4WENB

Co-complex structure of the f4 fimbrial adhesin faeg variant ac with llama single domain antibody v2
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCTASGSISSINAMGWYRQAPGSKREFVAHITNTGVTEFADSVKGRFTISRDNAKTTVDLQMNSLKPEDTAVYYCAATDWGTLLIKGIDHWGKGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords K88 fimbrial protein AC
publication title Structural insight in the inhibition of adherence of F4 fimbriae producing enterotoxigenic Escherichia coli by llama single domain antibodies.
pubmed doi rcsb
source organism Escherichia coli
total genus 29
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2014-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wenB00
1S7QB 4XPTH 4L5FL 4PRNA 4XC1L 1X5AA 1BF8A 4JM2B 3B9KA 3SQOL 5A2LH 4LCWA 3GMPB 2P4AB 3RGVB 3EYOB 1R0AH 3NIGE 4JPKH 5F7DA 3BDYL 4QNPE 3CDFA 4ZOCA 3I3DA 4S2SB 2V9TA 1Y6KR 4ZQKA 5C07B 1MRCL 5ADOH 4OQ1A 2NXZD 2PR4H 1X5XA 2QQLH 4Z95H 4O58H 4H5SB 3ROLB 1QO3B 4L8SA 2BMKB 4YHIA 3I85A 2FO1A 1I3RA 4N0UA 3UMTA 1KCLA 1BPVA 2AXGB 2M1KA 5C0CA 1JGEB 3R8BB 1V05A 4NQXB 1AGBA 4YDJA 3ARGB 2VXSH 3NH7L 5C0DA 4ZXBC 3IRZA 1TENA 1ZV5A 2IWGA 4OZIA 5LGKA 5GS1B 4PJAA 5F8RC 4HCRH 3ARFB 1T1YB 3GSQA 1PX4A 1Q9KB 3Q3GA 4PJ8D 1LD9A 3DSFH 4U1MB 4JPWH 2P48B 4F3FB 3IJYA 2X05A 4QXWA 1AGFB 5C08B 2H32B 5DMGC 1LO0L 2ZUYA 4MX7B 5FV2A 2YPLD 1EEQA 1T1ZA 4RCAA 4P4KC 4B7IA 1OW0C 3PWLB 4TTDD 2CGRH 4IDLA 1WIOA 3CXDL 5EOCJ 1N6UA 5BVPH 3LD8B 4MJID 4F37K 4LU5L 1B3JA 3IVKB 3TWCL 1P1ZA 3U9PL 3ARTA 8FABA 1CDYA 1RIHH 2ENYA 1F11B 3DV4B 1TTUA 1EHAA 3ULVD 3ARYA 3QFDB 3QIWD 1RULH 4NUGH 4GAFB 5JLZB 2NZIA 3BQUB 4Q6IB 4M6OH 4PJXE 1JFQL 2HT3D 1YPZE 4K3GA 4GG6E 1KENH 1BZ7A 1DQDH 1S7RB 4YBLC 4ZTPH 5IVZA 1TVHB 4FXKB 3ZDXF 5KBNC 4DEPB 4K7PY 1S9YA 1JHLL 3RGHA 3QAZB 4XNUL 2Q1EA 4YFDB 1V3JA 4MMXC 1EO8H 3PDOB 5EN2A 1O7VA 3Q0HA 4POUB 1B88A 1B0WA 1YEJL 5H2BB 2W0LA 4QHMA 3U30C 5IFJB 1G7MB 4FZ8L 4U1SB 4P9MH 4JKPL 3HG1E 2BSRB 4G9DB 3S4SA 1AD9B 4Z7VE 1MEXL 5HYIA 2MKWA 4KFZC 1QR1B 2YUWA 5TDPA 1UH4A 1AQKH 1ED3B 3DX7A 4XWOC 3HTLX 2H8PB 1MIEH 4OIIL 4NKIH 2X70B 1NLDH 1MFAH 5D7JC 1DQMH 4LSTL 3IFNL 5EBMB 3V52H 1KPUA 1LE5A 1T20A 4EN3B 4F58L 2XA8H 3ES6B 3LPFA 2W1NA 3MO1B 3BUTA 4HZAA 3EFFB 4Z7UF 2DM7A 1P6FA 4KQ3L 3MXVH 2HYMA 5E56A 3JBG7 1KSRA 4N9OB 1PYWB 2E9JA 3RVUC 3VA2C 1KN4L 1KB5L 4JFDA 5J13B 1M05B 1AGCA 3WFZA 1RZKL 5BW7A 3CFJB 3H42H 4H8WH 1HH9B 1MQ8A 2Y7QA 4NT6B 3UTOA 1NFIB 3V7AG 5B3JF 4IDJL 3UPRB 1PKOA 2XKNB 4RFNC 3H9SD 4TUJB 3HA0A 5DJYA 2BFVL 4WNQA 5CJ8A 2Y6SC 4KJQC 3P0GB 4XH2A 5BJTA 2NX5E 3QA3B 3CNKA 1QFWM 2F54E 3QB7C 3CLEH 4Z78B 1JHKH 1JGVH 4IRSD 4Y5YA 3VFNB 3UTQB 4ODUB 2CIKA 4ONFH 4HC1H 4M9OA 1JGUL 3TH4T 3MMEA 2E7MA 2R0LL 4QXGL 4DUXA 5IG7B 4LHUA 4UT9H 4GBXD 3PJSB 4NDMA 1TNMA 4H0GA 4PRHD 1MCIA 4YQXH 1RUAH 4UZGA 2AV7B 3GMMB 2CDFB 5HHOB 4JQVC 4M1GH 4S1RH 4PG2A 4TPRH 5C09A 2D4FA 3ARPA 1OCWL 3O9WB 5K59E 3VMOA 3Q6FA 2VDQH 4XPGL 4ODVH 4PV8A 2FX9L 1HIML 3O11B 4NO0B 2YSSB 5TF1H 1XF5B 4MDJA 4HEPG 3D39D 1F58H 2HJLB 1IQDA 1BQHA 3RVVD 5KS9A 2EEAA 2XG4A 3UYOD 1UZ6F 1Y6NR 3E2HB 4K2UH 1DR9A 4YJZL 2WZPD 4ZUUB 3O6FD 5JO5B 3BPCB 3DVFA 2HT2C 5TQ2H 2DI7A 2E7HA 2A2QT 2JK5B 3SO3C 4X9HA 5D2LB 4J3SA 3EJJX 2QKIA 1NC2B 1WZKA 1I7ZA 2GHWB 4LQ1A 3SKMA 1H8OA 1EFXB 4Q97A 3KJ4B 4LIQH 3IFOA 3WFCH 4GMTH 2P43B 3RVXD 1H8SA 4MAYD 1K6QL 2XFXB 2E9WA 5ISZA 3QNXB 1HHIB 3BP4B 4U6VL 5HI5C 1T04B 1NGYA 5D1ZB 4PJIF 5DLML 1DCLA 4JDZB 5IV2A 3QO1B 2ID5A 2FRGP 3FB7B 2E7LA 3TN0B 4JAMB 3VXMA 2AW2A 3T65B 4YH6A 2D2OA 3R8QA 4NN6C 1YA5A 1N0XH 5GISH 4ELMA 4LRIA 3OKYA 1F4XH 3ZYJA 2AJXL 1A21A 2XWBA 5EZOH 1BFVL 2YMXH 4JO1H 1QSFA 3N06B 3F6IA 5HVGB 1MFCL 4NQSB 5LWYL 3RUGA 5CP3A 5T33H 1LEKA 3U4EB 3C6LC 4JJ5A 5DS8B 7FABH 1KPRB 5I73B 2J4WL 1U8PB 3FQTB 3H9HB 3BP7A 4JFPA 4MSWA 2YPKB 5E9DD 3O45B 1OWRM 1YUHA 2LTQB 4NWTH 3RY6C 1T83C 4CAGA 3VD3A 1V7MH 2BNQE 1I8KB 2CKBH 1AXTL 5I15L 1RURH 1JVKA 2X4PA 1C5CL 4IRJA 5BOPA 1J8HA 3UJIL 2I60L 3VWJA 2X9WA 1WTLA 3LHPH 4J7RA 2VLLA 5GGUB 2FATH 4JZJA 4I3RL 3L5JA 4G6FB 4LAQH 3FT2B 4GRLA 4KKNA 5CGYD 2EYSA 2ZCLL 3WFBH 1INDL 2W92A 1I7UB 4XPHH 1DLHB 4PS4L 2NY5C 5D93C 4G8IB 4OV5B 4JQXA 1KTLB 4CMMB 5IESL 3BKYL 2FO4A 3FL7A 1RZFH 5E2UL 2G75B 2XQBL 2KDGA 1BWWA 3JUYA 5JHDE 3C8KB 3KYMB 4JFXB 4HPYH 4OGXH 4Y2DC 1GL4B 3DYOA 4C58B 5MI0C 3QH3B 2OK0L 5T3ZH 3OG6B 1U3YA 5T1LD 1JPTL 5HYSA 3C5ZA 3CD4A 1R3HA 1T5WA 4XCFL 2M8XA 3VI4F 1PVHA 1IM3B 1TZHB 1EGJH 1ORQA 1MHEB 3K8MA 3FQXA 4UU9A 3U0PA 4L4JA 2OQJB 1H3TA 3MODH 2Z35B 1N2RA 3FCTB 3O2DA 4NZJA 4M62H 2J8UF 5A3IC 5C7XH 5GS0H 4ZNEA 4HXAL 4GLRI 1S7VB 3L6FB 1FFNA 5M94B 5EFIB 4FTVD 3VFSA 2DJ4A 1CE1L 4M9PA 3SE9H 4QOKB 1WWWX 1M7XA 3LY6A 1DBAH 4H20H 3GMQB 4PR5A 3BKCL 5BXFB 2GSIB 4K94L 2CK2A 4W81A 5JQ6L 4GSDL 3ZO0A 1A22B 3V7AE 5A43C 5IKCB 2P7TA 4NGHL 1K3IA 3SDAB 5ID0A 2MJWA 2VH5L 2VXTL 4PRIB 4F7MA 1AE6H 1J10A 3B9EA 3IDYB 2SEBA 3FQRA 3CZFA 4PYHA 1EA9C 1BFTA 3HUJE 1MVUA 3IFPA 3QEHB 3V6OA 4L9LB 3PG2A 4XPFH 3TV3H 2D03H 5DEFA 5AZ2L 1FAIL 4KK5C 1KCSH 3MRDA 2DLFH 4ZS7L 5I2IB 3MNZB 4HUNB 5MEPA 1A1NB 2O5XH 2OJZH 4JM4H 1IC1A 1UM6L 2AKRB 3BIKA 3MRLA 1XIWB 4NQUA 2VZ1A 2R2HA 3BKMH 2YS4A 1T7VA 