5BUPA

Crystal structure of the zp-c domain of mouse zp2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
172
structure length
159
Chain Sequence
PLVLVLQTYPDQSYQRPYRKDEYPLVRYLRQPIYMEVKVLSNDPNIKLVLDDCWATSSEDPASAPQWQIVMDGCEYELDNYRTTFHPAGAHSGHYQRFDVKTFSSLIYFHCSALICNQVSLDSPLCSVTCPASLRSNAEANKEDTMTVSLPGPILLLSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Zona pellucida sperm-binding protein 2
publication title A structured interdomain linker directs self-polymerization of human uromodulin.
pubmed doi rcsb
source organism Mus musculus
total genus 28
structure length 159
sequence length 172
ec nomenclature
pdb deposition date 2015-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5bupA00
3NK3A 5BUPA 3NK4A 3QW9A 4AJVA
chains in the Genus database with same CATH superfamily
5HY9B 2J5LB 4XVSH 3RNQA 5DVPA 1PG7X 2YMOA 4X8XA 3BP7A 4CKVX 2C9AA 4DK6A 4IOSD 1ITBB 3SDDB 5CJQH 4LLVA 2GJ6A 3EHBC 5TTRA 4NUMA 5DSCA 2IGFH 3L5WB 1KGJA 4FYTA 4WFHD 3SDYH 4JCMA 5BZDB 5CIPB 1MFAL 2KDGA 3VVWA 2YGOA 1HCFX 3LKSB 2YPLA 4GMTL 4L29B 2IC2A 1T22A 3EYFB 4IBVA 2BOLA 1S7RB 3A6CL 1T21A 2ORBH 3FRUA 3LRLA 1KFGA 4MWFB 2Q7YB 4HF5H 3L3OC 2BHFA 3LEVL 3U1QA 2DIJA 1FG2B 4HKJA 1NIDA 4GKSA 2COVD 4HIIB 3AQDA 2Z4TA 3QI9A 2VDRH 1YEHL 2WZ5A 4BK5A 1TENA 5F7AA 3V5KB 1P4UA 1SPDA 2PWFA 4DT2A 4A7SA 3FBQA 4UAOC 3CV5A 4RZCA 5DO2C 2VDOH 2ID5A 3OZ9L 5I6XB 4ZO7A 3Q3GB 3NESA 5GS1A 4K7FA 2YBGA 4IRZL 4L4VD 1NDMA 4JRXB 4N5UA 4NN5B 2ZXGA 2G5RA 3SGKA 1BVNP 4PVMA 3ZL4H 2OZ4H 2YUXA 4JDVB 5IFHL 3C5ZC 3K1KC 5AZUA 3WIHA 1V3MA 2E86A 4LLUA 1J11A 1SMAA 3GKZA 1TJGH 4GSRA 4UQIM 1JXJA 2IPKB 1IVTA 4F33A 3IJYB 4UT6A 5JHBA 4ZMVA 3MV9A 2R9HC 2WNXA 3FRPA 2OMXB 2VRKA 3ENEA 3S6CA 1CL7I 1O6VA 3TJHC 4EIZC 3CMOH 4UMSA 1HOCA 4XXDB 5KYNA 4QT5B 3K2MC 4FKKA 4FGMA 2DL9A 1KB5L 2WLKA 4MJ5B 4C57C 3ABLB 1OHZA 5KAQF 2VLJA 3ME0A 4JFEE 3EFOA 1IEHA 3M7OA 1MWAB 1OTUD 1DBBL 3PL6B 4QXUH 3UAAA 2BSBA 3C5XA 1DBAH 2ZX6A 3LKOB 4LKXB 1QBAA 1PNCA 3BCDA 5C2BH 1BF2A 3LMJL 4OGYH 4PS4L 5D1ZD 3ISRA 2G3NA 3QRGL 3IFLH 3BSZA 3CPLB 4U6YB 5AB0A 3CCHA 4FHJA 1JNNL 1DVFA 4DPAX 2CLVA 3QXAA 4OY9A 5E5UB 3RDTD 3CFCH 4K94C 2APFA 5DK0A 1XBDA 1Z9OA 1TZHB 4G9FD 4R90H 3MODL 2ZKMX 1A4AA 1KTJA 4Q4IA 1MXDA 4IDLA 5H35B 5C0AA 4N2FA 5TPWH 3UOAB 3OLIA 4QNPF 3B5HA 1WIPA 3H85A 4KTDL 4LOFA 2EAEA 4FS0A 2OS7A 4Y19A 1NBVH 1HYSD 1FORL 1P4IL 4KNSA 2DQEL 4XP1H 3NP4A 1SDDB 1KTDA 4XB3A 1A21A 3GK8H 4FLSA 3EKCA 2F7OA 2WSPA 4HT1H 4NBXB 4BFOA 1MCFA 2DWEA 3KPQA 3TBSB 3PWVA 5EBWB 4NQEB 1S3RA 3CN3A 2CHWA 3G5VA 3GRBA 1PCXA 2XSKA 4H4NA 4X83A 2AANA 4U1MA 4F58H 1PLBA 3DSFH 1U3YA 3NJMA 2Q7AA 2ZXBA 4KX7A 2C4XA 2HTLD 4ORZC 2VITA 4DK5A 5DMGC 2AI0L 5D7LB 3FSWA 3DOIA 3DURB 5EZJB 5HGHB 1D5XA 2APWA 4XX1G 2GYSA 3QS2A 3DARA 1DSFH 2HG0A 4NIYE 1EQWA 4TUJB 4B9YA 2LVCA 4LSTH 2HLEB 4PD4J 2YJQA 1HHKB 1G9EA 5C08D 4P0DA 1SJVA 1A3QA 3DHPA 2X6AA 3HHMA 3FFCA 4OZGF 3O6FC 1S7WB 4IBUA 2CK0H 4RBPH 2E75C 3F7YB 5FXCH 4HU8A 1FZMA 3BKMH 2Y5EA 5D1QC 3T9WA 4WFED 1AFVL 3AAZA 2IQ9L 4OCMC 2IQAA 4UDTA 3HG1B 4DO5A 2E27L 1UWYA 3ZHNA 4ZTOL 4RQQB 2W95A 5DRXA 5EBGA 4CADA 2AXJA 2ZCKL 5BZWB 3STZA 3ZZQA 3HE6D 2WJ7A 5KSBB 1JWUB 3HI1A 4PGJA 3LNFA 4NQSB 4WO4C 5TFSH 2X40A 1E2ZA 1KB9J 4Z7NB 3EFDL 3CHPA 4ZX6A 3MTXA 1N5YL 2IAAC 4D9QE 2XXGA 4LP4A 5EEZA 4JM2B 2COQA 1SOQA 4KPHH 4WEBL 3ZYZA 4ZQTA 4KK8C 2XWTA 1N10A 3CXFA 1W80A 4PJAF 2C3WA 3SO3B 4MJIB 1MQKH 5IHWA 4ALAC 4XH2B 4PREB 2K8MA 3L9EA 4P9HL 2XACC 1LK3L 5GGUA 4K3GA 4KKBD 4AEEA 1MJJB 3QIWB 3D7PA 3HTLX 1XSOA 3LKRA 1F2XK 1I3RA 2JJSA 2VZTA 3SE8L 1IFGA 1A47A 2J8OA 4BFBD 3CQFA 3NABH 3P4OA 1P53A 2Y2TA 4HUXA 1DVQA 1IM9A 1QPPA 1EXUB 1ZVNA 3LKPA 2GSIB 3GSRA 1QSEE 3FHEA 5DI8A 3T5WA 4QRPD 4Y16C 1FVEA 3G5WA 4XX1E 5KW9L 1NKOA 3SPGA 2G5UA 4EIBA 3EYSH 1AOHA 3GSQB 4TQEH 4ODVH 2PWGA 2CUAA 4NRXB 2AVGA 2YHGA 4PG2C 2XN9A 5D7KD 3RWJA 4QHNA 4DVRH 1OP3K 2NQDA 1RZ7L 4HJGA 1MEXL 2Z92B 3D4ZA 3UEZA 1T7ZA 4YE0A 4YO0B 5C0BE 3CFEA 1CLZH 2CM5A 3LZLA 4B9KC 1ITCA 1DDHA 4RETB 3JZYA 4IS6A 3RUGB 4TV3A 4XI5D 4KJYB 4ELMB 5KBDA 3EO1B 43C9A 1A14H 1BJ1J 1DQDH 4IRSB 3DYPA 2OYMA 5FUZH 2H41A 4EUPB 5AB9A 4QWWD 5CLWA 2E9BA 4HGWA 1IEBB 3QAZB 4NUJB 1G7QA 2FAUA 1R0AH 4X6EA 5E08L 3NSDA 1UWFA 4J4PA 4OD1H 3OQ3B 5IBTH 2BXZA 4J3VA 1DJXA 1Y0LB 3QDJD 3IAQA 5TQ2L 3WNPA 1E9PA 2WV3A 4A7QA 2IH1B 5EEYA 2L7EA 3CD4A 2F19H 3VQ1C 3LSOA 4AT6B 3F8UB 3IF1A 2K8QA 1U3HD 3MLTB 1ZAGA 3QSKB 1S8DB 1P1ZB 1YC7A 5F1SA 3FU7B 1GW6A 3AVEA 2H1PL 4J5VA 5CGMA 4ODSL 3CDFA 1TZIA 1I1FB 4QRRB 4MMXA 1CICB 4R3SB 3QIUD 1RMFH 1C12A 3D39D 1CD1B 3MA7B 4UM9A 4BV1A 2YQGA 5EU6B 4NYLA 3W5NA 4RCAA 2VR5A 3WIIH 4KJQD 5E1IA 2YUVA 3H9SE 5AQ0A 3EGSA 3QWOA 4BFFA 3ZQXA 5K69A 2FUTA 4P2CG 4M1DH 4NN7B 3H7BA 2UYLB 8PAZA 1BJ1H 4RAUB 1KXVC 3H42L 5C0CD 2C7FA 4AUYA 1IGCH 3C6SA 4I2XE 2WAQA 4X5WA 3LX9A 2EIBA 3P73B 3QG7H 5ABZA 4ISVB 1EH9A 1KPRB 3C08L 5GGRB 1Y6KR 2OR9H 1ZLSL 5F21B 3QORA 2EXYC 3MREA 1NKRA 5DEZA 1SF5A 2IXQB 1QO3A 2EKSB 1TTBA 2E8ZA 4MNGA 5F8QC 1A0QL 1CO1A 2AEPH 1U8NB 5TDNA 1L0YA 3LNEA 2X0UA 2BDNH 4JY6A 4HWZA 3GD1C 5DJ2A 5FW7A 4W9FC 1JYNA 1RUML 2OZNA 4POUB 1NFAA 2VZ3A 3ARED 3MGTB 1LE9A 3HZKB 2NW2B 3C8DA 4HS8L 5DWPA 