4ATTA

Fimh lectin domain co-crystal with a alpha-d-mannoside o-linked to a propynyl para methoxy phenyl
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title Validation of Reactivity Descriptors to Assess the Aromatic Stacking within the Tyrosine Gate of Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 38
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4attA00
4LOVA 3SQBB 3BFQG 2W07B 5FX3A 5FS5A 4AUJA 4XODA 4XOAA 2VCOA 4X5RA 4XOCA 1N0LB 5IQNA 5FLUA 1PDKB 5FWRA 4AV0A 5F3FA 1KIUB 3BWUF 4X5PA 4J3OH 4XO9A 5AALA 3MCYA 4AV5A 4XOEA 4AV4A 1KLFB 5IQMA 4AVIA 5AAPA 4J3OG 3JWNE 5LNGA 2UY6B 1TR7A 3ZL1A 2XG5B 4J3OF 2JMRA 5LNEA 1QUNB 3ZPDA 3BFWA 4AUYA 4CSSA 3ME0B 4CSTA 2XG4B 3ZL2A 5F2FA 5JQIB 5CGBA 1ZE3H 4AVJA 2WMPB 3JWNG 2UY7B 4CA4A 5ABZA 4XO8A 1N12A 4XOBA 5IQOA 3JWNH 4ATTA 1UWFA 5AB1A 3RFZA 2J2ZB 4X5QA 4AVHA 4AUUA 4AVKA 4X50A 2JTYA 4BUQA
chains in the Genus database with same CATH superfamily
1CGSL 3U0TA 4K94H 1S7SB 3TXAA 3D9AL 4HWBH 4IRJA 4JRXD 1TTAA 3LXBA 1H6UA 1WHPA 4NCC2 1TTBA 4LAQH 3TPKA 5EU5B 5GRJL 1GW0A 1TZHA 1ZCRA 2R0KH 4FMVA 1JUFB 1RD6A 3K7UA 2YKLL 4MZ2A 4DGIL 5ENWA 1RSYA 2Z91A 4WWPA 1IM3A 4P5MA 1DQML 1PCXA 1AXTH 3CSTA 3RWCA 1A4JA 5B3SB 2W65B 3O6LL 3IDXH 3T6QC 1JZ7A 3UYOD 2Z93A 2B4CH 5IR1B 5DWUL 4AI7A 5C0BD 4GG6E 2DICA 2BIMA 1ZLWH 1FIGH 3GXFA 5IMLA 2VUYA 4JO2H 4O58H 4OKVB 4WY7H 5KJRH 4ZXBD 3IS1X 2K4WA 2UWEE 4OD3H 3ZE1B 2XKNA 2IH8A 3AS0A 1M7IB 3RY6A 1A8JH 2BIOA 1GVIA 4ZD3H 2YPVA 2IOIA 1ITBB 4R97B 3PGCB 5F7LB 2FJUB 1KLFB 5E6ZA 3GIZH 5C2BH 3VG9C 3LB6C 3WUWG 5HSFA 2DMKA 1LEKA 1BQUA 3CDGB 4OLYL 4W6XB 3GKZA 1KNOA 5D4JA 4JHVA 1KIRB 2F7IA 4X7EC 1KGJA 5LNGA 1JGIA 2H2PC 4L1BA 4DKDC 4ABWA 2W81C 5DK2B 3MLZL 4ES8A 1K9TA 4ZX6A 4KOCA 4R7VA 4NKMA 4QOKE 4ANVA 4XNZC 4PW4A 4GUPA 4MD0A 4L0YA 1AY1H 4I85A 3ZKNC 2OR9L 1Q72L 4YMPA 2CR3A 2AQ1A 1T0NB 1ZLEA 3S88L 2GVYA 4OZFB 5BPPA 4FYRA 5IBLD 1HZHH 2OMWB 4GLRI 5DJDA 3GRBA 4DP7X 4W9ZA 5IHZB 3SSGA 4D7PA 2XDHA 3RI5K 5I19L 4TNFA 1KTDB 4XTRD 4K8RC 5D2LB 2TSAA 2P8MA 2LT9A 2WBKA 2W1NA 1HHIB 4KZEH 2V17H 2X0VA 1HIML 1HT6A 3NSCA 4IBZA 1EMTL 1EO5A 2EXYC 1QZNA 2JK5B 2OYLA 3QDME 5C0ND 2XV2A 4AY0A 1UQSA 1KEGH 5IJKA 5CZKA 5ESQA 1PG7X 1D7BA 2ARJA 1XH0A 1SZNA 4G9DB 4QNPE 3I9AA 2XFXB 3QJOA 3LQAC 4PREA 4KK9C 3PGDB 1P4LA 5FKPB 1U8MB 2O6CA 2F5AH 3U2IA 3MJGX 4WHTA 2G2RA 3FQWA 3V0GA 4G83A 3MRBB 2GB2A 4OUUA 4XCYB 4X6DB 4GAJH 2C4XA 5LVEA 4KFZC 2Z7WA 4G8AC 3AMLA 5CN1A 4TKWA 1MIEH 4GH7B 3WMSA 3K72B 1ZS8B 2FL5A 3QUHA 4ODWB 3O6FD 2O5NA 4QY8A 1OAQH 3RWJA 1FA4A 2VSCA 3MLVH 2WUBL 3SDAC 5I8OL 3QCVH 5E8DH 1ECZA 2A74B 2WY3B 1JTPA 5JIIA 1QLRA 3K2IA 1M6UA 3EYOB 1O7SA 3K91A 4PP1D 4U0RC 4N2CA 3OMNB 3MLUL 2R0ZL 4S1QL 2IJ0C 2IGLA 4JUSA 5KSBF 5AVWB 1OOAA 1FNSH 4HW6A 2YMXH 3B9VA 3HE6A 4YHML 2MKWA 2IGFH 1BVNP 4Z7IA 4X7TA 3LSOA 4LEEA 3EDJA 5FA3B 4AQEB 4K71C 4PB0L 2CDGB 4K8RL 4A2DA 1N4XH 4LASL 3G9VA 3GF8A 4M43L 3FSOA 3L1FA 4BKTC 2BP3A 1ZGLP 5D7LB 3AC0A 1RJCA 4OZHE 1T2QH 2VDNL 4F3FB 2Z7ZA 4WSJA 4UQ3B 4Y5VA 1RH8A 3BT2L 3EO0B 4B9YA 3HHMA 1N19A 5DFTA 1U4EA 4TUKL 3B6SA 3WSQH 1JWMB 1UOWA 3CZGA 4WTQA 4OQTA 2X1OA 3GMQB 2A9ML 5BJTB 1QFWL 2G75B 5EZOH 3TWYA 3ZKXB 2N01B 3LQAL 1J5DA 3KDPB 2DKMA 4MD4A 2R8SH 3IDNA 5IQ9A 2VDRH 5I15L 2F7RA 4N2HA 3CN1A 4WNSA 2WQWA 4JN1L 4MSWA 2BIQA 4UAOC 4ELMF 4IJ3B 4EIZC 1GRWA 3QEUA 3DOIA 1H8SA 4L9LA 4P4KB 5B1JA 4J3SA 3HNTL 2FWUA 5DFAA 3TJHD 1SBBA 4LPUA 2C9QA 4QKTA 4QYAA 2NY5L 2ZX5A 1MVUB 4LCIL 4GKSA 5KANG 2FEJA 2AXGB 1GGCH 2GJ6B 4HUCA 4UIKL 4WEEA 3MJ7B 1ZVYA 5F7HA 1MLCB 4MAYD 4H0GA 3DRQB 4Y2NA 3N91A 8CGTA 2VWEE 1MLBA 1HSAB 2B9AA 2X28A 4Q89A 1OY3B 5DSCB 3LIZL 3QJQB 3G5VB 5AVSB 1AXSB 1Z1WA 1IRAY 1K85A 1OCCB 1RK0B 3LQZA 5DS2A 5BMFH 2VDPB 3C5ZD 1E4WL 5IJBC 2Q76B 4X8JA 2DEXX 1A7NH 2OS7A 2K6WA 1V7NL 3VW3H 2HFEA 1F4WL 2AABL 3I85A 4ZTOH 2EIBA 2WXHA 2ZOWA 1VFMA 2R7EA 4M3JA 2L8AA 5D8JH 4PJ7B 4H20L 2MOQA 3V6OC 3DO7B 3W39A 4Q14A 4XGZB 5IBTH 2VDLL 4XMPL 5GHWL 3QEHA 2WSPA 2GT9A 2MKLC 1GPOL 4UT6L 5K9KA 1BQHB 2OSLB 4LL4A 2X2HA 3P1VA 3WN6A 2YWYA 3U0WL 5BW7C 5GZOC 3W5NA 3HC3L 1G7PB 3IJHA 3QI9D 1CE1L 1QLEB 3FUEA 3A6BL 2CRZA 3D2UA 5DU7A 5IFJB 3PNWB 1ZT4B 5DYOA 3TZVC 2P5EA 3HG3A 5BV7H 4MWFB 5EU7E 3DYMA 4D94A 4IKIA 5EO1B 4ZPTA 5GISH 3KGRA 3SD5A 1CYXA 1LO3H 4K07A 1KT2B 2X89A 5SWSA 3PDDA 3ULVD 1S5HA 3BUTA 4KTDH 3DX2A 1MY5A 4D9LH 1LO2L 2J56A 1V55B 3TL5A 3F58L 1VB9A 4Y1AD 4B9GA 4P07A 1IC4H 4URTB 2B1OA 2PTUA 5E6ID 1LO4H 4HZAA 1A3RL 1U92A 4KGJA 3CFKA 1JDAA 1RIVH 3PWLA 3QXUA 3O8XC 4IU3B 4PS4H 3MRRB 4KHXL 1NAMB 3GSRA 4XPFL 2R2HB 3ULUD 2RFXA 2IDQA 3HG5A 3LKNA 4PBXA 2YAQA 3C5ZB 4B3EA 4J5VA 3T3ME 1KYUA 3B7TA 4FFYL 4JDVB 1DL7L 3HKZA 2P5EE 1NLDH 5EUOF 3P0VL 4UV7H 5FFOA 1ML0A 3LEXA 2IPUK 2ADGA 2ESVA 3RTQB 3QDGD 4S1RH 2JI1A 4A2HA 5AENA 4GMTH 5HGHB 1DQLL 5SWSE 3MRQA 5EG6C 3BXNA 2R4SL 5CKGA 3MYZA 3Q8AA 3T8VA 1QX1A 2NW2B 3X12B 4FQHB 1YYCA 2VAAB 3MV9E 5KYWB 3UTTD 4JY4A 1MG2C 1ZGLA 4C55A 3CC1A 3Q5YA 1G7MA 2ZAHA 1EEYA 1HS6A 4MRCA 3DDFA 1AQMA 4Z95L 4H13C 1XGZA 3UZVA 3FPYA 3BMWA 3AU1B 4E9SA 1LE5A 4J7RA 3WG7B 3IU3B 3V52H 1JPFA 3BH9B 3GLZA 5E00B 2RGSA 