4ATTA

Fimh lectin domain co-crystal with a alpha-d-mannoside o-linked to a propynyl para methoxy phenyl
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIMH
publication title Validation of Reactivity Descriptors to Assess the Aromatic Stacking within the Tyrosine Gate of Fimh.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 38
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4attA00
4AVJA 3BFWA 4J3OF 4XOBA 5FX3A 4X50A 4XODA 2VCOA 5F3FA 4AVHA 4AV4A 4AVIA 4X5QA 2WMPB 3JWNG 4XOCA 5FS5A 4J3OH 4XO8A 1QUNB 4CSSA 4AUJA 5LNEA 5LNGA 1ZE3H 5JQIB 4BUQA 5AALA 3ME0B 1KIUB 5FWRA 4J3OG 5CGBA 2JMRA 5AB1A 4LOVA 3ZL1A 4X5RA 4AV0A 5IQOA 4XO9A 4AV5A 4CSTA 5ABZA 3RFZA 1KLFB 2JTYA 1N0LB 2UY6B 5AAPA 4AUYA 5FLUA 3MCYA 2XG5B 3BFQG 2J2ZB 3JWNE 4X5PA 4ATTA 1PDKB 5IQNA 4XOEA 5F2FA 1TR7A 4AUUA 1N12A 3BWUF 4AVKA 3ZPDA 1UWFA 3ZL2A 4CA4A 3SQBB 2UY7B 4XOAA 2XG4B 3JWNH 2W07B 5IQMA
chains in the Genus database with same CATH superfamily
2OCCB 4N86A 4DZBA 4WU7A 1J0YA 2HZHA 4W4OA 2HX8A 5ID1B 5IOPA 1RZ7H 1GYAA 4E42B 1AJ7H 3CFDA 5J0BA 4YHOH 1T7XA 2WQ8A 3GMLB 3IGLA 3B7UX 5EN2A 1I85C 3BLKA 1OWWA 5E6SB 1JVLA 1DQJB 2J25A 3QIWD 5JIKA 3WAJA 1XFPA 2YSSA 5B1AB 1URZA 2YA0A 3BCDA 1MWAA 3O41B 4IRJD 1REIA 4JG0H 4WFHD 5D71L 5EO1A 1MCDA 1VLXA 5DRXA 5A7EA 3LN4B 4MJ6B 4KKLC 2JELL 2XKSA 1D5ZB 2Y2WA 3OZLA 2EUWA 2ZX9A 1BA9A 5AW1B 2ADJA 3UTQB 4OZIF 4X4ME 1EX0A 2A2QT 4D9RE 4CU7A 1O75A 2ZWLT 3NIDF 1AY1H 2R27A 3ARZA 4HW6A 3GXMA 5C07D 1L6PA 3H6JA 1BD2E 4W68A 2A9ML 4IDJL 5CEZD 4OLEA 2GITA 1I3VA 2EKSB 3DHJA 3H9SB 4FMKA 4ZUTB 3CIAA 5AUMB 1BXAA 3MJWA 1QSEA 3V6ZB 4NSKA 5D7EA 5L9DL 3PP4L 4HWEL 1UQSB 5MI0C 4XP1H 3MRNA 4FFVC 4GB9A 1TYRA 3NT0A 4TOYH 2HG5A 1WP6A 2GIMA 5E9DB 3WDIA 1QKZL 5CGMA 4HT1H 1ZA6B 3NZSA 4OCWH 2YO3A 3MRBB 3VDBA 3K72A 1Y1UA 4K15A 4QRAA 4AOFA 1IKNA 5C6WH 5CM1A 4JKMA 4HU8A 2KBGA 3B9EA 3DUSA 3CVIL 2AXGB 2EC8A 3F7QA 3HPLB 4XMPL 4MAYD 1J1XL 3LZPA 3EHBB 4FHBD 4LFHD 4LCIH 1TQWA 3FU5A 1PZUB 2P7TA 2CJSA 2VDKH 4A7SA 1OWRM 4UB0H 1OW0A 1GZPA 2CNYA 5FYJE 5I2IB 2VN5A 4HC1A 1S7WA 4NO2B 4A7QA 5GS0L 2F54D 4XCFH 3DIFB 3LMJL 4MD5B 2OM5A 4UYPA 5D7LE 2NY4D 1ORQA 4NQDB 2EVGA 1QBLH 4QCIB 3MACH 4ELDA 1AQDA 3LIZH 4NRYB 2R56H 3T3MF 8FABB 4TNGA 5ITFA 1SOKA 4IMKC 3ARDB 4G7SB 1JGIA 3SDCB 3BKCH 1YECH 1BWMA 1MCRA 4X80L 3X2QB 1EV2E 1OPGH 1QR1A 5ISZA 4ICWA 1LTXA 4FQHA 2V3DA 4R7LA 1R0AH 4N3TA 1U3HD 1MCJA 3P4MB 3U7YH 4AYDC 4ENZA 1PKQA 3VG9C 3BKMH 4X2UA 3M1BB 1CXIA 4AE0A 1PG7X 4N8VB 1KULA 1AGDB 3X12A 4OUUB 3BDYH 3LPWA 4P9ML 1QVOA 3OAZK 3WUWG 3NA9H 4QO1B 1ETJA 2CLZB 3JV0A 4KO6A 1AR1B 3SY0A 4DK6A 3C6EA 1PFOA 3BUYB 2WVUA 3MYZA 3DK2A 2IBBA 3GSOA 5EUOE 2CLVB 4FXTA 5C0IB 4ZMTA 1YNTA 5DC9B 3C5JB 4YFLI 1FYTB 1IGCL 4OD1H 4YGVB 1GGUA 5EU3B 1FZMB 4LCVA 1BQRA 3N41B 4WDIB 4D94A 4JFEB 4YSCA 1A6VL 4JO5A 5FOJA 2QZ5A 2A74C 3G5VB 5FM4A 3EYFA 2VXUL 3FN0L 1IAOB 3N40F 2W9DH 1CL7H 1VKXB 1YNLL 3DTXA 4P99A 5JO5A 3CFCL 5I1HL 4NQSA 1I75A 1N6UA 4PRID 4NBYB 3SKNA 4AJ0A 1D5XB 1MJUH 2ZWKA 1ZT1A 1DLFH 2YJQA 3G08A 1B0IA 3ULVL 3OSVA 3IFNH 3MLVL 3H55A 2FNBA 1TJIH 1LE5B 2XC8A 2YGVA 3P73A 3F62A 3L7EA 4L8DA 3TBTB 2IH3A 1OD9A 3QCUH 5FDYA 3VXSD 3U82B 2V3FA 2AZAA 4ZT1A 1YEFH 5IQLA 4AQZA 4O2CB 1YEJL 3N3EA 5D1ZB 3HR5B 1C5BH 4MVBC 1PLBA 4WV1C 3VGBA 5A2IH 4LSDA 3GUTA 1AACA 1IV8A 4LEXH 3VI3B 2NOYA 4LEOB 1C5DB 2HT4D 4O02H 4ENED 3TS8A 4JNXA 4YWGH 4ODVL 4XWGH 4JFED 3BAYA 4KAQL 4LASH 4O4YH 4G80A 3CSTA 3V0DA 4FAAB 2VDQB 3DDFA 4GRLD 5GGVH 2UX7A 4M7KL 1G7LA 2JWYA 2QPSA 5J06A 1QHOA 3MLZL 3NIFB 1HI6A 4P3CL 3SGKA 3IJ7A 2P5EE 4RISH 2VZVA 1QTSA 2VXVL 2W94A 3GIVB 1NJ9B 4BFIB 5FDWB 1AHKA 3QZOA 3QUXA 1B4RA 4LXFA 4O58H 4I0PA 2BMKA 2JCCB 4CNIA 4XPFH 1ONQA 2QKIC 4MJ5B 4ABVA 1KYUA 4FFZH 1KJ2L 1ZV5A 2K1MA 4YX2H 1W72L 1GYWA 3ISYA 4FNTA 4GSQA 1PTZA 4X50A 3D2UB 5C0BB 1FP5A 3EJZD 4DVBA 3TBSA 5F96L 5TDPA 1CG9B 1DBJH 3BN3B 3FFCA 4QT5A 4RFNB 2FEDC 3QUKB 4LCYA 1X6LA 4B95C 2QV4A 4KNTA 4OCYH 3FOLA 3LKPA 2HJFA 2VH5H 3MYJB 2AV7A 3VTAA 2X09A 3Q9QA 4AITA 2FX7H 3CFEB 1QSFB 4KKCC 4YAQB 3ZR5A 3QDGE 2LVCA 5JZ7D 3VGFA 4AGNA 3ZE2B 4TPRH 1BQLL 3FRPA 3DETD 3RQ3A 3QIWA 4YO0B 4NRZA 4L4TE 3FAXA 5F3HB 3TX4A 1HZKA 4M8QB 4LPVA 3QJHA 1AANA 5FUZH 1DN0A 3VH8A 2Z31B 5ILTH 5IMLB 2ZOUA 5IBLC 5DR5L 4ELMA 1AKPA 1HXYA 4KGLA 5GGVY 4M1DH 4W9IC 1SUHA 3OHXC 1NBZB 4YK4C 4OCXH 3A4EA 1CLZL 2YPVL 3KR3L 3OPZH 1CFNB 2EIDA 2W80C 3OZKA 5IB4A 4Z1PA 4JY4B 5CN2A 2EYTA 2LU3A 3LKNA 3QFDB 5C07A 5I1KL 5I75B 2A1WL 2A7BA 5E5RB 5F1IA 3E3QC 1Z3GH 4DN3H 4NOFA 4NO0A 5J7CC 1YEDA 3L5IA 4PVNA 3Q2NA 2QDVA 2AEQH 1BQSA 3H42H 2DQGL 2ZF9A 5TGBB 5IT2H 4ABUA 1KCKA 5IEHA 3NH7L 3ARPA 3KDMB 3RWHB 1HHGB 4KMTL 4QHNA 3BKYH 4MCZB 2X1OA 1JNHB 5ACMA 1MCHA 2L8AA 2A6IB 4PLJC 2DQTH 1ZIBA 3LYRA 3ZE1B 2G60H 1H15A 1LYQA 2MPAH 2DWTA 3SPVA 3O4LD 5FV1L 5CN3A 4CGTA 4EIGB 2AQRA 4LLQB 3ZT7A 3AU0A 3RZCB 1GGYA 4TULH 3FQUB 3HS8A 5IJVB 3L9YA 4IBYA 4MMZC 2ICEB 3PY9A 1DR9A 1PF3A 3EZ8A 3B2DC 4MAYA 4QEGA 4XO4A 4PQXA 3FYIB 3V6OC 3ULUC 4FFYH 2LFEA 4NN7C 4XE5B 1BD2B 1ZTMA 4F58H 4NNPL 4ANUA 2DKUA 1YRKA 3KVPA 2OSLB 5T3XE 5KVGH 1TKWA 2VM3A 5FCSH 3RL1B 