4Y19A 3U7WH 4Z0BL 1YNLH 5DRZA 3HAEH 4Z77A 1NCNA 4OZGF 4NQDA 4RFEB 1K5NA 1MCNA 2GJZA 4WO4C 3VD5A 3WEXA 3CDYA 1QLEH 4XVTH 4IHOB 2VLJE 3TT1H 2YK1H 4MHHG 2YZ1A 3CDGB 2HMID 1CBVH 2H9GB 4BZYA 5I30H 4OF5A 4CN1A 1HHJA 3TIEB 2R23A 2HG5A 5GGVL 5I1LB 4PREA 2D7NA 1IT9H 5TJWK 1Q9OA 1TJHH 3QJFA 4KTDH 1NLBH 1QSVA 5FECA 1ZHKA 2KQNA 1KELH 3KJ6L 4HQQH 4MA8L 1L0XA 1VB9A 3F58L 1L7TL 1OY3B 3HC0A 4W6XB 5B3NA 4M6NH 4P59H 12E8H 4YFLF 1JMXA 4O2EA 5E1HB 2DWEA 3SDXE 1MRFL 3GSNB 4XHQA 3MJ6A 3D2UA 4XP1L 3IDJA 1NCAH 4R90L 3WO4B 2FZ3A 1YC8A 1G9NH 3PWPB 1NFDE 3W2DL 5B38A 1HILA 3S35L 2NY1D 1CDCA 5F93C 3ELAT 4LRNH 4ZOEA 4BSJA 2HT4D 4CADA 1A7OH 1MH5A 1KCVH 4RISL 1A6AB 4U1LB 4D0BA 5I71C 3VGFA 2QADB 4K7PH 1AR2A 3TESA 1WISA 3V79C 3P4MB 5FUZH 1P6AB 1JNJA 3ZKNC 1QG3A 2VRAA 4OM0H 1JIBA 1A9BB 3QULB 3HG1D 2WBKA 3HPJA 2V2XB 3NVQA 4KAQL 4WGWB 1P2CA 2EDYA 1FFPB 4H0HB 4EUPH 2HRPH 2LE9A 4P5TD 4H1LA 1MSPA 4Q9CA 1K8DA 4FMFA 3PP4L 2X7LB 1KYOK 1JBJA 2IPUK 4U6YB 1U8NA 3NGBC 4PJCB 1MCEA 1CL7L 1TJIL 4WW1A 1J1OL 3QXVA 4O4YL 1XR8B 5D1XC 1T0NB 2E6PA 5LGJB 4RNRB 3BZEB 4YHYB 4LDEB 4WGVB 4PIRF 2FIKB 1A7NH 1I8MA 4HS8L 5IBLC 3G6JA 3VA6A 4BH7A 1FDLH 2R1YB 3RTQC 2D9CA 3WNMA 5DRWA 5EU6A 4JM2D 4URTB 4XMLL 2R9HD 1ZOXA 1OTTD 2ZUQB 4CBPA 5E1AB 4PJEA 2M26A 3GKZA 3UYPA 2ITDB 3F5WB 3SY0A 2UZXB 1ZLSH 4U0RC 4CVXA 1IAII 4I0PD 4D9LL 3VFVA 1H15B 5I8OH 1DUZA 5DUML 5FKPB 1R3KA 3CSGA 2IAMD 5T1MB 2NTFA 5KVFH 3QFJE 1I9RL 3O4LA 4FFZL 5CBEA 4X98A 2NX5D 4CL7A 2F54D 2ZG2A 1F5WA 2NR6C 4MD0B 4ZD3H 4NN5C 1XAUA 2D7PA 4XVJL 3QDJB 1ADQH 4G8GE 1E6JH 2AJ3A 1ZEAL 5GIRA 1G1YA 3MRQB 5I1HL 1FZOA 5FV1L 4FQ2H 4PGEB 4OZFH 4DKEL 4OLVH 5HGAA 1AGEB 4OV6F 1RK0B 4LNRA 1KEML 5DUPH 3IFLL 5F7UA 3SKNB 1ITBB 3TBSB 4OB5H 3VXQA 4ZNCD 1N64H 1YNTB 3KLHC 1LDPH 1SHMA 3HS0A 4TN9A 5IEHB 2XICA 3VGBA 1J0JA 4OCXL 1NH6A 3SKOB 5JIHA 3QUYD 3X14A 3Q1SL 2EC9U 1IAOB 2F8OA 3IETB 4BSWA 1LP9E 1U8LB 3EKCA 4Y1AB 3BISA 1CFQA 3MRBB 1EO5A 4LQFL 4R3SA 4U05A 2NY0C 1IGJB 4GXUM 5F7LB 3MGOA 4HWEL 5L6YH 5ILTH 3BWUC 1FO0H 4YX2L 3UTTB 3PWPE 5CILL 4I2XB 4PGBB 2W60A 3BQUD 4MXQD 4RQQA 3B9DA 5IB2A 5GSRA 4YHZL 2W65A 3AAZB 1IGMH 2UVFA 5CIPB 2Z92B 3ILQD 4FP8H 3FFCB 2Y5EA 3BDBA 2JB6A 1RVFL 2FL5A 1ERNA 3AU1B 1MCHA 4UIKH 4LCYA 5CD5C 3IT8D 4MS8D 1RZGB 3OSKA 4HJJL 3KNBB 2CO6B 1OLZA 3DTXB 4XCNB 1Z5LB 1RUMH 4PJ8A 2X4QA 3BVNA 3O2WH 5D2NC 4DKAA 4FQLH 5EC2B 4NQEE 1N8ZB 1PLGH 3ZKMC 3UAJC 1SYSA 2YPLA 4LSRL 5INCB 3DVIA 4PJHE 4FNLH 3VXPA 4YWGL 1FZKA 3CK0H 5F96H 1YY8A 3C09C 5HHNB 1J0YA 4NPYA 4IS6B 2Z4QA 4G6AC 4OGYL 3MNVB 2EZ0D 2EH8L 5D96C 1MCBA 4N8VA 4JRXB 4MJIA 5EH1A 4KK9D 4JY5L 4PG9B 2OTPA 2P5EE 2CLRA 4NNPH 4Q9BA 4M02A 4GKSB 3TCXA 3HNTH 2NW3A 4CDGC 3TF7C 4BK5A 4MJ2A 3MJ8B 4C83B 3BH9A 4P2QB 3UBXB 2BNQD 2A74B 3D25A 3SGKA 3QIWA 1A6VH 1DE4B 3L3KB 2NY7H 3F7RA 1YDPB 3QIBB 3BZDA 4NNYB 4EXKA 4LLDB 4EQ3A 2X10A 1BFOA 3MV9B 1K9TA 4JRWA 5IK3B 3EZJB 3EGSB 4LVNB 5TDNA 4AMKH 4C59B 5JDJA 5D1QB 2HTKD 4YHOL 5F3HB 4EI5B 1B0RA 1MUJB 2BOCA 4UTBL 3W39A 1RY7B 1G7PA 4ZS6D 4NZDA 4POYA 3IU4L 3V9FA 1VADB 3UZEA 4MQTB 5IJVA 4YHML 1FH5H 5D5ME 5TE4L 1T1WB 3A6BH 4JEGB 1P7KB 2D7QA 2WBJB 4HH9A 2UWEE 1QLRA 2XTJD 3IXTA 1G7QA 1VGEL 4KTEH 3VXSE 5JHDD 4M7KL 3L5HA 4HJ0C 2FH8A 3G5XA 1RJZB 3FONA 1U8JB 2RJMA 5JMOC 2XKSA 3MXWH 3WFHA 3BJ91 4YDVB 5EIQA 4HK3N 5DD6A 1PG7L 4MAUL 1T3FA 2D7TL 3WHXA 5FB8A 2X4SB 2JELH 1A6TB 5I76A 5FO9B 3MBED 5FGCB 3O9WD 1BJ1H 4BSVB 5H94B 4K3JL 3ZDYF 2BXYA 3OPZL 5KSBF 4HIXL 1T89C 1UYWH 3ESUF 4L8BA 3LEYH 3TIDA 5CZXC 1CD8A 4WFGE 3LH2L 3QBTB 4C56B 4UT7L 1HQ4A 3B5GA 4IEFB 3TCLB 2DQFB 4I5BB 1RZIB 2IGFH 3CVHH 1AY1H 4NJAL 3DO3A 5DHYA 1F97A 5J1SC 3VFMA 4XBEL 2XRAH 4LHJB 4M6ML 3FO2B 5JA9A 4PP1C 2X4NA 3S3PA 4IJ3C 4FABL 5CD3B 3IF1B 2I07A 2Y23A 5CEXA 1VEOA 2A6KB 4KUCF 3GIZH 1G6RH 1IAKA 3H9SA 1CR9L 3KYOB 1FFOB 3UTTE 4J12A 3LQZA 2ZG1A 1T4KA 4GQ9L 2NLJA 2O5ZL 4WWKC 4B5EA 5IR1A 1RJYA 2E6QA 4IRSA 2JCCF 1WAAA 2BVPA 1LE9A 2A9MH 2R0KL 1L7IH 4KROB 3S36H 5DJ6A 4KKCC 4OCYL 2QEJA 3RIFF 4MMZC 4GBXA 4JN1L 2OL3A 4XP5L 3RZWA 1MLCB 5T1KD 3WLWC 4PRHA 4DK6A 1BHGA 5JHLL 3T1FA 3EYQC 4IIQB 4HT1H 2H2SC 2MFNA 4U33A 5SWSE 4R97C 3DXAB 2DKSA 1RUQH 1FC2D 1ETZA 1U3ZA 3KPPB 4FHBD 5D71H 1WC7B 4ONHA 1IVLA 5GZOD 2W9EL 5CSGA 5IB1A 1JN6A 5C6PB 1MCQA 1MWAH 1OGAB 2FR4A 3D39A 2OZ4H 5AYUH 2V5MA 2BVEA 4Y5VB 5JW3H 5KVEH 1ZGLB 2VZSA 3PV6A 3UO1L 2H6PB 4JRXE 2BRRL 4BFEA 1CXKA 1DFBH 2EXWC 4TYUA 1U8MB 5HHME 3O6FA 5TDOA 2F53D 1HH6A 5EO9B 4S1SH 2VLJD 3BKJH 1AHWA 4R2GB 1UB5A 3D0LA 4EIGB 1H3WM 1VACB 4P2QE 3C2AH 5KAQG 3MJ7B 2DS4A 4HKJB 5EO0B 3BH8A 1I1YB 2HLAA 2APVA 3BO8A 3M45A 3EO9L 4QGTA 1B0GA 4XNMA 1KBGL 2P8LB 3MV9E 3RA7H 2BC4A 3GMRB 3R06A 3DVGB 2PYFA 5DHVH 3RPIA 4MAYA 2XACC 5SWZE 5CINL 5HHQB 2MQCA 1EHNA 3FTGA 3I6GA 2JJSC 4RAVB 4ZPTB 1JZ5A 1IGYB 5F70A 4QHNA 2GKIA 1P69B 5FCSH 2B1AH 1FVDA 4E0RB 2D31B 3SKJL 2FECI 4WFFD 4F7TA 2ZP0T 3BXNA 3SPVB 3LQAL 1OTSC 4Y16D 5F89A 4ERSH 1UB6A 2AJZA 5L9DL 3WHE1 4UTAH 1NCTA 3C60D 5F1NB 1MJ8H 3BGMA 3ZE2E 1BBJA 1P4IH 3OHXB 4MNGA 1D5BA 2FGWL 3EYUL 5J56B 5E9DA 4XP4H 5HGGS 5CUSL 5FHBL 1YJDL 4QHKI 1HXMB 4K3EL 1JPSH 1T6WA 2AEQH 4LP4A 3EYVB 1CDUA 3B9KC 3S88L 4UDUA 1Y18A 