2EH7H 4OAWB 3FU3A 4XC1H 5TDPA 3GO1H 5F9OH 1A6AB 4UB0H 2AK4D 4NERA 4XCEB 2DWDA 3L5WB 2OTUB 1GY2A 2P42B 4MA1B 1I31A 1L5GB 4MMZC 3I9GL 2ESVE 3MRLB 1QFPA 4QO1B 3AXLB 4N5ED 4P9HC 3ZHDA 5HHNB 4BM7A 4YDKH 2ZSVA 2O4EA 2X09A 1C5BH 4UOZA 3CFDB 1WSST 3CXHK 3SBWA 4LVNB 1VFAA 5C0AD 3AT0A 3V8OA 1U8PA 4EN3D 3RY5A 3FRPG 1HDMA 1OD7A 4TPRH 1AZZC 4JFEA 1JV2A 2DQCL 1UH4A 4B96A 3O2DL 4I5BA 2V4LA 3VXMB 5IWLC 5IV2B 4PRHE 5INDA 3FTZA 4KKAD 3ARBA 3FRUA 1JRHH 1MW3A 5G4MA 4PG2A 1RZ7H 5ABAA 1AJ7L 3HHRB 4WHDA 4JFPA 3B2XA 3QDGB 4AIEA 15C8H 3VXUA 4DH2A 1MUJB 3QAZC 2J88L 5ANMA 5AOIA 4LCUB 4MQXC 3QHZH 3ISWA 3U1SH 5BRPA 2UX7A 2VNCA 4WUKL 1JXDA 4F1SA 3ATDA 1RIUL 4D9QE 5EZLB 3UTTB 4XBEL 1OP4A 3P4MB 4JMNA 4OCSL 5CEZH 4EQ2A 5DD3L 2HSIA 5F9WB 2R59A 5DVPA 4H26B 1UCTA 2YBRB 1UA6L 4GW4B 4X42A 1WTGT 2OMYA 1NMAH 4JFEE 3QXVA 1FFTB 2C9SA 3D0LB 4DERA 3C5SB 3EO1B 3H9HA 4HH9B 4WSGA 3VSQA 2R2BA 2AK4B 4HDIB 5CZXC 5DEGA 4JPQA 5IEHA 3B2UC 2BSRB 2DQDH 3QDAA 1X4ZA 3P3UA 2WLLA 2CRMA 4IRSB 2ZCKH 1OF2A 5IHLB 3NSXA 2W80C 4IOFD 2DAVA 1OP5H 2GTZA 3VXUE 3B7RL 2WZPD 4KRLB 4WKZA 5ANME 1BZQK 4P9HL 1MCLA 2TRHA 5G4OA 3G6JB 3KXFB 4UDUA 4OF7A 4ORGA 1K5NB 3SDXF 5C0AB 2WXIA 4EN3B 2OBGA 5EIIG 2GBVA 2ADIA 5DHEA 1PZ2A 5M94B 3K6OA 2IQ9H 2J57A 5F7YC 5C09A 1D5ZA 2FHFA 4MNQE 4QJ4B 3O4OB 5JYMA 4HUVB 2HT4C 3KPMA 3D0VB 4ERSH 3H3KA 4FXLA 5ABZA 1DLHA 3X1EA 1QFUH 3RX5A 3QRBA 1XB6A 2WUCL 4BKLB 1BXUA 2XQBH 3L4XA 4MA3A 3EHBC 4P05A 4AM0A 3E6HB 2PW1B 4KKPA 4EUPH 4EDXA 3M45A 2DMBA 3DV4A 4WTWA 4KPHL 4PRPD 5TF1H 4AXWB 5TQ2L 1R46A 4BZ2L 4RAUB 5IHUL 3UABA 2B3IA 1RPKA 5KSAD 1VGKB 4LLYB 4HJEA 4HETA 1MZZA 4JFOA 4MJHA 2V2WB 3D5OF 4O2CB 2OK0H 4IM8A 4FQCH 3U48A 4GUOA 5C09E 1JK8A 4KXAA 2GBAA 3GGWB 3NZHH 2X4RA 3L1OH 2IPKA 4P5SA 1DVZA 4XOCA 3PG2A 4AEHL 4HUXA 4ZDHA 2P24A 2CXGA 3BN9C 3Q9PA 2DS4A 4G82A 5I8KH 3BGAA 3GMMA 3KPRB 4JPKH 3O2WL 4H40A 3OZ9H 2JIXA 1W8EA 2O6FA 5EBLA 2Z8RA 4XWGH 3ARGC 2K7QA 4MNHA 4X5PA 5K9QG 1ZLDA 4JGNA 1L6PA 4Z3IA 1G7QA 6PAZA 1G1KA 3I6GA 2YARA 1F56A 1S6NA 1A5FL 1MFDL 2I32A 2EP6A 5DFVC 5HVHC 1X4YA 5IQMA 3VJ6A 2APSA 1KPRB 1NL0L 4IU2A 3QQDA 5AAPA 2AI0L 1N68A 2H32B 2ZG3A 3BGMA 3LN4B 2QEJA 5FM4A 5ITFB 2WKGA 1UM4H 1KV3A 3TEZA 1GKEA 4ZNCD 3DIDA 2GUOA 2NY3C 4K73A 2LABA 2WOYA 4LGPB 1N10A 5TH2B 1RERA 3RFZB 4PRPB 1IT9L 4GIPD 3KPLB 1FFRA 1OTSD 3QQXA 5CP7B 2B5IB 5H35A 5KSAB 1PD6A 5FOBB 3MUZ1 4GMSL 1U3JA 4P2RB 5J12B 2WLKA 3FQXA 3KW8A 1UD6A 5KZCB 1FFPA 4PHXA 1T3FA 3FQYA 5B7MA 2QPDB 3P0GB 4TVPE 4P5TC 5IF0B 5B1CA 1SVBA 4K7PY 2B3RA 1P9MA 2P5WD 4JHBA 5DCCA 5DVOA 3PNRB 1SLUA 4B53A 2A9DA 1H5BC 2PCFB 1F4YH 1I9RL 3OKKA 3UAEA 1CU4H 4FZ8H 4OCXH 1YNLH 1JHLH 4XX1E 5GJTH 3RTLA 1QNZL 1Z9MA 2A7BA 2OCJA 1J1PL 4P59L 3N0AA 4Y4KD 1OLZA 2QPFA 2WZ5A 4NBYB 1JK9B 3C08H 2BRRL 4CN4A 5I5JA 4X9FA 1AGFA 1UOLA 3WKML 1JZEA 3FYIB 4DUWA 4HWUA 1RZ8B 3GJEA 5IREA 1V27A 3U6RB 3VGFA 4G80B 3EOAB 5DI8A 5L2JA 1ECYA 3GTNA 1GXEA 1F1AA 3N40F 3CSGA 5D2NB 4PRAB 2ITCA 4JQXA 3L8QA 4QIRA 1I8KA 2I7SA 3T0AA 3LQMA 1J8HA 1BM3H 1OGAD 2HXAA 4YHLH 1M71A 3CPLB 3TV8A 4YDLB 3ZKSD 2C7FA 1NTDA 3R19A 4FLRA 3N06B 2V7NA 3Q48A 2WIIB 4RDQF 4XXCC 4WO4C 2NTSP 5FECA 1VZGA 1XGQA 5FYKD 5HGAB 1MWAB 1ZHKA 4NBZB 4DW2H 4HUNB 3SKNB 3V6ZB 1I1CA 5C0GA 5DMKA 5T5FL 1PZCA 3V55A 3A47A 4MYPA 2GQHA 4LBEA 5T5NG 3QPQD 3O3DA 3VFPA 3WNOA 1RPUA 1SXSA 2B0SL 4M7JL 4Y16C 2D31B 1NEZG 4LPTA 1J8HE 5E8EA 2QADD 4QHNA 1T7YA 2ISDA 3RGVD 4LRIA 4MMXA 3UGXA 3W57A 4U49A 1QSFA 1I7ZB 1KLUA 2H6PA 3EH2A 2KQNA 2JV6A 4RIRA 1QUPA 4PB9L 2A83A 1ZLVK 4LCCB 5A2IH 2BNQB 3IPBA 4EUPA 2WQAA 1DZ0A 3P9LB 4FXGC 1NFDB 2NY1B 3BVUA 3OGOE 1LHZA 4D9RE 4K2UH 4M6OH 4OU3A 4R7DB 5DRZB 1MCKA 1ZHBA 2D03L 5F1IB 3TJEL 2H7WA 3O11A 3OR6B 4TYUA 1X5MA 3TS8A 1GC1C 1HEZA 1FL6A 3MRJA 1UM5L 3KWWB 2BP0A 2ILLA 5JXED 5AG8A 2AJYH 3P3RA 3ALXA 3CUPA 2Q6WA 2HB0A 2BNRD 2FGWH 4LLAA 4IJTA 3Q1SH 4ZTPH 1N5YH 1NAKL 1WBYB 3REVA 1CFNA 4ZAKD 1CDGA 3II2A 4YGVA 3ECBA 4MX7A 2AC0A 1A6VL 4P49A 1QSFE 4MXVF 4K3DH 2NUTA 1H3TA 3WU1A 2YUZA 2GAZA 1D6EB 2WPGA 5E4EB 1JN6B 4DT2A 1NGWB 3TWCL 4F7TA 1IAIM 4NIKB 1KB9J 5E1AB 4ADJA 2PUQT 1DQDL 5E56A 3WL9A 5KJ4A 5J6GB 4IRZL 2RCSH 3OAYH 3T09A 1HH6A 5D1ZI 1EK3A 4B50A 1YNTB 5HDBE 3RQ3A 2XQYG 1IGYB 3ARQA 2PO6A 2W9LA 1FBIH 1FNEA 3DXAD 2DEYX 4GO9A 4H88L 4J3WA 3N5AA 4XC3H 3FB8A 3IMVA 4G5ZL 4MQ7A 5MI0C 3TIEA 4Y5YA 3H3BC 2FB4H 2V2XB 3WFCL 3G5YB 4QRTB 2P8PA 2CO4A 3L3JB 3COOA 2DYPD 2BIPA 5ACZA 3BO8A 2ZX6A 3V0WL 3DSFL 3NJLA 3U7YL 4DWHA 5LCVH 5FS5A 3SE6A 3FUMA 2VDKL 3NJJA 4J3OD 4KTEH 4KAQH 1CDYA 1QHOA 4YR6B 2VN5A 2VLRD 1Q0YL 4KJYB 5T8IA 4JJOA 4NKIH 2DJMA 5KAQF 3RWGB 1TLMA 1J48A 1IZKA 1A6PA 4BIKA 2CSPA 1F0LA 4IIQC 4RMUA 2ATPA 3TBTA 4TN9A 2ZJSL 4JG1H 4ZFFB 2KLTA 3QHFL 5B3NA 3GBNL 1VPOH 3VO0A 3WS3B 4AYMC 4CSZA 2YD3A 3VXNA 5HI3C 4G11A 3F6LA 1U8KB 3BUDA 4LHUA 2ALWA 4LVHB 4G8IB 4YEEA 3L17A 1O6VA 2G3NA 4PBWD 4DFIA 3LZPA 2QKIC 1MJ7L 1COBA 1S9XA 1S9VA 4GINA 1B0GA 3GK8H 3B3BA 4TQEL 4WDIB 4JGJA 3RIKA 1X9UA 1MCSA 2VDMH 1WIUA 4M3HA 4R4ND 1FNHA 3LRLA 1G7HA 2MMXA 2E4TA 1CN4A 5EN3A 1XGUA 4P2OD 2E5EA 3PIQA 3Q6FB 3LEYH 1CFQA 2FT7A 3S5LA 3BLBA 3RP1A 1MEXL 