3PAZA

Reduced native pseudoazurin from a. faecalis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
123
Chain Sequence
b'ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
molecule tags Electron transfer
source organism Alcaligenes faecalis
publication title Site-directed mutants of pseudoazurin: explanation of increased redox potentials from X-ray structures and from calculation of redox potential differences.
pubmed doi rcsb
total genus 34
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 1997-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pazA00
1X9UA 3AG1B 3UGEA 3QJVB 5I5MA 2FT8A 2YAOA 2BP0A 3ASNB 4KO9A 1ASQA 3C75A 3ZX1A 1AZRA 3X1BA 2Y1AA 1MZYA 1NIEA 2IDUA 1MZZA 2PPEA 3NJHA 3NP4A 2IDFA 2BP0B 1ET8A 2XU9A 4Q89A 5B3SB 2YAPA 3TA4D 9PCYA 4YSUA 4NAJA 1GS6X 2GC7C 2PPAA 2TSAA 1SJMA 2CAKA 3JT2A 4X4KA 4WTQA 3FSAA 1BAWA 4G70B 2ZOOA 2VW7A 5D4IA 4FAAB 1ZDQA 3V9EA 4BWWA 5F7BA 1VLXA 4RH4A 4W1TA 3WNJA 4UANA 1WA1X 2DYSB 5B7MA 4GP5B 1KCWA 4DP2X 1E65A 4KNSA 4M4RB 1JZHA 1ET7A 2YXVA 6PAZA 1CC3A 4N8UA 3AZUA 3T6XA 3NJGA 1NWOA 2YXWA 3QJUB 4K9JA 4EF3A 1CUOA 3UACA 1JERA 1NDTA 2YARA 3FU7A 4UF7C 7PAZA 2IDSA 4CSPA 4YSSA 2YAMA 3EH3B 1L9OA 2R7EA 2UXVA 3EH4B 1YLBB 1PLBA 1GYCA 2HZHA 4ZK8A 4HALA 4A66A 5I6NA 3WG7B 2YAQA 5I5IA 1PNCA 3FSVA 3X1NA 3T71A 3CVCA 1OF0A 4GP8B 3X1EA 2AZUA 1OE3A 1NIFA 2YAFA 3FQ1A 4YSQA 4GY4A 2GI0A 1T5KA 2XV3A 2HRGA 2YAEA 3CDZA 3NJNA 4G71B 2EILB 2B08A 1EZLA 2CCWA 2VW6A 1CYXA 1A4AA 4E9SA 3IN2A 3PAUA 1QNIA 2ZXWB 1URIA 4UAHA 5I6KA 3FS9A 2FQFA 1PZAA 4BWUA 2CBPA 2X88A 1OE1A 1J9RA 4F7KA 2MTAA 2FQDA 2HX8A 1OCCB 4KO5A 1SHWA 3OMAB 2VSKB 1L9SA 3FQ2A 2GSMB 4A2FA 5I26A 1GW0A 3TBBA 3IBOA 3OM3B 1W8EA 3CG8A 3IN0A 4AKOA 5I6OA 2J57A 3NSDA 1ADWA 4W9ZA 4HAKA 4JHUA 2YAHA 3CVBA 1A8ZA 1AIZA 3GXUB 4Q8BA 4YSDA 4E9WA 1PMYA 4YSOA 2XLLA 2DWTA 2VM4A 3WNIA 1PLAA 1IUZA 1J9QA 1L9TA 2XX0A 4E9XA 1JZJA 5I6LA 4E9QA 4QLWA 3N55A 2E86A 1BEXA 1NINA 4A2DA 1NPJA 4AX3A 2CUAA 4A67A 4CSZA 3ERXA 3GYRA 1RCYA 3IEAA 2EIJB 1AAJA 4DP4X 4HCIA 4DPBX 1HFUA 1AZCA 1XB6A 4FA7B 1WAEA 4DP0X 5B1AB 1OCRB 2HX7A 2PP9A 3CVDA 3OMNB 3AW5A 2DYRB 4DPCX 3PXLA 1XMEB 2ZONA 2VN3A 5ANHA 3SBPA 3X1FA 2EINB 2P80A 2ZWNA 3KW8A 1J9TA 3FPYA 1M9WA 2HX9A 2XVBA 1SFHA 1ZIAA 2MRYA 2EIMB 1M57B 3D12B 2I85A 1SF3A 2GC4C 5AFAA 1V10A 2PLTA 2PPCA 1E30A 1WA2X 3FSZA 1KGYE 