4L3CA 5KN5B 4PJDA 5JPMA 2Z8RA 3NZ8A 4WU7A 1FHGA 4OLYH 2LAAA 1IC4H 1FNGB 3GJEB 2GK2A 3K81A 3HNSH 5IM7B 5IFAH 4B7LA 4L8SC 4HKBA 4KRLB 1LNUB 3IJHA 1XT5A 4HV8B 1ZHNB 5INDA 4KKLD 3PV7A 4WHTB 1UADC 3O6KL 3MRNA 4NNXB 3IDIB 5CJQH 2FJFB 1PZ5A 1FORL 3B3IB 3RVTD 3FHAA 5DJDB 3EHBC 1I75A 1KCKA 4QT5A 4NP4L 4K23H 2PW1B 1YEHH 2RQ8A 3KPQA 3B9VA 4MCZA 4OSUL 3MRCA 5ESQB 1FYTB 5T1LA 1CU4L 4O00A 3GSXB 4B50A 4LMQI 3TNNA 3TVMB 2IMNA 2K1MA 1B90A 4S10A 4KKAC 1Q1JH 2EH7L 1OSPH 3MROB 3N85L 5EU5B 3P40A 3GHBH 4Z76A 1DBBH 3NFPB 3VFOB 3MOBH 5E6ID 3QQ9C 4LEOB 5AD0A 3SO5A 1TDQA 2EIEA 1AIFA 1HHGB 4OCLC 4ZUWB 3BESR 3ZYZA 2YEZA 4ODWA 3CSBA 32C2A 4Y4HC 1HI6A 1QLFB 5KSUB 3WN5B 2Y06H 4NO3A 1WEJH 3QFJD 3B83A 4U1GB 1NMCB 3JV6A 4FTVA 4Z7WB 5TE7L 1H0DB 1BQSA 1V3MA 1QP1A 4I3SL 4F15C 3U36A 3PWUA 3GB7A 4ZAKB 4YHKH 4KPHH 1U95A 4ZFZA 4MGXA 3D3VE 1OM3H 1JTTA 3IKCA 2X41A 4IMLB 4YE4L 4G8GD 4OZIF 4KQ4H 4JO2L 2VABA 2P8MA 4XHJC 5DMIH 3S3JA 2J88H 4OBRA 3DX6A 3ILPB 4KDWA 3PHQB 1EXUA 4UT6L 1C5DB 8CGTA 1B6DA 1QHOA 1NCCL 1X5YA 5LG1A 5FDYA 4U7SA 1FP5A 4KJWD 4PD4K 5KSVA 4UQ2A 3UROR 1J11A 2IANB 5EOQL 4I48B 2NY5H 3QZWA 3FB6A 5JUEL 5DRXB 4MA1C 4ZFFB 2F8VA 3NTCL 1G9MC 4PJGB 3BPNB 4LLAA 2ICWA 4S1QH 4PRBB 4ODHH 3U46A 2CK0L 1B4RA 4XVUD 3OAUL 2YD6A 3MZGB 1KCUL 5JORA 5HGHA 2BVUA 4ODTL 4LK4A 4RGOH 4BUGA 2AXJA 2QSCL 1S78C 1T21A 1ODAA 1OARL 1IBGH 5ENWA 1FZJA 4P46B 2VIRA 3PWPD 3ULSB 2DIAA 1EUTA 2ED8A 1MCFA 4Y4FD 1HE7A 5EZLB 4GG8A 2NNAB 4OQTL 5C9KA 1QSZA 5BW7C 4P2OD 4HMCA 4E5XB 2N56A 4HKXB 3KPTA 3RWFB 4G6JL 3RWDB 3C8HA 3GEWB 5F1OB 4GRMB 4WI9A 3DBXB 1ZT4A 5C6TL 5E70A 3RL2A 2VOTA 1QFOA 4D0CA 3SGDH 3A6OA 4IOIA 4NQED 3TBYA 5KJRL 1K4DB 2O5YL 4C54A 1MFDH 2X4UB 4APQB 4Y5YC 2ICEA 2Z9TA 3QQ4B 4BQBA 1YEFH 1NGPL 2UY6A 2WWMC 4JDTL 4NRXA 2ENSA 5C0GB 2BRQA 4ZO8A 3UBXI 3VXTA 5FK9A 3EAKA 2V17L 3LIZL 3R1GL 1QEWA 2BSSB 3V7MA 1HSBA 3T2OA 4K9EL 4U3CA 5DI8A 5EUKB 3O4OC 3TJEL 5CLTA 3EDDA 4L29A 3EYSL 4P49A 3OKLB 3AS3A 4PG2C 2NYYD 2P5ED 2X2YA 5CSZA 5DMJB 2CKBB 4L4VE 4G7YL 5I8EA 1P4BH 4OI9A 5KVDH 2DQJL 2EKJA 3KAAA 5ERWA 4NKDA 4OF0A 1Q9LA 2ARWA 2DDQL 5E2TL 3KPSD 1HQRB 3MLWH 2A38A 3STLB 1QA9A 4PJXA 1SJHB 4RFOL 1YPZA 4GG6A 2IBZX 1F4WH 5DO2C 4WTWA 4GH7B 2OI9B 1SJEB 3MREA 3BD3A 2AI0H 2DL2A 5L88H 2AJVL 5CJXC 1G0XA 1IKNA 4O2CB 2AEPH 5HJ3A 1G7IB 4MDIA 4YNYA 1O0VA 1IL1B 1EAPB 4HX1A 1HINH 4JPKL 4KZEL 3AS2A 1XGQB 5DSCA 3RY5A 2QL1A 3HG1A 4J4PD 5E7BA 3VXSD 3WBDA 1VFUA 1ZA6B 4P5TA 5ICXB 5JW5A 4Z7VA 2PR4L 3GHEH 4XAWL 2DBLH 1I3GH 2YXMA 4Z95L 4ZUTA 4FQPA 4O58L 4ISVB 4BZ1H 3IDGB 3QDGB 1U58A 3SJVB 3LN4A 1U3HB 4TVPH 1FG2B 3I9GH 1FFQA 3QNYA 4P5KA 2VXSL 4QRQA 1E4XI 1Y0LA 2HFGL 3RVWC 4J8RB 3BW9B 3HAEG 4X6CB 4WFGD 1F3JB 2KZ1B 3E6FA 4NBZB 3QG7H 4O02H 1TMCB 4FFYL 2EDWA 43CAB 1MREH 3QRGH 5CCKH 4JM2A 3DSFL 1GOHA 5D72L 4LRIC 4KUZL 1OWWA 2BHZA 4TOYL 5I1AA 1DVFD 2KQMA 5D7JD 3OKMB 2NY3D 4HW6A 3QI9C 1GGUA 1QRKA 3QQ3B 4U6TA 1EZVY 1R3JA 5EZJA 4AIXA 2HH0L 5J1AA 3TO2B 4I0PA 1CVRA 1L6ZA 1YNKH 4NKQB 3NN8A 3MV7E 1HWHB 3L7EB 3OGCB 2IAMA 3DYMA 5LCVL 1FN4A 4WI5A 5CHNB 3UTTD 3C5SB 3DGGB 1X6NA 2NX5A 4NKMA 5EUOB 1BQUA 1W0WB 2F54A 5BVPL 4PBWD 1BD2B 1CDJA 1CFTA 1RUKH 3MV01 3ZKQD 4NRYB 3NZHH 4IRJC 3CH1B 3HI1B 3VH8A 1DJSA 4P48A 1XGYH 3VWJC 5AUMB 1U3JA 1DL7L 4GUPA 5K9KB 3L7FA 2ZKHH 4OFVA 5I9QB 3V6ZA 4JZJC 4NUGL 1FGNL 3BAEH 4GRLC 3QEQB 5SWSD 3K74B 1OF2B 1KENL 2VKXA 1QKZH 3L3OA 4AEFA 5MEQA 1N6VA 4KY1H 4JQXC 4HZLB 1A14H 1S7WA 2CMRH 3MBXL 5HI4C 1ZHLB 5FGBA 3V2AR 3KPLB 1F3DH 2Q8BL 4KMTL 4LARH 4YDLB 3SDCB 3GI8L 5EBLB 1DSFH 3ULUC 3HAEB 3QUYA 1X6LA 4OZHB 1NAMA 1TTFA 5DJ2A 5I6XB 4P9ML 4K55A 3VGEA 4PJ7B 3FOMB 1HKFA 3IVKA 1UFUA 5HHMD 1UXSB 3C5ZC 4HFWA 1MHPH 3RZCB 2C1OA 3HC3H 5DD3L 1UWEL 4NO5A 2VDKH 25C8H 1F11A 1A6ZB 3UZVB 4HUUB 4NKIL 4YR6A 1NLDL 3BJLA 3GRWA 1DQML 4XXCA 5ALCH 3V52L 2ICWI 1CD1B 3AM8A 2XA8L 4U6HA 3BIBX 3BQUA 3IAPA 4M4PA 3ECBA 2ZJSH 3HKFA 4PJ5B 1C5BH 2A6DA 4UOW0 1X5IA 1T66C 3P9MB 5DF0A 4RDQF 5F9JB 5SWZD 3IGAA 4PJ9B 4BELD 5IQ7H 4HGKC 1CXFA 3DGCR 2ZUVA 1FL5A 2OTUA 1MAMH 3PL6B 4QRRB 2AXFB 5E8PB 3H42L 5E95B 5L8LB 3DROB 3V0AC 4PLJC 3VWKB 4OUUB 5IEKA 1ORSA 1X7QB 3TH3T 2P47B 3H3PH 5J6HA 2EYTB 4JHBA 1IKFH 4F33A 1U6AH 4RGNC 1MI5D 5DFVC 4N0CD 5EU3B 5I75C 3SE4A 4JDVB 3HZMA 3CCHA 3HI5L 1AKJD 1EEYA 3UJTH 3QDGE 15C8L 4G6MH 5KW9H 5JMRA 2AJYL 3HZVA 3CLEL 5DD5L 1JHKL 1LWRA 1WTGT 2X9YA 4MA3A 5F6HI 3BEVA 4QRSA 4ZFGL 2PXYD 3O3UN 4DVBB 1KXVC 2BSED 4HC1L 4DAGL 3N1PC 3RKPA 3FRUA 1MIML 1JRHH 3ARQA 4HS3B 4YQXL 4YHLH 1RUAL 1SY6H 5IBTL 5ACZB 2B1HL 4O9HH 1CLZH 4QXUH 3NIFE 2AP2A 2BNQA 2VQ1A 2I9LA 4JKKA 3D18B 2LAGB 3C6LD 2VDQL 3VE0B 2FEEI 5I19H 1NFIA 1A0QH 4JHWH 4OZFG 1KLGB 5GJSL 1YYML 3QXWA 3TLRA 1EV2E 4U1IB 2F58L 1ZTXL 5D7LE 2E3VA 3BD4A 3WDHA 4GKZA 2GTWA 5FYJH 1WBXA 5EUOE 4OKVB 5DD0H 1DQQA 5KSAB 1ZSDB 1G7LB 5D6DA 2RGSA 4M1CC 4K2UL 2XWTB 2CH8A 3MNWA 4LLQA 5A2FA 2XY2A 1ZVHA 4KROD 4DOHB 1PSKL 2AJUL 5FKAB 4HUKB 5JHDA 3MFFA 4ALAH 5IB4B 3WFDH 3ZZ1A 3GMMA 1XF4A 3S8WA 3QEQE 1LO4L 4U1NA 3MBEA 3E1F1 3O9WA 3WFCL 4BM7A 4UQ3B 4KDTA 3QNZB 3RDTB 3HRZB 1P7QD 3GM8A 1JP5A 4W6YB 3J7HA 4BH8B 5BS0B 1BEYH 4PRDB 2V9QA 3RWIA 1FBIH 1U92B 1S8DA 