4WENB

Co-complex structure of the f4 fimbrial adhesin faeg variant ac with llama single domain antibody v2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCTASGSISSINAMGWYRQAPGSKREFVAHITNTGVTEFADSVKGRFTISRDNAKTTVDLQMNSLKPEDTAVYYCAATDWGTLLIKGIDHWGKGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords K88 fimbrial protein AC
publication title Structural insight in the inhibition of adherence of F4 fimbriae producing enterotoxigenic Escherichia coli by llama single domain antibodies.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Structural protein
total genus 29
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wenB00
3QDJD 4NQCE 5JR1L 2APTA 1DLHB 3ILQC 4KVCL 5EO1A 5FHAH 4MD4A 5IG7B 4I2XA 3W39B 4POZD 2BRQA 4PJHA 4OGYH 2GT9A 3RWIB 4IIQC 3GBNL 5FFLA 2H32A 2X7LA 5HHOB 3ARGB 1V05A 3HZVB 3PGFH 3VXPA 4U2YA 4D9RE 1QSEB 2CKBL 1TQCB 4XP1H 5CJXC 4NGHH 4ERSL 1OCWH 3MLRH 3O6FB 1S7TB 1CI5A 2VLRE 1UG9A 4LRIC 4XAKE 5CJ8A 3QEUA 4Z78A 1Y6NR 3B9KC 3L5IA 4LRNL 3L3JA 1EXUB 2GJ6E 4JFHD 4Y2DC 1LO2L 2WZPD 1U8LB 3LKOB 2OMBA 3ARDA 5HI5D 3JV6B 1K8IB 2FZ3B 3QWRA 2DAVA 4P5KA 3B6SA 1YPZF 5DQJA 4KJWC 4C58B 1R5IB 3ARBB 3CFKA 2ADJB 4NO2A 4LGSB 5IHZA 1R0AH 4RWHA 3NTCH 1MJJA 3WJJC 4S1SL 4CKVX 4CVZB 4PGDA 3CX5J 3L5JA 3TWCL 2YK1H 1L6ZA 3QISA 1E4XH 5ADOL 1ZHLA 1BEYL 4PTTB 3MRDB 4P59H 5IJVA 2NZ9D 3QO0B 3VXME 4PRDB 1JV5A 4Y4FC 2OR7A 1U8OB 5JDSB 3D39A 4OCRL 5I71B 4ZS7H 5C3TA 1I8MB 1J0IA 4BFIB 3MV8A 4GW1A 4NCDA 2X4OB 1ZK9A 5IMKA 3W0WA 2Z4QB 4J3TA 5D2NB 2EDKA 5IVNA 2CR3A 1Z5LA 3SE9L 2JCCB 1FNLA 2FYYB 4RDQG 1OW0C 1PZ5A 4PB0H 4PR5B 4RA0C 4GAJL 2J3SA 4Z6AT 5BV7C 4LMQE 3MRCB 2QQKH 1KV3A 3HN3A 3PXJA 1SHMA 3OPZL 4HWEL 3EUUA 1HOCB 1S7XB 1PDKA 1IE5A 4HUNB 3KPQB 2ZCKL 1J0YA 4R4ND 1ULVA 5CZXC 5IM7B 1OSPH 1QOKA 1NDMA 5ID1B 5FYLH 4XVJL 5TH2B 1X6NA 3AREC 1S3KH 3WIIL 3BMVA 1AKJB 1FYHB 4XB8A 4NWTH 1OL0A 1RUMH 2FX8H 4KUCF 1DQTA 1ZMYA 3P9MA 2NY5H 1I85A 1UM6L 3LKNA 2ZOKB 4L4VA 5DVLA 1E6OL 1DDHB 1DEEA 4PJDF 3NCFB 5T3XE 2ED9A 1YYMH 2Y25A 4YHNA 3BKCL 5A1AA 3GIVB 3MJ9H 5FYKE 3JVGC 5HHPB 1KC5L 3ARZA 5EU6B 1IKFH 5EO9A 5JLZA 1Y6MR 5DMGC 1CFNA 4O9HH 1FLTX 4Z8FL 4G7VL 1JPSL 1I75A 5T1DL 4OB5L 4DGVH 1N0XL 3MRJB 4LKCB 4QHUB 2ADFH 1LEIB 3PWPD 1KACB 4KZDL 2A38A 1JNLH 4YDLB 3MTRA 3SGEI 3MRLA 3FRUA 4F7TB 3R8QA 4JE4B 4QXTA 1SVZA 2DKMA 5BS0A 3FB5B 2ED7A 3NCMA 4LFHG 5H37H 1WZKA 4MNQD 1BREA 1ZEAH 4K9EL 4APQC 3LB6C 2Q6WB 4YHOH 2P4AB 1O7SA 1DLFH 1XF1A 4P2OD 3H6JA 5FYKH 4AMKH 1FC2D 3BIAX 4ELMA 1UA6L 2HLAA 2AJ3B 1ROWA 4Z7UA 4NRZA 3NN8B 1P53A 5JIHA 1FLRH 1B9ZA 2J8HA 5CLTA 1D6VH 3IDMB 3P30L 4E5XB 5TF1L 4XNZB 3GMLB 1NUDA 2BC4B 5I73B 4HLZH 3PWPB 3MLPA 2J5LB 1FO0L 3VWJD 3GSVB 3QUXC 4MD5B 4FXKB 1G7LB 3LDBB 1C16A 3WXVL 4CVXB 5I76A 5HGAA 2VLKE 4N5UA 4AENB 3K7UA 2LFGA 4WI9A 4M7LT 1U2HA 4FQHB 1LO4L 3UTPE 4UTAH 3DV4B 1Q38A 4PJEB 3JTTA 5D7LD 4ETQB 4LF3B 1HEZA 1A5FH 32C2A 3CFCL 4XCFH 2A6KA 1BAFH 1CXKA 1T89C 1WT5C 3O3BA 4P2OB 1NBVL 1BZ7B 4U1IB 3LKRB 4GAYA 3DPBA 1K8DA 4J2XA 1R24A 5GS1A 2IEPA 1KLUB 4F9PA 5J6GB 4PJ7F 5DJDB 5E8NA 1JWUB 4LPYA 3SDAD 4F80A 3F7PC 2AEPL 1GZQB 2X5PA 3GM8A 3MRKA 3FQXB 5CIPA 35C8L 4K94H 2CRYA 2YN3A 1F02I 1PY4A 4HH9A 5H2BB 3VXTA 1KB9K 4OI8A 5DJCB 2YPVL 1L7IL 1J0JA 1AGFA 3UJJH 2KDGA 3WBDA 3VA6A 4CNIA 4WTZA 1PX3A 3HMXL 3CSYB 4HWBH 4UQ3A 4ZUWA 5E08H 2LVEA 5D7LB 4O58L 5I1JH 6FABH 3MQIA 3H9SD 3PDOA 4GQ9L 1EJ6A 3UX9B 4U31A 1MI5D 4X5WA 1I7TB 2DIAA 4PP2B 3VFGL 3RDTB 4POYA 4IDLA 5D8JL 5BOZG 3ULUD 1Q9LB 1BJ1H 1HIML 3RU8H 5ADPL 3SDAB 1R5WB 1XMWA 3LHPH 3GBMH 1S5HB 1HDMA 4K3JL 3MROA 4HV8A 1YEHL 4OZGA 3HHRB 3W11C 5JZ7D 3UBXB 1QUNA 2ADIA 1MCRA 3FOLA 4GSDL 4Q0XL 2XWTA 4J3WA 2C4FT 2HTKC 1T83C 4PJCA 2R1YB 4XP9L 1LVEA 1FG2A 1GPOH 3SOBL 1OM3H 5KG9A 4QHNA 4V1DE 4DK6A 4JY5L 1SBBA 1CK0L 4NJ9L 3PQYE 3ROLB 3HE7D 3HI5L 3ROOA 1MCIA 5T1LD 4HJ0D 2VXSH 1FNHA 4JHZA 4PJ9A 2DWDB 2XFXA 4O51A 4P3WA 2WW8A 1Q9OA 2IGFL 1F4YH 5HDQH 3GJFH 3OL2A 3TJHC 1T7XA 5CEYA 3T0EA 1WC7A 1H8OA 4E0RB 3BKYH 4NKIL 3ZE1E 3D2UB 1XH3A 4O2EA 5DHVA 2H6PB 4Z9KB 3VXUD 3JUZA 2D0GA 1YJDH 1PYWB 3SKNB 3O3AB 1SBSH 4DKFL 1HH6A 3QI9D 4EZMA 2HLFC 1A7BA 2VSCA 1NC2D 5IKCA 2ICEB 4AM0A 5HHOE 1PVHA 4U6VL 3QPXH 1BFSA 1S9XA 1I9RH 2NY4C 2V2XB 5T1LB 4CRPA 3CDFA 3FO1A 1Q0XL 4M8VA 1QSEE 2GKIA 4KRNA 1BFVL 3QNXA 3WIHH 4GKZA 3G6JB 2PF6A 4ETYA 1HNGA 5D70H 4KJQD 1RUAH 1RZ8A 3O6KL 1JGVH 3T1FA 3OKKB 4PRHA 1MCWW 5F7HA 3QG7H 5IEHA 3QHTC 1ZOXA 4JFEB 4I3SH 5IFHH 3VXUB 3FB8B 4JGJA 2D0FA 2OP4H 1M7IB 1RJLB 2CLVA 3MRQA 1J0ZA 3QI9B 2E9IA 3SE8L 3LEXB 5FB8A 2R1XB 4HJJH 2Y36L 1EPFA 4NN6C 4LCCC 2E7HA 4HX1B 4Y4HA 4L8DB 1RURL 2FJFB 3CH1A 5EBGA 3VDBA 4Z7VF 2P5EA 3KPOA 4ZFGL 3ARPA 4KK9D 4PV8B 1BJ8A 2AKRB 4YHKL 4JHAL 3MZGB 4N0RA 2R1WA 1F4XH 3PL6D 5E1HB 1UZ6F 4XGZA 3T2QA 3T4AB 4XAWH 4GUPA 4PG9A 3VXSA 3MRHA 1G6RL 1KTRL 1HHGA 4HXBL 2YEZB 3L7EA 4F58H 3UC0L 3EJJX 2IQAA 3VFSB 3V4PH 4JFHE 1B2WL 2EYSA 4EEEA 5CJQH 2CPCA 3ELAT 4JG0H 2JCCE 4MNHB 4NDMA 5I15H 4P5MA 1T2XA 4UT6L 3C87A 4YWGH 1MNUH 4IMKC 2VXUH 4F3FA 2UUDK 1TZHB 1M05B 4UQ2B 1WK0A 4Z7UF 3DHJA 2X4TB 4WY7L 4XHJD 4UDUA 2YMXH 4GBXC 3GHBL 1KTLA 4ZQKB 4R0LB 3MV7A 3TBYB 