2PPFA 1JZGA 1IBZA 4E9YA 3NJKA 8PAZA 1ET5A 1TEGA 1L9QA 2FT7A 1ZPUA 2N0MA 3CZUB 4QKTA 3NT0A 2J5WA 4HCFA 5D4JA 1GY2A 3S8FB 1ID2A 4A2HA 2BO0A 1JVOA 4DP9X 1FFTB 2QDWA 5D4HA 1MG2C 4KOBA 3ZBMA 4KO6A 1RZPA 4DPAX 1E5YA 1KCBA 3AY2A 2XV0A 1GS8A 3UAEA 3L45A 4YSRA 3S3BB 3FYEB 4YVUA 4KO7A 2IWKA 2H3XC 1QHQA 3IE9A 1DZ0A 1QLEB 2IDTA 1ILUA 1JZFA 1X9RA 1FWXA 1I53A 1MDAA 2BW5A 3FQYA 1J9SA 1TKWA 1A3ZA 2UX6A 2UX7A 1AR1B 2FNWA 5E9NA 1IBYA 2PCYA 1SDDB 3AG2B 1L9PA 3FSWA 4JHVA 1OOWA 2GBAA 1NTDA 1WS7A 4YSAA 2IH9A 5PAZA 2GB2A 1GSKA 4YSCA 2VM3A 7PCYA 1N68A 1PLCA 1PAZA 4G7RB 3FPXA 3JTBA 4HHGA 4NB7A 1BYOA 1BXVA 1E67A 2J55A 3FYIB 3QJSB 4MFHA 2FTAA 2QT6A 4AKPA 2HLEB 2FT6A 5IY5B 1OV8A 5F7AA 2UXFA 1PZCA 2X87A 2VW4A 2H47C 3BQVA 1BQ5A 4DP1X 1E5ZA 5AZUA 1W6LA 3AG3B 1NIAA 4F2FA 3T9WA 2DY2A 5TK2A 3PAZA 2AANA 2VMJA 2A3TA 3PCYA 1UATA 4PCYA 4G72B 1AS6A 2UXGA 5TK4A 5B7FA 4NERA 1IC0A 4BWTA 1PNDA 2AZAA 3OD3A 1SDDA 3OQRA 3U25A 3NP3A 3NJLA 4YVNA 2IWFA 1ZIBA 5I6PA 1IKOP 4E9TA 1AOZA 1TEFA 2JFCA 3MBWB 2BZ7A 3QPKA 4P5RA 1MG3C 4GXFA 4E9VA 1PZBA 2PP7A 3FU9A 1ASPA 1F56A 4G7QB 3RYMA 3S3DB 3NSCA 2UXTA 4DP5X 1OE2A 3QJRB 3AG4B 1KBVA 4JKNA 1M56B 2IWEA 3TBCA 4AI7A 2FJSA 2JKWA 4HIPA 3MX0B 2J56A 4BDVB 5LDUA 4DP8X 1XB8A 1JOIA 2PPDA 3NJJA 3FT0A 2B3IA 1SFDA 4KNTA 3T6ZA 1ZV2A 1AS8A 1NPNA 3H4FA 4PAZA 3WIAA 1NZRA 3UABA 5FC9A 1TU2A 1NIDA 5B7EA 2BW4A 3PAVA 3SBQA 1B3IA 2YQBA 5AKRA 2DV6A 2XXFA 3GDCA 2BWDA 3S8GB 1J5DA 1NICA 1BQRA 1BYPA 4DP6X 1GY1A 4GYBA 2JXMA 1AG0A 3FU8A 2CJ3A 4L0PB 2WSDA 3ABMB 1R1CA 1L9RA 2P80D 2CALA 4AZUA 1AG6A 1NWPA 3SQRA 2XYBA 1JXFA 2TSBA 4N4YB 4A2GA 2W8CA 1PCSA 3NJIA 4YL4A 3T6VA 2I7OA 1J5CA 1XB3A 2QPEB 4AKQA 1JXDA 1JXGA 2OCCB 2Q5BA 3ABKB 4P5SA 1EHKB 3H56A 3HEIB 3NSFA 3QJQB 3UAAA 1A4BA 3EHBB 2I7SA 3ZDWA 2AFNA 1HAUA 1ILSA 2W88A 3WKQA 2H5UA 2FQGA 1SHXA 2GHZA 1ETJA 2XV2A 2HXAA 5I28A 5B1KA 1NIBA 3KW7A 1KDJA 2FQEA 2PCFA 2IH8A 3FU7B 3CDZB 6PCYA 1SF5A 4M3HA 3NSYA 1V54B 4YSTA 3NJMA 2BP8B 1GR7A 5B1JA 4BDVA 1AZNA 1CYWA 1WA0X 1OCOB 2XX1A 1BXUA 2Y69B 5PCYA 1OCZB 2IDQA 4HHWA 1AS7A 1KYAA 1BQKA 3UADA 2XXGA 2R7EB 3WI9A 3H4HA 2AVFA 4HCGA 3T6WA 4A2EA 2RACA 1PF3A 1HAWA 4GP4B 4A68A 4TXVB 5B1JC 4DP7X 1BXAA 4HZ1A 3OMIB 1KDIA 3HB3B 3PPSA 3SBRA 2DWSA 2WO3B 4WKXA 3TASA 1AZUA 3WKPA 3PLYA 5I6MA 4E9RA 4BK5C 4G7SB 2BP8A 4ENZA 1A65A 2XUWA 3ZIYA 2BHFA 2HRHA 1W6WA 5EHFA 3V9CA 