1U8LB

Crystal structure of the hiv-1 cross neutralizing monoclonal antibody 2f5 in complex with gp41 peptide dldrwas
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
235
structure length
227
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTTLFGVPIARGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGAAAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLQTYTCNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY 2F5 (LIGHT CHAIN)
publication title Crystallographic definition of the epitope promiscuity of the broadly neutralizing anti-human immunodeficiency virus type 1 antibody 2F5: vaccine design implications
pubmed doi rcsb
total genus 38
structure length 227
sequence length 235
ec nomenclature
pdb deposition date 2004-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8lB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u8lB01
1Q0XH 3O3DA 1QFPA 4PBWD 4J3TA 2AI0L 4NM8H 4X6DF 2BNRA 5BS0E 4JFDA 1MCIA 3Q2CA 5D7LB 4I2XA 3I6KB 3CFJB 2NY0D 4IRSC 1AHWC 3MJ8B 3BWAA 1OTSC 3MV11 3VFWA 2VAAB 2Q3AA 4TNWF 1XF2B 2JJTC 3OHXA 2DM3A 5EB9A 1NANI 3T09A 4WW2F 2WBJD 5CHNB 3RNQA 4Q9RH 2QSCH 2WMPA 2Q6WA 3U83A 2Y06L 12E8L 2FNBA 1CXHA 3PWUA 4XP9L 2R2HA 1H8NA 5T1KB 1PEZA 1EAPB 4L3CB 5D1QD 5DQJB 1XF3B 1AXSA 4KMTH 1BZ7B 5F7DA 5ICXB 1LO0L 2EDTA 4MXQD 2CLVA 4J8RB 3UO1H 1XGTA 2D0FA 3UTZA 3HE6A 1I7TB 2RB8A 3NCJL 1H3TA 4WV1A 4XTRD 1P2CA 2LVEA 5IR1B 3B9KC 1FPTL 4PYGA 4WUUE 4X4MA 2BRRL 3UAJC 4UDTA 3S37L 2YUXA 5GS0L 5DTFA 4ZYKB 5DMGD 1I1AD 1NGXB 5BZWB 1TQBC 3PWJA 4YH6A 3IJSA 4P4KC 3GSUA 4FTVD 4OGXL 2XTJB 4ALAL 3SY0A 4BFIA 1KPVB 5C0AB 2P5WD 5A1AA 1FP5A 4U1NB 3FOLA 1IZJA 1QKZH 5KVFH 5E1HB 1KEML 4HS6B 2FBOJ 2AK4E 3O3BB 4X6DE 4KKBD 5EU7C 4JJHA 1IEBA 1TVDA 4D9QE 1HXYB 4P5MA 4D9RD 1YY8A 5BV7C 4OUUB 3KJ6H 2YC1B 3TA3B 1OT2A 1M05B 5J89A 4H0IA 2E3VA 1MRCL 4F80A 1CF8L 2Z8RA 3Q6FB 4KTDL 1RQ5A 2Z31C 1ADQA 2IBZY 2ZKHH 3H3PH 5DDHA 2QQNL 3RUGF 4Z7NE 1IKFH 4N0UB 4LCYA 3QFJD 3D3VA 2VN4A 4H20H 4NN5B 2OJEB 4TUOB 4ZDHA 4G8GA 1JI1A 1INEH 5EZOL 1ITBB 5FYKU 3MRPA 4PP1C 1UA6H 1D5MB 5BZDB 4PJ5E 3EGSB 3IDJB 1HHIB 4AL8H 3SE9L 2JTDA 4OF3A 3GJFK 4TSAH 4L8SA 3G6JB 3GKWH 2K7QA 3MV9E 2XZCL 5GSRA 2GT9A 4GRMA 1AH1A 4NP4L 4PRDB 3HZKB 4LSPH 1JGUH 1G7MA 3LIZL 4ORZC 2B0SH 3QQ3B 4CN6A 2E8ZA 3BRDA 4K23L 4JO2L 5C70A 5I73C 5BVPL 1D5IL 2I24N 4KVNH 4JRYD 5EU4A 4D2NA 3FRUB 1KIRA 4IRJB 1LK2B 4W68A 4LF3B 4ONFH 1HINH 2RBLA 3RY4A 5LCVH 4M62H 5IVZB 4Y8AA 5AEAA 3DSFL 3Q1SH 5EZIL 2HP4A 3PG2A 3O8XA 1J05A 4WDIA 3T65A 4Z9KB 1FNFA 5I0ZA 4JKMA 4L9LB 2ZCHL 2WINB 3GMMA 1OTSD 4MDIB 4U2YA 2R4SH 1J1XL 5CD3A 4JFPA 3O3DB 2N4IA 4KUCF 4MQXD 3RUGE 2FX7L 2EYTA 4KH2A 2EEDA 5J11C 1KXTB 1JF1A 2YA0A 4JFDB 4N8VB 3IJHA 5L8JB 3TGXA 1CG9B 2VXTH 2X05A 4KK8D 3O2DL 1AIFB 4HIEB 1C5BL 5D70H 2O26U 2AGJH 1N0XH 4FXKA 1BM3H 4TSBL 1VEPA 2D0GA 1IBGH 3UTQA 1ZSDA 3OHXB 1YY9C 1YC8A 3QHZH 3L95B 4DN4L 4KUCD 1U3YA 3QPQD 4JRYE 3OKLA 3RNQB 3KPOA 5BRZD 3WXVL 5C0CD 1CR9H 5I1HL 4R97C 2C3XA 3QUYA 2DM2A 1NGQL 4K8RC 1AXSB 4XCYA 3B9KD 5F7DB 4N1CA 1G6RH 3H9ZA 1NAML 4WEMB 1P4BH 2AJYH 1AQKH 4NIKB 2WNGA 2X89D 3I50H 3GMQB 3MRQB 3UTZB 3HC0A 1CLZL 1RZJH 3HE6B 1KJ2H 1YEJH 2VXUH 3DXAA 5E6IC 4OCSH 2F74A 5J1SC 4LEOB 5CCKL 3RVXC 2O5XH 4YBQC 4OZGE 2AJUL 5F9OH 5T33L 5AUMA 4HQQH 2CJUH 3VWJD 2R0WL 4ODHH 2I60H 3OAYH 3P0VH 5F9WC 4GXUM 1E6OH 2VWEC 3WJLC 4K7PY 1YN6B 3PWJB 1FDLL 3GSUB 3F12A 3D9AH 5HHPA 1EO8L 4CMHC 2YKLH 3J7HA 4KTEL 1FZOA 3DETC 1DBAH 4O2EA 1VKXA 1FFNB 1UKSA 3FOLB 2VZUA 1RFDL 1D6VL 1NPUA 4AQ1B 1NGZA 2F9BT 1DBKL 3Q48A 2AV7A 2G60H 2E6QA 2ERJC 1JMZA 4PJ8D 5FEBA 1T20B 5C0CE 2MFNA 2Z31D 4KZDL 4EN3A 4ETYA 3S35L 2DJSA 1L4IA 5DVOA 3WUWA 1Q38A 1LDSA 3BP7B 3BGMA 3UJJH 2AXGA 1Z0MA 1CE1L 3X11A 4QWWC 1MFAL 3TVMB 1DTUA 4E9LA 3FO0H 1PQZB 1MAML 5B3JE 5DC9B 2X44D 3C8HA 2HRPL 3D3VB 3MR9B 4PGDA 3DRTA 2AJSL 5EWIL 2MJWA 1AGCA 3HZMA 2R69H 2RAMA 2E7LA 2OXGA 3KWWA 4O9HL 1AE6H 1PY4A 4Z7VF 3EYFA 3TCXA 4NN6B 4DAGL 1MFNA 4HF5L 3MFFB 4JPWL 4HMCA 5HI3C 3H6JA 1CLYH 4JKKA 4X6CE 5DJAB 3K2MC 5E9DE 2VDOH 2ITCB 3E2HC 2XRAL 4PREA 1QO3A 5GGRY 5I6XC 2I9LB 4XC1L 5LXGL 5FCUL 3GDBA 1X4XA 3RWGB 2E6PA 1EUUA 1U8HA 1B0GB 1JHLH 4DK6A 5HYQB 5I66B 1R5IB 4KC3B 3IFLL 4W81A 3FHQA 4ZFGL 5EU4B 1QBAA 3FRPA 5DJ2A 2IQAB 5C09A 3T0AA 1GAFL 4S10A 4POUB 4F7TA 1JMXA 1LO2L 4LGRB 3PHSA 1A22B 3FQWA 3S5LG 1TTGA 4L5FL 3F5WB 3RWEA 1Z9LA 2LU3A 4MD0B 3U0PA 3O8XB 1J05B 4WDIB 3G5YA 3TCLA 5IF0A 2AKRA 1JE6A 4P2QE 1CIUA 1DEDA 3IVKA 4U6XB 4P5TC 1LDPL 3X3GL 5C2UB 3IDUA 4U0QB 5CD3B 5J06A 3VXRA 2XZZA 4JFPB 4KAQL 5IB3A 1INDH 2APTA 5JQHC 1GH7A 1YY9D 3MRCA 4PGBA 5LGHH 3IJHB 5D8JH 3VXMA 1X5LA 3R4DA 2EE3A 4GKSA 5KSAC 4WI6A 1BGXL 4GXVL 3O2VL 5C6TH 3G04A 2VLKB 5F1NA 4WGVB 4JY5L 3QI9C 4KRPB 2ATPA 2ZNWA 3TA3C 2FR4A 5HYSG 1RJZA 2NY5L 1G9MC 1TXKA 2ZSWB 1IAKB 5LWYH 1EK3A 2OTUB 2MPAL 4K8RD 3UTQB 2VLRE 1A5FL 1UACH 5A2JH 5B38A 2O5ZH 4DK3A 4GXUN 5CEXA 3ISWA 4LPXA 2EH8H 4HKJA 2D9CA 3UJIL 3KPQB 3U7YH 4GW1A 3RVXD 1AKJD 1HEZA 3O9WB 4YDJB 1XFPA 4PRHE 2CRIA 4YC2C 4JY6B 1RHFA 1RSFA 1T0MA 4POZC 3RVUC 4BQ9A 2IFGA 3MRNA 3RDTB 4NZUH 1OPGH 4HBCH 2OP4L 3WNPA 3D2UA 4HZLB 2W92A 3SO3B 2NY7H 