3O6ML 5E9DE 4QHNB 1XH3A 1QBAA 5JOFB 5C0BE 1PZDA 2CBPA 3LQAL 1GOHA 2H26A 4JHUA 4MS8D 5SWZB 3U6XA 1MJUH 1E9QB 1N0XH 4E42B 1QSVA 5BS0B 5LWYH 3VWKC 2WAQA 4HOMA 4X6CE 1E5BA 2VN7A 5HYSB 3CFKB 3QQDA 2IH8A 4KROD 4AQ8C 2HLEB 2M8XA 5ERWA 4ZMWA 4U1SA 1L6PA 4OZHA 4IRJA 3B7UX 1PZ2A 3QDAA 2F58H 4LOFA 1LEKA 2F54E 2HTKD 4RBPK 2AEWA 4HS8H 3BAYA 4FC3E 5EC2B 2OP4L 2J2ZB 1AAJA 2QQLL 4P0DA 5B3SB 4JANA 4BELD 2K9FB 1MAJA 1TTRA 1TKWA 4FQHA 2VXVH 1HC1A 4EJ1C 3WFEL 5K1NA 4FA6A 4JG0H 3ZKMD 2JKLA 1W0YT 3BPCB 4QRPB 3GLEA 1N59B 3FQNA 1HIML 5I0DA 2O5ZH 4XOEA 4MB3A 2P5WB 5D55A 3N2JA 5BVPL 1FGVH 1WWWX 1OHZA 1C1EH 3LZPA 5E94B 3T2PA 4E41B 1XSOA 2YJLA 3HRZB 3RQ3A 2L3BA 5H94A 2ZSVB 5IB2A 3HOGA 1F6AA 3FF7A 4X8JA 2GY5A 2ZCHH 4WUUE 4WFFE 4JUTA 2P5PA 3LRMA 3NQKA 4GY4A 4AEHL 1NGXA 3UZQA 2A77L 2RCSL 4L1LA 3WUWG 1ZSDA 1DSFL 3ESMA 4Y8DC 3KPLB 4Z3JA 3O6FD 5FKPB 1FBIL 2R56L 2WXMA 4ZFGH 1HJCA 1CT8B 1D5ZB 1I8MA 2H6UA 3QQ4A 3QULA 4NPYB 2OSLA 1DCLA 4IRZL 3L9BA 4NIYE 4IU2A 1PFOA 5FGSA 4PJ9B 3QIBA 4YWGH 4Z18A 5EF0A 3INUH 4Y4FC 4KQ0A 2P9RA 2D2OA 3B2VL 1MFCH 5MENA 1WITA 3HMXL 2CIIB 1CIDA 3TO4C 3WD5L 1RSYA 4DKFH 4NFBA 3WE1A 4JFPB 2QSCL 4LNRB 3OXSA 1OZUA 4AE1A 3DTDA 1QFWL 3UTTA 1MI5B 2WIMA 2EDXA 4N2CA 5DUBB 1RUML 4XMUA 2V8MA 4KTGA 3JWOL 2YQ2A 5KSUB 3FQRB 4XNMA 3T8XB 3U1SL 1E0OB 5DLML 5FUZH 1B90A 2VJXA 4HV8B 1K6QL 4KROB 1RLWA 1BAWA 4KHTL 4POZD 3ZE0B 5HHXH 1N70A 4JQVA 4QO1B 3L3JB 2HPOA 3WXVL 3RVUD 2X88A 1HH9A 3Q0HA 4KMQA 2VLKA 3LIZA 3ZKSD 5IJVA 1LP9A 4F27A 4BWTA 3PQYD 3RTLA 2Z65C 2Y0SA 5LDSA 5EWIH 2YAQA 4A2LA 2VITB 3F62A 3II3A 3OKMA 4NCDA 4NKMB 2IFFH 4R4BB 4DFIA 1K4DB 4YHKL 1MJ8H 1SBSH 5G2NA 2Q76A 4HVBA 1SM3H 1S3RA 4PJXE 2QVTA 1BCIA 1N7ML 1ZEAL 4LSRH 1QLFA 4UOJA 4CN1A 3IRZA 4Z7WF 2JCCE 4KV5E 4K7PX 2XFXB 1U8OA 4X8GA 3GSUA 5JDSA 5I71B 5KUKA 1NLBL 3RI5K 4Y1TA 4WNJA 2PCYA 3NIGE 4GAGL 3C6SB 1OAZH 3EJZD 3HB3B 4Y4KA 2D3NA 3SYCA 4LBEB 2NY5C 4H8QA 3T77A 2EVFA 3LB6D 4NJAH 1RUPL 1M7IB 1HQ4B 1G6RL 1R3LA 2CO6A 4F8NA 1XSJA 5F7MC 4PJFA 4DIXA 2WIIB 4G8GA 2PW2B 1JGDA 2XWJB 5DDHB 1TQUA 3U1PA 2YAMA 1MW3A 5E51A 5L4MA 1ODAA 3V0AC 3MLRL 5B39A 3CFNA 5DGRA 1J1PL 1PDKB 5C0DB 3LQZA 4J3XA 2RALA 1ODUA 4IIZA 1BXVA 3S3DB 1AGBA 1UWGL 1XGYL 4UTAA 3VD7A 1BZ7B 6FABL 1M3JA 5D70H 2OZ4A 1HHKB 1YPZA 5I8OH 1H8SA 4LU5L 1IQDA 1QLRB 4NP4H 3A67L 2C3HA 3P2TA 2NY7L 1Q0YL 2PYFA 3AXLB 4UOQA 4Y16D 3S7GA 3W0WA 1KCVH 2VQ4A 5JOEA 2Z91B 5ESAA 4RDBA 3FZUD 4XGZB 1A1NB 3M17A 5I1LA 2AJ3B 1KENL 2IGTA 2WLKA 2VW7A 2X38A 4N3TA 5CMAB 3WL9A 3OKNB 4XWOC 4NHCH 5IB1B 3NJLA 3QDGB 2HFGL 2Q3XA 4GAYB 3QWOB 1GZPB 3TU6A 3ARDC 4PS4H 4JHWH 5KVDL 2WWKO 5F9OH 5SX4I 5LBGA 2E76C 5T5FH 1Y1UA 1F3DH 2PW1A 3TONA 1YEFL 1ZK9A 2IDTA 3BWUF 4GKNA 5JPMB 3P54A 1LQSR 5F7WC 4FAAB 4A38A 4K5NA 2FEJA 2O5YL 2XV3A 1LL1A 2OMZA 3GBMH 4O9HH 1JV5B 1DZ0A 5AEAA 5ID1B 3DX8B 5CZXC 2YRBA 4K71C 2EH7L 3KGUA 1EH9A 4NQCB 3HG5A 4QXTB 3QZPA 2I7OA 4NOFA 4Q89A 1M1SA 1OM9A 3Q2LA 1SBBA 5IVXA 4NKIL 4JN2A 3VXRD 1GTFA 1ESOA 4IRJC 1YYLL 5JOPE 1EBAA 4WJKB 1TZOA 5F21B 4HISA 4NC1C 4PJEF 1S4IA 1ZXQA 4IHBA 3MFFB 1AS7A 1YEKH 5ID0B 1SQ2N 3MRIA 5GGTL 3SY6A 4HJIA 4GRMA 2W0FA 3ZR6A 2DLHA 5I5IA 1N67A 2HRPL 1YEHL 3L9EA 1OSZA 2KZ1B 1DQDH 3HC4H 4UZSA 2X0UA 4OVVA 4JDZA 3RU8L 5CLYA 4MXVF 2W9EL 4M00A 4NWTL 4R3SA 1Y18B 1QWUA 2A9DA 4J3OF 4B60A 2PYEA 3X13B 1PJWA 3P02A 4UQ2B 3MKGA 4MXWL 1HEZA 4AX3A 4DGYL 4P5SA 3MGTB 3SDDD 1AGDA 3O6KL 2VM3A 4RFOL 1X5KA 4Y16B 3JWNH 1J48A 4TYUA 3L4TA 3BN3B 4KK8C 2NRDA 2X4RB 5HDOA 2CQVA 1A6AA 2MNUA 2ADFL 1E3ZA 2WZ0A 3KWVA 4LSQH 3GZOA 5AD0A 2X1OA 2F0CA 1A9EB 2OI9C 2CHDA 2QPSA 4Y9EA 5C6TH 1NPNA 2Z8SA 3ZRCC 3B7TA 1QWNA 5CR8A 5KYUA 1RFDH 5E8OB 3V5DA 4P3DB 5IWLA 2X6CA 3G5XA 2YD5A 4L1BA 3VQ2C 3PY9A 1NMCB 4PJ7F 4HUVB 5BCAA 1FRGL 4XP4L 4TUKH 3MO1B 5I1CL 1X5AA 3WTVA 3MXVH 4PRIA 2W9DH 3SKJH 3QIBC 5INDB 1OCWH 3E80A 2VLRA 3V79C 3KDPB 1G7QA 1I31A 4MX7A 2XKSA 4RWYL 5JQ6L 1MCPL 4F33B 4K7PH 2EO9A 4PUBL 5A6IA 2AKRA 3D39D 1SLUA 3KH4A 2XUWA 5DHYA 1UXWA 3BZ4B 4H0GA 4AITA 1IC5L 4R7LA 4OI8A 1I1CA 2OYKA 1XX9C 3II2A 4RAUB 1CDYA 5KW9L 2SEBA 2C1OA 4ZFZA 2MKLC 