1DYZA 1RKRA 3ABLB 4F2EA 4BXSV 1SNRA 3NYKA 3EH5B 3S3CB 1N70A 3BVDB 3DKHA 1CURA 1ASOA 5A7EA 1AQ8A 2XWZA 1A4CA 1RZQA 2QDVA 1ZDSA 2WO2B 1JVLA 4KOCA 3EF4A 2Q9OA 2PP8A 4KNUA 2QPDB 1PY0A 2OJ1A 3NJFA 1JZIA 1AACA 3QJTB 5I5JA 3ABGA 3DTUB 1KV7A 2VSMB 2FWLB 5B1BB 2BWIA 2BZCA 3N2JA 3ASOB 3X2QB 3X1GA 3QQXA 1WS8A 1V55B 4YSPA 2EIKB 3DIVA 3TU6A 4BXVA 2GIMA 1AZBA 2NRDA 2IAAC 4YSEA 1JZEA 2LLNA 3G5WA 1FA4A 1GS7A 1AANA 2OV0A 1KBWA
chains in the Genus database with same CATH superfamily
1X9UA 3AG1B 3GBNL 3HZ3A 3N0PB 4OZIF 1ZA3A 4OFQA 3UJIH 3GSRA 5B4MD 4FQLH 4OGXH 4Y19E 2J6WA 3CPLA 1H15A 2NX5D 4PRID 4DKAA 5DSCA 5LN8A 3OAUL 5F8QC 3CDGA 5AVYB 3PGDA 2G2PA 1G1YA 4WO4D 3W11D 4XVJH 1OK8A 3H85A 4CVZB 3QUMA 4WNSA 2HAZA 3LZOA 1U3JA 4F1SA 3TS8A 3P4NB 1H5BC 3D2UD 4EXPX 2X2YA 4Y8AA 2UWEB 4WTQA 5AOKA 1HZLA 2VC2L 2L04A 3CZNA 3A6CH 4G70B 4N0CD 1YQVL 1E9QA 4TQHA 4LSUH 2NNXA 3W9EA 4MD4B 5FGBC 1RZFL 2QMJA 3O2VL 5EZLB 4NKOA 4RMQA 2COVD 5F1NA 1G1KA 3QIBB 3APNA 4N8UA 5TDNB 5E6IC 3B56A 2VIRA 1NGWA 1U8IA 4I3RH 1FZKA 1RY7B 3KBPA 2L7QA 1QBLH 1JMZA 4IMLB 3GSVA 2G30A 2D2CC 5KBPA 1FF5A 4QXGH 1CU4H 2F61A 5KYWA 3MCLL 4MXWL 2UXVA 1KZYA 3MU3A 1TQCB 4ZD3H 1B9KA 5HHOA 1NFDE 4X42A 2XBTA 4K7PY 3ESMA 4PJ9D 3JZ7A 5JZ7C 2NYYD 3QUYB 5BZDB 4NZJA 3FONB 3ZGHA 3IDYC 3NCFB 2YA2A 4UT6A 4XBPB 3I6SA 4YHYB 3BT2H 2CGZA 4PJCE 4ELDA 2DW5A 3VXTA 3DTDA 4KQ0A 1DQML 2NY5L 4D94A 4GRLA 3IDUA 4ZDHB 4HAFA 1BVLB 1JZ7A 2WZ6A 1A4AA 2Q7YB 3GK8H 2ROYA 3IN2A 2GPZA 1QNIA 5DRWB 4TLTA 3VXNA 4FCHA 4PJFA 2B3RA 4FDWA 5DJZB 3VG9C 3FB5B 3WO4B 1JN6B 3TBWA 1P4IH 1R5IB 2K8MA 2NQDA 2ZXBA 3SPJA 5J3HC 1UOLA 2DQFA 3ESPA 1QNZH 3KWXA 1O7SA 3UTPE 1TPXB 4WY7L 1SYVA 4TMPA 5IMKA 1RUKL 4Y5VA 4F92B 3M1OA 1B0IA 5ANMB 1WWAX 2MCG1 1BP3B 2O1AA 1U8OB 4JKWA 5EEVA 1MHHB 4YSDA 4ZSOB 4KQ4H 4XB3A 4F8TA 2EIEA 2DWTA 1MNUH 4I1NB 1T6VN 1XH0A 1HQ4A 2X3BA 1I3UA 1FC2D 4QAMB 2CO7B 4M5SA 2C3XA 3DRTA 4NQDE 4QJ4B 3E7JA 4GSDH 2XWXA 1YEGL 3D39D 1C7TA 3MRMA 2FEEL 4OUUA 5CIPH 3WELA 4UTAH 4U1KA 4E9QA 4A2DA 5L88H 1YDPB 2P52A 1NPJA 5CD5D 1EHNA 4FN0A 4Q9RL 5LJYH 2GT9A 5DK0A 4I4WA 1BM7A 2VZ3A 1DVFB 5SWQB 5F96H 1IKNA 3H9HA 5CSZB 2ZAGA 3U83A 2X6BA 1AZCA 1YA5A 3BWUC 4JPVL 4X8JB 2OR9H 3D69B 1EFXA 4S1SL 3UIZA 2BSCA 1Z9SB 2GG1A 4LL1A 3IFNL 4N90E 1JRHI 3D3VD 3K2UL 4NBZB 2IGTA 3O9WB 1E4KA 4GI6A 5KS9F 4KTGA 2ICWJ 1HSBB 1M9WA 4NRZA 4P9MH 4L1HA 