3DXAB 3FT3B 2HG5A 4AIZA 2ZNXA 1YQVL 1N2RB 3UZVB 4GAFB 5DQ9A 4N0RA 3TT3H 4H8WL 3RVTD 4Y4KD 4JM2C 3T0EA 4HIHA 3B3IB 3F12B 5HHPB 4JEGB 4KVCH 4BKLA 1X4YA 2W9DL 4P2OD 5T1MA 5I1CH 1SHMA 5KG9B 1VKXB 4I48A 1WTLA 1IGTA 3MLVL 1ZK9A 4YHIA 4MJID 1FGNL 1NGZB 2H1PL 1JGVH 4TUKH 4QWWD 4O4YH 5JPNA 3OGCA 3PP3H 4M00A 1O7VA 3WUWB 3BGMB 5EU6D 4XH2A 3U7WL 3NCMA 1OY3B 5EUOF 3VRIB 3I84A 4HKXA 2J8UE 1A9EA 3B9DA 4KHXL 5FDYA 3MRJA 5DI8A 4S1QH 1S7XA 3CMGA 5SWZD 1UM4H 4XCEA 2YZ8A 3T2PA 3BJ91 2KKQA 5IESH 2V7NA 1JZ6A 2CUHA 3IT8D 1MCCA 1QVOA 5M95B 1AGCB 3MLTA 3ROOA 1FRGH 5LKNA 5D6DA 3KWWB 1G0XA 3EYFB 5HJ3A 3IYLW 5IW6B 1XH3B 3IFNL 1KEGH 1FSKB 2PXYB 4G5ZL 1TJGL 3N85H 4Q97A 1VADB 4KGJA 4OT1H 1DBML 1MCNA 3DSNA 3SDDA 3TF7C 4PREB 1QO3B 4QF1A 2FHBA 5FCSH 4QHNA 1ZVSA 1LEIB 4GAGL 1AXTH 4QT5A 3C60B 1ZGLA 3L1OH 3LAFA 1U8HB 2P8PA 3DUUA 4Z8FH 3QWRD 4KK6C 3KPRA 2OS7A 5FYJU 1V5JA 3HE6C 3P4NA 5KVDL 5DJ2B 4QRRA 3T0VA 3OJMB 4WV1C 4K94C 5C09B 3L3JB 2R1WA 3OJDB 2B5IC 3W0WA 1HHGA 5IEKB 3LEVH 4N1HB 5IHUH 1FAIL 3WIIH 4MCZB 5TE4H 1D9KA 3G5YB 1T80A 4IS6A 5IF0B 2DM7A 3NFNA 5FDWB 4JANA 2OR9L 1TTFA 5C08D 3WYRA 4DGVL 3WS6C 1JHKH 4UNUA 3QI9D 2OL3H 3IXTA 3VXRB 5IB3B 2UWEA 2V17L 1V7ML 3O6KH 1BWWA 1J10A 1MJ8L 4QXWA 4LLUB 3MRCB 3DO7A 1GGYA 3RNKB 3RKDC 3VXMB 4PRPD 4GKSB 4E42B 4GOSA 4QYOB 2R0LL 2EO1A 5F96L 3N9GL 4RX4A 1NC4D 1KB5A 1VPOL 2ATPB 4OIBA 2FR4B 2EKSA 4K3EH 4CUCA 1RJZB 1S7TA 4ODUB 1X5HA 4U1JA 3EYOA 1BVLB 2OQJA 4GKNA 4POZD 5GS2D 3SGJC 5CEXB 3QRGH 4ODWA 3ZT7A 2BNQD 5AYQA 1BZ9A 2YUVA 4OSUH 1HEZB 4ZAKA 4FXGB 3LKNA 1TVBA 5FKAA 5LQBL 2X4NA 3MRNB 4O02H 4NN6C 4FHBD 1CGXA 5HGBA 4L8SC 1CL7H 3PWNA 1J8HA 3ARUA 3GRWA 5HPOA 4FQCH 5DQ9B 1U95B 3HE7A 2Y7QB 5IVOA 3STLB 4X8XA 5F3BA 5IFAL 1NFKA 4HIHB 3A0OA 4CU7A 4PRPE 4JFYA 1DLFL 3E1F1 4YE4H 3GSXB 5T1LD 3EOAA 4R7DB 4APQA 1E28A 5T1MB 5EPMA 1RIUH 4JQVA 3IGAB 4JR9L 4CVZA 2EDRA 4I48B 2W0FA 3L3DA 3U30B 3PHOB 2HKFH 2CLZB 3LKPA 3HZVA 5FUCE 3T04D 3W2DH 1A14L 2SEBB 1P84J 5E03A 4OM0H 1PD6A 2EH7L 4PJCF 2VZ1A 3MNZB 4C54A 3O8XC 1KCUL 4WWKA 1QLFA 4YJZL 4CBPA 1CGSH 4Z7UF 3I2CH 4O00A 3GBNL 4PJGB 2D3VA 3LB6C 4L9DA 5C0FB 2C4FT 2Y5EA 1J18A 4BQ6A 4M9OA 5DSCA 4MWFA 1E4WH 2EDFA 3QUMH 1QSFE 2FLBT 5E2UL 3R06B 3QIUB 1A9EB 1NFDA 5BMFL 1E4XL 3MRJB 1UM6L 1SJEA 2UYLB 5IW3A 1NH6A 4OGYH 3SJVE 1KLFA 5SWSA 2V7NB 4D0DA 1Z9SA 2R56H 3BRGC 1QVOB 4KRPC 3GIVA 1CWVA 3MLTB 2AQ1A 1BIHA 3ROOB 1CT8A 1R3LB 5C0EA 4XGZA 2CR6A 5HJ3B 1SJXA 3TV3H 2DD8L 3BHBA 4XCCL 1F00I 5IMLA 1T04A 1K3IA 4OD1H 5CEYB 3TO4A 1UH2A 4X4YB 3QUYC 2YD2A 4WY7L 4ODVH 1QBLL 3MACH 1BQUA 1S7RA 4QT5B 5FO8A 4E41A 1UWEH 5HHOA 3DUUB 5T3ZL 4WTXA 3SKOA 4JFXA 4UAOC 3T2NH 2QQKL 3K2UL 4WI7A 5JOFA 3P4NB 3VGAB 3CFBA 4QRRB 1J86A 5L2KE 3NA9H 2IAND 1IGJB 5ADPH 2R1WB 1ZHBA 5KJRH 3W0WB 1HHGB 1FFRA 2UZIH 3JXAA 1C1EH 4LCWE 2X6MA 2NCMA 4PJCE 4U1MA 5AZEH 4IS6B 3ARGA 3LPWA 3OG6B 1A1NA 3HNVH 4FABL 1JNLH 4M7KL 1UB5A 5MERB 4FFWC 1F4WL 3IXTB 2UWEB 4LK4A 4PB9H 1FC1A 2J5LB 5CS7A 4M7LL 2DRUA 4KXZH 3UTPD 1Z6JT 3DO7B 1HH6B 2NX5A 3QQ4B 3L5XH 4LLDA 4EN3C 1GOFA 5D93B 1RUQH 1GZPA 5I19H 1RK0A 2N7BA 5MEOA 4NM8L 4LEXH 1CDBA 2EKSB 2YD7A 1UYWH 5C07D 2ORBH 4Y89A 3BE1L 4GKNB 3L7FA 4KJQC 4GBXA 1Q9WB 5DC0A 1R5VA 2GJ6A 3DI2B 2BFVL 5CGTA 4ZFFB 6FABL 5D1ZD 1RUMH 1YEHL 2CIIA 4FQ2H 4Q58C 2DWEA 5GS3A 4I0PB 2PR4L 1F8TH 4YQXL 3O3UN 3SGKA 4Z7OE 4YBLB 4NQUA 2X70A 5EO1B 4ZAKB 4Q9RL 3LKNB 1OAKL 4KZEH 4OGZA 4FFYL 2E7LC 1Q72L 4AYFA 3AS3A 5FYJH 3DX6B 3C6LD 1HE7A 4KMTL 3PHQA 1J8HB 5D2NE 4ODTH 1RJCA 1I3UA 2BSSB 3HE7B 3QEUB 2D7OA 1MCDA 3HG1A 5FECB 2PF6A 3THMH 4JO1H 4BQBA 3WKNA 4DVBA 3ZTJH 4LLMB 3KXFD 4JFYB 5D7IA 1FIGH 4OF0A 4G6AD 4APQB 1BJMA 4TULH 4CVZB 1JWSA 1Y6NR 3AREB 4QXGL 1FJ1B 4S1RH 5IHZA 1EHXA 2W0FB 4J6RH 5JQ6H 5BV7H 1JZ2A 2XI9A 1U92B 3PWPD 4PLJC 2VC2H 4RIRA 5GHWL 4MCYB 3MRBA 1SEBB 1QKZL 5KSBF 5KVFL 4J12A 5D5MA 4OLXH 2W07A 5E56A 4WWKB 5I30L 3R1GH 2HN7A 1UWGH 2EDOA 5C0IA 1BD2A 4JPVH 5KW9L 5KVEH 4WFGD 5DSCB 1MVUA 4Z5RB 2NXZB 5C0BB 1R3KA 4GKZA 5CKGA 1HI6A 1BQHA 1NFDB 3HRPA 3MXWH 5FM4A 4MVBC 2YWZA 1OB1A 1SJEB 4QXUH 3IF1B 3OQ3B 4JZOA 3P0YL 2ZKHL 1C5CH 1MJ7L 1ZHNA 3WFDH 1G9NL 2EDEA 3QULA 1JWUB 3ARFD 3O6FC 4NQDD 2XWJA 3KXFE 1X5FA 1FL6B 1A7PH 1NCCH 4LIQE 4ZO6A 4P23D 4N5EC 5I8CB 4PJEB 5IMLB 4O5LH 4TNVF 1YPZA 1GIGH 2BOBB 1CCZA 4IIQA 2VLJA 1UA6L 4YXKL 2MHAB 4AL8L 1G7LA 4I3SH 4NM4L 2BXYA 3B2UD 4TTGA 1S7RB 5FO8B 2BMKA 1N5AB 4C4KO 3L5WA 3SKOB 4JFXB 5FHAH 2IG2H 1MFDH 5IOPA 1I1FA 3KPSE 5JOFB 4LSPL 4XPAL 3JZ7A 4L3EA 4YHOH 4WFFD 2B0SL 3OKKA 1T3FB 2GTWA 4YDIH 4Q0XH 3LCYA 1SEQH 3PABA 1ZHBB 5MEQB 3GM0A 4KVNL 2ZCKH 1NDMA 4HIXL 5JNYB 4Y19E 4ZOAA 4FFWD 3T0EC 1DE4A 2AEWA 4U1MB 1MY7A 4RWYL 3Q0HA 1A1NB 3MLRL 2XQBH 3KYMA 3QXDA 4IJ3B 3L5HA 1NAMA 1FFPA 3OZ9H 4ENEC 1P7QB 4JFHE 1NBVH 4M48L 2DF3A 4M6OH 3A6BH 2UUDH 4LLDB 4PJBE 4R0LA 3EFDH 1E4KA 1NC2A 3MJ7A 1H8OA 1FZMB 1GZPB 2VO5A 3MA9H 4FQQA 1A1MB 3REWB 3EOBA 3OPZH 3P30H 3RL1A 5D1XD 3SOBH 5DA4A 3WIHH 4XPFL 2VXTL 4ZFOA 1EEQA 5KS9B 3L7FB 4GBXB 2GJ6B 3HAEH 1N5YH 1N0XL 1ZA6A 3EYUH 1BQSA 2NNAA 2Z91A 2JJVA 4HXBH 1U2HA 2CIIB 3DLQR 3HNTH 4PR5A 5HVHB 3ZDZF 3KHQA 1IBGL 3MLYL 4YEEA 5BW7A 3V5HA 4G7YL 2ADJA 3FZUD 5KVGL 1F02I 