3L3HA 4NN7B 5D7JA 2Y6SD 1CD0A 1UA3A 2BSSB 1G43A 2BHZA 4XNDA 3RAJH 1XQ4A 2IDSA 3CVHA 3L45A 4JQVC 4JQXC 5I1JL 1SJEB 3IXAB 4B53A 3VXRB 2WLYA 3BUIA 3RX5A 2GSGA 4B9PA 4Z5RB 1HS6A 2OJEB 3WGUB 1CFSA 3EYSH 2LU4A 5C0AA 2Y07H 5FF6B 4ZAKD 3PIQB 1XB6A 2JIXA 3DI2B 1F42A 2AJSH 4FG0A 4HK3J 3GXIA 2QR0B 1IM3B 3GFUA 3DX0A 4OD1H 3IMRA 3WN5A 2WANA 2X6MA 3VRLE 1T1ZB 2BPBA 1T5WB 3WNIA 5F1KC 1L7TH 3P9MA 3CHXA 5EB9A 1BVLB 3ZKXC 5KVEL 3LZNA 5IG7A 3FRUB 1YNTA 2V4LA 1I3GH 2BSRB 3O2WH 5ESVB 2VE6B 5DJ0A 4FADA 3ZSSA 3IFPA 3HPJA 4PJHE 1I9IL 3NSXA 1GIGH 1T2QH 4BHUI 4JFEE 5D7SH 4Y4KC 3MV7B 4DVRH 3ARXA 1AFVL 3S34H 5F9WB 2QHRL 1XF2A 4Z9KB 3AY2A 3P0VL 3BGFB 4LLQB 4P4RA 4PW9A 3SKMA 3RUGF 4XBEH 4JJ5B 4MA3B 3VH8B 3RILA 2O5XH 2WBJC 3CMGA 1A7BA 3VMNA 4BM7A 2VMDA 4WGWB 3NEEA 3VXUE 1YEWA 3AADB 1A7QH 1CE6B 1WO2A 5D8JH 3H8NA 3QCTL 2AABH 1BFOB 2C1PB 3O3BA 3K2MC 4I4WB 1ASOA 2I5YL 2J3SA 4PRDB 1HI6A 1EEZB 2UY6B 5F89B 3TYFA 3UPCA 1IGML 3MI6A 1OB1B 1T2XA 5HHVH 4OZFH 3LH2L 4D9RE 2XTLA 4AUUA 3DDFA 1P7KA 1XF5A 2A6KB 3BJLA 3RVXC 3F12A 2WD0A 1NGZA 3EDKA 2YUVA 5E95B 4EZKA 2BOBB 4JW3A 2ICES 4QOKE 2FZ3A 4P5TB 1CIUA 4GO9A 5DO2C 2VDKB 3LS5L 5IFJB 3PHOB 5T1JA 1KEGL 4K7PY 4LLVB 5DJ6B 2VLME 3I3BA 1E9OA 1MFUA 4DOHB 2QGDA 4PP1D 5DZ9A 4TVUA 3MLPA 1I9EA 1WAAA 3IGKA 3KLQA 2Q0ZX 3NIDF 3ZMRA 3ILEA 5FYKE 3WTSA 2GEEA 5CBEA 4HOXA 4KOCA 3RVWD 1AGCA 5J3HC 2CGZA 3U7WH 1EEYB 3U7YH 1QZNA 5ABZA 4JFOB 4MQSB 3MV9E 2PTUA 2UZXA 5D1QA 1HHHA 5DFAA 1N19A 2M1KA 5E4EB 3BE1H 5C71A 1RQ5A 2IWGA 2A9CA 2ZSWA 4M7ZB 2FT6A 4N1EA 2Z31D 2GK2A 2QZ5A 4QXGL 4ISVA 4UIKL 4OJFL 5FHBL 3EJTA 2BFGA 2VR6A 1MUJB 3VE0A 4KPHH 1UD8A 4WI5A 1HZHH 2VXQL 5FKAB 2R4SL 1H8LA 3L5WA 3MRNB 4WWKA 1O6TA 1IIIA 5FOBA 5F1IB 3KPPB 3VD3A 3ASWA 3B9KA 1RHHB 5DLLA 1DJXA 2APWA 3ARBC 1ET8A 4JO3L 1XAUA 2NY1B 2LU3A 2X0VA 2XRAH 1U8IA 2YEZA 3BQUD 4HZLA 2NW3A 4DNLA 2BDNL 1TUPA 2EYSA 2FO8A 3RDTA 4D3CH 4X83A 5LGHH 3NN8A 2X4UA 4ZTPL 5I2IB 4TUOA 2H32H 2R0ZH 4LCIL 1D5RA 4PVBA 5HYIA 5EF2A 4I5BA 5EF3A 2JSFA 1NOLA 1T66D 5T8IA 2YC1B 3QUZD 3U1QA 3MVSA 3W9DA 2NY0D 2Z35B 4RFNB 1P69B 1TITA 4W9LC 3W56A 3KXFE 3QS3A 1WDAA 4AVJA 3C8DA 2Z93A 1RUQH 1U95B 5AYQA 4EQ3A 1CUOA 3CQFA 1A1MA 3HNSL 2EYTB 5EZOL 1YN6A 1OAQL 2V17H 2YPVL 4EN3C 3CQQA 3ZPDA 3OLIA 4TQIA 2ESVE 3KPNA 3V2AR 5JA9A 2KBGA 2WLIB 1JGLH 1URIA 4G8EA 1LJMA 1M6UA 1U8NB 5AYUL 4OZGF 2NNAA 1C5BL 5DT1H 1CDHA 2HVKB 4WI2A 1MFVA 5IWLC 5JUEH 1WWBX 2ZUSA 1GTNA 4OJDH 4R4FH 1KN2H 5SWSA 3NJXA 3UTQB 3X1GA 2QPFA 1T5KA 4W70A 4XHJC 4Q6YA 2J88L 1KJ2L 2AMGA 1SLXA 3GSVA 1UCTA 3TBVA 3PJSB 5HGBB 3KYKH 4RQQA 5E5UB 4YDJB 2VLJE 3EO9H 5CKAA 2OJZL 1DUYB 1CLYL 4RX4A 4X7DC 3WHE0 1VESA 1OAUL 4Z7OE 2AQTA 2WXPA 5T3XL 1E3XA 3GMRB 3EG9A 3B7YA 3WEXB 4Q2ZA 2CUMA 1PY4A 3H1ZA 5D7JC 3DXAD 1BXAA 1QBLL 4LHUA 4JRYD 5JHLL 3UPAA 1J9QA 1JPGB 3VB8A 2PO6A 1HHJA 3AUVA 3IDIB 1CL7H 5ALBH 4YX2H 1GCYA 3KL3A 3HC0B 3GMLA 3C60D 4P5MA 5KS9F 2YA1A 4HH9A 2BC4B 3VI3A 2JQZA 3BQUB 1QASA 3CBJB 4N8CH 2VDQH 2B3IA 3H7BA 2DDQL 2PR4L 5C0EA 3EDJA 4JG1L 2MCPL 1E6OL 1TTFA 1R5IB 4FQCH 1W8OA 4YSOA 1U3NA 2C9VA 3N85L 4NKDB 3SPVB 3TPKA 4JO2H 2ZOLB 3WN5C 4GRLA 1CR9H 2V8LA 4GFTB 5MERB 4WHYH 4U1NB 1HZLA 3EJJX 2QADB 3QUZB 1I7RB 2AEQL 4HKBB 2F53B 1FP5A 2COQA 4N4YB 2Z0BA 1T20A 3V4PB 1UT9A 1JF1A 4FFZA 4X5XB 5C6WH 3F04A 3EXLA 4G43B 3VDCA 2X2JA 2ITEA 4ESKA 4EXKA 2P46B 3QI9B 4P2OD 4M6NH 1MQ8A 1HNYA 2EICA 3CBRA 5AWNH 4EI5D 2W91A 2A2QT 3EDFA 4NQXB 4ELME 1JNHA 5KANG 2UX6A 5D5MF 1KTLB 3S96B 5IMKB 4ZO6A 3REVB 3UP6A 4Y1AA 1YC7A 5G5DB 4Z8FL 2DWSA 2GT9B 4JLRB 1A65A 5AOMA 1XH1A 2V9UA 1HE8A 3S3CB 2CLZA 5D1ZB 4HULB 3DHMA 1FO0B 1TETL 3VGBA 3UJTH 4NQSB 4TNEA 4AZUA 3KVDD 1B4JL 2ZOKB 4MASA 4GSQA 1U8JB 3KPRA 4NYLA 1IT9H 1D5IL 4AQEB 4LSPL 1T6BX 1XDTT 2EE9A 5C09D 2VNCA 3HI1A 4MA1C 3T6QC 3IS0X 4YQXL 1LO4H 1KPRA 1MHCA 3AMKA 4PJDF 4N6RA 1OALA 2WB7A 3KHOA 2BMKA 1WBXA 3L4ZA 4RAVB 3V7AE 4N2NA 4RZCB 1XZWA 4J2QA 5C0RL 2EDEA 2X4QB 4FFYA 3DXAB 4G9FB 4JRYB 5CWSB 3IDUA 5GZOD 5KYYB 2ADGA 3OAYH 5TH2A 4L3CA 2HJLA 3TPUA 3C60B 3TJEL 2YD4A 3QEQE 3LJ3A 2OR9H 3MNZA 3VXNB 4QRFA 2QQNL 4NRZA 