4ATTA

Fimh lectin domain co-crystal with a alpha-d-mannoside o-linked to a propynyl para methoxy phenyl
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords FIMH
publication title Validation of Reactivity Descriptors to Assess the Aromatic Stacking within the Tyrosine Gate of Fimh.
pubmed doi rcsb
source organism Escherichia coli
total genus 38
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4attA00
2VCOA 2W07B 5IQOA 1QUNB 4AV5A 2JTYA 4BUQA 4X5QA 1N0LB 4AVIA 5IQNA 4XOEA 4ATTA 5AALA 3RFZA 3ME0B 4AUYA 2UY7B 1PDKB 1UWFA 4AV4A 5CGBA 5FS5A 3ZL1A 3ZPDA 4AUJA 4J3OG 1N12A 4XOAA 4J3OH 4XO8A 3MCYA 5F3FA 4LOVA 2J2ZB 4X5RA 5JQIB 4J3OF 5F2FA 4AVKA 4XO9A 4AVJA 5LNGA 4XOBA 3BWUF 2XG5B 2WMPB 5FWRA 3ZL2A 4X5PA 3BFQG 5FLUA 4AUUA 4AV0A 5FX3A 4X50A 3JWNE 2XG4B 2JMRA 3SQBB 2UY6B 1TR7A 4CA4A 4CSTA 4XOCA 1KLFB 4CSSA 5AAPA 4AVHA 5AB1A 5IQMA 1KIUB 5LNEA 3BFWA 1ZE3H 3JWNG 3JWNH 4XODA 5ABZA
chains in the Genus database with same CATH superfamily
1LQSR 1NGXB 1GSKA 5FYJD 3VGFA 1ZLDA 2WCSA 2MTAA 2WLMA 3MV8A 3QUMH 3FSOA 2ARJA 2FGWL 2N56A 3QHZH 3WDJA 1JV5B 3OKKB 4B9ZA 4MJ4A 2VE6A 3NG5A 4Q6IA 1XZ0B 2WINA 1A2YB 2WGXA 3W38A 2ADJB 3OGOE 1MWAB 5DHYA 4ABQA 5FK9A 5CJ5A 4PJCA 4ZNEE 1DBBL 2J88L 4WHTB 1HH9A 1OAKH 3BH4A 5D7EA 1XAKA 5HDQL 3ROOA 2OYLA 3C09C 4RCAA 2Z64C 1J11A 3GS4A 3K3QA 5MEQA 3KLQA 2E9JA 5J7CC 2CDFB 1KLFA 3AMLA 4W9EC 1MW0A 1W15A 4G7VL 4AY0A 3JBG7 2XHNA 3FN0L 3C9NB 1MJ7H 4TV3A 1FO0H 1PG7H 4ZMAT 5SX5K 2F54B 5FW7A 1CK0L 1RPQA 4U2YA 5AW3B 5HHPB 3CZFA 4DUVA 1S9YA 1IC4L 1FAIH 3Q6FB 3N44F 3AQDA 3F6IA 4PTTA 1R34A 2F1AA 3V5HA 3S4SA 1N2RB 4P05A 5GGSB 5FKPA 5AAMA 4KK5D 5AOLA 1KEGH 3WYRA 1FGVH 5F7UA 2R15A 4IS6A 1E7UA 3MLTB 5GGQL 2RD0A 4NSKB 3RDTD 4JFUA 3X3GL 5BUGA 2ZSVA 3RKDD 1E65A 4WI6A 4Y4KA 5I17A 5E94A 5FYLE 2D7QA 2BNQD 4R7XA 2NY5C 3KBFA 4MAYB 4OJDH 5D4IA 4E68A 2MOVA 4FXGA 5C7XH 1ZE3C 5IMMB 4P2OC 5D1XD 4PJ7A 5C0GB 1FYHB 5IB2A 4NQUA 2X4SB 1DBJH 2VN5A 1EJ6A 2VTFA 4I5BA 4MZRA 3IMUA 1DJSA 4LCYA 5AZEH 5TF0A 3NSYA 4EBQL 2JKJA 2TRHA 3ESUF 1KCRH 4FZEH 1NGZA 4DVBA 2JLLA 3HLAB 2OPCA 1SXSA 4WV1C 5EU4A 4I18B 3ULUF 4QO1A 5D2LA 5JOEA 4LSPL 1CMOA 1DCLA 1KN2L 3QT2A 4ATWA 3UTPE 5BNXD 1XXFC 2IH8A 1D5MB 3S9DB 3ROLB 5FCUL 1IFRA 5EIIA 5D55A 2JI1A 2IWGA 4XVOA 3NFSH 4P46D 4NHUA 3K4AA 2ZYHA 1O6VA 4PP1C 2XV0A 4ONHB 4RMRA 2P47B 1PKQA 3MXVL 4B9YA 3TN0A 4EVNA 4JLRA 1DSFL 2H8PA 4HSCX 2Z1PA 3D0AA 4CC4A 4L3CA 5C07D 1FVDA 3EJSA 4DO5A 3WFEL 3INUL 2FD6H 4V1DA 2NYZA 2EIZB 3I75A 3TFBA 4UZSA 1JNJA 1WUNT 4ESKA 2YBGA 4Z0XB 3THMH 5CEXA 5E56A 1XF1A 4KDWA 1E9QB 2GAZA 3MNVA 2XJKA 1VKXB 5J9PB 4FXLA 1QA9A 1VEPA 2QL1A 3TU6A 1AGFA 3GRWH 1NC2D 1W0WB 1W8NA 4H8QA 4TXVB 3QWRD 3CLWA 1KNOA 3HI5H 3APCA 2Y2YA 1WHPA 5ETUB 4LVEA 4CRPA 4ZPVB 5HYIA 1NC4A 3D0LB 4XTRD 3MJ9L 2CAKA 2QR0B 5DHVB 2K8QA 4NI3A 1WVZA 3I74A 5AW1B 1B9KA 2HTKC 2EXSA 3FAXA 4LKXA 3QAZB 2MTPA 2NZ9C 2ZSWA 5F2FA 1TVBA 1X5ZA 3T4AB 3LXCA 4PRPE 1R6VA 3BOVA 4IQHA 1NIAA 4YO0B 4B9GA 4YIQB 3HJ0A 1JNNL 2CXKA 3BSZL 3QDJE 5IB4A 1PQZA 4PJIB 1Z66A 1CT8B 1I8KA 1P5UB 4XP6L 3GHBL 2X4PA 4S11A 4ZX6A 2HN7A 2ADFL 4P2QD 3U48A 5I0VA 3B83A 3NZ8B 1HC1A 4IW4C 2OMUA 2EINB 4UDTB 4V11A 3V0VB 1BQSA 2EYSA 3A23A 2EAEA 2NY0C 4QOKB 1CLCA 1WO2A 2VDKH 2JCWA 3BVNA 3HRZC 3M46A 4HK3J 4N8VB 4POZC 2WXFA 4QMEA 2B5IC 3WFDL 1AG0A 2YPKB 4JKPL 1A7OH 2ZOKB 3FQXB 1ZAGA 4HW6A 4YHLH 3SQBB 3GMRA 3VXRB 4L3FA 3JZYA 1YNTA 4Y0GA 3VB8A 3HAEA 4U3SB 4YZFF 3QQ9D 3TIEA 1TDQA 3QZBA 4X2UA 3QG7L 1QBBA 3RL2A 3IJYA 1DQDH 4GAFB 3TASA 2CBOA 5EN2A 2E3VA 4PJEE 2J5LC 2WLJA 1OB1A 1KDJA 2XT1B 3KW8A 4WI3A 4I4WA 3QXDB 2EUXA 3IMTA 2CD0A 3JSSA 5EO9B 5DFWH 4IBQA 4N2GA 3QO0A 4HGKC 2CGZA 1CXHA 4QHLA 3H56A 1QUNB 4BUGA 4HA1A 3GKWL 4WWKB 3DBXA 3OX8B 1BVOA 4LF3B 3TO4C 1LTXA 1MI5E 4I85A 4P4KA 4DERA 5CIPB 2HLFC 1U8HB 2NY2B 1CYGA 3HG1A 3UPRA 3UDWA 2IQAB 2WBJD 2WSPA 4PWJA 4BFIB 4Z8FL 2I9TB 4Y2DC 3C5ZA 4AC2A 1TFPA 1JGVL 5BW7A 1JNHB 1LK3L 2YXFA 3QR2A 3VQ1C 1ET8A 1CU4L 3UTTD 4NKOB 3L9EA 3QK0A 1T2QH 4C4BA 4FZ8H 1IILE 5EIVA 4AJWA 4PSPA 1DBKL 2PWEA 4HDIB 3OWRA 3F65A 4U1IB 3SJVE 3EXJA 3T2QA 4LSRH 1YEWA 4F33A 3IMWA 4MCZB 1CFMA 3FT2B 2OTWA 3HS9A 2PR4L 4MKMA 1FGNL 1XGYH 2X2UA 1NL0L 3S3SA 4NAMA 1QBAA 5JIIA 3LMJL 3FC8A 1MFBL 2XIBA 4DUXA 2V2WB 1OTTD 2X1OA 1UENA 3FQWB 1BF2A 5AKVA 1MAMH 1AGEA 4JRYA 4FD0A 3D0VB 3QUGA 1T7WA 3LZRA 2Y1AA 4DZ8B 5IP4A 3FQNA 4DP1X 5E4AA 3GJEB 2JJTC 2VDOH 4UV4H 1U8JA 3Q9PA 1IT9L 1PZDA 2HG0A 1E43A 5DC4B 5CUSL 2SODB 3L5HA 4XVTL 1GZHA 1JYVA 1BBJA 1ZGLA 3WTYA 3P4NA 1RQ5A 2DEWX 3MV9A 3ZE2E 3UTZB 2JKTM 2ZXWB 1NCCH 4N20A 4DNLA 4DO6A 5DS8B 2F58H 2APVA 6TAAA 1GXEA 3VX1A 5K69A 3Q2NA 4ZSOB 5TJWK 1ZLSL 2X4UB 3G9AB 2K9FB 4GAJL 4TRPH 1UB6A 4N3UA 1KYOJ 2XN9B 3MLRL 2X2IA 3DC0A 1RVFL 1ZA6A 2AKRB 2XQYK 3BX7C 4KUCD 1THAA 3VI4A 4PW3A 1SYVA 5I19H 3PQYA 2DRUA 2A74A 2R1XB 1YAIA 2BWDA 2CIIA 4PWFA 4XAKD 2H6PB 3FJTA 4FERA 4FQQB 3LIZA 4LPVA 4QHUB 5F88B 2B16A 3PGDB 4YXLL 4FABL 1OP4A 2VABA 3GJFK 5IG7B 1FN4A 4P5KB 3VFTA 1BQRA 2VZOA 3V5DB 3OAYK 4WHCA 1LP9F 4GRLD 4NO2A 2HT4C 1C5CL 5DD5L 1ASOA 4R5TA 2VXQL 4APQA 1KUMA 3CZNA 2EDRA 2ZJSL 