5MENB 2IJ0C 4HIIA 1NBVH 2P49B 2OP4L 4P0DA 4ZUUA 4YHPA 1N0XL 2N7BA 1DEEA 2NY2B 5GISL 4BQ6A 1F4XL 4F7CB 1JNNL 4CJ1A 2DQHL 5DXWA 3TBWB 4WUUB 1GSMA 2YMXL 1XCTB 5E8EB 3D3VD 3B5HA 4YXKH 2JJUA 1R24A 1KPVB 3S3SA 1VHPA 3CFCH 1UCBL 5C0IA 5ACLA 1GHFH 5J6GB 4OZFB 3RU8L 3MGTB 1MHHA 5E99H 2BHUA 2EIZB 4Z9KB 1DQJB 4D3CH 2OX5A 1Q72H 4A2LA 2VDLH 3O41B 4JFFE 1TNNA 2X89D 3MRMB 2B8OT 3WNOA 1MRDL 3H3KA 4NWTL 1T22B 2HP4A 4U1JB 5ANMB 1V7ML 3MRHB 4WRLA 5T1KA 3GO1L 2CKBL 2NW2A 3HUJA 5F72S 5GRVK 3L5XH 3SDYH 5IB5B 1RV6X 2FX8H 3QISA 4OFYD 2QR0A 4K8RL 3LHPL 2WIIA 1H9VA 5HYQA 4IOFC 1KFAL 1CE6A 3DV6B 2HFEA 2A9NH 3DI2B 1B4JH 4HWBH 2P5WE 4YPJA 3TZVD 4YFEA 2GEEA 4L4TE 1WQVT 4NQSA 2JJTA 4P2YA 3WS3B 5IFHH 1FO0B 1FV1A 3O3EA 1RU9H 1RZFL 1MHCB 5LGHL 1BECA 2JJWA 4Y5XB 4OGXL 4KI5E 1U42A 1SBBA 1CLOH 1A4KA 2GT9B 3SDDB 3T0EE 2VLJA 3U4BL 3HFML 4D2NA 4DW2L 2Q86A 4U3XA 5GRJH 3EDEA 2PTVA 3MA7A 2R2EA 1XZ0A 2CXGA 2B5IB 2IADB 1EGJL 1MOEA 1YQVH 4MXVE 1A3LH 4QTIH 5EBWA 1I7RB 3GI9L 4N68A 2NQCA 3P9LB 4NC1E 5DJAB 3CIQA 2V2TB 1UZ8A 3GSWB 5KG9A 4WO4D 4JPVH 4CMHB 3DARA 4HUXA 4X4ZA 4QWWD 4KRPD 2FJHA 3QWQB 5DJ8B 5GPRA 3BX7C 3VFGH 4FA8A 1NJ9B 3BRGC 5DT1L 4OCNC 2FB4L 3V0VA 1N26A 3LKQB 3U6RB 1TITA 5D7IB 3U0WH 2PYEB 4JFXA 2ATPB 3AREB 5HHPB 2ZSWB 3IS0X 3KWWA 2RIKA 5C0NC 1M4KA 3REWA 1PX3A 3GBMH 4K7FB 2VXUH 4Q9QH 1YMHA 2J3SA 5FA3A 4Y16A 2CRZA 4QRTB 5I1KH 3SDXA 3OQ3B 3TVMD 4L4VD 4ZFOB 2DIBA 4FQXB 5IMLA 2R1WB 3C60A 1BJMA 4UUJA 4MQ7B 5CZVH 3UC0L 4PJEF 1NFDA 1CFNA 3JTSB 5BS0E 1ZLWH 4EBQH 5DGQA 3TV3L 4HH8A 2KL6A 3WS6A 3OJDA 4GAJL 1T0MA 2DLFL 1S7VA 5FFLA 3QCTL 2O5XL 2BVYA 1S9KC 2J1KA 1T6VN 3RRQA 1NQBA 3NAAL 4ZXBB 2IQ9L 4FQHB 3W11D 3FN0L 4OZ4A 5GRZA 3U7WL 1Z6JT 5FEBA 1XF3A 4F2MA 4JPIB 4C4KO 3HCVA 5BRZE 1G7JA 3TH2T 4XVTL 4WWID 3FOLA 4X6BB 4HIEB 4Z0XA 4JZOB 3TT1L 4PBXA 5FYLE 4DN3L 3QUMH 3VD9A 1KC5L 4DGVH 4M43H 3QEHA 1CBVL 5HHXH 4ZSOB 4P4KB 5IMOB 4PJ8C 3LRSB 2W07A 3JWDC 5I2IA 5EA0L 5DYOB 2Z31C 2AEIT 1BIIA 3ARBC 1HYRC 1YECL 3DVNA 3IKKA 3V95A 5GJTH 1W0VA 1EHXA 4M7ZC 5E6IA 4UILH 5E4EB 3VG0H 3HZKB 4HQQL 1WZLA 2IPUG 1KTRL 1IRAY 2R2BA 3MR9B 4X4ME 1CFBA 1L6XA 1SM3H 2Y07H 3MV7D 2J12B 5HY9A 1S5IL 3IAGC 1QNZL 1HOCB 4WHCA 3D69B 4MNQB 4FQ1H 4P59L 3QFJA 3HE7D 1GPOH 3I75B 1HZHL 2VDOL 3BPLC 3L5WA 5HVFB 2VC2H 5C92A 3DUUB 2L7UA 3ARSA 4YBLB 4LASL 3GUTA 4R96B 2VXVL 1KNOB 4P3DA 2BNRB 4AH2B 4JLRA 1BOYA 4G3YL 3ULVC 4P9HL 3SGKC 3OTTA 3QIWC 4V2BA 1FIEA 5DJ0B 4JB9H 4G8GA 4HUVB 1CL7I 1KF9B 3ISWA 2HT3C 4HK0B 2BVTA 4J1UA 3U30B 5F9WC 1AR1D 2NXYC 3LKRB 3RNKB 2MNUA 3G6DH 1IARB 3FT3B 4J3OC 4LRNL 4KHTH 5IOPB 1I3VA 1AFVH 1MWAB 3DX8B 1IAMA 3BDXA 2DQUH 3PGDB 2WSKA 4K7PL 4KKBD 1KJVA 2MCPL 3REVB 4HG4J 4OM0L 5E2WL 4Z6AT 3FJTA 3PF2A 3OBAA 3M17B 2HVJB 4HIJB 3OZ9L 1LP9A 3MOAL 4MJ6B 4JCLA 3K2UH 3HN3A 2AVGA 2Z8WC 5I1IL 4PY8J 3N1GC 4ZDHA 3MUGA 5E5MA 1PAMA 1XMWA 5IB3A 4K8RD 2KUTA 4F7EB 3W9DB 5K9QG 2OMBA 4HBQA 5M7QA 4KVCL 1A5FL 3VFPB 3PWPA 4Y4FA 2ZUUA 5DHVB 2BVQA 4HWNA 5T3XH 1IGTA 3TNMB 5EU7C 3KDMB 4C57C 4NOBA 4P2OA 1T03L 4NYLB 3SOBH 2H26B 3S5LG 3IU3A 2VWEE 5DQDH 3LS5L 3MPCA 1INQA 5ICZB 2IG2H 3FKUS 1F42A 3PABA 4NZTH 4F9PA 1A1MB 3NCCB 5DJXB 5I18H 4NQEA 1HWGB 4OCMC 3ZDXE 5KVFL 3WIHA 4GW5B 2A73B 2XTLA 3QUZB 4PJHA 2V2WB 5F97E 4M1DL 4GBXC 5K9JL 3ME0A 4ZO7A 1YEEL 1NMAL 1ADQL 4LCIL 3BZEA 3S35X 5FOBB 3INUL 2P5EA 1A7QL 2EKSB 2PN5A 4LLMB 4UV7H 4N90E 2C3HA 4M7LH 4OLVL 3KYKH 4YZFE 5F7YC 1G9MH 2GUOB 1VPOH 3C9NB 1FNLA 3E6HA 3V5DA 3KPSA 3AUVA 2C3WA 3OXRB 4OB5L 3U7YL 4ODXA 5BZWA 2FBJL 2L0DA 5F1IA 3QHTC 5FYLL 3RVVC 4QCIA 3SO3B 3UTSB 4Z7UE 4H26A 5DR5L 1S7UB 2WLYA 4EXPX 2JKXA 1YEDA 3KPRB 3ZKSD 4GLRH 3F12A 2OR8A 5D7LD 2X4RA 4JE4B 5C0EB 2Q76B 3MA9L 3QCVH 2AABH 3O6FC 3PIQB 3ET9F 3ROOB 5FHAL 4JFQB 4OAWB 5D5MA 1CXLA 1BGXH 1AGDB 5DVMA 3S5LB 3D87B 1WAAF 2UWEA 3WJJA 5F3BB 4J4PA 3VXSA 5ILTL 4NBYB 5B3JE 3CFDB 1HXYA 1BOGA 3TT3H 3MYJB 2ZUSA 1KTDA 1OGTB 3V0WL 3ZT6A 5EORH 3GFUA 2P8PB 3MRFA 2VAJA 4MAYC 3ZMRA 3P11L 3NIDF 1BBDH 3QXDB 2HJKB 4RZCB 4OCSL 3GM0A 4C55A 1ZA3A 2K3TA 3QO0A 2YKLL 1CN4A 1EPFA 1D5IH 1U8HB 2JB5L 3CFEB 2CRIA 1MCJA 4WV1C 3M1BA 3KR3L 3JWOL 5FDWB 2ARJA 2DQGH 3TGXA 4DKFH 3CLFH 3LSOA 1RUML 1NUGA 1TFHA 4M93C 4AM0B 1DVFA 2ZOKA 2A1WH 2I26N 5D7JA 2XZAL 2ESVE 2AK1L 3RX8A 4LPCA 4YGVB 1LK2A 5CZXD 5HYJB 4FNLL 4UINH 1T7XA 3CK0L 5E8NA 2CLZA 3BZFA 3UTTA 2P46B 1UJ3C 5TFSH 5I74C 4XGZB 3QUXB 1UZ6E 3VW3L 4X5XA 3S37L 1GVIA 3B2VH 4JFFD 2DTMH 3DUSB 2E5EA 3X3FH 2DQEL 5D93B 4PRPE 5DDHA 3QRFM 3P4LA 4PJ9D 1TIUA 1JF1B 2QHRL 3PGCB 4D9RE 4ZFOL 5EC1B 3DTXA 1Z5LA 5SWSA 2BNUB 4Y2DB 2YPVH 5HGDA 5MI0B 4CVZA 3CC5A 5HPMB 1C8PA 4O2FA 1DN0B 1MCPH 3DMMD 5CEZE 4ACPA 3ZL4H 1GZPA 3VXNA 2YHGA 4P2RE 3QJHB 3VFUA 4DZ8B 1JPFA 2P5WD 1T7ZA 1JGLL 2HAZA 1I4FB 4L4TD 2KKQA 1NGXA 3WLWD 1FH5L 4PJIE 3V6BR 1F90H 1W0YT 1CFVH 1SVCP 3QIUD 35C8H 2L4OA 1J18A 5T5FL 1H3PH 4KI5D 3WNNA 1YEGH 4PRAA 4TNWF 4YXHL 5E5UB 4HK3J 3VXUB 3V5HB 3T0ED 2CQVA 4P2QA 1FRGH 4X6FB 3X3GH 1B6UA 4GO6B 4J23A 3L3JA 3QDAA 1T0PB 1GIGH 1LVEA 1C16A 3PDGA 3WIIH 4X6DE 4BJLA 1UYWL 3CXHJ 4I4WB 3W9EB 4OZGB 2EXWD 5CP3H 4WJ5A 5F9DC 5IGXH 1R3IL 4JQIH 2ICES 5SWZA 1FQ9C 3EOAB 1MCDA 1N3NB 2QBWA 