1T20B 3KYAA 3GSOB 3GI8L 3WSQH 4XP6L 1MJUH 1RK1B 4DN3L 3RTQD 2BVOA 3U0TB 3O2WH 1NLDH 1HXMB 3TYFB 4UU9B 1AHWA 1FL6A 4LKXB 5IK3A 4D0CB 1M4KA 1N3NA 4HKXB 1CDUA 2VLME 2WINB 4XBEL 3B9EA 3JV4A 1OP5K 1N7ML 4OUUA 3VG9B 3ILQD 2XG4A 1OAQH 3ZT6A 4U1KB 2BSED 3DGCR 1T1XA 4CBPA 3LN9A 4P9HH 4XVSL 3EYOB 3VWKA 4NP4H 4TNVK 2J88L 3CX2A 3EJYC 4KC3B 2VZUA 2GW5A 4P2CG 4QRQB 3OKOA 4HIJB 5IHBA 4NKMB 2X89D 4UDTB 5EU6E 4MLIA 4XNQB 3TC9A 3RTQB 5B4MC 2H8PA 1RI8A 4G42B 3NOIA 1LK3H 3B9KD 3BSZL 5KSBB 4Y2DD 3S34H 2K7QA 4LSUL 3QXUA 3HA0A 1ZLVK 3IXAB 3EOAA 1UACH 3HE6A 4WW2F 5HDBF 2X6MA 2DTML 4KJWD 2KL6A 2VAJA 3QDGA 3B9DA 1FBIL 3AXLA 4ZPVA 4WGVB 1NCCL 3BVNB 4JFDA 3U36A 1HE7A 3BE1L 4MA8H 1A7OL 4PJ8B 3PDGA 4I18C 3RAJL 5CMAA 3PP4H 1FDLH 4JG1L 2KQNA 3U4EB 5HPMA 3E2HB 3H3KA 5CP7B 1IQWH 1AGEB 1HYSC 1U3HA 3BWAB 1QVOA 5KVEL 3DV6B 3HR6A 5LVEA 5J3HC 2DDQH 1D6EA 3D69B 3ARQA 2V7NB 1KIUA 1QLRB 4KJPC 3IAQA 3P40A 5SX4I 2R0ZL 1EO5A 1KJMB 3VCLA 3EDKA 1KLGB 4EUPB 3BYTA 2FRGP 3CMGA 3FB7A 2QLVB 3KHOA 5IFAL 1IL1A 5IFJA 2CK0H 3S37L 4KI5E 4XPFL 3K4AA 3HR5B 1IAIM 2JF1A 1V3KA 5KVDL 1HKLL 1WTGT 3HNTL 3UBXI 1OY3B 4WHYH 4OIIL 4LFHD 2Y07H 4NQVA 4I48A 1MAML 5CZXD 5FYKU 1KIRB 3FOMA 5FUZL 4I0PC 5DC4B 2ZP0T 4LHUG 5DR5L 2F8XC 1MOEA 1GIGH 1R6VA 3BISA 3SGKC 5ESQB 1JIBA 5DC9B 3W9DA 2WMPA 5FF6A 3GZKA 5AYUH 3BXNA 2ESVD 3BPLC 4XVTL 2DICA 1C8PA 1PBYA 4OZFA 3VRIB 12E8L 2QR0B 4EBQL 3NFPB 1ZANH 1AP2A 1OAUL 4X9HA 1HK6A 3VH8B 2K7PA 5C0JA 4LSRL 3OZ9L 3TA3A 4OLUL 4RNRB 2AJZB 5DMGD 4I5BA 3TBSB 2P1YA 4LLDB 4TUOA 1RFDL 2WAHA 3BIKB 4BH7B 4XPAH 5CFHA 2B1HL 2CLZA 1WEJH 5KOMC 1W0VB 1J05B 4XNYL 3T2PA 1NJ9A 5DK2B 1WLHA 3K1DA 1BQHG 1WITA 3SQOL 1DQJB 4PJAB 4PBVC 2OXHA 1FCCA 4PFEA 3HPJB 3U2SB 3VFVA 5FV1L 1MCNA 4APQD 4ZUTA 1NBYA 3STLB 1F6FB 4G8IB 5TFSH 4LARH 5BVJA 2ICES 5GS0L 1EV2E 1MJ7L 3JUYA 3JTSA 3BIBX 3X14B 4CU7A 2VC2H 1DJSA 1UZ8B 4OFYD 2FDBP 5CJBA 1RU9L 5IB4A 3L1OL 3TPKA 2VZ1A 4RMRA 1JGUL 3KPSA 1UC6A 4Y8DC 3QUXD 5E9DB 2DD8L 1X5FA 5E6IC 4GMTH 4BQCA 5HY9B 1U8PA 4OLWL 1G7MB 2D31A 3OXSB 1U0QA 5J89A 4X6CE 5E2TL 4APQB 2B7DT 2P8MA 4KK8C 5FYJL 5L8LB 1VFAA 2MPAL 4JFQA 5I19L 5D2LB 3BZ4A 4NRXA 5IW1A 4FQQB 2PTTB 3OSKA 4FZEL 5E5MB 4GG6A 2W0PA 5GSVA 4TRPH 4M1GH 2F53E 2W65B 1JN6B 4JFFB 5KS9F 2VITA 3G6JE 3QUXB 4RGNC 4K71C 1MHCA 3VFTA 2WWMC 3ZO0A 5ESVB 3P4MB 3MRMA 4X6EB 4QRTA 5AWNH 5E00A 1R3KA 4XXCC 3SPVA 4DJMA 1ZA3A 4JFEE 4YDIL 3C6LA 5I1DA 1KULA 3MFFA 1KPVB 3S5LB 2NX5B 2GFBA 1K4CB 1QQDB 1FV1A 1YNLL 1FZJB 1FZKA 1X4ZA 2VR4A 4CDGC 4KVNL 4H5SB 2BERA 1L0QA 5L9DL 3ZDZF 4CADB 1HSBB 1MFNA 3DIFB 5JUEH 4YXKH 5IEKA 2OM5A 2NLJA 3W11D 3KYOB 2XZQL 3WN5C 1IEHA 5T3ZE 1I7UB 2B20A 4GLRH 1B0WA 1WZ1L 2HTKD 4ZYKB 3EYVB 4I3RH 4BFGA 3DSFL 4JGUA 1AC0A 1DSFL 3STZB 3WMSA 4N0UA 1A6ZA 2A9NH 2VXVH 5JXEC 3DROB 4NHUA 3QFJB 1MRFH 3CXHJ 2Z92B 2H2SC 2DQFA 4U1NB 3B5TA 4KGLA 5GHWL 3WLBB 5TPWH 5JNYB 4DGIH 5C0EB 4TSBH 3TJHD 3KLAA 3MGAA 3BPCA 5JPMA 1I8LA 3RUGA 4S2SB 3S35X 1SEBB 4DKDC 2PCPA 5E5UB 3ZE2F 5DRNB 8FABA 3ARDC 1X4YA 3KAAA 4O02H 2HVJA 3UYOD 4P46A 2QJDA 3CMOL 4OCXH 2YS4A 3RY6C 1IJ9A 1Q0YH 2HLFD 3MV01 1A7RH 4NIKB 3FFCA 3N1GC 4CDHA 3NCJL 4KHTH 1RJCA 3VFNB 3MRIA 2GIYA 2OTWB 5ERWB 2NY4D 5GRJH 4NYLA 3TT3L 2NY1D 1M71B 4NQDA 2GK0A 1FFRA 4YDVB 1SYSA 1NEZA 3ALPA 1BVLB 4D0DB 4ONHB 5DYOA 5DT1L 2AAVA 2OJEB 3C6SA 5F7KC 5D7SH 3UPAA 2BRRH 4FXGB 1NAKH 4XVUC 4JM2A 4JO3L 5I30L 5EZJB 4HC1H 5CBEB 2IMMA 4E41A 2CKBB 3EAKA 4NNYA 3MLZH 1VEMA 3BEVA 4NZUL 2IAMB 1KJVB 1TETL 3LOWA 1N8ZA 1DQDL 2ITDB 5C07D 1FL3B 4HK3N 3OKEA 2AJVL 3OJDB 1AO7A 2NW2A 3UCRA 1JYNA 3D3VD 3V6FB 4IJ3B 1EK3A 3VRLF 2HFEA 1EGJH 1IAIL 1U8QB 2QSVA 3BD3A 3BUYB 5TE6L 4H1LG 5CKGA 2NY1B 3MXVH 3NIDF 1FVDB 2VXTH 2Y06L 2B8OT 5DMKB 3HC0A 2E7LC 5EIIB 4FRWA 3VA2C 1IGCH 2JJVA 3MUY1 3SEPA 5BCAA 2AJXH 4H26B 5CBAB 5E2UL 2J8UF 1RD6A 4UT7L 2VQTA 5DFVC 2WWKO 4HQQH 1N2RB 5KTEL 2DWEB 2IALA 3O11B 1MFCL 5C07B 2H26A 3N1MC 2R8SL 1DN0B 4NN6B 4GBXD 5DJZA 2HJFB 4NZRH 2CRZA 5DJ6B 5E8DL 3CDCA 5HHVH 5I9QB 2KPNA 2W9EH 1K2DA 5IVXB 3KPLA 4OM0L 3EO9H 1FH5H 5JW4M 2FR4A 3UPRA 2V5YA 3FB6A 1NSNH 1NFDB 3V5DB 4FQXB 2HRLA 3EYFA 1T80A 2QQNL 2FO4B 2X09A 5ITBL 5F89B 4JREC 3BZEB 5ICXA 4KHXH 1JFQL 2PYEA 2A83A 5IF0B 2UZIH 1LO3L 3EFDL 5D71L 2X9WA 2X40A 3S35H 3RRQA 2FBJH 4JR9H 4YQXL 4EUPH 4UT9H 2LU7A 3B2VL 1AD0B 5BZDB 4XCYA 5EUOF 3HI6H 5IBLC 3EJYD 2XT1B 1GRWA 3NH7H 3LMJH 3PWNA 3UTQB 4HK3J 2HT4C 3L3KA 4YHIA 3U0PA 4NWUL 25C8L 2MQCA 4MJIA 2OI9C 3QJHB 3UPCA 4YDJA 3BQUA 3O3DB 3QFDA 4GXVL 2FHFA 4KWUA 4I1NB 2NNAB 1HYRC 4NPYB 1CD9B 2PO6C 5E2VH 4JEGB 3D18B 1JZ6A 2PETA 3O41A 3T08A 1XGPB 4LHUD 5C7XL 1GGIH 5EORH 4PJAE 3VXRD 4LEOA 1X5GA 1B3JA 5EU5B 1N59B 5J06A 4S1QH 3SDCC 15C8H 4N0YH 3PDDA 4QXUL 3RPIB 3G5VA 2BCKA 1HCVA 5LKNA 5CZVL 3LAFA 4OLYL 1HYSD 2C1OA 1EEYB 5JMRA 3HZMA 2E9WA 3C8DA 1QRNA 5IHUL 5DJ8A 2FD6L 3L7FA 2CUHA 2NXZC 3MJ7B 3QJFA 3KPTA 1MH5A 5E9DE 1QFUH 1MCFA 2PTUA 4PGEB 2X1QA 3SO5A 1YECH 1YEIH 1JYVA 3MYZA 1MIMH 2NMSA 1S9YA 3VI3E 1PLGL 4XX1E 4PD4K 4NQEA 5ID0B 4KDVA 1CL7L 2Q3ZA 2VDLL 4WW2C 3BHBA 5DD1H 1ED3A 1C08B 5FCSH 1YN6A 1FO0B 5D2LE 2Y7QA 4GS7B 4DKAA 2IPTL 3RGVB 3LPWA 2BNQB 3DI3B 1I3RB 3F6LA 