4GG8A 2DKSA 1X5LA 4JHAL 3QORB 4IOSA 5HHOA 4ANXA 4TTDC 4CMHB 2XBDA 3QFJB 4TS6A 3WKQA 5IB1B 4GBXB 4NNXA 3QSKB 2IAMA 5K9KA 4Z7UA 2IAND 3FH8A 3V6FA 1KCUL 3C6LB 4MJ5B 4DPRA 3ZZLA 4ZUWA 4KK6D 3RVWC 2WJ7A 2Z65C 4JRWA 4QEGA 2DM4A 4CJ0A 1NGQH 1U93A 3UG3A 4IOIA 3EFFB 4PJ5B 5FYKU 4G83A 3T3MF 4GYBA 5ADPH 3AREB 4FLHA 4IGBB 5MEPA 1CXKA 3M88A 3KYNA 1TQCC 5E1IA 3EJRA 4PV8A 1M3JA 3IDNA 3GQFA 4JRXB 4JG0L 4JO2H 1BOGA 4Y7MA 2IXQA 5T1DL 3EYFA 5FO9A 3RI5K 5JYMA 1CURA 5KYWB 3KS0H 3BVUA 2FUTA 4HCRL 1BD2A 3GEWB 3ES6A 5F7LB 1BQHG 5FA3A 3OKLA 4XMZA 1O9VA 9CGTA 4N0YL 2DQEL 2ZAGA 5KZCB 5IUCA 1AYRA 3DX2A 2O5ZL 5E6ZA 4B5EA 5AYUH 4XHJD 5DZOA 2D0HA 4Z76A 2NNAB 2A77L 3J2PA 1WBZA 4L4JA 3KJ4B 4FDWA 4UM9A 5I15L 3V9CA 2EEBA 2BOCB 2OX5A 3ZDZB 1J0IA 5FGCE 1NLBL 4BSVB 2J20A 4B0MM 4BHUA 4JPKH 1OAUH 5FLUA 3OR6B 5JW4R 1IJ9A 3C12A 2YC1B 5FOBA 1DE4A 4OJFL 1V27A 1I9IL 2Z0UA 3ULUH 1EH9A 4K5MA 5T1KD 4MQXC 4O4YL 4R97C 2BNQE 2VLRD 5DJDB 3QWOA 3WY4A 5FGRA 3HHSB 4GXUM 2Y5EA 3HMXL 5FLVA 3RU8L 2C7UA 2VKXA 2R29L 1EEQA 2BVOB 2VL4A 1HHJB 4Y4FC 5D1XE 1QTSA 2DYRB 1ANUA 1AXTL 4PY8I 1M3IA 5A2LH 2Z92A 1WAAA 4L3EE 4U1MB 5I1JL 4GT0A 4J3VA 4DKAA 2EKSB 3OGCA 1IAOA 2AK4B 4Z7NF 4HIJA 2FLBT 2EZ0D 1EDYA 2XTSA 5EBMA 3FPYA 1IBZA 2E9GA 1OWRM 1OSYA 3B2PA 4TTGA 4GRWF 3FQYA 5KSAA 1CGWA 3VXMB 1I1AA 3MV7D 5KYXA 3HJEA 4BCYA 3KXFD 5DLML 5GS1C 2CKBL 3HHRB 2R0ZL 1WZ1L 4QNPE 3FZUD 3VD2A 3KPSB 3L1OH 3HI1B 5EG6C 1KBWA 2WO2B 4L4VA 5AVRB 2PXYA 2J8OA 1L5GB 4P2RB 4MNQE 4AV5A 2C26A 4J3SA 4DKTA 3ZTJG 3IFOA 4O9HH 1OM9A 1SJMA 1MRFL 3APDA 2P8LA 2XWDA 4KX9A 1HS6A 2PPFA 1IGTA 2BHUA 3CQFA 2Q6WA 4ZYKA 4X6CB 3BKYH 3HUJB 1RJLA 4GSDH 4H26A 1E8YA 2PCPA 3F2LA 5DRWB 3M7FB 4YE4H 4E9YA 2C1PA 4OZGE 1QO3B 2UY6A 3FQ2A 1FZMB 2ZXGA 3CZLA 2YA0A 1EBPA 2R39A 2JELH 2YAFA 3BYYA 4KK5C 5C0FB 5J1TC 5ITBH 4LK4A 3L9RB 3OKEA 4JL2A 3DRQB 4Q9BA 3TWCL 3QS3A 3RDTC 3AG4B 3RKDC 1PCXA 3ELQA 4IYKA 5A3ID 4N1EA 4O02A 1CGUA 2EH7L 4G80A 3JUYA 4APXB 1CFNB 2EABA 3BUQA 5D70H 1RJYA 5IBTH 1TTCA 1YQ2A 1TQUA 5D1XC 2GCYB 4M9PA 1YNLL 2D8KA 2A38A 3WIIH 3V7MA 3PHAA 5LXVA 4GG6E 1R1CA 1A7NH 4JPSA 3L6FB 2R7EA 1H6EA 1QBLL 3NFPA 4QRBA 4KROB 5GZOA 3KYKH 1OQOA 4Z5RB 4C8XA 3CFIC 3GGWB 4F5CE 2P45B 5DMIL 1Z32X 5CXPA 2J7LA 4S0HA 2ZNXA 5T33H 2NY6D 1FV1A 4UUJB 4PP2A 3UROR 1IM3D 4OQTH 3B8SA 4LHUB 4M62H 4F8LA 4P2QE 1R46A 2J4WH 4L0YA 5DEZA 2FATL 4LDCA 4R4ND 3VD5A 3PHQA 3DX8B 5F3BB 2NMSA 1MZYA 3OZKA 3KM2A 1G6RH 2YKLL 1IGIH 5DYOB 3VE0B 3PNWB 1U8MB 2XI9A 4NZTL 3ZDYF 3TFKD 1XD0A 1L7IH 3Q43A 5B1KA 1B88A 2OSWA 1GHFL 1IGMH 1JUFA 1XV8A 2DEYX 2QVTA 4DFHA 5GS2H 1OAJA 2RCSH 3JVGC 1I8AA 5F9WB 1E6JH 4P5MB 4ELMB 3ZK0A 3U46A 4OQTA 2ENJA 1T4KA 4WFED 5I0WA 2ZP8A 1OPGH 2WN2A 1RJZB 5I74C 2XXGA 3GMNA 1KN4L 2GSIB 1LEKA 3QJFB 2VH5L 1UWXH 1INQA 4OZFH 1RUKH 1K8DA 5IJCC 2NW2B 1ZHKB 2YLKA 3PGFL 4FQLL 4Y5XA 1CI3M 3U6RB 4OLVL 2K4WA 2VN4A 5FW6A 4F8NA 4Q56A 2FLRT 2GI0A 5CZKA 2R27A 2B39A 1WUZA 5CCKL 1VGEH 3LKNB 4P3CL 4XTRC 1V54B 2CBQA 5A16B 3R8BB 5IHHA 4Z7VA 2X4TA 5EUOB 4MD5B 3O6FB 3BVDB 3UIYA 5E2TL 3L5IA 3F62A 1AZNA 1KIRA 3UTSD 4B9KC 3UACA 1XGQA 2W9EL 4Y19D 3MLPA 5L8KB 4YR6B 2GITA 5GGTH 3HA0A 3UTTE 1WTGT 4OF3A 3X12B 2YAHA 2O26U 3MRCA 4DPCX 3EUUA 3MO1B 3P4MB 4AEIL 5KS9A 1NM4A 4ZZFA 2A73B 4JM2F 4L8SB 2XZAL 2JJVA 3T0XA 1OTSD 2ZXAA 4GO6B 4JFPA 4AT6B 5KVGL 4R96A 4X5RA 3STLA 1ZA3B 2Z8VC 1FI8C 1GOFA 1OV8A 3N42B 4X9HA 5JTWA 4GSRA 4FTVB 4QAMB 4EN3B 5GQBA 4B3EA 1EO8H 4XPBH 3EGSA 3B8YA 2F5AH 4NKDA 3K81A 4KTDL 3LNIA 3MOBH 3D39A 5E9DA 1TKWA 3S37L 2Q3ZA 3C60D 2IF7A 2EKJA 1EEZB 1OSZB 4JEGB 4YUEL 5IGXL 1XMEB 1S7SB 32C2B 4PBVC 3GIVA 1NFIA 5L8JB 3OAUL 1WZAA 5FYKH 4LVNC 1YEEL 5FM4A 2AJYH 2VRAA 3D52A 3ATFA 4FG2A 3X13B 3MNDA 1D5BA 1MVYA 1YC7A 4UT6L 3HC0B 1AR1D 2DLIA 3UAJD 4MZIA 5JA9A 3FQTB 3MRMA 2YEQA 4JQIA 1KLGA 1B9ZA 2XRAH 2F9BT 4IBLT 2F0CA 4WEBH 3U0WH 2DQHH 2PYFA 2KMWA 5L2KB 3UGXA 2WP3T 5FHAL 3P0YH 3EO9L 1NJ9B 2WBJC 2X4NA 2X70A 4HMEA 1ZXKA 3X11B 1DVXA 4JN1H 2YMTA 4TNFA 3HIZA 5I1GH 4R8WL 3FS9A 1OAXL 4NFCA 4TYUA 3SKNA 1A6AB 3WJMA 3IRPX 5HGDA 4WUUA 2QQLL 2CBPA 4MQ7A 5DHDA 2QVFB 2V2XA 1I31A 1KCLA 4ODHH 4X6BB 1QR1B 1G7PA 2XIDA 4LEXH 3HPLA 3WFHA 1PZUB 2GKIA 1CFTB 4F92B 3MRHA 15C8L 3W82A 1KXTA 4K5LA 1BLNA 2BJMH 3JV6A 1OTTC 3GXTA 3VGBA 4Q9RH 3CDZA 2MQGA 4K5OA 1RIUH 4W93A 4UINH 4PGJA 1UOWA 3X1BA 4F58H 3COOA 1XH3A 2IANE 4FG6D 3LH8A 3P0VL 2A7BA 3LQAL 3R19A 4PCKA 5EC2A 4AUJA 2AJ3A 2VR9A 1DQJA 1HHHA 3G5ZA 4N5ED 4OFYA 2OTUB 3TYGL 2GJ6A 2VMCA 5CEYA 1DP0A 1QD0A 3LXBA 4GFTB 5JIHA 5J6GB 2DY2A 1LVEA 5IQLA 4LOVA 1UXWA 3HRZB 3QJRB 4UQDA 4QLRA 2BZDA 2OYKA 1DUYA 4DGUA 1MY5A 4WHYG 1DBAH 1IC1A 2RHEA 1QSEA 2W0LA 2FJUB 1W72B 1LO0L 4D0BB 5EWIH 4KXBA 2JKXA 2WB7A 4OTXL 1UURA 4NNYA 5F9OL 2L04A 3HCVB 5I8OH 3BVXA 2VDQB 4MS6A 1TU2A 3QZWG 3NJIA 3W2DL 4NDMB 4YEEA 2DTMH 4H8VA 2C8NA 1SY6H 3F8UB 3GRBA 4G11A 1J0KA 2J5LB 5JHDB 3OAZH 1MHCA 4UT7L 2ITCB 2JTDA 5SV3A 4ZUUB 3TZVB 2EO9A 2Z8RA 3QJQB 4MMZA 1S9KC 1URZA 2TRYA 2JJSC 1OE2A 3HZMA 4IJ3C 3WHXA 4QT5B 1E42A 1HCZA 4HLJA 4JRFA 4GRWH 1ACYL 1EAOA 3HVNA 1EAPB 4HF5H 1ROWA 4GRLC 4QRTB 5B39B 3BDYL 1PEWA 2KUTA 2F5BL 4LSSL 