2VH5H 5HYQA 5CEYA 3S3BB 4Y4FA 3DXAB 4S1DD 4TNVF 4WW1A 4JG5A 5C3TA 2VDQL 1WHOA 5J1AA 1O6TA 2SODB 3WFHA 2J20A 1OKEA 3IFPA 5JORB 4YK4C 1AC6A 5FHBH 5IMOB 3QEQB 4KV5E 3JT0A 4QPEA 5DC4B 1KIPA 2JKTM 3PDGA 1JGUH 4GBXA 2JKRM 1C5DA 4F93B 3LJ3A 3OG6B 4HT1H 5DC9B 4LKXB 3V10A 2G5UA 5C71A 3RKPA 4Q6IC 3UG5A 3NUKA 3ATAA 4NN7C 3MAWA 2HTLC 3M07A 5CZVL 3FT4A 2GITB 4QAWA 1G4RA 2BVYA 4N68A 1AKPA 3QDJD 5T3XE 1KN2L 3C6LC 3L95B 3RUGA 3SPJA 2O6DA 1D9KC 4ANUA 1A3QA 1TNMA 2JCCA 4NZTH 3O9WB 4BQCA 2UX6A 3DTXA 2ED6A 3V95A 4PTTB 4FQXA 4FXKA 5AW1B 5C0EA 3VWJB 1CBVL 3QFJD 4OF3A 3RNQB 4KHTL 4OV5A 1F00I 3I02A 3LH9A 4B0MM 3DSNB 1ZVSB 3L7FA 2NUPB 4UIMA 2EYSB 4M6ML 2H0JA 3ETBF 4AEFA 1FGVL 1BQLH 2BOCA 2OR8A 4AL8C 5EU6A 2YQBA 5KTEH 3R7QA 4U1LA 1YJDL 4WI6A 1KXQA 3VH8A 1P7QD 3N43B 2O5YH 2K78A 5TDNB 5DJZA 2R27A 4ZQKB 4QXUL 3FF8A 4WI5A 4MZRA 4CMHC 3NK3A 1G9EA 3B3IB 3DIFB 1ZVHA 1KFAH 1RJLB 2DLFL 5T1KA 4BE5A 1GH7A 2WOBA 5EIQA 1DJIA 4I87A 2F8IA 1G43A 4HBCH 4GP8B 3GMRA 4RZCB 5KBKA 4BSWB 2EZ0C 1YEKH 3BVNB 4RLDA 1MRDH 5DD0L 3NN8A 2JF1A 1E3ZA 1NCJA 3VNYA 3A6CH 3GRWH 1HHKA 3SE9L 3VA6A 1CE6B 3TN0D 3BHBA 4XOEA 4XVJH 4W70A 2D0HA 1BLNA 3NCJL 4DVRH 3OR7A 1FFOA 4YHOH 4XAKD 5CILL 1IEAB 4ETYA 6PCYA 2W0PA 1RQ5A 5EU6E 5CNHA 1BFTA 4LSVH 4NQCD 1FCCA 3FSVA 1FSKC 3VG9B 3GNMH 1MWOA 1H9VA 3BMVA 3FQ1A 3QNZB 5FM5M 4PGJA 3AG2B 1RHHB 4HGKC 4NZJA 3IPFA 2Z35A 4F7MA 5CUSH 3EFDH 3QJFA 4PJ5B 5E2TH 3UTSA 4A38A 2JSFA 2DEWX 3P3SA 4Y19B 1WAAE 1EHAA 3DECA 1G7JA 3MODL 4FI7A 1AR1C 3IETB 2V5SA 2X4OB 2FD6H 2XETA 3EJTA 3B2VL 2WLZA 1BFOA 2ZXEB 1N59A 3QFJB 3EAKA 3QIBD 5CJOH 3VFGH 4B60A 1FVEA 5ALCL 1WZAA 3FONA 3ZTEA 4J6RH 4XNZB 1NCTA 2VMCA 1KYFA 1RZQA 2QPUA 4X4ZA 4BRVA 3IFNL 4GRMB 5GZNC 3QVAA 1MCEA 5LCVA 1AH1A 4OI9A 1WV7T 5EO0B 4G42B 4AL8L 1HL5A 3JYBA 2FH6A 5CMAB 5GRYA 4FADA 2YSSB 1IGCH 2B1AH 4YPGB 5DQDL 2Z64C 2W9DH 5CGTA 3EBGA 4DKEL 4FQQB 3GBMH 3H42H 1MCPL 1BFSA 1HXYA 1LLAA 5J6HB 3VQMA 1FFNA 4WNQB 4BCXA 2OXHA 4GAGL 1KZYA 2GC7C 4ANKA 5D70H 2QQKH 4PJBB 3UTSE 3UC2A 4JVWA 1MPAL 1KB5A 4G9FB 2VDNB 2C4FU 2W0LA 1IC0A 3QEGL 3T4YA 1E5YA 2A9CA 4MCZB 4XBPA 1TT6A 4UTBH 2VDOL 4LOEA 4WSKA 3AG1B 3CHQA 3QZWB 3F6JA 3WTWA 3QR0A 4HEPA 3O2VH 4ZW7A 3AM8A 4L3CA 3S6CA 3T3PE 1B88A 2QPSA 4FLHA 4M62L 1F2XK 1FNFA 2EIMB 4ODSH 5ITBL 1S7TA 1PNCA 3ZW3A 2CPUA 1O0VA 1KACB 1SJMA 3FN9A 3SDXE 1J9QA 3BEVA 3OD3A 1MCWW 5CHNB 2WLNA 1UWXK 1KBGL 2OQJB 3KYMB 2EICA 3EFFA 2EEBA 5GRUL 1PYWA 3X1FA 4DZ8B 3QIBB 1E9OB 5E99H 3DI2B 5KS9B 3L3OB 3VRLE 3K2UH 1RPQA 4PU2A 3WFDL 5CM1A 5GS1A 5I1EL 1S7SA 5DDHB 4GSQA 4KXZH 1NEPA 2IADB 2HH0L 3FFDB 3U83A 4ZFZB 3F7VB 3UBXA 1WEJH 4PAZA 5E5RB 3GHEL 5BZZA 3ZZ1A 3T77B 3GQFA 1QACA 4JKPL 5CGYC 3EYFA 2AXFA 2BOLA 1CT8B 1PSKL 2FQFA 3M1BB 1ZD6A 2VT0A 4ICXA 4M8QA 1IEBB 3PWNB 1EZUA 2ADYA 2CH8A 4K71B 3GIVB 1WFOA 1MRCH 2R69L 1WS8A 2XWBB 2OLDA 3ARDD 4PUBL 5MENA 4GRLD 4RGNE 5AW2B 1AIFB 3UAJC 1M7IA 4M5ZH 4YGAB 3LNGA 1KGXA 5HYEA 1D5MB 3M46A 3MNZA 1DVFB 3FQUA 1RU9L 2KS0A 4F15C 3QXTA 4G7YL 1IJ9A 2HG5B 2VDLB 4NO3B 5E5MB 1G9MH 1B2WL 1G9HA 3JUZA 5CN3A 1RZPA 1EERB 1NLBL 2VR5A 3HG1A 3ZL1A 1A6WH 5LGJB 1WCBA 3HI5H 1WVZA 1JNJA 3CDGA 3NSJA 2Q3ZA 2CWRA 1S7VB 4LU5H 1H0DB 5AW4B 3RVUD 4XP1L 4L9DA 1KIRA 2FLRT 4AUYA 3KL0A 2VSKB 3LKRA 3QCTH 2GJJA 2AJSL 1KC5L 3SOTA 4IBWA 5JPNC 1T4KA 2QVKA 4G43A 1AQKH 5D4QA 1IGMH 4N28A 1CFMA 3CFBB 1CXKA 4HCRL 4L1HA 4IS6B 5BZWB 1T5XB 3ZE1E 2RACA 3MYJA 1F1DA 2R1YA 3NIGB 2WNWA 1MAMH 2BWDA 4Q56A 5I8EB 3TH2T 4Q9CA 4JRXA 2EH8L 2J25A 1SN0A 3SODB 3UBGA 1GW6A 1AR2A 3GRWA 2Z34A 4LESA 4MA8H 3OXRA 5JZ7C 5D72L 4E68A 3HFMH 1SXNA 2VQ4A 3HBZA 3TGXA 4ZUWB 4H1LG 2EDQA 4LLVA 1GMIA 1DHKA 3LDBC 3QZMA 3R8QA 1HHIA 4QHKJ 3UACA 1G9NH 3NFNA 3FU5A 3KGUA 3ZU8A 3IFOA 4TMPA 1UYWH 3N04A 3CVIH 5C0BA 1LYQA 3W11D 4YLBA 1TLKA 1KPUA 1IVTA 3BLKA 3F7YA 4ZXBA 4U31A 5DD1H 2BSDA 5D7JC 4DN4H 3DX7A 4G9DA 2VXTL 4JRYD 4WRLA 1T1XB 2H3NA 1JHKL 3IGAA 5HGBB 1RMFL 3PGDA 1X4XA 4B9PA 4KKLD 3MO1B 2ATKA 4HCIA 3RRQA 1Y6KR 3B7SA 4JRXE 4HIEB 4J4PD 1MFBH 4XCYA 4X6DA 4Y9EA 3GSQA 5D2LE 1FN4B 3TA3D 2G60H 4L37B 2K3HA 1MRFH 1T04B 4UT7L 5EF0A 3PCYA 4JFFA 4B3VA 4WI2A 3VXSD 2XIBA 3TZVB 1KIUB 3HG2A 4DP6X 3WNPA 5I66B 4D0BB 5C0BE 1PLBA 2N3JA 3GXNA 3LKSB 2HVKA 3FJTA 1PQZB 3EJSA 5J1SC 5EC2B 1M6OA 1NBQA 3L54A 1AZBA 5F97E 3RG1C 3T0WA 2HVJB 4UI2A 3EYUH 3SZ6A 4DAGH 4J23A 4NWTL 4I8DA 3OAUH 1HXMB 3MV01 1IAII 2DLGA 1FDLH 1FL5B 4RGOH 7PAZA 2KZBA 5AVQB 1TCRB 2Q5BA 4UTBA 1AGEA 2L7QA 4EVNA 5I1AB 2J72A 4M7LL 4X6DE 3ZGHA 2ORBL 2KPNA 3BAWA 3B2DC 2JNZA 5A40E 1YEGL 5SX4H 4KDWA 4UQ3A 3E3QE 3LVTA 1K8DB 1TQUA 2XZAH 1AHMA 2APWA 1JWMA 1UWYA 5D93B 4N8VG 2XG4B 1KJ2H 5BJTA 4HJGA 1URIA 1E5ZA 1FWXA 4R3SB 2G75A 5DK0B 3ULUH 3EGDB 4HGWA 1NSNH 3P77B 5HHVL 1RLWA 1PLAA 3B83A 3R0NA 3V5DA 2YQ3A 2F58H 1X44A 1XGPB 2H1PH 1G4MA 5AW9B 3QR1A 3O45A 3EDEA 3O6FA 4U6XB 4FEMA 1H9DA 1E3XA 3D39D 1MVUA 4S2SB 5KUKA 5D7LE 2UY6A 2X4PA 3QJZA 4UANA 2XKUA 3JBG7 3GKWH 4MFHA 1MLCA 1LK2B 2DWEB 2R0LH 4R2GD 3GTTA 4WWKC 1GS8A 4JO5A 4QAMB 4QXGL 5DSCA 2ROXA 1A14L 1JYWA 3V4VL 5FCUL 4UUJA 4UTAH 1JVOA 5DUPL 5HVWA 2HRHA 2VUKA 5CFAA 2Q76A 5FGBA 5JOPD 