4U4BA 4IRZL 3Q6GL 2GITB 1HKLH 3LKSA 1BVKB 2HFFB 3DRQA 2R4RH 1MPAH 1CGUA 2AGJH 2QQKL 2W9DL 4FQCL 1BVLA 2AK4D 3PHOA 5J11C 4LSSH 5F71A 1S9WB 4OF8A 4PB9H 2K9UA 1EHLL 1FVCB 1K85A 2YD3A 3VGHA 3GIZL 1RJZA 4TRPH 2RB8A 4OQTA 5IHZB 3THMH 1MI5A 2PUQT 4PP2B 1RZKC 5KOMC 5JOPE 4YDVA 1AKJA 1AI1L 3ORJA 3VMPA 4GW4A 1VKXB 1A6TA 3K1KC 5H94A 2PXYA 4OIAA 5HGBA 3G5VA 3OJVC 3RDTD 5HTSA 4DKDC 3ZT7A 5A2KH 5MP6H 1UXWB 1JGDA 4QYOA 3LCYA 1F6AA 3T0AA 4F8TA 1RZIA 3G5YB 4PGDA 5BS0D 3WNLA 4OD1L 4RA0C 3ULUH 5JW4R 5HHVL 1TVDA 1OTSD 3MRKA 1UEMA 1XGPB 3C6LA 2DMKA 3VI4E 1I3UA 1S9XB 4HIHB 5IW3A 2GQHA 4N8CL 1P5VA 1A64A 2YOCA 2A6KA 4NHCH 4WFEE 3BP6B 3STZA 1EDQA 4KJYA 2B0SH 1R5WB 2OZ4L 5FF6B 1QVOB 1LEIB 3LKPB 5EIIA 1LO2H 1TJGL 3O6ML 1T83A 5KVGH 2J8UE 5ESAA 1MELA 1UM4L 5GGRA 1HK6A 1A6WH 1DFBL 1TVBB 1KJ3H 5CJOH 1KJ2A 3DO7A 3O2DH 3IJSA 5BRZD 2HMIC 2PO6B 3AFLA 5I1DA 2BJMH 3VFWB 2YD9A 2XOTA 3RHWF 5FYLD 2W59A 1YEKL 5DEGB 4XNZC 3HPLB 4KI1A 1DUYB 2G9HB 2WWKO 4DCQA 3F7YA 4DVRL 1PKQB 3PXJA 2C7UB 3RA7L 3WD5H 4NZUH 3KPPA 3RWCB 3VXOA 3S6CA 3I02A 1P7QA 5DJCA 5F9OL 5IF0B 4KHXH 1TPXC 1AD0B 2AV1B 1IGIL 4YDKH 3SCMB 4HBCH 3NIGF 4Q7DA 1FSKB 1BF2A 4NHUA 4R0LA 1U36A 2VLRE 3DHJA 3EJZD 1MQKH 3QP3A 3VGAC 2FBOJ 5C2BL 4EDXA 3FO9B 3H7BB 5IBUG 2ED9A 1LEGB 1P4LA 4H88H 3QPXH 1Q0YH 1D9KB 5DZOA 5L0QB 3D3VA 4ELKA 1VACA 4POZC 4PPTA 2VZUA 1NMBH 4M3JA 4XC3H 3L3IB 2CDEB 5I71B 3FRPA 4R26H 4UTAL 2NY1C 4XP9H 1BLNB 1MJ8L 1N5AB 1YN6B 5CSBA 4Q9RL 3QCUL 4Y4HD 2X89A 4HWZA 3CFIC 3G5ZB 4XP4L 2HT4C 4JKWA 5EOTA 3K3QA 5GGSY 1JPSL 2AEQL 5F88A 4KXZI 2CIIB 4M7LT 1IKNC 3JV4B 1MF2H 3V4VH 1UT9A 1QBLH 3Q48A 1CGTA 4OFYA 3NGBB 2FH6A 3KXFB 2Y4SA 5HVHB 4PJBB 5B39G 4LCUA 3VJ6A 5D1XB 2IALA 2OS7A 4P5TC 4NBXB 5IFAL 2HKFH 2COQA 5J1TC 1XH3B 4GKNB 4PUBL 1E27A 5L7XH 4Q74A 1QYGH 3OX8A 3TZVA 4GRWE 4X7EC 1EO7A 3X13A 4I3GA 1IZKA 5C2UB 3RTQB 5FM5M 1INEL 4XBGA 1GAFH 1U8QA 3HNVL 4B41A 2XZCH 5T5NF 4L8DB 3K4ZA 2CXKA 4KJPC 3AGVA 5FO8A 1IEBA 1A7BA 1DP0A 2I5YL 3PNWA 1QFWI 4JZNA 4PV9B 1OQXA 4PGZA 1JZ6A 2ZPKL 5A2JH 4JM2C 5A40E 4PJXF 1JWMA 2J6EA 2R9HC 5IBUB 3QG6B 3LZFH 4CKVX 1MLBB 5IT2H 1C12B 1MFEL 3MACH 2HVKB 4XVSH 1LK3H 5I1GH 4MVBC 4FN0A 2LU4A 1YN7B 4I0PC 4Y89A 1DBBL 1OAUL 4XZUA 4WO4A 2IAMC 2P42B 4RMUA 1RZJC 1M7IA 3UYRL 5DRNB 1M6OA 5DWUH 2ICCA 1N59B 2IPKB 1EEZA 4ODSL 1JWUA 1I8LA 1KIQB 3GNML 3RJQB 4MJ4A 5SV3A 3RL1B 3MRPB 4G9FE 4X5WB 4YHKL 5BO1H 2VL5A 5SWQB 4HSQA 4ETQB 4DZBA 1AQDB 4EOWH 2Z91B 4AL8H 2WQ8A 3IXAB 2PW1A 1EX0A 1S7SA 5B39B 1IC5H 3H6JA 3NACH 1KEGH 1IGFH 3LPGA 4KQ4L 1PKQE 5D7SL 3NFNB 3TBVA 3TVMA 4N90D 3QEUA 4L4VA 2VITA 1HDMA 3MV8E 3IS1X 2VE6A 1QBML 4K94C 2XQYK 1NCWH 1R5VB 4H1LH 5FGBC 3HC4H 2NY0B 2QSTA 5FA4A 5KANI 3OKEA 3QUYC 4PJGF 1BIHA 4X9BA 4F9LA 5I1CL 2FJGB 1HHGA 3WDJA 3T09A 2GTZB 3LEVL 1QLFA 3LD8C 4M8QA 4S1QL 2UYLA 4ZAKA 2QHLA 4G8EB 1ZGLP 4HGWB 5EWIL 2V7HA 4GXVH 1VA9A 2F19H 3AM8C 3U82B 1ZVYA 3BQUC 4Z7OF 3HMWH 1IBGL 4AEIH 2DD8H 5EU4B 3RWJB 1UGNA 3G6AA 4MA7L 4JG0L 1ACYH 4UDTA 5FYJU 1RMFH 1MFBH 3U9UB 4YK4C 4AG4H 3TBTA 2X1WL 4S0TD 3PWVB 3BZ4A 1CICD 1SEQL 2Y5TB 1IC7H 5JOEA 4JY6A 2VXQL 1UQSA 1T2QL 1OAYH 3ZTNH 5JIPA 1KYOJ 4PLKC 2AJSH 4OTXL 4HFUL 5DC0A 4UNVA 5C86A 1XGRA 4PRBA 5D96B 4U1KB 3SE4C 4BA8A 2ITCB 1DBML 3V8CA 5I1EH 4I18A 2ESVD 3VRJA 4Z8FH 1D5MB 5KSBB 4R8WH 1K8IA 3QXAA 1MFDL 1RFDH 1A7PH 4KRNA 1KUMA 3T4AB 1EERB 5C8JB 3MV7A 4J2XA 1BX2B 2H1PL 1JF5A 1JTPA 4KK9C 3ZSTA 4MD4B 3HE7A 2ADGA 1MNUL 1VEPA 3AXLB 3GMNA 3CUPA 2MHAB 2NNAA 3UCRA 3DYPA 2VZ3A 1FNSL 2R56H 3QI9D 5FO7A 4E5XA 1ZHBB 4Q58C 3VRIB 3G04A 4PRPD 4L3EE 1U8OB 1P4BL 3DI3B 3CU1A 3RWFA 4DTGH 5IUSA 3O81A 2DQIL 1GGCL 1RHHA 3VFTA 1SEBA 4JKMA 4WDIA 2E7CA 2W0FB 4D9RD 1GZQA 4HUWA 1DQTA 1OB1A 4NUJA 1IJ9A 5DURD 5CBAA 4Z7NF 1WK0A 1CWVA 4R7DB 3QEGH 1F4WL 1K2DA 4ZS6C 1J05B 5CEZD 5I1JH 5D6DC 1IAIM 1HEZA 2X4UA 4JFYB 4QHUA 4P2RD 1RZ7L 1K4CA 4J3XA 4LSPH 5ICYB 4YPGB 2H3NB 4Q0XL 2BSTB 3TA3B 2UVEA 4NO2B 4NRZB 4OLUH 1JNLL 2CR6A 4PGCB 2VDMH 1I3GL 4J3TA 3MBEC 3U2SB 3O9WC 5F7NC 3LEXB 4BZ1L 4KDTC 5HI4D 1XR9A 5HPOA 3AB0B 3O6LH 3FHQA 1IEHA 3JWDH 4GT7A 3TJHD 1R3LA 3C6SA 1KACB 4X6CF 3I9GL 3NFSL 5KVMC 4IJ3B 1MCRA 2XWJB 3KPOA 1DANU 2YRPA 1Y6MR 1DBKH 1X4XA 3QG7L 4XTRC 5D6CB 3OJ2C 1FL3B 1MREL 3KG5A 3QDMB 1LMKA 2EIBA 3QUKB 5F7FA 4WWKB 1QQDB 4NQVA 3LKOA 5DTFA 3W0WE 4X9IA 3HHRB 3U0TB 3HMXA 1YEIH 3ULVH 1OAQH 1YNKL 1OTUD 4JFOA 3P30H 5GSVB 4XPBL 2YD8A 4RX4D 5JOPD 1NBYB 2RFXA 4XNYH 4AT6B 3I50H 1UACH 4R97B 3IDGA 1NCDH 5EOCH 1S7TB 5GGTL 5J4MA 2QSVA 5LBSL 5JZ7D 2X6MA 1X3DA 1RUKL 4V1DE 1T80A 1U91A 2YC1B 1KGCE 3TN0C 3K1DA 3L9RA 4P3CH 2ZKHL 5DFVD 5C0BB 5F6IB 2XXCB 3BAEL 2ORBH 1N7ML 3O0RH 5GZOC 2UZIL 3JWNC 3WJLA 3ZE1F 1I9JH 4WW2F 4DUVA 1QKZL 4LCCB 4CU7A 4EVNB 3HR5A 4GW1B 2CMRL 2DJSA 4LOUD 1E0OB 4XT1C 3TO2A 4WFED 2X1OA 3O8XD 5I73C 1RJLA 4PJ7F 4HAFA 2EDOA 4JRYE 5D7LA 2HJFA 3EO1B 3OR7B 5IHLB 2PETA 2PF6A 3KLAA 3T2NL 3KHOA 2YA0A 3FB5B 5C0AB 3QUMB 4LSVH 4LDOB 2BOBB 3HC3L 5F7HA 1EAJA 4NRYA 3HI1A 1E4KA 1G0YR 4L3AA 5K9KA 5E2JA 5ALCL 1A7RH 3MLZH 3WKNA 1QFUH 4HKZB 3GBNL 1EVUA 1WICA 1G7HB 2XN9E 4M1CD 2JCCE 5DMKA 4HZLA 3UJJH 2FYYA 4DGIL 5LKNA 1ZXQA 4XMKL 2ILLA 1ZK9A 1TZIB 