2X70B 3OXSB 5EC1A 3TEUA 4U1KB 4CVUA 1IM9D 2IGFH 4QRPD 3IDGA 5TGBA 1MCBA 4Q9QH 2D0HA 4P48A 4JZJB 3IB4A 3OAUH 1G7JA 4XP4L 2ZCLH 4O2FA 3WD5H 3LKOA 3KVQA 2D2OA 5E94A 3VXSB 3PHQB 1YEGH 3TN0C 1G6RL 1JYWA 4EKXA 2AJYL 1AQKL 3VGBA 4M93B 3SDDC 1AGBB 3GJFA 1MI5E 5IKCA 3SCMA 1KJ2L 1YEJL 1HNFA 2A6IB 4DWHA 3EYQC 3CFEA 4X6BA 2KL6A 4DVBB 2OMNA 2O5XL 1M7IA 1KCKA 3VMNA 1U3ZA 4W6XB 4KQ4L 3HFML 1EERB 4ODHL 3PF2A 3P0VL 5FFLA 2NQCA 4LCCA 1E6OL 1JWSB 1NBYA 5IHZB 5JDJA 3S96A 2YKLL 2H2PD 1GGUA 2A9NH 4J3VA 2NXYC 1DBAL 4RIRB 4PD4K 4V2CB 4XPHL 5F6IB 2D7PA 1DCLA 2DWDB 1D9KC 1S9YB 3NIFF 5D5MB 4I9WD 3WV0A 3BPLB 3BT2H 2HN7B 1AO7D 3KYKH 4NNPH 3TO2A 4G9FE 3QIBA 3DWTA 2WWMC 4QRPE 1WBZA 2H8PA 1WAAA 3OWEA 4G80B 4LSDA 3UJJL 1MVUB 4FQHA 3O6FD 1BQHB 15C8H 1X7QA 2R4RL 4DKFL 5D7KD 1OB1B 1TQCC 3PDDA 3G5ZA 2FZ3B 1ZHNB 2A9ML 4GG6A 3WFCL 2E7MA 4HS3B 1NCBH 4N9OB 2XPGA 3VD3A 4JFFD 2NLJA 4WENB 1YPZB 1I4FA 4PJ9B 4IIQB 2VLJB 4Z76B 4JQXA 1G7LB 3QEQE 4PPTA 2C1OA 4G9DA 1XIWA 4OZIF 3ULUC 4LASL 1LP9B 2ESVE 1FNLA 2BMKB 5C0NC 3OR7A 3PJSA 4R96A 3IU3A 5ITBH 1U6AH 3MOBL 4PG9A 1I1FB 5I8OL 2V7HB 4G8IA 2CKBA 2FWOA 1XF1A 1D3CA 4E5XB 1YMMD 3OKKB 3RWHB 1FNGA 2GTWB 4PJIA 3PABB 3S4SA 4LLWA 3HE7C 1U8QA 2EZ0C 2P42B 3GSRA 1NDMB 1G7IA 3O6LH 4N0CC 4ENED 4BUGA 3HTLX 2C1PA 1WVZA 2C4FU 1EEYA 5IBLC 3FL7A 3KYMB 3QXDB 4R7NA 4APQC 4KKLC 2B1HH 3NN8A 4JQVC 4J4PA 4XXCA 2FYYA 1IVLA 3WN5A 3AAZA 3C8KA 4WI5A 4D0BA 2WQ8A 4I0CC 1G9MH 2GI7A 1A7OH 2BVPA 4IDLA 3V6OE 1G84A 3MJ7B 1NC2B 4OLZL 5ABDE 3OX8A 5GGVY 4WWKC 5CLTA 2VDRL 1H3PL 1UKTA 1FLRH 3QG6A 1CU4L 1JWMA 3HPJA 4B41A 2YRLA 4WU7A 3H3BC 1G1CA 3I02B 1JNHB 4OLUH 5DYOA 5C6TL 5FYKL 3B6SB 1VGEH 3U4BL 1T7XA 1UGNA 2NY6C 1ZA6B 4HPOH 2NNAB 2Z91B 1I9RH 4WFED 1UACL 4ZPTA 3V5HB 3TN0D 2A83B 4WUUB 3D39D 2CDGA 3NABH 3OJ2C 5C3TA 2EIBA 1GPOH 2O5ZL 4LVOB 5K9OB 2FX8L 2Y23A 3WUZA 4EBQH 5TGBB 3EYQD 2EH8L 1KPRA 1TJIL 3MLSH 3LRSB 5LAXA 3BUTA 4U1HA 3WKMH 3QUXA 4N8VG 3NA4A 2VDQH 2X1OA 3TO4C 3ULVC 4NZUL 2VISB 4KDVA 3SCMB 5I1DA 1FZKA 3ARBB 2VSCA 3BP5A 1M7IB 1Q1JH 4HWUA 3KYOB 2DTML 2FB4H 3TT3L 4G8FA 1WWAX 2L7UA 3GZKA 4FNLL 3ZTNL 3S97C 2EXYC 3NZHL 4HJGA 1JPSL 2X4PB 3KLAA 4U1IA 4J3WA 1V3LA 4RMRA 4TNWK 5I1CL 3C5ZB 4UT7L 1WJ3A 4OI9A 3A6CL 5FO9A 4PIRF 3NFPA 3LDBB 5DT1H 3U9PH 3ARGC 4EDWH 4IJ3C 1MRDL 3TO2B 3QIBB 1BAFH 4OCXL 5H35B 4QHMA 5JXEC 1WBZB 1AD0A 4PJ5B 2B4CC 1NCWH 3S88H 4FQHB 5CUSH 3VWKD 1X7QB 5AD0A 4JFOB 3MV9B 2ZG3A 5C7XL 5FUZH 4HPYH 1TVHA 4N5UA 4P59L 2E7BA 1KYOK 3G5ZB 1HN1A 3NPZB 4UILH 5GS0C 5F8QC 1HHJA 1GXEA 2KBGA 3SDCA 1VFUA 3D25A 3GMLA 4GG6B 3S36X 1R5WB 1S7UA 1UM4L 4NO0A 2JELH 4PJAE 4TTDD 3WDJA 5BOPA 4P4RA 1Y6MR 2XPGB 5IESL 3K1KC 4GBXC 4NQXA 5C0ND 2NLJB 2ICWA 4G6KL 1I4FB 1OT1A 7CGTA 3Q3GA 4ZFZB 1FNHA 2DLTA 1A6AA 3SGKC 1QA9A 1RZ7H 1KEGL 3DIFA 3AB0C 4G9DB 3N85L 4NNXB 4XNMB 3S7GA 3ABZA 1WSST 4K94H 5JHDD 1J8KA 4LSUL 3OR7B 1WWBX 1B2WL 1RURL 3H7BA 4R96B 3DX8A 3CUPA 3ZHLA 3JBG7 4PG9B 4G8IB 2CIKB 1IT9L 4YHLH 3O4OC 5DA0B 3RIFF 3QWQB 1FNGB 1UCBL 1NAKH 4M3KB 3LS4H 4M61B 4LLWB 5EG6C 1H3UA 1U8QB 3GSRB 1GGBL 3CFIC 1G7IB 35C8H 4F7PA 2NZ9D 2C1PB 2HFTA 3QZWB 4LSVL 4YZFF 3CDYA 1MQ8A 1EEYB 5C6PB 3WLBB 1XT5A 3LEVL 3WIIL 5IHUL 1CZ8L 4MAUL 4P46A 4DKEH 4FZEL 2FYYB 5TE4L 1W72L 4YPGA 3HNSH 3C8KB 1EAJA 3GSQA 5F7FA 4D0BB 4XP1H 2COQA 3AU1A 4QNPE 3UC0L 2OLDA 4AM0B 2BVPB 1JHKL 4JFEA 3DHMA 4MNQA 3X13A 1DQJA 2OL3L 1ADQH 2R0ZH 4O2CA 2NY2B 4YGVB 3O6KL 2A74B 2NTSP 3LVEA 5C92A 3S3JA 3QG6B 5JHDE 4PRBB 4BJLA 4WU7B 3INUH 3HA0A 5HYJD 3L3OB 1JYXA 1MCRA 4H1LB 4S1SH 1OP3H 2YBRA 1FVDB 1RIHH 3RZCD 4LFHD 2AEQL 4OZGB 2GSIA 5I1KH 2D03L 3QWOA 1FC2D 4Y4FC 4BQCA 5GS1A 2BY3A 1MH5A 2CDGB 3DX9A 4GRWB 3RX5A 2YPLD 4Y0GA 4D3CH 5JORA 4EVNA 2AJVH 1ULVA 2IADA 2P24A 5TQ2H 4BH8A 4QCIA 1WK0A 5LAXB 5ALCL 3ZSTA 5CWSB 1H9VA 5F7NC 3TFKD 2CRMA 1U93A 1X5GA 3OB0H 4K7PL 4O02L 3BKML 4ERSL 1CL7L 1EVTC 4Z78B 1FZKB 3VXQA 5E2VL 1T7WA 4FQCL 3VXUA 3QDJD 3CVIH 4HH9A 4OM1H 4X98A 4G8FB 5K9JL 1C12B 4L8DA 2ZUQC 1FNAA 4DFHA 3KLAB 1T7VA 1N7MH 4IOSD 2VKXA 3GNMH 4RRPA 3PGCB 3P4OA 5JXED 2XTLA 1MRFH 4BZ1H 5I0DA 1ZHKA 5DJXA 2VB5A 4AH2A 5DEZA 1NBZB 2W9LA 4R2GB 1J11A 2BK8A 4M6NH 3O4LE 4O51A 5FA4A 4RMVA 4MQ7B 1A6VH 1AP2A 1AD0B 2A1WL 3CZFA 1CGSL 4M6AA 1I7UB 4XWOD 5ANMA 5AD0B 3WNKA 5DRXB 2DIJA 4M9PA 2G5RA 2NY1C 4R0LC 2XA3A 3QA3B 1E4KC 3QUML 4L29B 5CKAA 1HHJB 3SDCB 4K3HA 1BVKA 3GMLB 1FYTA 1QR4A 2ENYA 1NLDH 1CICB 4P4RB 4MA8H 3QDJE 4OGYL 5E2WL 2NYYC 3LN5B 5E08L 1IGMH 5CZKA 2O5YH 4RA0C 3Q3GB 3H2WA 4Y4HA 3W81A 1BFTA 1MQKL 5BW7C 1BFSA 4PJ7A 3WUWG 4G6MH 4JG0H 5DJ0A 3RTQD 4PGCB 3MBXH 4LVOC 3U46A 1BMGA 3H7BB 3CUPB 4XBEH 1MNUH 4Q2ZA 4WO4D 2WIIA 3H8NA 4HD9A 5ETUA 5IG7A 3H42H 4NCC2 5L0QC 1G7QA 3KPMB 2NY4C 1DL7H 1ZV5A 3T2NL 4OZHB 4U1SA 4UTBL 3JUZA 3SCMC 4M1CC 4XWGH 3BQUA 4Q6IA 2R1XA 1J88A 1HILA 2X7LA 4F7PB 5ADPL 3K8KA 5F1KC 3W11D 5KJRL 3B9AA 1D7FA 2G75A 4JLRA 4LCCC 3VA6A 5HPMB 3GSVB 4M1DH 4P46B 1BLNA 4DW2H 3SDAA 5AZEL 4F2MB 3GSQB 3UBXA 1AI1H 1I1RA 4MD5A 3GIZH 3VDBA 1RVFL 4MHHG 3DV6B 3T2OA 3HCVA 3CDCA 3EJYC 2D4DA 2MMXA 4JFEB 4L8CB 2W9EL 3EDJA 1DQJB 4OGAD 4X5LA 5DVKA 2VZOA 4O2CB 4PB9L 3SN6N 1JGLH 4R6UA 4RWHA 4XC3H 2R39A 2VDNL 3QIBC 