4U1KB 4WFFD 4D9LH 2AS5M 1INEL 3H9SD 1X4XA 1NUFA 3GFUA 4P4RA 3I84A 4ZFGH 3IDIA 2OL3B 3TCXA 1C5BL 4M7KL 5TK4A 2W94A 3OKNB 1OQXA 1A3QA 4DQOH 5BVPL 3O3AA 4XNZC 2EDYA 2WJ5A 2KDGA 5H37H 1EXHA 4KK6C 4ONFH 2NY5L 2UXTA 5T3ZL 3HFFA 3MQIA 5C09B 4YL9A 1D5ZB 4ZO7A 4PJXA 3DIFA 4FQXB 4WK0B 2BDNL 4RFOL 1XCQA 3NJVA 3KXFE 3A4DA 4KXZI 1NGWB 2YAMA 1N6QL 1I4FA 2EDWA 1Z5YD 4PS7A 3Q2LA 4FP8H 4XMUA 2AHIA 3GBLA 2Q7NA 2UZXA 4N2HA 2O5NA 1AS7A 3OAZK 4MD4B 1U8PB 2J55A 3BPLC 1VDGA 3MRLA 5ICXB 5C0ND 1VB9A 2BIQA 3ETBJ 3QEQB 3KPLA 1IC5H 4G43B 1JZ5A 5JXAL 1PZAA 4KPHL 5K39B 2LQRA 3GSXA 5LN4A 2WVUA 2UVEA 1CBJA 3E9TA 2KLTA 4QJ3B 2UYLA 1KIPA 2QQNL 4XHJC 2ZWYA 3ETSA 4XP1L 3O0LA 4F8TA 3MN8A 1ZLWH 5BS0D 4XN4A 2E7DA 4HLZH 4Y5VC 3FUHA 3MKGA 4K5PA 1AIFB 4WY7L 1QWNA 5T8IA 5KVEE 4XNAA 5DXWA 4RIRB 1QFUH 3HZYB 4KUZH 2Z4QB 2WKOF 4D8PA 1A6UL 4HUWA 3ZRSA 3FMGH 2Y7NA 4PJDA 4E5XB 5B1CA 3QI9D 3U0TB 3V6OC 2OMVB 3G6JE 1F4WL 4ERSL 1S78D 3O8XD 3WEXB 3WO4C 4YPGA 4XR8C 2QFPA 3GSOB 3LNEA 2B2XH 4WDIA 2V9TA 4QTHA 3ZL2A 3L9BA 1JZDC 3RBGA 1QNIA 1JYWA 4OSUH 2DWYA 3F3HA 2XXMB 1R3JB 4N8CL 2EZ0C 2IQ9H 1OZUA 1F90L 1R3LB 4K94H 4LARH 4OLUH 1JK9A 4OZHE 2DJSA 4X4XB 5D7HA 4AX3A 4DKDC 2X9WA 5F3HB 3K6SA 5K9OB 5BZWB 4GS7B 1F4HA 2P5WD 4HKBB 1OT2A 4MXVF 3GMMA 2VC2L 1B4RA 3QZLA 1Z6JT 1SLVA 3SGJC 2OS7A 2O30A 3IETA 3FZUC 2FWUA 4XPTH 4WI8A 4NP9A 1IARB 1CFSA 3L45A 4B7LA 4QXTB 3RUGE 3Q2WA 1J0HA 1J8HD 5DS1A 4G9FE 2E5EA 4IRZH 1UACH 3BSGA 5JW4M 1C5DA 5D4HA 4TL5A 4DGYH 3HFML 3PHOA 2X4RB 5GISL 3ABKB 5D6CB 2EEXA 1JS4A 1REIA 1NBYB 2XDHA 4PJAA 4QKTA 1J7VR 1JPGB 3VRJA 3S3PA 3RWDA 3H2WA 2P8MB 4MA1C 4E41B 4OBRA 3IK2A 3LS4H 4OIAA 1TQCB 4U6TA 3KPOB 2YK1L 3CG8A 4UIKH 1WFIA 1CI5A 5JORB 3FUJA 1HI6A 4JGJA 4XC3L 5IVXA 4TSBL 4CADA 3D06A 3MOAH 3H4HA 1DVFD 1MDTA 4NGHH 2B0SH 2VIRA 2W88A 5TDOB 3AMKA 4BKLA 3VACA 2H3XC 3N9GL 3O2DL 5A3IC 3UMNA 3ME0B 4OGYH 2FQFA 4PV1C 3KPNA 4YDZA 2G0KA 1DQMH 5A2AA 5FO7B 3TX4A 4Q9CA 1EFXB 2VDQL 3QRFM 3CN3A 3IGKA 3MCKA 1AD0A 3FFCD 4JFFD 5C0IA 3TGXA 3EYUH 1Y7VA 1M7IA 4JG1H 4WZ9A 4EUPH 1NAKH 2UZPA 1UM5H 4QRUB 1AKJD 3B56A 2EXYD 2LLLA 4YSCA 3QUZB 1RURL 5D7IA 5SWZB 2PWDA 1JWMA 3SBWA 1PYWA 3DTDA 4YHMH 1VEMA 1JGLH 2AMUA 2NY6C 2QHRH 3CDFA 3D2UD 3KLDA 3PDDA 1Q9OA 4FTDA 4JM2A 3DROB 2V7HB 4MJIB 1NGXA 2NZIA 2XQ0A 3GSNL 4N2IA 4Y9GA 4JKLA 5DK3A 4DN3H 1DQIA 5D7LB 1MFDL 2JKSA 3JV4B 3MCLH 4R4NC 3FT3B 3UO1L 1JV5A 1ETA1 3OKKA 3FU5A 4MS8D 4MQSB 4M48H 1XZ0A 1A2YA 3AAZB 2DMKA 2UWEB 2ADJA 1MWAA 5CZRA 3TFKC 1AI1H 1EGJL 1MQKL 1TFHA 1XGTB 1DFBL 4WHTA 1GTFA 3W11D 4KVCL 1MRDL 5AVUB 1I3GL 4LRIC 5GS1B 2MCPH 1M6UA 1UVQB 1YAZA 5L8LB 5HHXH 5KBMA 3BE1H 2VM4A 4MGXA 4XHQA 3UADA 2OKMA 3VGDA 1AE6H 1QBML 1COBA 3CXFA 1TZIB 3NESA 1BHGA 1MCSA 3C9NA 5A40E 1NAMH 5FUCC 1EANA 5IWLC 5DA4A 2ZX5A 1YEFL 2GW5A 3B37A 3C5SA 3V10A 2F54A 2OMYB 4GQPH 5HHPA 3WTTA 2DF3A 2XWBB 1OKEA 3Q6FA 2H0JA 2HJLB 4KDTC 5AL8A 4HBCL 1J0ZA 2BHFA 1N2RA 1OAQL 4JL1A 5GGSA 4B60A 1LHZA 3S88L 1JNLH 2QV2A 1R5WB 3BIKB 3P4LA 4OLYL 1LXMA 5HVFB 1XZWA 4RMUA 3SDCD 2ICCA 2Y3NA 4JY5L 4JCLA 3MLTA 3VQLA 2CUIA 4NSKA 5TE4L 3KE0A 4MAYA 4HHWA 3SCMC 1Q72L 2DAVA 2YD7A 1ET5A 1NFDE 2CBTA 2WYTA 3BGAA 3SGDH 5IMMA 3VH8G 4A6YB 5F7FA 5C0GA 3L2LA 2VLMD 2X4SA 4BRVA 3L4XA 5BOPA 2J8HA 4FNUA 4WI4A 2D7PA 3OKDB 3IFLL 3DJZA 1NCDL 1UT1A 4HC1L 1OTSC 1A7RH 1P6FA 3HB3D 4W4OA 4PJFB 3HLAA 3MRPB 4RGNE 4K3JL 4I18A 1AC6A 4FOMA 3RWGB 1KFAH 3HNSH 5D8JH 1MHPH 3VD7A 3ZE0F 1JZIA 2B7DT 2P43B 5D1QD 4H8PA 3REWB 4KZDH 1DSYA 4Y1AD 1DDTA 2PPEA 2XA3A 3KBPA 4BSWA 1D5MA 3ROLA 4PIRF 3E8VA 4S0TD 1KGUA 3C60C 2BP3A 3LRGA 5BV7C 1L6XA 1JIBA 2OMNA 4JJOA 4OAWB 3VVWA 1M1XB 2ITFA 2YMXL 4XNYL 4ONHA 5C2BH 2ED9A 4P46B 3ZDXE 5K9JL 5LNGA 2IOIA 2X88A 3O3DB 2DBJA 2EDFA 2ZCLH 4NJ9L 4HIHB 5CGYD 3FCTB 1AJ7H 1CFBA 1CYWA 1EXGA 1NIFA 4Y2LA 5HYSG 1AR1C 5T5FH 3LH2L 3CN0A 5IHUH 5C07B 3UAJC 3HUJF 1N7MH 4NZUH 2XKUA 2RALA 4TULH 4ZNCD 4ZUTB 3GI8L 1ZIBA 3PRZA 5SWSD 2P1YA 5DUBB 4NQTA 2EADA 2HJFB 4J8RB 1ND0B 4X4ZA 3FBQA 4Z0XA 2P7TB 2ZF8A 2QSVA 3QEHB 2CHXA 3K6OA 1RZJH 3VXNB 4N2AA 1E9QA 1TJMA 2RJMA 4K3EH 3SZ6A 4HJIA 1VKXA 5J9PA 4Y4HD 5E08L 2KPWA 1BF5A 1W0WA 3WKML 4NQEE 2H32B 4DP4X 3T4YB 1IEBB 3I9AA 1SOXA 1NC2B 4AOFA 2HT3D 4CSTA 5EZLB 4J3BA 5ETUA 1G1CA 4I87A 4ZPVA 1JXFA 3D0LA 3CDYA 4CDGC 4Z95L 5KVDH 5HJGA 2QR0A 2X6CA 5CLTA 1PGRB 3GSRB 5DHVA 1E30A 3ARGB 2EE9A 5E1AB 4YNYB 5EN3A 5E9NA 4WFFE 1A64A 4LU5L 1DDHB 1VHPA 3KPRD 3H9SE 3S35X 4C83A 5I28A 4RGNC 4WAFA 4UQAA 4CW1B 3T4AA 3PDOB 4OLXL 3QYNA 2IH1B 2BSSB 4YO0A 4B9CA 5DWUL 2XC8A 3V4VB 4KVNH 3IPBA 3ULVD 4KNUA 4KZ0A 3BAXA 4PJIA 4DEPB 1CT8A 1P5UA 3GZKA 4FG6C 4E9LA 3FO0L 4AL8C 1GY2A 1X3DA 1F2QA 3NZ8A 5MP6H 5EMYA 4UDTA 1OSPH 3V0VA 2ENYA 3U30C 4N5EC 3T09A 4CN1A 3AFLA 4QOKA 1A22B 2G2NA 4ATTA 4LLAA 4RSVA 4N8VA 4HCRA 1A3LH 4TVPH 3ZKXC 4CVUA 1MCPL 2YPKA 5C0BE 5T1LB 3BZDA 1P7QB 2ZOKA 3FQXA 3WGUB 4QXGL 1DLHB 3SQBA 3CXDH 5CHNB 4FMKA 5FYJL 3VXRA 4AV4A 2YUVA 4RISH 4JQXA 4WFHD 4S1DD 5KSUB 5E6YA 4U3SA 5KBNC 4ELMF 4OIIL 7TAAA 1QI3A 3H3PH 3MBWB 4DN4L 3C2AH 3BAEL 4PB9L 1GGIH 1BZ8A 2G5RA 2VGLM 2X38A 2DLEA 4AMKL 1FHGA 3HI6L 2OSLB 4NN6C 3V6ZB 