1MAML 1UH3A 1V5JA 2XNAA 3L3GB 2VQUA 4CUCA 2VLRD 5CEYA 4PB0L 3P73B 2GJ6B 2OL3H 2R0WL 4LLVB 1FE8L 1CT8A 3FO0L 2A77H 4PRNB 4Y16C 1WCBA 3B9KB 3DJ9A 4LCWB 5DQJA 1QRNE 5KW9L 3C60C 1WGOA 3D9AL 4N0YH 2CJUL 4ZMAT 5F7DB 5E2VH 3BP5A 1CD1A 2Q6WA 4JFEB 2YBRA 3DX9A 4ZQKB 2WINB 2OSLA 1RUPL 4JFFA 4YAQA 4PJFF 1J1PH 4L8SB 3T77A 1SY6L 4YHIB 4YHLL 1I3RB 4N0UB 3O3BA 4NSKB 1VESA 1YMME 4PJ9A 5C0CB 4U1HA 3RX5A 4YDJB 2GAZA 1CGSH 2DICA 5C0DB 4XB8A 2APWA 4NWUL 4XWGL 4OZIB 1A1OA 43C9A 4ESKA 5E94A 3NABL 4ZOBA 4PJAB 4AIZA 3S4SG 4KKLC 3QXTA 4E41E 3DMMA 4L5FH 3GSQB 4XC1H 1AXSA 3B43A 3Q3GB 1LD9B 1QSEE 2P5WA 4JVUA 3T3PE 2B39A 3IJYB 4L4TA 4G80A 3RVTC 4HS6A 2P1YA 3GSOA 3IDYC 5I66A 1E4WL 4DVBA 3QIUA 4L9LC 3WHE0 4A6YL 1MRCH 1T1ZB 3WKMH 2IQAB 1NBQA 2VDPH 1FZMA 4IOFD 1VENA 4WUKL 2M2DA 1VFBA 3T0EA 2HN7B 3NCJL 4JN2A 3KPNA 1D5ZA 2GCYA 3ALPA 3C87A 4DGYL 1EBAA 1XIWC 4F15B 5E6IC 1P1ZB 8FABB 1LQSR 5GGVY 5CMAA 4LBEA 1JRHI 2YWZA 1QD0A 4QY8A 4U1IA 3BFOA 3L1OL 3T4YA 1FIGH 1JUFA 1ZWIB 1BZ7B 5IVZB 1NBVL 2CO7B 3D85B 1LO0H 2AK4A 1NGZA 4G9FD 5FKAA 4DQOL 3WMSA 4YXKL 3OXSA 1V7NH 4LHUG 4PY8I 4QHMB 3RWEA 4MA1B 5E99L 3S4SB 3CXDH 2ZUTA 4QRPB 4PTTA 4OLWL 4KJWC 4LU5H 1AC6A 4UQ3A 1GJIA 3RDTA 3MV8D 2DWDA 3U9PH 4ZG1A 3MCKA 2YA2A 1I1AD 3SCMD 5FXCH 3L5XL 1KPUB 1GGBH 2FX8L 2AERT 2HWZL 4LNVA 3PWJA 5BS0A 1SYVA 1T20B 1LE5B 2D0HA 1NEZA 5IMKA 1Q94A 4XVUC 1BQHG 1JFQH 3GGWA 4JO4L 4MCYA 6CGTA 1B4JL 1JHLH 4JFDB 3D5OF 4XNUH 1AGCB 1DDHA 2AQ2A 2BX5A 5JPNA 1KPVA 1W72L 1HCVA 1UVQA 3G08A 3V4PL 4JKPH 2Y7QB 4Y4FC 4JFEE 1M71B 3T0XA 5HDBF 4TQEL 5DJYB 1MEXH 5ALBH 5BRZA 4P2OC 4WNQB 4WI7A 4LSUL 4XH2B 5BJTB 5CKAA 4OIIH 4XI5D 3EDKA 3C5JA 3GK8L 1DQLH 4LSTH 1J0HA 4Y5YB 5DVOA 2Q8AH 3A67L 4YIQA 2CIKB 1Q0XH 1YQVL 3K7UA 3MMEB 5C6WH 1AXIB 4LHUB 3LQMA 3RP1A 4F9PC 4KQ3H 3O4OB 4NDMB 5AWNH 1AO7E 1PDKA 1CFSA 5ESVA 1F2XK 3CSYB 4JG1L 4JPVL 3JTTA 3T04D 1KN4H 1KB5H 4JY4B 4IBLT 5L2KB 1RZKH 5F21B 4ZYKA 3W5NA 5DVLA 5D7IF 1PY9A 3Q6FB 2Q7YA 3BEWA 6FABH 1DEDA 4X4MA 4PV8B 3P3YA 4IDJH 3U1SL 4CW1A 1NDGA 1X5GA 4OGAD 4JFHE 1D7FA 4MDJB 2NYYC 1IQDB 2BFVH 2Z31D 3ARBD 1BQHB 1N4XH 4WI8A 5KS9B 1OPGL 5D70H 3GBML 4HHAA 2VMFA 5TQ0H 2BHYA 1GRWA 4I8DA 4ZPVA 1MCOL 2LU7A 2ADJA 4L3ED 3PXHA 1JGUH 2R0LH 1ZT1A 5DJAA 4Y4HA 3CPLA 2DI9A 3GSWA 2JJVA 1TCRA 2QKIB 2FCBA 3LQAC 3CSPA 4EBQL 3SKMB 4RDQG 4KC3B 4EEEA 3CVIH 3IFOB 9CGTA 4JO3L 3QR2A 5DFTA 1BAFH 3WJJC 1X5FA 5ISZB 2FX9H 4J4PC 1HIMH 4OCWL 2EC8A 2MPAL 4XX1G 1I1CA 1WBZA 3BSZL 2NXYD 3P4NA 3F8UB 4LHQB 4YUEH 3VXMB 4PBVC 1NFKA 5CAYB 4QRPE 4N0RA 5CP7A 1FNAA 4V2CB 5HYSG 4ELMB 1J0IA 1KJMA 4ZUSA 5B8CA 2PW2A 5DQ9A 2XWBB 1X5LA 4LKCA 4M5YH 5ETUA 1QSFB 3QUML 2HKHL 3RUGB 4DGVL 4M43L 1LEKB 4CVUA 1KLUA 5HHXL 5FGSA 1D6VL 5TPWH 2VLKE 2GK0A 3BP7B 4JFPB 1DVFC 4MSWB 2NY3C 1YUHB 3LDBC 1K6QH 2EE9A 1GGIL 1WT5A 2JIXD 3W0WD 5CJ5A 4U6VH 1EK3A 2X4PB 4UILL 4JGMA 5DLMH 1C08A 4IRJB 1J8HB 1ONQA 1ND0A 4FQHA 5SV4A 3VWJB 3VG9B 1SM3L 2P44B 2Y07L 5FYKU 4JZJB 3BD5A 1JWSA 4GRLB 2EYSB 4QF1A 1F8TL 5KZCB 2CUHA 2R2CA 2AJXH 5EBGA 1FVEA 4X6BA 1DBJL 3GMOB 5C07E 1MFCH 5LWYH 4V1DD 4WI4A 4FXGB 4G42A 2FO4B 1KGCD 3VCLA 5IMOA 4OI7A 3CFBA 3LRSA 4RGMC 2YR3A 1CDGA 2ZOLA 4YHNB 1CLYL 2FEDD 3V6FB 1JZ7A 5HYSB 5L2KE 5IROA 1NGWA 3P4OA 3C5ZB 1WBYA 1AXTH 4XCEA 1R3HB 5I15H 1C5CH 1T5WB 5JDSA 2DQUL 3UJIH 3UTZA 4TSBL 2I60H 4S11A 1N6QL 1ORQB 4Z7UA 5ITFA 1R5IA 4AENA 3FQXB 4I3RH 2QLVB 4JRYD 4UU9B 3U0PB 2ZCLH 4Y4KD 1INDH 5C08E 1N2RB 3LKNA 4PS4H 2F74A 2VAAA 2BY2A 4DUWA 1DANT 3QPQC 4LF3A 1FFNB 3MLTA 4NC2B 4OCRL 3V4UL 3VFSB 2C1PA 3PP3K 4MXWL 2XQBH 4KUCD 2EDRA 3NCBB 4PR5B 3QT2A 5CJXA 2BERA 5GS2D 4RGNB 1OSZA 2DF3A 5I75B 2P7TB 1RZJH 2XN9D 5ID0B 1CICA 3QHFL 4F7MB 4XCFH 4GAYA 1E28A 2XT1B 2VJXA 2SEBB 1MJ7L 3FQRB 3CZFB 1JI1A 5IW6A 1MVUB 3IFPB 4N0CC 3ARUA 5AZEL 4AEHL 5I16A 2IG2L 5K93A 4HIJA 4R4FL 5DEFB 4MLIA 5I18L 2ESVA 3ZSSA 3MRDB 3CFKA 2KPNA 2PXYC 5MEPB 1CE1H 1QRND 3EUUA 4F7EA 1Z0MA 3ALXA 3BIKB 3MRLB 4O5LL 3MSPA 5FYKE 2R2HB 4DWHA 5JQ6H 4GSDH 5EPMA 1CG9A 1KB9J 4Y19B 3TNMA 5DRZB 3QI9A 4Z77B 4NQDB 4UV7L 1NAMH 2VH5H 2VXTH 1K5NB 4PRPA 2GJZB 4XPAH 1DLFH 1YMMD 4K9EC 4QHLB 4G5ZH 5BVJA 4K7PX 3O3DA 2I9TA 4OFIA 3SE8H 1XGTA 3MX0A 1FLTX 1A1MA 2R23B 5AZ2H 2HG5B 1FAIH 4N9GA 3GRWH 1QBAA 4PREB 1PBYA 4E41D 1Q9OB 3QJFB 3HE6B 3L3HA 4P2RA 4H1LG 3MLVL 3QCVL 1QSED 2AABL 1PJ9A 1QACA 4KROC 4XRCA 5JXEC 4PTUB 1ZHKB 4PJIA 1FNEA 3RBGA 4YDIL 4BZ2L 3N1QC 4G7VL 5F7MC 1TETL 2WW8A 4IIQC 4Z0BH 4XX1E 3HC0B 3ZE2F 3G9VA 4LP5A 4O2EB 2DWEB 2O26U 3D0VA 1BBDL 1WLHA 1FL6A 1ZGLM 4X6DA 1E6OL 2ERJC 1D5IL 5J12B 3D2UB 5HHOE 4R0LC 5H37H 3S97C 5GGVH 3IDJB 4KV5F 3BT2H 2FZ3B 1IQWL 3P0VH 2Q76A 5B38B 1JV5A 1HILB 5MEOA 5C0FA 3DRTA 2ADIA 2EDBA 4JFQA 4CADB 1MH5B 1IM9D 1JF6A 4D0BB 4RMSA 5D9SB 4CDHA 4OFKA 1I7TA 4MA8H 3F58H 1L7TH 5BZDA 3MYJA 5LQBH 4CGTA 4RX4A 3CZJA 4WU5A 1M7DA 1OVZA 5TFSL 3HPJB 4U2YA 5E8OA 1P2CB 1PFCA 3IDNA 1KCRH 3N9GL 2DTML 4H1LB 1K8DB 2Y72A 5D2LE 2ADFL 4MWFA 2A6JA 5F44A 1U8HA 3MC0A 1BREA 3CFEA 1RIVH 3IDXL 4WW1B 4R90H 4XP6H 3T8XA 3W2DH 1FLRL 3V6OE 3S35H 1J12A 3EFDH 4FQQA 3TZVC 1I8MB 3BWAA 4AYFA 3G6JB 2EYRA 3MJ9A 2NY4D 4BH7B 4RISH 3FQWA 1QFPA 5DRWB 2FLBT 3ZYOA 