5HVWA 5F88A 2ODHA 3FTVA 1DQQA 5H94B 1MJUH 5DVNA 3HZYA 3ULAB 1LO5A 1AGFA 5FECA 1KPUA 1XSIA 3NZSA 1BLNA 3TBYB 2I60H 3RDJA 3V4VL 3WS6C 2ZXCA 3CX5K 1W8EA 3MJGX 5MEPB 4DAGL 3BOVA 4FFVC 3U9PL 5IQMA 5GRYA 4GAJH 2RCSH 3WTWA 1ASOA 2WCGA 3FPYA 3JT0A 3AGVA 1NGQL 3FTGA 1WIUA 4G6JL 2F74B 4NRZB 3P77A 4TUOA 1U0QA 3NG5A 4Z7UA 2FRGP 1KYAA 2YQ2A 4ERSH 5IB3B 4C55A 2NY5L 3HVDA 2XBZA 2IDQA 3DX6A 4IDJL 3SPIA 4F7PB 4PJ7E 3VXOB 3N40F 5FA3B 3AFLA 2DWDA 3E1ZA 1WBXB 4M5YH 5LG1A 1A4CA 4WWKB 2EVHA 3KPRD 1MCKA 2UWEA 1JMZA 2DH3A 3S3DB 2OMYB 4UINL 4OLXL 32C2A 4JJHA 4OBSA 3ULVH 2MTPA 2WY3B 4AVKA 1PJWA 2BVPB 1A22B 3PHSA 4ZFZB 4K8RL 3OXSA 3HZVA 1Y7VA 2G2RB 1BVLB 3BT2H 2A6DA 5CN2A 4MD0A 1N6VA 3GSNA 1ZGLA 1ECYA 2IH3A 4I0CC 4LCIL 5BVJA 5D2LB 2YBRA 2AEOA 1ORQB 3ARXA 1N5AB 1DVZA 3VFGL 6PAZA 3VXRA 4U3XA 4OZGA 1FNAA 1YECH 4V11A 2AAAA 3OC8A 1YHPA 3BDYH 3QQ4A 4LL9A 4X9YA 2VH5L 2JJTA 4FNQA 2IH9A 4YLBA 5E03A 2NY0C 2UZIH 4XNBA 4FZEH 5FK9A 5A2LH 1ZHNB 1CN4A 2XXMB 1IEAA 5FX3A 3FN9A 1RIUH 3DJZA 3CH8A 5IJBC 3RY6A 4ZUSA 1J48A 1KFAH 3CC1A 5C09E 3V52H 1BOGB 2JI1A 1WGOA 1KACB 3DTUB 3V5DA 1EJOH 2X6UA 4J6IA 3QQ9D 2EDMA 2OM5A 2IDSA 3PPSA 3GMNA 3K1DA 1RPKA 4IKJA 4PJAA 2QSCH 5C9JB 3NCMA 5B38A 2A9NL 2OQJB 3TIEB 2VDPH 2BNUB 4PG9A 1KBWA 3BP4B 1IM3B 3ZE2B 3T3ME 3S37L 2FSEB 4KQ4L 3PAUA 2ZAHA 2DQGH 3TN0D 2E47A 3APCA 1HSAA 2IPUK 1VACA 3W39B 3TO2B 3ZKXB 2IG2H 5EA0L 3QZBA 3EO0B 4PRDA 3DROB 5B3SB 3VSVA 2VDNB 4F8LA 4BZYA 2ADIB 3V79C 1T6VN 4MX7B 1RIVL 2HJLB 4P5RA 5HHXL 4JPWL 5EBLB 3C2AH 4X80H 5TE7H 2HUHA 1SBBA 3GKWL 1SN0A 1FV1B 4Z7QE 3C5JB 4QLWA 5A6MA 5DK2A 1DQTA 4OF5A 1MREH 3CLFH 3QDME 2K3HA 3DX3A 5JW4N 4MRCA 5DZ9A 2MNJB 1BQKA 1HT6A 1X7TA 2BSRB 2MQCA 3MFFA 3AQZA 1TZ8A 2R83A 3S5ZA 2ZX8A 3VA2C 3S8GB 1BAWA 4OKVB 3L9RA 3O0RH 3VFRB 4M4PA 2VR7A 2VQUA 4JRXD 4PCKA 3UEQA 2W8CA 3VRIA 2AXFB 2ENQA 3WLBB 2VMEA 1L9RA 1H6UA 1ZS8B 4LSRL 3ZTEA 3TBBA 4NKQB 1R3LA 2JIXA 1OAZL 1T1XA 2H6UA 3KBHE 4M4RB 4PJHB 3Q9QA 5HDBF 3OLEA 3C8KB 4LVHC 3S5LA 1BD2A 3I2CL 3D3VA 4AYSA 5EZOH 1ODAA 3Q6FA 4NPYB 2FECL 3TYFB 2ZX9A 5ID1B 2O26U 5INDA 4AJ0A 3BC9A 5KJRL 4DKTA 4PRPE 4APXB 4F2MA 1RUAH 4DP7X 5FO2A 2HRLA 3KDMA 4OZFH 3PL6D 2R23B 4S1QH 3IWUA 4Q6IA 4V1DE 2P7TA 1IAOA 1OAYL 3O3AB 4ODXB 4WJ5B 3P69A 4YHLL 4E0RA 2DLHA 3BWSA 4UNUA 3HC4H 3MRLB 2IDFA 1KY6A 3U2SB 1PU0A 4NENB 1E4XI 1O9WA 2Z9TA 1BLIA 1SY6H 3IJEB 5SWZB 2J2ZA 3ERXA 5CKGA 4LFHD 5FOJA 2Y7NA 5AB1A 4IOIA 1YEFH 3A6BL 3HS0A 1PFOA 5I1AB 3AU1B 4IGBC 7TAAA 3L5HA 1A6WL 1IGJA 4H1LG 3PGDB 5KOMC 4F7TB 2CRYA 1IE4A 1BQLH 5F3FA 1OOWA 3OJ2C 4BA8A 3MBWB 3ARQA 4WSKA 4ZUUB 5J3HC 3TT3L 2BCMA 3LEXB 1TR7A 3RY5A 2HFFB 1SFDA 3FO2B 2AJ3A 2DLIA 3CUPA 5I9QB 1OQXA 1OZTG 2XA8H 3QIBB 3NFNB 3FT9A 3HAEA 3PCYA 3O11B 4UDUB 1D5IL 4NQED 1I75A 1S3KL 2R7EB 1AR1C 3TIDB 2G75B 4GH7B 3RX5A 1QI3A 1E8WA 3CN0A 3LPWA 3H3BC 4XAWL 4HOZA 2DM7A 4PGBB 2G3XA 3CX5J 5AB2A 2FYYA 4P5TD 4XVOA 5D7LD 1RZKH 4IJ3B 5FWQA 2VDQL 4P4KA 5JIPA 1QNZH 4LHJB 1ZSDA 5J5EA 3IE4A 5FKPA 2Y2WA 5ADPL 4CSPA 2JF1A 3BPNC 4LZKA 1OSEA 5MI0C 2YLKA 2X4NA 4L9LC 3T6XA 2N7AA 2WTOA 1X5KA 2VERN 1ZA3A 2CLZB 3FOMA 1UZ8A 4N8PA 2ZG2A 3C9NA 1QSZA 1ILSA 3CSGA 1KPVA 2Q5BA 3UTZA 5I74C 2H7WA 3O3EA 4YDVA 3N04A 4U05A 3OKKB 4HX1A 5A2CA 2OFQA 4YEEA 5E6RB 1ZIBA 5LWYL 2Y25A 3LPGA 3N2JA 3L7EB 1MNUL 4GS7C 4ZZFA 1T2JA 3MGOB 4TVUA 1RHHA 5KN5A 1RU9L 1YMHA 3D85A 4MFHA 4ZMAT 2LHAA 5PAZA 5HYQA 4FXTA 4AL8H 1FVCA 1CDYA 5GRVK 5CEZL 1G84A 2ZOTA 4MJID 4XMUA 1K8IB 2EH8H 2HPTA 4XWOC 5L8JB 4DSYA 4N8CH 3PDGA 1ZK5A 3IETB 2FT7A 4M6OH 1A3ZA 1IKFL 3BW9A 4PRHA 3D2TA 1KIRA 1JVOA 1SLXA 1QWUA 1SBSL 2A6JB 4NC1C 3PF2A 1KELH 5D96B 2MPAL 3BEVA 2ZSWA 5HDOA 3RB7A 4I3RH 1WAPA 2IBZX 3FQRB 3I6LD 3NJXA 4H0LC 4EIGB 1CGSL 3RWCB 1DANT 2JQAA 1M1XA 2DMHA 1MVYA 1P4LA 2WVVA 1GKOA 2H32A 1AO7B 5IZ7A 3IN2A 2VE6B 3M1BA 3OG6B 4KKNA 3RWDB 3RNQB 5IUCA 5KUMA 4BKLA 2WLLA 1BJ8A 2EC9U 2PW1B 4JHWL 1CTOA 2EDYA 1EAPB 3GHBH 5AAWA 4LLVB 5JOPE 2XPYA 3GS0A 5D70L 2V5YA 5DHMC 3DJSA 3WENA 4Z7VB 4M9PA 4WFFD 5J6GB 2NNXA 1WHOA 2EDWA 4G6ML 4LVOB 1L0XA 4RISH 2DWYA 3DO4A 1NGWA 1NL0H 2R0LH 4FXLA 3S3CB 4XXCC 4L8CA 4GW5A 3KLLA 3DGCR 3GTTA 2OI9B 2BSSA 3WO3B 2AKRA 3QEGL 4PJBE 3RX7A 3UZVA 4P57B 3LZRA 1UWXK 1QFUL 3OGOE 4E5XG 2EC9T 1ES0B 3PNRB 5C3TA 1BQHA 5GSRB 2XN1A 4HKJB 4GKSB 3IU3A 2Q3ZA 1A25A 1EJ6A 4M8QB 4KZEH 4ODWB 1JDAA 4PJ5E 2XZCH 1KJ2H 4JGUA 5GRXG 4AX3A 2DBLH 4YN3A 3T1FA 2BP5M 1LO2L 1NUFA 2DLFH 1S9VA 2VZ1A 3TZVA 3K2UL 4P5MA 3ZTCC 3ECQA 1UVQA 4P59H 4JRYB 3MLVL 2GSGA 1W6WA 3CLEH 4MA3A 1N8ZA 1NDMB 2XC8A 3BPOB 4BCZA 3SCMA 4EKJA 4XPAL 4JKLA 2VJ0A 3KEHA 4NQXB 4QOKE 5JHDB 4PWFA 4YDIH 1KNOA 2CUHA 3GGWA 3BDXA 3SOBH 3F7VB 4LLUB 3VJ6B 3JVGA 5E1QA 1QRNE 1JHKL 3SE3C 4EDWH 5ANHA 2EIEA 4OCXL 4IOFC 4KZDH 4HFUL 3UBXG 1K6QH 3MV9B 2OSLA 2I5YH 2A99A 2X9XA 3H9ZA 4Y9GA 5T33L 3KR3H 4B3EA 4MLIA 3D48R 5DRZA 3NJIA 2DQCL 1MW2A 2YK1L 4DETA 1OAXH 1EJFA 2AQRA 3CVIH 3MRRB 3EJRA 2Z31B 4CN1A 1G9NC 3NPSB 1HQRB 5BV7H 5IFAL 2VZVA 2VZOA 2R1WB 1OPGH 2X89A 1Y07A 3TBTB 3KPLB 4EVNA 4FF9A 4JO3L 1FO0A 1GZPB 2XCMC 4KFZC 1XR8A 5D7JB 3TVMB 4BUQA 4CC1A 4CVWA 5IVXE 1WTGT 4FL4C 2NY3B 3D2UD 4MA7H 1F90H 4WI8A 2Q8BH 5J1TC 1QAWA 5D9SB 2CLVB 