4JB9H 2J5WA 1TTGA 4NBYB 4XP9L 3N1FC 3L3OC 3QXDA 2C9SA 2HKFH 2B4CL 5EO9A 2GJRA 1FUNA 2ZUSA 1BG1A 1RZGB 4EIZC 2R29A 5HVHB 1QUNA 4WWKA 2WKOA 3CZEA 3OX8A 4FNTA 2YRLA 4LF3A 1W6WA 1E5YA 3MRIB 5GRYA 3UBHA 3NYKA 2WB1A 2QADD 5CIPA 1U8HA 3ZQWA 2FAUA 1IX2A 5ALBH 5EUOF 4NRYB 2IQAA 2N7BA 3F58L 4OFPA 4BFIA 2I9TA 5JUEH 1BYNA 5A43C 2WBJB 1JNHA 2HX7A 4H1LH 3R7RA 4NKOA 1J05B 4PWIA 2DQDL 4PVNA 1IV8A 1MH5B 3DKHA 4M43H 1J1XL 1V7NH 4HDIA 1UGNA 2YGPA 1A0QH 4U1IA 1LDPH 3TN0D 3E3QC 4MCZA 4RFNC 5JHLH 3FT2A 3QUXD 5TQ2H 5AAPA 5DQJB 1PTZA 1P9MC 4ORZC 4JFYB 1NLDH 1AZRA 4A6YL 5DJXB 4R4FH 3VSVA 2V2WA 3CK0L 2WUCH 3FQWA 2AERT 1GGUA 2HH0L 1SDAB 2YXWA 4IDJH 3NQKA 3D0VA 2PYEE 4XN2A 2EDXA 1H3TA 1QNZL 4OZ4B 4DZ8A 5KJRL 2VRKA 3GJEA 3BJLA 3ARFD 4QPEA 5DC9B 5INDB 3KWXA 1C7SA 3GBEA 4KMTL 1RI8A 4O5LL 2FSEB 5KTEL 2MRYA 3UTZA 1TJHH 5MENE 4F80A 1P7BA 2YPLE 4X9GA 5DS8A 3RGVB 2R23B 4YBLC 4IKKA 1M42A 4HG4K 2E7HA 3GMLB 4JPVH 4ZSOA 1E2ZA 2X4UA 1L9OA 1LNUB 4HZLB 5KBDA 4RAHA 1EJ8A 2LV4A 2XNAB 1UT9A 3NRPA 2XN9A 3KGSA 2AKRA 1GC1C 4UANA 4K7PY 2OR8A 4PI0A 4ETQB 2X9YA 4IU3B 5ADOL 2VOTA 4UTBH 3SYQA 2DQTL 2CLZB 4G6ML 2XA8H 3E80A 2R1XA 3TTSA 5B38B 4F15B 2J44A 4NQVB 1IVLA 1NEZG 2Y7SA 1S78C 3O8XC 2XN1A 4K3DL 5F88A 2H6PA 4FQQA 2WLIB 4QHUA 1VPOL 3UJTH 1JZ3A 2ILLA 1UOKA 5DR5L 4JFQB 1U3NA 3AQXA 3PGDA 5IG7A 4I3RL 4P5KA 3V0AC 3OZ9L 2H0FA 3V5DA 4NNPH 3BVWA 4XO3A 3T0DA 4PGCB 4IJ3B 4Q4IA 5JQ6H 1FYTB 4U6XB 4Q9QH 3QJXA 5IBUG 4ADIA 1DN0B 1K5NB 1U8LB 4TUJB 5I6LA 4PRIB 4G42B 2EXWD 1EMTH 2MNUA 4GRLB 4MLIA 3L4UA 1NUNB 3BWUF 3QORA 3CIAA 3SQOL 2G2RB 3GNMH 4HMDA 3QFJA 5I0YA 5IB1A 3IM1A 1MEXL 4GBXA 4XVUD 2EQDA 1XGRB 3FOLB 1PEZA 1FH5L 2IWKA 3TBVB 1DYZA 4CGTA 1E9OB 1Q9WB 3C6LA 4MJ5A 4JZNB 4NWTH 4XNZB 4XO5A 3VG0H 1ZVYA 3AU0A 3CVHH 3KM1A 3T6VA 1PSKH 1G7HA 3EFFA 4PJ5A 3V4VL 1H3PL 4A38A 3FCGA 2H26B 2EE3A 3S36L 3AREA 4IGBA 5FUOL 1A47A 4XOCA 3BAJA 1IFHH 1Q9LB 4LRNH 4JRXA 3II1A 3HG1D 5HI4D 4D8OA 4J2QA 2DLFL 4OD2B 1WS8A 3RX9A 3VI3B 5KYWA 3EHBB 5MI0B 1JZJA 1OWWA 2QQKL 3C5ZD 1BF8A 1DVFC 2PTTB 2HWZL 3CSPA 4HFUH 4J2XA 4X4ME 3BPLB 1RZKH 1GGBL 4ODSL 1BAFL 5IJKC 3QUYB 3W56A 3EFDH 1E6OL 2IPUK 4MCYB 1TUPA 4KI5D 3T8XB 2ITDB 2DL2A 2NNAA 4X8CA 4C4UA 1FJ1B 3O0RH 2ERJC 2BOCA 1AXIB 3L5XL 4BSVA 1R4XA 2BNUB 3AY4A 3DMMB 3QRGL 4Y5VB 2V5RA 2E27H 4ZX4A 2Z35B 3OR6A 2Q76B 2OMTB 2YC1A 1U42A 3EGXB 3UGUA 1DN2A 4HUUB 4H20H 5DJDA 4ODUB 5I6NA 3AUVA 3HHSA 5E1GA 1FA4A 2ZKXA 4QRPD 4JRYD 2EXYC 2WLLB 3CLFH 5LAPA 3T2NL 2BVOA 3QRLA 4BWWA 1HHJA 4OZIE 2FWSA 5LBSA 3FBKA 1HSBB 1YEGH 4U1MA 1ODUA 3NIFE 2HVJB 3L7EB 4HXAL 2EKSA 5DFVD 1IAMA 4PPTA 2AK4A 5EU6E 3TF7C 2V7NB 1G9MH 4G59C 3WBDA 2A1WL 2XV3A 1AY1L 3FUIA 1HIML 2HB0A 3P3TA 2APBA 4MS8C 1RIHH 3K2KA 1MCCA 1HAWA 2VDPH 3EH4B 3PWJB 3PYCA 2HLEB 4BV1A 2Z7UA 2CGRH 2KH2B 2WO3B 4LE8A 3VXMA 2EUVA 1WEJL 5F9DC 1MPAH 4N8PA 3AWEA 3SE3C 1UD6A 3JT0A 1T0PB 1VFUA 3W11C 3RTQB 3MV7B 1OIOA 3MGOB 4P99A 3KPSA 5HHME 4HGWB 4Z3IA 3HI1A 3X1FA 4UT6A 3PQYD 1FC1A 4M8UA 1L5GA 4P2RA 3NJFA 3MZGB 3GXIA 1T0NB 2CHNA 1WIOA 2K4AA 3QQ4B 3RX5A 2G9KA 4I48B 3L4YA 5EIQA 3RLSA 2MCG1 3V9EA 4F7KA 1IAKB 2YAQA 3LHPH 2ZQKA 4X6CA 3HUJA 5L0QC 4FNRA 3MODL 5DRWA 3QBTB 4BKTC 4ZO9A 1QO3A 4LLDB 1GGTA 1HHIB 1FZMA 2D7NA 2ESVE 4CDHA 5C0FA 5KSVB 2FB4H 4KU1A 3ZU8A 3SDCC 3L9RA 3DRQA 4JFZL 3BP4B 1TYRA 3MRKB 4IOSD 5HHOD 5IHWA 1U4FA 2J1ZA 2CQVA 3K8MA 5DJZB 3MAWA 3MV8E 2IH3B 2XKSA 4OR1A 1HN1A 1CFNA 3WNMA 4APXA 2QGDA 4LDEB 1TLKA 3ARRA 1QFPA 5AKSA 3TEYA 1QPKA 1JGEB 1AANA 2GCYA 3P2BA 3WUWG 1JPTL 4Z7QB 3OPUA 9PCYA 2VLJD 4NJAL 5G5DB 1J0YA 2XZCH 5LWYL 2VXSL 5AW9B 3PHSA 4PJCE 2YRBA 3V0GA 3PJNA 3W81A 3HB3C 3L6FA 4HQQH 4N86A 2Q8BL 2MJWA 4PW4A 4Z5RA 3EDDA 3GGWA 1R33A 1N0LB 4JE4B 1HNFA 2XTLA 1YEIL 4JPIB 5SWQB 4WWPA 1FFPB 3BUPA 5D1QC 3B34A 3SE4C 4UUJA 1BD2D 3UYRL 3LZFL 3SY0B 1R3KB 1NCTA 4LHUA 2NY6B 3VMNA 4P9HC 2O5XL 3GMPB 3NIGE 1IM3B 4ZMXA 1W8OA 3R0NA 3EDKA 3DX8A 5F3BA 4LSTL 3WEAA 2DQGL 4E2OA 2OAAA 4F57H 5DYOA 4UM9D 3VE0A 3PNWA 1U8MA 1CLYL 5LG6A 4O2FB 3Q1EA 4HWBL 4XH2B 3HKFA 2DMBA 1OY3B 2JXMB 1N3NB 2I24N 3OJMB 5CGYC 4BFBD 4P5MA 2Y6TE 3MUHL 1S7VB 4WFHE 4H0GA 3QPKA 3L3GB 4IMLB 2BVUA 1MNNA 4KGJA 4FQHB 1CD9B 1RJZA 3QUKB 2GSIA 2VLLB 3QJFA 3H8NA 1BFSA 35C8H 4NM4H 2JQZA 1A6ZB 3BUYB 4QHKJ 2NW2A 1ZHKA 4ODTL 4PJ7E 3GT6A 4LLQB 1RSFA 4Y4HC 3U6RA 1FFTB 3ZZQA 2UX6A 1A4CA 2J57A 4EI5B 3T0VA 3NCWA 4PY7B 2DQUH 2HT3C 3D4CA 3IFPB 4FQPA 2XBTA 4KXDA 1H0DB 3POHA 3ULUD 4FYQA 5DMKB 4Q8BA 4DEUA 3LKNA 3KD4A 5A16A 5D2LE 1VAHA 1CDBA 5KSAD 5HDRA 5EUOA 2Z0BA 3O6FA 2HFGH 3JWNE 5I9QB 1CB4A 5GXBB 2N1TE 3TEZA 2WP3O 1WD9A 2TSBA 1NFAA 4YR6A 3UTSB 4L4VD 2PXYD 4Y19B 3X12A 4NKIH 3UERA 2AJXL 4PCSA 4RAVB 1QFWH 3P4MA 3MO1A 2ATKB 3GUTB 3ULVC 5AB1A 4HWEL 2FX8H 1KIUB 1ZD6A 2GJPA 3VYPA 1PKQE 4ANKA 1FLRH 5AD0B 3CX5J 2A73A 4WSJA 4JDVB 2XTJD 4PB0H 4AT6A 4U31A 1IBDA 4GLRH 2XQYG 5H2BB 4V1DE 2CGYA 2AJVL 4FTVA 4EN3A 4B50A 4IBTA 4M8QB 2NXZD 3JWOC 5ICUA 3WNLA 5AAMC 5IW1B 4B53A 2BSBA 1KYDA 1S2EA 5IESL 2C3XA 2E8YA 2WXLA 3EH3B 5HI5D 3GB7B 1TO5A 4JFEB 4S1DC 4XRCB 5F0JB 2ZUTA 4LOEA 2UVFA 3RHWF 3X14B 4PJ6A 4M1DH 1EEZA 1OSZA 1X5KA 