1U8NB 5IMOB 1TZGL 2W59A 2X0UA 1VDGA 2F54A 4Y16B 2YMXH 2DLIA 4Y8AA 2XIBA 4R4BB 4QRBA 2K8QA 2EKSA 2QPUA 5TK4A 4KTDL 3NRQA 3PAZA 1F1GA 2HVJB 3LEYL 3IRZA 4TRPL 1PQZB 5EBWA 5I0DA 4TUOA 4PJIF 3GNML 3FQ2A 3MGAA 3JT2A 1OSYA 1U95A 4KHXH 4GOSA 4NO3B 3RAJL 4QWWD 5DA0B 5IG7B 2CPUA 5BCAA 1CXKA 1OTSC 3BE1H 4J8RA 4B9IA 4PB9L 1SXZA 3CZUB 3ML9A 4BFKA 4UQ2B 2E5EA 2Y22A 4KI5D 4M1CC 1U3HA 5DC2A 1EBAA 3ZKNC 5JR1H 4Q4IA 1BEYL 5C0CD 3L3GB 2XU9A 1QEWA 4PB0H 4F7MB 1ZMYA 3PHQB 5GGRA 1T1XB 2BSDA 4JREC 4B97A 2JJSC 2ED8A 3DJ9A 4L29A 4U3CA 5T1KB 4IQHA 3HE7D 1A5FL 2WTRA 1PSKL 2YOCA 2G0KA 4GBXC 4PRBB 1W15A 4YHZL 5B7FA 4JQXC 5HHPA 2YAFA 3EOTL 4NO2A 4AEHH 1EK3A 3CH8A 3OAZH 5CKAA 4NQDA 2NY3B 4QJ5B 4M61A 3N9GL 5BRPA 5F6IB 3GSVB 4XRCA 3U7AA 2IOIA 3VFOA 3I9GL 3V52H 3FQRB 3N06B 4UTBH 3ECUA 2DQIL 4G7QB 3ARDA 3UAJC 1X5LA 5IR1B 3GZOA 3TU6A 4GRMA 1R17A 4LPTA 2AJSL 2GCYA 3ROOA 3SDCA 2AQPA 5E94A 3VRJA 1K8DA 3WN5C 1RJLB 3MNMA 3MRDA 1CGTA 1MRFH 4LU5H 2ALAA 4PRIA 3TVMD 3ZHFA 5IWLA 4JFHE 5DO2C 2VR6A 2VW7A 1XH2A 2AVFA 1CICB 1R46A 3QJQB 3P4MA 5C0AE 1NDMA 2E76C 4JY6B 2YC1B 3FHQA 4TLKA 2WJ5A 1EERB 4LSTL 4YC2C 4LCWB 4OQ1A 4TQ8A 2FSDA 4JW3A 1G1KA 1XL6A 1E28A 2P1YA 2XX0A 4N8VA 2YBRA 5BQ7A 4OT1L 4OFYD 4B9PA 4FULA 1PG7H 1X9UA 4H8PA 5F9AC 4HUVB 1RZKC 2BY3A 4ZW7A 1SMOA 3LZOA 3V9FA 5JDSB 4UOW1 2J1ZA 2Z93B 1HXKA 5EOCJ 5C0IA 4YJZL 5BOZG 3LB6C 2J6EA 5E4EC 4WI9A 2YUXA 2OCFD 3MXVH 2DEWX 4ODSL 5GS1B 3MV7E 4UYQA 2V7NB 4IBWA 4JFEA 1M1SA 3TF7C 1G1YA 4DKTA 1SOQA 3AT0A 4K23L 2K7QA 3G5VA 4GRLA 3T0VA 2UY6A 3UGEA 4N2HA 4WI3A 1Q9KA 4Z3FA 2ADGB 2BHYA 2NY0D 3JTTB 1DBAL 3WFHB 2KL6A 4L9LB 4NQCE 1D5XA 4M3HA 2WWKO 2MSPA 1HDMB 3BPOC 4NP9A 1PY4A 5FFLA 4TSBH 5IP4A 4MA1B 4LCUA 3NZHH 1NWPA 1OVZA 3COOA 4HS6B 1BVZA 2KC0A 4M5ZL 3RP1A 1GXEA 2B16A 4UAOB 2EAEA 3LCYA 1DQLL 2N01B 4XOCA 3TBTA 3V4PH 5GRJH 1ZPLA 2NSMA 4JKKA 4M56A 3EO9H 3RI5F 2BIQA 4B96A 1TTBA 3PJLA 3BEVA 3UTPE 2GJJA 2JIXD 1N19A 5C6PB 3SDXF 4XB3A 1C5DA 1RZ7L 1WTGT 1AQKH 4WWID 4JZJC 1AJ7L 1ZLUK 3NSFA 4UUJB 5E23A 3S5LG 3LS4L 3KMDA 4MSWB 2VDLB 5D5ME 3CPLA 3MLXL 3UMNA 3KHOA 5JXAH 2BCKA 3AQDA 4J7RA 5M95B 2OMTB 3RGVC 3FCTA 4DGIL 1VFBB 4JG0L 4ALAH 2VGLM 1NBCA 4P5KB 4MB1A 3WN6A 2CRMA 4MNGE 4POUB 1QUPA 2A9NH 3DUUA 3BJLA 1ML0A 2BJML 3GIVA 4AV5A 5IY5B 4NNXB 2MRYA 4NO5A 3AGWA 4U6YA 4HJEA 4TTGA 1GS6X 1Q9LA 1AY1L 1M05B 3BW9A 4M5YH 1N59B 1IMHC 1TQVA 2DIJA 5CWSA 1MXGA 1ACCA 5D7IF 1IGTA 2X4NB 3ML8A 5AL8A 1SEBB 2WWOA 5EF3A 3QFJD 1CG9A 4AYMC 3OMAB 4KZDH 2DQJH 1GHFH 3QUKA 5BRZE 4QRPD 2Q86A 3DRTB 5C86A 3L3IB 2WYHA 1WWWX 4XP1L 4KKPA 1A1MA 3C60B 3UZEA 5E0QA 1MHCA 5ES4B 4JRYB 4HAKA 1MSPA 4W6YB 5D6CA 2G5UA 1H6TA 1KPRA 3CN1A 4HT1L 3O4OC 3ZRFC 4L4TB 4OCWL 4N28A 4ONOA 5I74B 3SCMD 4CVZA 1ZHNB 1ZEAH 2KLRA 2QHRH 3O4LA 4DSYA 1RULH 2WLYA 4FQXD 5IROC 1KFAH 4P49A 4CSZA 3KS0J 2ZXWB 1SMAA 3M46A 2XZCH 3ZRSA 2XTJE 3MJ8A 5IMLA 1S3KH 4LCIL 3IBEA 4X0KB 2EUVA 2VDKL 3QEUB 4PJ7F 4RGOH 4S2SB 2ZCZA 1NBZA 2CO7B 4PMEA 4UOZA 4OZGA 5IW1B 1CFNA 1JL8A 1FFOB 1K3IA 1XD1A 2P5WD 2Y6SC 3PQYB 2KMWA 1HAUA 4MDIA 4WNQB 5DD1H 4XCFL 3B9KB 5DJ6B 1CS6A 2YLKA 2DWEA 1KV7A 3MOQA 4MMXB 4ZOCA 4J1UB 1QBLL 3MACL 2IXQA 2QGEA 1L9OA 3WDJA 5L2KB 3FU9A 1OXYA 1DVFB 2Y5TA 4GUPA 1GL4B 5C0DA 3L7FA 1JV2B 1YC8A 2WNKA 1GC1H 2G4GA 4XBGB 3BKCL 3RWHA 3OKMB 1YECL 2PPFA 1OPGL 3L4YA 3PLYA 4X9FA 5E6RB 3ZUNC 3ZSTA 4BGLA 3EYUH 4LESA 4GG6F 3P0YH 4FE9A 4X99B 1R0AL 2A9CA 2BNUB 3AREC 4LL9A 1GSMA 1WDAA 2WBJB 2B77A 1WPCA 3BKML 4OZFG 4Z7WB 1TZOA 3CV5A 1E6OH 3JSSA 3VM7A 1NC4B 2ICEA 3MRCB 5BPPA 4J3TA 5E5UB 5C0CA 4L8SA 3HG1E 1U8KA 4URTB 4BZYA 1OSEA 3CSYA 1Q1JH 1SYSB 1JGLL 2C9UA 3NA9L 2KT6A 1SJEB 3MFFB 4I18C 3BH9A 3TA3B 5LGHH 5DD3H 4XXDA 1DSYA 2Q7NA 4RSYA 1M71A 1A7PH 3ZDYE 4YDMA 2FHFA 5IMOA 3S35X 4OD1L 4W9JC 5CEYB 5F7KC 5EIQA 4UQ9A 3CFJB 4ZMXA 2WZ5A 3BSGA 4ZS6C 3WGUB 3EO0B 5F7NC 5HGAB 1T0NB 2TAAA 3SO3B 2B1AH 4B50A 3ZDXF 1VJSA 2W9DL 1S7VA 1FL5A 4Q2ZB 4AW4A 3A4AA 4PV9A 4V1DD 2EE2A 3DK0A 1NIAA 1F3DJ 4PAZA 5IMMA 3VD4A 3Q5TA 2XG5B 4JVPA 1MQ8A 1MJUL 5D1XD 5HI3C 1DLFL 3JWNE 4LT7A 4OCSH 4P4KC 4X6DF 4Q6IB 1BWWA 2WNWA 5GRVK 3IFNL 2F8VA 4G1EB 2VDMH 1TJIL 3QA3B 4H2AA 2X1QA 2WBJD 4BHUI 5DFWH 3JWDC 2Z3FA 3JT0A 3LNFA 3C6LB 1G7MB 1E42A 1XXDC 2W8CA 2VQ1A 3KE0A 2A3TA 3VXNA 4F8TA 1T1XA 3AU1B 2OA9A 3QCUL 2J8HA 1I1AB 2XETA 2ZP9A 1N12A 3J8F7 1YEFL 3H3PH 5T1KA 2B0SH 4Y5VB 1C5BL 3ZXAC 4OFYA 1QSEE 3MLSH 1SNRA 3CX5J 1OTTC 4OI9A 3PUCA 5DC4B 1SBSL 4X6BB 1LM8V 1NLDL 3BO8B 4XP9L 4O02L 3OQ3B 2YAHA 4GP4B 1HH6A 4HETA 4YWGL 3C8KB 3W0WD 3WS6C 4XWGL 1E8YA 5AD0B 3KPSB 1UH3A 2R59A 4LASL 4O4YL 4W9KC 4PREB 4BSVB 4GO8A 1OOWA 5GGVL 3WNKA 4MQSB 4D0DA 2XWZA 3BXNB 3IXTB 4JFZH 4CGUB 5IK3B 3SDAC 5IR1A 1Q0YH 2V6HA 2NDGA 1ESOA 3O6LH 1UCBH 4AV4A 4HIPA 1QTYT 1RJLA 4PJ9C 3ZE0E 1LD9A 1BYPA 3E8UH 4QGTA 4RISL 5FYLL 1UUNA 3E8VA 2FL5A 2FHCA 5KYYA 2KERA 1QTPA 3KYMB 3EJTA 4J3OH 4O58L 2XQBH 3O0LA 2FLMA 4NUMA 4XO8A 4XPFL 3C6LD 2GFBB 4E9RA 1A3RH 4FFZL 5CD3A 4YX2L 4Z95L 3WEOA 2X6AA 2HFTA 4KNSA 4N2CA 4W9CC 4P23C 3STZA 2I60H 1ZY9A 2MNUA 5D93C 5F0PB 4OCYL 3U0PB 1OT1A 3WJMA 2IGLA 3MV7B 2YD5A 3K2IA 5IESH 2UUDK 4GINA 