1BP3B 3O8XA 4PJEB 4I77H 5LXGL 4Z7QF 3SY0B 3LB6D 2J8UA 4JFED 1J0KA 5AG9A 4WHDA 2WNGA 3VFVB 3NCYP 4GJTB 1DUZB 2NY6B 1R3KB 3F7VA 5E5RB 2NTFB 2QV2A 3PP4H 2EXYD 4JVWA 4UV4L 3O4LB 4QRUA 5CBEB 4X98B 1Q8MA 1CL7H 1FRGL 1TJIH 1JF1A 1U8KA 3IDMA 3X17A 1J1OH 5T1DL 4O4YH 2OCFD 2DQDL 3OR6A 4PGJA 3WUWA 4BYHA 3DOSA 2XKUA 5EC1A 4RIRA 5DUBA 5I17A 1F02I 1T5XA 3KS0H 4EDWL 5GIRB 5FYKL 1A4JA 4HS8H 1NPUA 3A6CH 4KRPC 4QWWC 1AO7D 4WEMB 1FZOB 4X80L 5DVNA 1RAMA 4N1CA 5C9JA 1WFNA 4LLWA 5HGAB 1I8LC 1U93A 4XMLH 2NCMA 4G6KL 1II4E 5IHUL 2R4RL 1MPAL 2AGJL 3VXQB 4FQJH 2DI8A 2VLRA 1KXQE 3HS0B 3FT4A 2MCG1 1Q9WA 4DFHA 4D9LH 2OR9H 4XNXL 3SHSA 3S37X 1J9CT 4JFHD 2YUZA 4N8VG 4K07A 1FPTH 2EDTA 3X14B 5J9PB 3TVMC 1EMTH 4BSWB 3HB3C 2WUCL 1NC4D 3TM6A 2A6IA 2C4XA 1CFQB 1VFAA 4LPUA 4XNQA 3MLRL 4R3SB 2CDGA 5MP6L 3MGOB 1CDIA 4F9LC 1ZEAH 1ZT7A 1KIRA 2NXZB 2Z0BA 4I4WA 3JV0A 3OB0K 5LAXA 4U6XA 5I1HH 5ITBH 4FZEL 4DKEH 3KPMA 4LKXA 2I25N 2W60B 4WI6A 4KVNL 4RQQB 1KEMH 3IFLH 4POZD 2IMMA 4ZAKC 5GSRB 2W65B 3AY4A 3D85D 2WV3A 3VI3F 1MFNA 2JB6B 2FL5B 3W11C 1IAIL 2EDEA 4NHCL 3VXRB 5FUCE 3IB4A 4KK6D 2B0SL 3QHZL 4PJ8B 1JHTA 3Q1SH 3BVNB 2YWYA 2X40A 4QRPD 4QOKE 1NCUA 5CJOL 1PQZA 1FFRA 4JFZH 1OAZL 1SYSB 2A83A 2YPLB 4HWEH 2Q7NA 4M7ZB 3VXPB 1FZKB 2OYPA 1UKQA 1YY8B 1LHZA 4RAUA 4NPYB 4YX2H 2Z4QB 2VYRE 2G2RA 4PRIE 2YXFA 2VLKD 4N8VB 4MJIB 3TO4D 3GSVA 3WD5L 4YHZH 3PP3H 2CLRB 4I18C 1XGPA 3S34L 4P5MA 3BPLB 4OF7A 2NW3B 1HHKA 1AP2B 4NFDA 1RVFH 4KHXL 3MRJA 4KJPD 1U8IA 3BH9B 4YDKL 3D25B 3BP6A 1V3LA 1U0QA 4HBCL 4BFIA 5BV7C 3QIWB 3OKDA 1IZJA 4AQOA 1H5BA 4X0KA 3RWHB 2GFBA 5ADPH 1ES0A 3PWNA 3HE7C 1BFOB 3RGVD 2J8OA 1NBZA 3K0WA 5TDNB 4G9FA 4H88L 1B0RB 2BOCB 1GC1H 3W39B 1G7PB 4TNVK 1NGQL 4MVBD 1JPGA 2FSEA 5C07D 1WWCA 5IJVB 4XC3L 3ARZA 3HPLA 4HH9B 4XB7A 4OGYH 3IXTB 1QLRB 4R26L 1AR1C 1G7QB 1MJUL 2EH8H 3G5XB 4JY5H 3FONB 5C70A 4TSAH 4LLYA 3BRDA 2X4OB 3MV8A 3ARGD 5GGRY 7CGTA 5DD6B 3WHXB 5FB8B 1N5YL 2AV1A 1I1AA 4KKBC 5L2KD 5I76B 3SCMA 4PJBF 3V4VL 5F1KC 4OM1L 2XPGA 1BZ9A 2AXHA 3ARFD 4X99A 4L8BB 4MQXC 1XCQA 2EO1A 3OJMB 1JCKA 3H9ZA 3T08A 1I8IA 4F80A 4I1NB 1HQ4B 2HKFL 3H7BA 5DHYB 4YHOH 5C08D 3S96A 3VFMB 2MQ3A 4UTBH 4FQIL 5L7XL 1D9KA 3IU4H 3KLDA 3SGEH 4K8RC 2X4NB 5TE4H 4F57L 1JZ8A 2APBA 1KIPA 2I07B 5TGBB 4M7KH 5CEXB 1BLNA 1N5AA 1YN6A 1GGTA 1IAKB 3H9SB 4TVSa 3MUZ1 2GSGB 4YXLL 5E7FA 2OI9C 3UBXG 3LQZB 2FWOA 3GDBA 1PG7H 4MAUH 4OJFL 1WV7T 2NLJB 3ZHLA 5IR1B 1RJYB 4XCYA 5ID1A 3LZFL 4IRSB 3V5KA 2BVPB 1LE9B 4K3JH 2WP3T 3OPZH 4M61A 2CD0A 5DD1L 5DJ6B 3Q5TA 1S3KH 2X5PA 1PY4A 3LH2H 2FX7L 4GBXB 5JR1L 2OL3B 4KGJA 4UT7H 4X7TA 3VXRE 4PRHB 1RQ5A 4U31A 3FMGL 3T1FB 4NJAH 3LVEA 4XBEH 5E24E 4TULH 1KV3A 4M6MH 5DWUL 3SE3A 5IMMA 1ETZB 3H0TA 4IM8A 4ONHB 4WEBH 3MUHL 1UWXK 4HMDA 4FABH 2H41A 2FDBP 3QWRD 5IB1B 1JN6B 3EOBA 3X11A 3GJFB 2FR4B 3SN6N 4PLKD 5FYKD 1CR9H 3D39B 4EOWL 3NCEB 1JYNA 2Z31A 3ARBA 4ENED 5A16A 5HBBA 4QKXB 2G5BA 5EZIL 4GQ9H 5GGSB 3WJLC 3PV6B 4WTZA 2O5ZH 4PJCE 1F4YL 3KYNA 3MLPA 3O6FB 2DQCH 4L3EA 2R0KH 3L3DA 5TDOB 5HDQH 1HH6B 3ARWA 4EN3D 4OCYH 3UEZA 1AHWB 1UB5B 1NCWL 3D0LB 1HHHA 5JHLH 3BH8B 2HLAB 3BO8B 4OIBA 3LS4L 5CWSB 1GGYA 4FG6D 1B0GB 5DRNA 4XNMB 5E8DL 2BC4B 4M7JH 1OD9A 2MTPA 3R06B 2H45A 2PYFB 3RPIB 4MAYB 4RRPA 4UMGA 3TYFA 3MRPA 2W9EH 4OGZA 4GAGL 3DIFA 1JK8A 2IPTL 4ORGA 3FTGB 1E4KC 3I6GB 4GXVL 4OD2A 3Q5OA 4LMQE 5I9QC 5GZND 1MJJA 2F19L 1X5JA 3BHBB 4QHNB 3HMWL 3UO1H 3EJYD 4AEIL 3FO1B 1FVDB 2AAVA 4M93B 2GJJA 1RMFL 2YRLA 1MFBL 3QDJE 4F7TB 3BXNB 5EG6C 5F89B 1UB6B 3WIHH 2AJZB 1IC7L 3D48R 1FGVL 2OTWA 3O2VH 3BMWA 5HHOD 4CVWA 1KBGH 1F4AA 4KZDH 5JXAL 3ZTNL 3BGMB 4NM8L 1BBJB 4MNGB 1D5BB 1J7VR 5E9DB 4LGPB 5JOFA 5CINH 3TYGL 3S9DB 2O61A 4MNHA 2JIXA 1CZ8L 4A6YA 3W0WA 1UM5L 4UDUB 1Y18B 4Z8FL 4L3CB 1KN2H 3VDBA 4R8WL 2B4CL 3FQNA 4NO0D 4PJDB 1TQBC 3WV0A 5JPMB 1A7PL 1CK0H 3NZ8B 1AJ7L 1CLCA 4WU7B 2DM4A 1T2JA 4RWYL 2CR3A 3VRLE 4U7KA 4XTRD 4I13B 4Y1AE 3SKJH 3MRGA 3RQ3A 4D94A 4HKBB 5ELIA 3IJHB 5INDB 2VISA 4PJ9C 3MRNB 2X9XA 3LQAH 4V1DA 1WWAX 2Y5TA 5L9DH 1ACZA 5FUOH 1PZ5B 3QZWG 1NC2D 3FAWA 4I2XE 2IH3A 1EFXD 5GQBA 4FOMA 3EYUH 2FGWH 3ZHKA 4O51A 4QT5B 4EIZC 1WJ3A 1LO5A 5FHBH 1JNHB 3DMMC 4K3EH 3KPQB 4ONGH 4MCZB 1ZVSA 4P9HC 3MRCB 2ITCA 3FFCE 3NIDE 5T1LB 3S88H 3B8SA 3L95A 5BMFL 1LILA 4TUKL 3TNNB 4X8XA 2C3VA 5D1ZD 1NAKL 2P45B 3GSNL 3OB0H 4R6UA 2OJEA 5AAWA 3TN0D 3QIUC 4RMQA 4LSPL 5IW1A 3BE1L 4JRYA 1I9IH 4Z76B 4KI5C 1HSAA 5AD0B 4Y4KA 2YUXA 1ZANL 3AXLA 5SX5K 2FECL 1AIFB 1BQLL 1CIDA 3T0EC 2YEZB 4ODWB 1CF8L 32C2B 3UPCA 3F7PC 3P77A 1OAKH 4NO3B 4Q2ZA 4FTVB 3JV6B 1FORH 3U36B 3PWUB 3GB7B 5F7WC 1U95B 4ZFZB 1F13A 3RNQA 2FD6H 4NC1C 5J11B 3IKCB 4G43A 3MLYL 4KXZH 4OSUH 2AQ1A 3MRRB 4P2CG 3WNKA 2VABB 1CU4H 1DBKL 2P8MB 2PTTA 1TTGA 2XN9A 2JCCA 1XF2A 3DX6B 1EXUB 3HE6D 4CN4A 1W72A 3OKKA 1B2WL 2EH7H 1EFQA 3N85H 4BUHA 5KSVB 4UQ2B 5JW4N 3NCFB 1C7SA 1YQ2A 2VB5A 5IVXF 3QZWB 4G6FD 4GMSL 3FB6B 5GHWL 3BUYA 4NO2A 4X6EA 1F6LL 4LVHC 2ICWB 2I27N 4HF5L 4NN7C 3U46B 5TE7H 4I3SH 1NCDL 5EOCL 3RDTC 4G8FA 1QRNA 5T5NG 2R8SH 4WV1A 3CH8A 4JANB 4ZTOL 4Z5RA 5JORB 1P5UA 5HGHB 2XWJA 5GRXG 3MRIA 2UUDK 4MZ2A 1QFWH 5L2JA 1JYWA 1J5OL 4YE4H 1D6EB 