4ELKA 2WWMC 2VITB 4LLUA 1DANT 3NIFB 3D12B 4WWOA 5L6YH 1ZEAH 2XZQH 4H1LA 2BIMA 1QRNB 4KKRA 3X3GL 3ZY7A 3IGAB 5CEZH 5L2KE 1JZ5A 1G1CA 4I8DA 4R5TA 5JQHC 2IANA 1RU9L 3A67H 3S35H 4QLRA 4QKTA 5IR1B 3NT0A 4PW4A 5A2FA 4K7FA 4OD1H 1NUNB 2WANA 3FHEA 4CDGC 4WJKB 1EEQA 3UBXI 3IDNA 1U58A 2AJSL 3DRQA 2IBZX 1M1XA 1BZDA 5KSUA 3RNQA 4AIZA 4KO6A 1PYWA 1ZT1A 2H6OA 3MLTB 4R2GC 2ED8A 1TTFA 4M6OH 5KBNC 5D72H 2O6FA 3CN3A 4YHLH 3S3BB 1BG9A 2CO4A 1JV5B 4JUSA 3ETBJ 5T5NF 1M2OA 5GRZA 3S3PA 3UGUA 5I30L 3RFZA 2HMID 2JJSA 4HH9A 2AK4E 1DZ0A 3KD4A 2VAAA 5DJ2B 1MPAL 3W39A 1WFUA 4OZHF 1B0RA 1IM3A 1F4WL 4NN6B 3CLEH 4DT2A 4IU2A 3QPXL 1KWGA 4TRPL 5EU7E 1A8JH 1OKEA 3C5ZC 4NUQA 2JXMB 2OMVB 2OYKA 2WM0A 1RP8A 4F7MA 3ZW3A 4CU8A 5F3HB 7PCYA 4EN3C 5IHWA 4KRLB 2F1EA 5IJKC 1AHWB 1J11A 4NB7A 1BYOA 1DEDA 5L0QC 1FCCA 2AVGA 4OLVL 1I3RA 3RVWD 1BOGA 1C5BL 1A1MA 4NZTH 1QYGH 1OQXA 1BQ5A 3ZTJH 3QZWG 1XGYH 5K59F 3OGCB 4GMSH 3KPNA 4L1SA 4ODUA 4K07A 1DQMH 2NY5H 4UIMB 3LIZA 4XVSH 3ETSA 3U30C 5D93C 5KS9A 5AVWB 2AANA 2F8OA 1UZ6F 5D5ME 2KLTA 3I9PA 3VFNA 1FP5A 2YBRA 3ARZA 3Q7JA 1D5RA 3C8KB 3NQIA 4G8IB 1MFAH 3ETTA 4YHZH 3QNZB 3LZFH 1M05A 4GSQA 1GIGH 3MLRL 5HI5D 4IEFB 3HBGA 3GM8A 2HFEA 1CLYL 4GO8A 2QQNL 1F6LL 3CSTA 43C9A 4LIQH 4NX0A 3G9AB 4XP1H 2W0FB 3ZTCC 1N5YH 2AITA 2WLNA 1IKOP 3HG4A 1AOZA 3REVA 4GXFA 1CXLA 3LH2H 3BSHA 1FVDA 1D9KC 2GBVA 2O61A 1AP2A 3APDA 5IFHH 3DPDA 1KJVA 2E4FA 3MO1B 3QCVH 1IGJA 4Y19B 1OE2A 3E1F1 5ID0A 4F8LA 3IDJA 2R2BA 4IM8A 4JKNA 3WU1A 3WD5L 4I77H 5C0EA 2F74B 2IPUG 1NGPL 5BZZA 4AJVA 1IM9B 3O45B 3D25B 3RWGA 1CXHA 2J56A 3TBVB 4BDVB 5A6MA 4DP8X 4BCXA 4A7VA 5FO8A 3WEBA 3NJJA 4PY8J 1JD7A 3VE0B 4PV8B 4L0YA 3PNRB 2HWZL 1ED3A 2EVFA 1NPNA 1FO0A 2FJHA 5J1TC 4F9PC 3L7EA 3RGVA 1TJMA 3WE6B 1MJ8L 1T03L 3KMDA 4HA1A 1DJXA 1AO7A 2BH0A 4NENA 4IMKA 5DF0A 3PAVA 1J18A 3ISWA 3RWJB 5E4EB 5DFWH 2DLEA 4PJXA 1BAFH 5B8CC 1IEAA 5ACLA 2HFGH 1A5FL 4OI8A 1CICC 3MNWB 4AE1A 5CLYA 1DBAH 1JFHA 1NCIA 1QBMH 3PWPE 4L1TA 4PR5B 1ZGLB 2PCXA 1DQDH 3LRMA 1F11A 4OQTL 5GZNC 1R0AH 4JDVA 5JW4M 5CWSB 5HDBB 3MRGB 2YD6A 3RBGA 1LEKA 3SQRA 1DVFC 1OAKH 1PZ5B 1SJHA 3LS4H 4TVPE 4HK0A 3RWIB 4N4YB 1R24B 3MTRA 1JZ4A 2BIOA 5CD5C 1MCEA 1UWGL 1LHZA 1IQDA 4S2SB 3ARFC 4XBEL 1EHKB 1TZGL 2XIDA 2A6DB 3CX2A 1KBPA 3QJQB 4XMLL 1A4BA 2W9DH 1R33A 3DC0A 4NLAA 2W88A 2B4CC 3PL6D 5TQ2H 3ET9F 2ED9A 4EKJA 1XGRA 