4PGZA 3L1GA 1IC4L 4TSCL 3OXRB 1RHFA 5DK0B 3V4PH 1F3JB 1F42A 5AEAA 3SE9H 1S7QA 1WWBX 1NLBL 4TNEA 5ALBL 1OXYA 2J12B 5IW6A 1JERA 4LNRA 1BYPA 4BQCA 4J3XA 1CI5A 4S1DC 2E6JA 4JFEA 4YHML 4LL4A 5LQBL 4JPIA 4PRAB 4Y19B 4A6YL 4XCEA 1PZ5A 3ZK0A 2R29L 4H20H 3ABKB 1KTDB 2IMNA 4NZDA 5F70A 3SGDI 1ZTXE 1XIWC 1QX1A 2JB5H 4YVNA 5CU9A 4NC1E 5CN3A 1N0LB 1ZLDA 3KPQB 1BCIA 1SXSA 4XMPL 3P40A 4W9HC 4ZPVB 2NR6C 3K4DA 3OTTA 2YRBA 3ULSA 1FH2A 2HT4C 3B9AA 3EOTL 2FB4H 3WTUA 3NPZB 2EDRA 3BLBA 2BSCA 4GYBA 1A3RL 2CE6A 1KJ3L 3L1OL 2R27A 4JDZA 3V6ZA 2HFGH 1L9MA 5IROA 1CDBA 2VLRE 1NCAH 4KKLD 1BP3B 3BISA 4ZOBA 4E42A 3QFDB 4PJ7F 8FABB 3GYRA 3PIQB 5GZOD 5DJ0B 1E42A 3FFCB 2AGJH 4ESKA 1TTFA 3WDIA 1FZMB 3R19A 3CE1A 1G0XA 1NOAA 2ZXDA 3AAZB 3K6OA 2IQAB 3V0IA 3DIFB 5AOIA 5T1LA 2JV6A 3L7FB 1A2YA 1J1PH 4V2CB 5DRXB 3OHXB 3QISA 2CSPA 1ZVYA 4G3YL 4P4RB 4Z5RA 1X9LA 4G6KL 5I17A 5T5NF 3QG6A 3QUYC 1OANA 3HUJE 4OZ4B 2DYSB 4MXWL 5IJKC 3GFUA 3X14B 2NUTA 1HQ4A 1DQVA 3T0XA 4I1NB 3GDBA 5LBVA 4GW1B 5E5LA 4LSSL 5HI3C 4DP4X 3BQUC 2XWTB 3IGUA 5LDSA 2BWIA 1Q9KA 1F6AB 1IM3D 4HK3J 3SE6A 3T8VA 3FCSA 1CGUA 1Q1PA 3B9VA 3BGAA 4L5FE 4XC1L 5GGUB 4NCC1 3RVUD 3RVTC 3BVUA 3MOAL 1REIA 5AL8A 4N86A 4MSWA 2BSTA 1MFCH 2DMBA 2KH2B 3T2NL 1BEYH 2Q3AA 2XX0A 4HUXB 4DKAA 4R84A 2X2HA 4P46B 1KCRL 1T1WA 3IDYB 2J57A 4YE4H 1ZWIA 2Y36L 4JQIL 5DI8B 4YSSA 3KPSE 1MN4A 3ABMB 2AXHA 3DOSA 4PCYA 3WG7B 4LBEA 1Z5HA 1T3FA 5DD6A 1U2HA 3VU2A 3EBHA 1KIPB 3QXDA 3I9IA 5FHBL 3MJ9A 4QHNB 3QB7C 4QYOA 3RWHB 2BWQA 4R7LA 4BFKA 4XPHL 3DRQA 3IRCA 3T3MF 3U2IA 2DTSA 4HHAA 5KG9A 3DMMA 4RA3A 5E4EB 1DDHB 3NIDE 3RI5F 1FH5H 1N64H 2B16A 43C9B 5J7CC 3ESOA 4AVJA 1OGTB 1QSEA 4OZHB 1ML0A 3I75A 4ODBD 4KK9C 2QTVA 1UASA 4X0KB 3WN5C 3BIKA 1G7QB 3QFGA 2UY7A 4X6EB 3Q05A 5HYFA 1RZQA 1VFAB 1ID5I 3D2UA 4Y8AA 4ODHL 3CGTA 4Z7QF 3DIDA 5GIRA 1V7NL 4R4BB 3G9AB 3QZNA 5C0BA 4MB4A 1FJ1B 4R97C 1CYXA 5BO0D 3CC5B 5KVGL 1EDHA 3O4LD 3A0OA 5DURB 3O0LA 2VT0A 3FUEA 4G8FB 5HJDA 1KCVH 3V6OE 5AOKA 4KITB 4JY5L 1NEZG 3L95B 4XRCA 2Z93A 1QW9A 4JGJA 4MMXB 3TNNA 3WNIA 1C12B 1TQCB 5EBMA 3B6SB 1MQ8A 1GW0A 4AXWA 1I9JL 1CCZA 1YY8A 3ARUA 1U4FA 4Y5VC 2JLPA 3QWOB 4QHLB 5EORH 3UBGA 3KXFD 4FZ8L 4KO6A 5HI4D 3H7BB 1RURL 3EJTA 3KPOB 4GKNB 3ZDYF 1NCIA 1RK0A 5LN8A 3MDJA 4AH2A 1QSFB 2N4IA 1P7BA 2WQSA 2ATPA 2YXFA 4A2EA 1B4JH 1BW8A 3JQOB 3WEXB 5IFJA 1UCBL 2AXGA 4JKNA 4ZFGH 4XHQA 4XPBL 5CIPH 5FHAH 4LCWD 4HUWA 3QORB 1SUHA 5KSAC 4GQQA 3NCJH 3MUJA 2BW5A 4G11A 4BDVB 1UWXH 4Q58C 1QO3B 4PJGB 5CSGA 1ET7A 2BIIA 3H9SA 3TH2T 4ZMPA 2EYTA 1LK2A 4MTMA 2WLNA 3FQNB 5KVFE 4U1KA 3VFTA 1G1OA 1T2XA 4JY6B 1Q94A 4U0RB 5GZOA 2VAAB 3QPKA 3QIBD 2QSVA 4I2XA 1WZLA 1NA8A 3B1UA 3EOAA 4PAZA 4CU7A 4PU2A 5I1JL 4DCQA 3QJOA 4N2HA 1UT2A 4JZOA 4ANVA 2E0PA 2IFFH 3U6RA 4GXVH 4FNLH 3D08A 3ILQC 5CZRA 1DQQB 3DECA 3QRFM 1HU8A 1I8KA 3X1BA 4N2BA 1AGFB 1PSKL 2C9PA 3UC2A 5FECB 2PTTA 4G6AC 4GRLB 3N1MC 1BLNB 4FABH 2CLRB 4GP8B 4F15B 2HLAB 1GC1C 5D6CA 2OMUB 3RWIA 5GZNA 2NQCA 1URIA 1UKQA 3H54A 3RHWF 1SXZA 5T1JA 3NA9L 3FTZA 4TUOB 4GI9A 4Z7UB 1QUNB 3JWOC 1CFNB 4XBMA 1B9ZA 5I6NA 3CSYB 5F3HA 4F7CA 3QQXA 3QQNA 4XZ4A 4AVIA 4QHMA 3P0VH 4OJYA 4WO4A 4I0PB 3MROA 2CNZA 1Q0YH 12E8L 2ZPKL 4LLMB 1XH1A 2UWEB 3Q1SH 3HNVH 3QDHA 32C2B 1FI8C 2G60L 3ORJA 4MQSB 1H3PL 1MWAH 2F15A 3MXWH 1A7PH 4YEFA 2FTAA 4ABQA 2VXUL 4FI6A 4KKCD 2AV1A 2L8AA 3GS4A 1XGUA 2X7LA 4ALAL 5EEVA 3ES6B 5BVJB 1BHGA 4ZXBD 4PJ7A 3R8QA 1WJ3A 5SWQB 4HSAC 3AMKA 4JFXA 1I85A 3VXRB 3MLXH 2BSEA 1WO2A 4OCLC 4C47A 4PVBA 4G1MB 2GTZB 2PETA 1M71B 2R56H 1U8PB 4JDTL 5DK3A 1W8OA 2IAMC 3CHXA 5LGKA 4W9DC 1IGYB 3RTQC 4H8UA 4I9WE 2ZYIA 3GWJA 4MXQD 5SX5H 1X4XA 3HJEA 4KX9A 3UFIA 2WXGA 1IEAB 4OM1L 3V2AR 2EQDA 1HH9A 2FZ3A 4FQQB 4HOMA 3KYOA 1RVFL 1U8KA 4PJFB 3VD2A 4M5SA 4YAQB 1KEGH 2VCOA 3Q0HA 3QS3A 1MFBL 4MNQB 2R8SL 5AVSB 4HWBH 5IB4A 3CH1A 1M4KA 1IU1A 4H8HA 4HC1A 2QPFA 1C1EH 3O4LA 5GRUH 4QTIL 1W2KT 4QI3A 4JLRA 3K5RA 4ZYKA 4TRPL 4HDIB 1X44A 2CRIA 3J07A 3WY1A 1FDLL 1M7XA 5CP3A 3IU4H 1UEYA 1RI8A 1UXSA 3E6HA 5CJ8A 1VACB 2BNRE 4WIQA 2LU7A 3DUHA 1ZT7B 1FL3A 4RAVB 1LQSR 4KVCH 4N6RA 1NGYB 2GUYA 2LVEA 3LRSB 5C09A 6FABL 4LPTA 4U6XA 3CU7A 1X5XA 4QUOA 5ITBH 4XC3H 3A4FA 3MCLH 3ETTA 3KWTA 1I7TA 3LN4B 5MP6L 2GVYA 3DBXA 4X4XA 1PYWA 1NBCA 1O6SA 1G1CA 3BEWA 3CTTA 4WI6A 1AACA 1P6FA 4XVJH 4Y7MA 2D0FA 2BIOA 2GT9B 3ARDA 3W56A 4AM0A 5E1AB 5LXGL 1MW3A 4AQOA 1H5BC 1N8OE 5DZVA 5GISL 2QPDB 4DTGL 5FYLL 3NJLA 3VUAA 1FCCA 2AQ1A 1KXVA 2Y72A 4PJDE 1YEDB 1UG9A 2MOVA 4X9GA 3PUCA 3L9RB 2WBJA 4HZAA 4YSRA 5CMAA 5BMFL 2DQJH 3GNMH 3T0WA 4BEIA 3RIAF 3I9AA 3WN6A 3VRIB 1YN6A 4JG0L 3WJJC 5HPMB 5JHDD 4GXUM 2OW7A 2V9UA 1EMTH 3CU1A 3PAZA 3LQMA 4LSVH 5ERWA 1GY1A 1SLVA 4FFWC 3QDMA 3IJHA 2FBJL 3BH9A 4JFYA 1P84K 3KPMA 4XZUB 2BJMH 3GIVA 4AITA 4X4ME 3I02A 3FT4A 3OKLB 5CJOH 2PWDA 3FU3A 3Q6FB 4YWGH 5INDB 3NFPA 5F6HJ 4CMMB 3UTTE 2Z31D 1MIMH 5T5FL 1YEEH 3EXLA 4LRNL 1HXYB 5JW3H 5ANMB 2ZNWA 2ZIDA 3HRZC 2J1XA 3OKMA 3S96A 3TNMB 3TVMD 5D7JD 4GRWF 1HKLH 2ZUSA 2XZAL 3WS6A 2Y23A 4A55A 4ZX3A 1CFVH 3P2TA 2NY3D 2NYYD 2VLKE 2VZUA 3OV6A 4JGMA 4Q6YA 2WZAA 3W3BA 3ZKND 4ZFOL 3ATDA 2H26B 3W0WE 3EZJB 4XB7A 4EUPH 2J2ZB 4KI5C 3QEUA 2WLZA 