4JO1H 2AK4A 1HI6A 1WWBX 5DVMA 1R3JA 3ZKSD 5DUPH 5E8OB 4M61B 2J12B 4HXAH 1RVFH 1G9ML 1KCUL 4JFFE 5E4EC 4HGKC 3KYKH 4LVEA 3WFHB 4AG4L 4QTHA 5HGHA 1IGMH 5TDNA 4JRYD 3CLFL 1X5ZA 1A3LH 4WVRA 1OAKH 4M4PA 3GSNA 3NFNA 3S4SB 1UB5B 1CE1H 4Y5YC 5JOFB 1E4KC 1EHNA 2NX5E 3QG6B 5ICYB 3J8F7 5EBWA 2EDYA 1CFVL 1AQDB 1IAKA 5DJ2A 5SX5H 4S1RH 1TIUA 1DBMH 4GKSA 4KUZH 4PJ9C 4GW4B 1IC5H 3THMH 1KIPA 2AJUH 5CEZL 3QZWA 3ILPB 4OCWL 2IG2H 3EOTH 5HVHC 4JHWL 4B7LA 1DL7H 3BPLB 4NHCL 2VZ3A 5EFIB 2XPGB 5CAYB 3TN0B 2G9HA 3P0YL 5K9OA 1V7NL 4OD1H 4U05A 5DO2D 4JRYB 4ISVA 4K7FA 4TULL 2A73A 2RCSH 1QO3B 4LU5L 4M4RA 2ZKHH 2CXGA 3E0GA 5HGBB 4XBPB 4RFOH 1F6AA 4N8VB 4MS8C 2EECA 1YNTB 4OSUH 3EOBA 4P3DB 3QFJE 1MCQA 2MOVA 1VGKA 5HGGS 5IJKA 3CH8A 5I1CH 4IMLA 1RZJH 3A67H 3LD8C 3BT2H 1FORL 4HKBB 1FFQA 3VJ6B 3V8CA 3TFKD 3IF1A 3ZE0E 3FRPG 4K7PX 1HXYA 4ZDHB 4CU6A 4MXWH 4OZIB 2E9BA 4Y2OA 4KY1L 4U1SB 5EZLA 2Y9RT 4KK8D 2DQDL 5F7YC 5C0BA 1MCOH 4M1DL 1HQRA 4F7PB 1KB9J 1IEAB 2YPLD 2R2HB 1A6PA 3L3IA 1S7WB 3DVGA 4JZNB 3V52L 5F88B 1W0WB 5HGDB 2DKUA 4R6UA 2BZDA 3UDWC 1IT9L 1QBLH 2X42A 5DJYA 3LKSA 3CXDL 4MVBC 5LXGH 5L2JA 2V9RA 4RGND 4AL8H 3DUSA 1ZT4B 3AS1A 3X12B 5D1QA 4G8GB 4KMTL 3TVMB 4FNLH 1J5OH 1OGAA 2IANB 3RWGA 3IFOB 4MMZC 2H9GB 1LEGA 1P4IL 2FH6A 4ONFL 3DXAA 4L3EA 4GRLC 1D5BA 3TO4B 1BVKA 4P4KA 4NO3B 4M6ML 5I74C 4DKEL 4GAGH 3IJSA 1CS6A 3BD5A 4DQOL 2YPLB 3V8OA 4Z7NF 5MI0B 4J23A 3H0TB 3T65B 5F1KC 3OKLB 4NT6A 1A7QH 1C7SA 3BGAA 1TZIB 2D4DA 4Y19E 2CDGB 5C0AB 2X4UB 3EGSA 4NUGL 4OD2B 1WFTA 4ZAKD 5K9JH 1RULL 5JR1H 3HLAB 1TMCB 4R8WL 4WNQB 5D5MF 4KVCH 1NDGA 3MLWL 4OAWA 4M7LL 2IQ9H 5HYSA 1KFAL 3KYMB 1J11A 1FFNA 1MFBH 1TVHA 5IWLC 2N4IA 4MXVE 5F21B 2ZUVA 3GBNH 2XWBA 3BP7B 4FS0A 4UI2A 5LGKA 4PJ5D 5MP6H 3LRSA 2GTZA 3QB7C 4KKAC 4R7DA 2HFFB 5C0FA 1U2CA 2Y6SC 2NW3A 5JXED 4ZNEE 4BSVB 3DGGB 2H2SD 1YEDB 4FQCL 2NY6C 4QNPE 3LKQA 1YY8A 3UJTL 3IFNL 4AQOA 4ZAKB 4ORGB 5IVXE 5A2KH 2DQTH 3P4NB 4ALAL 3ZHLA 3MJ9A 1FN4A 3PHOB 3WN5B 3SJVA 1NFDE 1T0MB 4FQJL 4EIZC 1HHKB 1I7RA 4MQXC 3ARDD 3HE6C 3C09C 1PKOA 5EO1B 2QBWA 4MD4B 4OF3A 4S1SH 4NJAL 4I2XB 1TJHH 5EWIL 4QTIH 2XXCB 4PJHB 3TWCH 4YHLL 5ADOH 2GT9B 1BEYH 4J3VA 1RZ7L 3AY4A 3TLRA 2H32B 2X7LB 4K7PH 1KCLA 1IC1A 3VXPB 2GITA 2WP3T 3ORJA 2Q87A 1TCMA 3PNWA 5LWYH 4J6RH 4QRUA 3CZFA 4PRAA 1C1EL 1A6AA 1OTSC 3QEUB 3H42H 3LQAL 3MV8D 1P7QA 3L3JB 2DIBA 4XVUD 5MEQA 1A6WH 4IBLT 4C4KT 3ARDB 2EE3A 3K8LA 3QH3A 4JDZA 1DVFC 4P5KB 4M7JH 3OPZH 5DQJB 1TVDA 3CFKB 4NO2B 1HZHL 4U1HA 1FGVL 2VL5A 5IHZB 2X4NB 3SKUD 1D5IL 2ZCKH 1CFSB 1NFKA 1IGTA 1U41A 1MJJB 1J0KA 3OAUH 4AZ8A 4PGDB 4MAYC 1OT2A 3MC0A 4XVJH 5IJVB 3AMKA 3B4NA 3FAWA 3WIIH 4FHBD 2W9DH 1JV5B 1FFPB 5F70A 5GZOC 1KJ2L 1WBYA 3QA3A 1KT2A 3D39B 2DLGA 2ILLA 5GGVH 1JRHH 2MMXA 4Q9RH 1RIVH 3MV8B 4GW1B 3W0WB 5IMKB 2FGZA 2A1WL 1XF5A 4HUUB 2DYPA 3CVIL 1Z5LB 5DFVD 2F74A 4L4VD 4R4BA 1JUFA 3BKCH 1PZ5B 2X05A 4RX4A 4TUKH 2AEQL 2GYSA 4YBLB 3O8XA 2EKSB 4LLUA 1KF9B 1NANI 4NUJA 4OM1L 4G7VH 2FIKA 3L95A 3BFOA 4OCLC 1JPSH 5T1DH 2VDNH 4OB5H 4K8RC 5FGCB 2ZOLA 5F9OL 1NDMB 1F97A 2BNQE 4QRSA 1RPQA 1QD0A 2BJMH 5CP3H 5J1SC 1WUNT 1YEEL 2GTWA 3P9MB 3BWUC 1RJZA 5SWZD 1GC1L 1I7ZA 3LKNB 4K9EH 5BS0D 4L4VB 2PXYA 4JDVA 1BQUA 1DEEB 1CGWA 2AXGA 2HKFL 3N85L 2C5DC 4LLQA 5DSCA 5DXWA 4MWFA 4YHNB 1UVQA 1UA6H 5IBLD 1TZGL 3I2CH 1VGEL 4N68A 3WLWC 3HRZA 5ETUA 5JLZB 2HT4D 1CFNB 3NAAL 4PRID 4KXZI 5GGQH 1AGBA 2W1NA 3O4LA 4ODUA 5IMOA 1UEMA 2X1WL 4J3OC 4PJGF 1FVCA 1UWXK 4IOFD 2E7MA 2VUYA 1S9WA 3WXVH 1G7QA 2PO6D 5DEZA 5IBUB 1LO4H 1GGBL 1H15A 2H3NA 1EFXA 3MRLB 3FRUB 4WO4A 4QXTB 4LCIL 5BS0B 4YHYC 5JQ6L 1FNFA 4U0RC 1RZFL 4M93B 4IRJA 3MLXL 5K9QI 3FO9A 2YD3A 3GJFA 1XZ0A 2VJXA 1X7QB 2VZOA 4OLXL 1UM4L 1T5XA 4KV5F 4K3HA 4ELMB 2HLAB 7FABL 4NRZB 35C8H 4M9OA 3WS6A 5KSAA 1L7IH 5EBMA 3FT2A 2NXZD 4F7MA 5FOJA 3MO1A 4NQSA 2PW1A 3AB0C 5D1XA 3T77A 4POUB 3HMXH 3DRTA 4M6NL 1JHTA 5F71A 3RZCB 1F4WL 5I76B 5HGAB 2HFTA 5CILH 1WIOA 3AMLA 4O58H 1AFVL 1TQBB 2OSLA 4DAGL 4GQ9H 1Y18A 3JTTB 4LQFL 1HEZB 5F9AC 1MHPH 1U42A 32C2B 2EC8A 2A6KB 5FDWA 2OK0H 3O3BB 2BXYA 2HT2D 1HIMH 4GAYB 4I0KA 1I9IL 2XRAL 1K85A 1K8DB 3QUZC 1R24B 5GS1B 3MRNA 3BZFA 3C5SA 4K3JH 5E8NB 4FG6C 1YEHH 4RWYL 3MRKB 2LTQB 5CIPB 1BWWA 2ZUQB 4Z7QF 3FJTA 4HH9B 5F7DA 1ZLWH 2B5IC 4WI7A 3VXTB 4GSDH 5C0GA 4Q0XH 5I75B 1AGFB 1YZZA 4PYHA 1G6VK 2DM4A 4U4BA 3SOBH 1PG7X 3ARGA 4G8GE 5EU4A 4CNIB 3JWDC 43C9B 3KR3H 4UQ3B 2IANE 4ZUWB 1QSEA 3OX8A 4X9BA 5I8CA 4HG4K 2R0KL 4G5ZL 3BYYA 3HI5H 3PDOB 2YZ1A 3T0WA 1QFWI 4ZO7A 3UO1L 2HH0L 1MRCL 4X5WB 2OX5A 3OB0K 2IGFH 3DURA 5KVGL 4PJ9D 5JW3L 4KRPB 4NKIH 5I6XB 3SO3C 3IYLW 4NN7B 3ZT7A 1T21A 1HDMB 5C0AE 3MROB 3SBWA 4ZUUA 3X11A 4OZGB 5E4EB 1R5IA 2ADIB 5F7MC 5FHAL 2JLLA 3FOLB 3KXFA 3R4DA 1QRKA 4PLKC 5EN2A 4PJXA 2XWTB 4NBXB 4OGYL 4PJCB 5C6TH 5E56A 2ZCHL 5F9DC 5ACLA 3MRDA 1FG2B 2HKHL 4U6VH 5KG9B 4MJ5A 3SDXF 3PGFL 4KQ4L 1A8JH 4AY0A 3C2AH 5FGBC 2WK2A 2ZJSH 5HPOA 1BFVH 2DQEL 4HZLA 4JQXA 4MS8D 2ID5A 4C83A 3ROOB 2O93L 1XR9A 1OCWL 3MLRL 4QRPA 3DWTA 2X4OA 1GHFL 3O6KH 1A14H 1D3CA 1NAMH 1S7SA 2GJJA 4PJ9B 2XFXB 4O51B 1Q9OB 4NOBA 1MF2H 1RUQH 3AS0A 3T0EB 5CEYB 2W91A 1WC7B 4TOYH 2PNDA 