2F54D 3BUQA 4GRWB 4WNJA 4DGVH 3HS8A 5JUEL 4PJAA 2R56L 2EXSA 1URLA 3ZDXB 3LNFA 4FULA 3M17B 1UJ3C 5KVEH 4IBSA 3KLKA 1MQ8A 5KN5A 2OPCA 1BAWA 4FG2A 2F1BA 4Z0BL 4BZ1H 5IJDC 3KS0H 1F90L 1NCGA 4OIAA 1ZJBA 3SDDC 2WNXA 2YO3A 4ONFL 3BW9A 1TQVA 5L6YH 5MHSD 2APBA 3TT3H 4M5YL 3SPGA 3MLYH 1FF5A 3I6SA 3QAZB 2VRAA 3L5XH 3MRMB 2HRPH 2B15A 2YPKB 4DK5A 1BQRA 4R6UA 1M1SA 2Q8BH 2X6MA 1EJOH 3NQKA 5FUCC 3OJ2C 3RNKB 1H3XA 2KMWA 2GBUA 3GSWB 4UM9D 3ZYIA 1CGTA 4XWOC 2D7PA 3NACL 4G8GA 4LLUA 1UWEH 3K71A 4B95C 5EO1A 2VMFA 5I16B 2PWEA 4L2LA 3B8YA 1B6UA 4PJAE 3D39B 1ZAGA 2BY0A 4PJ7E 3O3EB 3T0DA 1NEUA 1MNUL 5I1CH 2D2OA 4E9YA 4MAYA 1GOHA 4XH2B 1IILE 4HWZB 1BYOA 1XGYL 4HIXH 2XN9B 4U7KA 2CLRA 2VM3A 3NCBB 5GGRB 4FTVB 3KD4A 2EEDA 4NM8H 2HVBA 2BMKB 1Y6NR 2HTKD 3HR6A 4N8CL 2EACA 4OW6A 1RZGA 1Z0NA 5FYJU 4PLJC 3BH8B 1I1FA 4TNVK 4YE4L 3ASOB 4YBLB 2FSEB 2C9AA 2VISA 4Z7OF 1U6AH 2Y7SA 1IZJA 4OB5L 1P6WA 4GKNB 4HHAA 2OZ4A 1GZQA 1UURA 4KGLA 4XRCA 4FNLH 3PL6C 5DLLA 1MFEH 5ICXA 5CSZA 4XO8A 3PHOA 1GGIH 5F0PB 5I73C 1HYSD 2JQMA 1E9QB 4NZ8A 4N25A 5H94A 2MWCA 4GQRA 2DQIL 4M6NH 2BY2A 3QI9A 3GHBH 3X12A 1NGPH 1HI6A 3BKML 2UYLB 2DRUA 4RISH 4E9LA 3K8MA 3RB5A 4JFTA 5DZJA 5HHPB 4F7PA 1N2RB 2ZAGA 1T1ZA 1UOKA 5E2WH 1IGIL 1JMXA 2RIKA 3KCPA 4BH7B 4G72B 1JD7A 3C2SA 3WNIA 4AG4H 5I1IL 5F7DB 4KZDL 4GXVL 1QEWA 2B14A 1FYHB 1P6AB 1XSKA 3ZIYA 5F21B 4UWQB 3VXOB 4JY6B 1OB1B 3QZOA 2B20A 4Y1AA 5KSUB 3BYTA 2IALB 3LN5B 3MRLA 5E6IA 2PABA 4QO1A 5GGTA 1ACYH 4XAWH 5E4IA 1KJ2A 3X14A 3MZGB 5HYSB 4OT1H 4O02L 3G3LA 4WQOA 3TEYA 1PLGH 3UBHA 4HLEA 1M2VB 2IFFL 2M1KA 5J06A 4QHUA 3VACA 1QBLL 3R1GH 1INQB 2B59B 2YXVA 5DD6A 5FFLA 3EJZC 5IV2A 5DO8A 1WZKA 3S8WA 4NIYE 2BPBA 3LEVL 4HULB 1QAWA 1Q1JL 2UXTA 2F7OA 3FH8A 5EZJB 3AXIA 3L45A 4YHZH 5DMGD 3QDGA 1P6FA 5IQ7H 3DUUA 4NUJB 1ZA6B 2AK1L 4UT9L 3EADA 3S36H 4FA8A 3ULVE 3VNZA 5JYLA 3U4BH 2D4FA 4G8EA 2VR7A 2I85A 3PFQA 4KRPD 4Y1AE 4XN1A 4BSVB 2ZF9A 3GJFB 2IH9A 4X2UA 3WXVL 2VGLM 5EZLA 1HILB 2BOBA 3UTTA 3LXUX 4JDTL 1KBPA 4ODTH 4CW1A 3MGTA 2XV0A 2P45B 2E9JA 3OXSB 3ULUE 4M5TA 4EBQH 1G6VK 1OAUH 2EDNA 3MV11 1ED3B 2CJUL 3D69B 1RZFL 2X3AA 4NUGH 1I8MB 3RAJH 2DM2A 4IDJH 3TVMD 3OB0K 2K8QA 2HLAB 4KWUA 2EQDA 2OJEA 1ZT7A 4HJIA 3AFLA 1AGBA 2QV2A 4P5TB 5DEJA 4IRJC 4LPWA 3FH5A 3CBRA 3T1FB 1TOXA 5B38A 5ISZD 1YMHB 2J1KA 4APQD 1T0PB 1TZ8A 1UD3A 1X6LA 2I25N 3QDGE 3MFFB 4RVBA 2R9HD 3O3BA 1TO5A 4OF0A 4BZ1A 5ID0B 3G6JA 3L7EB 2PTTB 4QTIH 1G7LA 5E2VL 3QG6B 5C0AA 1TTRA 4LPVA 4EN3A 4HA1A 3UTTE 4JPWH 4YXKL 4RMWA 2NX5D 1N6QH 1JF5A 3EYSL 4HUVA 2HKFH 4NJAL 1O9WA 4NFCA 4ONGL 4RA0C 5AWNH 3ZE0B 5DJCB 5DJXB 4PJBF 3I84A 3RY6C 4WZ9A 1QG3A 2A6IA 4R96A 2GBTA 4XP5L 2GK0B 3VFRA 4BQ9A 2XN2A 3OHMB 1BV8A 3E6HA 4MCYA 2AK4E 4YDVB 5TFSH 1JWUB 1NDMA 3A21A 4AXWA 4KVCH 3GMNB 4M48L 3NIFF 1Y07A 2GTQA 1E4JA 4DFHA 3EO9L 1S5IL 2C7UB 3VCLB 4LLYA 2VQ1B 4Z7UB 2Y36H 1IO4C 3G6JE 1C12A 4QKXB 3FN0L 1NGQL 3U4KA 4HG4J 5C0AE 4YX2L 2FLBT 1NCNA 1RXLA 1TCMA 5E4AA 4EKXA 4ZX3A 5FKAA 1WPCA 4QRPB 1VDGA 4F7EA 3HMXL 4LDLB 3RKDD 4C4UA 1XQ4A 5LNDA 3UYPB 3TVMB 2FIKB 4FQIL 1NM9A 3AB0B 3NSFA 1NJ9B 2YZ1A 4H8UA 4EMZA 3SYOA 5L88H 3T8MA 4TQPA 1FGNL 4M93B 4XNAA 1DUZA 5I71C 3QA3B 5KS9F 3PU7A 3DX8A 5IB5A 1A3LL 2VW4A 1WE5A 3MLTA 3DJTA 3MNVA 5FYKH 1SFHA 1TQSA 3F5WA 4N6RB 4OM1H 5DJ8A 2WZPA 3GBLA 2Y3NA 3ARVA 2ZUSA 3LRSA 4FN0A 2XBTA 3WFBH 4BCYA 1FAIL 3FOLB 2HRLA 2C34A 3VXTB 3QXDB 1PEZA 1LDSA 2B1HH 4PP2A 4X80H 2QVTA 3P4OA 3WHXA 3V6FA 5T1DL 3X1NA 1I8IB 2JJTC 2NX5B 5C92A 5B8CA 2WN3A 4QLWA 1OCRB 5IJKC 4AQ8A 2EXWC 2VDKB 2VMJA 5EEYA 1QQDA 3S37H 1RSFA 2X44D 1KPRA 5KVGE 4R4BA 2XG5B 2ZQKA 2L7JA 2VR9A 5F7AA 4CN1A 3KW7A 3IXTB 3ZTCC 2WWMC 1LQSR 2G4EA 2YPVL 1WBXB 4NGHH 5DJ2A 3IWVA 4OCWH 1UB6B 1W6LA 4V2BA 2AJXL 1U30A 2YAOA 4JQVA 3SZKC 5I1DA 4PRPA 1FH5L 1KCSL 2DJUA 1FC2D 2OMZA 3MROB 5KSAA 5FOBA 3OKMA 3RIAF 1URZA 2UZIL 1AC0A 3NJNA 4WEBH 3DNKA 1WA0X 2BJML 4JK0D 1AI1L 1SN2A 3T0VA 2ICWI 2Z8WC 3UMTA 3H53A 4NO5B 5CLWA 3IXAB 4K3JL 3FDWA 2XWXA 5DZNA 3VFUB 3E8UH 8FABA 2W5PA 4HH8A 4WK2B 3PE9A 4M00A 4ZMNA 3ARTA 3LRKA 1E4XH 1HEHC 4QMEA 4R0LB 3NIGF 5CBAA 2K45A 3D87B 3QNYA 2X2UA 4KFMA 1MCHA 35C8L 3FZUC 3HE6C 3DLQR 2IDTA 6FABL 1Q0XH 1WLHA 2VDQB 3EDFA 3N1QC 4PRPE 5DT1L 1JHTB 3CTTA 3GUTB 4PR5B 3VXQB 3ZRFC 4BWTA 5C8JA 1RZ8A 1MF2H 3QFDB 4G6AD 1CURA 3D0AA 3FQ4A 2PWHA 4TSAL 3HZKB 1MFCL 1OHZA 1TO4A 4B27A 5DVLA 4Y5VC 3FAWA 3QCUL 1CF8H 4OCMC 2FBJH 1CXEA 1WWBX 2VWEC 2LU7A 5KVDL 3CBKB 4FA7B 3WMQA 2KI6A 4MJ5A 2EAEA 2PWDA 4Z3HA 5A6MA 3TCXA 3BE1H 1R3IL 3NT0A 1JDDA 4P9MH 5J57B 4XPHL 1MWAA 2JJSA 3CN2A 2J2ZA 3SKNA 4J3OH 1EZSA 2WO4A 1OGTB 5EBWA 2EE9A 4L9LC 5B1JC 4GW5A 1S4IA 1Z32X 2QKIB 3PGFH 5E2UH 1JOIA 5F7NC 1KIQA 3MRIA 2BCMA 2MH4A 2P5WA 1CD8A 1WAEA 3T4AB 1OB0A 5B39B 2D31A 1A7RH 5CJBA 3TYGH 2AKRB 4XNMB 3JWNE 3GINA 2QGBA 3BWAA 4ZQTA 4CRPA 5HHXL 3OAWA 4G1MA 2IAMC 2H9GB 4Y4KA 1JFQL 1DSFH 4N0UB 4KI1A 1MJJA 2F53B 2P26A 1I3RA 4LCCA 4MRBA 2NYYC 5DRXA 5A7EA 3MDJA 5EU7C 3VE0B 2OZNA 1N26A 4NQTA 5DRZA 2EDMA 5FOJA 1TJGH 3HJ0A 3E6FB 4OZ4B 4YSUA 3UAFA 2E56A 3G04B 3AS1A 3W9EB 2A4EA 2F8OA 3EJCA 1R5VB 5HPOA 2JELH 2IWGA 