5C0FA 4WI4A 5LG1A 1NJ9A 3NZHH 1RIUH 1W0VA 4QTHA 5CLZA 4P9HC 5GRVL 4WU5B 4XXDA 5F9JA 5E2UH 1AIZA 2D7TH 3JWOH 3PV7A 2VABA 1JSYA 5D1QC 3CIQA 2OXHB 3EGDB 3QEUA 2LLGA 3PWJB 4Q4EA 1TNNA 3MLZH 1XFPA 2H7WA 3VXME 3SBRA 1IM9D 1G7HA 5ICXB 1N6QH 4PG9B 5C86A 3DRTA 3DO7A 4OLWL 1SXZA 4P2QE 4FXKA 1ZS8B 2H2SD 1XGQA 4I7ZC 1TYRA 2HN7B 4QTIH 35C8H 4EI6B 3HS9A 1JVOA 4EI5B 5L2JB 2K3TA 3V8OA 4KZEH 4N5EC 3MJ9L 2DM4A 4JB9H 4WWKC 5GZND 1KG0B 1INQA 1X5IA 1PSKH 4O2FA 3B9KC 3VTMA 2GAZA 3OJ2C 3L7FB 3N42F 2Z0UA 4LPCA 5D4JA 3TV8A 4OD2B 5E2TL 4XB3A 3WNNA 2EEFA 2EDQA 4UTBA 3VQ1C 2IWEA 5CGTA 5E6UB 4BRJA 5KYWA 1KWKA 2ODIA 4HKJB 4EBQL 1II4E 3LKOB 1DDTA 4PVLA 3RDTC 3QCUL 3OTTA 4P2RE 1TTCA 1EFQA 4OJEH 2DQHL 5F6IC 3J07A 1C12B 1TFHA 1MEXH 4QGTA 2EEXA 3IVKB 1VACA 4AY0A 5C09B 1MWAA 1VB9A 1L9RA 3GGWB 3FB5B 4PGDB 3BFQG 2DI7A 3BKML 4GH7B 4A55A 3BH9B 3I6SA 3RL2A 3LV3B 2A6JB 3ZXAC 2FX7H 5ILTL 3RDJA 3WFZA 4C54A 1J10A 3TV3L 1WZMA 4NN5C 4Y19E 1U9KA 2DRUA 2DEWX 1UD3A 4IJ3B 4LHUG 3T4AB 5BJTA 4I3RL 2WNKA 3D4YA 4WTZA 4ZK8A 4BZYA 4UU9B 3A5VA 3TF4A 3W2DH 3WS3B 4D2NA 1HZKA 3D30A 4Y5XA 1GGIH 5DURB 5ICYB 1OB0A 3NFSL 4OFVA 1V3LA 3MUY1 5C7XH 3S35L 2EDWA 4ZSOA 3GUTA 1YEEL 3CH1A 5DHMC 1WIUA 4FA8A 1EHLL 2YBRA 1WS7A 5DEJA 1RJZB 2FX9H 4DF9A 4GINA 3KPMB 3OKOA 1E6JL 4M4PA 3CXFA 3Q6GH 5EBLA 3V7MA 2HVJA 4JCLA 4PJEA 3E8UL 3ZDYF 3G9AB 2A9ML 2V6HA 3O11B 4QEGA 4Y4HD 5DFVC 3EJYD 3ARPA 1IM9B 2O4EA 4UUJA 4MB5A 1ZKAA 5MI0C 3IDJB 3R0MA 3ERXA 3U9UA 5FW6A 3P4MA 4FQXD 4R26L 4LDLB 3SD2A 1MREH 5IOPB 2PTTB 4FFTA 4WWID 3OXRA 3F7VB 3GB7B 4B9CA 1KBWA 3F83A 5GS0H 2DWEB 1V05A 5EN2B 3MYJA 1G7PB 4OT1H 4Z7UE 1DBBL 2Q86A 1JK8A 3U6RB 4MJIA 5IREA 3SB3A 4LCCB 3VFMB 1TCMA 3O4LA 4JM2F 4HBQA 4L9LB 1TZIA 3BKYH 3HG1A 2BIHA 4ZDHB 3STBA 4GRLC 3WG7B 4M5ZH 1EGJA 2JK5B 1MVUA 1W0WA 1CLOH 4G6JL 3BKJH 4Z7NF 4RMTA 4LVHC 5GJSH 3HLAA 3K5RA 4NT6B 7TAAA 3SEPA 3WGVB 3SPJA 5IUSA 5HPMA 3D85A 2IANA 2QSQA 4F24A 2P4AB 4G9DB 3NSJA 3APNA 1YN7A 4RIRA 3ZRFC 4IKNA 3HIZA 1MCBA 3FNKA 1FNSL 2PWHA 2Z7UA 3L95A 4JRXE 4L8BA 4LEXH 1WG3A 5CD3A 4YAQB 2WO3B 1YECH 4P4KD 5E6ZA 4JR9H 3FS9A 4TULL 2A9NL 4U6TA 1YMMD 1P84K 1DE4B 4LE8A 5A3ID 3U2JA 1P6WA 3QDHA 1LDPL 5FO7B 1CLCA 2ZWYA 1JYWA 3GTTA 5BOZG 3IJHA 2P7TA 3MN8A 4K07A 3UBGA 4OCNC 4HGMA 2DM7A 3PGFH 5IOKA 4PVNA 1F86A 1J0HA 3LRKA 2B8OT 2OL3A 2LE9A 2FEEI 4PGCB 3K6FA 4NUMA 1YY8A 5CP3A 2OMTA 1TDQA 2R1WB 4NGHH 4NO3B 2ZE0A 4WFHE 5DJ2A 5B21A 3ECBA 5HDQH 4FQLL 2AFNA 3IT8D 4KHXL 5AOLA 2ICWA 1F3RB 1I7UA 5FYLD 4DGVL 2VKWA 5E2VH 4F37F 1R5WB 5C08B 1AG0A 1IEAA 2QSTA 3GZQA 5CJQL 1G1OA 5I1KL 3TYGH 2ZKYA 4DEPB 2P8LB 3GNMH 4JKPL 1AOHA 1CGWA 2XWBB 1XBRA 2OPCA 2C4FU 2BHUA 4IMLB 3T6ZA 4C59B 2DQ6A 1S9VA 4HXAL 4N0FB 4KQ4L 4U3SA 3L4VA 4XNZB 4ZUWA 3GHBH 4MCYB 1ZPLA 4YHLL 4H88L 5DC2A 3GMPA 2J5LC 2B4CC 3LKNA 1J5IA 4XVJH 3GXMA 2CDGA 5FM4A 1EJ6A 4N2EA 3ARFB 1RI8A 4EN2A 2DQEH 2K8MA 4M4RB 2A38A 3BP7A 3GSXA 2AXGA 4J6RL 1AIFA 1U93B 5I9QC 1VGKB 3L3OB 3LPWA 4UZGA 4MRCA 2H3NA 4HMEA 2BSDA 4FXKC 3L4UA 3F6JA 3FRPB 4PRAA 1JGUH 2FRGP 4FE9A 4P4KB 4G6AC 3HE7A 4CSPA 5CEYB 1KTDA 3NMEA 4WTZG 1AACA 2QQKL 5PAZA 3RWDA 3SKNA 4CVWA 3W39A 1K85A 4O4YH 3MLXL 3QRGL 3VFPB 2YKKA 1KYUA 1EJ8A 3W81A 1NTDA 1PZSA 2IALB 4ZT1A 5FIEA 2DD8H 1DJSA 3ZN6A 1UVQA 8FABA 1P0SE 4ENEC 3QYNA 1XGRA 5IQ9B 1CICA 4LCWB 4DGWC 1QRNB 1DN0A 4J4PD 1UXLA 1F2QA 3ULUE 3QFGA 1RIVH 3EO0A 2YPLD 4ATWA 1ZLVH 1JXKA 2CALA 3T0EE 4I9WD 1NC4D 2CRIA 4XXCA 1A22B 3V6FA 1JTTA 2HFFA 3V0VB 4ODUB 1G1CA 4K3GA 4DK3A 5EEVA 1TSRA 5IVOA 4APQA 1IBGL 1HCZA 4JFTA 1KB5B 4OIIL 5F1NB 1ORQB 2X4SA 1BV8A 1Z1WA 1HXMA 2A74A 3NZUA 4J3OG 3WKML 1OTSC 4XAKD 2ZX8A 5FUOL 5CHNA 1JOIA 3WFCH 1S5IH 4Y5XC 5FYLH 1K2DB 2I7SA 5D7IB 3CN3A 3PHQB 1YY9C 4UAOC 4PJ8D 2MOGA 4OZIF 2Y6TE 1WH0A 1NDTA 1IC4L 1GJWA 1QACA 3MRBB 3SE9L 3BP5A 1OCRB 3BDYL 2IH1B 2ZUWA 4X6BB 2EXTA 4J3BA 1UM5H 3CLFH 1ZJAA 5CJXA 2WAHA 3MOQA 1BX2B 3OJDB 3UFIA 3O0RH 5CJBA 3QHFL 1P5UA 4PRBB 1FSKB 3TWCL 1S3KL 1XWVA 4G8IB 2F9BT 2Y3AA 4KKBC 4L3AA 1AQ8A 2YSSA 1VJSA 3FT4B 3MFGB 3MLYL 3FQYA 4JCWA 3GDBA 4U6VH 4PRHE 4KKAD 4MZ2A 1NGWA 3TWYA 