5HVHB 2Q7YA 3SE3A 4GKOA 1XH3B 1T7YA 4JCMA 5J6HA 3ZYZA 4O2EB 5DHVB 4S1DC 3SE8H 1WV7T 1S7XA 4MA7H 3T1WA 4X9GA 4CN1A 4M8QA 4Y5VA 1HWGB 3NTCL 1HH6B 4MD0A 5IM7A 2NYYC 4I2XE 2VWEC 4XPGH 4OCYH 1RURH 4PJHE 1OGTA 3RY5A 1E4XL 5IKCB 3S36L 4P59L 3EYQC 4ZFGH 1U8JA 1S9XB 4JHAH 3QNZB 4KPHH 3FO1B 5L8KB 3TF7C 3QNXB 2P5ED 3TBWA 4GKZB 1N6UA 1G6RH 4HXBH 1RZ8B 3HZYA 1B2WH 1CD0A 3VXSD 1ZGLM 2WLYA 1NPUA 1LE9A 3T3ME 4OGXL 3T1FB 1EFQA 4PRHB 4UT6H 4PB0L 3SDDC 5IEHB 3GIVA 1EVTC 3PHQA 1M7XA 4GRLD 4WY7H 2CLVB 3MRQB 1PG7H 4QRRA 5FB8B 3GI8H 5FUOH 3NCYP 4RMUA 5GJSH 3FN0L 4ZOBA 5L2KA 4IDJH 4Y4HB 1LNUA 2H32H 3HC3L 4J4PA 1J1OL 4PRBA 3SGJA 5EOQH 5FYLL 1UJ3A 2P5EB 3KDMA 3KPOB 1S3KL 4R7NA 3FB5A 4PY8I 1N7MH 2R1WB 1RUML 2FX8L 2QSTA 4Z7WF 4XGZB 3D39E 4GUPB 5DWUL 2JELL 4PG9B 3VGGA 3VXSB 1DANU 3MRHB 1ZAGA 2NY5L 1HHGB 2DJSA 3L7EB 1GAFL 4O4YH 3W0WE 2IQAB 3VDAA 4WI6A 1SJHA 2EYSB 3FO0H 1YYML 5CZKA 4NDMB 4P5MB 4EJ1C 2BHZA 4TUJA 5EG6C 4F3FB 1IGIH 4KKAD 5I74B 2Y6SD 2VQUA 1HHHA 5TF0A 1CIDA 1UCBH 3T4YA 3HG1A 4UDUB 1KTLB 4Q6IB 2BC4A 3MV7B 2Z31A 1YC7A 1WCQA 1AGCA 3Q6GL 2BVOB 1YN7A 2ADFL 2UWEA 1A47A 3BQUC 4AENA 2HP4A 5EOTA 4LSUH 1AHWB 1JNLL 1FL6B 5HHMD 5IK3B 4DFIA 1N3NB 5TJWK 3TV3L 1RUPL 1ZVSA 3JV4B 1YMMA 4WFGE 4MQXD 3TBTA 4OUUB 3HE6D 2DI7A 5I2IA 4MJ4A 2X4QA 4OCNC 4HAGA 4L4VE 1T1XB 4LVOC 3B5GA 1CXEA 3VWKB 3RAJH 1CTNA 4JKWA 3NCEB 1HWHB 4GO6B 4PJIF 3MJ8A 1ACYL 4HUVA 3P77A 3VMNA 2DN7A 3OKOB 4ZTOL 4BZ2L 5KVEH 4JKLA 5HYJD 1FLRL 3QUML 3VI4E 4N90D 1U3HD 2H8PB 2EDBA 1C12A 1OTSD 2R0ZH 3RVUC 4K2UH 5FEBA 1EA9C 1KYOJ 4YHZL 4KKNA 4R90H 1DQLH 1M1SA 4HHAB 5IFAH 3S37H 1WFOA 3F7VA 2MNUA 4WWKA 4XPFH 3EOAB 3HE6B 3C09B 3VGAC 5KVDH 1N4XL 3KWWA 1HKLH 5IB5A 4UILL 3IJHA 3NZHL 3QDGB 4UIKH 5HVWA 5IP4A 4KZEH 1BAFL 3AXLB 4ZPVB 1Q9LA 3U36B 3FT4B 4JFDB 3LCYA 1JGLL 3MGTA 4MAYD 3FHQA 1R5WA 4YC2C 2J2ZA 5CMAB 2QKIA 3ZDYE 5AAMA 5HPMB 4ELME 4YEFA 3QUKB 1U3HB 1QVOB 3S3SA 4YIQA 1D6EB 3SHSA 2BDNL 2B4CC 3PWLA 1S9VA 1U8HA 4EBQH 1KEGH 2DQIL 3FB7B 5E08L 4QHKI 3B3IA 1IL1B 5IFJB 1YEJL 6FABL 1P7KA 3ZSSA 2LU4A 1NEUA 1T5WA 1HILB 4TTGA 3MCKA 5J11C 3TA3D 1F2QA 2Y23A 4NQVB 4GRWB 2JCCF 4I48B 1UQSA 4XNYH 3FOMB 4WV1C 1CGUA 3UZEA 3W9EA 3N1PC 3LHPL 5FOBA 5KANI 3SY0A 3SQOH 3P0VH 2A74A 4X6CA 4KKCD 3W9DB 5FF6B 5KOVC 5ISZA 3VE0B 3DO3A 3BN9C 1V5JA 3BXNB 2MCPL 5FYJE 4JQVA 1RV6X 2C3GA 3E8UH 4OZFB 4EI5A 5IHLB 3BP4A 2YRLA 5EZIH 5GS0H 1AP2B 1FSKB 2Q3AA 2F53A 5DFTA 5C0JB 5IVZA 5CEXA 3TA3B 3WXWL 3MFGB 1QSFA 1RU9H 4I5BB 5IUSA 2VXSL 1JGUH 3F6IA 2J4WH 4TUOB 2CLZB 3U30C 1T7WA 3CFDA 5HDQL 4U2ZA 3LZFL 4EDXA 2P45B 3NZ8A 1NJ9B 5AYQA 5JTWA 3BJLA 4OLWH 3QAZC 4HCRA 3WFEL 1MFDL 3GMMA 5FA4A 1WWCA 5C0DA 5DK0A 4KROC 1YJDL 3VGEA 5FYJH 2GK2A 3VFVB 2MPAH 4RGMC 3G9AB 4ODVL 5I19H 1SBSL 4ZUTB 1NBYB 2IH1A 3OJ2C 4U0QB 2XZZA 4X7EC 3OGCA 5HDLA 4PJCE 1J1XL 5BVJB 3QPXL 3JTSB 2EDHA 1I9RL 3O4OB 1NC4A 2NY3B 1Y6KR 3QRFM 3JWOC 4GMSH 5IB4B 4OKVA 1YQ2A 4PD4J 1RUAL 2YEZA 3A0OA 4IRZL 1JPFA 3KPSB 2OL3H 4X0KA 1JGVL 5IB3A 5T1KA 1IMHC 3WO3B 4OF7A 3C5ZA 3T0EE 1DBJL 2FHCA 3QG7L 5DD0H 4JVPA 1PSKL 2NR6C 1U8PB 4I3SL 3H7LA 2X9XA 4XC3H 4WEBL 5K93A 1ITCA 3KJ4C 4U0RB 4BSWA 1G0YR 1XGTA 1QYGH 2P8MB 1VFAB 1YNLH 3BZ4B 3E3QE 4Q6YA 4NRXB 5F6IC 2BSSA 1HINH 3I3DA 4MYWB 1JK8A 2X70A 5IW1B 2EIZA 5L9DH 4HC1A 4KI5F 4GG6B 5GSVB 1IAMA 4PJEF 1TXKA 1T6VN 4XNXH 1F4XL 2XZQH 3MV11 4GW5A 2W9LA 4XAWL 1RQ5A 2VITB 3ZL4L 4RFEA 4F58L 1MHCB 1WZ1H 3QIUC 3NFSH 3J7HA 3VFTB 3D25A 3MRMB 3V4PL 1EGJA 4QRTB 5CJQL 3DSFH 4JG0L 1DSFH 1R3KB 3QEGL 4PRHE 3SPVB 1CLOH 2VDRH 3OWEA 4YWGL 1MNUL 1ZA3B 2VXUL 3IB4A 2I9TA 3C6LB 5I1DB 3MFFB 2J8OA 5DHVH 2GFBB 2XQBL 3SGDI 3U4BH 3PUCA 3BOVA 3QQ9C 5GHWH 1FV1B 1JTTA 4FA8A 1FZKB 1MJUL 5F9WC 4X4XA 3GEWB 3RVXC 1LP9A 4DK3A 1E28A 2G60H 1KTDA 5FCUH 2P5EE 3WUWG 3EDJA 3UYRH 1D9KA 5IEKB 2NLJB 5E5RB 1OAQL 5B38A 4PLKD 3VXSE 4YUEL 4F2MA 1WAAA 2OLDA 4P9HL 3GSXA 3U4EA 3FFCD 4JPKL 3AY4C 2D0HA 4N0UB 1A6ZB 3VFWB 3IRPX 4NHUB 3IKKA 4LGPB 3STBA 2I60H 2DQFB 3OGOE 5DT1H 3MV7E 1DE4A 1LK3L 4EUPA 4JO3H 3GUTA 4YDKL 3KLAB 1C5BL 3BPCB 5JPMB 3RUGB 3E1F1 2GSGA 2F19H 4Y1AE 4NZUH 3NMEA 2PCPB 4MDIA 1DQDH 5SV4A 1YY9C 8FABB 4MZ3A 4GQPH 3ULUF 4E41D 2AJVH 3OAYK 2HVJB 3EO1A 5C08A 3CC5A 4MQSB 1J7VR 5D7KE 1AD9A 4P46B 2MJWA 4I9WE 1JMZA 3Q48A 2NYYD 4HUMB 3FFCB 1BD2A 4WI3A 4P2QE 3P73A 1FDLL 1NCWL 3EYQD 3NVQA 2Y06H 3MRIB 8CGTA 1FYTA 5IQ7L 3PE9A 4LPXA 3HNVH 4NYLB 1T6WA 1ZKAA 4NQDB 2UUDH 3IKCA 2DTSA 2GK0B 1U58A 1SYSB 1NEZB 2A6IA 3BUTA 4KMQA 4PY7A 5DYOB 4UT7H 2DB8A 3C6SB 3K0WA 2FNBA 4GAFB 4U1MA 1GOFA 3IDNA 4JM2B 5KTEH 1MFCH 1EEUA 3SDDD 2HFGL 4NNYB 2J7LA 3BEVB 3GSWA 5I18H 3G6JF 1N8ZB 2R2BA 4LAQH 4MQTB 1PEWA 1I1RA 3OKEB 1CQYA 1WZLA 4LCUA 3QDGE 1AO7B 4EVNA 2NW2B 4K94C 4X6DA 1J05A 3MBXL 4RSVA 2HWZL 4JFDE 2CQVA 3HTLX 5IBTH 2HFEB 5CD3A 1MCEA 4PLJD 1AE6H 1DQJA 4HEME 4Z0BL 2QQNH 3HC0B 1FIGH 3DARA 4GG8A 1ZE3C 4N90E 5ITBH 1S7VB 4HIXH 2V9QA 4MCYA 4X6BA 4O2FA 1LO3H 1CGTA 2R23A 5D71H 3RX8A 1A7NL 2ZWLT 2PYED 3H9YA 1EAPA 3B2VH 2AQ2A 4ZOAA 1INQA 3VRJA 5FV2A 4KDTA 2IALB 3B5HA 5D7IE 2H26B 2XV6B 3CPLA 1J8HD 4NWUH 2YUXA 3QUYC 25C8H 4M7KL 1WZMA 5DJZB 4AEHH 5IW3A 1A21A 4GXVH 3QDMD 4CJ0A 