3SOBL 3Q13A 1AY1H 4M1CC 1IL1B 3HG1E 1QABA 3JBG7 3AROA 1I9RL 5HDBE 4N5EC 1Z3GL 3I6GB 3MXWH 2CLVB 2XDHA 2EH7L 1UH2A 1JHKL 3VXOA 4DKFL 1OCOB 2VERN 1CICB 4KVCH 3RI5F 4C4KO 3FQXB 8FABB 1HEHC 1Y07A 1GPOH 3CLEL 3H9ZA 5EBWB 2ZOLA 1Q94A 2OJEA 2QSCH 3LV3B 3MROB 1CFQB 2IIJA 1E3FA 4PR5A 4XNBA 4YX2H 3FHAA 3PWLB 1CBJA 2VL5A 3G5XA 3BKJL 4N68A 4FC3E 3S5LA 3BKCH 2YGQA 3KS0J 4ALAC 3N9GL 3QJFA 1UB5B 2QADD 4MNQB 5AZEH 2IPTH 5KSBA 4Y7OC 4CMHC 1KIQB 4G6MH 2BHUA 1T6WA 3NFSL 3VGAB 3FJTA 3MRCB 5BZXA 5CEYA 3RZWA 3HE7A 2W07B 4JZJA 1XIWD 3QEUB 4AUYA 3VNZA 4FERA 4RZCA 5F1SA 2OR7A 1QKZL 3OAYK 4PLOB 3DBSA 3PJSA 5HDQL 2ENJA 5IV2A 1AQ8A 2X05A 4LCWB 3C5ZD 4QCIB 4N6QA 3ULUE 1ZDSA 2ORBH 5I1CL 2BK8A 2J25A 3TNMA 2DYPB 1LVEA 4KRPD 2DTML 3I2CL 2X4SB 2HT3C 4URKA 3NJFA 2WTRA 5I5JA 1AXSB 3H3PL 4P23A 3D06A 1Q9WA 2FWLB 1O6SA 3OG4B 3QK0A 1AQKH 1UJ3A 4PRPA 3SZ6A 2BSEA 4L29B 1A1OA 3P73A 3ZKMD 4FFZH 5JXEC 1WS8A 3QQNA 4XN4A 1KBKA 2P1YA 2X2IA 4HF5H 3P40A 3TU6A 3SDCC 2J21A 4ZUWB 4CMHB 3UZQB 3N41F 1C8QA 1M05B 1WZMA 2IAAC 4M5TA 1U3ZA 5ENWB 4M62L 5E4AA 5I75B 3CSYA 3S36L 5EZOL 4LEXL 2WXGA 3PFQA 4UWQB 3GS4A 2OLDA 4NQXB 1EVUA 1L0YA 1MHCB 3UZVA 4L23A 3BXNA 3QA3A 5IVXF 2WNKA 3UYRH 1AZRA 5GJTH 5I66A 4TTGA 4ONHA 3WGVB 4PGCA 1MUJB 1I7UB 2J12B 3RTQA 1MZYA 1MZZA 2YQGA 4WTWA 3TCLB 3KDMB 2W59A 3LKPA 1G6RA 4ORGB 1IAKB 5FYKH 4AGOA 2Y3AA 2ZAHA 3QQ3A 3IE4A 1PQZB 3NCMA 2LLGA 4K3JL 3I75B 4JZOB 4U7MA 1I1FA 3U79A 1A5FH 4W9KC 2FBJH 4FAAB 3WIFB 1HNYA 4NI3A 4Q58C 5INDA 1XF4B 4N9OB 1VLXA 1QFPA 1YYCA 1INEL 1E9PB 3RGVD 4WGKA 4F8PA 1R0AL 3VFVA 1HDMB 4HS6B 5TPWL 5J4MA 3IXTB 4IQHA 1UJ3C 1ZCRA 3EJZC 3AZUA 1U8HB 1T0PB 4DAGH 5T3ZE 1NWOA 1RIHH 3DYOA 3V0IA 1C5DB 1UM4H 2ADGB 2QTEA 4H2AA 2EIDA 5CCKH 3QJUB 3S9DB 1J0KA 3DOSB 1JV5A 5CJBA 2ZXGA 1YY9D 5SWSE 3TWYA 1NFDF 3HE6B 4MAZA 3WE1A 1GYCA 4OCNC 3WG7B 1KCUL 1U2HA 2P5WB 4KK6D 5BV7B 3C12A 5KAQF 1TIUA 4ZQKB 3X1EA 3AVEA 4MJID 1P6AB 3MLXH 1C5BH 4NZTL 3VGDA 4U3SA 2KDYA 1JGEA 3PYCA 2NXYB 3MJ6A 1SBSL 4MA7H 2YAEA 2YFOA 1DJWA 5AVZB 3O3BA 3D85A 4PVBA 3FRPA 4UIKH 3V6ZB 4AW7A 3N91A 5I24A 3M8OH 2KZKA 2HG0A 2VDPB 1PPIA 2BS71 3SDDD 1MXGA 3I02B 2B9BA 1FNGA 2E8ZA 1NCWL 2CBPA 2DBLH 3GZPA 3H9SE 4L8DB 4W9FC 2B15A 3K2UH 4ODHL 1P5UB 3HW7A 2A9NH 2O6DA 1HXMA 2VSKB 4HT1H 1NMAH 2GSMB 2ZQKA 3O0RH 3SYQA 1DVYA 3GXDA 3QB7C 4A2FA 3DX6A 5L2JA 1EFXB 3CFCH 2ILLA 2OSWA 