4UILH 4XMUA 2JIXA 4M5TA 5JDSA 2FX7L 3WKQA 4D8PB 1UXWB 4G8AC 2FYYA 2B4CH 4LVOC 3P4NA 2XXFA 3AWFA 1GJWA 4TPRL 4TL5A 1DO6A 4CKQA 1INQA 3L2LA 3LX9A 4P3DA 3MO1A 1S4IA 3TYGH 3US0A 4EZJA 5GSRB 2ZF8A 1NUFA 5IVZA 1ZLUH 5FUZL 5ILTL 2ADGA 5DVOA 3WFHA 3NJVA 3VFTA 4M1DL 3BDBA 1TPXB 2GBAA 4ZRGA 1HDMA 1JWMB 1SM3H 2IADB 4OCXL 4ZPVA 2GBUA 4U3XA 4BA0A 2PNDA 4GQ9H 2BY1A 1V3MA 3H7LA 1CLVA 1H8OA 2R29L 1JFHA 4MYPA 5C0RH 3L08A 1HILA 5DQ9A 4YEFA 2H6PB 2ZONA 3UOAB 1QR4A 3QFJA 4OI7A 3VMNA 3H42L 5IT2L 4QRPA 4EUPB 4M8UA 3BKYL 4WKZB 2JI3A 4GKNB 1F42A 3RX7A 2DQTL 1E8WA 2G60L 3QHZH 5H2BA 4WI6A 1G9NC 1NCNA 2MPAL 5C0FB 4G1MA 4X4KA 2IAMD 1CGYA 4FXKC 3SCMA 3L5XH 1UWEH 4YQXH 4FZ8H 3M7OA 4FQXA 2QGCA 4PD4J 4TULL 1ADQA 3CAFA 4PUBH 2BSSA 4Z3JA 5KSAC 2Y25A 1IFRA 2BP0A 4WCYH 2CCLA 4KXAA 4FFYL 1A9EB 1Z6JT 4Y9FA 1HHIA 1HSAA 4PJXB 4LBEA 4AT6B 3DMMC 1SJHA 3HUJA 4F58L 4X6EA 1W8NA 3DV6A 1E40A 2HMID 1XSIA 2YGNA 3T2PA 4K3EH 1IGJB 2DLHA 3AMKA 4JR9H 3CDZB 3U7WH 1A6TB 1NKRA 5B8CA 2P5WA 3EH5B 1Z5LB 5E4IA 4FFWC 3L3JB 4GIAA 4HH9A 1DHKA 4N2FA 1OSZA 5CJXA 4HP5A 4GQPH 2CUHA 1BLNB 3LZQA 2N1KA 1J88A 3P4OA 2AXHA 3RWIA 3OB0K 1CUOA 3C60A 3MV8D 4JHAL 4ZMZA 4JUTA 4JRYA 1GGCH 1D9KD 1KACB 3FU7B 4LHJB 4JFUA 3E1F1 3BE1L 3KPMB 2CHNA 4QAWA 4WGVB 3ERXA 1HEJC 1ZVYA 1E4XI 3BX7C 5F1NA 1ZHBA 4F24A 3ESMA 3MUGA 5JR1L 3BQUD 4WO4D 1W0WB 3VD5A 1NDGA 3D9AL 4PB0L 2F7OA 4WU5B 1YEKH 3S3BB 4HWZA 2J72A 3GMOA 4AV0A 1ROWA 4XPAH 4WWKC 3RDTD 1FFPA 3FFCE 4G6FD 4X0KA 5HYEA 5K9QG 1UOKA 3APDA 3L3DB 3UADA 1QUNA 2WXFA 4MDRA 1BZDA 1BVLA 5J1AA 5LHDA 3GHPA 3X17A 4YSQA 2YZ1A 4V2BA 2PN5A 1D6EA 3NAAH 4WNQA 4AEHL 1OCCB 3B6SB 4YS4A 3B9KA 3ARFC 2NQ3A 2PWGA 1DEEB 4MMXA 1UATA 3KVDD 5AKVA 3ZKMC 2R2CA 4JPWH 1DVFA 3CXFA 1UA7A 1TJGH 4KK5D 3BHBB 3GI9H 4JCLA 3MZTA 2H1LM 4O51A 4UTBL 5I0WA 4KRLB 1JYNA 3QZLA 4MA7H 2QQKH 1MW3A 3U2SB 4KKQA 4V1DA 4QHMA 1MRFL 4LU5L 1KB5H 1I7UA 2I9TB 4PJDE 4ELME 2YRLA 5D1XA 1CFQB 4EXPX 2R4SH 4N90D 2X2IA 1BVKA 2NLJB 4JPKH 4X99A 5CR8A 4QLWA 2B5IB 4PJBF 1WFIA 4L8CB 2H45A 1KZQA 1PMYA 3QUZD 5FF6B 2WBJA 2EYSA 1FCGA 3NABH 4FYRA 4V2CB 2HTKD 2NY6C 2YQBA 5C07E 1GAFH 2HFFA 5EEXA 3IWVA 5CEZE 3HC4H 1P4BH 1UUSA 1PG7L 1PY9A 5H37H 1WBXA 1E2ZA 4P5TD 3MN8A 1E90A 1FO0H 5I6XC 1OGTB 3LQZB 2GB2A 1DANT 3OQRA 3QJZA 4OTXH 3VGHA 2ROYA 3Q8BA 5CD5C 2BVQB 3MXVL 1T1YB 4BGDA 2ZG2A 3W0WA 4EXKA 3ZOAA 3S35H 4Y4HC 3GWJA 3EO0A 5E99H 5FHBH 5I26A 3JVGC 4IEFA 3WO4C 5HGAA 4EPSA 4I4WA 1FAKT 5I8EB 1GIGH 1OAQH 3N43F 5SV4A 2HWZL 4N6RB 1KN4L 2NXZC 1YYMH 3QNXB 4O2EB 1L5GA 5KVFL 4QF1A 3QWOA 4J4PD 4X5WB 4YLCA 3NESA 4N2LA 1M3IA 4Q6IA 1K4DA 1RZIB 4TSBL 2Q3ZA 4Z5RA 3WNMA 3K2UH 4JPIA 3LV3A 3O3EB 2AKRB 3C6LA 3RYMA 4CILA 2XZQH 3D0VA 3IETB 2WXQA 3V4PL 5JXEA 5GRJL 3V5DA 2F54E 2NPLX 1BJ8A 5DMKB 2CR3A 4PJ8D 2NR6D 3CU7A 2Z8VC 3EO9L 3MBXH 4JE0A 5AVYB 3TNMA 3VFSA 3WBDA 5LGJB 4I3SH 2VXQH 4P4RB 5G55A 2Z4QB 3SE3C 5DTFA 5CAYB 2I85A 3FT1A 3UYPA 3HFFA 2P47B 3MNZB 1KGJA 2NY2D 4CSTA 5DJ2B 4LHUB 1AQKL 4JAMB 2FZ3A 1AGCB 2GSGA 4OJFH 4XO5A 3VXUB 1MY5A 1XVSA 3GLDA 2APFA 4G42B 3BIAX 4PEEA 4N1EA 2EEDA 3EJQA 4MNQD 3ZL4H 2UUDH 1H6EA 3ZE0B 4GLRH 1RIHH 4TTDC 3RWCB 4ALAL 4I8DA 1HH9A 4TUJA 2P46B 5D4JA 3BP6B 4AYEC 4TMPA 2A9NL 5I71C 1R9FA 4ZUSA 2NW2A 4YHPB 3FCUB 5ECGA 4XMVA 4K4KA 4L3CB 1OAKH 4C54A 4M5YL 1MCWW 3P2TA 5A43C 5DJXA 3GRGA 5AZ2H 1DVYA 2N4IA 2Y7MA 2NDFA 3FB5A 4AVKA 1MHEA 1NANI 3MLTB 4KZDL 3OSKA 3SBWC 1U8PA 2GBTA 1TEGA 1UGNA 1FZOA 4H8HA 3BKJH 5A2KH 3VRLE 3T0ED 1XCQB 1NPJA 2WD0A 2CD0A 2P5PA 2Z35A 1FNLA 2BIOA 2ED9A 3QZWA 1C1EH 4Z3IA 4DK3A 4Q89A 1XQ4A 1Y0LA 4G8IB 2VR5A 4DAGH 5KYNA 4FD0A 1YUHB 2CIKB 4I5BB 3RVXC 4N2MA 1ZEAL 3PFQA 2IAMA 2QHRL 4WHTA 4F7CA 1RULL 3QQNA 1HXMA 1BPVA 1JD9A 4J3VA 1KFAL 4OB5H 4BRJA 1TTGA 1M6OA 4LSPH 3ORJA 4Z7QB 5DJYB 4BIKA 2XZCL 3NZUA 3E9UA 1HN1A 1U8LB 1MFUA 1S3KL 1N0XH 3DGDA 3V4VB 1NFDA 3ABLB 4FYSA 7FABL 2VWEE 4JBSA 1NCUA 3IJYB 4YR6A 3VXSE 4RGOL 1XF4B 3R0NA 4LSQL 4RFEA 3FSWA 2VNCA 3WXWH 4PGCB 1QBML 4RMQA 5DD1L 1F18A 1OHQA 1R3KB 2E46A 4W9DC 4K94C 5B38A 3UPAA 1TU2B 2IV8A 3UZQA 5I1AA 3LNDA 4QHUA 4RGNE 4U1GB 1HINH 2RBLA 5GS1C 2IPKB 4H8WH 1GC1L 3IKKA 3GTTA 4ZX6A 1M57B 1NBYA 1Q90A 1U33A 3MV8A 2D0GA 3FUMA 1KMGA 1D9KA 4XN5A 4QTFA 1DCLA 3IJHB 3NBNA 3EYUL 4IBTA 2ZXBA 3P0YL 1UM6H 3WIHA 3QH3A 4HH8A 3U2IA 5HJBA 5KVEE 4UV4H 1T21B 5JA9A 3AY4A 5FGBC 5EFIB 3BQUA 1EZUA 4GP5B 4WO4A 2O6CA 2JTDA 2WXMA 4YE0A 4OCRH 3VWJD 5IHZA 4E68A 1Q1JL 3R19A 1KBKA 3RDTA 2PUQT 1X5GA 5L2JA 5CLTA 2AS5M 1ZE3C 1IM9D 5DD3L 2X4PA 2H32B 2WZ6A 4JO3H 3PWPD 5SWQA 2BLFA 4X4XB 1IGJA 1A7PL 1F1AA 4PJEF 4JFFD 3WD5H 1D5MB 1BF8A 4HUUB 2UXFA 2WANA 5EV7A 1EUTA 2G5BB 3EHBC 4DPBX 5C71A 3QARA 2B1AL 2A4CA 1HHKB 3O6KH 1KG0B 3AXLA 3IMSA 4FZEH 4TNFA 5A2CA 3BSHA 5DK0A 4NIYE 5A2BA 1U8QB 1E4WH 1WHOA 2HJLA 5AAWC 2EEAA 3Q8AA 4UMSA 2UXTA 1EEYA 1XB8A 4IIQB 2XWDA 1MVFA 4HMCA 2VDML 5DO8A 1P4UA 2B39A 4LOUC 1J7VR 4AVJA 1PIGA 2P9RA 2W92A 3ARDC 3SKOB 2OZ4A 4OZIA 3D34A 3SDCC 1ZRUA 3IPFA 3SKMB 4F8OA 4I87A 2OJEA 2CRYA 3H3PL 2B0SL 2V2XA 2GJRA 3MLSL 5KZCB 5F7DA 3CZEA 3LH9A 4QRFA 3FZUC 2C9XA 2IDUA 4JFOB 4P5TA 2FT6A 4POYA 5JPNB 2PWEA 