2PYEB 3VDAA 5JOPD 1BBDL 1G7JA 1UT1A 2PXYC 4PRPA 3HS0B 4MQ7A 3TEWA 2F5BH 2VSDA 4MMZC 3QNZA 2FCBA 1UQSA 1HNYA 3STLA 1A7QH 3S2AA 4Z3TA 4ETQA 1DQJA 4V1DA 5CBEA 1J18A 4A7TA 3CUPB 3G5ZA 4NJAH 3MRQA 3UGXA 1KIQA 1XF3B 1V10A 4M29A 1YQVH 4IMLB 3D9AH 5GGVH 5HHVL 5IVXF 3UJJH 4E9LA 4HMDA 3U0TB 1AAJA 4GPVA 4F37F 1NSNL 3SPHA 4NQVB 4WCYL 1UYWH 1HXMB 1GKEA 1UACL 2BIQA 4GFXA 4Q9CA 3DV6A 5F9OL 3FK3A 3GI9L 2AK1L 3RB5A 4F57H 5JPMB 2RHEA 1VZGA 5DFVC 5E6SB 2BERA 2RB8A 3UYRL 1CU4H 1AYRA 4BJLA 4GSDL 5KANG 2ZX7A 4LSPL 3KLKA 2N3JA 5AOZA 5EOTB 2NRDA 3HI5L 5E2WL 3MRPA 5FKPB 3SY0A 4WFGE 5A2FA 2XJLA 2DPKA 3BMWA 4OAWA 1TTGA 1KIUA 1EEZA 4JUTA 3FOMB 3T8XB 3C9NB 1IL1B 4GT0A 3IDIB 3SPCA 5I8OH 3BZFB 1QRND 2NNAA 1GTFA 2C3GA 3BAIA 3M8OL 4GQPH 3UTZB 1JK8A 4L1HA 4F7EA 3UJIH 1E4XH 3PV6A 2ODIA 4MCZA 3F7KA 4WHTA 1I7RA 2IPTH 3H8NA 2A73A 2NY6B 3KGTA 2BFGA 3P9LB 1VLXA 2P80D 4M61B 4PFEA 1HK6A 3FT1A 4BA0A 2PUQT 1WEJH 2EE0A 4JBSA 3CFBB 3X2QB 1V05A 1YMHB 5DO8A 1J0YA 3UBFA 5HYQB 3DJ9A 1R9FA 1JXFA 3L3GB 4FYRA 4M3JA 4TUKH 4G9DA 1RFDH 1AHKA 4PJIF 5IGXH 1IAII 2D7TH 4TSBH 2MNWA 2YA0A 2AQNA 4WTXA 5IHUH 3VWKB 1I8AA 4IRZA 2BZCA 1KIRB 4JHAH 5HYJB 1H0DB 1DJSA 3H1ZA 1FHNA 4H1LA 5LAPA 4PGEA 1V3KA 2A6KB 4MNHA 4JFDE 1EJ8A 1KYUA 3HUJF 4PV8A 2ZSWB 4P46D 4UM8A 5D1XB 3UCQA 4G7RB 3GHEL 1PZDA 1AXTL 2GFBA 4Y5XA 3NJVA 4TVPL 4W9LC 3LYRA 2P8PB 3BAJA 1VESA 2WVVB 2GI7A 4YDKL 2H32B 1DQMH 4K3EH 4M7ZC 3M1BB 3OPUA 4R26H 1JCVA 1ZT1A 1QQDA 4BKLB 1T0NA 3FOLB 1QBBA 5JW5A 3B5TA 2A38A 1EK3A 3ZTNH 5C0RH 4PLKC 4U31A 3WY2A 4CL7A 4WI9A 1KB5A 4YSAA 3O4OC 2NXYB 1IQWH 3FQTA 1RJLB 3L81A 3I50L 3QUHA 1BQ5A 4AIZB 2PPEA 5IJCC 4Z8FL 5SWSE 1DYZA 5IBUB 4F24A 4JCLA 3TH3T 1A65A 2SEBB 3MNZB 4GW5B 4NKIH 2LFEA 2ZKHL 4AJVA 4UTAA 4KI5E 2WKGA 4GAFB 1R19A 1RZJL 3WUWB 7PAZA 3ULUL 1E3ZA 4OFVA 4JZJC 5IT2H 5KTEH 5I30L 2ED9A 4WY7H 2TRHA 2BNQE 3IU3B 1NCOA 4OD3L 4XPGH 2GSMB 5DURD 3NIDF 4ZUTB 1NGPL 1EFQA 3VCLB 3IRPX 1QI5A 3O8XC 4JEGB 1C7SA 4TNVF 3MMEA 2P1YA 1UVQB 3FH8A 3EYVB 3HG2A 4OCRL 5I1LA 4FKHA 2GSGB 4JN1H 3MSPA 2OULB 4AW4A 1N8ZB 4G1EB 2FECI 4FFZL 2IANB 4FNRA 4PJBA 4HCRH 4YSQA 1LD9B 5C07D 4KRNA 1R3IL 1IZKA 3U4BH 1QFWL 1AVAA 1QSFD 4IGBA 4PJ9B 3IDJA 1ZPUA 3MNVA 4PTTA 4RGOH 3BVWA 4XAKE 3RA7L 2R2EB 1E65A 4ACPA 2F54E 5B1KA 4X4YB 3FAXA 2YGQA 3W2DH 1P84J 1ZKAA 4PJ5A 1BAGA 2ESVE 4XNYH 1CD9B 2QQKL 2VDNH 2XQYA 5DD0L 4FLRA 5AW7B 1SHWA 2H1XA 4N20A 1FGVL 4WV1B 1CMOA 1WZKA 5L88H 2WQWA 1ZLWK 2BO0A 5LN4A 3JWNH 1MG3C 2O5ZL 4KDWA 4JKPL 1TYRA 1ASPA 3HLKA 1FZJB 2B0SL 4QOKA 2DZEA 3NGBB 2XG4B 2J6EH 1FO0B 4LDLB 1DL7L 1XR8B 2JKXA 4X6FA 3EJZD 3QCUL 1W6LA 1KB3A 5CINL 1FLRH 1QRNA 2ZZUT 1BFVH 2FSDA 3HC2A 1OTTD 4GI6A 4PVNA 3QPXL 5DMJB 4OBRA 1T1ZB 1SZNA 4JJ5B 4Z7OE 3MCG1 4GRLD 4G8GE 4OIIH 4YDJB 1JPSH 2HH0L 1Z5LB 2A77H 4K7PY 1K9TA 1X5LA 3NQIA 1Y1DA 4OQTH 1KLUB 4JFEB 2OLDA 3IVKB 1CF1A 3TEZA 4MQXC 2YMXH 3B2VH 2XVLA 5IJDC 4UQBA 2DQIL 3BZ5A 4FDWA 3U7YL 5TF1L 3NP3A 5IVXA 1JRHL 3GIZL 2AQ3A 1RXLA 2X12A 4E5XA 3R0MA 1WBYA 3OLGA 3NK4A 4I0PD 2CIKA 5I0DA 2NX5E 2XTJC 5CGTA 3GSXA 3UAJC 2GJPA 3O3DA 2KQNA 3IDGA 3EDFA 3VQLA 1H6TA 3GXIA 4OJFL 4K8RD 2X2JA 3V6FA 5I0XA 3ULSB 5I1GL 1R3JB 1DN2A 2ZUVA 3HNTH 2W0PA 1C08A 4JHVA 2OR7A 1UD6A 2ZUXA 3VXTA 5I8KH 4OM0H 4LHUB 4EN3C 5I1IH 5EU5B 3HMXH 3V6ZB 1ED3A 4G80A 1FGNH 3D4YA 4ZUVA 3KJ6L 1QLEL 4IBZA 4PW4A 4E42B 1O7DC 5LGHL 2OYPA 1CC3A 5ES4B 4UM9B 1RZGA 4F7KA 1N26A 4WJKB 1DP0A 3ILPA 1RZFL 3UBXA 3WKPA 4TPRH 5T1LB 5DLMH 4YZFE 1ZHBB 4PJXB 4AYGA 1SRDA 4JG1H 1BGXL 2OCFD 4MGXA 2V7NB 3B3IA 3MBXH 3OPZL 4NO0A 4X7SL 5HHPA 3NCCB 3QJFA 3QNYA 4TNGA 2EUXA 3ZDWA 1HQ4B 2VLRA 1USQA 3EHBB 4PJ8D 35C8H 4MNQD 2W9EL 2EYRA 4WU7B 5GJSH 3WEOA 2BVQA 4TTGA 5I0WA 1J8HD 1TO5A 3B4NA 1UM5L 4HIHB 1HI6A 5EU3B 1LTXA 1TCRB 2OTUA 1QASA 3GJFB 5DEJA 1DQLL 1TJMA 1T66D 2IOIA 1EGJA 4CAGA 1A66A 3B56A 5GGSA 2JI3A 3AUVA 2KZWA 3HUJA 1Z3GL 3L3OB 4YVUA 2V3DA 4JX0A 4A7GA 4IKKA 2OJEA 3OKNB 3L3HB 2GCYB 4CA4A 4LBEB 3B7YA 1TQTA 2YGVA 5DD6B 4UAOB 5E6YA 3KBFA 3RPIA 4JW3A 1DBMH 1QYGL 3SBWC 5F0MB 4N2DA 1J1XH 1MAJA 3G3LA 2XI9A 4G5AA 5E9NA 2ZXEB 3FF7A 3MYJB 3N55A 5L2JB 4EBQL 5JHMA 3U4AA 2B7DT 3S34L 5KG9B 3II3A 3GXDA 4XVSL 4UOW1 3C5ZB 3DGGA 5DS2A 2OMZA 2HTKD 2MHAA 3VI3F 5CJQL 1UA6H 3SE3A 3KPSA 5DZJA 2ICEC 2D3NA 2ZUQC 4FJZA 5C0NC 5IHBA 2F6AA 2IGFL 3WMQA 2VDLL 3SDYL 3WFHB 3GSVB 3SYAA 5CD3A 2KMWA 2HN7B 5GIRB 2YQBA 3KNBA 3TWCL 3H7LA 1T5XA 2VR4A 3G5YB 2GHZA 2IBBA 3KVDD 3V4VA 3QPQC 3VG9C 1H3UA 3FMGH 1MRCH 4OGQC 2ORBL 4IYKA 4QHKI 3S36X 3KLHD 3FONA 3GBLA 4PJDF 2NXZC 1NKGA 4XRCB 1MHPH 1XWVA 2QHRH 3QEQE 4PP1C 5EBMB 4L1LA 2APBA 4G7SB 4A7VA 5EDSA 2DQHH 1ZGLM 2XTJE 2W94A 4Q7DA 2CM6A 3D0VB 3EJSA 3CDZB 4PB9H 2J25A 4ONOA 1HHJB 1NLDH 1VFMA 1RK0B 5LCVL 1ZGLP 3QWQB 4DP9X 4QRQA 5FGSA 5I8CB 2ATPB 5I71C 1KZQA 1YEGH 3MRBB 2BP0A 3TXAA 1MFAH 5IFJB 3SQOH 2PYED 2OZ4L 3ZL4L 3V6OA 2A5UA 4C8XA 2CK2A 5AW5B 1KG0A 1EXGA 2LLGA 1TJGL 2DW5A 3V0EA 3H9SB 4MCYB 2EYTB 3PU7A 1A8JH 1JD9A 2R15A 1TEFA 3LHAA 4GLRH 2E56A 2NR6A 4OUOA 5JPNC 3ZIMA 5C6TH 3CMOL 2IO5A 3UO8B 1WQVT 1KGUA 4DCQB 4LLDA 2Y0SA 1EZSA 4JZOB 2X4UA 3BAWA 5HBBA 3U6RB 2YEVB 1TJHH 4N5ED 4NBZB 3GZPA 1DBAL 5E70A 4LCCC 2ZUTA 4KDTC 