1NGPL 3QWRA 1RVFL 2AV7B 1RZ8A 2HVBA 3TT3L 1KFAH 3RWEA 1MN4A 4QUOA 4PWKA 3RNKB 3BHBA 1H9DA 4JAMA 2NXZC 3UBHA 4FQPA 3DIFA 4KJWD 1FAKT 1D6VL 1JGIA 1Q0EA 2FEDD 1WBZB 3POCA 4IBLT 3O9WA 5KVFE 4LLDB 3IJ8A 2XWEA 1PG7W 2VL5B 4MDRA 1UM4L 3WFDH 4M5TA 4FI7A 1T0NB 1NL0L 3N40F 3ZKNC 4OCSL 4A2FA 1XEDA 2HB0A 2YPLB 4OZGA 4CVXA 4OM1L 1EX0A 5L0QC 3S0PA 4XPHL 3I9AA 3HN8A 4F3FA 3QQNA 1GSMA 1S9YA 4H25A 1F4WL 4FLSA 4GNKB 4UIMB 4DKEL 4R96B 2YOCA 4D0CB 4GG8A 4ORGB 4U4IA 3FTWA 5DF0A 3SO5A 3GMQA 1NIFA 3LPFA 1FL6B 3U2SB 2DQCL 3C9NB 5LQBH 4JPWL 4OLEA 5DD6B 5EO0A 3QNXA 1TPXB 3BVNB 4XN8A 5FA3A 3BFOA 3S8FB 1XIWC 5EIIA 1EJFA 4NHUA 2Y7NA 4PRNA 3BZEB 5FB8B 1BD2E 1BIHA 4HXBH 1I1AD 4ZX3A 1IAKA 1NCGA 2VN5A 5AALA 1NBQA 1TMCB 5DEGB 4DFHA 4DKDC 4DHLA 1CB4A 5KJ4A 1JK9B 2BIQA 4NKOA 2CMRL 1RZ7H 3AWFA 4EDWH 2VDKL 1G0YR 1VCAA 4GKZB 2X41A 1VFOA 4NJ9L 1ZSHA 4DEUA 3LKPA 3X3GH 4UDTA 1JHTB 1AR1C 5DRWA 1CTMA 5FGBA 1DYZA 2XV2A 3R19A 1G9ML 5GISL 2R0WL 4G42A 5ETUB 4LDEB 4LP4A 4YL4A 4KRPD 3DDGA 3VG9C 4PS8A 4LAJH 5JHAA 1MVFA 3T6WA 3T9WA 2BP3A 3TNNA 4U3HA 5CSGA 2Q8AH 3U46B 3ZDXB 4QRQA 4NZRH 3HVDA 1IAII 1XXFC 2PPDA 3NH7H 2P42B 3BMVA 3SPIA 3FFDB 1QSFA 1Q38A 5GIRA 3AB0C 1KXQE 4NRYA 3U4EB 5E5MB 2I26N 4FL4C 4XMKH 1MHPL 4AL8C 4RMVA 3SO3B 1W6WA 1I7TA 3J7HA 1BQHA 1LK2B 2ZWZA 3GBEA 5HHQB 1NKRA 2GJ6A 4RETB 3FH7A 4WLCA 4DVBB 4Z6AT 5T3XH 3AMLA 4PU2A 2R2BB 4NQTA 4QRUA 2UWEA 1U0QA 1R5VB 3WTYA 4YHMH 1MPAH 3BO8A 1R33A 1Z9PA 1CFQB 1CK0H 5DZPA 3OAUH 2Q8BH 3CCHA 1WUNT 2J43A 1VSCA 2Z4TA 4X7FC 1IVTA 1DDHB 1HHGA 1PZ5A 1HXKA 4JGJA 5CU5A 5DGQA 3TBBA 2G60L 4F7PA 1AMXA 1H3WM 4JRLA 4DN4L 4JO8A 3UEZA 3VWKD 3SGKA 3ZHKA 5CZRA 1JZHA 4JDTL 3BP4A 1HILA 4ALAH 1NEZA 2SODB 4ZMLA 4F9LA 2WXFA 4HKXA 4X6FB 5E1QA 4RDQF 2BW5A 4ZPTB 3FUIA 3Q5YA 5DK0A 1CICC 3H4HA 4M7JH 4HEMA 3I02A 1KC5H 2B5IB 3EOYG 5EC1B 4F7KA 1MH5A 4B9GA 1T0MA 2O5NA 2Y5TB 3U30C 5J6HB 5TE6L 2P5ED 3CFBB 4XR8C 4M62L 1CDGA 4XXCC 1BAGA 4GG6E 2N56A 3V4VB 1SOQA 2B08A 4LSUL 1YEGH 2QJDA 1FJ1A 3FN0L 1AH1A 3QR0A 2DH2A 4HS3A 2VMEA 4KRPB 1YDPA 3UIYA 1CXFA 3WYRA 2W07A 2Y7MA 4APQC 1UZ6E 5CNHA 2ENJA 1CXEA 1J0KA 4WFGD 4WFEE 5FYKL 2N1KA 3UJIL 5TDPA 2H3KA 2A74C 2QKIA 5JIMA 4FNPA 5LAXA 4V2CB 1SNRA 3QW9A 4V1DD 3ABZA 4WV1C 5K39B 5HYJD 1FPTL 4N9GA 1CFVH 3O6LL 1FL3B 1OCCB 2CIKA 1INEL 5IIEA 4HJUA 1KIUB 3K8KA 4OI7A 4HEPG 3GMOB 3HS0C 4GI9A 1TJGL 3W3BA 5JA8B 2KMWA 5LXGH 3NIFE 2VOTA 5MEQB 3ML8A 5CJXC 4DH2A 5B7EA 3T6XA 1QHQA 4BFJA 2BVEA 3L6FB 5AW5B 1T22B 5IHZB 1CGTA 2Y5QA 3MV8E 2GJPA 3Q1SH 1UXSB 2R1XB 3CZEA 4IK7A 2V3EA 1JGEB 3D25A 3MOAL 4Y4FD 1GJIA 4PJAE 2WZAA 3BQVA 1TEFA 2PTVA 5DFWH 3FT0A 3TO4D 4LCYA 1ZIAA 4PJCB 3X12A 3NAAH 1N68A 3D6GA 4HC1L 4M5YL 1BZ9A 4DETA 1F11A 1AMYA 3QFJA 3N1PC 1Z7JA 1SDAB 2BP8A 3ZKXB 1IKNC 1WSST 4ZG1A 1AZCA 2XBZA 5DSCB 4OLUL 3ZE0F 3GMNB 4WENB 4BWUA 5E08L 1ASQA 3DV4A 4XPGL 3UGUA 5ISZE 4HBCH 1WIPA 5I1IH 5JW3H 2M26A 4U1IA 1JPFB 3I74A 3O9WC 5EIIG 4LIQL 3V4PL 1UD2A 1GXEA 5F7LB 1E5AA 1FZMB 3PGCB 3RYMA 5H35A 1F97A 4JZOA 2FX8H 4DKTA 4DZBA 3FXIC 5HHOA 3LKSB 1VFAB 5MHSD 4PD4K 4C58B 4PPTA 5AG9A 3U48A 5I17B 2P5EB 3UTSE 4U7SA 4H8WH 4B50A 5HHPA 2HKAA 3AT9A 4IEFB 3FCSB 2Z92B 3OC8A 1B0GB 4HUMB 5E1IA 5H8DA 4MMYB 4E9LA 3RKDD 3HZKB 5BZZA 4M8VA 4U33A 3VRIA 1FH5H 1FAIH 4DQOH 1AR2A 3C2AL 1QPXA 5ANHA 2EDHA 1FO0L 4L4TA 4V1DB 1XZ0A 1P2CB 3MX0A 5GGSY 5IBUB 2CKBH 4LRNL 5DXWA 4MBOA 5FUCC 2V33A 1B4LA 1WEJH 4NNXB 2MQ3A 4CADB 5DQ9A 4L8DA 4U6XB 3TBYA 1JNLH 1Z0NA 1BQHG 1KIQA 2J25A 4J8QA 4Y9BA 3PWPE 3APDA 1DCEA 3QNYB 5DTFB 4Q56A 1MZYA 3FTVA 1IEBB 3QCVH 1MJ7L 3MBWB 4IGBA 3MZTA 5TDNA 4XO5A 4ONFL 3WBDA 1WUZA 3G04A 4Y4FB 1A4KA 3A4DA 3LTVA 4GKSB 4GW4B 5D7EA 2ID5A 3HI5L 4XCNB 1KNOA 4D8PB 4LOUD 3TO4B 4O5LL 4X4XA 2AJYH 4GXVL 4JM2A 1A25A 4OGYL 3JYBA 4IOSD 3GIZL 4LSSH 4BFBD 2X40A 5A7BA 4ZFOB 1E4WL 1EMTH 4ZRGA 5C8JA 2WQRA 1UEMA 5KYXB 3Q9QA 1K5NA 4OI9A 3TTYA 2CSPA 2E27L 3ILPA 2OAAA 2FECL 4JZJA 1N6VA 2AITA 4BFRA 4WHTB 5JDJA 1MCHA 1F02I 3CWGA 3EH2A 4YZWA 5DRXA 2LQRA 2IGFL 4U1KB 1XD1A 1RUKL 3QQ3B 3SODB 1KIRB 1MG3C 1GA2A 1QOKA 3IWVA 2A6IA 4BSWA 5CR1A 1HK6A 