4MJID 4KKBC 2FJHA 3O2VL 1OAZL 3BQUD 3D85A 3KPLB 3R0NA 5FHBH 2FR4B 4D9QD 3FB6B 4PRPA 4J8RA 3OXSA 2C9AA 5C7XH 2FATH 3SQBA 3EYFB 3U82B 3VGFA 2DM2A 1A6TA 4WO4C 5ICXB 2PYEB 5JOEA 1VFBB 4R96A 2A83B 4ZUSA 3M1BA 3U46A 4XC1L 4QXUH 4LARL 3EDDA 4MJ2A 4XCYB 4YO0A 1ORSA 2CO7B 5CZVH 3B8SA 2OJZL 3MJGX 1YNKH 3PWNB 2VC2L 3MLVH 1A3QA 2FGWH 1NBZA 2UY7A 3DUHA 3L3KB 5E95B 5CHNA 1MCSA 1T2QH 3U0PB 4FFZH 2BNRB 4MJIB 3OTTA 4YDJB 4XWOC 3BQUB 3QFDB 4XMPH 3RVUD 2BHUA 2E6PA 4XPTL 2QQLL 2EDXA 2P5WA 4EN3C 3IDJA 3F7RA 3GMRA 1M6OA 2CIIA 4RFNB 3O41B 1PLGH 4MB5A 5HTSA 4P57A 4RRPA 1CL7H 3P4OA 1EBAA 1IKNA 4LEOB 4CL7A 1GVIA 1IQDA 2R39A 4NQED 1MFAH 2NXYB 4XNUL 3TNNA 3O6ML 5J4MA 5KSBF 3MCLL 4EQ3A 5C3LD 4OTXL 3G5VB 3NA4A 5CEZE 2BCKB 3VDCA 4TRPL 5C70A 4M1GL 3R1GL 4TVPE 2QSCH 2C1OB 1VPOH 1KCUH 3HZMB 2AK4D 4GRMA 3X3FL 4AG4H 1QRNB 5DJ8B 3TJEH 3L7FB 3L6FA 3QJFB 3KPSE 2CLRA 1F42A 1MH5B 4QHKJ 4HJGA 2AS5M 4Y4KA 1RZKL 2EXWD 3ARGC 1LO5A 5MENA 4OGZA 1S9YB 1AQKH 3RX7A 1S5IL 4NQEB 4JRXD 3OAZH 1TQCC 1CFVH 3BHBB 4Z7OE 1ED3B 3B2UC 3QXDA 3O6FC 4YGAB 1YN6B 5I0DA 3K2UL 1FP5A 1V7ML 2Y7QB 3DYMA 3P0GB 2ENSA 1F45A 5DJAA 5FO7A 1CLYH 4CN4A 4HUXA 2DBLL 4OCWH 4TVPH 2RQ8A 2AK4B 4GG6E 1HI6B 5E6YA 4NHCH 1R3JB 4XH2A 4X7CC 3DLQR 3CVHA 3WJLC 4LCYB 3P0YH 3BN9D 4X5XA 3SBWC 5DFWH 2R0WH 4U49A 3WYRA 3ARBC 4POZC 4TULH 1PKQA 5BJTA 1IFHL 4QTHB 3ZDXE 5TDNB 1AJ7L 1WBXA 2RFXB 1L9MA 1VESA 1X5XA 2WUBH 4P2RA 3GSNB 3NFNB 3VXQA 4FQ2H 4HCRL 3A6BL 3FCTA 5J11B 1QPXA 3G6AA 4DFHA 1JHLL 3PP3K 5HYQA 1CFQA 1A7PH 1MRFL 1UWEH 4JQXC 3M8OH 4EI6A 5EBWB 4D0DA 1HHJA 4G3YL 1IAKB 5I71C 5E24E 3N0PB 5GRVL 5DJ2B 1MAKA 5C0CB 1CG9A 1FORH 4GKSB 1BIIA 3DETC 4WFED 1J88A 1GOGA 1C5CL 3QZWB 5HI5C 4Q9QH 4PJBA 3HKFA 2NQCA 4E42A 4WENB 4PREA 2WQRA 3KPRE 1RK0A 3SE3C 4KY1H 4KROD 3NA9L 4O02L 3FQNA 4U1LA 2G9HB 3ZKNC 5K9OB 4M1DH 4PJFA 4ISVB 4K7FB 4ZFOA 1EHXA 1Q0YL 5C0BD 1JP5A 2A73B 2CR6A 4OF5A 4BQBA 4Y19A 1A1MA 3V52H 5C09A 3MA7A 2IFFH 1BZQK 1INDL 4PTUA 4PJAF 5DUBA 1F6AB 2X2YA 4N0UE 1I8KA 3EOBB 4IRSA 4NQCD 1VGKB 4TYUA 4JCLA 4X8JA 2VIRA 5F9JA 4H88H 4IMLB 3QXWA 2BRRL 1NAKL 1NGQH 1B4RA 1FZOB 2W0FA 2NR6D 1P4IH 4ZNEA 4KMLB 4ONFH 2W0KA 3IF1B 4KROB 1MCWM 2H45A 1DN0A 3MLZL 1HXYB 4D9RD 1BM3L 5A2IH 5CS7A 4DQOH 2I25N 5EZLB 3CFBA 1J87A 5C0BB 4J1UA 5I1GL 4G43A 1HQRB 4X7TA 4XAKD 3WHXA 3PXHA 4ZFFA 3BEWA 1ZT1A 1EGJL 3L3IB 5J8OA 3RL1A 3FFCE 3DVGB 2GJ6D 3VI3F 4F8QA 3NIGF 1RULH 4YDLC 2FO4A 5DJYB 1IEBA 3LKSB 5JDJA 4NQDE 4HG4J 1JI1A 3UP1A 3V5KA 4M7LH 4N9OB 1KFAH 1MPAL 5L2JB 5D2LF 2AJXL 3DUSB 3MOQA 3QIUD 5I1HH 1T7ZA 2VDQH 1OTTD 5D1QB 4IOIA 2EDLA 4C56A 4HQQL 4Y5XB 1T0NA 1OGAB 1BZ9A 3GO1H 1NUFA 3RWGB 4NO0D 2CRIA 1LEGB 3UTQA 2FECL 3DXAB 1U3ZA 4L3EB 1D5BB 5FYLD 1BVKB 4P4KB 3VXMD 2DIJA 4GXUN 4CMHB 4NZRL 3IJSB 5F6IB 3KLDA 3I50L 3QQ9D 3F58H 1AO7E 4XNZC 2APVA 3RVXD 2W9EL 5I73C 4NT6B 5EBLA 2J5LC 3WNOA 3DX8A 3C60A 1FH5L 4ALAH 3LDBC 2DMKA 1E6JL 2ORBL 3I6GA 3EGSB 1TPXB 1G9NC 3L5XH 4FQJH 4KJYB 4KI5C 1D5ZB 5DZOA 1NDGB 2NY0D 2NY2B 4KHXL 1QPPA 5HYSB 1FFNB 5EWIH 1TVHB 1ZLUH 5JQHC 3S35L 2BVTA 2FBJL 4JR9L 2XWBB 3BI9X 1MHHA 4UT9L 3WDJA 1G7HA 3LRSB 1JGDA 2GTZB 5F8RC 4D3CL 3HI6L 3P9LA 3NH7L 1J12A 3LMJL 4R7DB 5C0FB 2NW3B 2M26A 1D5XA 4K23H 1UH3A 3V4VH 1A2YA 3MJ7A 1JNHA 3LKQB 3BDBA 5C2UB 2R29H 3LQAH 1YY8B 3DYPA 3MSPA 5DJ0A 2PN5A 3TBVA 4U3XA 1X44A 2R15A 1FN4B 3BAEL 2Z8WC 5C6WH 2NY0B 4X4ME 3SJVB 1NGZA 3EOYG 5EORL 5FYKD 2MQ3A 1I7RB 4WWKC 3GJFK 1DFBL 4WI5A 4OCMC 3K1KC 2OR8A 1F00I 15C8L 4UAOB 4WUUA 3RDTC 1LE5B 1WIPA 3P3YA 2GITB 4CAGA 5KSVA 3CCHA 1KJ2H 4X7SL 3PNWB 5J12B 2V5RA 1J86A 4G9FA 4LSSH 4QRUB 1XGQA 3CZFB 4PRAB 4X9IA 2BNRE 3WV0A 4DOHB 3RNQA 2Z8SA 5DJXA 1A6AB 3CVIH 4JQIL 1F13A 4X4ZA 1P7QB 5MEQB 2VDML 2DYPD 3QIWA 4G6MH 2AEQH 4KI1A 1YECL 1YEIL 3HUJA 2V2WA 4JDZB 3QH3B 1MIML 4AYFA 2Y4SA 4LSTH 3PG2A 4RX4D 4ZD3H 1RMFL 4OM1H 3ZLQC 4ZXBA 1VERA 1ES0A 4U1HB 2YXMA 2VL5B 1Z9SA 2DM3A 1XCQB 4W4NA 5DD1L 3U48A 4LLMA 3ULUC 3MBEA 4QLRA 5F9OH 5B3NA 1QR1A 4XPHH 5KSUA 5EPMB 2JE8A 2C7UA 4JO1L 2VLKD 3LH2L 1G7IA 2I9LA 3UTPD 1IGFH 1KPRA 1WBYB 3QA3B 5DUPL 5K59E 1KT2B 3TN0A 1YEEH 4HXAL 5L8JB 3QCTH 1GC1H 1UGNA 3KYKL 4P99A 1QRNE 3HMWH 2R4SH 4OFKA 1XF5B 1RHHA 2DYPB 2HKFH 3N85H 4N0CC 3ULVL 2F74B 4L8BA 1A3LL 4R4BB 1JUFB 5ALCL 5BW7A 4EI5C 2WNGA 3DRQA 5CINH 4LCWE 2YXFA 4KXZH 1JZ3A 3O8XB 4LLUB 3NAAH 4HJ0C 3D0LA 2CJUH 3GSRA 3QUYD 4NUJB 3CFEA 4NQEE 4R4FH 3UBXG 5A43C 2FIKB 3L95B 2E9JA 4MXVF 5FK9A 3L3GA 4YLQT 5LCVL 3GBLA 4JO4L 4KKBD 1DBML 2ZOLB 4FTVA 3QDJA 4GKNA 1ZSDA 3V6ZA 3BGMA 5C0IA 1N5YL 4QRSB 3L5HA 3EOTL 5IMLA 3CSPA 1E0OB 3RP1A 1DL7L 4OV5A 5F6HI 4WO4D 4QNPF 1P5VA 2GTWB 1RJZB 1RZFH 1I7ZB 1Z9OA 1OTUC 2PXYB 3QI9C 4JDVB 3MLXH 5KZCD 5IVXF 4YX2H 2AXGB 2RCSL 3SKMA 3FTGB 4LLQB 4IRJD 5DSCB 4N1HB 5T33L 4MWFB 4OLXH 1UVQB 1W0WA 1NFDF 2EDDA 7FABH 2BP3A 3C8HA 4YBQC 5ETUB 2VOTA 2A77L 4OSUL 3RWEB 4KJQC 5CGYC 4QKXB 1AGBB 1BFTA 2APFA 3O4LB 4ODUB 4XWOD 5IMOB 2YZ8A 1FVCB 1RZJL 1XEDA 5C0CE 1S9WB 4N8CL 1G7QB 4EN3D 2ZUXA 1PY9A 2H9GA 5DVOA 3LRGA 4I77L 1H15B 2H3NB 3TO4A 1EFXB 4Z5RA 4V1DD 4UMGA 4WO4B 4LQFH 4NO3A 4HH8A 1QP1A 4XZUA 4YR6A 1OSZA 1NAMA 2N56A 1MCOL 4R0LC 2IBZX 4IRJB 5EUKA 