1I8KB 4OGYL 4WW2F 2PTTB 1KBVA 3JTBA 2XXCB 4H0HB 4UQ2A 4WI0A 3LZNA 3A3YB 3NFSH 3O6FB 4KXZI 3CFCL 3TV3H 5D1QB 3KLDA 5EN2A 1GH7A 3VGBA 1G43A 3QQ3B 5I6OA 3TM6A 4P23D 5TPWL 5F3HB 4LO9A 3GM0A 5J6HA 3U25A 4WGWB 1ZE3H 2DI7A 1NBVL 2WWKT 4QHMB 4WO4B 3BWUF 1AGCB 2O61B 2GABA 1CXLA 1UURA 2P5PA 2DKUA 3EOBB 4XN5A 4K3HA 3GK8L 3IFNH 2ZOKB 3PWJA 4HT1L 3WNLA 1JWSB 1NEZA 2X44D 2NY6D 4ZS7H 2KI6A 2WWKO 3PP4L 3LMJH 4PS4H 2X5PA 5AKRA 5HHOD 3FPXA 3GBEA 3ECBA 5IW1A 3B2DC 3W81A 1Z1WA 4F5CE 1JNNH 3PJLA 3IDNB 1F4YH 5CEZD 1JTPA 5EWIL 1CVSC 1DQIA 5FCUL 3BP6A 3DXAD 5JXEC 1T4WA 3VWJA 3FUHA 3AW5A 2OPCA 2JKTM 1KTBA 4LSTL 4XWGH 4FTVD 1B3JA 2ENPA 5T3XD 3VWKD 4Y16B 5HYJD 2EYSA 4QXGH 4APQA 3BWZA 1G7MB 4AKQA 4KV5F 3GLAA 2EDKA 1E90A 3EG9A 2CK0L 3QJHA 5JR1L 5D1XD 1ETJA 4NRYB 5K5YA 1XF4B 2FGWL 2FQDA 4P04A 2F8IA 1ZHLB 5D55A 1U95A 2FEEL 5MEQA 3FB7A 3LNHA 4M48H 5HJGA 2PKDA 4LEEA 2Z7WA 3EH2A 4UQ3B 1ZLEA 1AGDB 2EZ0C 1T4KA 4OF0A 4Z3HA 5TFSL 1NCGA 2DJSA 4N1CA 5KBPA 2JQZA 3ALXA 4KPHL 4PHZA 3FXIC 5DD5H 5IMMA 6CGTA 3HHSA 1MQKL 1FL3B 3DK0A 4KOCA 5DMYA 5E51A 1XF5A 4DUVA 3Q8EA 43CAB 5C09B 4BK8A 1FC2D 2ETWA 4U6XB 4JQXA 1JNLH 4PN6A 3QWRD 1AFVH 5EMYA 1KENH 3NABL 2Y6TE 3CN4A 4HJ0C 3T04D 2E27H 2Y5TA 4ZTOH 5I0YA 4X4XB 2YD0A 1H3WM 1PYWB 2ZCKH 3HIZA 4K3JL 4RMBA 4YUEH 5D2NE 2ED7A 4R7NA 3R4RA 3SDXE 4AM0B 3Q01A 4U1NB 1AANA 3DSNA 3EYSL 4ODVL 2X4TB 5E7BA 1CR9H 4BCXA 4DVRL 2BNRA 3TEYA 1S9XB 3N41F 1S9KC 1TKWA 3LIUA 4YIQA 4MJ6A 4POYA 4WEBH 1EUUA 3T1WA 2K6WA 1I7ZA 3HVNA 1CLZL 2V2XA 3MLUH 2W65B 5I16A 1BDYA 2A1WH 3OX8B 1JXKA 1JE6A 1LK3H 2OBGA 4PJ9D 3NIGE 4Z7AA 3DA0A 4BFEA 4OFYA 5HGGS 3IWVA 4Q97A 4JFFB 1P7HL 3PREA 3DV4A 1R0AL 3VFNA 3X3GH 2WKOF 5C0EB 4M3HA 2CKBB 3MLWH 4OD1L 1S7TA 3QRLA 3N40P 4RGNC 5IBTL 5BVPH 3KE0A 3I02B 2F7PA 4F7MB 4KTGA 4PJDA 3FT4B 5FAAA 4KY2A 5C0JB 2OCJA 1TIUA 1BZ9A 3T2LA 1FP5A 5C7ZA 3EXJA 3P1VA 2NUPA 3X12B 4GP4B 2IFGA 5JIHA 2F19L 4X6DB 1L5GA 3Q1EA 4PS8A 4JFOA 1J5CA 1AD0A 1RZ7H 3HE7A 4YXLL 2I07B 1NUDA 4WNQA 5FV2A 4HUVA 3OKMB 5DHYB 3QFJB 1RMFL 1TXKA 4CGTA 1CXEA 3DX8B 1F45A 5TQ0H 2WWOA 3F85A 1AIZA 3DGDA 3MRKA 3NAAL 3S4SA 3A23A 3TA3A 3WIIL 3PXJA 4ZMTA 5IESH 4X4MA 4GKOA 4M1DL 4YPJA 1J05A 1RIHH 3VFMB 2AMGA 2X6CA 4KXDA 1IGCL 1G7JB 1QR1B 5E9AA 4PRPB 3UTTA 1TVHB 3VE0A 3QG7L 1UQSB 5TQ2H 3R0NA 4XR8C 1WAAE 4BFRA 5KVDH 4RGMC 4V1DB 4W68A 5A16A 2ICWB 3RNKA 3AXLA 3G5ZB 3MRQB 4HEPG 2A4ZA 4N0CC 2VLKA 3V9FA 2AEPL 3RVWD 4ODSH 4H2CA 2BVOA 1FNEB 3BKJH 5DYFA 2HMIC 1P9MA 3W0WA 2VERA 3ZL1A 4ELKA 4Z3FA 4HUUB 3TBWA 3QJRB 4M7LT 4B5ZA 4Z7OF 4WW2A 4GIAA 4LVNC 5I76A 4O2EB 4GW4B 3MR9A 3WTXA 1XH3A 3H42H 3BUIA 1MJUL 2P5WD 4L0ZA 3RGVC 2CCVA 2KLRA 3IDXH 2DM2A 4LHUD 2F68X 2B20A 3SGEH 2D7NA 4BUHA 3MRPB 2I60L 3P0YH 3PNWB 3ULUE 3L5XH 1WTLA 1ZXQA 3GS7A 4BH7A 4ENED 3AY4C 1QFOA 4X0NA 1BM3H 5G2NA 5L4IA 3PFUA 2GBTA 1KIUB 4GAJL 1Y1UA 2RCSL 2ATAA 1CGTA 5KSUB 5CD5C 2AJYH 3ZZ1A 4ERSL 1A0QH 2NNAB 3D50A 4Y9FA 4J3SA 1JZGA 1X7SA 4F7EB 1KN2H 1CB4A 2WNGA 1K5WA 4NNPH 3VTTA 3TGXA 4HWNA 5EF1A 1VZIA 3C60C 3CVBA 1IAMA 5DEGA 2XFXB 4P2AA 2DI9A 1JPEA 2ZJSH 2ILLA 4Y2DA 2GBAA 3UYPB 1R3HB 1GOFA 3ULVL 2YAEA 1G94A 4OW6A 3BDBA 5B8CC 4D7BA 2EO7A 5FO7A 3VXQA 4FXKA 3VW3H 3BT2L 3TCTA 1UJ3C 5FGBC 3BH8B 4DAGH 4TUUA 2B77A 4JZNB 2GBVA 5K9KA 3B7TA 5IG7B 1B2YA 1S9YB 4L3FA 1MF2L 1NGQH 2UZPA 3GRWL 4JQVC 4NI6A 4UTCA 3U36A 1R33A 5CHNB 2X4OA 5KVEE 3AG3B 1WCBA 1V3JA 4H1LB 4I48A 4ONHA 4MNHB 4UM8B 3ETSA 4PV8B 2WIIB 3TT1H 3BDYL 4H0IA 5J56B 3EFFB 4HJIA 3WKNA 4EZLA 4O4YH 2UZIL 3A5VA 4FZEL 4ZNEE 2EDOA 1THAA 5CP7B 3X11A 2VWEC 3P54A 1UGNA 1ZT1B 3CXDL 5HI5C 1T0NB 4JPSA 4K8RH 3GZQA 1VKXA 1CDUA 2NTSP 3I6KA 4I4WB 1EJOL 1ONQA 3N42F 2JKIS 1TNMA 2OYLA 3WJJA 2YIHA 1XH0A 4NZTH 1JNHB 2AQSA 4WU5B 3FQTB 4JFPA 4N9OB 4LCIH 4JFDA 4UTBL 1NGXB 4LCUA 1NBZA 2EDTA 1DZBA 4C56E 4LLWA 4H8QA 4HK0A 1I8LC 3EJUA 3HBGA 3SQBA 3T0ED 5IQ9A 4LVHB 1U42A 4TULH 4DJMA 5HGDA 4ZW7A 3L1FA 3LNIA 3WXWH 3IGKA 4EJ1C 2MEJB 1NBYA 2OJZH 2IG2L 4WUUE 3FB8B 3VXME 3X1FA 3PXLA 1OAJA 4JFQA 4NKOB 1WG3A 4PR5B 4RVBA 5TE4H 5EUKA 5SV3A 4U6HB 3ZDXE 1S7XB 3NOIA 1FNHA 5JZ7C 3BRFA 2OMWA 3DVNA 3KLQA 4XPFL 1KCWA 3C2AL 4X80L 5TE7L 3KWWB 1SXAA 4GUOA 3FZUC 4TYUA 5CAYB 5DJCA 5SWSA 1MREL 5FW8A 5AG9A 3CLFL 5HGBA 3V0VA 1KF9B 1WD8A 4HS3B 2D3VA 2H8PA 1OHQA 2E5EA 3ESUF 4K7PH 1XX9C 1T20A 2BS8A 4K5PA 3TS8A 4PJBB 1F02I 2K7QA 5DYOB 4UMGA 2BP3A 2K4WA 1U8IA 1GS8A 3RZCD 3EJCA 3IMBA 4IGBB 3CHOA 3IDJB 4KQ4H 1A1MA 3ARTA 1RUKH 4AKPA 4WEEA 2WN2A 2BNQA 2WKOA 3AU0A 3GZKA 2OXGB 2OL3A 2ZF9A 3IPFA 4WK4B 5EA0H 2AQ2A 3CFQA 5E00A 1U3ZA 5KJ4A 4LP8A 1CFTA 1AHWA 4X6CE 4PJCE 1IC1A 3D09A 4LP5A 2ITCB 3O2WH 2PYFA 4GUQA 1SYVB 4JPWH 5E8OA 3FH5A 1JF6A 3UGUA 1S9WA 3LKQB 2QJDA 1EAJA 1BMGA 1D6EA 4J3OC 1AR1B 4RFEA 3ARFC 5D7HA 2QVFB 2GITA 3LQAH 1YMMD 2VNCA 1QW8A 2CRZA 3U46A 1OM9A 2F54A 3O81A 4O2FB 4X6FB 1CDGA 3HPJA 4X7EC 3UTSB 4KQ0A 2IBZY 4LKCB 4N0UE 2XPGA 4WTZG 3KJ4C 1EDYA 3PJSB 4K5NA 2GJJA 2ESVA 1XB3A 3TESA 1K3ZA 3SD5A 3BPNB 1NCWL 3QUMA 1MAKA 1SFHA 5MI0B 4L9LB 4DQOH 5EUOF 2J55A 3EYOA 3WTVA 3PHAA 1DJIA 1SY6L 4OI7A 2A9BA 3ROLB 5D1QD 4LXFA 1YEFL 2ZTBA 5I1HH 2RGSA 4IIQA 2XZQL 3OMAB 2CA4A 3FT0A 5I74B 1D7DA 5F9WC 4QTHB 