4XWOD 4CC0A 2WWMC 5GS2H 2K7PA 3F7YB 4L3EE 3GSWA 1DJWA 3DOSA 4HFUL 5F96L 2OK0H 1VENA 2ADJB 4MNGE 2NLJB 3ARDD 4YDKH 1R24A 4M02A 2R1YA 5KYNA 4G83A 3O2DH 5L8LB 2BSBA 1N12A 1IVLA 1E8WA 5E56A 2BIPA 4GP8B 1LD9B 3DROB 4NM8H 4AWJC 1ID5I 1K3IA 4YLQT 4G7SB 1WBYA 4H13C 2IO5A 1Y0LA 1G7MB 2BNRA 1F1DA 1ZD6A 3W38A 4OQTL 2BFVH 1NDGA 5CJOL 5CZXD 3SGKC 4ODBD 5JHDD 5TPWH 3KLHD 4Z7VB 2FWOA 4F9LC 3N91A 4CRPA 2NYZA 1MCNA 3PWVA 1L4IA 1ZHNB 4IRJD 4YBLC 4POYA 4ZTOH 4EIUA 1VFUA 4L37A 4N1CA 1ET5A 2WINB 3FU8A 3FHQA 3D69A 4WCYH 1EUTA 3CXHJ 2NY5H 2OQJA 1A6UL 5DZJA 1R3IL 2VXUH 1EXHA 4HHAB 4P2CG 4BZ1A 1BOYA 3RWFB 2DF3A 3BD3A 3BUYA 4IKIA 4MXQC 1YEDB 2XKNB 4X98B 4BKSC 5HYFA 3STLB 2WMPB 4FG6C 4MB4A 4HJJL 1H3VA 4JY6A 2W94A 2FO1A 2ZUYA 3INOA 1KGJA 3Q8FA 4A04A 4LHQB 3OF6A 1FC1A 5FGCE 3REWB 2QKIC 3CDGB 2WWKT 3HW7A 3QAQA 3LOWA 1ZGLM 2EIMB 5D93C 5FHAH 2AVGA 3ARGA 5F0LB 3QPQC 3ZTDC 3FCTA 3DUUA 3OLDA 4YIQA 1HINL 1XAKA 4M93C 2VH5L 1OF2A 3WJLA 2E9WA 2OR8A 3U7AA 3CJJA 3A24A 3H9SB 4JMNA 1ZHKB 4XNYL 1MFBH 4Q0XH 3ZZLA 4M8QB 1V7MH 2CD0A 3ARDB 1FYTB 5DQJA 3U4BL 3MREA 1GOFA 4NI6A 2YS4A 5IHUL 4F7TB 1MNUL 1ETJA 4WTQA 5LBSL 3Q13A 3IBOA 1CDIA 2ZCKH 3QIBD 4LQFL 4BQCA 1JDCA 5EEXA 3MNVA 3L9RA 5MEND 4FQQB 4YSUA 4FP8L 2VDNB 4EF3A 1S7VB 3T2NL 3ETBJ 3NCXA 1ZGLA 4NQEA 3CFDA 3HJEA 3KG5A 2XBTA 2BWQA 4OGQC 4NAJA 4CVZA 1SQMA 1XH3B 4Q9QL 2WY3B 5FWRA 4M6MH 2PWGA 4KJQC 3WNMA 3B9EA 1S6NA 4D8OA 3MODL 5CD5C 1J1OL 4S2SA 1A7NL 4K71B 1OK0A 1QWHA 3QUYA 3QQDB 1IX2A 4F57L 1EO5A 5CILL 3QJTB 2JLLA 4S0HA 1VIWA 5ERWB 1VF5C 2F18A 4U1SB 1P5VA 4N0YH 4OZHB 4IRJB 3BWZA 2IOOA 1LEKB 2CGRL 2V7HA 5ALCL 1RL1A 2VLKD 2Z8RA 4E5XG 4XVSH 4JANB 2XX1A 1UA6H 3JWDC 1TKWB 4FQHB 4ONHA 1UM6L 3HNTH 4KTEL 4EIZC 3L5IA 3TLRA 1GVIA 4GKLA 3FQNB 2VDOH 5GRUH 1B2WH 1F0LA 4GUPA 3AQDA 3NSDA 2H47C 3L9YA 3FTXA 5HVHC 3IDNA 1DBMH 1OCZB 1TO5A 5H94B 4PHXA 5BVJA 5IB2B 1F6AB 1TVBA 2NY2C 4PWIA 4X8JB 2RA1A 5DK2A 3K72A 5DJAA 1PEWA 5F7FA 3W82A 4Y4KD 3ATAA 1NGXB 3E2HC 3UZQB 5IQ7H 4W81A 4IBVA 4XCCH 5BQ7A 5CS7A 1ZSDB 2OI9B 3FN3A 4JFFA 4YFLI 1DL7H 3GJFK 4ZOBA 5K69A 1IBFA 4GAJL 1YZZA 1I8MB 1BA9A 2L0DA 4BH7B 1DFBL 5J7CC 3QQ4B 3QULB 4FQJH 1X9QA 2NCMA 1WWAX 2WBJD 3CBKB 7PCYA 2OSLB 2EUXA 4F5CA 4IU2B 4PBVC 4IGBC 3K91A 4ADJA 3QIBB 1OGTA 2XY2A 4YHZL 3DK0A 1CE1H 4D9LL 5MENB 1OAKL 3LHPH 1N5YH 3SY0A 3QXAA 4A1RA 1TTAA 4CILA 2FTAA 4DGIH 2Z64C 3N41B 3P0GB 4JGMA 5DS8B 2LU5A 3OXSB 3RVXD 5D71H 5I76A 4JDEA 3FAWA 3UG3A 4K4KA 3KBEA 3UTTB 3F7KA 1UWFA 2WYHA 4ELKA 4KWUA 5I16A 4ZUTA 1SEBA 1LDSA 1W16A 3HI6L 1LWHA 5D2NE 2EDFA 4X2UA 5DO2D 1OWWA 4XNMB 4WI0A 5D7KE 1BXUA 4DN3H 3MNWA 3DJSA 2XKUA 4K5OA 1SEQL 3DETC 4LFHD 4Z95H 4ZS6C 4KO5A 1PKQE 3H3BC 4L29A 3IMWA 2BHYA 1HH9B 3ABGA 5FYKU 2C9RA 2VLKB 2DLFH 1LP9B 1GJUA 5KBLA 1QA9A 5B3JE 5A2BA 3CH8A 4M43H 1D3CA 4MA8H 5J3HD 1AD9A 5BV7C 2G4EA 3OKMB 1ZV2A 2XA8H 4OCMC 3P30H 2K6ZA 2Q76B 3M86A 3WKYA 5FO2A 1DANT 1JI1A 5I5MA 1QLFB 1BP3B 4LP5A 4R7NA 1WP6A 1IKFL 2J4WL 1O6SA 2DL9A 1U8OB 4XVTH 4JFED 3LRSA 4FEIA 4NEHB 3GSUB 5JDSB 1MNNA 2J1ZA 5J13B 5HI4C 1H3GA 1T04A 5LLIC 4FHJA 5AB1A 4TN9A 1Z32X 4Y4KB 3NP4A 5H4YA 3T77B 2X89A 4KRMB 2HLAA 2ED8A 3V6OA 3NZ8B 3V95A 4HAFA 1E4XI 1R3LB 1WISA 3LS4L 1RK7A 4JX0A 5EPMA 4BZ2L 2KLRA 4N2AA 2EDNA 5DS2A 2UY7A 2ZCLH 4MDIA 2XN9E 1YYML 2XLLA 5D4HA 4PJFB 3ARBD 4G8GB 1JGDB 4UT6H 3L5JA 4M6OL 4ZNEE 1KB5L 3MA7A 1NFIA 1P4IH 4D9RD 4LSVL 3EJUA 5AVYB 3L1EA 5B39B 1BJ1J 2AQNA 5C0JA 3JBG7 3ORJA 1F3JA 2J8UE 3LQZB 1KBGL 3FKUS 4UBDC 2E7LA 3NACL 4NO0A 1AGBB 3F84A 4QOKD 1YPZB 5DD5L 5BRZE 2QVFB 2B7DT 4YLBA 1IQDB 5EUKA 3CXDH 4M29A 4I1PA 3W0WB 2PYFB 3KEHA 3EOTL 3L1GA 1L9TA 1QBBA 1ZVSA 5ESAB 1BREA 2BRQA 3ARGC 1JZ7A 3M17B 5I1LB 4IOFC 4XTRC 3WL9B 2ETWA 4QRRA 4EN3D 3GHEL 4KVPA 4F2ME 2X2IA 5JPNC 2JWYA 2WUBL 1YUHA 2HJFA 3C5ZA 3ZE2B 1BQLH 3T1WA 2H6PA 4FA7B 4ZW5A 1CVRA 3MQIA 1FORH 1VEMA 3BZFA 1J0IA 4HJTA 4AMKL 1LO2L 1HVXA 5GGQL 4N25A 4R5VA 2VMJA 4XBGA 2CO4A 1KPVA 5HSFA 3OL2A 1CBVH 3FO0L 4XHJD 2VLRD 5HTSA 2PW1B 3TURA 1KB9J 2NZIA 2F5AH 4PJBE 4UV4H 2C34A 5TQ0L 4A7UA 2ZT9C 4HG4K 4GKNB 4XH2A 4M1CC 1JYXA 2QVMA 