4PAZA 4W6YB 3UL4A 1S7SA 3VA2C 32C2A 3C60B 4FXGC 5CSZB 3C8HA 5EO0B 5BV7B 2F53E 2Z7ZA 3HN8A 4FKHA 4LQFL 4QXUL 1KY7A 4RNRB 4LLUB 2XLLA 5TF1L 1PZ3A 1QLFB 3RAJH 4WW1B 5B1AB 3X13A 4HJ0D 4HAKA 4HPHA 3KPQB 4P48A 2WV3A 2JJUA 3HC0A 5EDXA 4PG2C 4QRFA 4K71B 3V7AE 1T03H 3VXUB 5JQHC 1CL7H 1TQSA 2HUHA 2WSKA 2V4LA 2PWHA 1NANI 3LOWA 1MJUH 3FQTA 2CJUH 5GZOD 5EZJB 4PVMA 3US0A 1NOLA 3GTVA 4ACTA 3TT3H 4OH2A 2W9DL 4HV8B 4XB7A 4G5AA 2G60H 5L2KA 2QADC 3JWNC 5TDNB 4GQ9H 1DJHA 1NJ9A 4HJJH 4HCIA 5C0DB 3X11A 3C6SB 2DQCH 5GZNA 3B9VA 2ATPB 4L8CB 2Z1KA 1FE8H 5I1IH 3HC3H 3MYJB 1HINL 4XPFH 4YK4B 1A6AA 5BZDB 4U6VL 1K8IB 4HPYL 1XDTT 3V0EA 3U7WH 4B0MB 4JKWA 1R47A 3TN0C 4X6BA 4BWUA 3QUXC 4KBPA 1QR1A 5ABAA 1YEKH 4AUUA 1CFVL 1P1ZB 2BNRB 3HMWH 1OGAB 3D05A 3DO7A 5I18L 1CFTA 4F1ZA 1MFAL 3I6SA 5IIEB 3FUKA 5LGHH 4N2LA 5GJTL 1O9WA 2E7MA 1AQHA 1V7ML 2IG2L 5AOIA 1H3UA 1ADQH 1A3RL 3TH2T 2YRPA 2FYVA 2DLTA 4RETB 2SEBB 3GSQB 1CVRA 1YQVH 3FYIB 1FHNA 3ARFC 1WZLA 5ACZA 2OTUA 1KMGA 3OJ2C 5J6GA 4AVHA 3S3JA 5IMLB 3GM8A 3VTMA 1FORL 4OKVB 1F8TH 3HRZA 1XH1A 1IBHA 4X5WB 3ZN6A 1AQ8A 1DQVA 1SOKA 3EF7A 4GKZB 2PUQT 2XZQH 4QXVA 1W72A 1IGCL 1NUDA 4D0BA 1AZBA 2MNWA 4BFJA 2QMJA 3CGTA 3HCVA 3OF6A 4FNSA 5FECB 4DKFL 1KXHA 3EIFA 4H4NA 4JNXA 3K74B 2IGFL 3A6CH 4QHPA 4OLEA 4ALAC 3E7JA 2HRPL 2W0PA 2HX8A 4NDMA 1OANA 4P59H 1RH8A 4XPGL 1WWAX 1GMIA 1V10A 2ZOTA 4AEEA 3FU8A 1WP6A 3CMOL 2WWOA 4XBEL 5JHDA 5JR1H 3CNKA 2ITCA 2QVKA 1TEGA 2X2JA 3AUWB 4NN6B 4U1JB 5DHEA 4ZUUA 3TZVA 1PAZA 4Q89A 5BRZE 4Y8DC 3UABA 1YNKH 1ZOXA 2W9LA 2YUZA 2GG1A 3QQNA 3OKMA 3F64A 4QT5A 2CKNA 2XKNB 2GJJA 1EAPA 5AZ2H 1DHKA 4UZGA 4QRTA 5B39A 3HG4A 2LAGB 5KSBB 4J27A 5HBBA 1SVCP 3G6AB 4KVPA 1O9ZA 4AITA 2EXWC 4WF7A 4U1KA 4K9EC 1N12A 1KZQA 4N9GB 3D39D 1BW8A 3NCMA 4XXCC 4NC0B 1TZGH 4WSKA 5E9DD 4WFGE 4YJZL 1EWHA 2A9ML 3CPLB 1MF2L 3BQUB 2XU9A 3FU9A 2OL3A 1FZKB 4PLNC 1EGJA 4XVUC 1N19A 1OHQA 3MV9E 1MLBB 3OKNA 3QHTC 3ARBB 4Q97A 1B2WL 3CFQA 4U7SA 2R4SH 3V79C 3BLKA 2NQ3A 2NDFA 2ZUQC 4NO5B 3AT0A 1BIIB 1JWSB 2NY1D 4RFNB 4UILH 3LNHA 5C09A 3SIKA 3NCCB 1D5ZA 4GKSA 4XXDB 5CM1A 4FQXA 4X7SL 3AU1B 3QO1B 2OA9A 3S5LB 5GHWH 5C97A 1NGWA 1K6QH 1DL7L 1QLEB 1T80A 4P4KC 1ZK9A 5FUZL 3C5XA 3BVTA 1VENA 2V33A 5FYKD 5CILH 3VI4E 5HI4C 3PQYE 4M5SA 4WNQB 1ERNA 3L1GA 3QWQB 3UDWC 1Q8MA 4EEEA 3EDFA 4MD4A 1U8PA 5ICXA 3C5ZC 2J12B 5FGBC 1WF5A 3FF8A 3QEQA 5BW7C 4G43A 1L6ZA 2JJTA 2QGEA 5F1IB 2P24B 2XG4B 5FKAB 2N0KA 5K39A 4DP2X 4KK8D 4FL4C 3H53A 4WUUD 5A7EA 3VW3L 4FMFA 3EYSH 4NEHB 2Z6FA 4JFDD 4AIXA 3BMVA 3IU4H 2ZCHH 4I1PA 3BSHA 4G5ZH 4M7JH 3D85A 4DTGH 2C9AA 3CX2A 4GI9A 4KXAA 1KJMB 2CMRL 3RY5A 1AIFA 5BV7L 5GJSH 3LEVH 4OFVA 4RIRA 3HZYA 3IGLA 3HS0B 5LJYH 3BRDA 3WMSA 2Z4QA 5L6YL 3C08H 5JDSB 1BIHA 4WW2F 1BEYH 2X3CA 4E5XA 3TURA 3A3YB 4JY6B 2KYIA 3MNWB 2OMVA 1BGXH 4PS3A 4J6RH 4Z7UE 3BWZA 3QI9B 3WEXA 2ICEC 2VQ1B 3TA3D 4JCMA 1UM4L 3CLEL 3GSOA 4O58H 4QTIH 4XP4L 5CJOH 2CIKB 3O8XB 4UTAH 4OFYD 2BIIA 2GJ6D 3BN9C 4GQRA 2E7CA 3IJ9A 4XMPL 3DDFA 1R3JA 5DFVC 3LDBB 2WNGA 3NZSA 1OP5H 6FABL 2QSQA 1T2JA 1GVIA 1R3LA 3FW6A 4X4KA 4XVJL 4X4XA 5AVXB 1M1SA 5F3HA 3U1SH 2Q86B 5D72H 4PGEB 2YQ3A 4GO8A 5K9OA 2G4EA 5BZWA 4FI6A 3HN3A 2VMJA 3BP7B 3TNMB 2AV7B 3TV3H 2F18A 1BD2E 4HKBA 3QNXB 3DGDA 5C6PB 3BKJL 4UAOB 1BBDH 1NWPA 5BJTB 2X09A 2P5WB 4W9LC 4JE0A 2CM5A 2QSCH 4KJPD 4MBRA 4QXTA 2NCEA 2A74C 4FKKA 2MKLC 4HKXB 1T1XB 3MLSL 2IADB 1J8HB 4LQ1A 2K3TA 4N2MA 2X4RA 3J8F7 3ZE1B 3CJJA 2J1KA 3T3PB 5D6CA 2VWEC 1NBYA 5IEKB 3BC9A 3F12B 1JPGA 1BZEA 3SKMB 5F0MB 5CJXA 4BFFA 1PZSA 2HUEA 2P8MA 4E41A 5ESVB 3RE0A 2RTTA 2X1XR 3KPOA 3PXHA 4AL8L 5JORA 3FSAA 2BVYA 3PDGA 4KO9A 4LKCB 5C71A 4NUMA 1XR8B 4Y89A 4YHOH 3MNMA 4GAGH 2B1AH 1WAAE 3O11B 5TDOA 2VZTA 5FHBL 2QBWA 5B8CB 1ROCA 1FL3B 4WTXA 7PAZA 3ME0A 1MFVA 3RIAF 4TQEL 1WBYB 3MLZH 3ABGA 3JTBA 4HETA 5HD8D 4W81A 2Q2LA 1EFXA 2VSKB 2CJTA 1S3KL 1HSAB 1QRND 5H8DA 4BM7A 4ZW7A 5IB5B 4WJG3 2ERJB 3L17A 1VZIA 2AABL 2APFA 2A9NL 2QPFA 5JW3H 1LL1A 4HPOH 3FFCB 4JFFB 1B3JA 4JHUA 2IFFH 3AC0A 1KXQA 2X0WA 5A6LA 2J6EL 4QRUA 1BZOA 3S34H 3VX0A 1TQTA 2DQMA 3NRQA 3IJ7A 3V2AR 3VD9A 4M5YL 3ECWA 3GZPA 3QUZA 2QSTA 3T0WA 5SWZA 4F3FB 2WUBL 4HD9A 1G9NC 1NUGA 4OU3A 3BRGC 4NPJA 3UCRA 1VFBB 4MJIA 3DROA 2V7HA 4BZ2H 2WXKA 3D2UB 3FT4B 3L48A 5KWYC 5I1KH 5D7LA 2Y07H 2R69L 3B43A 4PCYA 3X1EA 3JV4A 4LLMB 4F7EB 3VU2A 3FT3A 1DCEA 3W9EB 2J3SA 1P69B 2FQGA 2VJXA 4XN1A 1F42A 3AAZA 2UWEA 4RLDA 1BQLL 2KERA 2DQFB 1CCZA 1XGTA 2M1KA 3ALPA 3PCYA 3T04D 1G4RA 5D6DC 3DUHA 1TT6A 3Q2VA 2EVFA 1E2WA 1IGJB 3FK3A 5GS1A 1UVQA 2CXGA 1OAZL 2WYHA 5F8QC 1ICTA 4RRPG 1WDAA 4N0RA 3TBYB 4P5SA 1II4E 3U9UB 4W9GC 1DBBH 1TZIA 3MBXL 4GW1A 4RGOL 1VESA 4X8JB 4Z77B 3IMBA 1LDSA 2ZX7A 2FE0A 4K23L 5EC1B 4W9IC 5DYFA 3QJSB 5HDQH 3LEXB 4ZTPH 4DKEL 2I5YL 4PJ8B 3HE7B 3SDXF 2OMYA 4MVBD 1SHMA 2VR7A 2XWBA 3FTUA 4GAAA 4XPHL 2OJZH 5DURB 2HJLA 2KPNA 1QKZL 4RSYA 4DP7X 3FN0H 2C9RA 3ULUC 4WU7B 1FRGL 2H0PA 4YWGL 3V4UL 4L3AA 1MVFA 1R5WA 3BIKA 5HPMB 2NX5E 1CK0H 5KSAC 4YC2C 1IC4H 3VFGL 3NAAL 1R3IH 3QJUB 2Y0SA 4GXUN 3NEXA 1ZLEA 4OM0L 3VXSD 2EIBA 3BPNB 1MN4A 3NTCH 5D7SH 4DAGL 1UOLA 3CSGA 