4ZO6A 2UYLA 1I9IH 2XRAH 3FO9B 1XZ0B 3GJFB 1E4XI 3BRFA 1EHAA 4NBYB 4P0DA 5I1EL 1T5XB 4RWYH 2GCYA 3QIBA 5D93B 3QCVH 5KSAB 1QZ1A 4EKXA 3TH4T 3FT2B 3VG9C 4AL8L 4F7MB 2KQMA 1OLZA 3MODH 2XY1A 4NQSB 5GRWA 1W8OA 2PW1B 3RJQB 5D1XB 3T77B 3IETA 3DRTB 1J5OL 5FM4A 5IR1A 5HHOD 3ARGD 3EDEA 2D7NA 2OSLB 2R0KH 3UO1H 4L4TE 1JZ7A 1QSED 1MRCH 2C4XA 3CVHL 3B9AA 1G6RA 1EH9A 1YEDA 4MJ6A 4I3GA 2F54A 2UVEA 5TDOA 3S88H 3B2UD 3O6FD 5FDWB 5FM5O 1I9JL 5KVGH 4NZTH 3ISWA 4L9LA 3MRNB 3QXAA 3C5SB 1VCAA 5KVFH 4RMSA 1VKXA 2K9UA 1HHKA 2OTPA 2P47B 4OFPA 3BGFB 5F7DB 3SE4A 1SMAA 1CWVA 5DMJB 2IQ9L 5C0GB 3ARBD 1MFBL 2AV7A 4V2CB 1V3MA 2ZCHH 1QFOA 2IFGA 2HKHH 4H1LH 4R26L 5EU4B 4NM8H 5MP6L 4KQ4H 4PG2A 1OGAE 4LGRB 4PJ8C 3MOAH 2DQEH 3OX8B 4LMQI 2DQJL 5I8CB 2YUVA 3T2OA 1KPUA 3DXAE 3GIZH 4L3EE 3E2HC 5LQBH 1GHFH 1P1ZA 1MHEA 2XG5A 2BOBA 3DURB 4ZFOL 2OR9L 1GGUA 3IDIA 4MGXA 3DETD 1L7TH 1OWWA 2DQTL 2X41A 1SY6A 1T21B 4MNQA 1WVZA 1XF2A 4FMKA 4YNYA 4M6AA 4ZUUB 3RY4A 3X11B 4F9LA 1K3IA 1XF3A 4X7DC 1JF1A 5DVNA 1A4KA 5F7UA 2X4NA 1CFSA 3ZKND 1RIUL 3K74B 3KXFB 4HMCA 3WCYA 5EN2B 4PJXB 2AXFA 1TJHL 3MX0A 4QTIL 1KCVL 3QWQB 1X5HA 4Y88A 3S36H 5B39A 5J9PB 4K7PL 4F33A 4HS3A 2VN4A 4MJ5B 5FYLE 1FFPA 3QRGH 2F5BH 2EDFA 3DECA 4HZLB 2VLMD 3VWJA 3CD4A 1MSPA 4HF5H 4C83B 1XR9B 5LWYL 4J6RL 4QRPB 1AKJD 1RSFA 3BPNB 1ZS8A 4FQ1L 2Q8BH 1S7SB 3OKMA 4HUUA 3O0RH 3BO8A 3H42L 4JHBA 4OGXH 4BQ8A 5HXMA 4L29A 4UUJA 3GK8H 3BP6A 1AR2A 2Q7YB 1A6WL 3TYGL 5J6HB 2EKSA 1AXSA 1MWAA 1UZ6E 4M7JL 3SJVE 5EU6D 1H8SA 1JF5A 2PR4L 4MHHI 4M8QB 4OF8A 4Y5VB 3MR9A 4HMDA 3FN0H 4MD0B 3OAUL 4QRRD 4NC2B 2D2OA 3WFBL 3HC3H 1J1OH 1EZVX 1OGTB 2WSKA 2BMKA 1SM3H 2DS4A 4WW1A 2JK5B 4PB9L 1U8JB 2W9DL 2BY1A 2HMID 3TO2A 4OZIF 3V6OA 5DWUH 2JELH 3TBWB 5DUMH 2AEWA 2FH8A 5GGVL 1JRHL 1V3JA 4Q9RL 5B22A 1RIVL 1R3IH 2CGRH 5IT2H 1GAFH 3HZYB 5LAXA 4DOHE 3AROA 3H9SA 1H3VA 1LE9B 2C4FU 2DJUA 1J0HA 2Z93A 3I6LE 1MI5A 1JTOA 3O2DA 4C54A 4TUKL 3PHQB 2EIDA 3KLSA 1I1AA 2EH7L 3TIDA 4QRRB 4J3XA 1TNNA 2VDNL 3GJEA 3VD9A 1FHGA 3Q6GH 1G84A 2ICWI 4LDEB 3HFML 5E8PA 5L2KB 1LNUB 3Q5TA 4PRBB 1FNSL 1UJ3B 5E99H 3VH8G 1DBBH 3KDMB 1F2XK 3TV3H 1RUPH 4R7NB 2BJML 5DEGA 4KI5D 4D94A 4BUGA 1ETZA 4KRMB 3QULA 2VH5L 4H8WC 2BSTA 1LWRA 1SJHB 4DN4L 4EOWH 3HE7A 1X7QA 4HIHA 1ACYH 3BKMH 3U4AA 4TUJB 1ODAA 3CJJA 3I2CL 1G7JA 2NPLX 4ZTOH 5HDBE 4BZ2H 5L0QB 2J1KA 1HHHB 2P43B 3QUMH 3AM8A 3U9UB 5D72L 3HG1B 3T4YB 4MCZA 2LABA 5GGQL 3LV3A 4JAMA 2Z31B 4KAQL 4JJ5A 1AGCB 4JKMA 4YHZH 1YN7B 2UWEB 3RZCA 5EOTB 1Z3GH 3S98A 5CSZB 4C55A 4DVBA 1B88A 4MQ7A 4HDIA 3FO2A 1N4XH 1ZVSB 1YMMB 1NC2A 4UILH 3NZHH 4JANA 4WWKD 3TBTB 5I2IB 2X4QB 4YXLH 4ODHL 4Q7DA 3S3PA 3JWNC 3IFLH 4U7MA 1JGLH 1MIEH 5EO0A 5AEAA 2EDTA 4M1CC 3RDTD 2ZPKL 2D4FA 4F7EA 4HUVB 3MJ8B 1ZA6A 5DQ9B 3P77B 4XX1G 5DRXA 3T3PF 1JGEA 5HHQA 4XMLH 3WNNA 3G5YA 1I3GL 3FN9A 5BVPL 1JHKH 3D1MC 2BDNH 3LEVH 1C12B 4PJHF 1JPGA 3O4LE 1CFTB 3DMMA 43C9A 1LGVA 5IIEA 1X5YA 4P48A 2DQIH 3C8KA 5CILL 1DZBA 4PPTA 1YEJH 3F7VB 1X5AA 1WWAX 5B8CA 4WWKB 1R5VA 4JY4A 1WFUA 1YQVL 1ZT7A 2CRMA 1B6DA 3K4ZA 3KWWB 5IB5B 2FLBT 2WANA 3IJHB 1MHPL 2P24A 1H3PH 5ITFA 2OL3A 1WISA 4K7PY 2OK0L 4D9LH 3T3MF 5JW5A 2VDKH 3MGTB 3PL6A 4P49A 4ZFZA 2QKIB 5TE4H 3DVNA 3KVQA 3S5LG 3D2UD 3N50A 5CCKH 1YEKH 1TTUA 2MCPH 3AU1A 3V0VA 4YIQB 2ZSVA 3INUL 4N0CD 3PWLB 1S9VB 1U8HB 2EYRA 3KR3L 1GL4B 1UWXH 4EI5D 3WKNA 2IC2A 3B3IB 2BSRA 3WXWH 1P7KB 4L3AA 1AXTH 1PQZA 1T5WB 5ECJE 2F53D 5LJYH 3MCKB 3U9PH 2EIEA 4CW1A 4RCAA 4LP5A 2GAZA 2XA8H 3LZFH 4JFXA 1XT5A 1UQSB 3GRWH 5J7CC 2AABH 3W9EB 5FOBB 3G5ZB 3SY0B 3IFPA 3WFEH 1MFDH 2QADB 5F6HJ 2A74B 5GGVY 5DQDH 4X6CB 4JFED 5ANMA 4IIQA 1CICB 5ISZB 2IAMC 3O6LL 4ODVH 3RWHA 1OTUD 4Z76A 1EMTH 1EDQA 4EI5B 5C6TL 3BP4B 3VXOA 5CJXA 1J1XH 2DI8A 3VFUA 2P49B 4IJ3C 3QNZA 2F53B 4LRIA 3C2AL 2ZJSL 5IVZB 3GMPA 1QTYT 1VFMA 2NY1C 5CEXB 4HS8H 4YBQD 5J56B 5F7FA 1NMAL 1QSFB 1K3ZA 3C08L 3NPSB 5CGYD 4Y2DA 1NC4D 1NAML 1A14L 4IRZH 2O5XH 4IRSC 1BLNA 5JIIA 3CFDB 4UZGA 3ZYIA 5T3ZD 4EDXB 1MF2L 1RUQL 1BQSA 1DBJH 3NZ8B 4HK0A 2B0SH 1R3HA 1PSKH 4TOYL 4WI4A 4N1EA 4WEBH 1A0QH 2XTJB 2BY2A 3C5ZD 3GMMB 5FA4B 5AZ2L 3WJJA 1IBGH 2EKJA 3I9GL 2XZCH 5C0DB 5DK0B 1SEQH 4MA7L 3GSQA 2FX7L 3KXFE 4M03A 1FCGA 2YR3A 4PJXE 5FDYA 4Y4FA 3MGOB 2I5YH 2IH1B 4XPGL 4OCYL 1MCDA 2DLFL 3OGCB 4BQ6A 1L0YA 3T09A 4BK4A 5I9QC 2C3HA 3WO4C 1KCSL 1YA5A 4DW2H 5MHSE 4KPHL 4ODTL 1FGNL 1NC4B 4HAFA 4HFWA 2X4PA 4OZHB 3ZL4H 4FQXC 4OKVB 2EDWA 4QRPE 1OW0A 2DOCA 3VG0H 3WKML 4YE4L 1JPFB 4X0KB 4NNXA 4NBZB 5T1KB 5IB3B 2FO1A 3QEGH 2C3VA 3C5ZB 3ZDYF 3OR6A 4ELMF 5BRZE 1P4BH 3DOSA 2XQBH 5JHLH 4Q6IA 4BSWB 1XGTB 1WWWX 3IJYA 1PG7L 4HD9A 4K07A 1T7VA 5FUOL 1KXTB 1OB1A 1AR1D 3AREA 2G5RA 3BKJL 2JB5H 2VB5A 1UH4A 2IH3A 5GJSL 2BSSB 1OQOA 4IDJL 1JK8B 2X70B 2EIZB 4Y1AA 2ESVA 5INCA 5EOQL 5F3HB 4HFUH 4GW5B 1ORQA 1UYWL 2MKLC 4YUEH 1D9KD 4RFEB 1NCDL 4O4YL 3JVGA 3D25B 1NGWA 4P2QA 4M02A 3FO0L 4JPKH 4QY8A 2C3WA 1U8KA 4PJ8D 3ZZ1A 1IGIL 1SY6L 2I9TB 1MQKL 4OI9A 1UCBL 5IW6A 2XY2A 1I3VA 4QRRE 2G5BA 1I1FA 1KGCE 2XKNA 1JCKA 4X4XB 1LP9B 4BA8A 4K9EC 4YDKH 1C5BH 5L2KE 4MMXC 1ITBB 1NKRA 4HHAA 1JTPA 1E28B 1KTDB 3U7YL 2VISB 2JTDA 5SX5K 2YD9A 