3VI4B 1YDPB 2MMXA 4LOEA 4PJ6A 1SF3A 3H55A 1OALA 1BQLL 1JF1A 3FO0H 1YAZA 4XN9A 3NBNA 3BRDA 2Z35B 4GS7B 4G8GA 4YHNA 2NY4C 4N2IA 2AEQH 1EZVY 2JCCE 2PCFB 2PCYA 3GF8A 3C5SA 3V6FB 4AW7A 4M93C 2IWKA 4IBTA 2BVYA 2Z8WC 3SYPA 4A67A 4OF6A 4YFLI 2B3IA 5GSVB 3VXTB 1PAZA 4PLOB 4M9OA 1IARB 3N43F 2UUDK 4MAYA 3QDGE 3W9EA 4DEPC 1ED3B 3WFCH 1YEJL 5DA0B 5J0BA 1OT2A 1DEDA 3A6BH 5AZ2L 3O2DA 2NX5A 3JYBA 4L3EE 4MMYA 4IQHA 2ZYRA 3QK0A 1Z0MA 2C9VA 1T03H 5K39A 1I8UA 5HSFA 1PY4A 4Y5YC 2Z8VC 1XL6A 5E56A 3WHXB 4ZAKD 1A7BA 4KROC 4KMLB 3P30H 4O5LH 4TSAH 4ONFH 4NO0B 2EDQA 4MA8L 4IRJA 1D5MA 3QJFB 2B4CC 2YZ1A 3MV7E 4K71C 1MAMH 1KJMA 4X8GA 2ZOLB 2EYRB 5LLIC 2ITEA 2E59A 5J6SA 1K4CA 3H9YA 5E0QA 1LP9F 4M56A 3TO4C 5INCA 1P6AB 2HT2C 5DQDH 15C8H 1HI6B 4H8WC 4XGZB 4AZUA 3FYIB 1E4JA 2FEDC 1C16B 2GI0A 2Q20A 4PJEE 2EH8L 3MV8E 4N8CL 3UZEA 5FW6A 4F20A 3VVVA 1DLHA 1OCWH 3QO1A 3QR0A 2R4SL 4M6OL 4H7VA 2OJEB 5DRWB 2XUWA 1OGAE 4KK6D 2ICCA 1KELL 4NC0B 1L7IH 3IJ9A 4DFHA 1JYVA 5C3IA 4GEIA 1FYTE 5G5DA 2HA1A 4I3RL 4J39A 2EXSA 2WO3B 1E28B 1G5GA 1UXMA 5FYLD 4E41B 5LWYH 3ATBA 4PYGA 4R5TA 1M56B 1JL8A 1SEBB 2IALA 4U1SB 3N1FC 4AQ1C 2FO1A 4ZOAA 5EHFA 2ADFH 4JHUA 3A4EA 3OZLA 2MHAB 3GHBL 3C2SA 5CEZH 3BVNB 3KPSB 2VDLB 1OCCB 2AEWA 4ANXA 2EXYD 3L4YA 4IU2A 5DF0A 1SXNA 3V4UL 4AKOA 3VXPA 5HXMA 5MENB 4RISL 1G9HA 3REVA 5I75C 1ADQL 2O5YH 4KTEH 2WYIA 2AAVA 3DIVA 2NNFA 1WGVA 1NL0L 4URTB 4JFFD 3RWGA 2CO7A 2YAPA 2ZG3A 5T3XH 4N9GA 4FA6A 4GQRA 4LU5H 2P44B 1VGEH 2WCSA 3O6ML 4NZRH 1QFWI 1M05B 5B39B 4JO2H 5DS8A 3W9DB 3DHJA 3FN3A 1M6OB 3JSSA 4TNWF 2VMCA 4XCNA 4BK4A 4F9LC 2HLFC 4FL4B 4KZEL 5C3LD 2EEDA 2H32H 2HKAA 1I1AB 3ARBC 3JUYA 2XZCL 1KJ2L 3OJDA 2P5EE 1T6BX 2DBLL 4UOW0 1X6NA 5D5ME 3BXNA 3QFJD 2DLFL 4XP6H 4H8PA 3G5XB 4YFLF 4UZUA 5D70H 4ZUWB 5JMOC 4P59L 2VN6A 4NPJA 1G5AA 4F8NA 3CLEL 5D7IB 3QUZC 1AH1A 4JPQA 4P2OC 1BZOA 4G6MH 4KUZH 4WSGA 2PO6A 2OTPA 1CT8B 1XCQB 4RLDA 1NWOA 1SXCA 3BD3A 1AE6L 2CJSA 3MBEA 4YDIL 2JMRA 1ZVSA 3QEQA 4S2SA 4EOWH 2LOEA 3WV0A 1KG0B 1XIWB 1JD7A 4AZ8B 3L3KA 4LEXH 4D3CH 4EDWL 4KZDL 3UZQB 5DQ9B 3OC5A 3UAJA 2V2TA 2I5YL 3LHPH 5DHVB 3KR3L 4P5KA 4QGYA 1EAQA 3E7JA 1OAXL 3CVIL 4J27A 1NDGA 5CSBA 4R96A 5H2BB 2IADB 2X4UB 3HI6L 1OPGL 2FATH 2N01B 1I8MB 1RUPH 4HMEA 3LZFH 3BO8A 5E6IC 3MRIA 4N8VG 2VM4A 2YXVA 4L8SC 1JRHI 2IDCA 2VXTH 2Y06H 2WVTA 4UQ2B 2QKIA 4MA7L 4Y1SA 1TQUA 2Q8BL 4A2GA 4KVNH 1WAAF 4G8IA 4MDIB 4OLYL 3EIFA 3IJSB 3T0BA 2Z3FA 2NTFA 4E9SA 2YD9A 1IV8A 4LF3A 3SE9L 4OCXH 1YPZE 1XZ0B 2V2WB 2ITFA 3HZ3A 3SDAA 1UOKA 4AENA 4Y1TA 3MHZA 5ESVA 3Q13A 2ZKWA 3JVFC 2DQCH 2YK1H 2BWDA 3QUYB 2XWBA 2MOQA 2H2SC 4H20L 5DJDA 5AKSA 1BJMA 4JJOA 3HW7A 2JB5L 2CHDA 5FR3A 4KOBA 3F64A 2E4FA 1MY5A 1NEZB 1TLMA 1IKNA 3BQUB 3DHMA 3GQFA 3R06A 3WUZA 5IREA 1AMXA 3BHBA 3X1EA 3OAYK 4OZIE 1FO0H 1U93A 3ULUF 3QI9C 5MHSD 4CDHA 2RTTA 4EE2A 3S8FB 4WI5A 1N59A 3LXAA 1XCWA 2FB4L 4XBEH 2AK4D 4HJJL 1IC4H 1OP5K 5HP5A 1EX0A 1XGQB 4R2GC 1M2VA 3H9HB 2BHZA 1DCEA 1WBZA 5BO1H 9CGTA 1USZA 5GS1C 2V4LA 2DQUL 2HFGL 4N2LA 4YDLC 3GXUB 2XWDA 1NCAL 4YHMH 4HA1A 5FYKD 3SGKC 1CG9A 1ACXA 2A4CA 3LB6C 5DJZA 4D8PB 3EG9B 2AGJL 3SBWA 3BSHA 2AJSH 2HFEA 2DYPB 3NRPA 3VFUA 3AS0A 4TVPD 2FWOB 4DZ8B 4F5CA 2F58L 1QTPA 2BSDA 4IU3B 3HPLA 3WAKA 3WBDA 1J1PL 2DLTA 4HFWA 4KXZH 3FB7B 3D87B 4LOUC 1VCAA 4Q9BA 1LDSA 2CXGA 3EF7A 1QP1A 4Y9BA 1B90A 1MCDA 3MJWA 3KW8A 2H3KA 5EU4B 1EBPA 3SJVD 3WN5B 3QJSB 1A3RH 3VX0A 4QO1A 4QRSA 3LD8C 3IS0X 2DQFB 1QHPA 1RK7A 2NY2C 4FG2A 3RJDA 5LJYH 2MIZA 4ZFQA 1R5IA 3CBKB 5JOFB 4B97A 4HK3N 4JGNA 2AQPA 1DJYA 2ADJB 4DFIA 1XF5B 1DVFC 4R97B 1IGFH 5BJTB 2OA9A 4UBDC 4ZFOA 4ODTH 4QXWA 1BEYL 5GXBB 3QHTC 2CG9X 2X70A 3DUUB 1KBPA 3FU0A 1QWNA 3F00A 4U1JA 4YE4L 4TMPA 1I7UA 5HHNB 1TMCB 4Y5VB 1I1CA 2EC8A 3TV8A 2C9QA 3DSNB 3ESVF 3QDAA 4XOAA 1K4DA 3LV3B 2X1XR 5SX4I 3L3IA 3M1CA 1R24A 4PYHA 1KYDA 1QLFB 4MKMA 2R4RH 3N3EA 4Z76A 4RA0C 1I8IB 1QI4A 2WUBH 5D71L 4HAKA 4O51A 2YC1A 4Y4KD 3RI5K 3MA9H 2V2XB 4PS3A 3F6JA 5FA4A 3GSUA 1FH5L 4UZGA 1N64L 2WBKA 3NEEA 5KSAB 3CVHL 1CXIA 2YQ3A 5E8PB 1LO3H 2VAJA 5D2NA 3SDXA 3GJFH 5ID0A 4X99A 3LVEA 3BWAB 3MKGA 2EDDA 3C6LA 4Z0XA 4AIOA 3DRTA 1S7TB 3UIYA 4FJ6A 1MKFA 2WINB 4XMTA 2FX8H 2HG5A 2ZWSA 1KCRH 3BZ4A 3PV7A 2Y36H 3WEMA 2ZOOA 3I9GH 2XN0A 3F6LA 1AZVA 3OKYA 1IJ9A 3MLZH 2DH2A 2IOMA 3ULVE 5EF3A 1KMGA 2FDBP 5AUMB 4J28A 1AR1D 5F1IB 5A40E 3UG3A 4JFOB 2G9KA 1KCVL 2F1AA 1HDMA 4PGCB 1JZHA 4WNQB 3MJ9H 1X6LA 3OAZK 2WXNA 2WVUA 2OW6A 4NO2A 1UFUA 3PWPD 5IMOB 1R3KA 1T89A 4UUJA 3VD5A 3RVXD 3ZO0A 2JKLA 3WJMA 1BA9A 3ZZLA 1L6ZA 1KJVA 3Q2CA 4X6CF 4PJCF 5BUGA 3DLQR 1J05B 3T2PA 2PP9A 2PLTA 3PWNA 2MJWA 2G9HB 2EIZA 3HBZA 3WOVA 3MJ8B 3AT9A 3VE0B 1B4JL 1FFOB 3TH4T 2OV0A 2VM9A 4ZFGL 5I23A 2BOBA 4UIMB 5FHAL 3LN9A 5HHME 1HZKA 3NCJL 5A16B 1AIFB 5KVGH 1TTCA 3CK0H 5GGSY 4WUUD 1HHGA 4NDMB 4OLVH 3RL1A 3SODB 5I5IA 4QJ3B 4Y4FA 4JCWA 1PQZA 5E8NA 4AM0Q 3V0FA 2GJZA 3W0WB 3U82B 2YAMA 3TF7C 4BELD 4KMQA 1JPFA 4L9DA 3WYRA 2DAVA 3LS4H 2MQ0A 3UACA 2XZZA 4GRMA 3IXTA 1JGLH 2IFFL 1CF8H 2Q76A 1RURH 4GXVL 1WAAA 3F83A 4FNLL 4XWOD 4K94H 2WLIA 1A6AA 1II4E 2R2HB 4N2NA 3ZE1B 3UDWC 1LDPH 1KV7A 4ABWA 3OD3A 1IGTB 4A63A 4OZFG 5IHZA 2BH0A 2RBLA 