5I76B 5EO0A 4U3HA 1CLYH 2J57A 4LF3B 1VEMA 4W9ZA 1NLBH 5EOCJ 2XPGA 2YAHA 3STZB 2ICES 2Z7UA 3NIDE 2Y06H 1A8ZA 3CVHB 3KPRA 3RWCB 5BRZA 1LD9B 3FFOA 2XLLA 4FP8H 4FXKB 5D6CA 1KJ3L 4TUUA 1VACA 1H5BA 1AXTH 3Q5YA 3KEHA 3KPPB 2BFVL 2WQ8A 4LBEA 2W0PA 4S1RH 5DC9B 2M2DA 4UB0H 4ZS6D 5JOFA 1G7MA 1TTBA 4UIMA 1HHKB 1XAUA 3MCKB 2FHFA 2E76C 1WVZA 1LEIB 5DD5H 1F00I 1JZJA 5ISZE 4ELMA 3PHQA 5I6LA 3O8XD 1GL4B 4IU3A 5D7JC 5FAAA 2CUAA 4AX3A 5IT2H 1LEIA 3S37L 3VTMA 3GSUA 3G08A 5DEFB 3ERXA 4CSZA 4JAMA 4EJ1C 4KQ3H 3MAWA 1HFUA 4JPIA 2BC4A 1KLGB 4BSWB 5FHBL 3N06B 3LKRB 4ETQA 4B0MM 5AZ2H 2VKXA 1RERA 2HVKB 1XF5B 3IFPB 2R0WL 4M5YH 5D1ZA 2H6PA 2R1YA 3DX8A 3F7YA 1JWUA 2VN3A 5KS9E 1UXMA 2CIIB 3X1FA 4AXWB 1BHGA 4I0CC 3W82A 2WYZA 4PJEE 1WFTA 2G60L 3NJXA 3BP5A 4LSPH 4LF3A 4A7TA 3O8XB 2F6AA 4OQTH 3TJEH 5EUOA 5EO0B 2QHLA 4KJPC 3HI5H 2PR4L 3N1FC 5BOZG 2CXKA 2H9GB 4WEUD 3ARBC 3WSQL 3LRLA 1QACA 5IVXA 1H6EA 4KITB 4OF7A 1DJHA 3KXFB 2ICWI 2NNFA 3L4UA 2IMNA 4Y9FA 4OLUL 5IB1B 5LGYA 3GBLA 2V3EA 5LQBL 1IAIL 1LILA 2R1WB 3EO1B 3L3IA 3WJLA 3V6OE 1OCWL 3NCCB 1R5VA 5JUEH 1DEEA 1IGIH 2NX5E 4PRIE 4HZLA 4H26B 4TLKA 1WWWX 2LU3A 4LSSH 1RZJC 5I17B 2Z1KA 3F7LA 1EFXD 4F7EA 3H42H 4NNXA 2M1KA 4MDJB 3LZFL 3MGTA 2QLVB 2M26A 4LSVH 4UTBL 2NXZC 3ALWA 3KBEA 3BGFB 2Y4SA 1H3TA 1ZT7A 3B7UX 4JEGB 4O9HH 3BSZA 1FWXA 2FWOA 4JHBA 3TZVB 3O3EA 4FNPA 4GXVH 5CR1A 1OSPH 3PABA 4KJWD 3EYQD 4NN5B 2YKLL 3UJJL 2EDBA 4D8PA 1BJ8A 3DLQR 1Q9OB 3QG7L 4H8WH 1WCBA 3V0HA 1WS7A 3VU2A 2G3MA 4RRPG 4XP4H 1VFBB 4BK4A 1J5OH 4YSCA 1HILA 1MJJB 3U0PB 3ZGIA 2X1XR 5E8PA 2A6JA 3QSKB 3JTBA 4PWIA 4L4TD 3VFVB 5IUSA 1P4BL 1NGPH 5DU7A 2C9AA 1WTGT 5C9JA 3OXRA 4RQQB 1OV8A 5FM8A 1YDPA 1GHFH 3SE4C 3VB9A 1PZCA 1NCDH 3O2DA 4GRLC 4OUOA 3VXSD 4MA7L 2Q76B 4AE0A 5D5MF 3MX0A 2M83A 4S0HA 4QIRA 5HGDA 2DI8A 3B7RL 1X7SA 4OAWB 1OZTG 5I1LA 5C0GA 3WIHH 4PGCB 3N1MC 1E2WA 1NCWH 2DBLL 1FIGL 1BBDL 2WCGA 4O2FB 1QSED 3NEOA 5AW9B 2GBUA 3FN0H 3ES6A 5H4YA 4MNGE 3ZHLA 5LBGA 4QRTA 3IDGA 2WXRA 4XXWC 3HIZA 4WI0A 5JIKA 4PV9A 3AXHA 2XPYA 1LGVA 1PGRB 1U8QA 4LRIA 1O7DC 4FLHA 3SDAD 1K8DA 1D7DA 2IANE 1T20B 2BY0A 3FO9A 5FB8A 3QDJE 3O6FA 4E9TA 5AWNL 1N3NB 2D7OA 4L1LA 5GRVL 2CRMA 1JPSL 1PZBA 2D7MA 5DJAA 4XGZA 1K2DA 3RTLA 5J6GB 4PTUB 3S4SG 1AXTL 2NY5C 3DJRA 25C8L 1HKLH 2YMXL 5DLLA 1BQLL 1OHQA 4K9EC 3FO1B 1S7SB 1A6TB 5D2NA 2PMZA 4AT6B 3TBCA 4IRZL 