2RCSH 4MAYA 3L5XL 1ZAGA 4G42A 1MCOL 4QHLA 4Y4FD 2OTWB 4NO3A 5HYFA 1FCGA 1A3RL 3JV6A 2P5EA 4RQQA 5EIIA 4YDKH 4P9MH 1CVRA 2Z4QA 4LEXL 3ALPA 3NAAH 4U6TA 1FH5H 4NDMB 5D7LD 4H88H 4Z7WA 5HI5D 1YEIH 5HD8D 2VWEE 4CGTA 4NGHL 4PJHF 1R0AH 1IEHA 3F6LA 4DKAA 5EO9B 4KQ3H 3V0AC 4PP2A 1RUAH 3DX9B 4FQ2L 1T4KA 1F8TL 3AS2A 5B39A 1RZKL 1WEJL 2HMIC 2IADB 1NCDL 3FO2A 4AIOA 4QCIB 1IC7L 1TCMA 3MBEB 4MJ5A 5DUPL 5T1KD 1NMAH 5HHNA 1U93B 5FYJL 4AEHH 5JZ7D 3HKFA 3G5VA 5I2IA 4JQXC 4NQEA 1XIWC 4HWEH 4P2RA 3U82B 3VXQB 1LO4L 4YO0B 3GBLA 3HN3A 2FH8A 3VXUB 4MQTB 4HH9B 3KYNA 5J12C 1S5IH 1IAIH 4WGWB 4X98B 5DD1L 5IJKA 4JG1L 4L8DB 3BDYH 2NY5C 3THML 3WDIA 4EUPB 5J13B 2FECL 1YYML 5T3XE 4X7SH 1FIGL 3MNVA 5HHVH 4HULB 3GMNB 5AG9A 4P0DA 1KJ3L 2GCYA 3UYRL 4TULL 5FYLD 5CZXC 2J8UB 5D7LE 1N59A 2XTJD 1ZHKB 2DQGL 4HS8H 5DJXB 4S1RL 5DD6A 4OKVA 3VDAA 4ZUVA 3MLZH 3OKMA 1I9IL 3GO1H 4O51B 1QPPA 4LKCA 4J4PC 4XXCC 4L4TD 3WN5C 1QLEL 2DKUA 1TIUA 2IJ0C 3TNMA 4CMMA 5L6YH 1NSNL 5D2LA 1TPXC 2X4UA 4UT9H 5DK0A 1UWGL 1JGEB 4YNYA 5HHMD 4M7JH 2VL4A 1MLBA 4WTZG 4NO5A 1RUKL 4U0RC 4X83A 4YK4B 5HDBF 1FCCA 2NY2C 4H8WC 4PJDE 1FBIL 3MV7A 2VLMD 4HEPG 1BVKB 3VFMA 5AG8A 2IALA 3MV8A 5I1JL 4QXUL 1TJHL 2XXCB 4WHDA 4QO1A 4RBPK 4M3JA 3WFDL 3OR6A 1BEYH 1IEAB 1ZWIA 3K7UA 4JFQA 1DVFA 3WL9A 1QPXA 4EZMA 3PGDA 1NCCL 3T0DA 3E3QC 4PJ7B 3EOTL 2J3SA 2IPKA 2KZWA 2A6JA 5DJ0B 2UZYB 1FORH 2Y6SC 5JIKA 3VFTA 4M1CD 1RJLA 4FOMA 2GJZA 4H5SB 5C0AE 5FUOL 4I3SL 3WDHA 5B8CA 4JVWA 5IG7B 1RIVL 1DQDH 3HZYA 2Y07L 3F58H 5GSVA 3QBTB 3RZWA 3QUXC 1AD9A 1HH9A 4PJXE 5MP6H 5FHAL 5TH2B 5KAQF 5HHXL 4XVTH 3WS3A 3S35X 4MB3A 2X4QB 3DVIA 4YHOL 5JOPE 4PRID 4Q6IB 2IEPA 2R1XB 3RY6A 2RGSA 4LSQH 2YK1H 3EJYD 3LKRA 3ARDA 3CFKA 3SBWC 2CO7B 3AXLB 3LQAC 5C0GB 4IRJD 1ZLWH 1BLNB 5D7JA 1KCVH 1S9WA 3SDAB 1A4KA 4JO3H 3LN4A 3UBXB 4MD5B 2PO6B 5DR5L 2F58L 4N0UE 5E00A 3HCVB 3HUJA 5F7EH 1G6RA 4PGEA 3WEXA 1QEWA 5HDBE 3V6FA 1KJ2A 1NBVL 5SX5H 5HY9B 3RJDA 3SE3A 4IOFD 4M6OL 1IQWL 4MAYB 4UB0H 2CXKA 4QHLB 1KCLA 1JI2A 3EFDL 3JV6B 4RQQB 5EIIB 1Z5LA 3G6JE 3U2SB 4R4ND 2QV2A 4F3FA 3P30L 4L8BA 2PTVA 3WFEL 5DJ6B 3SOBL 4KJPD 5L88H 4ORGB 4M1GL 3WIHL 2HH0H 4Z7WB 5MENA 2D7MA 1EUTA 3BIBX 4K8RL 1ZOXA 3QXWA 3SDCC 1CK0H 4OFYD 4PP2B 1IFHH 3HNTL 3QO0A 4ZUUB 4WHCA 5I74B 4TOYH 2C3WA 2H32A 3SGEH 5EUKB 3O11A 2PTTB 2VXSL 2BDNL 1A3QA 4HGKC 3V0WH 3WO4B 2YD5A 2IGFL 4MA7H 2GTZA 4ZNCD 4DGIL 3CNKA 2PUQT 2FD6L 4Q9QL 3H9SA 5I2IB 4R8WH 2ZCLL 4A2LA 2A73B 3MV01 2X9YA 5MEPA 2ED9A 2ADIA 3CU1A 4OFVA 1YQ2A 1KGCE 4S1DD 5L9DH 5E70A 1GOGA 1OAZL 3ZYJA 2M26A 4L1DA 1SVZA 2QR0B 3MXVH 5J56B 3S98A 1L0XA 3MRGA 3VDCA 4X6FA 4ISVA 3LKQA 3PL6D 2MWCA 3MNVB 2BNRE 4JFDE 1N6VA 3RVWC 1U3HB 4JRWA 2XNAA 4IDJH 2GCYB 2R23A 3JVGA 4MXWH 3EJZD 4I2XE 1N59B 1RV6X 1I7ZA 5DD6B 3S36H 4OKVB 2Q86A 3SJVB 2A9NL 4U7KA 3OF6D 2C3HA 1N4XH 4MNGA 5IB4A 2G2RA 4P46C 3KNBA 4LKCB 2J6EL 4CMMB 2JLLA 3E6FA 2J8HA 5D2LB 2X4UB 4UOW1 1KB5H 4LAQL 2E27H 4NNPL 2ZP0T 5ICZA 2DQDH 4YNYB 2EC8A 4RGNC 3MUGB 5CILL 4NO5B 2DS4A 2FGWH 1HOCB 3BWUC 1UCTA 1ZTXH 4HKBA 4XHJC 3QNYA 3TVMD 3VGHA 3MV7B 4FFVD 4G7VL 3LS5H 3LKSA 3TNNA 2GJJA 4NT6B 2IALB 3MV8B 1WIOA 3ULUH 1GHFL 3EO1B 1JV5B 1I8IB 2YD3A 3LRGA 4X4ME 1NCBL 3AFLA 4LU5L 3WL9B 5L2KB 2HFFA 3QYCA 1T21A 3M45A 2IPKB 5GS1C 2A6JB 3VXOA 2F8XC 5F9AC 2LU7A 4LCWB 3GRWH 5LGJB 4DCQA 4UT6L 1FHGA 3BZFA 4PUBL 3VFTB 1RJLB 4L4VA 1B9ZA 5C2BL 3QDMA 4ESKA 4ZNEA 2PYED 4URTB 3HZYB 2I9TA 5E8NA 3P73A 4HFUH 2MSPA 4XZUA 4DGYH 1IAIM 1JGDA 4KUZL 2BVQA 3KLHC 1OARH 1WIUA 3ARDB 1U8MB 4F33A 1ZGLP 1T5WB 3A6OA 5EOQL 4WJ5A 1E0OB 2BNUA 3MREA 1VFMA 4LQFL 1A4KB 5ICYA 2YSSA 5E00B 3GK8H 4R90L 2B1HL 3D3VE 3HUJB 2ZOKB 1G6RB 1FYHB 4PGEB 4EI5A 3WEXB 1QEWB 5D72H 4KI5F 3IXAB 4JB9H 1T1ZA 1X5IA 5L8LB 3NH7H 1KJ2B 5IB2A 1G9ML 2Z35A 3L3IB 2HT2C 1MCQA 5T5FL 1A7OL 2AK1H 2H45A 5DVLA 5E6YA 1Z5LB 3ZDYE 4LLQA 5IUSA 1KT2B 5B4MD 2EDYA 3V52L 2ZOLA 1NEUA 4L8BB 5F71A 2VR4A 2VLKD 2WANA 4KI5D 4RAUA 4YHYC 4UQ3B 3V5DA 4XVUC 3BW9B 1QLRB 4NZTH 1VGEL 3BPNB 4OFKA 2Y5TB 1UENA 5EORL 3ROLB 2GQHA 3QO0B 1A7QH 3IFOA 1I9RL 4K2UH 3ULVH 1XZ0B 5SX4H 1AQDA 1X6LA 2BX5A 3I75A 5JUEL 1DZBA 1GPOL 3PWVB 3EJJX 4JHWH 5JMRA 1ED3B 4Y4HC 2FEDC 43C9A 1K4CA 2FEEL 4HKZB 3O9WD 3H9SB 1H5BA 3MLSL 5FF6A 3P3YA 5MEPB 2W0LA 3QB7C 3UTTA 3WKML 4KHTL 3RDTD 1YN7A 2YEZA 3FFDA 3VRJA 4J3XA 4MS8C 1DEEB 1NL0L 3VFUB 2Y06H 4X6FB 4XP9H 4ISVB 3VI3F 4KRLB 2PCPA 3MODH 3M17B 4K3DL 4TVPE 5E8EA 4GRLD 1QSEA 1IE5A 1HZHL 1GZQA 4CU6A 4M7LT 3BQUC 1KENL 3U0TB 2VLKE 1QOKA 4XNZB 1I9JH 1II4E 2B4CH 4KI5E 2Q86B 5ISZA 4KU1A 1HYSC 5C1MB 4MNGB 2G2RB 3AGVA 2CUIA 5BS0A 1YNLL 4BSJA 3SDAC 43CAB 2VR5A 3GKZA 3D1MC 3S37H 5GS0H 5EO0A 4PYHA 5I16B 4CL7A 3VRLE 1OL0A 5ICZB 3O3AB 4OGXH 4Z0XA 4ALAH 3B8YA 3CXHJ 4NQVB 1WV7T 4HKBB 5A40E 3QNYB 3TNNB 4MAYC 2XACC 3FFCA 1KEMH 4HPYL 5FB8A 1U8LB 3DXAE 2DKSA 2VE6A 3QCVH 5SWQB 5DWUL 3MRRA 3MRHA 4NKDB 1C7SA 1HIML 3MCLL 3NFSL 4AT6B 5I17A 4N8CH 1W72A 1CXLA 5E6ZA 2AEIT 3PQYA 2JELL 5FM8A 1ETZA 1OTUC 1T21B 4HGWA 4C56D 2XKNA 1FO0L 4LRIC 4HDIB 1ACZA 3RBSA 3ARPA 2VR9A 2JCCF 4KTDH 3RWIB 1ZGLM 2PXYD 4M02A 1RZ7L 3BZFB 1G7PB 2HT4C 3QDMB 4NC0B 3KLHD 1WWCA 1BQHG 5E8NB 3BESR 3P73B 5ID0A 3VD4A 