2OMTB 1U8OB 2IAMB 4FABL 3POHA 4BH7B 4ICXA 3EOYG 3RTQB 3UAEA 4Y9CA 3RHWK 3T2OA 2H1LM 1BF5A 3U30C 4HGKC 2UXGA 3ATAA 2VXQA 2JCCF 1KTLA 2NSQA 4P06A 1D5ZA 1FNFA 1T0MB 1XB6A 4W81A 2ZYSA 4NX0A 3WMPA 3P0VL 1U3JA 4BYHA 1JHTA 4YPGB 2E9JA 3ZKSD 1FN4A 4OFQA 4WSJA 5EPMA 1K5NA 5CWSA 2JSFA 3BUTA 2FEJA 3Q1SL 5T1KA 4H26B 4J3UA 2ENYA 3HNVL 1U8HB 3ISYA 5IK3B 3K6SA 5HD8D 2FGZA 2P24B 3FO1B 1B88A 1MWAL 4M8UA 1PKQE 3MXWL 1A7OL 1A7PL 3V9EA 5CCHE 2WWMD 5JUEH 1K3IA 3BKCL 5K9KB 2FEEI 3Q2WA 3MACH 5BOPA 3WL9A 1E5YA 4FTDA 1U3NA 3MRDA 3T3PF 3NA9H 3MLXL 5EIVA 4GG6B 1YYML 1UGKA 1WCBB 4QRTA 5CSZB 1GZQA 4HD9A 4D0DB 2R56L 1NFDE 1AZUA 1KTKE 5TK4A 1UKTA 2F9BT 2BS9A 4UCFA 3VFVB 1GJWA 3DX9A 1XD0A 1H5BB 1EHLL 1O7VA 2F53E 2JJVA 2VR6A 2E9WA 4HEPA 5C97A 1MUJB 4GAGL 4I77H 5IM7A 2VL5A 4NO3A 4MBOA 1JGEA 4E41D 5GS0C 2YKKA 1H3PH 1A7RL 1KEGL 3I6KB 3VXUB 1CI3M 1F4HA 1QHOA 1JFHA 3O6LH 1D5BA 3JV6A 4HIJA 2VABA 4NWTH 4ENZA 4Y89A 5MEOA 1OP5H 1E9OB 2J1KA 4ALAH 1C1EL 4JFDB 5CZXD 1TFHA 3E2HC 4LCUB 1NBZB 5I8EB 5A2JH 2H3NB 4LLWB 4HK0B 1ICTA 3RU8H 3MLYL 4KK5C 4WWID 4XO9A 3SQBB 1P2CA 2DI8A 4MZRA 3IU4L 5MEND 2GW5A 4ZNEA 2GAZB 1NPNA 5HGDB 3CLWA 4XNUH 4JANA 4CBZA 3ASOB 3MUGB 1ZV9A 1NBYB 3IXAB 3ROOB 1KWKA 1L7TH 1ETB1 4KVCL 1K85A 3VFPA 4R5XA 4HUCA 1MCIA 4G8AC 1BBJA 4P48A 2MSPA 3V95A 4AG4H 5B3NA 5ITBL 4XC3L 1P4BH 1JI1A 3MCLL 1UH4A 2OMWB 3BP5A 3KL5A 4HZ1A 1F4XL 4OM1H 2F1BA 2J4WL 3HRZB 3B7SA 2CBMA 5H8DA 3BFOA 1E3XA 3K72A 4L37A 5A2KH 4C56A 5CLXA 4XVJL 2R8SH 2A7BA 1OP9A 1E2WA 4FXGA 4PMFA 1YUHA 4L4VE 1I1AD 1JBJA 3VFWA 4WDIA 4IHBA 3ZE0E 5FGRA 3VXMA 4WUUA 1MHHA 2NT1A 5EEXA 3V4LA 2PXYB 1AP2A 2KQMA 1VPOH 3CIQA 3NSFA 4MMZB 1A1MB 1S7VB 3E9TA 3SKOA 3GNML 2MQ3A 4S1DD 5DWUL 3MJ6A 2R1YA 2OL3B 1PLGH 3DBSA 1EMTL 4LSVL 3KGSA 1RUQL 3HMWH 1CLOH 5AWNH 3PWUA 3P02A 3GTVA 3I9PA 5EFIB 1S46A 2FT8A 3MV8D 2AMUA 2BJML 5MP6H 4FLOA 5FUCC 1JZJA 4JRLA 5KAQG 2DB8A 5CJOL 5D5MF 1EEQA 3RFRA 3RWFA 4YWGL 1OGAD 2JJTC 4L8DB 4YSUA 2HT4D 3EO9H 5F8RC 5GISH 1XSKA 2Q9OA 3WXVH 5C9KA 5TH2A 3EDDA 1OZUA 1YEEL 4W9ZA 2O4EA 3L17A 1FYTD 2WW8A 5JW3L 4DZBB 1HSBA 2C9SA 4GUPB 4PGDB 2XPGB 4X5XA 3K2IA 4M62L 4PJCA 4L1BA 4X6CA 3MLSH 1HKLL 2ESVB 1PBYA 1LL1A 1CFVL 4G9FE 1NGZA 3NQKA 1OOAA 2FQFA 5ICUA 3QUMB 1KYOK 4NC2B 1U3HC 1OSZA 1OVZA 1W8NA 2I85A 1E8YA 2JTYA 3VD3A 1INQB 4NAMA 5EG6C 1MCOH 1MH5A 1W0WB 3GXPA 4GXFA 5I5JA 4CNIA 3QIUC 3U1SH 4OUUA 1OB0A 1LEIB 2GC7C 3QH3B 3IDMA 4Y2NA 2QMJA 2CKBH 4P3DB 3RG1C 3CSFA 4L8BA 3FQYA 1A7QL 3OBAA 4N0UA 4BZ2L 2A74A 1JF1B 5FB8B 3QUYD 5JIKA 4KMTH 2ICWJ 4YK4C 3ASWA 3LN5A 4YZWA 4X7SH 3FU5A 4NJAL 5E8EA 4LRNH 1YQVL 3UJJL 3D9AL 1UWGH 2FWUA 4E36A 2VXVL 5FF6A 3AC0A 5J8OA 1TZAA 5HI3D 3P3UA 3BQUD 1XZWA 3MRGA 3ZRCC 1GTNA 1TF4A 1UJ3A 4HJ1A 1J10A 1Q0XH 3BGMA 2MCAA 1UYWL 3GEWB 4YR6A 3MRCA 3H2PA 2IH8A 4HXAH 4F57L 3RVTD 1YRKA 1MIEH 4BKTC 1LJMA 4JQVA 5C08E 4AYFA 1W91A 3D0LA 1CU4L 1KGCD 3FW6A 4S1SH 5C8JA 5FGCE 3EGDA 1QBLL 1WICA 1PVHA 4LDOB 1HS6A 4WFEE 1CLYL 4FLQA 4W9EC 2JCCA 3FUKA 3ALWA 1RV6X 3WMSA 3AREC 2XV6B 3GUTB 3HG3A 3LH2H 4M7ZB 3LEYH 2DYPD 2YR3A 4ODUB 5FYJD 4K9EC 1P7KA 1VENA 4M5ZL 5HHVH 5I8OL 4Z77B 4QNPE 4GBXA 1D5MB 5AVXB 2Y4SA 2GTWA 3QDGA 3KS0H 4WJG3 3UJIL 1NSNH 2CIIA 1R5WA 2FJHA 1KJMB 3C12A 3CZFB 3IJ7A 1QFHA 2P28B 4G6FB 1E40A 4WCYH 1UJTA 1QZ1A 2IPTL 3O4OB 1IE5A 4CW1B 5GGTH 1BIIB 2YSSB 3GI9H 1K4CB 3ARZA 2AK1H 4L3EA 5FKAA 4FJYA 3OB0H 3ZHKA 2WLHA 3FS9A 4F91B 1WEJL 5INCB 4KK9D 4XNMA 4GSDH 4WTZA 2FR4B 5KYUB 3B2MA 4LSPH 4PTUA 3QJTB 4Q6IC 1DUYB 3CSPA 3HI5H 1G6VK 5IBLD 1QSVA 4WGKA 4Q9RL 4XODA 4EI6A 1RFDL 2ZSVA 3GZOA 3N6YA 2D7TL 3ECUA 3K8LA 1TSHA 3MV7A 4JZJB 4TSBL 2BFVH 1DLHB 2YRPA 4NUGH 5EOQH 5IHUL 4QRPE 2WM0A 1M7IA 3VDCA 4JHAL 2EINB 4LESA 2L3BA 5BRZD 2OZ4A 4BSVB 1LO4H 1BIHA 5D7KE 3O8XB 1RK1B 5FUOH 2YPVA 5G5DB 1SLWA 5EO1A 2HVJB 1AKJD 2VQ4A 3OMNB 4MAZA 3AM8A 3LAFA 4R7XA 2WGXA 5FUCE 1T7XA 4NQCD 4S10A 4PJEA 1IAIM 4OCSH 4R26L 1XTMA 3MV8A 3NIFE 2GY7B 5JO5A 2KKQA 1I1YA 5HVHC 3ZTNL 5C0RL 3H3KA 5IKCB 4Z9KB 1B0WA 3CPUA 4OB5H 1OGAA 2YRZA 4BFIB 4F3FA 2TSBA 1IQWL 4IU2B 5KSAD 3HHRB 3UPAA 3QDJE 1GIGH 1FYTA 3MJ7A 3REVB 1HEZA 1SN2A 3P9MB 1NC2A 5HYIA 4D9LH 2A6IA 3CZGA 2CO7B 3EDJA 5FYKH 4N9GB 4P4KC 1MFNA 3KGRA 1U91A 4P07A 2JXMA 3ARFA 4H1LH 3S5LG 3BUQA 2J5LC 3QQ9C 3T4AA 4NOFA 1IIIA 1UUSA 5DS8B 4TVPH 2RH0A 3BSGA 4UB0H 3D39E 1DJHA 4XCNB 5IT2L 5KTEL 3D25B 2EDFA 2VISA 4WY7L 2IOOA 3BT0A 4Y1AB 4BE6A 5F7BA 4X6BA 3U7WH 1FA4A 3ILQD 5IF0A 3PABA 4XPGL 3V5HB 3OJDB 4Z23A 4HQQH 1MVUA 3TN0C 5ICXA 4OFKA 4C83A 5C86A 3D51A 4RMTA 2F5AH 5IEKB 4R4NC 5M94B 3BXNB 4H0GA 4TNVK 5C0CE 2O6EA 4G5ZL 2QPUA 1OPOA 2EP6A 5AYUH 3QHFH 5DVMA 1W72A 4P2RB 4HCRL 1HCYA 1VIWA 1LLAA 3FQUB 3U4BL 1MLBB 3OKOA 4OLUH 1N3NA 3F62A 1CFSA 1CPUA 3EJQA 4RGOL 3US0A 3VGEA 4S2SB 1E4WH 4LMQE 1MW1A 3ULVF 3AS1A 2B14A 4UTAH 4ZPTA 2CD0A 2XTJB 2P5EA 4CU6A 3TJEH 5D5MA 5E94A 5EZLB 1T1YB 5I30H 3NZUA 4PVLA 2VDNL 4XNYL 4FCHA 4P5KB 3S98A 3ZBMA 4DH2A 4OD3H 5L88L 3LVTA 1RJZA 1XXFC 1G7HB 1VADA 2WZPA 1NGPH 1E5UI 3ZTJH 4R96B 5ENWB 3K4AA 3L48A 3EYUL 2XV2A 4OCRH 4EN3B 2X42A 5JW4M 2J6EL 1QA9B 4GG6F 2PPAA 4IK7A 4XE5B 1FLRL 3JT2A 1KYOJ 4BQ8A 4CU8A 2NCEA 4MVBC 3E3QE 1PEWA 2H0FA 