3F00A 4KGJA 4Q74A 2OMZB 4TSCL 4DP0X 2CG9X 1KCBA 1F8TL 1LNUA 1CYWA 4Y9FA 5D7JD 1HCYA 3QO1A 4U3CA 4WQOA 2JI3A 1N4XL 3E8VA 3RFZA 5IVXB 4JN2B 2COVD 3DJ9A 1OY3B 2K6YA 3WHXA 3DMMA 3MA9H 3JVFC 5J8OA 4R83A 3ARBB 3MRIB 4GRWB 2X9WA 3WMSA 4APXA 3SDCC 4KKZA 1YVLA 4BSVA 4GRMB 1JZ6A 2W0FB 3ISYA 4PLJC 5EOCJ 2CJUL 1OSZB 2JIXD 2W81C 5DR5H 4JDZB 4NZDA 3QO0B 3SGJA 4R3SB 3FC8A 5MP6L 4OJYA 2FBRA 1EZUA 1J0JA 3B9AA 3KLAA 3T2OA 1T80A 3HVNA 3NCEB 1J8HE 2PYEB 5IROC 5C92A 4HCFA 4OCWH 4DP6X 1HEZB 3WTUA 2NT0A 4MS6A 2X3BA 2NY4C 2D7QA 1AQDA 1AGDB 1PNDA 1NPUA 3DPBA 2W60A 1XF1A 4UINL 1EZVX 4FNLH 4O02H 4OLVL 1KGYE 1JUFA 1A6AB 1IGFL 1QI5A 4JM4H 4XI5C 5ACMA 5L8KB 4DERA 4HMCA 2G30A 3MLSH 5AD0B 1KGIA 1FVDA 1EEUA 4FI8A 1C5CH 2O93L 4XP6H 1HKLL 3ARYA 1URLA 5KYUB 3V5DB 3G5XB 1A7RH 4EOWH 1T7XA 4QO1A 3JV6A 3MRLA 4C4UA 1X44A 5DFTA 3TBWA 3CV5A 4FCHA 4P9MH 2GITA 4PRIB 3RL1A 3DX1A 3FOMA 2VLRB 4X7SL 3C87A 1TJXA 3GINA 5KSBF 1G7QB 4MX7B 4X80L 5FYKH 1T7YA 1E5CA 2VLJD 3WE6A 2JKIS 3EYUH 1G4MA 4DPBX 2FNWA 4AYID 1T0OA 1JNNH 2AKRB 2YFOA 4NDMA 3HE6A 5IMLA 5DHYB 1UXWB 4KY1L 4HIQA 1CXKA 3T08A 1RULH 3WEAA 2GABA 4L05A 1VKXA 2SEBB 2C1OB 2X6AA 1P7QA 2XZZA 3L3HB 3NDZE 5D7JB 4ZFZB 4CSSA 3KJ6L 2WO4A 5BQDA 4K3DH 1N3NA 1KXHA 3CVHB 3EBGA 4V2BA 2MTAA 2AI0L 4KZ0A 4XNUL 1WAAE 2DLGA 3SQBA 1TJIL 5GGVL 3EFOA 2V3DA 3QUXD 1MQKL 1H5BC 1CFSB 1MFNA 5C0AB 4ECNA 3UIZA 3EH4B 1AZZC 3O6FA 3ZTCC 4FG4A 3S98A 2O6EA 3D33A 1FF5A 1W9XA 3IGFA 4Y7OC 3ZX1A 1IJNA 2JIXB 4Q52A 1A6VL 3GSOA 3F3HA 4AG4H 2ZKMX 4M61A 1GHFL 4K23L 2EO1A 4OCYH 3V0IA 1W72H 4NS0A 1EZSA 2XV0A 3WN5B 5I19L 2YWYA 3ATEA 1HSAA 3P9MB 1UEYA 2VW6A 4NCC2 4EKJA 5IG7B 5E08H 1YNTB 5D4QA 2ZUVA 2WSDA 3Q3GA 4ODVL 5DJ0B 4BK4A 2EC9T 1AYRA 3IFPB 3HPJB 1KLGA 4FZ8H 4UT7H 2DQIH 5JQIB 5DHVH 1VDGA 1SYSA 5C2UB 2FYYA 4BK5A 4LEOA 4F37K 4PB0H 1XF2B 4RISH 4N5ED 5F7YC 3V0DA 3CNKA 2FGWH 4P4RB 2ED6A 4N2IA 2ZPKH 3B9KD 3V4VL 4TQEH 2VR9A 3QXTA 4XGZA 3K1DA 3QJFA 1LO0L 5KVGL 2FJGA 3ZGHA 1M6OA 2ZWKA 1FZOA 2AGJL 1NCUA 5T5FA 2FB4L 4AUYA 1HJBC 3OG6B 5LNEA 3RDTD 2L4OA 2R69H 4KZDH 3TYFB 2HTLC 1JD9A 1HI6B 3EHBC 5E9AA 4AT6A 2A1WH 1DBAL 1WCBA 2EDTA 2MKWA 3BH8A 4G5AA 4L8SA 4RDQG 2E7LC 3IMUA 3ZT6A 3PQYA 1P7KB 3K6SA 4HD9A 1XF5B 4Y9CA 4MSWA 5KJRL 3F12B 2J1KA 1NGZB 3K81A 2AK1L 4GMSL 4MA1B 5AVSB 3SJVE 4CN4A 4GP5B 1QRKA 1RZKH 4JKKA 3KMDA 4B5EA 1OARL 2OMYA 1S9KC 2FZ3B 1NWPA 1OSPH 2IGLA 3R1GH 4NLHA 2WKOA 4X8XA 1JWMA 2CGYA 2Z7YA 3LEVL 1SJHA 4AEIL 1WFMA 2E9GA 2R0KH 4HQQL 5HGAA 5BUPA 1E9OB 4IU3A 2NW2A 4RFEA 4IQHA 1EFXA 5B1BB 5FLVA 4BE6A 3C5ZC 1QQDA 2GBUA 2KL6A 2FATL 4QAWA 2PCPA 5TQ2L 4NB7A 2YKLL 5SWSD 5F9AC 1NDMA 5CBEB 1VFBA 1S9XA 1AGCB 5ABAA 3SGDH 3N1FC 1KN4L 1REIA 1SOKA 3K8LA 2ZUQC 3MRCA 4PTUA 4PW3A 5KWYC 2JKRM 4OIFA 5E00A 3GSNH 2AJUH 1KEML 2UZXB 5D1QB 1HHHB 1WPCA 4JM0A 4QHPA 4JO1H 2MJWA 5DFVD 2ZSWB 1P9MC 1ORSA 1RU9L 5I30H 1EZLA 4ISVB 3PP3H 4FNRA 4PCKA 3VXTA 3TN0C 3OHMB 3VE0B 5KSVA 2I69A 3ZL1A 2WXIA 1CTNA 1SXCA 4J3VA 3ULVL 3OAWA 3L4CA 2FSEA 4N0UA 3L5WB 4N2KA 4WWKB 1NSNL 1XF4A 4TV3A 5CGYC 5FOBB 5K9QG 3RFZC 1UZ8A 2LW3A 3B9KB 4LL4A 5ACZB 3WTWA 1L9SA 2VN6A 4NWUH 3BW9A 3B7RL 1A9EA 2APFA 2YEZB 1U8IB 4HZLB 4P2RD 4ODSL 2NW3B 3M8OH 2EYSB 2IOMA 2FIRT 3RDTB 4BGDA 1CF1A 3S48A 3LCYA 2J55A 3NN8B 1ACYH 2AK4A 2X4UB 4TUOB 1YNLL 1MIEH 3QFDA 5F6IB 1FN4A 2IDQA 3WIFA 4I5BB 1DQKA 5C0NC 1GPOL 2XZQL 4L1SA 4LSTH 3DI3B 3RBSA 3W9DB 1BVNP 2GUOA 3MKKA 5I74C 4PQXA 3K3QA 4JRFA 5L6YH 2G4GA 4ODTL 4Y19D 1G5GA 3SOBL 4MD4A 3I6KA 1QBML 1YEIL 2Z93B 1CQKA 4LASH 1U8CA 4OCXH 4NN5B 1A1MB 1YN6B 5AVQB 4PCYA 2WBKA 5AKRA 4AYSA 1E67A 1QPPA 3QIUA 1JXGA 5AW7B 3KPNB 5CEZD 2JXMA 4GQ9L 4G8EB 4H1LH 1JTOA 4Q6KA 4EUPB 2NNAB 1DQIA 1SMOA 1E7VA 1RP9A 5SWSB 1PMYA 4ZFOL 4H40A 4JN1L 3QYMA 3HZVA 4J23A 3ZQWA 1UWEH 1UOWA 3Q5TA 4QCIA 1MFMA 2DW5A 2ADIA 3GSVB 1SF5A 3COOA 3TBVB 1OP3H 3T6VA 2CRYA 1Z3GH 2WVUA 5D7HA 2ZXAA 3V9FA 4RQQB 2NY6C 3HE6C 2AW2A 4MJ2A 1UJTA 1AXSA 4HJGA 1NCDL 3B34A 3GS0A 3PJNA 3KHQA 1J1XH 4EVNA 3PREA 1WTLA 5DWUH 1BECA 3EG9B 1SLWA 1M3IA 3HBZA 4Q2ZB 2HX7A 4LHUB 2HX9A 3FRUA 4TNVF 2C5DC 3SDDA 1KCKA 