2XKNB 4GAFB 5I8KH 3VNYA 2RCSH 3TNNA 4JFYB 3D2TA 3EO1A 4M00A 1TCMA 4G8FB 5BV7B 5I1JH 2L7QA 3DPBB 4PJ6A 1UZ8A 1LWRA 1KYFA 4RZCB 1JNNH 1DFXA 4HKBA 3O4LE 2OMBA 1AR1C 2WC7A 3ETBF 2K6ZA 3BHBA 4JFZL 5AFAA 1Q0YL 3KYKL 3O6LL 1UCBL 5GGTL 1NSNL 1WZMA 4PRAB 1UA6H 4HAGA 4JHVA 4WI8A 3RKDC 5BO0D 4NZRH 1L9TA 2OMVB 4WENB 5BW7C 3C2AH 3E8UL 4QRTB 2EC9U 3ES6B 4J4PA 2YD2A 4ZSOE 3TJEH 4ZDHA 1P7QB 2XQBL 3EBHA 4FL4B 5JHDD 4Y89A 4OZGE 1A3RL 4L8CA 1KN2H 1OT2A 2FO1A 5FF6A 5TE6H 1IUZA 4F33A 1G9NL 1H3VA 2VMJA 3SGJC 4GY4A 2I60L 3QULA 4PJ8A 2NY1D 1X6NA 2NR6A 3GIZL 1QRKA 3R06B 5FCUH 1N0LB 5AVUB 1V27A 2COQA 4GRWE 5HJ3B 4CADB 5L8JB 1PLAA 3TO4B 4BH7A 5F9DC 5IESL 4RRPA 3X1NA 3C09B 4U1KA 1M42A 1EFQA 3EH4B 3UGXA 2B4CL 1C9SA 1ZSHA 2R0LH 3F65A 4WIQA 4GT7A 3E6HA 4JFWA 2CGRH 3RIFK 2PXYB 3P54A 4HIIB 1AHWA 2QLVB 3KPPA 3V6BR 3DO7B 3NRPA 4KROD 3O45A 5D1ZC 3QRGH 5DD5H 3TYGL 5DMJB 5DZVA 3B3BA 4KI5E 1TENA 1G1CA 4R7NB 2A73A 4BK5C 1BZ7B 5C0CE 1NOLA 4ZQKB 5JW4N 5KG9B 4KPHH 3VI4B 4DPCX 3WS3B 1ZTXH 3JYBA 1KLUB 3IU3B 1N4XH 1SM3L 1JJUA 1S7TA 4AM0B 5M7QA 3HBGA 3MRGB 4ZFZB 3TBYB 4GQ9L 5EF1A 1CU4H 3FJTA 1NICA 3WNJA 1ED3B 2X6VA 4NRXA 4ORGA 2XG4B 5CJ5A 2VJ0A 3IETA 5C0RL 3IS1X 2O93L 1O9ZA 1XH3B 2H3NB 3T4YA 1BVNT 4HK0B 2JXMB 5EOTB 3OD3A 2PW1B 1NAMB 2RD0A 5LKNA 3CDYA 4EF3A 3FN3A 1ZA3A 5IJCC 3T0EA 1N67A 2X70B 3EJPA 4KUZH 4X6FB 3MLYH 3MROB 3QHZL 4HD9A 1RFDH 4LVNB 3UP1A 4DP4X 5MEPA 4Y5YB 1DVXA 3D0LB 2OLDA 4P2RD 1I1FB 1UWEL 3NJMA 5D7JB 2OW6A 3U46A 4RFNC 4FZ8L 4AGOA 4YQXL 2O6DA 1R24A 2H5UA 2WKLA 2O5YH 3ALPA 1EAPB 4YHNB 3NJHA 1ZLSH 5C70A 1YPZF 4E5XA 2YUWA 2QFRA 3IGKA 4PUBL 4Y1AD 3VXRE 4LSRH 4WCYL 3JVFC 4M7LH 2FH8A 4RAVA 1UKQA 1BJ1J 5J6GB 4R2GB 3FQTA 2D7TH 3ZDWA 1HHJB 2EEFA 5HHNA 2I26N 1RPQA 2C4FU 3H9HA 3RWFA 4K3EL 1RUMH 3BP7B 4WJG3 3FUFA 2EECA 3U7WL 5SWZB 5DT1H 1VACA 2FR4B 1E65A 4AZ8B 4NUJA 2Z31C 2LHAA 1A2YB 2E59A 1KGUA 3MLTA 3SD2A 1U3ZA 4IKKA 4BKLB 5I19H 4D0BA 1CGUA 3IFOB 1P69B 4PJGB 5MENB 1KT2B 1CTOA 1ND0B 4HUKB 4HZLA 1XCQA 3ZQ9A 3BVNB 1EJ8A 1S9YA 2YWYA 3BMVA 3ZR6A 3O3UN 4X4YB 3DIVA 3GMNB 2IDQA 3QPXL 3HE6D 2FQDA 2HT3C 4AEFA 5AG8A 2FDBP 1EFXD 5TDNA 4HG4J 1WYJA 2DQEH 5JW5A 4K8RC 2K9FB 2QFPA 5K1NA 1YEKL 2QSCH 3ATDA 2OTUB 4N2OA 1XGPB 2W81C 3ZDZF 4XPAL 1G6RB 4ONHB 1X9QA 4IOFC 4ANKA 2Z65C 4UAHA 3DBXB 1YO4A 4WGKA 1IM9A 2AF2A 2YPLB 3F7YB 1TZAA 5EZJB 3GBNH 1BW8A 3RZCC 2Z91B 4PGCA 3LEVH 4A1RA 3N91A 5FA3B 1JAEA 3NAAL 4RGNB 1DYZA 1RPUA 1EJOH 5I6NA 1YCSA 4JFFA 2D9QB 1IBFA 4NBXB 4Z3HA 4LCCB 1QSVA 4W1TA 4JFDD 4JPWL 4ETQA 1TJGL 1EGJH 3GI9L 4WHYH 4Y2OB 1GKOA 5IMKA 4MA7L 2EIEA 4BELD 2QQKL 3VFUA 1NUGA 3RVVD 4I1PA 5ALCH 2EABA 3O2DH 1KB5L 3OPUA 2HX9A 3OMZA 3S96A 4Y16C 3GDCA 3RY4A 1CD0A 1XF5A 4JPKL 3GO1H 4Z78A 3BP5B 4KK6C 3WY2A 3CSBA 1RJCA 3NABL 2GBVA 3H6AA 3QUGA 2X88A 2LLNA 2VE6B 6PAZA 1W9XA 2C1PB 2CA3A 1SDAB 3MRIB 3UTSD 5DS8B 3HC4L 1P4BL 5GRVL 4Q9CA 3HMXH 1TCRB 4ZFOB 2DICA 1TFPA 3QFJE 1SLUA 5CBAA 2DB8A 4QRPE 1HL9A 1FO0L 3SPCA 5I24A 5IW6B 3KAAA 1DSWA 1KJ3H 2EH7H 3ULSA 3TJHC 4OTXL 2EDHA 4EVNB 3UDWA 4NPYB 3LD8B 4L3FA 2IH1A 1IL1A 2VQ4A 4PV8B 3S35L 5E99L 3GXUB 3RTQD 5FHBL 4L23A 4JANB 5TE7H 2BERA 1EEQA 2HVKB 1S78D 1A1OB 1S9XB 2V7HA 3GXTA 4X5XB 5JPMA 1E4KA 1GIGL 2XV3A 5DHDA 3PF2A 5IV2A 2D7OA 1N6QH 1CFTA 4ZAKD 2BSTA 1U3YA 3INUH 1YYML 1A9BB 3LKOA 1B2YA 3RVTD 3WMPA 3I6GA 5GJTH 2NY3C 1GOFA 2VO5A 5F6IC 2CBPA 5F7BA 3K2UL 2V2TB 2KQMA 5JHDA 3IKCA 3PJSB 2XZQL 1DP0A 3KWWB 4ZXBD 2D4DA 4NNYB 4GIPD 1T7YA 2BOBA 2B2XH 2GAZB 3VXMD 2VMDA 1NUNB 3ARGB 3MBXL 3FB6B 3MUY1 4EBQH 2E8ZA 5D72H 2VXQL 2GG1A 2HFEA 1MCWM 2C3WA 3JWOC 4HIHA 4WSJA 4N0FB 2W88A 4JFOA 1CICC 2BHFA 1MCOH 1XAUA 5F3BA 1WIPA 3QDJB 2WVSA 5I5JA 2ARJQ 1MI5D 5H4YA 4OJFL 1KJVA 1UHVA 2AXJA 3DPBA 3QCTH 4PJIA 5F2FA 5C0GA 3S3JA 1YYLL 2AW2A 3LDBB 2VLLB 1IB5A 2ZOLB 3ZL4L 1VADB 4BSWA 2EYRA 2O5ZH 2CDFB 2VMCA 3QI9D 1OAUH 5JORB 4YSDA 3WE6A 4ZSOB 4HKXA 3BAIA 3PGCB 2NYYD 4PVMA 2H2SC 1U8JB 3QVAA 1MF2H 2MHAB 3CZLA 1JZGA 4FJZA 4IKIA 1AGEA 1KTLA 3ULVE 4UI2A 4XBEH 1O7SA 3GSUA 2NQDA 4YVNA 5EBLA 3TH3T 5AZ2L 3DECA 3F3HA 3A6CH 3L3HB 5GZOD 4GRWB 1PU0A 4PRPE 3ZHNA 2XX1A 4PJ5D 3VQMA 3AWGA 1QNIA 5CIPH 3FL7A 4BKSC 2ZCLH 2XQYK 5AW5B 3FUKA 5HHOD 5DSCA 4L9LC 5FGCE 1F6AB 2DLTA 4G8EB 3K3QA 4BKTC 3OZ9L 2FUTA 1T7VA 1KIRA 3BKJL 3L3OA 4P5MB 3S2CA 1X44A 4MA1C 2Y2TA 4AQEA 1KBPA 1RK0B 4U1HA 4AYFB 1A4CA 5I6MA 1D6VH 1C1EL 1X5YA 4V1DE 4YZWA 4Z3TA 1GS8A 3KLAB 4UAOC 4DAGL 4A04A 3ULUF 3V7AG 3TM6A 4A7GF 5LCVH 5D1XE 3MNWB 4EN2A 5D8JH 4FQ2H 3QORD 3VMOA 4P2RA 3K1KC 1IVLA 4OB5L 1LGVA 5DHVA 4TVPL 1OLZA 1JZ2A 3OGOE 4LSPL 1HEHC 1NOFA 4R7NA 5F8RC 3EJYC 3QIUB 4G11A 4Y1AA 3QR0A 5LBSA 2ED7A 2V2WA 4NZUH 4OZ4A 1UXLA 5KG9A 4L1BA 4P59H 4OAWA 1CIUA 1UCTA 3DVGB 4LOVA 1XTLA 3D4ZA 3WXWL 3MRGA 3TBYA 3N40P 2B3IA 2BNRD 2GJ6E 3UBXA 4D3CH 4F57L 1U58A 1ED3A 2XG4A 4CVXA 2Z7UA 1U8HB 3CC1A 1JZIA 5FAAA 5T5FH 2DM7A 4U0QB 3W0WE 4GQQA 1VAHA 2DBJA 4JKLA 1T5XB 1PZAA 4LP4A 5HYSA 5JNYA 3WSQH 1HINL 4H44C 1AMXA 4MXVF 3ATFA 3L2NA 2JSFA 4H8WL 2BWIA 4FTVE 4F7TA 4Q8BA 3NTCH 2I9LB 4PSRA 1VFUA 4YDJB 5DEGB 5GIRA 1S6NA 4P8QA 2G3NA 1M7IB 3HE6A 3VXRB 1UM6L 