5D72H 2NTFB 2Z64C 4Y5YA 1A6ZB 2A9MH 1SJMA 5FO9B 4L1TA 3BZDA 4LF3B 2A77L 4I18A 2AFNA 5C6PB 2EJ1A 3RTQD 4JL2A 1KY7A 2Y07L 4J8RB 3HS8A 4XP4L 5EC2A 2Z8RA 1BX2A 1A9EA 4AENB 5DD0H 4XOBA 2Q86B 4JS7A 3ZHFA 1U8QB 3B2VL 2C1OB 1OCOB 3KPRE 4XHJC 2EVIA 5DJDB 4FQXB 4HIEB 4K5LA 5L2KE 2B4CL 1TEYA 2P8LB 2Y3AA 4IMKA 1F56A 5IVZB 1MXGA 3VD9A 2E9IA 2C1PA 3QUKB 3TO4A 3ULVD 3QCUH 2X38A 4Z7WF 4XNQA 1HFUA 4HH9A 1YPZA 1P5UC 3QPXH 5BXFA 3C6EA 2B1HH 3H6AA 3HNTL 4OSUH 4HH8A 2W07A 5HVGB 1ID2A 1D6VL 1PZSA 3TZVC 3PGCB 1M2VB 1MFUA 2VYRE 4WNSA 4OQ1A 1OQOA 3MTRA 5FFGA 5I1IL 1UZGA 1QWHA 2WYTA 3GBDA 3HMXL 4D0CB 1FGNL 3HBQA 5EO9B 3CHSA 2KYIA 3IT8D 3SCMC 4U1IB 3W5MA 3VGHA 4PV9B 2EIKB 2EKJA 4KXBA 1LMIA 4PP2A 1H3GA 1QEWA 2ADYA 3PXHA 4OZIA 3OKEB 2XRAH 5C7XH 1QTYT 1UCTA 3THMH 2X0WA 1RCYA 3GIZH 3JVGC 5FCSH 4EI5A 6TAAA 4ORGA 1V5JA 1AI1H 2IDUA 3O9WA 1DVTA 4TPRL 2MFNA 1ETZB 1E50A 4ADGA 3X13A 4N2EA 5DLML 5EC1A 1WT5A 4HFWB 4P5TC 2BMKA 5J1AB 1GGYA 4JG1L 3VQ2C 3MBXL 2UY6B 3CFJA 4LE8A 2VL4A 5I1GH 3CVDA 2VW4A 4L2LA 3B43A 2YD5A 1X7QB 2ICEB 2ZUQB 35C8L 5GJSL 3VXUD 2UV3A 3VXNA 4N8VA 1UB5B 4NFDA 1N12A 5L0QC 1H3XA 2E3VA 4FFWD 4K9JA 4LPCA 5E5RB 3SDCA 4Q9QH 2KDYA 4I87A 3VG9B 2UZXB 1ZHKA 1MHCB 4XO8A 2YEZB 4N28A 2YLHA 2VGLM 5F96H 4M03A 1RZFH 2JLLA 3MCKA 4OD2B 4NZFA 2NXZB 5BUAA 2N59A 4TTDC 1PD1A 3QUXD 4JRWA 4Z3GA 4Z1PA 1UD8A 1IBGH 1I7UB 3B9KD 3BD5A 4LFHG 4GSXA 4P8QA 1JWMA 3VRLE 4NKDA 3GSWA 4IKIA 1B9KA 1K4DB 4P3CH 5DTFA 1R24B 3WGVB 1J1XL 1NAML 1EHAA 5I18H 4FNSA 3IGAA 3HNSH 3QUZA 2HX8A 4JFTA 4JRXE 2VM3A 5I71B 4I5BB 3WDJA 4DP0X 2UZYB 2A83A 1UM5H 2NCMA 5FA4B 2HRHA 2K9FB 3CVHB 3QZWG 2E7BA 2WC7A 4F8QA 4JE4B 2O1AA 4FN0A 2LR4A 4FCAA 4XMZA 3FUJA 5E95B 3SDXB 1JPTH 5C2UB 3N1GC 5DR5H 5JQIB 1RP8A 1NEPA 1H3VA 5IROC 1P7QA 4GO6B 5JPNB 3BZ4B 2ZWKA 2AXWA 3WELA 1XL4A 3CDCA 2XTSA 3ZMEA 2D2OA 3WIAA 1QVOB 5CN1A 4N90E 4TQ8A 3G6JF 4AE1A 2IWEA 1G6RL 5IWLA 1U92A 3GMMA 1Z9MA 3AZUA 4R83A 1Z9SA 3DUSB 1OM3H 1OAKH 3VD7A 3ARGA 4LCCB 3LPFA 5DDHA 2EDBA 4L3CA 1MHPL 2QHRL 4L5FH 5DFVD 1ACYH 5A2AA 3S34H 4NO2B 4AIEA 1A1NA 4MZIA 4GG8A 2DQHL 1XCTB 4H5SA 1OK0A 1AR2A 1LGVA 2N56A 2X9YA 5AW1B 1EFXA 1TVBA 4PB9L 5CR8A 5JW4Q 3WY4A 1ND0A 5L4FA 1NM9A 1NLDL 1LVEA 1FLTX 4Y2LA 1NCHA 4YHKL 2HT3D 2VDLH 1YEGL 3N5AA 5SX4H 1DHKA 3SQOL 1HOEA 2VW6A 4MD4B 3TWCH 1OF2A 3II1A 5F9JA 2EEFA 3PQYD 3ZYOA 1G7LA 1G9NH 4GY4A 3UXFA 4WTWA 1QR4A 4YHPA 4NQEE 1T7WA 3R8BB 3DX1A 3QXTA 5IQOA 1D3CA 1WITA 4LIQL 2FHBA 5C6TL 1AJ7H 4LSQH 5FFLA 5HDBE 3GRGA 3VX1A 1CBJA 3Q5OA 4DERA 1OO2A 4XOCA 5D7LE 3IXTB 5F0PB 2YOAA 2Q76B 3RJQB 1TJHL 2P49B 3AS2A 2L04A 1XFPA 3IKCB 1UHVA 2O5NA 2WLIB 2B1AH 5LCVH 4HCIA 3S48A 3PDOB 4ABUA 1B4RA 4MZ2A 2FNWA 1J7VR 4FG4A 4MKTA 4RIRA 4UT7H 3DMMC 5IR1A 3BUYA 1LE5B 1AS7A 1NUNB 3NFSL 1AQMA 4NZUL 2Z0BA 2JK5B 4Y4HD 1YEWA 4LQ1A 3TV3L 3WIHL 8CGTA 3GT6A 3HG1E 3ASNB 4NBYB 5DQJB 5JHAA 1KTRL 4AEHH 3WJLC 2ZCLH 3GC3A 4Q2ZA 2HJFA 1UADC 4KRMB 1ZLUK 1AG6A 4N26A 5KSBE 4R5VA 4XCCH 1G7IB 3KBEA 3ZGIA 1JHTB 3ZT6A 5DHVH 4GSQA 1FN4B 2WMPA 3L4VA 1N2RA 2V5TA 3J7HA 5FC9A 3H2WA 5CWSB 3QA3A 4PLKD 3FDWA 3FO9A 2CDFA 5T1KB 3IFNL 4G6FD 1J5HA 1CQKA 1JOIA 1X5YA 4ZS7L 2LE9A 4PUBH 2QDVA 4UQAA 2G5BA 4MJIE 4O00A 3WFEL 4LMQI 1TLKA 1BMZA 1CTNA 2WJ5A 1YNTF 1M7DB 3BSZL 3QUGA 3T2NH 1F4YL 4KKPA 3G08A 2DD8H 5ESQB 2NLJA 1J12A 1FWXA 1HL4A 1EV2E 2BC4A 1SVCP 1UEMA 1NMAH 1U8CA 4NQDB 2Z1KA 1NC4B 1SOXA 4XWGL 1M9SA 3I6LE 4GO8A 1FE8H 2XWJB 4QXGL 3V8CA 1WFUA 1HVXA 3BN3B 1S2EA 4RWHA 3OZKA 4Z3IA 3FL7A 3W38A 1PKQA 4OT1H 4RNRB 1AS8A 1GMEA 3O8XD 2VL5B 4HCGA 5D7EA 1Q72H 4WVRA 1AMYA 2XKNA 3MNWA 1HWWA 3PP4H 4KKLC 4M48L 4NO5A 5CS7A 3K5SA 3RUGE 3UPCA 4ELME 5JA9A 4OIFA 1CFQB 1D5BB 5HDRA 5GZOC 4WZ9A 4ABVA 4WFFE 1FFPA 1R1CA 4M7JL 5MEOB 2BP8A 2DWSA 4NM8L 5EWIH 1NFDA 4NQUA 5DJYB 3VQMA 3P3RA 5FCUH 4LSDA 3U9UB 4UNVA 1W0YT 4QY8B 5F89B 2TSAA 2F53A 3O41A 3OMIB 4RGNB 4OZFA 5DD5L 1Q9WB 4WGVB 5F7DA 4ZJ9A 4IBWA 1H15A 4WKZB 4UIKH 4IOSA 2AP2A 5HYSB 5KSVB 4XBPB 2WP3T 5GZNC 4LGSB 1JNLL 1U8MA 4E9QA 1IFHH 5JR1H 1R17A 1KENL 5FYJH 2FGWH 1FL5A 3CN2A 3FTUA 3H0TB 4QRRE 2ARWA 2IJ0C 5DFTA 3N85H 3NIFF 5E9DD 3UYOD 3K72B 4L37B 4Y9EA 2HFTA 1GS6X 3Q5YA 4Y1AD 1K8DB 4YUEL 3OGCA 3QZLA 2QKSA 5DMKB 1KXTB 1CR9L 1KLFB 4NT6B 1J9RA 1FFNA 1B0RB 4E9TA 3F5WB 4X8JB 3VXSD 3WS3A 1TOXA 3JTSA 3ZDXB 4CMHC 2C3HA 4KVPA 4L1SA 4MDJA 3AS3A 3BYYA 5IVNA 3KLAB 1YJDC 3MLUL 1ORSB 1RH8A 4P2RD 4F93B 3D69A 1DE4A 2R1YB 4JL1A 1HHIA 2A1WL 2JKWA 4RGMB 1G1KA 2OSYA 4PRIB 1ZT4A 3B3BA 1PS3A 3UTOA 3PWUB 1ZA6B 5A6IA 1I85C 1U8LA 3X3GL 1NIEA 1X5ZA 4L4VA 2QLYA 4WLCA 2H2PD 3MLWL 1A6TA 2ZUYA 3ISWA 4JN2A 4ETYA 2CO6A 5BVPL 2B8OT 4XB8A 4I85A 2ROXA 4K3JH 5FDWA 4FOMA 4NFBA 3RWFB 3BYTA 1BEXA 4GIOA 4H88L 4LVNB 4O2CA 1IAKB 1SYSB 3BMVA 5E2VL 3PHQB 4HPOH 4Z7IA 5IB2A 3TEXA 1AXSA 2AJZA 2FH8A 1KDIA 5DA4A 3L4TA 1FZKB 1FNSL 4UT9H 3QGVA 1MRFL 1HSBB 3RGVB 4G8EB 3RL2B 4EN3D 4NNYA 3UDWA 1T80A 4HWEH 1MRDH 5HHQB 1J88A 5TQ0L 1LWJA 2DY2A 4R7DB 1FSKC 1WC7A 5IESL 1JUFA 2WTRA 3CFKA 2A4EA 4W6WB 2KPNA 1EWHA 1U33A 3IJ8A 1D2OA 1OSZB 5K1VA 1WPCA 3TOPA 1RIHL 3WU1A 1XV8A 4WUKL 7PCYA 1MCEA 3DO3A 1GL4B 5D1ZA 5E24E 5G4OA 1YAIA 2J88L 2FO4A 2X3BA 3QNFA 2QSTA 5KS9F