2PXYC 4AEFA 3W1ZA 1JHLL 4WJ5B 2UZYB 3ECQA 4HMCA 4MRBA 4H8WH 4K15A 3IMVA 4NUQA 5F7MC 5GGQH 3X3GH 1RZ8B 4A6YA 2VUOA 1X6LA 4X83A 1XGPB 2C7FA 4MX7B 3OKDA 1B90A 1GC1L 5DT1L 1U2CA 5ILTL 2XTJC 2JB5L 1RULL 4DCQB 5BOJA 2X6VA 4PJFA 2J21A 3HB3B 3MRPA 3ZX1A 3G6DH 1HQ4B 3RWGA 3U4BL 2EUZA 2NXZC 3CVCA 2ED7A 5GGSY 2BHYA 1SMDA 5KG9B 1H6TA 3CFUA 3REWA 1DEDA 5AW5B 2LLNA 4PJEB 5D1QB 1Z9LA 5HI5C 2M2DA 4YHIB 4F7MB 3UMTA 1VFAB 4YSSA 2FIRT 3OPZH 4GUCA 1PJWA 2WY3B 4H8UA 4OAWA 5DEFB 5F1OB 5KW9L 3P3YA 4PJGE 4P46A 4PJHB 2CPUA 1WA0X 4Z7VE 5FCUH 4HJ0C 1MI5B 3O3DA 1OGSA 4HIHA 4NRZB 3FCTA 3QEGL 3WE1A 1MY7A 1OP3K 2B3RA 2FEDD 3OHMB 4B41A 2OW6A 1NEZB 2V5TA 3MA9H 5C07A 5E7FA 3K72B 3IJ8A 2Q3AA 5GZOC 4ZUTA 5C0JB 3MXVH 2BW5A 2CO7B 5DUBA 4ES9A 2C5DC 5HJBA 2HJFA 3RIFK 4J8RA 1ND0A 4G6JH 4NZDA 4G7YH 1FBIH 1DSFH 1U6AH 5FM5O 5T1MB 2P7TA 3QEHA 4UF7C 3UYOD 1QUPA 3VXNA 4YDLC 3DUSB 4LOUD 4IBSA 3INUH 4BDVB 5KS9E 4TUKH 4JM2D 4M9OA 4XC1L 3FUMA 2H32A 4JUSA 3T4YA 5DMYA 1IEBA 4GEIA 2KDYA 1JMXA 1B6UA 1OGPA 1NC2A 3Q44A 4A7UA 3SGKA 2WN3A 5EZLA 3FULA 2VN3A 5KJ7E 1A4BA 2DL9A 4FYRA 5E9AA 4XE0A 4LHQB 3OTTA 2LVCA 2IO5A 4AIEA 3DGCR 3GSRA 4Z7QF 3P11L 1DJYA 4ZOBA 2EJ1A 3ARGA 5JDJA 2APXA 5E1AA 4YNYA 4BK4A 4AIOA 2NSXA 4TQPA 1I75A 1DDHA 3MJ9H 4LCUB 3RY6A 4K07A 4CW1A 4M3KB 4LEEA 2A9AA 3KPRB 3PDOA 5EDSA 2IH1A 3U7YL 3EUDA 3QUMB 3RDJA 4C59B 5HDBE 3V4VA 1SN2A 4N0CD 4UNUA 4XMKH 1T83A 7FABL 5D7KD 3KLAB 4D3CL 1MCOL 5CLXA 1JHTB 4FRWA 1J10A 2D3LA 4X5PA 3BSZH 1HZKA 2BVTA 3FU3A 3GHBH 5T1LA 2WXJA 4JO3L 5G4MA 2ADFH 3KCPB 1P7QA 1G1KA 3FO2B 2D2OA 3IDXL 2FK9A 1DLHA 5T1JA 1TJIH 5E2VL 5CHNA 1E40A 5KSUA 1KB9K 3MZTA 1I8UA 4FJYA 4H7VA 3RWCB 4ZFOL 2WOBA 3HC4L 3MRFB 4P3DB 3WFDH 1ZHBB 1JPFB 5IB3A 3MBWA 1FO0B 1G0YR 2Y2WA 1P7HL 5B22A 4W6WB 1G84A 1YEHL 2GVYA 4X6DB 5AVSB 1KC5L 3FHEA 4DWHA 4PSRA 4WUUE 4RFEB 2OK0L 4OF5A 5E4IA 2OSLA 1F3DH 2Z91A 3V6ZA 3I6KB 1P84J 2FEEI 2Z7WA 3HBQA 1KJ3H 4NBZB 3MA7B 1DVUA 1I7TB 1HNYA 3BKML 4XODA 1RZGA 3RJQB 2R2BB 4HIIB 2OM5A 1RHHB 1O7SA 1QOKA 2FJHB 3MJGX 2DI9A 3GSUB 3MRIA 4I77L 4TNWF 5BMFL 2J6WA 1W9XA 3CSYB 5IQ7L 2GUYA 4NRYA 4DUWA 4M02A 4WTZA 1OPOA 4HHGA 5IQNA 4BH8B 2WBJA 4MHHI 3TVMB 1RMFL 4G7QB 4MMXB 2VN7A 1J05A 3WNIA 2GJ6E 4AK2A 3V0WH 1JPSL 2ZP9A 1AKPA 2ZZUT 1MH5A 4E9WA 5KYNA 2IDSA 4HYTB 2VRQA 3OHXC 4E36A 3WY1A 4IHBA 1JGVH 4NOFA 5HTSA 3BRFA 1SJVA 1QSEE 2X9ZA 2QTEA 5DQJA 4NXKA 1AQDB 2NY1C 2HKAA 5JPMB 3UEZA 2EDJA 3QUXB 2G4GA 2P3YA 3HR5B 3IT8D 4JFYA 5DJXA 5F1SA 1DBKH 2MFNA 3FFDA 3EJTA 1ML0A 3MLVL 1XSIA 3WFCH 4AJ0A 4W9CC 2AEQL 4LBEB 4OCWL 1BVNT 3ABLB 1FGNH 1NL0H 4J12A 4Q52A 3LMJH 1UYWL 4NO0B 1GR7A 4OZ4A 2WXOA 2VL5B 3JWDH 4GSQA 2J1XA 1IM9D 4UV7H 5INDA 5FGCB 1EZUA 3TPUB 4ZW3A 2GT9B 2I26N 4KK8C 2FSEA 1VJSA 2W92A 1N6UA 2J8UF 4KRMB 5HDOA 5I8EB 2R23A 3QDGB 1J5CA 4H40A 1UG9A 4BH7B 4P9HL 1IT9H 3GMLA 1J5OL 1J1PH 3IWVA 1LNUA 3QFGA 2GY5A 3TEWA 3P02A 2LFEA 2XNAA 3MLXH 3SD5A 3VWJD 1HKLL 1QFOA 2QDVA 4NZRL 1ZLSH 4ETQA 4IU3A 5C6TL 2JK5B 1UKSA 4GAJH 1RIVL 1CQKA 2CLZA 5GS3A 2H1PH 1ZJAA 5B38A 4GPVA 4KKCD 3SE6A 4NQVA 4MA7L 5A2IH 1M71B 3TA3C 8PAZA 4K8RC 2WLIA 5IQMA 3BDXA 1OE3A 4JFQA 3AABA 4QOKD 3PY9A 4PJXE 3BZFB 4F20A 1YY8B 2WCPA 4FFYL 2WLHA 4ODBD 2EEAA 1X7QB 2ZWKA 3QR0A 2CRMA 1GZQB 3DOIA 4LVHB 2JJSA 4PGCA 1IRAY 1FYTA 3AG3B 3AROA 2NY7H 4U6XA 4BHUI 5FR3A 1DN0A 1K5NA 1MRCL 1U8LA 4U1HB 4PRIA 3VXRD 4G42A 4GRLA 4A2LA 2OR7A 4PW9A 3ZMNA 4DGVL 3Q48A 1NMBL 1E4KA 5C0AD 3V0JA 2JCCE 3GI9L 4KV5F 5J0BA 3P9MB 3GM0A 1KGCD 2G2RA 1TETL 3CXHJ 1TQBB 1XGRA 4HWBA 2AP2A 2VXQH 3I2CL 4KJPC 3TBVA 1E9OA 2VDKB 4KHXH 1Q9WA 4JHAH 1NFKA 4JZNA 4OGXH 1WIPA 3QCVL 4YXKL 4LBAA 2BWIA 1GRWA 2ZUQB 5EULV 5F9AC 3WJLA 2EIDA 2PETA 2XWXA 2Y69B 3QHZL 2H26A 4MMZC 4TUUA 3B4NA 2VDMH 1V3MA 4XCFH 3ULVL 2ETWA 3IXTB 1H6UA 1VERA 1Q9LA 2GB2A 1BVLB 1RZIB 4PJDE 1F86A 4NQDB 4OD2A 3VI3A 5CO1A 1AQMA 3QDME 3EJYD 2X6BA 2PTTA 4ORGB 5E1HB 4NI6A 3HE6D 1JRHH 1UCTA 2NYKA 4JDEB 3QUYA 3JWOL 2ZWZA 3MSPA 4ADGA 3QHFL 4JG0H 4MCYA 1KCVL 4X42A 5T1DH 3T8XA 5A2CA 2CK0H 2MPAH 5AVWB 3ZTNL 5JOPE 1HE7A 2ITDA 2Y3AA 3UOAB 1MJ7L 5HD8C 6PAZA 1FJ1A 1FO0L 2VR5A 2RQ8A 4N0YH 2DQEH 3QQXA 3DMMA 2BNUA 1F4XH 5E99L 2O5ZH 4Y5VA 3WNOA 2Z35A 1P0SE 2Q76A 3DSNB 1FAIL 2OMTA 1WIUA 3QCTH 2NY3C 3BGFB 2BY3A 4HUUA 4B96A 1WSST 4ODUA 2QPUA 3GLEA 3TA4D 2WLLA 3ELAT 1NEPA 1FGVL 5E4EC 5KSBF 2Y4SA 4QRPB 2EIKB 2AI0H 3ET9F 4BRJA 1N5YH 3F7YB 4P5TD 2ICEB 4ZRGA 2V3DA 1HSBA 5GSVB 4O4YH 2Q7AA 3VXOB 5I76B 2HVJA 3L7EA 4WGKA 3HMXH 1AR2A 3ESNA 4PJBF 2V7NA 2EDKA 4PJAE 4HK3N 4KJWD 3IKKA 1AXTH 4JUTA 4UT9A 3ILPB 2UXGA 1DBJL 3I3EA 4P0DA 4EI6B 3PWJA 3SYOA 5AZEL 3EFOB 5KUMA 1Q90A 5IVXE 1GPOH 3MU3A 4FZEL 1ZLUK 1KCRL 4HSQA 3SOBH 3UXFA 4MRCA 4ZDHB 2A83B 5I71B 5DZNA 5EZOL 2E56A 1VZHA 3QEUB 3RTQA 5LBGA 1FZJB 3MV7A 4GMTL 3MGOA 3CHQA 1D5XB 4HGWA 2L7JA 3SGJA 5L4MA 2EC9T 4Z7AA 4NYLB 5F7BA 2JB6B 5DMGD 2YAPA 4DEWA 1QEXA 3KR3L 1T0NA 3QQ4A 3MJWA 2QLVB 3QGVA 3UBFA 4Z7OB 4I48A 4XMXA 2CKBH 2R0ZH 4R2GB 5GRJH 3QP3A 3SY6A 1KTJA 1Y6MR 1IAKA 4BWTA 5EFIB 3MFFB 5JHBA 3A67H 1B4JL 3LAFA 4MVBC 25C8L 2KZWA 2NT0A 3FU0A 1WK0A 1ZVHA 5E5LA 1CLZL 4A7GA 3G04B 4LLDA 