1TVBA 2CHZA 4G6KH 1EFXA 1U36A 3AB0B 4PGDB 5D7JA 4AH2A 1RY7B 1SFHA 1R5WB 2DLGA 2W38A 4JMNA 4LB8A 4FQLH 2DWXA 3C60C 1JIBA 4OCRL 1MFNA 2B15A 4ZS7L 2MOVA 1BX2A 1HQRA 1PGRB 1WBYA 4ZFGH 1USQA 2XSKA 4HKZA 5T3XH 5C6TL 1J11A 3PREA 1WO2A 5I74C 1HKLH 3LNGA 5KJ7E 1JZ4A 4JRXD 1OCRB 4JKNA 3X11A 1SY6H 3FN9A 4OIIH 2XV2A 3BP7A 3VD1A 3C75A 2G30A 2X53A 4MS8D 3WD5L 3JUZA 1IBGH 2H3XC 2I7OA 5LNDA 5DRWA 3JV4A 3BFWA 3QQ3A 1XGUB 4IRZH 3N0AA 1CIDA 2QR0B 4L9DA 3WEMA 2GT9A 3O81A 4EKXA 2Q3XA 1I8LC 3SDXA 3VCLA 4ICXA 1ADWA 1T20A 2LE9A 2MCPH 4BKLA 3IFOA 5MENA 3V0GA 2YD7A 3O6KL 3A5VA 1E4WL 1MCCA 5FKAB 3BVNA 2Q20A 4ZW6A 3I75A 2BRRH 4JPQA 1N6VA 3MRKB 4MMXC 2OR9L 1EDQA 1NCIA 5IZ7A 1DVFC 3ZTDC 1VA9A 1FZKB 1CLYH 3FT2B 3BEWA 4LDOB 2EP6A 3O3BB 2WAHA 4PJCB 4OGYH 4XXWC 4BUQA 1AKJD 5ICYB 1E8XA 4HOXA 2HLFC 3HC0B 5D7IA 1WK0A 5FWRA 1PZDA 4PJAF 3DBXA 2OR7A 1J5DA 4NLAA 5EZJA 3RILA 3D09A 5I8KL 4JVWA 5EPMA 1CVRA 1AZUA 1KY6A 1CWVA 2RCSL 1JGEB 4TNVK 5G2NA 4IKLA 1N5AB 5I1JL 3CUPA 1XGRB 2JI2A 2EDNA 1AQMA 1KTKE 4N5UA 1JNNL 4V33A 2IDFA 1J8HB 3RTQA 4HJGA 4Z7OE 3TA3C 2WK2A 5I15L 3B43A 3O6FD 3LH2H 1R3IH 2Z9TA 4QRSA 5DK2A 4BH8A 3LKSA 1I8UA 4XH2B 1UZGA 3S37X 1UA6L 3AS0A 4ZAKA 4Q9BA 1BXVA 4NZRL 3ARBD 5K93A 3C2AL 4RIRB 3GD1C 3SGDI 1WFJA 2X9YA 4WJ5A 3TJEL 3BFQG 3SO3C 4C55A 3CTTA 1KN2L 4WLCA 1DO5A 2E8YA 4PJ7A 3NQKA 3GM0A 3ZKQD 4PGEB 5TE6L 2JKIS 4K3DH 4ZXBA 2C1PA 4ZMAT 3D69B 1KIPB 4BE5A 2B59B 3QXDB 2PP7A 2FO4A 2Q7YB 1NKGA 1BZ9A 1TCRA 4CL7A 3ETSA 3BRDA 4Y88A 5FOBA 1NCBH 3KYAA 3O3AB 4MWFA 1I7RB 3OX8B 3SE9H 4DUVA 4OD2B 4NFCA 2R0LL 5JXEC 4S0HA 1MI5A 4FJYA 1T0PB 2CGRL 2FLRT 4EN3D 1I1AC 2F19H 5GS2H 3FFDB 1NFIB 4Y5VC 1F3JB 3QRGL 5DD5L 4GG6A 1B90A 1V3LA 3QI9A 1AVAA 4L2LA 3VMPA 5AW8B 4MRBA 3WJLA 1NGPH 1XCTA 5BS0D 4KPHL 3P9MB 3HZKA 1TZHA 3LQAC 4XMTA 3QP3A 2BK8A 3T1WA 4UINH 5IB3B 3Q2CA 2VLKB 3ZYOA 3N55A 1N4XL 1ZT7A 4TUKH 2WMPB 1R5IA 2MFNA 4GYBA 2Z92A 4FYTA 4XX5A 1CU4L 5DUMH 5ICXA 4AMWA 3D5OF 5JLZB 4DPRA 3PJSA 4WW1B 5DA4A 5GZOA 3EGXB 4NNYA 1OEZW 4F2MA 2QDWA 4IRSB 4PJ5A 5C2BH 4XN8A 3NN8A 2NNAA 5EEYA 5HHOA 2K78A 5ETUA 4HUWB 2XDHA 4MJIE 4EOWH 1NCWH 2YLHA 3ZTJH 2ZUVA 4E0RA 2VC2H 4W9GC 6FABH 2BDNH 1P7BA 3QUYB 5JUEH 4KUZL 4N0RA 3MLYL 3QDJA 3E0GA 2ZNWA 1RFDL 3T4AA 1LL1A 4DKFH 3N0PB 3QDMD 1L0QA 2FWLB 3KLKA 2KH2B 3AZUA 2V5MA 4KTEH 1IU1A 3UJJH 3QORA 4JFQA 4N90E 2O5YL 4M03A 4BBWA 4PW4A 2W0FB 1ZLSL 4X6DA 4XPGH 3V5HB 4XI5D 5JORA 4KDVA 4NQEE 4WEBH 4YSSA 4LSRL 5A16B 4F7PB 5F71A 4OZIE 4M7LL 2ATPB 3WUWA 3N2JA 5AW2B 5KS9B 3F6LA 3G6AB 1FNEA 3NIDE 4YIQA 4LARH 3NJLA 1KLFB 2ZNXA 3MUHL 4I0CC 1YDPB 3VGAB 4PRPB 3PWUB 4POZC 1ZK5A 4UDUA 5DXWA 4DESA 1RUML 3FO9A 2TRHA 3Q6GL 5FGCB 2YPKA 3HAEH 1RHHA 1MLBB 2BNRA 4JFPB 4JFXA 4Z23A 1U41A 4QPEA 2CBQA 4Y1SA 4X5PA 2R1WB 3U4BH 5HGDB 5I19L 1TPXC 2G4EA 4L05A 5DMGD 4PJHF 1RLWA 5IQNA 1BOGA 1M1XB 4J5VA 3DX0A 4HHAA 4QLRA 5A40E 3JTBA 1GZQA 4NT6B 2DQEL 2BS71 3UIYA 4HPOH 4JM2B 4KDWA 2GUOA 3HBZA 2QSCL 2CJUH 2VSKB 3DYPA 4WK0B 3IDMB 4X98B 1NZRA 3KGRA 4GAYA 1FQ9C 3Q7JA 2GJ6B 5FYJL 2I69A 5CJQH 5GGSB 1KJ2B 3B2PA 1B4LA 1SDYA 5D1QB 3Q6FA 3REWA 1W72B 4B9CA 3BCFA 4BINA 5GSVB 5F72S 4KZEH 5ABAA 4JRXA 3OAYK 3NCYS 3KNBA 3R4DA 3LEVL 4KJYA 1SOXA 3OKLA 2ZX5A 1FNGB 5KUMA 1EJOL 4WUUE 1NGWA 3GLEA 1UXMA 3T65A 3QNZB 4WWOA 4OJAA 4X9YA 3MODH 3S5LB 5L0QB 4M7ZB 2XA8H 3HVNA 4FTVB 4IMLB 3V5KB 4EI5B 4M8VA 3VDAA 2XACC 1FFQA 1U4FA 1YN6B 3U4EB 2OP4H 1DJIA 2R23A 4PI0A 1JE6A 4MNQE 3P0GB 4PRHD 1BP3B 2Y69B 1AS7A 1IRAY 1A1NA 1R3HB 2EZ0D 4XCYB 4DP2X 1XH0A 5ALCL 3O2DL 1A4JA 4QDGA 3T6QC 5DEGA 5DYFA 5KN5B 4P2OD 1DBMH 5LUMA 4NC0B 1SUJA 3S3CB 3X3GH 2C3XA 4C83A 2WWMC 5I66B 4D2NA 5CSZA 2R4RH 3UBFA 2E9WA 4IHBA 1LNUA 5CU5A 3VFWB 2YOAA 1J05A 1R5WA 2H2PC 2J5LB 2YQGA 1OAZH 1K4CB 2H8PA 4EQ2A 4HSCX 4PVLA 5PCYA 5LXGL 2OTPA 3AG1B 3HMXL 4K9EH 1AKJA 4Y4FB 5IVXB 1F3RB 2ZKMX 3PXHA 3IS0X 5E6IB 4HPHA 5C0EA 1IEAA 1KJ3L 1PZ3A 2EH7L 4KJWD 4XCNA 3T0EE 5CLYA 2ZXCA 5HVHB 1U91B 1KSRA 2XWTA 4JJ5B 1IE5A 1XGTB 4JLRA 5SWSB 1XGUA 4QKXB 3H7BA 1UG9A 4UQ3B 1MWAH 3RWEA 4LP8A 3HG3A 3GMQB 3AITA 3MX0A 5BOPA 3NFPB 4QXWA 5F44A 4A2LA 2CR6A 1D7CA 2FJHA 2QHLA 3B2VH 3O6FA 1N6QL 3HZ3A 1I3UA 4NQVB 1IJNA 4XVUC 3RX9A 5E8EB 3S36X 2W0PA 4I48B 1MJ7H 1NGQH 4F8LA 3ARBA 2O1AA 1JUFB 2YFNA 1E67A 5GJTL 4DIXA 4YBHA 4N0UB 2V5YA 3GSNA 3REVB 3RB7A 4E9TA 5E4OA 2WSKA 2QQLH 2HLAA 2CHXA 3FH5A 3CHXA 3ETTA 2B2XL 3FMGL 4MDJB 3G6JB 4EBQL 1SZNA 4KKBC 1KTRL 5D72L 4XNMA 4XVJH 5GQBA 2V17H 3GMPA 3IE4A 4JHBA 1HEZB 4KI1A 4UNIA 2PCFA 2XHNA 4U6VH 4N24A 1MCOL 5MERB 5KW9H 2RAMA 2YUVA 1E4XH 1TVDA 4X8JB 4Z7OB 1KB9K 5DUPH 1K5WA 1KXQE 2BIPA 2HKAA 2DQFA 4LRIA 1N3NA 2VLJD 1RZGB 4FOMA 4K7PX 1YY8A 4EN3A 4JCMA 2JJTC 3GBLA 4PP1D 3FU6A 1ITCA 1OGAB 1Q94A 2W9EH 4OZFB 1WE5A 5HD8D 2O5ZL 1OAUL 3JV6B 1LEKB 5CMAB 4IS6B 1BMZA 4LVHB 5KYXB 2VLRD 1IM3B 3DXAD 5BS0A 1UVQA 1Q0XH 2QQQA 3H53A 1A02N 2C8NA 4HJ0D 4U3HA 3WG7B 1MF2L 4HC1H 4BFGA 3S37H 2PR4H 1T89A 1MFVA 4XBEL 5EWIH 4LHQB 3ILPA 1EZVX 2M83A 5I76B 2A0LD 3PWPE 3JWNC 5DJ0B 3SDDD 3A6CL 3CIQA 1TETH 5J56B 3GMMB 1JWUA 4JFFE 2D4FA 5HHXH 1CFSB 4YEEA 1ZANH 4UQIM 5C0JA 2ZCLL 3L5WB 3U25A 