5DFVC 2K9UA 3RWJA 4NYLB 3C60D 1SMOA 1R24A 4XZUB 5EZOH 1JGDB 5E8OA 1H0DA 1S9VA 2V2XA 1Q9LA 3LS4L 3SE9H 4PJBB 4TQEH 5IJKC 1G9NC 4X7TA 1S78D 2IAMC 2WBJA 1XF5A 1BX2B 4X6DA 5J8OA 3QDGD 4WNQB 4XAKE 1JZ7A 2BNUB 3MREB 3DVGA 5CP7A 5ICYB 3P9MA 2YSSB 1FFOA 2HT2D 3LIZH 3K81A 4P3CH 3CFDA 5D1QA 1U0QA 1HCFX 32C2B 4TNVK 4QY8A 4JO2H 2ENSA 4JY4A 3B8SA 5J1AA 1T1ZB 4XP1L 5IB2B 4WW2A 3HS0A 4X4ZA 3FMGL 4YHNA 1XAUA 3VFNB 1ADQL 1LNUB 2R0ZL 4LLQB 3DSFH 2ZOLB 3VXMD 1UH3A 2GSGA 2XA8L 5EZIH 2D7TL 3MCG1 3VA2C 2AEPH 1HHHA 5DGRA 1AFVL 1I1AA 4GMTL 2A0LC 3RY5A 4WW1A 5KTEH 1T1WA 3INUL 4RAUB 4FTVA 2JIXA 1LILA 1D5ZA 3K4AA 5JR1H 1MI5B 3U36A 2YN3A 3I9GL 2ZCHH 3ZE1E 3IFOB 2P5WA 4NNYB 2B39A 2E9WA 5CFHA 1RIHL 2B1AH 1X4ZA 2FX7H 5C09E 3I75B 2V9TA 1DVFC 1MPAL 2W65A 4MS8D 5K93A 2AJVL 2BOCB 4PLNC 1H5BB 4IMKA 1QZ1A 4N0FB 2YUWA 1KNOA 2FJHB 5ESQA 4X9FA 1VACB 3QHFH 3SKUD 1IRAY 1T89A 4X80H 1YN7B 2J2ZA 4DN4H 1LO3H 3QUMA 3FN0L 3HRZA 5B8CC 1VENA 3CH1A 4MLIA 1HYSD 2UV3A 3QEHB 3VXRE 2PCPB 4OM1L 3QFJA 4G3YL 4XCFL 3F6IA 1HXMA 3VXME 5GGRA 4U6VL 2JB6A 4NJAL 1NAMH 1SYSB 3QHTC 5FYLH 1REIA 3RY6C 4MDJB 5IQ9A 4N90D 1HQ4A 4GG8A 4PJGF 1MRFL 4RGOL 4TRPL 4BZ1L 5CCKH 3RUGA 3NIDF 5D7JC 5T33H 2AXFA 1LMKA 2R0WH 3BKCL 1O0VA 2BVOB 5FIEA 1I7RB 4M6NL 3WHE0 1FDLH 4QTHA 3U9UB 2B2XH 5DZOA 1EO8H 4Z0XB 2OZ4L 2WP3O 4JFZH 4KTEH 1OTTD 3D69B 5DEGB 4U7SA 2PYFA 3OAZK 3C5JA 1OTUD 3T0WA 3SE3C 1KJMA 1RFDH 2ESVB 4JRYA 5CMAA 1D6VH 5J4MA 4WRLA 3E0GA 1DBKH 3V0VA 1YNKL 3QIUD 3KJ4C 3BGFC 2HVJA 3D6GA 3MRHB 4OCRL 4HT1L 4NQSA 4YWGH 5IVXF 4KZDH 5I1EH 1CDHA 3NIGF 1XCTA 3OXRB 1LD9B 4MA8L 1BIIA 4NFCA 3EOYG 4HGWB 3JV0A 2CD0A 3T0EE 1CE1H 2P45B 3BPNC 1HDMA 1MFAH 2QSVA 1MCFA 4J23A 2OL3B 5MHSE 4KROB 1KULA 4LARH 3GJFH 4XXDB 4G6ML 4XMLL 1MAMH 4XNUH 3TZVB 4RCAA 4C4KT 1NGPH 3LQZB 5DJDA 3MBXL 4PBVC 3GSWB 2HRPH 3OKOA 5ID0B 2BVYA 2AJSH 5EWIH 4I18A 5ACLA 2IAMD 1MNUL 1TLKA 1U91B 5FKPA 1QR1A 3L3KA 2GITB 4UZGA 3BGAA 5ILTH 3VFVA 4H25B 1DBJL 4O9HH 5E8OB 1S9KC 1MHEB 1S9VB 3BPCA 2V2XB 1Q9LB 4BFBD 1DL7L 4QHUA 3TP4A 4JPWH 2G9HA 2R2EA 1A8JH 2ZSVA 4XWGL 3GEWB 3NIDE 5BRZA 2FJGB 5C0CA 3P2TA 3QIWC 2Q1EA 2XRAH 3MLUL 5CP7B 1ORQA 1IM3A 4HXAH 5LXGH 1FFOB 5FCUH 3CVHL 3CFDB 5GGVL 4M1DL 3JVGC 5IJVB 3B9KA 4DW2L 2XKUA 3ETBF 3GMRA 3GSOA 4JY4B 5C9JA 4RMSA 1PDKA 4ZFGH 3WXWL 5J1AB 3BIAX 4PY8I 2X89A 2DJ4A 3CX5K 5BOZG 3OKNB 5KN5A 2WM0A 1GAFH 1W8OA 5L7XL 1X5KA 3IRZA 5BQ7A 3W82A 2FRGP 1LO2H 4Y5XA 1JGLL 4OV6F 3VWJA 4XC3L 4NN7B 4X6EA 4L5FH 3SKMA 3PIQA 1BP3B 3BEVA 1ZLWK 2RCSL 4WW1B 1T1WB 3QZWG 5J6HA 4YDKL 1CFVL 2JIXB 3NPSB 4P9ML 1D5ZB 3OBAA 4HUUB 1LDPH 1FH5L 4LHUB 3UZEA 3KPRE 3U36B 1DJSA 1NMCB 1EXUB 4JHBA 5D9SA 4KAQH 3CK0L 5C9KA 4QRRE 4TSCL 4I0PD 2ICWJ 1RUAL 4PJ8A 3IDXL 3W0WE 1RJYA 5DO2C 2X1XR 5K33A 2Z31A 1BGXH 4GXVH 5D7SH 2MQ0A 1A47A 4LHJB 4Q9CA 2CKBH 1E6JL 2UZXB 1TFHA 2NY5H 5E99H 3TPUA 1FL3A 5DK2A 2MPAH 4XB7A 1A5FH 4AEHL 4NBYB 1DLHA 2VYRE 3QUMB 1BOGB 4F7EA 3CX2A 3CH1B 2BHYA 4H1LG 4RFNB 5FOJA 4I1NB 2UWEE 3UJIH 1S5IL 2PKDA 4KMLB 4LVNB 3F7YB 3VXTA 1HXMB 5FOBA 4BFGA 3EDEA 3GMPA 4KKCD 5GGRB 4LRNH 5INDB 2JB6B 2HTLD 2ZUYA 3QAZC 4OCLC 4PS4H 2FGZA 2UY6A 4F15C 5IQ9B 2OP4H 4HWBA 4E0RB 3ARED 3O2WH 2FHFA 1LEKA 3J8F7 4JRXD 4YIQA 5TDNA 4KDTC 2V6HA 4PJAB 1CLOL 3MLZL 3STZB 4H8WH 2YD8A 1P7KA 1JNNL 4NUGH 5CEZD 1A6ZB 2VTFA 1QRND 5GRWA 3ARZA 1JPFA 4Y1AD 3SDXF 4EI5C 2ZUUA 1RU9H 2R1YB 3TBWA 3ULUE 2AERT 4Z7VA 2PYFB 3FO1B 1EVUA 1F3JA 3NZ8B 4XCNA 1NUFA 5I76B 2MQCA 3CSGA 3P4MB 5DRZA 5CMAB 1FGNH 5E7FA 2H1PH 2NXZD 4PJEF 5C0BD 3ECBB 3N50A 3FB7B 2HVJB 4V1DD 1J8HE 1S7SA 5GZOD 5A2KH 4NQSB 3VFSA 4NQCD 4U1GC 1XCTB 4GRWH 4QOKB 3U7WH 4GAJL 3W9EB 2APBA 4PBXA 3V7AG 4OD2A 1M7DA 5IMOA 1PYWA 4GMSL 2ZZUT 2DMCA 4IRSB 1A1OB 3EDFA 1F3RB 1AHWB 1EJOL 1O7SA 4KHXH 1D6EB 2EICA 3LH2L 1JPST 3B43A 4PV8B 6CGTA 2CPCA 4G6FB 5FKPB 3L3KB 3LQAH 3F58L 3VXNA 5CD5C 3MGTB 1RI8A 1TNNA 3ZT5A 4AENA 3PWLA 4Y5VA 3BPCB 2DN7A 3MLXL 3DYMA 3IFNH 2KDGA 3DGCR 4QHUB 2XG4A 1TJGH 4JCMA 4MHHI 2G9HB 2R2EB 3KDMA 5KVMC 5CSZB 3U0WL 2F8OA 3ZKND 5J6GB 2ICCA 5BRZB 4DN3L 3TBVA 5C0BE 3R8BB 3RQ3A 1NFDE 1IM3B 2YK1L 4LSQL 5ENWA 3SGDI 5F97E 1W0WB 4WWID 1AKJA 2NTFA 5SWSE 3B9KB 4ONHA 3KR3L 2ARJA 5TFSL 4U3HA 3HMWL 3WJLA 5KVDH 2J7LA 5JW3L 2CDEA 5KS9F 2AJ3A 4IMLB 1P7QD 5EFIB 3QH3A 4PJEE 1L6XA 2GKIA 4MLSA 3FB6A 1EMTL 5FO7B 2F54B 1FAIH 3VWJB 4UIMA 4X6EB 4PJFF 5I1IH 3LV3A 3ULVE 3S3SA 4Y4KA 1EEUA 3NGBC 1HQRA 5T5NF 3RIFK 1K3ZA 5J6HB 2I5YL 4DZ8A 1UJ3A 3EBAA 5E8PA 2OR9H 5HHOE 4DGVH 3FB8A 1U8OA 5BXFA 1A2YA 2V17H 1V7MH 4MJIA 1N3NA 1QTYT 1MJ8H 1U8NA 2AV1A 3ES6A 4LBEA 1CK0L 3ZLQC 5I1GL 1IFHL 1OGAA 2QBWA 2J6EA 1RJYB 3CSYA 2Z31B 4TOYL 4CADA 4DOHB 3N9GH 4HK3N 1X6NA 1FGVH 1VPOH 1WIPA 3WFZA 4P57A 3TPUB 5EU6A 4MMXC 2XYCA 1NGWB 3V0WL 5IP4A 5DK2B 3RI5F 3BSZH 2N1KA 3VXSD 5GRJH 3QPXL 4F7EB 2WBKA 4PB0L 1QNZL 5LBSH 2IPUG 2V5SA 1I3GL 4YXHL 5SWZA 4FQJH 3BP4A 2IBBA 5EC2A 3VXTB 2NX5E 2NY0C 5IBTL 3GMPB 1RULL 2FBJH 3KPPB 5LQBH 1JK8A 1QBML 1OHQA 4I5BB 3IAPA 4IOIA 1F2QA 4DZBB 5EUOA 1GYAA 3EYVA 1KFAL 1NCAH 2QKIA 1K5NA 1VHPA 2VLLA 2OTPA 5TJWK 4YIQB 2WBJC 5TDNB 3T3MF 5I73B 1LGVA 2GJ6E 1JRHI 1F90L 3TBYB 1SBSH 4K9EL 4R26H 3BN9D 3MFGB 5IFAH 