1H15B 1MJUL 4QTHA 1CGYA 1U8IA 1E3FA 1OGAA 2P5WE 3F85A 5D6DC 4YSEA 1A8ZA 4Q6IB 4OQTL 4NN7B 4M56A 3B5HA 4K7FA 3P9WB 2X12A 1MN4A 4HIHA 2EVHA 1Q38A 4HAFA 4K94L 2QFPA 3S5LG 5C70A 3GI9H 1D9KB 3GSXA 2APVA 1SHWA 3FB7A 4LAQL 5LGHH 1DN0A 2R0KL 1V3MA 2UV3A 2WBXA 3L3DB 3QWRD 4WO0A 1NFDE 3SQRA 3PUUA 1RJYB 2Q86B 2I9LA 1AXTL 1DE4A 1HCYA 1R3JB 5AYQA 3KPQB 1P53A 5J6GA 1EVTC 3IDXL 5HD8C 3D85B 4CJ0A 2VJ0A 1AD0A 3HCVB 2B4CL 4W81A 2PPAA 1T03H 1YCSA 5KOVC 3RWEB 1YNTA 3G5WA 3NYKA 4X6FA 1EVUA 1FIGL 1NA8A 2MRYA 4WY7L 4O58L 5KJRL 4CMMB 3P40A 3VD5A 4OD3L 3RGVA 1OGAE 3SQBB 3ISRA 4MB5A 2ZX8A 3FSAA 4K7PH 5ESAA 3UJJH 1OWRM 4FXTA 2H0FA 4AUJA 3MBXH 1Q9LB 1E8XA 3OC5A 4I18B 4CMHB 2K8MA 3IYLW 2YD5A 4GSUA 1BLIA 2NY6C 3GIZL 1ZV5A 5F89A 5K39B 5HDWA 5C2BL 2MQCA 1TU2B 5FYKE 4DVBA 5IQNA 2X6UA 4PJ8C 4H2AA 4AQAA 3DETC 5EO9A 5HDOA 2FNBA 2J4WL 3SJVB 4KJYA 2DYRB 4KDTC 1ZLVH 1AO7B 5DHYB 4WU7B 5JXEA 4P23A 1BOGA 1KBVA 2VDOB 1M1XB 2DQTH 2CQVA 2BNRA 1UZ8B 4FHJA 1U91A 3AY4A 1JCVA 1OO2A 1FUNA 1AY1L 2G2NA 1E40A 4ZAKA 4P99A 4GUQA 1KTRL 4G8IA 1TQBB 3RBGA 1AZNA 4P3WA 4JS7A 2WTRA 2YJQA 1HZHL 5JHDD 1I8LA 1GGTA 2BVOA 4NDMB 3FU7A 3GEFA 3W81A 5DD5L 1NKOA 4GFXA 1VKXB 3ABGA 3BIAX 2HFTA 1G0DA 1AR1B 4E9XA 4PJIF 4TL4A 4KZEL 1ORQB 2V17L 3OLIA 3MLRH 1YUKB 3BH4A 3TEUA 2PW2A 1PDKA 4ODHL 3B5TA 1WQVT 4WKXA 2BC4B 5IW3A 4TLKA 3FO9B 2JH2A 2HMIC 1KEGL 3ILPB 2EO9A 3DOSB 4YHIB 5TPWH 3STZA 1TVBB 3DXAA 1QHPA 3EFOB 5F3HB 2BNRE 1AANA 1NUFA 2HCZX 2X1PA 5HYJD 5AVRB 2JWYA 4AEIL 3ESNA 1HWHB 2CK0H 1U21A 4LSUH 4XP4H 2DYPA 4JKMA 1NC4D 2Y7QB 5C07D 3UTZB 5JOFB 3LZNA 2DLTA 4GAJL 2NXYB 4FFVC 2VLRA 4WEMB 3ABLB 3RU8H 4EIBA 1MCNA 2YXWA 4TS6A 1MIEL 3FQNA 3NDYE 1Z5LB 3O41B 5E7FA 3ESVF 4CADA 4XCCH 5LN8A 2XQYK 1UATA 1W0VA 1OAQL 3MLVL 3CHPA 3K4ZA 3L95A 3QCVL 4NXSA 5E8DL 3O4LD 2NOYA 3QS3A 3DO4A 2YPLD 2BINA 1P1ZA 3MA9H 3NFSH 3OM3B 4CGUB 4ZNEA 5AW8B 4P46D 4M8VA 3DXAE 2V5RA 3ZMEA 4GW1A 4PRBA 3I6KB 5DR5H 2HKHH 5T1LB 4XP9H 4OLEA 1WRFA 5EZIH 1FORH 1UGNA 2YMXL 3SPVA 3VXRA 2VABB 2IGFL 1ZVSA 4XPGH 1CUOA 5LBSH 2D7TH 1JWSB 2EYSA 4TM9A 4UF7C 4FLOA 3IFLH 4UQ2A 1G5GA 1A64A 2OI9B 1N4XL 2Q1EA 4QHLB 1IAIH 1DVQA 5F6HI 2VLRE 1CDIA 4P2OA 1LEIB 1E90A 4DQOH 4JMXA 1XD1A 4YQXH 4ZQKA 4RESB 4U7MA 2G0KA 5F3FA 3KR3H 2ZUQC 5HVFB 4WV1A 3MNWB 1RJLA 1MCRA 1NIAA 1Q8MA 5AALA 2F6AA 1WFMA 2O93L 4E9QA 4JFQB 4ZNEE 2VMDA 5IGXL 3KLAA 3EG9A 5JQ6L 3N1PC 5EZOL 2RBLA 1ORSB 2CR6A 5CJ8A 2ENPA 1NC4B 2CLVA 3QWOB 4JPVH 5IJVB 5EF1A 4HFWB 3P9MB 3V0FA 3ML8A 2VDRL 5AOZA 2DQMA 1DEDA 5HJ3A 1NGXB 4WUUD 3IDJA 1SPDA 4K5NA 4AENA 5JNYA 3TO4D 5AB9A 1KJVB 3AAZA 3QJHA 5KBPA 4KO6A 3BYYA 1A47A 1U8LB 4YXLH 2XYCA 3B9KC 5ALBH 1U36A 2WBJC 3P4NB 3QDJA 3QNZA 3PABB 2RQEA 1INEL 5B3JF 3O4LB 4IMLA 1GGCL 1TZIB 3BSHA 3MGOB 4P46B 4EIUA 3ZTNH 1AOHA 2X40A 1XT5A 3NJGA 4TLSA 3QJXA 5JPNB 5C0IB 3MI6A 3QFJA 4Y2DA 3T65A 1JGEB 1KJMB 2AVGA 5BMFL 3BZ4B 2EYTA 1KWGA 3SKMB 1TJMA 3PJSB 3VW3L 2OMVB 1NOFA 4LSRH 4ZTOL 5C1MB 1QLFB 5EO0A 4G42A 1ROCA 2CM5A 5D8JL 1P7QA 4R5XA 1YVLA 5KSBA 1IB5A 1QYGH 2OAAA 1XZ0A 5F88A 3CDZA 1XH3B 3Q7JA 3CSPA 1Y18A 4WHYG 5IBTL 4WK4B 4X0NA 3BVWA 1OE3A 2G5RA 2XX0A 3QDJE 3WXWH 1K6QL 3LDBB 2JKSA 3WJLC 1OQXA 4L4JA 3GSNH 3LTVA 3QUMH 1X7QB 1SJVA 3ULSB 3PPSA 1QRND 3QFJE 1I4FA 2XPGB 2HLFD 4IHOB 2D2CC 3TN0A 2A2QT 2YQ2A 3QZWA 1XR8B 5HTSA 3ZE0F 5D7JB 1TMQA 5BV7L 1XGRA 3WY4A 1CTMA 3FOMA 1IM9B 1UVQB 4X0KB 4HG4K 4NQCA 5GISL 2W0FA 5E95B 1LO3L 3KLQA 4NRZA 4UBDD 3FUDA 3I2CH 4D9LL 1P2CA 4KTDL 4N1EA 3MOQA 2VIRA 3NIDF 1RZJC 3GSVB 2ZOLA 5ESVA 5CHNA 3L3HB 2HLEB 2HP4A 2E7LA 1FV1B 1LO4L 1NANI 4KJQD 4JHWH 1J11A 4A7SA 4DZ8A 1RIVL 4PS4L 2A9NL 5IB1B 5BOZG 1EDHA 1ZHNA 3L3OA 4X7DC 4MS8C 4LF3B 4RBPH 1P9MC 3QO1A 1MH5B 1IC7H 1X5IA 5KUMA 1KDJA 2DI7A 2E0PA 2BNUB 3OVUB 4N5UA 3GXMA 1NLDL 3T77A 1OW0A 3V4VB 4XAKE 2XICA 1M56B 4KXCA 3ZXAC 2W59A 1OT1A 5DUBB 4BQBA 1T7XA 1IBYA 4NQCE 5C08B 1MCFA 2J1WA 3BQUD 1M4KA 2FX9H 4FE9A 4FL4B 5FDYA 4TOYH 2YC1B 2ZXGA 4DF9A 5IB2B 3D4CA 3SKOB 3GLAA 1WC7A 2XWBA 4RMBA 1AIFA 5ICYB 1QR1B 1BECA 3C60C 3WNKA 1D5MA 4JQXC 4AW7A 1QRNB 4ZS6D 1LNUA 3BPLC 2W9EH 4CSSA 1QTYT 4N8UA 1YQVH 3KPPB 5LBSA 1OTUD 4L3FA 5FO7A 4DO4A 4WTXA 1NC2B 2UZPA 3U6XA 3V52L 2OYMA 2EH7L 4XC1L 3GO1L 5F9OL 2QSVA 2ARWA 5KYXA 2XKSA 4UB0L 1S7WB 1HFUA 4H0LC 1AD9B 4W4OC 4HK0B 2MPAH 2A6JA 1D5BA 1NZRA 1MHCA 4YDKL 4KJWD 1PBYA 5EB9A 4IS6A 3M7FB 3WN5C 3RIAK 5HGDA 2GABA 1BIHA 5DJ6B 1IKNC 4ABVA 4TPRL 1TYJA 2I24N 4PGZA 2GW5A 3T8XA 4ZUWA 3GPEA 4JFXB 1TYRA 4N9OB 2R51A 3UXFA 2BVQB 4LRIC 3ZDZE 1NCIA 3FH7A 1JRHL 2NY0C 3B8SA 1SRDA 4RWYH 1LO0H 1RZ7L 2VLKD 4XNBA 2VMEA 3S96B 4DCQB 4ECNA 2X41A 1XZWA 1TPXB 4M8RA 5I9QB 2O61A 15C8L 1TFPA 3AUVA 1EFXD 1T89A 1YC7A 3KLDA 3JVFC 4HS6B 4I0CC 4A6YB 1RIHH 1BVKB 3QHZL 2MNUA 3U1SL 3ARDA 4XN4A 1E2VA 4GRLA 5T33H 4YSPA 4YO0B 4KMLB 4IBYA 5HGBA 2WXFA 4JDZA 3BAEH 3VUAA 5CEZL 1OM3H 5L9DH 1LE9A 1E50A 5BOJA 2P8LB 3I3EA 4PCTA 4BQ8A 2XBDA 3TONA 3PJNA 1NMAL 3K0WA 3BP6A 1F6AB 1WWWX 1X5GA 3HKFA 1Q1PA 4NSKA 1T1YB 4ZW3A 5IW6A 5BS0B 4L37A 2R1WB 4CJ1A 2DQDL 5BZDB 4PPTA 5AL0A 3H9SA 2ZCKL 5HJDA 4WTZG 4MKMA 4D0BA 3LPFA 4GAYB 3HAEG 4Y1SA 