1KIPA 2QVFB 4UBDD 5B39A 1ILSA 2ZOKA 1BQUA 4JDVA 2Q7YA 3BWUC 2G2NA 2FVNA 3MR9B 4WFGD 1X5JA 1FLRH 3I74A 3F58H 2BS9A 2QGDA 4JO8A 4F15B 3OG4B 1D6VL 3IVKB 1U8CA 1N8ZB 1OKEA 5JIQA 2EEBA 2UZYB 5FYKH 5EU5A 1S5HB 1UT2A 3LEXB 3QDMA 4Y0GA 4WI0B 5EU7E 5LCVL 3MU3A 5T1LD 2J7LA 4FQ2L 3VFNB 4G9DA 4A39A 4NQQA 4PIBA 1DVZA 1NFIA 1F3JA 1NPUA 3FRUA 3IDXH 4HJIA 4L48A 4J3BA 3CGTA 4IGBB 3FB8A 4IBQA 2NCEA 1AC6A 4ZMQA 4UZSA 2OMXB 3TA4D 4GW5A 4PWKA 4PJBA 4JRLA 1DJZA 4NZUL 2VM4A 2F15A 2CHDA 3D87B 5L4FA 3UAAA 5DRNB 4F3FB 1YY9C 5ESVB 3ME0A 2AJ3A 2VLKA 4OLWH 2YXWA 5CGYD 3WOVA 4P2AA 1EHXA 1OZTG 3QYCA 3Q13A 2WMPA 4LZKA 1QI4A 4GEJA 1MDAA 1OAYH 4D3CL 1TITA 3FTZA 5C0ND 4AG4L 4LNRA 4P9HC 3LN5B 4HOWA 4F91B 5F9OH 4ZODA 3EW3B 4P3WA 4MJIB 1YJDC 3HLAB 3RVWD 4EIZC 3N1FC 3HRZB 3LSOB 4XOEA 3VXOB 4LLMA 5E2TH 2J21A 2Z34A 3DARA 4IRSA 3K0YA 4W4NA 4DEUA 1B0WA 1CDUA 1N70A 1ITBB 4MQXC 4H1LB 3WSQL 2MNJB 4HUWA 1H8LA 3CZGA 3HBPA 1U8IA 3T0WA 3QHFL 3MCLH 1WCBB 3T1FB 5D2NB 3LKRA 2CRZA 1WHPA 4NQEB 3TBWB 3FW6A 4G6KL 2CO6B 3P77B 3RHWF 3LHPH 2ORBH 1MRDH 2D0HA 5JHDE 1KYOK 3V5HA 4FQLL 4KDTC 4PRDA 1Z9MA 3OJMB 3D39B 1DVSA 2CO4A 3FB7B 2W5PA 4NHUB 1I8KB 4ZFGL 3G6AA 5T3XL 1HOCA 1JOIA 3L9BA 1HKLL 1YDPA 3PWJB 1AS6A 2CMRH 3QZBA 1SY6L 1ZJAA 4GXFA 4FA8A 1KCBA 1RVFH 4OIIL 2PCXA 4PBDA 2GY5A 2CKBA 4IYKA 5T1MA 1LILA 1NGYB 1IBGL 1YNTF 3MUZ1 1PW3A 1CGVA 1FAIH 4H26B 4ZYKB 2PPAA 4PJIE 1J5CA 3L5JA 3FCSA 5A7BA 3MJ9A 4QTHB 2MCPL 3OAYH 1V55B 4KKLD 3Q8FA 3CK0H 2OXHA 4TF4A 4PRHA 1WUZA 1FL6B 1U3JA 1NIBA 1UWYA 4B7IA 3LPPA 2D31B 3R18A 4KK8C 1BQHB 2BRRL 2XPYA 3F00A 3MREA 4P2OA 3S98A 3PNWB 4FLSA 5C8JB 4P46C 4OCLC 4LAQH 5B22A 3SE6A 1XR8A 1M2OA 1BMGA 4OLVH 4U1GC 1LJMA 2CLRB 5LBGA 1NANH 5I6OA 5L6YH 5L4MA 1MVUA 4UM9D 1CL7I 1CLYL 4C47A 2XN0A 3WEAA 3IDMA 2WCGA 4FFVD 4OGYL 5DEFA 1NGXA 3P3RA 4FXGB 4MXQC 4WUUB 3SGEI 4ZMYA 2DIEA 2NUPB 4FQIH 5D1QA 1W72A 5JOPD 5J89A 3ARRA 3NSDA 4YHIB 2X4TA 4NKOB 1PZ2A 3GSWA 4XZUA 5DRZB 5KVGE 4MZRA 2FK9A 4L1HA 4QGYA 4HOMA 1A3QA 1M7DA 2JLPA 3CLFH 3FHEA 3AXIA 4UOW0 3S5LA 2IGTA 3LQAL 1P84K 1FZJB 4GMTH 4EI5A 1I1RA 2UZIH 2BOCB 2P4AB 4L18A 1YN6A 4OV6F 4P2RE 1ZGLB 1ZHLA 3L95B 5H8DA 3LH2L 3P0VH 1FNHA 1A7NH 3TGXA 1E3FA 1NMBH 4KFZC 4Y1AE 3UDWC 1O6SA 1RUPH 1JS4A 2E86A 4Y9EA 5TDOB 2IBZX 3VD7A 2KDGA 4K5MA 5LAXA 5IHBA 2DLEA 3QEHB 3QG7H 5I18H 5CEZH 1IZKA 3HLKA 2VDKB 1Y7VA 3H3BC 4KVNH 1RJYB 2B3RA 4NC1C 4K3DL 4OJDH 1KGIA 2YPVA 5FLVA 2OL3A 4UQCA 4D9LH 3RWDA 2NX5D 4GJTB 1QYGH 3BWAA 4JZNB 4IIQC 1X4XA 3G5XB 4OFDA 1XSOA 4OIFA 4Y4FA 5AVVB 3WO3B 1FVEB 5KSBF 3IEAA 4PWFA 3FF7A 1NCBL 1EUUA 2X0VA 1JK9A 5HTSA 4NPJA 5D2LF 3SE9L 4KRPB 1MIMH 4F27A 5D9SB 1OGPA 4IU2A 5HHQB 4AM0Q 2HKHH 2PP9A 2F19L 4UQ3A 1C08A 2VLJA 2XNAA 3LRSA 3OAWA 4PS4H 3L17A 43CAB 2J3SA 4MAZA 2E75C 4NHCH 3U4KA 5JPNC 5DLMH 4Z7VE 5MHSE 5DD0H 3VSUA 1NGPL 1WWBX 3BAKA 4JZOB 5BV7C 1JERA 3DXAA 4UINL 3CBKB 4MMYB 2R2BB 4J28A 1JUFA 1AD0A 4TUKL 1OF0A 4KX7A 3TIEA 5DUML 3FTVA 4HEPG 3HB3B 4C4UA 4ELKB 2JJUA 2WBXA 1ZT4B 1XF1A 1OSPH 3SDDA 2JMRA 2ITDB 2VSCA 1S9WA 3HI1B 4M9OA 4PJEA 5C2BL 3FOMA 3N04A 1VCBC 3POCA 3RNKA 1ET8A 2E7LC 3SDXE 3C5ZB 4I85A 4JFDE 4GKSA 4PHZA 5JIPA 1J86A 4EOWL 1NCWL 5EOQH 3O8XB 3MLWH 4MFHA 2VC2L 4FL4C 1IAMA 3IJEB 2BDNL 5JUEL 2XFXA 1MJJB 4O00A 2YD6A 4DKFL 4N3UA 1FV1A 5FK9B 4FADA 2AV1A 2GTWB 2Y3NA 4G9FB 4FABH 3DJZA 1U92A 2Y1VA 5T1LA 4LLVB 3L4UA 4XX1E 4OZFA 2FIKA 2QVMA 4XPGL 2ILLA 4MVBD 3TO4C 4K7PH 1X4ZA 3OKOA 3C09C 4WEBL 1Q72H 5KBLA 1EHNA 4HS3A 4LARL 3UTSE 2E4FA 1R5VA 3RVUC 4FNRA 2PXYC 1ZVHA 4XHJC 3IJSA 5HDQH 3UG4A 2GTZA 3L1FA 3AAZA 5AYQA 3GJEA 1A0QH 4ZMWA 5IJKA 2XV6B 1Z0NA 4QHKI 2FWOA 3ESVF 5BVJB 5JQHC 5DJCB 2C9AA 4O02B 4CU8A 1J12A 3TV3H 3U4BL 1AQ8A 2EO9A 1J1PH 3RIKA 4K5OA 5IFHL 4GFXA 3AGVA 1D2OA 3WFZA 3F12B 3IVKA 4G7RB 2H26B 1KXTB 3ZKXB 1R3LB 4MJJA 3QJTB 4L2YA 4XWOC 4K73A 1HJCA 1DBKH 1J18A 4FNQA 1YMHB 2LABA 3GJFK 2JQMA 2FEDD 4HPOL 4ODWB 5B3JE 1UWGH 4YHMH 1U8OA 2CJUL 1LO2H 5CHNB 4MJ2A 3CDCA 2EIMB 2G3MA 2HRGA 4P2QD 2UWEB 5CJQL 2DQUL 2QELA 1YMMD 4LVNC 4RVBA 3VXME 2FJGA 4KKCD 5GGRY 4LQFH 4Y5YC 5ESVA 4AIOA 3TLRA 5DDHB 4K7PY 2J6EH 4FRWA 3EYOA 4QKTA 4GUCA 5DYOB 2IDCA 2Y1AA 1KIQB 3ZYZA 1I85A 3HOGA 5FKPB 3UBXI 1SYVB 2EIJB 4XZ4A 3MODL 1P7KA 1H3PL 3HLAA 2XA8L 3LSOA 1EZLA 3VXOA 1T66C 3WFEL 1XEUA 2OP4L 5IBLD 4R2GC 4EDXB 4EDWH 4BFBD 3FPXA 3K6IA 1ZSDB 4GG6E 1N18A 4XGZA 2O6PA 4UQBA 3FS9A 7TAAA 5HVFB 3UABA 3BZ4B 3I85A 3B56A 1EZVY 2P80D 3MRHA 4FERA 4JM4H 4K5PA 3V2AR 4E9SA 2H4EA 2OTWA 3IDYB 5KVEH 2BRQA 1DBML 3SYQA 5J6HA 3X3GL 3D30A 2EEXA 2O5XL 3KJ4B 2QPDB 4PLOB 4C56D 5BZWB 2H0EA 2MWCA 4LDEB 2RR3A 3H9YA 3PV6A 4AENA 2R4RL 5FYLD 2GI0A 1OE2A 3UTZA 3Q06A 4NKMA 1OAZL 1SXCA 4P06A 4UM9A 1CD1B 1N7MH 4U1NA 3S6CA 1P7HL 12E8H 4PJ5E 4PLJD 4K9EL 4LLDA 3R7QA 3BRFA 5HHOE 2D7QA 4DW2H 3W9EB 1WS7A 1O7VA 1WZAA 2FGWL 1PJWA 4KITB 5JYLA 1YC7A 3ZDXE 2HRLA 3FUDA 3BD3A 1MWAL 3WTYA 5H35A 3N41F 3ULUD 5E9AA 1OM3H 3U9UA 3QSKB 5FO9B 1OIOA 1ETA1 3B2VL 1OO2A 3ARQA 4X6DE 1AGBB 1MJ8L 4CMMB 4RGNC 1TZIA 1W8OA 5C3LD 1YPZA 2EE0A 4X4ZA 5J13B 1MJ7L 1NGQL 1KCUH 1MNUL 1L9MA 1NIEA 4ANXA 3PS6A 2UYLB 4LCCC 