2BSRA 2XG5A 4Z7WE 3IFOA 2PO6B 1HHJB 1QSEE 5DHDA 2ITDA 1EZVY 4QJ4B 4LK4A 1DQLH 2KQMA 3GMLB 2D03L 4P5MB 3QHZL 4HH9B 1Q1JL 4WVRA 3VI3B 4MA7H 3H7BB 4KXBA 2DL2A 4NM4L 1ASPA 5C0EB 1AXTH 3C5XA 4PS3A 3I84A 5KBKA 1CURA 1TO4A 3GTVA 4OZFA 3D12B 3ZYZA 4YHYC 1G7IA 3HBPA 4GRLB 3WFHB 1BVZA 5ENWA 2DLTA 2OMNA 1I85A 3MODH 4FQ2L 2BINA 4PRDA 1U21A 3VU2A 4LVHB 1T20B 4AYGA 2BVOA 3PV6A 1JF1B 3VTTA 4MMZA 4MNHA 2O1AA 1MW0A 1HWHB 3D39A 2B0SH 2WO2B 4LLMA 1H8NA 4Z3FA 3F6IA 4BK5C 2Y23A 5EU6E 4G6AD 4W9KC 1JNHB 5HI3C 4QT5A 1WT5A 3HAEH 3IJYA 3VFGL 2HJKA 4Y1AB 2L8AA 1AO7E 3PHOA 4POZC 4S1RL 3SCMA 3KM2A 4DW2L 3SBQA 5I66A 2J6EH 3FSZA 5J56B 1JPTH 3BPLC 4NZTL 1AQKH 2QFRA 2E4FA 4ANXA 3RGHA 5FLUA 3IFLH 4ENED 3IWUA 5K9OA 2CLZB 3APMA 3RVUC 5DZOA 3WEOA 2JB5L 1OAXL 4MKMA 4JY5H 4L8SC 5AZ2H 4ZAKA 2XQBH 3JTSA 3H3KA 3KPRB 4NYLB 4ZZKA 1X7QA 5DO8A 3HI1B 3L5HA 1NFDA 1KPRB 1FC2D 1MHCB 1ZANH 4U31A 4N6RB 4Y2OA 4DAGL 2YGQA 2BMKB 1WBXB 2JCWA 5HGHA 5HY9A 3TEUA 4Q9RL 3QZMA 1IARB 4YSRA 1Z0MA 4CJ0A 1XCTA 2ZNXA 5GRVK 2YXMA 1SDYA 4U2ZA 1PYWA 1S7WA 5ITBL 2ADGB 4TRPH 5D7IF 4L3CB 2HJLB 3TPUB 4KUZL 2VDNL 1ZCRA 3EJZC 3NBNA 5KEZA 2GVYA 3MNZB 1BMWA 1TXKA 4BDVA 3QAZC 3QP3A 1YY9D 1L7IH 2DWYA 2MSPA 3FT2A 4NRZB 4OSUL 4ZUUA 1WZ1L 1NJ9B 5GRZA 5C0FB 4LARH 1W0VB 4QTHB 2H32A 4WSKA 2QGCA 3LX9A 4ZW8A 1JMZA 4XXDB 3AITA 5F9JB 2J5LB 3UYRL 2JVUA 4TQPA 1RURL 4QKXB 1U6AH 2WUCL 3P11L 3LNGA 4AVHA 4B97A 2VABB 3CG8A 1RK0A 1SJXA 1CFTA 3QEUB 5TFSH 1AD0A 1IGTA 5IP4A 1OVZA 5KJ7E 1JZ4A 3RZCA 2DWXA 3IS1X 3JWNC 1G7HB 2DS4A 2LHAA 4NC0B 3QNZA 2GJRA 4NQDE 4KKBD 3DRTB 1W91A 2B4CH 3D48R 4MXVE 4RRPM 4FXKB 5J12C 5DUPL 3PXHA 4PAZA 5IK3A 1FNHA 1XGQB 4JGNA 2A3TA 4XMLH 5C07E 4DUXA 1NA8A 5TDOA 2VAAA 1INQB 2WLMA 4AIXA 3G3LA 2NQDA 4O2FB 2GAZB 2NXZD 3ETBF 3V0FA 4K5PA 4I88A 4JFSA 3W9EA 3CVDA 1DQML 1XF3A 5KYWB 4MJID 1E8YA 3DO3A 5F93C 3L3KA 3KR3L 3ULUD 4P2AA 3KEDA 3GO1L 4CGTA 1V55B 3CC5A 2WYZA 1JMXA 3QUMH 3KPOA 1VACB 4RRPA 4QTFA 2K7QA 4B9YA 1MWAB 3OZ9L 4PJ7E 1MRDL 3IMBA 4JQIH 3CDZA 4PRPA 1MG2C 2F2HA 5B38A 1GGBL 5B7MA 4TUJA 4FXTA 3RL2B 2KZWA 3D85D 2IAND 3WCYA 4TNGA 5IFAH 3HUJA 2Z31A 2YAPA 5BJTB 2R2CA 3QIUC 4PB9L 3BGMA 3CMOL 3PJLA 3IAQA 4NUJB 3IJSA 3M6DA 4K73A 3CN0A 4XPTH 4Y5XB 4JFZH 1RZQA 3KZ8A 1OXYA 1XIWD 4UAOB 4XNBA 2N4IA 2ZG1A 3OSVA 5FCUL 1AY1L 2P28B 2MPAL 3NEOA 4ZSOB 3CH1B 3GUTB 2YBRB 5ANME 4FJZA 1PLAA 1JTPA 1WFJA 2XZCH 4G70B 4OZFG 2OX5A 4YE4H 3VH8G 3OKOB 5EBLB 3BQUA 4Z3HA 4KDTA 4X99A 2BY3A 2HVJB 4GT7A 4PJEB 4BEIA 5IT2L 2KZBA 3GXDA 1E27A 2ZG2A 3ZT7A 2DKUA 1RPKA 4HETA 1AR1D 4NKDA 4A6YH 2A9BA 4UUJB 1SF3A 3BVWA 3U9PL 3LNHA 1D5BA 2Y5EA 4I9XA 5DZNA 3DX4A 3QORA 3U9UB 1U36A 4I13B 2FEEL 2F7RA 2LAGB 2JFCA 3P4MB 3QUZA 1RPQA 2G5UA 3ZDXF 4AMXA 1FVEA 1GC1H 3LIZL 5GRJL 4XOAA 15C8L 4R4NC 2M83A 5DMGC 3JZ7A 4DPCX 5C7ZA 3ALPA 3OXRB 3DUSA 3MACH 2R29H 1IGYA 3LPPA 3BAJA 3BP6A 4Q6IA 2NXZB 4LAQL 1N8OE 3FFCA 3IFNH 3T5WA 4G6ML 4KK9C 2YHGA 1JK8B 2Q7YA 2Q86B 4MJIB 2YEVB 3X2QB 1I8IA 2KKQA 3O4LB 1TZIB 1UKQA 2QTEA 4OFPA 3HG1B 3RUGE 2EUWA 3SGEI 1AYOA 4WZ9A 1I85C 1P84J 1MVUB 2BY2A 1W0WB 2X28A 2J12B 4FTVE 4P59L 4AOFA 4AXWA 3HLAB 1XD0A 1Z6JT 2F8OA 3TFKD 4NQSA 2NPLX 3ULUH 4XNAA 2FQGA 4PJ5A 5HPMB 3D85B 1MFEL 2IANB 4MMZC 4OB5L 3TEWA 1QFUH 5KSBA 1YN7B 4RIRB 2DQUL 3WXWL 2RR3A 5HDLA 3L95B 4L8BB 3GI9L 5CD3B 1YLBB 3RI5F 2F5BL 4G6KL 4K55A 2IDFA 1FFOA 1R4XA 1JZJA 3FJTA 5JYMA 3QC6X 3FTGA 3SCMC 4FYRA 3VGFA 3IJHB 5AZEL 4UTAL 5G4OA 2P7TB 1LTXA 2OZ4L 2NSMA 2X10A 3KYAA 4MJ6A 2ZIDA 3IRCA 3KLLA 1KCUH 3LDBC 1J05A 1CICD 1HH6A 1KTJA 3MHZA 4NI3A 4F8LA 2ALWA 5A2LH 4H8UA 2OL3B 4CBPA 2FYVA 5GXBB 3NIDE 5E6SB 1C16A 5AOIA 3C09C 4KK6C 4I2XA 2BIOA 5I1HL 1FA4A 1U42A 4HUNB 2WCPA 1AR1B 2R8SH 5L2KA 3VSUA 1M05A 2IMNA 2OMTB 4AQOA 5DJ2B 3ECBB 3EH5B 2IG2L 2K4AA 2D3LA 2ICWB 5CN3A 4S0TD 1SGKA 1I7UB 3PWJA 3RRQA 2ORBH 4M48H 3Q48A 1IEAB 4Y89A 2HWZL 1IBHA 1N64H 3G5YA 4FNQA 3CFCH 4PWJA 4KX8A 1QMUA 1SXNA 2F7QA 3Q01A 4P2OA 3TJPA 1L9OA 4RH4A 2HX8A 1A6WH 1HAUA 3AB0B 1GS8A 1S9VB 1JVKA 2DZEA 4FL4B 1OAYH 4U3SB 1BPVA 5KBMA 2G3NA 4ZUWB 1LK3L 1NGQL 2N3JA 3S37X 4C47A 