5EZPA 3FO1A 5EC2A 3W0WB 1QA9B 4TQHA 4L0PB 2VR6A 3GSNA 4HJ1A 4KITB 2F19H 3T5WA 3QUMA 4NC2B 1HHJB 2AXHA 3B43A 2IQ9L 1ET7A 1LP9B 3JWDH 3QUXC 4WCYH 5EN2A 4GG8B 4WW2C 3ZDYE 2PO6C 4P2QB 2ADJB 2HT3C 4ERSL 5FCSH 2VLKB 3P73B 4Y5YC 5DEFB 4YJZL 2XQBL 3A23A 4I0PC 3NH7H 3CD4A 1Z2KA 4XMWA 1A1OB 5DTFB 2V0AA 4MMYA 1CICD 1U8NB 3Q2LA 1K8DA 2VYRE 3D25A 2AQPA 1WO2A 3PWPD 5L8JB 5CIPH 1BG1A 4JRYA 1AZVA 3CX2A 5DHXB 5E70A 3EW3B 5HDLA 4R3SA 4HFUH 5BQDA 3F7QA 4U3XA 3SPHA 3EGDA 4JZNB 3ATFA 1FNLA 3PL6B 32C2A 4NCDA 5K1JA 3RJDA 5I1KL 1MNNA 5I73B 2XU9A 2AZUA 3G08A 4ELKB 1F5WA 2OK0L 2BS9A 4FQCL 3FBKA 3DROB 2HT2D 4KUZH 3B2PA 4GKLA 5L4FA 1HQ4A 5AB1A 1AZRA 3NZHL 4FFZH 3L1OL 4U3CA 3TA3A 5JQHC 1XGPA 2B16A 1MVFA 3VXSA 1BX2B 5I8KL 5L2KD 4JPKL 4LZKA 3OZ9L 1ND0B 1JPST 5IW1B 4CUCA 4HUUB 4JFDB 4XWGL 4ZW6A 2J7LA 1LGVA 1IIIA 1F4AA 1SXBA 1SYSA 3GRGA 3IDUA 4R26H 2J6EH 3T6VA 5IZ7A 4GQZA 3TO2B 4JRYE 2FHCA 2ENJA 4JAMB 3T2LA 5K1NA 4LRNH 5EOCL 1IGJA 2Z92B 3L3GA 4EN2A 2CDEB 3BWUC 3TTYA 4Y4FC 2PP8A 1BIIA 3VM5A 3UFIA 3TV3H 4JM4H 3CX5K 4GSXA 1OGSA 3LIUA 3ZUCA 1EUTA 1SUJA 5BCAA 3BC9A 3BPCB 3HS9A 1UM4L 3S5YA 1GHFH 3UO1H 1KTLB 4ZK8A 3VXSE 1CDHA 2ZOKB 4GQ9H 5GGRY 2VQTA 3PWPB 2DLHA 3S4SG 1S9YB 2M83A 3FT1A 5AZ2H 3A67H 4J3UA 5I0ZA 3ECUA 1UKTA 4AEEA 4KU1A 1O7VA 4PFEA 4L4TD 3KWTA 2EYRB 2LFEA 4L8DB 5E1HB 5GS0D 5MEOA 2DQFA 3L81A 5GRVL 3HUJB 5DUMH 3K6SB 2YZ8A 2EUVA 4GB9A 1F4YL 5HHQA 1CU4L 3RNKA 4FZ8L 1UH3A 3MA7B 4OCXL 1YNLL 1JHLL 1ZV9A 5GJTL 1KG0B 3GXUB 2ZG1A 4XNUH 4GRWE 4KQ3H 3FHQA 2QJDA 1FZKB 5I16A 1VADB 5L2KB 2FR4A 5HPMA 3ZDXE 1CDCA 1O7DE 4BH8B 4FJYA 1EANA 3HB3D 4NQQA 2YD9A 4O2EB 3ZMNA 4PJDA 5IIEB 1SHSA 3OKDB 4Z78A 1WGOA 1VESA 2NY2B 1ZE3H 3U0TB 3KLLA 2V33A 5JO5B 4IRJB 1HJCA 2ZP8A 3ZKMC 3WFZA 4E5XG 3BUYA 1TZHB 3VB8A 5GQBA 3NQIA 2X6VA 4FQJL 1E5UI 1W15A 5ENWB 2Z91B 5K59F 1JZ4A 1IM3B 1BM3L 2F54A 3JZYA 4YHLL 2FK9A 3RWCB 1A4JB 4TUUA 2RHEA 5LBGA 5DFWH 2IXQA 3RVWC 3BGFB 1E27A 1PVHA 2R0WH 2Z93B 1F86A 4GKNA 1ETZA 3VD0A 4X6EB 1IAKA 3WKPA 5IMLB 5D7KD 3L5IA 3KPNA 4LLDA 4QD2E 4NUPA 2CD0A 3AACA 3D39E 3IJSA 1GA2A 2XKNB 4D3CH 3HNVH 1WF5A 3EJJX 3OKEA 3QW9A 4PJDE 3POHA 4MASA 3D34A 4N3UA 1QBBA 3GWJA 4WI8A 4FTVE 3QIUD 5DMIH 5DQJA 1ETA1 4OLUH 3ZQXA 4HGMA 5GZOD 3INUH 1KNOB 3OTTA 2XTLA 2B8OT 1DJGA 2F5BH 4UM9A 1YY9D 5JOPE 2F54E 4G7QB 4EEEA 1RUAH 4NHUA 1EDYA 1XGTA 3T9WA 1NCDH 1WCQA 2X4UA 1TNNA 4AKPA 4HHWA 4NKMB 1KEML 3TBCA 4MD0B 1YNKH 3HB3B 4GP5B 5KSUA 1VACA 2IALA 1NBZA 3K6DA 4K2UL 4M6OL 2AEPH 5CIPA 2MCG1 3RVTD 2WWKO 2ZE0A 3G5XA 1SBSH 3WBDA 3MCYA 1QFWI 2IGTA 5DJDB 5MHSE 1H6EA 3AQYA 2AJYL 2PYFA 4IBUA 1LXMA 5D71H 3RPKA 1OSZA 5FDWA 2P8MB 3BUPA 3MZTA 5PCYA 2FGWL 5D9SA 3OC8A 1AACA 2YLHA 3N85H 3Q1SL 5IKCB 2AVFA 4ZTPL 1N5YL 3OQ3B 4FFZA 4AT6A 2AQ3A 4UQDA 2Z7UA 3QARA 2EDKA 3OF6D 2G2PA 1TVDA 4K3DL 4JL1A 5ESQB 3NA9H 4NN5B 4NUJA 3DKHA 4OGYL 3AM8C 2PXYD 4JKKA 2AANA 4BQ6A 3EBIA 1U8CA 4LSDA 3HZYA 1P4LB 2J6EA 1LWJA 3D05A 2W94A 4WHTB 2G2RB 3FQWB 4NQDD 3ES6A 3QIUB 3MOBH 1NBYA 4OUUB 4L0ZA 3BZFA 4HPHA 4IBLT 3ESUF 4RGNC 4NOBA 4X6CB 1FBIL 2CU9A 2ITEA 4WFFD 3T2OA 2P43B 4XC3L 1J0IA 4YL9A 1ODUA 2FL5B 1H8LA 1NKGA 2CRYA 2LAGB 4MVBC 2Q2EB 3WUWA 2WB1A 2FB4L 4QY8B 4IBTA 5GS1C 3RWJB 3X13A 1T22A 3BKJH 1K4DA 1PJ9A 5HI4D 4M03A 5CD3A 1SDYA 1QLRB 1TEFA 4XO5A 1ZRUA 3KJ4B 4IGBD 5LCVL 2BVPA 3IVKA 2V8LA 1HQRA 1N9PA 4KAQL 4KTEL 3CFMA 8PAZA 3CHOA 2AV1A 4NKIL 3QT2A 1OCZB 3LZOA 1NBVH 2QKSA 3LSOB 3TH4T 4HV8A 4R7LA 5EWIL 1EZVX 2H2SC 4JG1L 1MW2A 3GMPA 2IVFC 4HF5L 1H6FA 2X05A 5DJXA 3ZZLA 2X4QB 3KL5A 1RUKL 4TNEA 3BFQG 3SGKA 1B3IA 1Y1DA 1ZLSL 4R97C 4Y5VB 4Q8BA 4YDVA 3B6SB 3N55A 3GK8L 2YLKA 4B97A 2PXYB 1CLVA 3N41B 3WHE0 2VDML 4A7GF 3SGEI 1SXCA 4I9XA 4KI5D 4PVMA 2UVEA 3AY2A 3JXAA 3I50L 2CBQA 3UIYA 4JFHE 4MD4B 4GFTB 4OJAA 5CR1A 4RFOH 3IDNB 1U41A 3LV3A 3GXIA 3D2UD 3HG4A 4AYBA 4BFFA 5IQ9B 1XF5A 2OSYA 2NYKA 3VFMA 4MSWB 4N4YB 5GRWA 2VH5L 4AGMA 5J3HC 3RDJA 3SKUD 5ACLA 3QEUB 4CKVX 3S8GB 4L9LB 1FZJA 1IKOP 5AEAA 3S7GA 4G1EA 3QA3A 1EJFA 1VRSA 1E2WA 2IAND 1C5CH 4GKSB 3CQQA 5FHBL 5ISZA 3S34H 2ICES 4WFGD 4APQA 1YPZA 5IFHH 5CEXA 3J27A 1V7MH 2VR8A 5DLMH 1MLBB 3C2AL 4HT1L 3IDIA 4Z7QE 1KBBA 2E9GA 5CZXD 3FOLA 3LQZB 2J5WA 1MCOH 5ACMA 2UXFA 4Z7UE 3U36A 5LAPA 4RMQA 1I8IA 1KN4H 4NC1E 4AIOA 2NX5A 3KPTA 3MXVH 1CK0H 1K3ZA 2HFEB 4ZXBC 4JO3H 3W38A 2R7EB 4F57H 2K6YA 3WENA 4NZTL 3RB7A 1E5AA 4XNYH 1F58H 1QHQA 3E9TA 4L23A 5JIPA 1J5OH 3W39B 5C0RH 1SOQA 5AVXB 4JLRA 1V3KA 3ZJAA 4ZW8A 3N44B 2GT9B 5K9KB 3IE4A 1XDTT 5ISZE 2GK2A 1J8RA 4HMCA 2EDXA 4XVUD 4AGNA 4FC3E 3AWEA 5KTEL 4JO4H 5D5MA 3DUSB 4OGXH 4MZ3A 4ATTA 3D2UB 3ZMRA 2O26U 3E3QC 5I6NA 2O5YL 5DYOB 5FEBA 3H3PH 3K6NA 4YDZA 3DBXB 2P4AB 2P5EB 3L9BA 1VA9A 1TZGH 3IXAA 5IK3A 2NX5E 4FG6D 1KFAL 2N7BA 2JTDA 3S35H 5C97A 2E9BA 1KYOK 3GB7A 4JRFA 4JREB 1TJXA 4ZPTB 4HBCL 5I0DA 4X7SH 4QRFA 1A4KB 3GZKA 1YEKL 2WK2A 4R0LA 2GIXA 3ME0A 1MRDL 5SWSB 3ZN6A 2OSXA 5AOJA 2GY5A 5C7ZA 1NOAA 3A6CL 3GRWL 1RHFA 4XTRC 3GXTA 9CGTA 3RDTA 1UH2A 3V5KA 3EBAA 4XVJL 4DVRL 1RUPH 3CFKB 3PWLB 4N2AA 4YHOL 3TBWA 1DP0A 3S3SA 5DJ0A 2RFXB 3LKNB 5D5ME 7CGTA 2ZOTA 5C0NC 3MRDA 4ATWA 