3APCA 5E70A 1KCSH 1FG2B 5C8JA 1RZJH 4XCEA 2E9GA 4PCYA 2AI0L 2FX9H 4J3UA 5E1AA 2QQLL 5ADOH 4LNVA 2YFOA 1QO3B 1F4XL 3PL6B 2BNRE 3CSGA 2WVVB 2BXZA 4N9GB 4IMKA 3WIFA 2R7EB 2P48B 3LHAA 3DURB 2VXSH 4LLUA 1MEXH 3MCKB 4XVJL 2NX5A 2V17L 3RWJB 1DUZA 1OTSD 4JFSA 2E7CA 2X1XR 4U6VL 1WICA 3MRFA 1FH5L 1FJ1A 1T5WB 1E4XL 2GIYA 3GXIA 4M1CD 3VI3F 3QEQE 3BOVA 3ZKND 5FB8A 2NY5C 5DMYA 5LDUA 2JCWA 2XWCA 5FO7A 2F8XC 1GZHC 2Z0BA 3OF6D 3FDWA 4CMHB 5C97A 3NZ8B 2W9EL 1EDYA 1G94A 3A67H 4LF3B 3II1A 2WYTA 3L95A 2R69A 1WUNT 2JKJA 2D9CA 3EG9B 2J44A 5KYUB 4GBXD 2DMBA 1GYUA 3VXTA 4BZ2A 1Q0XL 2DMGA 4HIEB 1E9QA 4OM1H 1QX1A 1IGYB 4HC1L 5E4EB 3S37L 3E6FB 2PR4L 5HI4C 5EWIL 1K2DB 2YD0A 1KC5H 3CLEH 2JCCF 1TETL 1O9VA 3T8XA 2J8UB 2NT0A 3GB7A 4ZUVB 2WHVA 4NLHA 3UAJD 5HHXL 3FT3A 3EDDA 4UIMB 3L3KB 5DJ8B 1G6VK 1N8OE 4MA3A 2ED6A 5EOCL 2Z8RA 3I9PA 5E95B 4R7XA 4WFED 3VX1A 1FLRL 2BW4A 2NXYB 5C92A 1FDLH 5DO2D 4XT1C 1GMIA 3GM8A 4YDLC 5DJDB 2EH8L 1ET7A 3RUGB 2CUMA 3S88H 4I77L 2WXRA 5FYKL 4Z7VB 3FNKA 1TFHA 2LR4A 3ARGC 3ZTCC 4FQQB 4EUPG 4KJPC 4TQEH 3ZE2F 1G9MH 4S1RH 3IDXL 4XNDA 4G72B 3N50A 1SF5A 5DURB 4WV1A 4BM7A 1KJMA 1K3ZA 1FA4A 3TIDB 1KGCD 2BWQA 2X44D 3DLQR 3DTUB 2YD8A 3TEUA 3LB6D 1DJGA 5E2WH 4HS8H 4OLWL 5F89B 3ZMRA 4UTAL 2XPZA 3LDBC 4R5VA 5B1BB 4Z7NE 3U0TA 1OAYL 4ELKA 2BZ7A 1FN4B 3N1PC 5F9OL 1CT8A 2DJMA 5AVWB 1M7UA 4AJWA 2QBWA 2XRAH 3BVXA 3MRLB 4JEGB 3KL3A 4B9ZA 4MD0A 5E2TL 2YKLH 4DCQB 5ABDE 1H3TA 1P2CA 5E1GA 3ISRA 1JWSB 3HAEG 4FEIA 4PTTA 1KCVH 2IBZY 3O8XA 2VZUA 4PCKA 3IJEA 1BBJB 3W5NA 4QHLA 4LGRB 4K7FB 4IK6A 2ZUUA 2QKIA 4Y19D 4X42A 5FK9A 2R0ZH 3ZE1F 2E3VA 3W82A 4UV7H 4N8CH 2R2EA 3LHPL 4LLVA 2ORBL 3M17B 4FJ6A 3I3DA 2CUAA 4K71B 4N2NA 3MJGX 3WEXA 1JV5A 1WQVT 3D25A 4X9GA 4XN4A 3TZVB 5AENA 1QFOA 3R1GH 4PU2A 5ID0A 2WLJA 3V4LA 3W56A 4P2QA 1MUJB 1Y6NR 4YXLH 2CDEA 1FFRA 1CLOH 1F5WA 1YMMA 3V4PB 3GJFH 3LH8A 3O4OB 4F1SA 2CMRL 4JO2H 2EDMA 1RVFL 5C3IA 1UM4H 5J9PB 4DERA 3UTOA 2PYED 3WDHA 5HGBA 3V0WH 3HE7C 1LE9A 1FAIL 3RGVD 3QIUC 5ENWA 1E5BA 2E27H 5CJBA 5D7KD 2ZXQA 2WZPD 2WLIA 4A6YA 2Y07H 5BZDB 3UMTA 3CK0L 5LQBH 3KPNA 5HYQA 2ADIB 2HLEB 1JZ6A 5BXFA 3MV9B 1JZFA 3OHXA 1BIIB 5IFJB 1S5IH 2GK0B 2WXGA 3BZEA 2P80A 5BS0E 2H26A 3OR7A 3QAZB 2C3VA 5K9KB 2J8OA 1BG9A 2CXKA 3U83A 2BSED 1C12A 2SEBB 4LAQL 4C56A 1YNKH 1BM3H 4OLVL 3NJNA 3GINA 1YMHA 5ICUA 5CSGA 5L6YL 1TNMA 1BBDH 4QYOA 2L7EA 4HV8B 3HS0B 1IC5H 1AYRA 4H88L 4I1NB 3TH2T 4LPUA 4YXHH 4JRWA 1QFWH 3FULA 3IXAB 2VL5B 2D3LA 3ZT6A 1QPKA 4KUCF 2WYZA 4FQIL 2QPEB 4AQ8C 1I8IA 1V54B 3AB0C 5IF0B 3V52L 4P2YA 4WNSA 4WFFD 2MNWA 1KIQA 1Q9OB 5BMFH 5IROD 1ACYH 1IZJA 3CLFL 4HG4K 4WUKH 5CP7A 2E47A 3PWLB 2C1OB 4GMTL 5I30H 3QDME 1DE4B 3CVBA 4U7MA 4WEUD 4ZK8A 2UZIL 4QRUB 2HT2C 2V0AA 4G8GE 2VQTA 3V6OA 5H94A 2ESVD 4A7GA 1THCA 2DJ4A 2H9GA 3P0VL 4EDXA 4I88A 4JCWA 3VXQA 4KRNA 5JTWA 3H85A 1A7NL 4DOHE 1NMBL 1JZ7A 2YRZA 1L9RA 4PJBE 1F41A 1RUPL 1EA9C 2A38A 1EXUB 3BDXA 3CH1A 3FTGA 5FUOH 3DNKA 3VRIA 1AG0A 3JWNG 1P4IH 4Z7UE 3QG7L 5I18L 4QRRD 5CEZL 3BSZA 4ZI8A 4KVNL 1ETZB 5EA0H 2HX7A 1B0RB 1U8MB 5LB1A 3VQ1C 1A25A 3L1OH 2UY7A 3PGDA 1OARH 3H0TB 4APXA 2IANB 2CR0A 1QYGL 3NIGE 5DHMC 1K5NB 5EUOF 4YHKH 2BS8A 2R29A 3MGTB 2OYPA 3ZJAA 3BGAA 1ZS8B 2ZSWA 3BIKB 2FBOJ 2Q6WB 4BK8A 2F58H 3W9EA 4J39A 5KVMC 3ARED 1MIML 2HUEA 2Y7LA 4L5FH 1INEH 4GAAA 2N0MA 2W9LA 5IREA 2HKHL 1DQDH 3F7LA 3II3A 3IFLH 1ADQH 4PS4L 4ZW5A 3C6SA 3EYVA 1FL3B 1PZBA 2JJSA 4Y2NA 1F56A 3FQWA 3R7RA 1GSKA 3HZVB 4NHCL 5I5RA 3BUBA 3K1DA 5DLML 5IEKB 1LO4H 2ZOOA 5HPOA 5DD0L 1Z32X 2F08A 1A47A 1ZLEA 4CMMA 4GBXA 5I0YA 4BCYA 1MLCA 4PJFE 2OYLA 3VW3H 1A65A 3MZGB 4I0KA 1GVIA 3MMEA 3DX9B 2QADB 3AQXA 4ZS6D 2AQ3A 3OKNA 4UMGA 3NSJA 4XP5H 3AUVA 1C8PA 3I2CH 3KL5A 2FSEA 1OSPL 3Q05A 3GXDA 2DWDB 2DI7A 3FONA 4FKEA 3LXUX 4N2AA 3BT2H 3UAJA 2CSPA 2R7EA 5CEXA 2W65B 1ZGLP 1C16B 4MQ7B 1A7QH 2C3GA 3QEQB 3WN5A 3PWNB 5HI3D 2VRQA 1XF3B 2D2OA 4P4KD 5EOQL 3MLWL 4U1JB 5SV3A 1IE4A 4YHYB 3QQDB 1S7SB 3EJCA 1E4JA 3PXJA 4MGXA 4AEEA 4GNKB 2BSRB 5E00A 2FNWA 2QV2A 3KXFD 3NPSB 4N5EC 1KZYA 4S11A 5GS0C 1G4MA 2OBGA 4CVUA 1LP9B 4HGMA 4Z9KB 5DHYB 4YPGB 4G7YH 2WJ7A 1PNCA 3FO2A 1NC2B 4K7PL 1OTTD 1LXMA 1Q72L 2DN7A 1S7RA 2VDMB 2AP2A 3K4AA 4GEIA 3TEYA 1TF4A 5AOLA 3RIFF 4J2QA 4HIEA 1I9JH 2X4OB 1QG3A 1HWWA 5K1JA 4GUQA 3C87A 5T33H 3VTTA 4OGAC 5HDQL 3WXVH 1DSFH 3ISWA 3ASWA 4R26L 4JFVA 5K33A 2WUBH 4PJAA 1A0QL 1PCXA 1R6VA 4Y5XB 4JPSA 4ODUB 3SDAD 4N2IA 3L3KA 1MAMH 4PYHA 2XN9D 1EEZA 3TV3L 1XZ0A 5FS5A 2EVJA 5KVDE 1J1PL 4OBRA 3E9TA 4PJ9D 5B21A 5LXVA 3D3VE 4HGWB 5FR3A 3QK0A 4F7EA 3FTUA 4Z3GA 4RMBA 3SGDH 5HHVH 4Q0XH 2CWRA 5A1AA 3CFKA 1WAAF 3LRGA 2W07A 1VRSA 4KZCA 3P2BA 4MBOA 4OFPA 4M7LT 4N68A 4X7TB 3OHMB 3SJVD 4BV1A 3ZHDA 3GMRB 4Y19A 4IRSC 1BXXA 2B20A 5E1IA 1WD8A 4PMFA 4B9YA 2DZEA 1DBKL 5AKSA 4P23D 5C08D 1KIUB 3D18A 3L16A 4IHOB 1UWGL 4A2DA 3NP4A 1TLMA 3TO2A 5LG6A 3PXLA 3QUYC 4Z7NB 2P28B 3GS7A 2XWRA 2VT0A 4LQFL 5AZEH 2AXFA 4I1RA 3IDNA 4NXSA 2EVFA 2X3BA 4JZJA 3PGFH 2A6KB 2XPGB 3FQNB 2OV0A 3F6IA 2FO8A 2PYEA 3ULVC 5FM5O 1EPFA 1L9PA 5I5MA 2W0LA 4L8BA 2EDTA 1S9KC 4UT6L 3RGVA 3HCVA 5IIEA 3PG2A 