4ORZC 5B4MD 4MXVF 1T21B 4JO2H 3WE6A 4OLZL 2BCKB 5ENWB 1FZJB 1CD9B 3OKNB 2VIRB 4UT6H 5FGCE 1GYAA 3O0RL 2V5SA 1YMMA 3T1WA 3QUKA 2VN7A 2E9IA 2X44D 1I9JL 1QZ1A 4GG8B 1G84A 3DURA 3E8UL 5CFHA 4C56E 5EOQH 3FFDA 4P4RA 2Z93A 2AEWA 1UJ3A 5AEAA 4JJHA 1P84J 3GIVA 2ATKA 3NTCH 3CX5J 4LDLB 4XNZB 3SBWA 4E41A 1EH9A 2X1QA 1ZT4B 3RL2B 2D0FA 1QSEA 2CK0H 3OAUH 1KCUH 4D0CB 4QOKD 4X4XA 1G0DA 2IC2A 4IOIB 4R4NC 3TBYB 3NA9H 1I85A 4ODTH 4D0DA 1TPXB 4KDVA 1XGUA 1BWMA 5DK2A 2OXGA 2QSCH 4NRXB 3TEUA 1OARH 5DK0A 5FK9B 1NANH 1QEWB 4TUOA 1TLKA 1HSBB 3QWOA 1A7RL 1ZS8B 3SDAD 3B6SA 3VGAB 4DN4L 4PRID 1QFUL 4L29B 4ZUVA 4OQTH 3AVEA 5CSZB 1MCLA 5I8EB 1PGRB 4XXDB 3EJZC 5ERWB 4NKDB 5BQ7A 4H0IA 1Q9LB 3DXAE 5IQ9A 4OLXL 3VD7A 5C6TH 3EO1A 3U7AA 3OR7A 2NY1B 3TP4A 1QA9B 1VERA 4PJXB 1YPZB 2OL3L 3BGFC 4GG6B 1OAXL 4UB0L 2YN5A 3MREB 1IM9A 5KJRH 2O5YH 2A77L 4HJGA 1OGAE 1MCKA 1XIWD 3JWOC 4BK4A 4B53A 4MDIB 4JDTH 2B5IC 3FZUD 4YNYB 4HX1B 3LIZH 3R1GH 3VH8G 4BKLA 4K9EH 5DSCB 4LPXA 3HG1B 3VGGA 1YYLH 3E3QE 3OGOE 4EZMA 1UWXH 4XBPA 2X4TA 4P5TB 5HXMA 5JW5B 4Z7VB 4K71C 4ZUTB 3HI6H 4HG4K 3LN5A 5D8JH 1R6VA 4G7YH 3B8YA 3LMJL 5E6ZA 1U58B 3LN4B 2DMBA 1TZIA 1WF5A 5H35B 1KB5A 1Z3GL 1A6PA 4D8PA 2BZDA 2F9BT 3MOQA 3QNYB 1CGSL 2DDQH 1KJ2H 4P5KB 4QRQB 5E2TH 1Y0LB 4PJAF 2KBGA 3W82A 1J0ZA 2ED7A 4LGRB 4I0CC 4RFOH 3E6FB 3LRGA 4HDIA 1F3RB 3DUHA 1BMGA 2QQQA 2AJVH 2APTA 1CGYA 4R4BB 1NL0L 1HN1A 5B8CC 4FQXC 3UDWC 5I1AB 3SGJA 4KZEH 4AY0A 3ZDZE 3CMOL 4JFEA 1R3JB 5EZJB 4LVOC 4E42A 5J1AB 2ZNXA 2WINA 4I0PB 3NN8B 3WKML 4YC2C 1WZ1H 2IAMB 2VDPL 1FN4B 4XAWH 4J6RH 4N0FA 2J8HA 3CU7A 2NX5B 4NKMB 3P0YL 4NSKA 2F54B 4HWUA 1NSNL 1WT5C 2VWEC 5E08H 3AS1A 1WVZA 4U49A 1RIUH 1RK1B 1CFTB 1MAJA 2HFGH 2BVOA 4QHKJ 2WAHA 5EO1B 3VH8B 1I1FA 4A2MA 2K7PA 4GUPB 1AO7A 3VXRD 3L7FB 3V6ZB 4FFYH 1OP9A 2OMNA 3NCYS 5D72H 4KUZH 4TOYH 1FIGL 3WXVL 2QADD 4YO0A 3L3OB 4K3DH 1A2YA 5MEQB 3CX2A 5H37G 3OKOA 1S7WB 5I0DA 2F5AL 3MV11 5BCAA 2HH0H 5GGQL 2IQAA 5TE6H 1V7NL 2R0ZL 5LCVH 2B2XL 5KTEH 1L9NA 3QUYB 4NQCB 3OAZK 1NAMB 5DJ2B 4OD3L 2HN7A 1VGKA 1S7XA 2J2ZA 4DK3A 1NC4A 2ZWLT 3EBAA 1E4XL 5IROC 2X1XR 4HFWB 2C1OB 4NO5B 5E4EC 3D1MC 5DJZA 4RMWA 1RZ8A 3VFRA 4YR6B 1DL7H 1FYTE 2ZSVA 3TPUB 1FGNH 1GGBL 4U6HB 2DKUA 3ECBB 2A6DB 1ZWIA 3RWGA 2EC9T 3D85A 1C1EH 2VR9A 2Y36H 3MBXH 2R1XB 4YK4B 2C3XA 3IGAB 3FQUA 2J6EH 1A9EA 4KMTH 2Q8BH 2EIDA 1FL5B 2OTUB 3GI8H 5GRUH 4XPTL 5IEKB 1ORSB 3LV3A 4Z7WE 4AQ1B 1KT2A 5J6HB 4QRPA 3BI9X 4F33B 3NPZB 1R0AL 5ALBL 3S98A 4X4YA 5I8CA 3HZMB 3CCHB 5DD3H 1UWEH 1CICC 1EEYB 4YZFF 2X1PA 2NMSA 3QDJD 5K9OA 3EYFA 2IH1A 5ADOL 3HZVB 5SX5H 1DQLL 4MD5A 4MA3B 1S9VB 2HLFC 4ZODA 3BEVB 4QRSB 2Q8AL 2QQLL 5IIEA 1HNFA 1Q0XL 4YBQD 2LQRA 2VLKA 3FRUB 3TO4A 3X12A 4PY7A 1A8JH 5AWNL 5LVEA 1FJ1A 1UENA 3WYRA 2RCSH 2IANE 5C0JA 2ZUXA 3GMLA 4S1DD 3DETD 2BNQB 2VQ1B 2H2PD 2I9LB 3W81A 4HCRL 1S7QA 4PJGE 6FABL 1VSCA 2VO5A 1M71A 4M8VA 5KS9F 4JPWL 4MLSA 3GMPA 3RGVA 2BDNH 3EYOA 4NKOB 4Y1AD 2DLGA 3TFKD 5JQHC 1EJ6A 1UKTA 1HYSD 3HI5H 1CIUA 1N4XL 4GKZB 5JW4Q 5D70L 2GTWB 4OT1H 1WBXB 15C8H 1L4IA 3BYYA 4S2SA 1DQQB 5C07A 2AJYH 5TQ0L 5DD5H 5HSFA 3MNWB 3G9AB 4ZFGH 1JJUA 4LLQB 2CGRL 2ZCKH 4H5SA 3ROLA 1QO3A 2XTJB 4LIQE 2BMKA 4DAGH 5JHDB 3LRHA 4Z7OE 2AXGA 3MFFB 1MIMH 1JGEA 3E0GA 1ZLWK 1L0QA 4NQXA 3CSYA 5IBTH 3ARGA 2O93L 1XF4B 2B1HH 4JY4A 3FFCD 4U1NB 1RIHL 2UUDH 3QUZC 5L2KA 3MBEB 5GS1A 3CVIL 2FHFA 3B2UC 3ARRA 1KULA 3VDAA 3ARFA 3C2SA 1RULL 1T1YA 1P7HL 1Q9KA 1BAFL 4U1MA 4M6OL 5GJSH 1YYMH 4F3FA 4JREB 1DQDL 4ZTPL 1UA6H 1ZTXH 2F58H 1AGFA 4NQCE 5C08A 2H32A 4W4NA 4YUEL 4WIQA 3RWIB 4MX7A 4ELMF 1S8DB 1E4JA 1GOGA 4WW2B 3CXHK 3LPWA 4HIIB 3TJHC 1J1XH 2B20A 1EO8L 3PWLA 4YHPB 3U48A 1DEEB 3RUGF 1PSKH 2AJUH 5IWLA 3HZYB 4M5YL 1CS6A 3NOIA 4JRXD 1R24B 1NUNB 5C0IB 2V5RA 4BFBD 2OBGA 5BV7H 1MHHB 3DHMA 3OG4B 5TPWL 1LO4H 1AQKL 5DA0B 3DV4A 3QPQD 1MIEL 4P2QD 3ABZA 1MFAL 3QFDA 2FEEL 2DM3A 1FNFA 4EUPG 3QIBD 5JLZA 4Q6IA 2VSDA 1KG0B 5T1KB 3MV9D 2NW2B 3HUJB 1OTUC 5J06A 1S7RA 2CLVB 3MXVL 1TVHA 4FXKA 2ZG3A 2QR0B 4Z7NE 3EZ8A 5D1QD 3IDUA 2WIIB 4EI5D 3OV6A 1PEWA 3TPKA 5HYQB 5BOZG 5JZ7C 2OP4H 3PDOA 1YY9D 1CE6B 2HFEB 5H2BA 4H8WL 2V5YA 4GOSA 5IFJA 1G7MA 1JNNH 3QWRA 2WBJD 3NA4A 4U1SA 2DQHH 2BSRA 4G9DA 4NIKB 5T3ZE 1AD9A 1Z9SA 3ULUF 1UCBH 1FV1B 4X6DF 3O3EB 3VD4A 3RU8H 1QR1A 4XAKE 1ED3A 2P24B 3SJVE 3B9AA 2H8PA 5DHXB 2X70A 1A4KB 1JGVL 5EBMA 1MRDH 2F53B 1XEDA 4OUOA 4LOUC 4EN3A 2VLJB 5CGTA 4ONFL 3WSQH 5HI3D 2Q86B 4X6CE 3ES6A 3MO1A 3EFFA 3GO1H 4UT9L 3O8XC 3MGAA 2E8YA 5CZKA 4C56D 2QSQA 3MA7B 2R2EB 1XZ0B 4U7MA 4K8RH 1PYWA 5EBWB 3WL9B 2FNBA 4M1GL 4S1RL 1M05A 4TPRL 3QUXC 4PJFB 3CFJA 1UZ8B 5KG9B 2YD4A 1KFAH 3I2CH 4KMLB 4HUXB 1HH9A 2APFA 4NT6A 4ODVL 2FJHB 2HRLA 3GMOA 3UPRA 3JVGA 2XKNA 4EUPB 4FXGA 5TF1L 4TUJA 3V0VB 1F58L 3NPSC 4X7SH 2XTJE 5LGHH 3ZKXB 4CU6A 2DMCA 2JE8A 1VDGA 3QA3A 1BD2E 1NUDA 4YHNA 4JVPA 4Z78A 3KWWB 2NTSP 3HMXH 4KK8D 3VFNA 3REWB 3UTQA 4ODUA 3U4BH 3HFMH 3V6FA 5JXED 4DW2H 5TQ2L 5IG7A 1YMHB 1RZJL 5FA3B 4Y16B 3SDXB 3PJSA 4N1EA 5IMLB 4QTHB 2AV7A 2CDFA 3C60B 5HHOA 2ZCHH 3RBSA 2ARJQ 3GI9H 4UUJB 3H7LA 2V7NB 1EZVX 3DXAD 1CVSC 1NFDB 4LIQL 1CFNB 3WXWH 2VR5A 4GMTL 4MB4A 3ZE1E