4E9WA 4PGBA 2ZF8A 3P2DA 3GNML 3HZMA 3OX8A 4ZFQA 4EE2A 1L9TA 1EO8L 4A39A 5IUSA 3ARGD 3MVSA 1UGKA 2J8UB 5CUSL 2YK1H 3ABZA 5E2TL 4OUOA 1F02I 3L4CA 2XI9A 3ARBD 3EOYG 4DQAA 4F8LA 3LEXB 3QPXH 4UAHA 3ZKXC 5CJOL 3VFGL 2ESVB 3IF1A 2FWLB 4RAVB 4ZX4A 4LIQE 3MRQB 4AQ1A 4J6RL 5I5IA 4FKEA 3BXNB 5DZOA 2XY1A 1YN7A 4IJ3C 5DHVH 2G0LA 2VR3A 3IN2A 4D0DA 1RJZA 4ZUVA 4JY4B 2NY3D 1ZGLB 2YMTA 1G7MB 5DJYB 4ODUA 6CGTA 1EEYB 3O6FC 3PP3K 2B1AL 4N3TA 3S2CA 2HX7A 3B34A 2W9DL 1BGXH 3GT6A 2V3DA 3UZVB 3H42L 5GGSB 3EH4B 1LE5B 2VLJD 4PP1C 1CO1A 2UZXA 2VO8A 5KW9L 4PJ9A 2E3VA 5D70L 2QQKL 2O61B 1IBGH 1IBBA 2DWDB 2X9WA 3M86A 1Z7JA 1TXKA 3U1PA 1I1AA 1NQBA 4TQ8A 1MCWM 5CLYA 2ZXBA 4UTBL 5FGBC 3CFEA 1ADWA 2ZSVB 2XWZA 1UB5A 3FT3A 5T3ZD 2Z31A 3O2VL 1F11A 3KVPA 1B2YA 1FHGA 3WE1A 4JE4B 4Q0XH 3SO5A 4ODSL 3V79C 1U8PB 1HDMB 4F2FA 4LDEB 2DM7A 4JFEB 2DN7A 4PS8A 2ROYA 2VDRB 3H6AA 5KYYA 4F7CA 4NJ9H 4Y4HD 4ZMQA 4I5BB 4JPSA 4RH4A 1QSED 2X6AA 5INDB 3ARBB 2VOTA 3FRUB 4NRYA 1UC6A 1T6VN 5ADOH 1ANUA 2H47C 3W56A 3CFJA 4JFPB 5E99L 5C0CA 2X9XA 3VXUB 1MIMH 2C9PA 5L0QC 3K2UL 3VTMA 5ILTH 4PWHA 2D8KA 4XHJD 3QP3A 4NBXB 1WEJL 3ET9F 1TEGA 5I30H 3TJHC 1R3JA 4WO4D 2EE3A 4JFZH 3POCA 1KCKA 2HFFB 3DIVA 2VZTA 3NJFA 2YGVA 4ZTEA 2OMYB 2CDFB 1Z3GH 4HWEH 5JIHA 5FLVA 2JI2A 2LOEA 4MAYC 4N0CD 3C8DA 3B7UX 4OGQC 3H9HB 4OZIA 4CMMA 1YDPB 2AQRA 3LS5H 4U6VH 5DEGB 1T21A 1G87A 4BBWA 5IEHB 4YBQC 3JVGA 1NIFA 2WLLB 3OG4B 4M5ZL 4NO0D 1TQCC 1OF2B 2N59A 3A6OA 4N0YH 3C5ZC 2JIXD 1G9ML 2BHFA 2GTZB 1QFHA 4WKZB 2BXZA 1KENH 4F58H 3SIKA 1A6WL 2C1OA 4MCNA 3HI5L 1CD9B 2W88A 4CNIA 4ORGB 5BRQA 1QRKA 2LW3A 1ZLUK 1CLOH 4G6KH 1OP3K 4LU5L 2ADIB 4RMVA 1MHEA 1P1VA 2VRKA 5FV2A 3QCTL 1KYAA 4GI6A 1D5ZB 4WU7A 5I76A 3S5ZA 1G0XA 1VFBA 3KPMB 3M1OA 1S78D 1L9PA 3NEOA 1AQKL 1QSEB 3D2TA 1DLHB 2YGNA 1TTUA 5BV7B 2E6QA 4DUXA 3OJDA 3UTPD 3FRPA 4MA3B 4OZIE 1A7QH 3IMUA 2NNAA 4XPAL 1J1XH 4I89A 1AS6A 2Y5QA 3A4AA 3V0JA 1MAML 4EDXB 4OTXH 4W9KC 3TPUB 4FYSA 1WFNA 1K8IA 4BA8A 4MA8L 1BDYA 3CCHA 2Q20A 4WWNA 1WISA 3QWRA 1PZBA 2BSTA 3JTSB 4JFOB 3OQRA 3ILDA 4GG6F 1UM6H 3WIIH 1G9NL 1NWPA 1DEEB 3ULVC 2P46B 1UYWL 2HA1A 2UWEF 2EUZA 2ICEB 3AG4B 1FZOB 5B7EA 1YA5A 3LOWA 1BBDH 1CF1A 3KLHD 1UFUA 1E30A 3ILPA 5E6IC 1TMCB 2X4RB 2IPKB 2WYIA 3X3GH 1UD4A 3IGUA 3FTSA 4DN4L 4OD2A 5D7IA 4HUXB 5IM7A 2P24B 2R2EA 1P4BH 3DPDA 2WP3O 3WTYA 3GMMB 3ULUC 4FNRA 4ALAH 4Z6AT 2JIXB 5EBLB 2XNAA 3ZIMA 4NT6A 4XZUA 5JOFA 1LTXA 3UTZA 4PCKA 1Z6JT 4MNHB 1MFBL 5JDSA 4J27A 1Z9OA 3CVBA 5DHVA 2FBRA 3VB9A 4OM0H 1G7QB 1UT9A 3I6GB 2G60L 1MSPA 2XN1A 4JZJA 1MRFL 1X5FA 1N5AA 3ILQC 3S3PA 5CEZD 1SLXA 4ODBD 3DO3A 4UM8A 2OZ4L 1OSPH 3TYFB 3VJ6B 2VSDA 1IJNA 4IU2B 3QQDB 5D6CA 3JQOB 4JVPA 5E08H 1M7UA 1SN5A 3BGMB 3B37A 3MCLH 3D4GA 3CXFA 4FTDA 2ODIA 3HOGA 2XA3A 1Q0EA 3ARUA 3MUUA 3KWUA 5EIIA 5FB8A 2PPEA 2GUOB 4M1DH 2WQ8A 3F83A 1TZAA 3EYUL 2KLSA 4ODXA 4JR9H 1RUQH 5JHDA 3DX3A 3OAUL 4RGOL 5F9WC 3CJJA 4LCVA 5H35B 4HCRA 2PN5A 3ALWA 1JWSA 1V3LA 2FBOJ 4UOW0 2CA4A 1CIUA 1FFPB 5JLZB 4QHLA 4AGLA 1DJZA 3L9YA 2G9KA 4IKKA 1XSJA 1BVNT 3UAAA 2CM6A 2VB5A 4IRSC 3ULVL 4M1GH 3SCMD 3N9GL 1DQVA 4QNPF 3LPOA 4Q9RH 3OKKB 2XZAL 4N5EC 4WJKB 3UG3A 2GSGA 3RWDA 5AAWA 5HYJA 3FUFA 2IG2H 5GGTL 3L5JA 2XVGA 3PWVA 1KJ2L 3ZVVA 3S3JA 1GKOA 4EN3C 5AVVB 3VSVA 3ULUL 5C6TH 5GS2D 4QRRD 4OQ1A 5C07A 1NSNL 1AGFB 2VXQH 3HI1A 5JHDE 3O4OC 3P9MA 2X9YA 3D7PA 3JYCA 2Y1AA 2F58L 4KKAC 5DI8B 5L2JB 4JPIA 1CGSH 1HU8A 1IKFH 2H1PL 2ITCB 1I8KB 3DI3B 2H1XA 2VLLA 3OB8A 4C4KO 2IF7A 4ZOBA 2F61A 1F13A 2XLLA 1M71B 1DQMH 3O4LA 5JQIB 2YPLA 3LHPH 4LCYA 3GKWL 2J8OA 4P46A 3NP4A 4C83A 4E9RA 2D7OA 2EIKB 2IWFA 5FA4A 5HYJE 1YN6A 2V7NB 3NFPB 2R0LL 4A66A 5E6UB 2E27H 5FO8A 2YUXA 5FECB 1XGQB 4GOSA 3FCTA 3TF4A 2GSMB 1EAPB 1ZHKB 3C6LD 5JXAH 1BG9A 1JGEA 5C07E 5C0GB 2RQ8A 4LBEB 4WGVB 2GSIA 4JY5L 4OZHF 4M61A 4DGVL 3O3DB 3VFPB 3KBPA 1PZ5A 4FFWD 5HI5D 1T66D 1DBMH 5KVEL 4IOFC 2XHNA 4OLYH 4UQEA 3U9WA 2VM4A 5E8EB 4YVUA 2YD6A 3KPOB 4BZ1L 4Y8AA 4MMXB 2Y7LA 43CAA 2VZVA 3O4LE 2PMZA 2YPLE 5FV1L 1QSFB 2NY0B 3C5XA 1KLUB 2H6PB 4RIRB 1X7QA 4WENB 2A83B 5L6YL 4EUPB 4KVPA 3MLYL 3QGVA 4GEIA 4KUCF 5C6WH 4NNYA 4YNYB 2G9HB 4L8CA 4AQ8C 3L5XL 2XPGA 3HPJA 1ZHBB 2UUDK 2R23A 4IHOA 4DPAX 4WUUA 3RPBA 3O11B 4OVVA 3TO4A 4I3SH 1EA9C 1EJOL 1HEZB 2YS4A 3V4PH 2EZ0D 3MRJB 3VI4A 4GKZA 4Z0XA 2BP0B 1UWEL 2WZ0A 4OF8A 3EYQD 3CUPB 4JQVC 3RFZC 4AX3A 1EQWA 3T04D 4YHYB 3N41F 4ELDA 2LE9A 5I1CL 1HWGB 2B5IC 3LRMA 4X9YA 3IEAA 1CFNB 4E41D 2PCPA 5KSAC 3Q2NA 3TFKD 4YGVB 5J12C 4HIXL 3MXWH 2ENYA 3DMMD 1IGTA 1XCQA 3ECBB 3KBFA 4MX7B 4NKQB 2NUTB 4NM8L 2GAZB 4DOHE 2EDRA 2IV8A 1JPGA 4IW4C 4F7TB 3MJ9H 1SHXA 2E86A 2OJZH 4TNWF 3IDYB 4HKBA 2EDHA 4BYHA 2BNUA 4WUUE 3WL9B 2HJFB 2C8NA 2HPTA 3ELQA 1HH6B 3VI4E 1U6AL 2MQ0A 4JBSA 4XMLH 4WF7A 3QUKA 2E76C 5AG9A 3TJPA 1NCCH 4I77H 2PO6B 4FNLL 1FNEB 1NBCA 1MFEL 1KXVC 2Z8SA 1RZKC 3MV7D 1CGXA 1GGIL 4LPXA 5IB2A 1NCHA 2YC1A 3FB8B 2OX5A 4MQ7B 4KH2A 3TIEB 3UP1A 3FHAA 3QWQB 4Y5YB 4QI3A 3IMTA 5KBNC 3CMOH 1J7VR 3GHBL 2P8PB 1R0AH 1KULA 5CINH 2EEAA 5ACZB 3BO8B 1QRNA 4U2ZA 1NEZA 3F7KA 4PG9B 4RISL 4GBXD 2XTJD 3DGGA 3UBFA 3JWNC 