3VFSA 4OH2A 5CSBA 1MFNA 5D7LB 1A9BA 3BPOB 4L3CB 4FJ6A 1KTJA 3RTQD 1BFVH 2P5ED 2YK1H 1MN4A 2VQTA 2B2XH 2EDMA 1IEBA 4HXBH 5F21B 4XNUH 2EE9A 1SEBA 4KNTA 5EIVA 4B9FA 5KG9B 4P04A 4HUUB 5EPMA 1J8KA 3H4FA 3CE1A 3CFDB 4PQXA 4X99A 3WHXB 4WSGA 3HS0A 4PPTA 5D7KD 1A7BA 1FG9C 1H0DB 4QXTA 2BW4A 1GOHA 5KYWB 1CFTA 1IBGH 1PDKA 4KNQA 3AJ7A 2QTVA 1Q0YL 5A2LH 2WTPA 3SY6A 1Z2KA 1UYWH 5MENB 3ASWA 1GXEA 3GSNL 4EZJA 4JM2B 4DP6X 4G9FA 5T1JA 4ABQA 4CVXB 3OKOA 4MD0A 1QRKA 4UQCA 3P2BA 1K5NA 1ZLUH 1RZKH 5LN4A 4YC2C 3SJVD 1A02N 4YGAB 4WI0B 5E8OA 5BOJA 3R0NA 2BVEA 5DC4B 2W95A 1M42A 3V6OA 4QRTB 4TVSa 3BUYB 4MXQD 4A2LA 3T0ED 4AQ8C 2E75C 3KWTA 2RAMA 2WVVB 1HNGA 4OZFH 3GTNA 1CD0A 3NZHH 4JPKL 2I9LB 4NFCA 2BXZA 3SY0A 3ZYIA 4L2YA 3KYMB 3ZDWA 1Z9PA 3DUSA 4CVZA 2OMWB 5D55A 4JZNB 2FQGA 1J9CT 4O2CA 1S7RA 5F9JA 1LE9B 1O7DE 3GHBH 4Z7IA 4N2NA 5BMFL 2YD2A 4EUPB 1XGPB 3OHXC 5K1NA 5GIRB 3WMPA 2PTTA 4N25A 3TNNB 4DTGL 4ZUVA 4JDTL 3OLGA 2LFGA 5IMLB 3MRKA 2ZTBA 3DO7B 1EIBA 2VLLB 1BGXL 3BMVA 3GMRA 4LCCB 4PS7A 4OB5H 2NSQA 1QBAA 5BQ7A 2KI6A 1KB5L 1CGSH 3H0TA 3N3EA 1NCUA 1ZV9A 4PJCA 3L9BA 3UZEC 4NN6C 4BKLB 5LG1A 3UYPB 3R8BB 4HHWA 2YC1B 5H2BB 3BYYA 2YZ1A 1BQHA 1YYMH 5DT1L 2XXGA 2R7EB 1IO4C 3BEWB 3UJJH 2DKMA 1J8HD 3TV8A 2K9UA 4HJSA 2CSPA 2RACA 4J3OD 1Q4NX 2IWGA 3MV01 3B3IA 4HT1L 3Q8EA 1UXSB 3OKLA 3LKNA 3MRGA 2J1XA 3CFCL 5LBSH 4A63A 2HJFA 1SLWA 3PV6B 3HS8A 1J5HA 4HZAA 4OFVA 5DZJA 2BOCB 2RA1A 4RGMC 3TASA 3GBNH 3OAWA 3MRBB 5FW8A 2D3JA 2LU4A 2HKFL 2Y06L 4BEIA 4YBQC 2HLFD 1D5BB 3L3IB 5GHWH 1WFMA 2VJ0A 5A43C 1S6NA 4GFTB 3TH2T 1BYNA 5EHFA 4GXUN 3OAUH 4K55A 3NYKA 3JTTB 4NGHL 3BVWA 2XTLA 4MZ3A 2NY2C 4XVJL 1AFVL 1RVFH 4NXSA 4KKBC 1M2VA 1XEUA 4MNGA 5E7BA 4HULB 1CURA 1E6JL 3EGXB 3EKCA 5DHVB 1C1EL 2RD0A 4BYHA 1UWEH 3FCSA 3IRCA 4XPHL 3TBSA 3S34L 5IMMA 2GTZB 3TBVA 2C9XA 4GW1B 3PWUB 3WO4C 3VTAA 3C5JA 1M9SA 1MJUH 2AJUL 2DMCA 3KNBB 2QSQA 4ZMNA 1QUPA 5BV7L 2AW2A 1RIHL 1V55B 1NFDB 2CIIA 4AXWA 4I3RL 5LCVH 4M5YL 1XGUB 1BCIA 1G7QA 2BINA 5CCKL 5CIPA 3GSUB 3LAFA 4IBQA 3U6RA 2PR9A 4XMUA 3ZKXB 3GIZH 4YAQA 1P69B 1REIA 4OZGA 3GUFA 3ZDXB 2C9PA 5CS7A 1MFBL 5DGQA 1KCUH 4AQ1B 1G4MA 4S11A 2ESVE 2VDPL 4L8CB 5IVXE 5JXAH 2DH3A 1L5GA 4LVHC 4BH7B 1OSZB 1AKJB 3A21A 2WBWB 2Y1AA 2NQCA 1TT6A 3BIKA 4WK2B 1SBSH 1I8IB 1GGCH 4C4UA 3NJHA 1JI1A 4ZX5A 1ET8A 2VXQA 1QI5A 2B39A 9PCYA 43CAA 1FLTX 