1HHIA 3UZEA 4Z7WE 3WG7B 5D7IE 5KSVA 2OYMA 2B08A 1JG9A 3QORD 3A24A 2FD6L 3BP4A 3L8QA 3MRKA 7CGTA 1QFWM 5DJZA 3QFJD 2WZPD 1RPKA 4GBXD 5J13B 2ARJQ 1TCRB 4HAGA 2EE6A 3FONB 2IH3A 4AYSA 3L3JB 2ZAIA 3FTVA 2A6JB 3TWCH 2XV2A 3VFSB 1MJJB 4K94C 4KFMA 4X6FB 4DP5X 1KIQB 3GRWL 3NCYS 2R0KL 4FC3E 4WHYH 5G5DA 2FHCA 2NOYA 1E27B 4GFXA 4PJ5D 1NIDA 2VLJB 4EIUA 4ALAL 5CZVL 1KBKA 3B2VH 2BVEA 3EJZC 3ECBB 5C1MB 1TIUA 1YNLH 3RG1C 2FGZA 1N0LA 1A1NB 4R7DB 1KWKA 2VR3A 1NM9A 4JPIA 5SWQA 1FFPA 4U3XA 4TNGA 3O2WL 1TENA 5FX3A 4JVWA 4F93B 4AI7A 4HJSA 3SY0A 1R3KA 5D7KE 2Y5QA 3EW3B 1L9SA 2CO3A 3S6CA 2C3GA 3GMPA 5DEGB 5L2JB 1IM3A 5KZCD 2F54E 4HEMA 5F96H 1CLOL 4YDIL 2AVGA 5C08D 5C2UB 3MACH 1HJCA 2FX9H 2DW5A 2WTOA 3N44B 4S2SB 5JW4N 4K9EL 2DBLH 4WI5A 4OQ1A 3VFWA 3DSFH 3D87B 2FT6A 1IKNA 4O2FA 2EP6A 2QV4A 4XH2A 4Q6YA 5FM5M 2JXMA 1N3NA 2QMKA 3N3EA 2WWMC 2VDKL 3SO5A 1S7VA 2FEDC 1IU1A 3L3GA 4IMLA 1M2VB 4FQHA 4E9VA 5KVFH 4LRIA 3I3BA 3QUKA 3L4ZA 2VLLA 1GHFH 1UA6H 3MGTB 5B7MA 4JX0A 4YHLL 2IGLA 1I9JH 1A6ZA 2VDRL 3BUYA 3SBWC 3QNFA 3AWFA 3Q8CA 4LLQA 4LOUC 1SYSB 4AE0A 4JM2C 5IWLA 3UFIA 1ZANH 4EI5A 5CBEB 1JZEA 1ZV5A 2AK4D 4JDTL 2VH5H 3FTZA 4PY7A 4TLSA 3UBXB 1KBPA 3IFPA 4EE2A 1XSOA 5FO8B 1H0DA 4GW4B 5DMKA 4FQLH 4KDTA 2R1YB 3ZJAA 1UADC 4OJEH 4OLVH 3O6KL 4XOEA 5F93C 4CVWA 3RVTD 1NBVL 1W0VB 1R0AH 2IBZY 4YC2B 3WJJA 3QZNA 3U0PB 1Y6NR 3FB7B 3KPSD 3O4LB 2UZIL 3UAFA 4S0SD 3UTSA 5LXGH 4Y19A 4P2RD 4OIFA 4U1GC 3NCJH 5FOJA 4RAVA 3GUTA 5E2TH 2ATKA 4N0CC 1C1EL 1KIUA 2W9EH 1F1GA 3ZHDA 1XTLA 3K6DA 5AD0A 4RDQG 3L2MA 4JDVA 4AW4A 1MCLA 3WIHA 1T2QL 4KKQA 4FZ8L 3DOHA 4GKLA 4ZK8A 2BIHA 2K1MA 2IBBA 5H2BA 4AEIH 1V3KA 2DH3A 3QB7C 1BLIA 2A6DB 4M8QA 3S4SG 4LSRL 3ISWA 1MLCB 5IW1A 4JBSA 1O5DT 2YD9A 2K78A 1EAJA 3EDJA 3BZ5A 2PP7A 3BH9B 5KVGH 2FEEL 3IDMB 3UGEA 3GB7A 4JFEA 4XRCA 5KANG 5BRQA 1KTLB 2ZG3A 1T1YB 1JN6B 3X14A 3G5XB 2HFEB 3Q3GB 1MAML 1ILSA 3C60A 1RJCA 5CSZA 3ZIYA 5I6XB 5EO0A 4KTDH 3W9DB 2DPKA 4RNRA 3UJIL 3NDZE 4LLUA 4NKQB 1QLFA 3D09A 4WW1A 3UX9B 2X42A 1BMZA 3B2XA 2VDOL 3KPQA 4UV4L 3C8KB 1UCBL 3VXUA 1FNFA 3CX5K 1CD8A 3MNZB 4F7PB 2N3JA 1YEEH 5EZJA 1NCCL 3UAJA 1WS7A 2IV9A 4I18C 1A6TB 1YYMH 1HHGB 1U92B 4HV8A 4YLCA 1R19A 4M6AA 3SSGA 3PJLA 2C3HA 4F37F 5TDNA 4V2CB 4TRPL 2B8OT 1H15B 3JWNG 4LPWA 2D0FA 4PH8A 4PJIE 1YJDC 5C0DA 2HG5B 1N8OE 5DO8A 3C6SA 1F3JB 3IDYC 2X1WL 2X12A 2ATPA 4L8CA 1ETB1 2V2TB 1JXGA 5FGSA 1X7SA 2AQSA 3MYJA 5IOPB 5FHAH 5EIIG 3X1NA 1S7WB 5BZDA 1K8IA 5F89B 3D25B 4HWZB 4HZAA 4DK5A 3N5AA 1QMUA 5F7AA 2BIOA 4PBXA 2MQCA 1P1ZA 2BNRA 3EYVB 1OGAA 1KYFA 3N04A 3DJSA 2QQLH 3NPZB 5IIEA 1JVLA 2IPUG 2NQDA 1XB3A 2NNCA 1JZGA 2I7OA 1NCJA 5I0XA 1KGCE 1UD2A 1OD9A 3TF4A 4WO0A 3VYNA 4QKXB 5J6HB 2ZKWA 1P4LB 2HPOA 1UXSB 3OKYA 1JDDA 1FCGA 1AZVA 2XICA 15C8H 4PJEF 1G6RB 2SEBA 3GSQA 2FT7A 4WSGA 1EXUB 2Q8AL 3IB4A 4QHNB 4QAWA 2A6KB 1LWHA 4NZJA 5IMLA 1PD0A 1HEZB 1RZQA 4R0LB 1V05A 2BZCA 1G9NL 4OKVA 2Z4TA 1UTDA 2F19H 3P0VH 4N8UA 3LQAH 4X5WA 1KBBA 4HGMA 4GKZA 1NGQL 3O6FD 2YFOA 5CN2A 3JZ7A 4W9KC 1RZJC 1XGUB 3V7AG 4BQBA 4HUCA 1OZTG 4OZFB 3MLWL 4UOW1 5I6OA 3VWJC 3QAZC 4OGAD 5FECA 1KEMH 4XZUB 5CKAA 5AVQB 3T4AC 1S7QB 3OLDA 4JO2L 2C34A 3K6FA 3W0WD 1TQVA 1LO0H 4U1NB 4X7FC 5D5ME 4RMSA 3P9WB 4KKCC 3WN6A 1P5UC 2PO6D 1ASQA 1UEMA 3FN3A 4U1JA 1MAJA 4L48A 3W2DH 1P2CB 3SN6N 1WITA 4LOFA 3EH1A 5AYUL 4FTVD 1HOEA 4EN3D 4NPYB 1WICA 2XKNA 5KSBA 1TLMA 2R69A 1OAUL 3G6AA 4DK3A 3OQ3B 3RIKA 3RWJB 4JQXC 2AJSL 3RUGB 4N9GA 5T3XD 4KNTA 4LPTA 3HAEG 4P2AA 4FFZH 2YZ1A 4LCWD 3ULUL 3WXVH 3CPLA 1JXJA 3BQUA 1ACYH 3CFCL 3DURB 3REVB 1FZKA 5I66B 3BDYH 2AK1L 4X8GA 1MLBA 3ARBA 4ZS7H 3NSJA 1EJOH 2VM9A 4M8RA 1INEH 1HL8A 2AJZB 2NTSP 3ZE2F 3OHXB 4XNMB 3TM6A 4NO5A 2QZ5A 4ZSOE 1JWSA 1BIIA 3LS5H 1C5BH 3BHBB 1CDJA 3GSVB 4M7KH 5F7DB 4AQEB 4XXDA 5D2NB 1Y18B 1P9MA 1QPXA 2NY1B 2RQEA 2XN9E 3AU1A 3QO1A 3UP1A 3S5LA 4FQ1H 4WWKC 1F0LA 4Q58C 2GBVA 1TZAA 5I73B 3VFPB 1EEYB 5L2KD 1T5WB 2E0PA 2NY2C 5CP3A 5T3ZH 1WRFA 5CN3A 5J3HD 4DP9X 4WNQA 1IMHC 5EO1B 3TJPA 3K2UH 1BECA 3EJYC 2EEFA 5GZND 1EIBA 1RLBA 4GI6A 3HE6C 3L1OL 1RZPA 5F1IA 5FKAA 2OMZB 2P24A 2XG4A 2CPCA 3OMNB 3NACH 2ICWB 3GBMH 3TLRA 3PWLB 1U8NB 5J11B 1YUKB 2E9IA 1LP9B 1PIFA 4JFDB 1JZ6A 4KC3B 1DQLH 3BJ91 3D33A 3L5WB 1KJMA 4MB3A 4O02L 2PPCA 3BEVB 1CF8H 1TG8A 1NBZB 3BKYL 1FVEB 3HS0A 3WD5L 1BQUA 2QFRA 5J8OA 5IY5B 1E2VA 4L1HA 4XBGB 3BWAB 3QFJE 5JDSA 4A67A 3RZCB 3UIZA 4E42B 1A7PH 5GRWA 4JY6A 3MNWA 3V8OA 4TOYH 5ITBL 4HKJB 2VLKD 4OCRL 3QI9A 4Z6AT 2VQ1A 1NPNA 1T5KA 2EH8H 2CIKA 3O8XA 4P5TC 1ZV2A 4XCYB 3OJVC 3Q6GH 3TA3B 3IE4A 4OM1H 1X5YA 4WQOA 3JUZA 4XCEA 3T3MB 5D70L 5IBTL 3BWSA 1TCMA 4ERSH 2OQJB 4KJWC 4QJ5B 1UGKA 2GFBB 5EF1A 1Y1DA 2Q86A 3DBSA 4JRXE 4M1CD 3LNGA 1ZSDB 1ZHLB 2K9UA 3FUEA 3W57A 4PGEA 3DO3A 4UI2A 1GKOA 1A7NL 4A7QA 4NRXB 3TNMA 3BP7A 2AV7A 1IBFA 4NQCD 4YQXL 5IFHL 3OF6D 3QNXA 5SX4H 3RPBA 4N6RB 3UC0L 1ILUA 5BJTA 2WVVB 2P5WA 4PLJD 4KY2A 5FYLH 1B6DA 4MHHG 5AW0B 3NA9L 5DMGC 1ZLVH 3H42H 2HKHH 2AVFA 5T33L 1HK6A 1NCGA 1WZKA 4X7DC 3NSCA 3SDAB 4HKXA 3ZO9A 1T1XA 1YMMD 4OQTL 4YGVB 2NR6A 2VC2H 5JHDD 4MMYB 2NUPB 2IADA 1J8HA 1E0OB 1CBVL 