5D1QC 3HB3D 1DLFH 1CTOA 4MXQC 3QWRA 4EIGB 1KB5L 4JR9H 1F3JB 4XCNB 2DQDL 4WW2C 1JNJA 4EUPG 2FO4B 5DRZB 1OGTA 5I8KH 5DZNA 4XTRC 1QYGH 5IGXH 3ARQA 1B0RA 4RRPG 1S7SB 4NO2B 1A14H 4GUPB 3VFSB 2EH7H 2UVFA 5DMGC 1I1AC 1KCUH 4MA3A 3HG1E 1LP9F 3FKUS 2V2TA 4AQOA 3GBNH 1PYWB 2VOTA 5D7IE 5C08A 3DURA 3GI8L 1ZKAA 5IHLB 5E2UH 3QI9A 4PJ9D 2DICA 2J88H 5BMFH 4OCYL 1M6OB 1UM6H 3GRWL 4KKBC 1M1SA 4YXLL 3RPIA 4WCYL 1FL5A 2VIRA 1P7HL 3UTSD 3SKNB 4P5KA 4HUWA 4IMKC 2EE6A 3IJYB 1NC4A 3L9RB 5D5ME 4MGXA 3PWLB 4Y5VB 1T89C 4NFBA 2IBZX 3VD5A 3ZKXB 5GRUH 3HAEB 1BD2E 1U9KA 3KDMB 5L2JA 1CD8A 2LTQC 3NACH 4WY7H 5E6IB 2BNQA 1QBLH 4S11A 4ODSL 1AKJB 2NTFB 4TUJA 5T3ZH 4K7FA 1IGYA 2DBLH 5K9KB 1F11A 4ONHB 3QDHA 1CE6A 2QQKH 3T1FA 5F9WB 3VW3H 1F4YL 2CDEB 3LY6A 1F6FB 3BDBA 4CMHB 4F7MA 5D72L 3VU2A 3QH3B 4JB9L 1YPZE 1DSFL 3NH7L 1PKQA 3FB6B 1OF2A 2VLJE 4UIMB 4JREC 3BUYB 2B8OT 1G1YA 2AK1L 4Y4KB 1EO5A 2D31A 2ERJB 1LP9E 2LVCA 4DZ8B 3UYPA 5E8PB 4FABH 4WHTB 3E6HA 5IB5B 4M7KH 1SVCP 3FB8B 1U8OB 1YECL 2DBJA 2APWA 3UBXG 4L3EE 4PY7B 1P9MA 2H9GB 1CFQA 4M7LH 4NZTL 5JW5A 5EZJA 4LBEB 5AYUL 3EO0A 4HG4K 2V9QA 2LQRA 1OGAB 1OWWA 1PG7H 4JJ5B 1A7QL 2CMRL 3CSYB 2G5BA 4K2UL 4NZDA 3QG7H 4L3AA 4WUUD 4ZQKB 2X4TA 1PKOA 1PJ9A 2VJXA 1MIML 4P57B 4X9BA 3V8CA 4JHWL 3VMOA 1JTTA 2W38A 3RVVD 3BE1H 3VFRA 3CD4A 5F44A 2BFVH 6FABH 1YEHH 2XY1A 4MQXC 2PR4H 4YQXH 1TZGL 4PJCA 2I26N 3DMMC 2J8OA 4I18C 2GFBA 1FVEA 1KLUA 2AK4D 3BP4B 4Z7NF 1OAKH 2OSLA 3ARBD 4KK8C 4HV8B 4FFYH 4Z7UA 3OG4B 4OQTL 1Q72H 4D9QD 1JK8B 1U8KA 3E2HB 1RPQA 1EFXD 5I6XB 3MODL 4IOIB 4S0TD 2QKIB 4MZ2A 1FO0A 4KKAD 3FQTA 5IV2A 2VLLB 4PJDB 3WSQH 3QPQC 1AR2A 2IPTL 1GGIL 1I1CA 1I9JL 2B4CL 1RZKC 4KFZC 1K8IB 3C5ZD 2JJSA 3SHSA 5TDPA 3T3PE 4TYUA 3FAWA 3RWFB 5C3LD 1NJ9B 1HSBB 4EXPX 3C5SA 4QXGH 1DQTA 4PJ5D 3H0TA 2X41A 2HJLA 2IANA 4AG4L 5GHWH 4Y5XC 4ETQB 3MV9D 4P5TB 3VWJC 3WS6A 4K7PX 5HDOA 1C8PA 4JDZA 4LCUA 4MA3B 3I85A 5I30H 4Y2DD 4PJXB 2E9IA 1FIEA 3CXHK 3QCVL 4UIKL 4HX1A 2C3VB 2V2TB 4N8CL 5KW9H 5KSAB 5C08B 3W39A 3DURB 1LEGA 2YZ1A 1BVZA 2CGRH 1QHOA 3QNZB 5D2NA 3MJGX 3QI9B 1T5XB 3U6RB 1MFEH 4J3UA 1MLCA 2VKWA 3AMLA 4PJ8C 5TDOB 3O3EB 1OCWH 2Z93A 3P0YH 1FL5B 2X2YA 1MJ7H 4NJ9L 4W6WB 1G9NH 5EU5A 1EO7A 1WZ1L 4JPIA 1NC4B 3SGJA 3G9AB 3GMOA 4HHAB 5C07A 3DUHA 3N1PC 4YC2B 1KN4L 2VDPH 2X1QA 1WAAE 4YXKH 3MRIA 1U8PA 1J87A 5D1ZA 3DOSA 4NM4H 4TQEL 3DVNA 4F7CA 4O58L 1Z0NA 1CFSA 1KIUA 4EOWL 4K7FB 1IGYB 1A64A 1KSRA 5EBLB 1EEZB 1U58B 3OKDA 3T1FB 1GGCH 3BMWA 4XPAH 4OLEA 4GG6E 4DEPC 5GZND 4P3CL 4JM2B 2O61A 1QFWL 4Z0BL 3C6LA 5I18H 1U41A 4F7MB 1UWXK 2IMNA 3O41B 4XHQA 1A3LH 1DQQA 4HIXH 3HI5L 3N1QC 2BSRB 2VDML 4OZGF 2DLFL 2D31B 1VERA 3I6LE 4RWYH 2EKJA 3KXFA 3MLRH 4LNRA 4OLVH 4HLJA 3V4PH 4AEIL 3DV4B 2AEPL 4OF6A 1OP5H 2XV6B 5I9QC 5KTEL 3VGEA 3ILPB 2FCBA 4M48H 5JR1L 5JW5B 1WITA 3TYGH 2Q8BL 1M7XA 1CDJA 4PJIE 3EO0B 3PWPA 1MUJA 2VNCA 5JIPA 4B5EA 3AS1A 5DHXB 3WFHB 1X44A 2G5BB 3ARTA 2B1AL 1U8JB 2X4TB 1J0KA 4FQXD 2BNRB 2DQJL 3RL2A 2VQ1A 4RMQA 3DMMD 5ESVA 2EEAA 4I2XB 4XPFH 3T8XA 2OZ4A 3VFRB 3K3QA 1NANH 3BKYH 4J3SA 4F9LC 1YJDC 3BWAB 3OKEA 3VFWB 4P9HL 3QHFL 3MLYH 4I77L 4G7YH 4X80L 5KVGH 2Y25A 5KSBA 4GJTB 1LO3L 2GFBB 3MNWA 1FVEB 1KLUB 1UZ8A 5DFWH 5B3JF 3ULSA 2Q6WB 5HXMA 3PWUB 2R2HB 1U8KB 4Y5VC 2EDKA 3ARFA 4XP4H 4KPHH 5DEFA 4NQDA 3M8OL 5A2FA 1Q9KA 3ZKXC 4HIJA 3C2AL 4P23A 5IV2B 2DQEH 1NLBL 1N26A 2CLVB 5FYLL 4YBHA 25C8H 1XGTB 1KIQA 1MELA 3MJ9H 4JKPL 4X6CF 3FQXA 3WBDA 4G43A 4WV1B 3TBSA 5EA0L 5DUBA 1P2CB 3E3QE 4YX2L 2B5IB 2WK2A 4X5XA 4KQ4H 3HFMH 4R2GD 4WFHE 4UDTB 5DTFB 4HIIA 1J1PL 3DYPA 1FNEA 4KRMB 4PD4J 3SQBA 3KPLA 4GRWE 2IQ9L 3C5SB 3IJSB 4LP5A 2B2XL 2XOTA 2HJLB 1QD0A 4HMEA 4ZFOL 5GXBB 4JFZL 3SY0B 4BFIB 2MOVA 5DMYA 3O45A 1IMHC 4XPHH 3V4VL 5E9DD 1ONQA 3RVTC 1IL1A 4X99A 4JDZB 4Y4KC 1EX0A 4LCUB 2H32H 1TDQA 3ESUF 1CTNA 4NSKA 4YUEH 5EU3A 3DUSA 1UJ3C 4JN2A 4HX1B 4KTYA 3CVHA 4M43H 1CICD 3D0VA 4YWGL 3TPKA 5A3IC 3SPVA 5I1EL 1IEBB 4P2OC 4P5MB 1OVZA 4GS7C 3W39B 1YY8B 2YXMA 3IS0X 2HA1A 1T1YA 2OK0L 2R4RH 4DKFH 4OZHF 2EDLA 1V8HA 3LD8C 4LARL 2Z93B 3Q6GL 2WUBL 3K74B 5DDHB 1CD1A 4XNUL 2A9MH 1KV3A 1NGPL 4GW4A 5EU5B 4LCYB 4JPIB 3WFCH 1PEWA 3GM8A 4ZSOA 5D1XA 3GMOB 3V7AE 4P2QD 1IC5H 4RSVA 4ZDHB 3D87B 1S7QA 4G8GB 5ILTL 4RAHA 1NBQA 3MRPB 4KI1A 4I3RL 2P46B 5D1ZB 2CR3A 3DYOA 1KBGL 3DVNB 4LASH 4L8SB 2FX9H 4FS0A 5CIPA 3DPBA 3X17A 5GSRB 1UT9A 1MSPA 2GT9B 1CFSB 1QSVA 4GRMB 3BRFA 1IM9A 2DB8A 3MOBH 2ICES 2R29L 4QRPA 4HXAL 3RWCA 5I8OH 2XT1B 3LEYL 1G7MB 1EGJL 4DQOL 2O61B 2A6DA 3F7PC 2QQLL 2VLRD 5F1SA 3ILQD 1GJIA 2E7CA 3PV6A 3K0WA 5MI0B 1BBDH 1KIRB 3LHPL 4YFDB 5HI4D 5CJ5A 1ZT7A 1B4JL 4LNRB 4PRHD 5BJTA 4HLZG 3CDGA 4R3SA 4EDXA 3QCUH 4JVPA 1VEOA 3T65B 5F6HI 1VFOA 4CJ1A 2FDBP 4MD4A 2IBGA 1U3JA 2F5BH 3TH3T 3KG5A 1JFQL 1A02N 5DFTA 3PWPB 1MUJB 5C6WH 1VDGA 1UFUA 3GMMB 4HUMB 4OZHE 4OLZH 5FA3A 4WU5A 3JWDL 4BQ8A 4ODXA 1MCSA 2EYTB 2VDRH 1H3PH 3UDWA 1JF1B 1CU4H 3RL2B 1AO7A 4JGMA 1BECA 3UCRA 4HSQA 4GH7B 3RBGA 5D7SL 2I07A 5FYKH 3MBED 1RUPL 3G5XA 2CKBL 2X4OA 3U4BH 4PTTA 3OKEB 5E99L 3S6CA 3NCEB 4FXKB 4Q7DA 5E8DH 3O6FA 5E4EC 1A7BA 1ZSDB 2HT3D 4Z95L 4HJ0D 3MNWB 2J8UF 1W0VA 3OKLB 4HLZH 1L7TH 1UZ8B 3KPOB 