1KG0A 1IM3A 4OFVA 3VFOA 5KAQF 1H3XA 1D9KB 4KTDL 3PGDA 3IU3B 2X10A 4HIEB 2ZNWA 4XPBH 5B38B 3FT4A 4F2MB 5EC1A 4OFYA 3KNBA 3QQ3A 3GSXB 1WBZA 1IZKA 3TT1L 4GS7C 1NCWH 3VW3L 5CGMA 5IQ7H 2A0LC 2XA3A 3RGVC 2FB4L 3QUKA 4OZGF 3WUZA 1MWAL 1W72H 4NM4L 3HG1E 4M43H 2ATPA 4YGVA 4PJCF 4JDTH 1DE4B 4LHQB 3VRLE 1U8IA 2JJTA 4K2UL 4U3HA 4Y16B 3GUTB 4LDOB 1U8NA 2UWEE 4R90L 2HFGH 5ENWA 3AC0A 1DQLL 5D7IA 2GSGB 3VGHA 1T89A 5E7FA 1HILA 1WT5A 4ZSOA 4MDIB 1CGVA 2MHAA 1X9QA 2XZAL 3O3UN 1YMME 1IZJA 3EO1B 5C08B 3CC5B 1JE6A 4UIKL 1AD9B 1INEH 4KZEL 2XIDA 2J8UE 3HRPA 3MBXH 4ZXBC 2HWZH 3REVA 4F15C 1Y0LA 1BD2B 3BZDA 3MBEC 4LP4A 3P73B 4HPOH 5BXFA 4Z0BH 3O2DL 4BZYA 3F8UB 1FYTB 4JY6A 4K8RH 2HG5A 2HRPH 3VE0A 1I1YA 2ARJA 3IKCB 3F5WA 3GNMH 1U58B 5JA9A 2WWKT 3MLSH 2A6IB 4L8CB 4TNWF 1A7NH 3TN0C 4PY7B 4NSKA 4D0BA 3VD4A 4HUKB 3MV9A 2HYMA 1KEGL 4U1MB 1NCBL 3IDNB 3NIFE 4BELD 3MNWA 5F7WC 2QL1A 5K9KA 5DVKA 4ZTPH 3MRPA 1F11A 5E8EA 3GSWB 1MRDH 4M7KH 4ZO8A 2R2BB 2GHWB 1T1WA 2ICWJ 5C0NC 2JJWA 4LCUB 5TE7H 5JW4R 4EVNB 1U95A 4Q97A 2CK2A 4X6DB 5GRYA 4LLVA 3O2VH 3U83A 1OAZH 2ERJC 4ODSL 4NQXA 5CD3B 4JVUA 5E9DD 3S4SG 1RZGA 2OYPA 3P0VL 3DO7A 3I3EA 3D85D 2FHBA 1GSMA 3KJ6L 1T83A 4GG8B 4R2GD 1A9BA 4NFDA 1AIFA 4MCYB 4O2CA 5DO2C 4X6BB 4O2FB 1L9NA 2R23B 2YKLH 5AZEH 3UTZA 4XC1H 2WBWB 3E8UL 4GLRI 1OHQA 4CU8A 4UTBH 1EAPB 5EZIL 1INQB 1QSVA 3VRJB 1E4JA 2OJZH 5C1MB 4ESKA 2V7HA 4HULB 1XGUA 3AS3A 3CPLB 3L3DA 4HBQA 4NRYA 2WUCL 2VXQH 2J4WL 4JFFD 4BKLA 4XPTH 4F37F 2QQLH 2FJHB 3BH8A 3WD5H 3CGTA 4AEEA 3MPCA 3D85B 3BX7C 3TFKC 3TVMC 2P8LA 4R2GB 4PRPB 4BFEA 4J8RB 3KG5A 4N8VG 4YBHA 1OPGH 5HVGB 3TO4C 1MUJA 1A6TB 5ISZE 2NX5D 4XNUH 3R06A 4R96B 1ZTXL 4ZUSB 3O6MH 3M1BB 3MCLH 4G8EA 3U46B 2QV2A 3P4LA 4M1CD 1VEPA 5MI0C 4OTXH 5GIRA 1BVZA 4YO0B 3AUVA 1ORSB 3R1GH 2KUTA 4X8XA 2X4RA 1NBZB 5F93C 4FP8L 4GMSL 5CHNB 1QSFE 3X3FH 4WHCA 4RGOH 3QIBC 2Z0BA 4UOJA 2OL3L 2DM7A 4OLVH 2VN7A 1QKZL 3D5OF 1CGSL 1CVSC 3FT3A 1RZKH 2P5WB 3MZTA 5I8EA 3IDJB 5DD0L 3GMRB 4NFCA 2XI9A 1M6OB 2CIIB 4XC3L 3ESUF 4LCCA 1S5IH 2L7JA 1N5AA 2XTJE 4Y4KD 4KGJA 3D3VA 4FFYL 4P57B 2EZ0C 3P4OB 4G6JL 1QYGL 3JWDH 3OHXA 3QFJD 1IQDB 4XTRC 3ABZA 3TNNB 3K2UH 5K9QG 1V7MH 1HINL 3O3EA 1KN2L 4JO2L 1DN2A 3RI5F 1L6XA 3U0WL 3FZUC 3CSBA 3WNKA 2DBLH 2R56H 4ZAKC 3KPRA 2VMFA 1ZHBA 4RAVA 3PV6A 4KKLC 4XNXL 2ZG3A 4HBCH 4OZHE 4GRMB 1EUUA 4PLNC 4U6XA 3U1SH 2BOCB 4LK4A 4IMKA 5ILTL 3L6FB 5H8DA 1IFHH 3NFSL 2CLRB 1AJ7H 4G9DA 5F7EL 4HJGB 5IMMA 5E7BA 4GBXA 4Y4KB 1CLOL 2VDRL 2BFVH 1UT9A 4HCRH 3A6BH 3RVTC 3VFWA 2BVPA 1LO5B 1JHLH 5MENB 3L5WA 4HS6A 4RISL 2G75A 3ES6A 4G3YH 3U4BL 4CJ1A 3QXDB 1HCFX 2R4RH 4DTGL 1HQ4B 4XBGA 1C5CH 4AIOA 5DJAB 3OF6A 4OZ4A 5FO7B 1Q8MA 1XIWA 4HUXB 3H9ZA 2G60L 5FCUL 4JVWA 1QR4A 4OGAD 4XH2B 3NA9H 1LK2B 3UYRL 5DMIL 3CVHB 2IAMD 4X5XB 3WNLA 1LEKA 5BO1H 3VFPA 3Q0HA 4GRWF 2F5AL 1PKQB 2B1AL 5SWQA 5BJTB 4XCNA 3MXWL 1WBXB 3QPQC 2UY6A 4P2RB 1CU4L 1Z9LA 3VXQB 1INDH 1CCZA 4Y19D 3FCTB 3TIEA 3G6AB 3BRDA 3I6KA 5HYQB 1CFQB 4PUBL 2I60L 3RWJA 1G0DA 3EKCA 4EI6B 4WTWA 1HHJB 5DF0A 2FSEA 4IRSD 4LHUA 1ZV5A 1AI1H 1CG9B 1LP9E 3UTTE 1A9EA 3VXRA 1BIIB 1I9EA 3Q2CA 1T1YB 2F19L 5HI4C 4PJBB 1A6UL 4E42B 4JPIA 1F3JA 2C1PA 1BM3H 4PREB 5FO9A 2EDJA 1RK0B 4PGZA 2FJGA 4YBLC 4Q74A 4GJTB 3FQNB 3K8MA 4I18A 4U1LB 5I1GH 1CVRA 4PJFB 4FZ8H 4ZFOB 3RVWD 5BV7L 1WAAE 3V5HA 2UZYB 4MZ2A 4Y19B 2H41A 3MCG1 1A1MB 2EDRA 5C09B 1XFPA 4NC1E 3MA7B 1AXIB 1VFUA 3QQ4A 4PTUB 4XHQA 5DUBB 4TVSa 3HNVL 1S7VA 3L3HA 4D2NA 1I8KB 4Z0XA 2AJSH 4IRSB 4FQXD 2EDNA 1MPAH 1OAXH 1NGXA 3BP5A 5E4IA 4Z7NE 1U91A 4X8JB 4XT1C 1B4JL 1I85C 2VIRB 5F9JB 4X80L 2VLJE 1QNZL 1BQHA 4BQ9A 2W0FB 1T03H 1YPZA 1O7VA 4JZJA 1KJ2A 5I18L 4ORZC 1EJOH 4LAQL 3RZWA 3Q3GA 4I0PA 3I84A 3SDYH 3I50H 4LSQL 3CFBB 5C08E 7CGTA 5I17A 1I1AC 1QBAA 4J1UB 4M48H 1A02N 4G43B 4NNPH 2XNAA 4OCSL 4X7TB 5JXAL 5EA0L 3SGKA 3WHXB 5AUMA 1I4FA 3BEWB 1ZT1B 1Q1JH 5IBTL 3WO4B 4ZFFB 4AIZA 1QA9B 3RL1B 1E6JH 1BD2E 2ORBH 4WWID 3TEUA 5I8KH 1JNNL 5J13B 1AE6L 4X4MA 4JPVL 1FYTE 1FIGL 1IEBB 4M62L 4Z7OF 4HIXL 1AGDA 1BECA 1VFBA 3V5KB 3TZVA 1MLBA 1FNGA 2HN7A 1NCAL 4UB0L 4IOIB 4M93C 4C56B 5EIVA 4QOKE 5GGSA 1T0NB 4D3CH 2L0DA 1BZ9B 1ZLWK 4O5LL 5GS2H 4GG6F 5DRWA 4M00A 3EZJB 1F4HA 2BNRA 1EX0A 4AEHL 4HMEA 4A2LA 5F7NC 3OAYH 3WHE0 4IOFC 1B0RA 4X6DE 3WFCH 3U7AA 5EBLB 3DX8B 3C60B 1CE6A 3I6GB 5FHBL 3BAEH 5GS0C 3RZCC 3BRGC 4W4OA 2FATL 5EIQA 3S3JA 4L4JA 1TQBC 3F12A 1DFBH 5JHDE 5SWSE 4PJDA 4KTEL 4AJ0A 3W5NA 1Z9MA 3B8YA 3SKOA 1MHHB 4WEMB 4LIQL 1Z0NA 2YC1A 5IBUG 1G7HB 1JGDB 1TJGL 1ZWIA 3P9LB 2A0LD 3RGVD 5GS1C 1YNKL 2BNQD 4X7SH 3MLVL 4F9PC 3PHSA 4JFOA 2FGWL 3FONB 3OKNA 1T2QL 3KS0J 4FFZL 1D5XB 1RHFA 5E6IA 2LTQC 3W5MA 2ZUQC 1A2YB 1JNHB 1N0LA 4JQIH 4XNMA 4OBSA 4XMPL 5I75C 4LPTA 1ZHKA 4KTYA 3ULVE 1CF8L 2VDMH 5DJ0B 3ARFA 4JB9L 3ZYJA 3TBVB 4LCWA 1A3RL 3CDGB 3CFIC 1NCTA 4PRPE 5ACZB 1CDJA 1NGZB 1RMFH 4AT6A 5GJTH 2PYFA 2OZ4H 3BW9A 1JPTL 1IAOA 4Y7MA 1MFAL 1A4JA 4ZXBD 2HT2C 3V7MA 3NPZB 4WUUB 2VDOL 3RUGF 2DLHA 3MBED 4K3DH 4TQEH 3LSOA 3QNYA 1BFOA 5KSVB 3LH2H 4KRPC 3CCHB 5I6XC 4NN7C 2QSCL 1U3JA 4LCYA 1VPOL 4G9FB 4XXCA 1IILE 1XGQB 4BFBD 3TJEL 4YFEA 3CUPB 3RNQB 5DJXB 