2XXGA 4M7KL 4E36A 3KPPA 1GCYA 1ZSHA 1LD9A 4YDLC 4W68A 3AGWA 4OD1H 5H8DA 4AG4L 3IK2A 4YE0A 3ZR5A 4XBMA 4RFEA 3TBTB 2ATAA 1S7WA 1CGWA 4OJFH 2AJ3A 1OTSC 2V7HA 3N44F 4K8RH 4OVUA 1BF8A 5FHAH 3VXNB 4WI9A 1ZEAH 1W0YT 3ECQA 2H0EA 2JVUA 3KLSA 4UV4H 1ACYL 4XAWL 5A3ID 1SEBA 3T3MF 2JJUA 3KH4A 4OT1L 2FQEA 4RMTA 1S9VB 2EKJA 1FYTD 1B0GB 5KYUB 2ZWZA 1PLGL 2ZKWA 4NENA 1U3HD 1DUYA 2VXQA 5GS3A 3T2NL 3UEQA 4BFJA 1QRNE 3FT9A 3X3FH 5SWQA 1G7HB 4Y7MA 1C1EH 4LOVA 5AW6B 3IMBA 3PIQB 3S5LB 1CFQB 3OJVC 3W9DA 4Y4KC 1RP8A 5ELIA 1S3RA 2Z65C 5HYQB 2V9QA 4XMKH 4LCCC 4K5PA 5CEYB 4YHZL 4I0KA 3C09B 4Y4FB 5IQ7L 4XMZA 3S36L 3BQUA 4HS6A 2NY1C 4WW1B 5I6LA 1L7TH 4A6YA 1RZKL 3LVEA 1YECH 2ZD0A 3MUJA 1BVKA 5DURD 5J1AB 2IBZX 1BVZA 2YA0A 3IFPB 3CDYA 3MRKA 4EI5D 1YEEH 4LCIH 2MCMA 4DKAA 4Y0GA 3P11H 2XQYA 2EADA 4MDJA 1X5HA 4ODTL 4BHUI 1KV7A 4GBXB 4NNPH 3T0ED 3ESMA 4PJHB 1C5DB 5J8OA 2P80D 2P8LA 1PEWA 4EBQL 4MCMA 4J6IA 1OAUL 1V5JA 3W3BA 5CLTA 4NUGL 3RAJL 2CLZB 4IDJL 4R7NA 4HLZH 3MNDA 2EE2A 4KVNH 4NPYA 3FT4B 3HRZA 3H4FA 3TNNA 1QI4A 3RUGB 4FGMA 2X9ZA 5CS7A 2WV3A 1R3LA 2JCCB 1MWAL 3DURA 5E4EC 1SDDB 3DTXB 3KEDA 3DTUB 4FQXB 3EH3B 4FXKB 4ZUTA 3WJMA 3QPQC 4I48A 2VZ1A 4QTIL 3WEBA 2BP5M 2VAJA 5I0WA 3ZOAA 1FYTB 4OV5B 5EFIA 4ADGA 2Q2LA 1U3HB 3L7FB 4UIMB 4JPWL 4PW3A 1IFGA 1LP9A 3B1TA 1QSZA 3K5RA 5I6PA 2BOCB 1Z9SA 2ADJA 2HKFL 3RX9A 2YAPA 5DMYA 2Q7YB 5AWNL 2ZWYA 2AQQA 4U1LB 3V4PA 3VH8B 2QV4A 4Z7WB 4HXBH 4WI3A 2BH0A 2NZ1A 2VLKA 4UDTA 3G7TA 5DEFA 1F3DJ 3QUYD 2XWTB 1DTUA 5TFSL 1EFXA 3HLAA 5T1KB 4BFIB 2APXA 2H0PA 1R3KA 3IDGA 5GSVA 4KVCL 4NQXA 4P57A 3GMRB 4WI0B 4EI5B 3NN8B 4BGDA 3CXHJ 2Y36L 1R24B 3BKYH 4MTMA 5JXEC 1NPUA 1E4KC 1HHKB 4JZNA 4PV8B 2A5UA 4FQ1H 3BHBB 1BLNB 1A3RH 3AY4C 3MJ9A 3OR7B 4ABUA 1FFOB 5AW3B 3CG8A 2ZKMX 1LP9E 5HJBA 2WZ6A 4ZAKC 3FNKA 4TNGA 4ZMOA 1WG3A 1I8LC 2VLKE 1DL7H 4PV1C 5MEPB 4M7ZB 4F7MB 3QJFB 5ERWB 5FYKL 3UTSB 3VVWA 2MCAA 4OM1L 1G7JB 1I9JH 2YGOA 4M5SA 5E6SB 3WFBL 4Y2OA 4NX0A 1J8SA 1BFOB 3F7RA 4OFPA 2B1HL 1FVEB 3CSYA 3TO2A 3FONB 4JDEA 1PZDA 2DYSB 5ETUA 4YSTA 1OZUA 3C9NA 4NM4L 4AC4A 4OSUH 4NZUH 4A7TA 3S37L 5IB4A 5LN4A 2IV9A 1UUNA 4QGYA 4WU5A 1T1WA 3KVDD 3TM6A 3QUYB 4X4ME 4JHZA 4NGHL 1HXYB 4OCWL 1BQ5A 1KTLA 1FFNB 1AP2A 1CICA 2OXHB 4MYWB 4ONOA 3IMRA 4I9WD 1PG7W 3HZ3A 4J3OC 4XMUA 1P4IH 2ZPKL 5CR8A 3BD5A 4A04A 2QMKA 3T4YB 7FABH 2VXSH 2EYRA 4OR1A 1G7IA 2J12B 1CLZL 2VDMB 3PHQA 3HG1D 4L3CB 2OL3H 3E8UL 3L13A 5FW7A 1D3CA 1S7TB 3UOAB 5GGUA 1F8TH 2V5TA 3CVCA 4YH6A 3WTSA 1E4XL 5AQ0A 1DJXA 1YEDA 2QBWA 4S0SD 1I82A 4OZFG 1SJHA 4H1LH 3QO0A 4OLWH 3DJSA 1R3HA 1EAOA 1Q0XL 4R4NC 3QK0A 3EFFB 5IBUB 1PYWB 1JZ8A 3OAZK 1K3IA 5JHBA 1OGPA 3PWPE 5I6XB 3VYOA 2OYPA 4P2OC 5GS1B 2DKSA 3CVDA 5JO5A 1NPJA 2VM9A 3IPEA 2NXZD 3OLEA 3SDAA 2JKWA 3UBXB 3WHE1 5FR3A 4WUKH 4RX4D 4S1DC 4WV1C 1CF8L 4AYSA 3HUJE 2XV3A 4ZYKB 3EYFB 2AXFB 4JM2D 2YQGA 3S36X 3V9CA 3ESOA 4NKOA 5I5MA 4M8QB 1SMAA 2YRLA 5HHOD 4RDQG 1RK1A 2JTYA 4X6EA 1SF5A 4P9ML 4GO6B 4NYLA 5CGMA 2DIBA 5L2KE 2PCYA 3NCXA 1UD8A 1U2CA 4HJTA 5MENB 5I8CA 1S2EA 4NFBA 3MNZB 2EVIA 3FQUB 1RP9A 4Z3GA 2EDOA 4L4TA 3PGFL 1OPGH 2NMSA 1BYNA 3HG1B 1ZPUA 5CJ5A 1WCBB 5JPMA 3H9YA 3L9RB 2NZ9D 2QHRH 2COQA 4A2GA 5LWYL 1X5XA 3TYGL 4XMXA 3KG5A 3FF7A 5MEQA 1ZS2A 2BHYA 4DP5X 4DGYH 3LKRB 2XXFA 5FAAA 3O0RH 4JFFD 1T4KB 5ICZA 4G43B 3KPSD 1XL6A 1EHLH 3EBHA 5GSVB 5T1MA 3IBOA 1ZXKA 4Q4EA 1R5WA 2M8XA 1Y0LA 4BCZA 1SLWA 3QQ9C 1TJGL 3MYJB 2R1YB 2ADFH 3D33A 2Z8VC 2OP4H 4JRXB 3NBNA 2C1PB 2NXZB 4KK6D 4N90D 4HOWA 3OXRB 4L4TE 2BVTA 3MPCA 4BZ2H 5IHUH 5IESH 3EOTL 4LLVB 2WSKA 4U3SA 4JM2B 1Q90A 5IMKA 3HC4H 2BWIA 1NCAH 2EIEA 3NFNB 5IKCA 5E8NB 3IFOB 3OWEA 1KTBA 4AYFB 2CIKA 2QGDA 5C0BB 1ZTXH 1KPUB 2NPLX 5EIVA 1JVLA 3F7YB 4MB1A 4ZXBB 3CHRA 3S48A 3SQOH 3TN0C 4UNVA 4NOFA 5LGHL 3BPOC 1X5AA 5F0MB 1BQKA 3DX7B 3HPLA 1MFVA 1GOGA 5CGBA 3SGJC 2H3NB 4XE0A 3IGAB 3ZE2B 3CZJA 3V6OA 4R8WH 2ATKB 2B2XH 2JLLA 5F0JB 5FYKU 1SFDA 3DHJA 3QIUA 4ZO7A 1T03L 3IDMA 4OIBA 5TE4L 1Q9OA 1JIBA 3GSQB 3QNXA 5GZOA 1HJBC 1ICTA 1MFNA 2E7LC 3HC2A 4X6CA 3VFNA 3ZQWA 5CAYB 3MX0A 5DGRA 2XJLA 4K7PL 3UJJL 4JFFB 1BMGA 2BLFA 3QIBC 1D5RA 2NY5C 4AKOA 3MBXL 2CNYA 3L3OC 2IDCA 3JV4A 4LGSB 4CBPA 1NDGA 4X9GA 2HVKB 5TE7H 5D7KE 2LQRA 1GL4B 1JV5A 1M6OB 4NHCH 4TV3A 1HH9A 5KVDE 4LSQL 1QEXA 4AW4A 1EWHA 3TP4A 3S37X 5KAQG 4QJ3B 1BZ9A 3V6OE 2OR7A 1AGEB 3QISA 4EVNB 1HN1A 1SOKA 5EUKB 5GGQH 1CZ8H 2DQTL 5L7XH 3E9UA 2YIHA 2MFNA 1TITA 3BN3B 3ETTA 3QDHA 4U6TA 3O8XA 1BQHG 5EPMA 2X3BA 3C8HA 4Y89A 2X88A 4X6CE 2H4EA 2X4QA 2W8CA 3OF6A 1AKJD 1DVFC 5HHMD 3T6XA 2E6PA 4H1LA 2DQJL 1ONQA 4C54A 4W1TA 4WJ5A 2PXYA 3EJZD 4D8PA 3L4WA 4HJGB 1KTJA 4J28A 2D3VA 4DP0X 4LGRB 1JZGA 3MLRL 1U8HA 4HGWB 5HDBF 3WO3B 3QORD 3DHUA 4NQDA 1M7DA 2FWOA 4HWBA 4LXFA 2X1WL 4QXWA 4TULH 3V5DB 4L8SA 1HAWA 5INCA 3E38A 4NAMA 5TPWL 1HE7A 2FEEL 4G8GD 2D3JA 3PPEA 2V2TA 3O45B 1Q9WA 3QIWD 3O6FB 2H3XC 1AS7A 3FCSA 1DSYA 3CPUA 2BZCA 4KROD 2CK0L 2IIJA 2WINA 5I1LA 2UY6B 4NO2A 2X4PB 4LSUL 4XP4L 2DV6A 3ML9A 1UKSA 1L7IH 1F3JB 2G4GA 4IGBA 2K70A 4TNWK 3SE8H 1ILSA 1TJHH 3P30H 3RU8L 4J3BA 4UUJB 4OCNC 3NABH 2CHNA 2OMXB 2GJRA