2HLAA 5E24E 4RGNE 4JFEE 4MNQE 2FX8H 2DTSA 5JIIA 3ARXA 2R2CA 3QUYB 2AVGA 1TJIH 1WC7A 4JHAH 5DEFB 1A7RL 4XCYB 4HIJB 4LRNL 4JFFA 2PTUA 5FUCC 4UAOB 2DQCL 4PS4L 4RNRA 1KIQB 4R4FH 3HC0B 3O2WL 2GIYA 2F74B 4KK5D 4FMKA 4CN4A 3QCTL 4G43B 3TESA 3TBSB 1I9EA 5DUBB 4M6ML 1WBYA 3FN3A 2DTMH 5AUMB 2OM5A 4A6YH 1N8ZA 5ACZA 5FV2A 3ZTNH 4FNLH 4HIIB 3NZHH 3KPLB 4NUGL 1EBAA 1JPSH 4NKMA 1RU9L 1YMMA 5A3ID 1FZOB 4NFDA 1A6WL 4O2EB 2K3TA 3O45B 1XCQA 4UT7H 2F8VA 3IKCA 4LLVA 4OZIA 3A6CH 4JQIL 4Z6AT 1FVCA 2AV7B 5IK3A 5EU3B 3DUSB 4JN2B 1MRDH 4V2BA 3CVHB 3SPVB 4EN3B 3VXUE 4OCXH 1JF6A 1PZUB 1KYOJ 3LEXA 2PW1A 2AXGB 1P9MC 3ALWA 3MROA 3TJHD 1T1YB 4QTIL 3X11B 1FNSH 5C7XH 3BP6A 2GK2A 4P59H 2QHLA 4BK4A 3ZE0E 5E1AA 4U31A 2AJXH 1CD1B 3I3DA 5DJCA 4GW4B 3DTXA 5ITFA 2Z9TA 4ZSOB 4PGDB 1XGYL 5CBAA 1MFBL 4XPGH 3DRTB 5H2BA 3MLWL 1F6AA 2YPKA 3HZMB 5FK9A 2QADD 3LQAL 4G6KH 5T3ZE 3MO1A 2FIKA 4C83A 2FL5A 2J4WL 5ANME 4YR6A 4X9GA 1MIEL 1XR8A 3TN0A 3VXPA 4XP6L 4JPKL 3NTCL 1IKNC 3D39A 4LSUH 2ED7A 4XPBH 5F70A 1B2WH 1RURH 1IM9B 2NW2A 1YEKL 2HJKA 5ID1A 3RWCB 1FYTE 1IT9H 4RMWA 2A6DB 1UCBH 2PO6D 1I1YA 2V5MA 2XXMB 1GGBH 3PV6B 4Y5YA 5IT2L 2JJSC 1KACB 3B9EA 4PJ7E 4LSVH 4F7TB 1JN6A 2W91A 2XFXA 4HMDA 2UVEA 3FQWB 1MJJA 1CZ8H 4MAUH 3CDGB 4FZEH 5I1IL 1W72H 3RWEB 3U0PB 3TCLB 2AKRB 5J9PA 2VH5L 4LSTL 3U1SL 3PNWA 3LPGA 3JWOC 3IVKB 3UC0H 4J7RA 5EOTA 5D71L 4PV9A 1RMFL 1L0QA 2ZUSA 3K46A 4NWUL 2YD6A 3D18A 1FV1A 2DYPD 3DRQA 4WU5B 4QXTA 3KLDA 2PW2A 4PGBB 3QXUA 5FHBL 1AO7B 1WT5A 2BERA 3QT2A 2VZVA 1OW0A 4L1HA 5D2NC 2I07B 1FGVL 3G04B 5F1NB 3ZDXE 3ZZ1A 2X40A 2X4OB 4PTTB 5DHVA 3O6FB 3MQIA 3VWKA 1EHLL 2IFFL 3BSZL 4QRQA 2AEQH 2D03H 5GRJL 1W0VB 2BSTA 1LHZA 2HLAB 5B38B 3MOAL 4LHUG 4PLKD 5LBSL 4HKJB 3VH8A 4BYHA 1N6QH 4GW1B 3EZJB 4FQJL 5ALCH 2FBJL 3ELAT 4JFFB 1T0MB 1X3DA 4K7PH 3MRLA 4HBQA 4LSRL 1KN2H 3BKMH 5D1ZC 3VFGH 4ERSH 1U3HD 2WLZA 4RNRB 1QSFD 3D2UB 1NCAL 2CKNA 1UM5L 4NC1E 2HG5B 4XNQA 4AIZB 1T0PB 3QEGL 1PX3A 3AC0A 3FB5A 4Z7WE 5E2VH 3WFBH 1WBYB 3SJVD 3JTSA 5JHDA 2WV3A 2O93L 1N8ZB 5K9JH 1SBSL 5HVWA 5IMMA 4R26L 3HR6A 1YMHA 2JK5A 3T0EB 4NKMB 3C6LC 2H3NA 3MZGB 4MJ2A 4BKLB 4HEME 5MI0C 3GFUA 1FN4A 3FQRA 3HC4H 3IKCB 1IGTB 1SJVA 4LLVB 3GUTA 4OZIB 2BVUA 3EFFA 4YHIB 3UPRA 5I8KL 5IK3B 1QYGL 5IGXL 4P2RE 3QUZD 5JPNB 3OGCB 4G6AC 5DHYA 4UTAL 5DD3H 4CVWA 2A1WH 4XH2B 3WLWC 3RGVD 3S34L 5GIRA 3MROB 3VI4F 1YNTA 5H94A 5L2KD 3AS0A 4AY0A 1UXSA 3BP6B 3I6GA 5E1AB 3R8QA 4HKXB 2J88L 1CQKA 4GW5A 4LCWD 5I8EA 5DI8B 4WI3A 1IAOA 1S7XB 4X4XA 5ITFB 4OIIH 3HI6L 4XCEB 5TQ0L 5E2WH 1IC1A 4XMPH 5GGTL 5BVJA 1F6AB 3ARYA 1DUYA 5E08H 5KSUA 5HYJA 5HSFA 3EYSL 5D2LE 1MQKH 2FL5B 4YFLI 5E5UB 4YR6B 3RZCA 5GRUL 1XR8B 2VDKL 3TN0B 3VXPB 3V2AR 3D39B 1ES0A 5GGSY 4Z7OF 1F13A 1HSAA 2HJKB 3SDDB 3NACL 3ARFC 4QF1B 3MV7E 4QHNB 2YPLA 1K2DA 1ZVSB 2FSEA 4P23C 1ZGLB 3QSKB 3MV8E 2P8PB 2DBLL 2IWGA 3KPRB 4YEFA 2VL5A 2AS5M 2E5EA 2ICEA 4P3WA 3VW3L 4UTBH 2KZ1B 3STBA 5ADOL 4MNHA 4Y5YB 1YUHA 4CKVX 4RFEA 3B2UC 5F1OB 4DUVA 1JN6B 2NXYB 4TPRH 4H0HB 3QDJA 3IAGC 1T66D 4OQTA 4IEFB 5DJZA 1D9KB 4N9GA 5J9PB 3NFNB 1ACYL 4JANB 3PNWB 1RVFH 3MLPA 3VI4E 3G08A 3RAJH 5EOTB 4PV9B 5TE7H 5JXEA 4G8EA 4UBDD 2W9EH 2KH2B 5INCA 1VEMA 1IGFL 3D18B 2BHUA 3IU4L 2PW2B 4X0KA 3F7VA 1TETL 2VDNH 1MCOH 1PG7L 1WFUA 2EYSA 4OF7A 1A3RH 1TQCB 5T1DH 3QG7L 1O5DT 5GRXG 1KB5B 1MCWW 5HGHA 3U4AA 1Y18A 1S7TB 4M5ZL 4ZOEA 1OP5K 3VWKB 4U1JB 3EYOB 4LGSB 3ZTJG 2OQJB 5D96C 3QJHA 4QRQB 4U1LA 4B7IA 4NGHH 5KZCD 3JV4A 3P9LA 3HUJE 1MFCL 4G6JH 4NPYA 3MC0A 4ODWB 3HI1A 5D1XC 1RZKH 1WEJH 3VH8B 1BZ9B 1NCDH 5TF0A 1G6VK 1IC7H 2GUOA 1E4XI 2D4FA 5DUPH 1TVBB 5FKAB 2X4NB 4FN0A 3CLFL 3MRLB 2OJZL 4ZUTA 3QO1A 1JRHL 3HPLA 1K8DA 5HGBB 3FZUC 3PWNB 3DROA 4XNQB 1KIPA 4ZS6D 1LO4H 3WSQL 3RTQA 5MENE 1BHGA 3JTSB 5DD1H 2ZG1A 5IMMB 4JG1H 4ZO9A 5F3BB 4M5YH 1YMHB 2DQFA 3CJJA 2PETA 4WO4A 3QFDA 1YYMH 2P1YA 3RHWF 2WP3T 1A0QL 4NRXA 2M1KA 2DL2A 3EOAB 4Y16D 1E28B 1KJ3H 2ZUVA 3UYRH 1X5ZA 3BEWA 5EPMB 3LSOA 1FN4B 2NY3C 4RFOL 2DQGH 3FQRB 3H9SE 1HNGA 3WLWD 3L3DB 4WUKH 4Z7QE 1I9IH 2XWBA 3LKPB 4NKIL 3HZVB 5I75C 5JO5A 3WNMA 2P8MA 1QLEH 5DHYB 1NSNH 1QLFB 3KPSD 4Q6YA 5CP3A 1RZGA 2VITA 5GIRB 2WIMA 4I13B 2H2PC 3VG0H 3FQUA 4GQ9L 2IC2A 2LFGA 4FQPA 1RUKH 2CGRL 3I6GB 4LDOB 3BH9A 3IKKA 1H15A 4MWFB 4OF5A 4NZRH 4OI7A 1MFEL 1FBIH 1NGYA 2NY6B 4Y19D 3UDWC 5I8EB 1ZLUK 1IAOB 4X4XB 5F1IA 3V6BR 4PJBF 4OLYH 1IQDA 5I1JH 1TJHH 1OCWL 5SWSB 4D0DB 2C26A 4Y4FA 3W5NA 2Z8SA 4KGLA 4NQTA 1DUYB 5CJOH 3GIVB 1QFHA 4MNGE 1QFUL 4ONGL 2HVKA 5KSUB 1NUGA 1CT8B 5C0EB 2HTKD 3EO9H 4XGZB 1J7VR 5D7LA 4P99A 3EOTH 3BHBB 4HWBH 1MF2H 4JFHD 5GJSH 3RZCB 3G9VA 1T04B 2VDPL 3TO4B 2CRYA 3NBNA 4NRZA 4HFWA 2KPNA 1HSAB 1T6WA 4RDQG 2DQUL 5FUOH 4LAJH 3KHOA 5DVMA 1RIVH 1I8MA 2OMBA 1K2DB 1JYVA 2Y07H 5CHNA 3IDYC 1K4DA 2FSEB 5HDQL 5FGBA 4ZG1A 4E41B 1WFTA 1D5XA 4BSVA 5HHOB 3D85D 2VL5B 5T1KA 1EAPA 1GGCL 4L3CA 5HHXH 1G0YR 3V6OC 1S3KL 1XF3A 4MNHB 1YUHB 3CFBB 4FP8H 1BZ7A 5ICXA 4PJHA 4RFEB 5I18L 2FJFA 4GLRH 2QQQA 3UBXI 1A3LL 2EIZA 1CXFA 1I7TA 2VXQL 3HAEG 4M4PA 1A9BA 2VABA 1XMWA 2AQ3A 4F8TA 4L4VE 5IR1A 2QSTA 3QDME 4ZNEE 4N9GB 5DR5H 2F58H 3ARGB 4OJFL 1Z3GL 5JPMA 1MOEA 4ZYKA 4OLVL 3G08B 