3RNKA 3TN0D 4JLRA 5C2BH 3ULVH 4OQTH 4DGYH 2RFXA 5ALCH 2P5WE 3QIWB 4QCIA 3V7AE 3NGBB 2VR5A 5TGBA 3HUJB 1DBAH 2V2WB 2XOTA 4WI8A 1HH9A 1AQKL 3BDYL 2CIKA 5CJOL 4ZXBB 5C0ND 4F15B 1ES0B 4UV7L 4YK4B 5LCVH 2EDQA 1TFHA 4LLMB 4JO4H 1H3TA 5C0CA 3MBEB 1BPVA 3MA9H 4QO1A 1QR1B 5KSUB 2CKNA 4JM2F 3IDXH 4WTZG 2NTSP 1CLYL 1N5YH 3T0EC 2C7UB 4FTVD 5FUCE 3DX7A 2Z91A 4TVPL 3U6RA 1G7IB 2I9LB 1KPRB 4LSPH 3MYJA 5KAQG 1N6VA 4H0GA 4PJ5A 1G1YA 4AQ1B 2R0WL 2JIXA 1E4WH 4PJGE 4M7ZB 1UM5L 4LVNB 5JXEA 1RHHB 3E3QC 1YEGL 3FKUS 4L8BB 1KN4L 3LPGA 5T33H 3LS4H 1WCBA 4W6XB 2WUBL 5IROA 2J6EH 2MWCA 4FQ2L 3LKPA 3DRQB 2ATKA 2H2PC 3K8KA 3SCMB 1JNJA 5MENE 2A77H 4DZBA 1A7PL 3D0LB 3GSRB 3CFEB 1UWEL 4CUCA 2P44B 3M8OL 1CD1A 2ERJB 3LS5H 2APBA 3L3GB 4MA1C 5FK9B 4ELKA 5IGXH 1T04A 2XWJA 4M3KB 1GGCH 4H1LA 4N8CH 1ACZA 1FZOA 4FTVB 3QDJB 4GKNB 3JWOH 1ZSDB 5KANG 4K3GA 3V6ZB 3BGMB 4G8GD 4KV5E 3REWA 4I77H 5C0IB 3TVMD 4Q9QL 4U1GC 2IAND 3RY6A 4L4TA 5EOCL 5IMLB 4OV5B 5F44A 5DHYA 3TO4D 1KIQA 3CZJA 4CVUA 4W81A 1B6UA 1PKQE 4ONGL 2DLTA 4ODBD 3SKMB 1TENA 3H9HB 5I1EH 4Y4HC 4P2RE 2IFFL 5J1TC 1Z2KA 4OT1L 4GT7A 3AFLA 5C0AD 1WF5A 2SEBA 3DHMA 5FGSA 4W70A 1F58L 4KU1A 1YEFL 3QIBD 5KVMC 2Z8VC 2BVQA 1QHOA 2D3VA 4H88L 4XCEA 4Y5XA 1B0GA 1NGQL 4OFDA 2V2TA 4YHPB 4TTDC 3NACH 5GGUA 4MX7A 3LN4B 5DK3A 3PF2A 1BGXH 3ARUA 4Z5RB 3EHBC 4PJBE 1CR9L 5HYFA 4XRCA 1JWMA 2EZ0D 2FBOJ 1S7QA 3CVHH 4XZUB 4Z7QE 1G0XA 1XR8A 4IHOA 2B39A 3GHEH 4YR6B 1OSZB 1NAMB 4JN2B 4XTRD 4QHMA 1I9JH 4Q6IC 2P46B 1IM9A 1BOGA 4PJFE 5EUKB 2F54D 1OAYH 2UYLB 2E7LA 2WV3A 3FZUD 4F57L 5C09E 1R3LA 2BVUA 4OLEA 4PS4H 4TSAH 4KJYA 2D7PA 3MLUH 1D5ZA 1AHWC 3DX6A 2GCYB 3ZTJG 3QIBB 4KKLD 3HAEG 4J3UA 1K5NA 1MFEL 1QFWM 3PP3H 1JRHI 4L3CA 2MKWA 4X4YA 1GGTA 4WCYL 5I1HL 2VDQL 4R26H 3G5XA 3IETB 3RA7H 1K6QL 2DLIA 4BM7A 3GO1L 1KB5H 3VWKC 2VAAA 5IR1B 3RVTD 2DQJH 5K59F 1S7RA 1HN1A 4N9GA 1G6RB 4MJ6B 2F54B 1S9KC 4PIRF 5TDOB 5KJRH 3F58L 2OR9H 5GS3A 1MAJA 3GMNA 3MJ6A 4Z7VA 2W60A 1IGJB 3SDXE 3ULSA 4K3EH 4L9LB 3WL9A 5SWZA 3QXAB 4ODWA 5TQ2H 1RZIA 1UXSA 3L5XL 4BUHA 1VKXB 2EICA 1CDHA 1QEWA 3LY6A 3QWRD 1RIUH 2IBGA 5T3XH 4PYGA 3PWUA 2AV7B 3RPKA 1KCVH 3V4UH 3ESVF 2ITCB 4RZCA 1NBQA 5D9SA 1LE5A 3VMOA 4C56E 3QPQD 5I66A 4PRIA 3PWVA 3W82A 4BJLA 3PGCA 2O61A 1DUZA 2HAZA 4RAUA 4UNUA 1KPUB 2XKUA 1BQLH 3Q5OA 2QTEA 4K23L 1U3HC 1P1ZB 2PO6A 4FQ1H 1M7DA 4UNVA 3D39D 3V4VL 3F7QA 4L8SA 1MHEB 1ONQA 2PUQT 3RQ3A 2R29L 2BOBB 1CDIA 1ZHNA 3RX5A 3W0WD 4HIIA 3IDIB 4ZO9A 2YRPA 4D8PA 2OS7A 5CUSL 5GGTH 3TYGH 2JJTC 1S8DA 5HI4D 4MNQB 4OLZL 3SDCA 1XF2B 4YNYB 3QUMA 4WRLA 1A22B 1XF3B 1JF1B 1HSAA 1A4KB 2PR4H 2M2DA 1XCQA 4P23A 2EE6A 4XMKL 5BOPA 2AXFB 4OBRA 3WFBH 4F7CA 4C57C 3AS2A 5B39B 5EPMA 4L9DA 4F33B 4HS3B 4G6AC 4PB9H 1DQQA 4OF6A 1VSCA 3VWJB 1E27B 2OQJA 4LSSL 2I27N 4MB3A 4WFGD 1ZS8B 1MVFA 3OKMB 3DX9A 4ZOEA 5GRZA 3BO8B 5I16A 1NGYA 4L29B 1D5MA 4UUJB 2BHYA 2IJ0C 2I24N 3BP6B 4DCQA 4PLOB 4WW2A 4G6ML 2RR3A 1FSKC 5DI8A 1AXSB 5A16A 1MWAB 4LSTL 4Z7WE 2EH7H 4ZD3L 3TA3C 5HVFB 2AXHA 1G9MC 1I1AD 3HFMH 3MR9B 4XPHL 4PGBA 5C9JA 3SGEH 2E3VA 4WUUE 4X5LA 1FNSH 2NY7L 5HHXL 2BMKB 4YFDB 4WW1B 2LE9A 3EYSL 3LQZA 4KKCC 3TO2B 1IGFL 3A6OA 1DQMH 3UTSE 4OIAA 4A6YH 2E6QA 4G9FE 3QCTL 5GQBA 3PWJA 2OBGA 1TJIH 2VH5H 3QCUH 3HMWL 2R4SL 5LAXB 2DMBA 1KJ3L 1X3DA 3H9SB 4WDIA 4Y5YA 3WFDL 4DN4H 5AD0A 2X4SA 1E4KA 3FTGA 1BBJA 3CU7A 3FRPA 2Z93B 4G6FD 2GI7A 1MI5B 3ME0A 3RVVC 5BZWA 4HKJA 1CDBA 1QFHA 5CINL 2EXYC 5I1LA 2VLLA 3HUJE 5D72H 3RWEA 1I1AB 4UINH 2V5MA 2CJUL 3ECBA 4R4FL 3TIDB 3O4OC 5D96B 4QF1A 2NY3C 4KAQH 3GJEB 3ALXA 4OZFG 2ARWA 5E8PB 2Q86A 4M5YH 2ADGB 4P3CL 4PJIE 4YFLF 5GS0D 3A6CL 1P2CA 1T3FA 3RZCD 1ADQL 3QEQA 4JZOA 4TNWK 2ZCLL 5DEGB 3TNMA 5KW9L 1I3UA 3I85A 1DUYA 1ETZB 4ODHH 4X99A 1H9VA 3QULB 3QDAA 2D9QB 2YHGA 4G6FB 4WU7A 3RWDA 4R9HA 2BSTB 3GRWA 1FAIL 2ZPKH 4YX2L 1TLKA 3HE7B 4HIHB 1MCPH 3Q1SH 3CFJA 1G7JB 2MFNA 2AGJL 1I3GH 5BVPH 3EO0A 4MCZB 5DD5L 2YWYA 4G6KL 3DBXA 3LV3B 4JAMB 1FPTH 1IC4H 2NZIA 2AERT 4JJ5B 5FYJD 1CXIA 2QQQA 2CDEA 5JO5A 2GSIA 4FTVE 3QDJE 4YEEA 4IEFB 1YMHA 2RAMA 3DMMD 4HKZA 4OD3H 1TCRA 3HAEA 4DVBB 2EC9U 4MQ7B 4HDIB 3FO2B 3G6DH 1X5JA 1YQVH 3C6LC 1LD9A 1NC2B 4JANB 3IS0X 1HHIA 2VO5A 5EO0B 3UDWA 2D03L 4Y8AA 4P5TA 2WIIA 1S7UA 4F7EB 4P2YA 3X13A 4RBPK 1ZA6B 4KRPD 2N7AA 2HJKA 5DRXB 1JGEB 4XP5H 5HHQB 1ZGLA 4X98A 1N64L 4F37K 3G5YB 3T0VA 3QCVL 1F3RB 2YRZA 5D2NE 1WFNA 3INUH 5LGHL 3MODL 1JPGB 4GRLA 3DMMB 5I1IL 5IIEB 3G04A 2MTPA 3S9DB 3GMQA 3M17A 4KFZC 5C71A 3BH9A 3C8KB 1W0YT 5GGRA 3T2NH 1UKTA 1QFWL 3FFDA 4L1HA 5B8CB 1P84K 1R5VB 5JPNA 3JZ7A 4JY4B 2O5ZH 4YPJA 1ZT7B 3TGXA 3GSUA 3RKPA 2P24B 1KELH 1SJEA 5ITFB 5IOPA 3S88L 2D9CA 2OL3B 4KDWA 2GJZA 4UV4H 1EO8H 2VABA 2MCG1 5JW5B 5KN5A 3PL6B 4NZTL 4DUVA 5E2WH 4URTB 4ZFZB 3TH2T 3T0ED 5FO8A 5JMOC 1I8LC 3DVNB 1QLEL 5KVFL 5IWLA 5KS9A 3X3GL 1XIWC 1PEZA 3O6LH 3AU1B 3QHZL 3V0VB 3OJVC 4M9PA 4HGWA 1KUMA 2ZSVB 3E6HA 4HPYH 4X6FA 1NCNA 4P46C 1SJVA 5J9PA 5GISL 3H3PH 4NM8L 2EYRB 3PABB 1ZVHA 1Q94A 3WE6A 1CDCA 3MOAL 4JFYA 2BSRB 2H2PD 1XGRA 1L4IA 3ZKXB 3BJ91 1NMAH 1PQZB 3GIZL 1DCLA 4WJ5B 3C08H 5LQBL 4LASL 2VDPL 4TPRL 3RI5K 1T0PB 3GKWL 1U6AH 4CW1B 5IESH