3ZDZE 2X9XA 4Z3EA 2J4WL 5EU5B 4RZCB 3TZVD 2YIHA 1KF9B 4N0UB 1Q94B 4J7RA 4QXWA 1FIGL 3L4CA 2CUAA 4PYGA 5IEKA 3F12A 2HMID 2VZSA 4HIPA 1M05B 1WAPA 3SKMA 4ZI8A 2DYSB 5F7KC 3AW5A 3IJHB 5ESVA 4NM8L 4XBPB 2N7SA 5EEVA 1SZNA 1L7IL 3V0FA 1BOYA 2VR6A 3HFMH 1IGML 5EA0L 2BP8B 3K2MC 5GISH 5BO1L 5KAQF 1NFDB 2RCSL 2ZUWA 4GIAA 1D6EB 3R1GL 1XCXA 2DWSA 4LKCA 3MV11 1XR8A 3QORC 3O11A 1J1OH 2YXVA 3L08A 4XGZB 2YK1H 5IJKA 2ZWSA 4PR5B 5B8CA 4GBXC 2O61B 1FL3A 2AK4E 4XC3H 5L7XH 3QXAA 2ZOLB 1WBYA 3FXIC 3DLQR 3BT2H 2ZWLT 4AGMA 2UUDH 1HSAA 2O6EA 1H3VA 4JR9H 3GSWB 2QGBA 4GRWB 5HJDA 5IB5A 2WANA 3ZRCC 1QRNB 2FYYB 2WBWB 3O2DH 3VXME 4FQXD 3RVUD 4EIGB 3NA4A 3NCYP 4FYTA 4AH2B 2WWKO 3FFCA 4JFFA 4LIQL 5F3FA 1ZLVK 4QNPF 5DTFB 5FWQA 1U33A 2DJUA 2QVMA 4TSAH 4YXHL 1QLRB 4F3FA 1LO3H 4X0KB 5J89A 4HJTA 4XPAL 5E4EB 2OZ4H 3QEQD 3W39B 1VFBA 5FCSH 4S10A 3F5WB 3D2UA 5GGTL 3FT4A 4F7EA 2D7MA 4LLMA 4X6CE 5ISZD 4MAUL 4IRSB 4JFVA 5GS0D 4ZMLA 3VFNA 3VTAA 3W9EA 4IIZA 3TBWB 2B20A 1ZTXL 5I1LB 3GSNH 4ZMWA 2DQFA 3NZHL 4OZGF 4KOCA 3BFQG 4MXQC 5BRPA 2WXIA 1F4YL 1LO4L 3OG4B 3UO1H 4G8IB 1ID2A 1CXFA 1F6AB 2Z9TA 5IROD 1IGJA 5BPPA 2DH2A 1EO8L 4NQEB 4XPBL 4KTEL 2JNZA 3TBYA 2JKWA 3PABB 2DZEA 3U9UA 3ZT7A 1OT1A 3SYCA 3CSFA 4KVCH 4X8JA 4Z77A 1MFEH 4JQIL 5EC1A 1FC2D 1I3GH 3LEXA 5GGVY 4PJ8A 1UH3A 2ZG1A 3HE7A 3MTRA 4WO4B 5AAWC 5KVMC 3SPCA 4NUGL 2YPVH 4IEFB 3VG9B 1QBMH 4GG6F 5FYKL 1AS6A 3PWVB 4FG4A 1U30A 2IGTA 4G72B 4PMFA 4WU7A 1EO5A 1XEDA 2PW2B 1YEFH 3BD4A 3G5YB 2KKQA 5HPMA 2VKWA 2MIZA 4NLAA 3RVTC 3RWFB 5JZ7D 2LAAA 4IBVA 1RK0B 1OAQH 5F6HJ 4WK2B 1T20B 2XRAL 3AITA 4WEBL 2DQHL 3QH3B 2BLFA 3VXSB 1G9MC 3DHMA 1SXCA 4WJ5A 2UZYA 3P0YL 1G1YA 1S8DB 4FLRA 2DI8A 1RZ8A 2PP9A 1E3XA 2Y1VA 1XGPA 4MX7A 3ZDYB 1K9TA 1Q72H 4HUXB 4LCIL 1QI5A 4DCQA 3QS2A 5AB2A 2CG9X 5DVPA 4W70A 4JFXB 2AEPH 4G8AC 2IVFC 4JPWH 3ULAB 1HQ4A 1LK2B 4LO9A 1JXKA 4E41D 3S8WA 3LZNA 4F37K 3BZ4B 3RKPA 4NS0A 2BY1A 4ODHL 3IFLH 5CGBA 1L9RA 5KG9A 1M9SA 1NCDH 4HC1H 1JL8A 4LVOC 4LEXL 4BQ8A 2C9VA 1E9PB 3ETTA 4PJEA 2ZIDA 5D1QA 2K70A 3SE4A 4DPAX 2CHZA 3T1WA 4YHIA 1DANU 4K3JH 4F7MA 3FQ4A 2DWEB 1VFAA 5KYUB 2BJML 4Q9RL 3BUIA 1CF1A 2LTQB 4JFWA 4MYPA 1KLUB 4UINL 3PFUA 4B5ZA 5DEFA 5CN1A 4N90D 1PZBA 5KOMC 2BFVH 4PJHA 1BCIA 4OB5L 1JPEA 3K46A 3X3FH 1MI5A 5FO2A 1C12B 5I8CB 1T7VA 4NRZA 4N2KA 4TNEA 3IN0A 2K3HA 4XNYH 3K72A 5SX5H 2IC2A 4F7TB 4YS4A 1SMAA 5C0JA 2CO7A 1E4JA 2VDLH 2OMXB 4ICXA 1JHKL 5T1MA 3QUZD 2Q5BA 2F7RA 3DUSA 3JV0A 2YUWA 4BDVA 3Q05A 5EWIL 4A7VA 4OCSH 3WDIA 1TSHA 2FIKB 2YGNA 3GI8H 4KKPA 2PW1B 3N1PC 4N1CA 3RI5F 5C9JB 5D7LD 1BJ1J 4BFGA 1FFNB 2F7PA 1LJMA 3TEUA 2DTML 4KDVA 3UAEA 1SY6L 5E08H 4ODVH 1P7KB 4FTVE 1PW3A 5GGRB 4GINA 4EUPB 1MDAA 1Z3GL 2BIPA 4JN2B 3NJKA 5EOQH 4BZ1A 5JIKA 5F9WC 2WXQA 3BQVA 2QTVA 2PYEB 3K0YA 4Y88A 5T3XE 4AEHL 1R5VB 4LCUA 4ZTOL 5DD1H 3BD3A 1DVYA 1KGXA 2VSMB 3KPRA 1P5VB 2XFXB 1NCAL 3QXWA 2VQTA 1XH2A 1Q1PA 3QUMA 1U2YA 2AZUA 2XQBL 4UNVA 1WPCA 3BUDA 1UKQA 1PKOA 4ONOA 4U1GB 4BA8A 5HGHB 5MENB 4LU5H 3KLAA 1RCYA 1X5IA 2I7SA 2YPLB 2XCMC 3DVFA 4EI0A 5HGGS 1ULVA 1FPTH 1EUUA 1JHTA 3P1VA 4ZFGL 1IEHA 4X99B 3EXLA 1QR4A 2E76C 2OULB 3NK3A 4R26L 4B27A 1E5AA 4F8PA 1NIBA 5E8NB 3RVVD 4ZMNA 4Y7OC 3KCPA 3FO2A 4Z3FA 4ONFL 1L0XA 3O6FC 2G9HB 1XSJA 4QI3A 3SDDD 1ZPUA 3ZGHA 4HUVB 3RWCA 4YSAA 3TBBA 3S35L 3QNYB 4FQJL 4WTQA 2JI3A 1IL1B 1NAMB 1ZHBA 1JPFA 2DB8A 3MRFA 4MLSA 4OGAC 1FO0A 3UYPB 2NNFA 4QXGH 1KACB 2R1WB 3GWJA 4FP8L 3EG9B 5FYJH 4X6DA 4RFEA 1IAII 5AVZB 4NQQA 3R4RA 2F61A 2PO6C 3I6KA 1GAFL 4AYBA 1IC5L 2XWZA 1UM6L 2J72A 3LHAA 4L8SC 5DCCA 2R0WH 3MA7A 4D9QD 4WEEA 1S7TB 3BAEH 4ENED 4PG2A 2X4OB 2R2BA 4LLVB 4HIIA 3QYMA 1J5HA 4A68A 4AMKH 1RHHA 2FJHA 4PD4K 4OBSA 4EN3C 4XP9H 1RAMA 3GSUA 1QHPA 5TE6H 1OM3H 3CSYA 1AGDB 1QFUL 4BH8A 4K9JA 1L4IA 1F6FB 3H6AA 4KUZL 3TVMA 3QRBA 3E1ZA 5J6SA 2HYMA 3IDYB 3RGBA 3VM5A 4MMXA 2ZKHL 3LPWA 4Z23A 3FMGL 4TVSa 1JTPA 3K80A 1P6AB 5FAAA 2NY4B 2UX7A 5DWPA 2K0RA 4KKRA 5D4QA 4KRPD 4KY1L 3BCDA 3A47A 2KS0A 3CBJB 3GK8L 1UFGA 1AQDA 5JPMA 2E6JA 4KXZH 4OSUL 3QUXA 1QAWA 3LY6A 3HR5A 4QRSB 2OJEB 4S1SH 2NT1A 3WIFB 2IQ9L 4K94L 4LARL 4OLUL 5I8OL 4JRLA 1DVZA 4X4YB 2PR9A 1HNGA 4LBEA 1SRDA 4QHKI 3A4EA 5CBAB 2ZYRA 4ZFZB 4Y5YC 3U2SB 1R24B 5J3HC 3R8QA 1IBGL 3Q7JA 4NO0A 1TMCB 1GH7A 1A4JB 1TZOA 2VL5A 5DFTA 5JHDE 2ZUYA 5GZNC 4LT7A 5C0CE 5IREA 4RGMC 4FN0A 4XPTL 5ECJE 3TPUA 3ARFA 3UAAA 3WELA 2GT9A 2HH0H 3FYEB 1LE5B 1XHHA 1IM9B 3B9EA 2DD8H 2X4QB 3MUZ1 2WTRB 4IRZL 2E6PA 5I8EA 2VDNL 3QDGA 1UXLA 1UACL 1B0GB 1F5WA 5FIEA 4BH7A 4BFRA 1IE4A 1VADB 3ARGD 3IF1B 1YRKA 1UASA 1JMZA 1PFCA 3BWUC 1PLBA 4KMTH 4AIZB 3FQ1A 2AQ2A 3VWJB 3GRWA 2V37A 3LRKA 1HWWA 3LS4L 1CD1B 1ADWA 4UIKL 5I5JA 3RTLA 2XWTB 2JK5A 4WLCA 5DA0B 1CN4A 3MOAL 1XXDC 5ERWB 1XBRA 4NGHL 3DX7B 2B0SL 2HJKB 2VUYA 4KOBA 2QEJA 1M71A 3GKZA 1THCA 5PAZA 4QRRE 3WN5C 2ITEA 2CHDA 2KQMA 5C09E 1A14L 4LMQE 5ADOH 2Q10A 4KNQA 2OR9H 1T1ZB 1NCHA 2WVSA 3GTTA 4OGYL 3BZFA 1YY8A 2DQTH 4OT1H 3TYFB 1DQML 3SKOB 2GTWB 1X7QA 5T1LD 1GZQA 4HCGA 2NUTB 3P77B 1P7QD 3D2TA 3I6GB 5J4MA 3VD4A 4OIBA 4M93B 5A1AA 4M1CC 4U1HA 4OUOA 2XSKA 3DK2A 2O6PA 2V8MA 4P04A