1MIMH 1QNZL 2AV1A 2D3JA 2DV6A 3GMPB 3LKNB 4Y5VA 2CDGB 5KVFH 3FQWA 2VDPB 4D9QD 1ULVA 1C8QA 3ARTA 5DRZA 1AANA 3BP7B 1CD8A 4MYWB 3RZCC 3S88H 4PJCF 3GSXB 5HVWA 1IE5A 2WLHA 2AXGB 1AIFB 1H6EA 2BNQE 1MFDL 2E9JA 5B38G 3FSVA 3KL0A 1QFPA 3T8VA 1WFNA 2H3NB 4M3JA 5C09A 3ZE1B 1HOCA 1J18A 1SOXA 1BGXH 4PRAB 5T3ZD 4N2HA 3SSGA 3ES6A 4GMTL 5C2BH 3HE7B 2J72A 4DK5A 3QWRD 2RD0A 1KTDB 5EBGA 1FIEA 1N5AA 4NNPL 3SKNB 2Q7AA 2TSBA 4KFMA 3RY6C 3W39B 4W4OA 2NY3B 3IU4L 4P23A 4PGJA 1H6FA 1JNJA 5FYJD 1J9TA 4AZ8A 1NBYA 4OD3L 3I6GA 5J06A 3O9WD 4P5KA 2V0AA 1UVQB 1H3PH 2D7NA 3DX6A 4ZPVA 4KVNL 8FABB 5I18L 5I24A 1LVEA 1XGRB 3KDMA 4YXKL 5I1GH 3ULVF 1CICB 1P1ZB 2X44D 5IVZA 2ZWSA 3THMH 2NX5A 4WHYG 2BX5A 2I9LA 1DN0B 3IGUA 4FABH 3IXTA 4K3JH 2NNXA 4OZGE 4JFDE 2VWEE 3EO0B 4WKXA 3K4ZA 4I3GA 4PY8J 1BZOA 4C56E 1CD1A 3QA3A 4N90D 1F4XH 5T33L 2C9XA 3V6FB 2HFFB 1SXBA 2XYBA 1DEDA 3BT2L 2NSXA 3JZYA 2C3VA 4IDJH 1TTGA 5HHMB 4APQB 3VU1A 1UH3A 4FZEL 4X5WA 5FDWA 3ROLB 2X4SB 2A74B 1A7PH 4B3EA 2D3VA 3IDJA 1BAFH 4BWWA 1RH8A 3AABA 3PYCA 5CHNB 4WV1B 4HF5H 5LBSA 2Y3NA 4RGNE 2GPZA 1DBAH 4RNRA 5GZNA 1VGEL 2X2YA 3EFFA 3LSOA 3VJ6A 2IV8A 5BUAA 1CF8L 3HS0B 2BZDA 3BP5B 4ZS7L 5AL0A 1BJ1H 3VGGA 3EUUA 3W5MA 3MV8D 2Y4SA 4XP1L 3VXSA 1MELA 4KDTC 2OSYA 5KS9E 3KBHE 3CN4A 4WNSA 3OHXC 1QR4A 1CG9A 3LNDA 1JZ5A 3CVHL 1P5UB 3LEVH 3OJVC 5IQNA 3AJ7A 4K7FA 4QYAA 4Y5YA 5ES4B 1I1YA 4IBWA 4AQ1C 4YSEA 3QORC 2NYKA 1YQVH 2YSSB 5F44A 2RMNA 4O00A 4MJ4A 4UB0L 4IDLA 2NY0C 3SYAA 1NGWB 4DGUA 1RZ8B 3NZSA 4CC1A 3RWEB 1KLUA 5EG6C 3BHBB 3NQIA 5GS3A 2XN1A 4Q6IC 3ZTJG 3L5XL 4JAMB 1FG9C 3DIFB 3U0WH 1QSFD 4YGVA 2FJHA 1D5MA 3WLBA 1J9RA 3O9WB 2A6DA 2WWMD 3QWNA 4PJIA 3D3VE 4A2HA 5AOZA 3EBAA 2F15A 1HQRA 2VWEC 1IAIL 3F5WA 3AM8A 5D5ME 4XPFL 4HPYH 4QLWA 2GJ6D 3D52A 4CAGA 1U58A 3AREA 3HC2A 4OZGB 4CVXB 1AJ7L 4LPWA 5I6PA 1WD9A 4KMTH 3TJHC 1MOEA 4F3FB 2R4RL 5DJXA 2FWLB 1S9YB 4H25B 4XP5L 3GBNL 2A83A 4I3SH 1R6VA 4N3UA 4YK4B 4X6DA 5F6HI 4G7VH 4GG8B 4Y4HA 4XPAH 1XR8A 3GMQB 1T3FA 3VFTA 4ZO9A 3BRDA 1RZPA 2OCCB 5EO0B 4Z7VF 1JRHH 5IB4A 3QNXB 1YMHB 1OAJA 4FQXA 2JTDA 4PJDE 1F41A 2DQFA 1MCOH 5FA3B 2X53A 5DUMH 1G9NH 1NAKH 3S37H 4NENA 4YVUA 5EIIB 1IGCL 2F19L 3QH3A 4Z7IA 4NHUB 4PRNB 5EOCH 5I1EL 1IAKB 2Y06H 5KTEH 3RA7L 3BDXA 3JWOC 4NKOB 2IPTH 4ACTA 4HWEH 3A21A 4XN4A 3FUJA 2XTJC 3ZOAA 4IM8A 2NXYB 3LKPB 1BXXA 4UDTB 4MCYA 4POUB 4H8PA 5I6NA 5I8KH 5DRWB 3P3TA 3BAEL 4G80A 4MXQD 2B1OA 4G42B 4IBSA 5DVMA 3S5ZA 4J3SA 4FG6D 2O6DA 2Y72A 2D31A 4LO9A 5JXAL 3TNNB 4N20A 4PBWD 2BZCA 4P9HL 4QRQB 1ROWA 2MPVA 4HCRH 5CUSH 3H0TB 4E9QA 5KVDE 2V2TA 3QPQD 4KU1A 1MLBA 1QSFB 4L3ED 4BFIA 5JW4R 5GIRB 3I50L 4NRYB 3DSFH 3W5NA 2Y7SA 3JUYA 1YMMA 2VR4A 1J5DA 1TVDA 3JQOB 3L3DA 5HDRA 1J5HA 4YDLC 3F65A 1I7TB 5EU7E 1BQHB 4XP9L 4Y88A 3U83A 3ZQ9A 2GJ6B 4HCIA 2WCGA 1D7CA 3TC9A 4BFEA 4QPEA 2OZNA 4ABWA 3IF1A 5I6XC 2ZF9A 3A6CH 5FFGA 4YHNA 4QRUB 2YARA 2CZNA 2UWEB 3VRJA 4XC1H 5EUOA 3BO8B 2DTML 4HIXH 2DIEA 3CCHB 3PUUA 5EZPA 1HHGB 4AYMC 4KUCF 2HRGA 3SZKC 4WI7A 1UH2A 4PJGA 3LZFL 3QFJD 2LFEA 4F7PB 4PCTA 2G0KA 5FECA 4JCMA 2ZWLT 3ZT5A 4KJQD 3WFBH 4LMQI 2YXWA 3RIKA 4Z78A 5CD5D 1A3LH 1NBZA 1WWCA 3X3FH 5LG6A 4W4OC 4P23C 2WXHA 3CSYA 1KB5A 1HILB 4OZHF 1NEZB 4NFDA 2HT3C 5IB5A 4XPBH 2BRRH 4RMQA 2WXQA 4HKXB 1OGAE 3D0VA 3D09A 1M71A 4LT7A 4ERSL 4ZFFA 1K72A 3N06B 3MGOB 1DJGA 2VISA 5I5RA 3I02B 1B3IA 1BJ8A 3NCMA 4UV7L 3KBPA 3L1FA 4ODHL 2ZICA 3H2PA 1L6XA 1MH5B 4ZD3L 2EVGA 1T0MB 3VVWA 1BF8A 4W6WB 1NICA 4Q58C 3MU3A 3GXPA 3II1A 5DD3H 5C0CA 3US0A 1G9EA 1LO3H 4G7YH 4RMWA 4OM0L 4TVPD 5J1SC 2QPUA 1FJ1B 2E6JA 2DMKA 2D4DA 4HS3B 2WXOA 1YDPB 2W07B 4PM1A 5JZ7C 2VDMB 4TNWK 3OZLA 3TVMC 3BN9C 1AI1H 5EA0L 3ZDYE 4R7DA 2X70B 4GXFA 5GS0C 2QKIB 2B15A 4ZMQA 4MMXA 5LAXB 1NCCL 2E46A 2NY2D 1NCWH 5D93B 2C9AA 5AUMA 2B1AL 4PSRA 3WSQH 1E40A 3MLUL 4N9GB 1DVTA 4M93B 4YUEH 5C6PB 4URKA 2CIKB 2P26A 4OF7A 4HOWA 3RE0A 3VFRA 5B8CA 5IIEB 1QVOA 1SZNA 3P0YH 3C08H 5CLWA 1UADC 5GJTL 5SV3A 3PDDA 1QFOA 3NCCB 3D4ZA 3T2QA 1UACH 5I8CA 2CO7A 4IGBD 3UGXA 4L4VA 3QDMA 4ZOCA 3MLVH 3RX8A 5JORA 3N41F 1B4TA 5FA4A 3U4KA