4DCQA 1CDCA 4APQB 3VGAC 2WZPA 4ZO7A 4EDWL 3VFPA 3L5HA 2NW3B 3KDPB 5F9JA 4UF7C 1NEUA 3OGCA 1EDHA 4B9KC 1KF9B 1T1ZB 1NCCH 2VLRE 4OU3A 3L4WA 5KVEL 3DXAE 4N26A 2CH8A 1M2VB 2EE3A 3K81A 4WRLA 4RQQA 3TTSA 2F2HA 4RGMB 5BUGA 2BSEA 2ZCHH 1MFBH 2ZUSA 2PTTB 4QD2E 3ZL2A 4I3GA 1N7ML 1U93B 3CN4A 1XIWB 3PWVB 5I8CA 1XT5A 4Z7WF 1UXSB 12E8L 4PJEE 4QOKD 2YD4A 1OCOB 1E2VA 3FBKA 5LN4A 2HB0A 3ZTNH 2VL4A 1G7QA 4DW2L 3V7MA 3GSXA 4X7CC 5D70H 4R96A 3W9DB 4WFGE 5J9PA 1G1OA 4KJQC 5B7MA 4CW1B 4JM2C 1OGSA 1YUKB 3KPOB 4R84A 5FYJU 5IROA 1Y18B 1JF1B 2BVOB 3DX7A 3C8HA 2XWBA 5EB9A 5KSAD 2BHUA 4I3RH 1NLBH 5FUCC 1BFOB 3MTXA 5D1QC 1OM3L 5IKCB 3Q5OA 1FNSH 3DMMD 3CZFA 2JB6A 5CO1A 2ESVA 5DZ9A 5GXBB 3MV9A 2WV3A 3RPKA 3KBFA 1BIIA 2Q2EB 5IFJA 3VUAA 2GC4C 5E7FA 2OAAA 1KCUL 4JDEB 1T04A 4M7ZC 4NN6B 5JIDA 5K9KA 1J0HA 4EI5C 5L0QC 1KCSL 4B41A 4J6IA 1RZJL 3T6VA 2X6BA 2MQ3A 2FX9L 3FF8A 5JW4R 3TN0B 3K46A 5ADOL 4QRRA 3ARYA 4B53A 1MELA 3ZVVA 2HFGH 1O7DC 3WNLA 3UJTH 1DQIA 1L6ZA 3IMBA 1O5PA 4XPBH 3IXAA 2SODB 1L9NA 1MEXL 4B6ZA 1T3FA 2WXKA 4HUXB 4LLWA 2ZIDA 3GEFA 5A3IC 4GSDH 3DSNB 3DX8B 2YN5A 1UYWH 3AC0A 4IW4C 5IF0A 3B7RL 4U1LA 3T6ZA 1PD6A 1NFKA 4G8GB 4L4VD 2J5LC 3AREA 4DP0X 3TP4A 4PJHA 1V5JA 2X38A 4RESB 2C1OA 3CDGA 3SZKC 2DYPB 4LE8A 4AMKH 4QRUA 5LN8A 4Y4FC 3NCFB 3L54A 4WWKD 2JI1A 2VDPH 3BYTA 4JQIL 1OP5K 5E6IC 5EF0A 5IUSA 2AMUA 1JGDB 2WLNA 2RB8A 4L3ED 4R8WH 4A7VA 4I18A 3RFRA 1CTNA 4MX7A 3UTTB 2WXJA 1WSST 1UD4A 5HVHC 1AO7D 4OM1L 4PPTA 2VISA 3ARFD 4NENB 1UJ3B 2WOBA 3STLB 3U1PA 2JNZA 4JM0A 4PW9A 3NIGB 3ZKMD 1KC5L 4Y4HB 3CLEL 1XF2A 4PBWD 4N85A 1Z0MA 4XNYH 4XNUH 3K6SA 2DAVA 4PY7B 4HZAA 1PYWA 5ICZA 4NI3A 3CVHL 2IANA 1KPUA 1QLFB 2H1PH 2N56A 4M6AA 3IDIA 3BIKA 1FDLL 3I3EA 1VB9A 4Y9CA 1V7MH 4P4KA 2ZWSA 3OKEA 4LKXA 4A37A 5DFAA 5FO8A 5AVRB 4BZ1A 5HHMD 1LK3H 2NTFB 3M45A 3S88L 1BM7A 4K07A 3WI9A 2C34A 2DF3A 3VB9A 1UB5B 3H2WA 1XEDA 2NY6D 2ZUQB 3BZFB 4JDTH 3KXFA 4TQEL 1G9ML 1KB5B 4S1RL 1FL3A 2BX5A 5CBEA 4LKCB 4DP8X 4DO6A 3WLBB 1F1DA 3RWGA 2QGBA 3MRQA 2C7UB 3HVDA 1OALA 3CC5A 4IKNA 2BSCA 3ZMEA 5E2WL 3VYPA 3WFCH 2N7SA 4HS8L 2C4XA 5CD5D 1QRNB 3BESR 3WU1A 3WS6A 1FGNH 3DX9A 5JOPE 4R7DB 1KELH 3OKDB 1E8ZA 1ZVSB 3DROB 3KCWA 1BAWA 5I17A 2XRAL 4IDLA 1FO0B 4LVHC 4YZFF 2YKLL 2VITB 3PDOB 3SDAA 3GS0A 2NXZD 2XN9A 4GKZB 4OZHB 1PZ5A 5IBUB 2F1AA 4PG9A 1UT1A 2GSMB 4J3WA 1KCVL 4PJ9A 4U2YA 4WEMB 5GGQH 4IBUA 3G5YB 1EMTH 3EH3B 4Z76B 2PW2B 3NSCA 3QQDA 1II4E 1EH9A 1G0XA 4M02A 5MEOA 1YPZE 1JI2A 3I6KA 2IFFH 4OUOA 5I1EH 1CBVH 1SVZA 2R0ZL 3ATBA 5AB1A 3D85D 3SJVA 1N26A 2ZICA 2OZ4H 4UV7L 4N8CL 5F0LB 1BECA 4DFHA 3QWNA 5C08A 4P23A 5F97E 5DHYA 2ICWA 2LFGA 2JLLA 2F7QA 2HSIA 2WKOF 4N2DA 2VLMD 3QR2A 4F15C 3IDGA 3R1GL 4YOKA 1I3RA 4R0LC 1AS8A 1LK2B 4HX1A 4MNHB 4Y2DB 4HKJA 4PWIA 4YXLL 1ZTXE 1CLOL 1QRND 1B3JA 2CXGA 4PJXF 4ECNA 4GW1A 3ESPA 4W9ZA 5DZLA 1UM4L 3KYOB 1A6WH 4B9FA 1CFVH 1KTDA 2G75A 3HZYB 2DMCA 5CLZA 4IGBC 3RDJA 3U6XS 3V0WL 5I8OH 2WNXA 1QLEH 5CU9A 2OCJA 3D3VB 4BUGA 4FCHA 2WQRA 4TTDD 3FT0A 2NY7H 4EMZA 3KM1A 2DOCA 3BD5A 5LQBL 1QFUH 2V9UA 4HGWA 4RX4D 1SDDA 1IIKA 1HHHB 2AZUA 5HSFA 1E9PB 1WA0X 1S5IL 4AQAA 5C9JA 3BGMA 3QQ9D 1N64H 1RU9H 2F7IA 1TVHB 5J12B 1SOSA 1VEMA 1QWUA 3HRZC 3BPCB 4HLZH 2NUTB 5K39B 4WJKB 2X87A 5GGTA 4UOQA 4HOZA 3T3PB 1YNKL 1BM3L 1CGXA 3Q8EA 3FHAA 2JJWA 1FORL 3X1EA 3ZDZE 1KIUA 1NOAA 4RAUA 1BBDL 3FQXB 3IPBA 4WW2B 2WINB 1IC5L 4AIZA 4HA1A 2X4SB 4YXHL 3PNRB 4AGQA 1QFWL 5D2NC 3QFGA 5HDBB 2GK2A 3V4UL 1ERNA 5J3HC 3ABKB 3GT6A 4QOKA 3WL9A 3C5SA 2FJFB 3KM2A 3QUZC 4QXTA 2QTEA 3S8FB 5K9JL 3HN8A 3BPNB 3RVXD 4NO0D 1CB4A 4RBPH 4A2GA 2AGJH 5DU7A 3QO1B 4GO6B 1KCWA 2XPGA 4FXKA 5BMFL 4IJTA 1ACYL 4Q4EA 4WUKL 3RIAK 4ORZC 4IIZA 4UDTB 5I30L 4QXVA 4OF3A 1T4KB 1SPDA 5KSAA 4GQRA 1PIFA 1WFUA 3T77A 3IGAA 3L81A 2X2HA 2OQJA 4XCCH 2CDGA 2J71A 4UM8A 3DMMA 5C09B 5E8DL 1GOGA 2NW3A 5IB1B 15C8H 5EU4B 5DUBA 1G7HB 1T1ZA 1BQKA 4NQTA 4NUGH 5FUOL 5I5IA 4WZ9A 3NCJH 3VFRB 3UACA 5EA0L 1QI5A 2PTTA 3MSPA 4N25A 3PHAA 5CLWA 3H9ZA 5CCJA 3QJUB 5F7HA 2WM0A 4RNRB 1OARL 3PJNA 5CZXC 1WZLA 4NUQA 1A8JH 1NIDA 2YAEA 4YHKL 3WFBH 3ZDYF 4OV5A 4UWQB 3CX2A 3AFLA 2R9HC 2H41A 2F58L 3H9SD 3WHXB 3GGWA 4L5FL 2WLLA 3KPRB 1INEL 3EADA 1AXSB 1NGZA 2OYMA 4L4VA 3ZSSA 3SE4C 1DQDL 2AJYH 3IFLL 2LLGA 1ADQL 4FXGC 4KV5E 1BCIA 5E9DD 2NY2C 3CQQA 4AC2A 4NYLA 1G7JB 2VRKA 4WWKA 3GQFA 4AZUA 1AP2B 4L3EA 3QNYB 3AM8C 3P69A 3O11A 4XHQA 4NAMA 3ELAT 4RDQG 1Q38A 2WVTA 3VW3L 3U6RA 4M4RB 1AO7A 4P2QE 4DUWA 1X7SA 1E3ZA 5AOMA 1YMME 2AQSA 2HTLC 1OP5H 5DJAB 3AT8A 3BWUF 3ARFA 3EHBD 1A4KA 4XP5L 2A6JA 3MA7A 3O9WB 1T0MA 3I2CL 1BZ8A 4I9WD 2YEZA 1ZVNA 3SQBB 4ERSL 2O4EA 3BT2L 5HYJB 1B6UA 5INDB 4X6CB 4HJ1A 5ANMA 1A7QL 1I7ZB 3ZY7A 1CLCA 3IRCA 1DJXA 5A2FA 3DX8A 1I7TA 2QLYA 3H4HA 1JTPA 4KMLB 3S4SB 4NQDD 4RAHA 3FU3A 3GSRB 5KSVA 3VVWA 4UT9A 1K6QH 3M07A 4LOUD 3EH1A 2BO0A 3KPLB 5GRZA 3ARDD 1A6AB 3ASNB 1OTUC 2R0KH 3ZW3A 3SDCD 1HFUA 3ZQWA 4FQJH 3RI5K 4C56E 3E3QE 5GZNA 4G7YL 1JZ3A 2B1HH 3SGEH 3ZE0F 4MASA 3FZUD 2DTML 3PDDA 3K71A 4KRPC 3UTTA 1A4BA 4FQPA 1I9JL 1QLRA 3QAQA 3OJDB 1QPXA 2APBA 4YDNA 3ZZLA 5F7LB 2PABA 1DSFL 2KI6A 2OXGB