5BZWA 1AXIB 3V4PL 1UB5B 4XVSH 5INCB 5FYKE 4NHCL 1B88A 3ORJA 1MI5D 4FZ8L 1JUFA 1PBYA 4X0KB 3TYGL 3F7VB 2NX5B 1IQWH 4U1NA 1XGPA 4ZTOH 2EYSB 4L4TA 1RK0B 5MEOB 3GHBL 5J57B 4OQ1A 3WFEH 1AR1D 1B6DA 4M1GH 2Y1VA 2ZUWA 4ZTPH 4U1LB 5JXAH 1ZEAL 3BKYL 4K8RH 1R5VB 4OUUA 4ZXBC 4HC1L 2RR3A 2DWEB 2ZJSL 2V5YA 4Z77A 2XQYG 3HI1B 1P5UA 3AB0B 2VXSH 2BDNH 4I8DA 4LOUD 4R4BA 4G9FD 4N0UA 4DGIH 3ARRA 2FD6H 1EDQA 4WHYG 2Z8WC 2BJML 4ZUTB 3QO1B 4KPHL 2DIBA 3JTTA 4TUOA 1I3VA 3O4OB 3ZKSD 1KIPB 5GJTH 3BKJL 4WIQA 2MNUA 2DQEL 1R3IL 3RTQB 2OXHA 5BZDA 3EDKA 1OAUH 1OAZH 3EGSA 25C8L 3HMXL 3IDJA 4MJ4A 1V05A 3ZE2E 1HHIA 2MKWA 2NY3D 3MJ9L 2CDFA 3HG1B 4OUOA 4WO4B 3QFDB 1TCRA 3ZKMD 3MJ6A 4XX1E 5D7IB 5CEZL 4NRXB 3RI5K 4AEEA 2KUTA 3HZKA 1DP0A 3LSOB 4Y5YC 2DI9A 1HWGB 4DTGH 3QQ3A 4RZCA 2WBWB 5EULV 5F7MC 3QEQD 4LCIH 4PRIA 1A7NL 3UTTE 2XWBB 3O81A 2ESVD 4W4NA 3MRBB 4I0KA 1A6UL 2J6EH 3QQNA 1ZLVK 4IRJA 3IFPA 4WHYH 1LK2A 5DUMH 2JB5L 4RBPH 4LF3A 4LAQH 4YUEL 4KV5E 4M43L 1EGJA 5C0IB 4RISH 1BD2B 4KY1L 3QXVA 5CILH 3BFOA 3BH9B 1H15B 1R3KB 4GKZB 1HI6B 1EJ6A 4K9EC 3BMVA 2R9HD 4G7VH 3QQ9C 4KROD 4L9LA 3VG9C 5F1IB 1WT5C 3C08L 4KDWA 2WINA 3TWCL 4JZOB 2X10A 2VQUA 3TZVD 4Y4FB 1OW0C 1GHFH 2HVKB 3QULB 5TPWL 4NKQB 4N8VA 4LU5H 3B5HA 3VWKC 2XWJB 4U33A 1CG9A 2C5DC 4DFIA 1AIFA 1IC5L 4HIEA 3PP4H 1PFCA 3Q5OA 2WWKT 4NRZB 1EIBA 4HFWB 3MRDA 4UT6H 4OFYA 4PUBH 5C2BH 2EDWA 2BVEA 3L95A 4TTDC 1I8MB 2X5PA 2FX9L 1K4DB 2CRZA 1CIDA 3FFCE 1D5XB 3L5WB 4BSVB 5KANG 5IOPB 1PG7W 5IEHA 3ZKQD 4ELMA 1YEFH 2ZUQB 4L3EB 2F53A 3PQYE 5I1LA 4PJHB 4KUZH 2FJFB 1R3HA 2H41A 3DECA 5IROA 1JF5A 2AJZA 2YUZA 3GMQA 3MRQA 5IWLC 1DQML 3CIQA 2EIZB 2ZPKH 1A9BB 1BBDL 5EOQH 4LEOA 2VABB 1DE4B 3DX7A 4AEFA 4P2CG 4LQFH 3UJTL 3MA7A 3DHJA 5FGSA 5JPMB 3PL6A 4R90H 5AWNL 1Q9OA 4HAGA 1NAMB 1FFPB 1YN6A 3QCUL 2DQHL 2JIXD 4B7LA 2D9QB 4YFEA 4LHUD 2F5BL 2NZ9C 1JUFB 1RZ8A 4UINL 5T5FH 4AMKL 1FFNA 1XGPB 3OF6A 2R0KH 4ZXBD 2L0DA 2NY1B 4R0LB 2M8XA 2UY7A 2Q7YA 1P4IH 4L4TB 5IM7A 4FQQB 3V52H 3EOBB 3RL1B 1T20A 4ELKA 4FQLL 2EEBA 4ZFOB 5HHMB 2Q8AL 3BP7A 3IDIA 4X5WA 2Q76A 1KELL 1BFVH 1OM3L 4PR5B 5E8DL 5EORH 5CJXA 2BHZA 2EDDA 2ZUTA 3TVMA 4ACPA 4Z77B 5GS2H 2ADJB 2IH1A 1PQZA 2VAJA 5EC1B 2ILLA 1YYLH 1L7TL 4R4BB 5FXCH 5JUEH 3CZJA 1UEYA 2E7HA 4OFPA 4LPYA 4PJAF 3RA7H 4ZODA 3IDGB 4OCMC 3MR9A 1G7JB 4JHAL 5CJQL 5I71C 4O2FB 3LKOB 5E94B 3JTTB 4DUXA 3RZCC 2HJFA 4KHTH 5L0QB 2OR8A 1NFIA 1AGEA 2CQVA 4FTVE 2NY4B 2V5RA 3L6FA 3GJFB 4R4FL 4XPTL 5IKCB 1VGKA 2CDFB 3PXJA 1EHAA 3MFFA 3CFEB 1NL0H 3QISA 4X6BB 4F58H 5DJAA 2P5WE 1TCRB 2PYEA 3KLSA 2ITCA 4WTWA 3SE8L 4K3DH 4A6YL 3TFKC 2I9LA 1HZHH 1KC5H 3SBWA 3BZEA 4LCCB 3Q5YA 4JM4H 2P48B 4RAVA 3RWGA 1KENH 2DDQH 4RZCB 3K8LA 1B0GA 1NBYB 5HYQA 5I66A 1NCNA 3S96B 4D9RE 1R5IA 1JJUA 4PRIB 3P4LA 1EZVY 2KQNA 1GC1L 5JW4R 1FG2A 3S3PA 2IQAA 1YNLH 1I85A 3IFPB 5A43C 3QQ9D 4MA1C 1ZXQA 3ZYIA 3AMKA 1CDUA 4EQ2A 4QOKD 1LE5A 3F5WA 1IZKA 3QFJE 4MD0A 2H8PB 2EDQA 1UJTA 1SBBA 4RGMB 3GSNH 3CPLA 4QNPF 4OI8A 5CZVH 4U6XA 4HUXA 3ZHDA 4IRSD 5EDXA 1FNSL 2HWZH 4XVJL 5I15L 1MREH 4QLRA 5DWUH 2AJXL 1HIMH 3MCLH 2W1NA 3NFSH 5AAMA 1JPGA 3CC5A 3CGTA 4XWOC 4G6FD 4XPGL 2EIDA 3A67L 2QTEA 3P40A 1FO0H 2VLKA 2VDLL 1RK1A 5E5MA 2ZSWA 1IAKA 4YDLC 1VB9A 1OSPL 2OTUA 3MRDB 3B2VL 4FFZH 2C1OB 1XIWB 5HYEA 5C0RL 2DI8A 2N7AA 4W4OA 3PJSB 4XPBL 3IU3B 5J12B 3KPQA 2BY1A 5IEHB 2CKBB 4ELMB 2FWOB 3O9WA 2EDHA 5JOEA 4HJJL 4YDJA 2F53B 4QOKE 5FYJD 5I1LB 4JY6A 1SM3L 3TH2T 1VCAA 3UAJD 3RTQC 4PJIB 1R3HB 3EHBC 3S4SB 2AJZB 3RDTA 3VFPA 3JWOH 4P4KD 4HZLA 1LK3L 3FT3A 1N64H 4GT7A 4KMQA 4YAQA 5GRVK 4WO4C 1J0ZA 1MCEA 3DX7B 1N2RA 3L3HA 3MA7B 2F54D 5KOMC 3BVNA 1HYRC 3PL6B 5E0QA 4R7NB 5JIHA 1Q9OB 3NN8B 3FONA 4GRLA 3WN5B 3AAZB 3B3IA 2X1PA 1TPXB 4OF8A 5F72S 3W11C 4QRSA 1RZ8B 1WCQA 4XNYH 1GGTA 5KG9A 3FMGH 2LE9A 4U0RB 3OX8B 2Q7YB 5IM7B 7FABL 2XA8H 2D7TH 4ELKB 1MEXL 1JWMB 5BRZE 3HPJB 1AFVH 4GMTH 2YRZA 3FJTA 2EIEA 5DYOB 4PLOB 4B50A 5ELIA 3IDIB 4X5WB 1KF9B 4OGAC 2Q76B 5FYJE 2RQ8A 1P53A 3I9GH 1G9EA 4XP5L 4ZPTB 3VRIA 1S7VA 1TNMA 2IH1B 3K1DA 1XGQA 3O4LD 4PP1D 4MZ3A 2MQ3A 5GISL 4JO4H 1MPAH 3S8WA 1KPRB 2F54E 1N6QL 4NCDA 1CGTA 3LZFL 3FT2A 3V95A 5HI5C 4U1HB 5HD8C 2HJFB 3QUXB 1NKRA 3SE4C 4C56A 3OV6A 4OTXL 1NFIB 1AGEB 5A2LH 1KN2L 3VFGL 2EYRA 3L6FB 3FN0H 5IW6A 1CGUA 1XH3A 5EU7E 1P1ZA 5GRYA 1VGKB 2PXYA 5I1DB 1VADA 5J7CC 1CLCA 5FGBC 3BP5B 1DBBL 2PYEB 3WFBL 3IAQA 3UPCA 5GGTA 4G3YH 4XCFH 1SY6A 5JZ7C 3BZEB 4LIQH 1LEIA 4HJGB 4U6VH 4NJAH 4RAVB 4DOHE 3C60A 3DBXA 4P9HC 4U1IB 4XMKL 4UNTA 1BQLH 2GY7B 2JCCA 2RFXA 1HKLL 4NWTL 2BXZA 1FG2B 4RGOH 4TRPH 1YEDA 3HC4L 4RDQF 4FQ1H 3L3JA 5FO9B 3OJDA 3NFPB 3BKCH 3QDGA 5IEKA 2YRPA 1LE5B 4MCZA 4QHMB 5DD3L 2OZ4H 2XTJC 5FDWA 3CPLB 1GVIA 4HUXB 3FAXA 4ZUWA 1TVHB 4EI6A 1YNKH 2ARWA 2HKHH 3TYFA 4OCRH 3WJJA 4HT1H 3D25B 3IS1X 1JPGB 3CC5B 4LLUA 3OJVC 4OIIL 3GBML 1S7UB 4NO0B 3RNKA 2AXJA 4XMPL 5DK3A 4E42A 4BZYA 4QYOA 3PDOA 2WW8A 4NQXB 3V7MA 2ICWB 1NKOA 5E5MB 1RK1B 4D0CA 5CINL 4ODUA 3S37X 2MCPH 1A6AB 4Z7VE 1QA9B 1BVLA 5DD5H 1B6UA 3DIFB 4ONOA 4XMLH 2RIKA 4N8PA 1CDGA 3N06B 3EHBD 5GRVL 2B7DT 2F5AL 3DX8B 5E6ID 2YPVL 3BXNA 3BN3B 4NN5C 4YBQD 4FXGA 4PFEA 3ZL4L 1DBJH 2FATH 5K9QG 1ROWA