4HWUA 1CYGA 4P06A 1GS6X 4HXAH 3MV8E 4LL9A 3LHAA 3CBJB 1N7ML 1I1YA 1A7PH 1YNKH 4JN1L 1KIRA 2ZOOA 1OF2B 1JK9B 3Q2VA 4H2CA 1QI4A 4CC0A 5FFOA 1A4KB 3PJNA 4JN2B 4HIEA 3O6FB 5F7BA 3QDAA 3SDXA 4K5LA 4L8DA 4YFLF 2MNWA 5BRPA 4PIBA 4LASL 5D5MA 1XGQA 2IOIA 4FEMA 1NBQA 1R17A 3VGHA 3LKSB 1T0MA 2XG5B 5D2LE 2A99A 3G6JE 2A4ZA 1HZHL 2VDOH 2ZNWA 3ES6B 3LRSB 2CKBL 5CGYC 4KKLC 5LNGA 2YLHA 3T09A 3O2DH 3HPLA 4E36A 3BGMB 2YARA 1FNGB 4JO1L 4DFIA 1GGIL 3AU0A 4A7GA 1BBJA 3DUUB 3EH3B 2X10A 3PG2A 3WMQA 2KC0A 3IDYB 4LGPB 4MAUL 4P0DA 5I6NA 3RDTA 5DJ2A 5HYIA 1OGSA 4IBLT 4CGUB 1OWWA 2C3VB 2OJZL 4HJ0D 4A7SA 4F9PA 1JXKA 4KZDH 3MBEB 1P4LA 3PWPD 1RUAH 1XT5A 3HE6D 3KHOA 4EO5A 4KFMA 1RUPL 3IKKA 3GUTB 3BN9D 3SQBB 1E8XA 1KIUB 2JQZA 4OFYD 2V5SA 2VXUL 3NJNA 3RKDC 3RJOA 2WXJA 3EXJA 1WITA 2WZAA 4N0UE 3KS0H 1F3JA 2A6JB 4MAYD 1N5AA 3CZEA 4TUKL 4B9JA 2HFTA 4ZI8A 4KKAC 3RVVD 3BZDA 1QSEA 5LGJB 1ECZA 3BH9A 1D5MB 2DQ6A 2OX5B 4X0KA 5AOZA 2G75B 4ONGL 3U7YL 1P84K 3P9MA 4BFBD 5INDB 3VXPB 4MWFA 4JL1A 4LEEA 1QSFE 3T4AA 3KL5A 1O5DT 4MCYA 1L9SA 2BDNL 2BPBA 2VDLH 1RJCA 4V33A 2Q0ZX 3D18B 5IVNA 3VVWA 1KCVH 4DVBB 1NAKH 3JV4B 2IC2A 1MRDH 4QTFA 3WS6A 4BH8B 3LDBC 4ALAL 4Q8BA 1WZAA 1ACXA 4JFFB 1RSFA 2F5BH 4ZUSB 4Z1PA 5HJ3A 1UXWB 5FA3B 2DQIL 4P23C 1VF5C 4JKPH 4KHTL 1WT5A 5IG7A 2MPVA 2AJSH 3VXMA 2VLLA 3KJ4B 3EFOA 3WEXA 4ZAKA 4EVNB 2X70A 4J6RL 2EDNA 3EJYC 5FO2A 3MXVH 1F1DA 2Y1VA 3GBML 2AEQL 3SEPA 3TIEA 5DMKB 4XPHH 2ZUXA 1T7ZA 4N2BA 5DYOB 5KVDL 2NY7L 1MHCA 3UZVB 5KN5A 4PLNC 4AL8C 4KZ0A 1MCBA 2AERT 4DP4X 1CE6A 3L3GA 4XXCA 4XNYL 2AXFA 4P2RB 4C58B 1KB5A 4JY6A 4YXKH 3HG0A 3GD1C 2IPKB 2Q86B 1F3DJ 4ZOAA 1FYTD 1QSFD 1S7VA 2EDHA 2X9YA 4L3FA 3RA7L 2XQ0A 3V4PH 3GSWB 1OD9A 3DDGA 4PJEF 2ICEA 3KPLA 2FGWH 3GXPA 3SBPA 2I07A 4KRPB 3HRPA 2P80A 2E7CA 2L7EA 4ANUA 4X7EC 1FZJA 3VDCA 1JFQL 5SX4H 3CFIC 1SFHA 2CJTA 4M3KB 1MHPH 1NCJA 5IUCA 4OLXH 5KOMC 1OTSC 3QIWD 5KVGE 3MJ9L 4HWZB 2YD4A 4NO2A 3KAAA 1JGDA 2BXYA 1R47A 1DFXA 4ODTL 3LKQA 1ZPUA 1ID2A 4V1DA 1FZMA 4NO2B 3MYJA 4B6ZA 2Q7YA 1G7MB 3AMLA 1BVLA 1FNSL 4Z3GA 4KZCA 1BXXA 4HC1A 1FFTB 5FYLD 2UZXA 2AEWA 4K7PH 2BVQA 3IF1A 4XP9L 2EYTB 3EFFA 3VRLE 5F7UA 1H5BB 3ECVA 1VGKB 4WWPA 1E5YA 4ZAKC 3S4SA 2CM6A 3T2NH 4CW1B 3RVUC 3QXWA 1FZJB 2MQGA 5DMGD 5GRUH 3RWDA 1O0VA 3QO0A 3V5HA 4JDTH 4BRJA 4AJWA 2D7TH 4HUMB 1XF1A 3OKMA 3QJZA 5J1AA 1QSEE 4Y4KB 1QHQA 1X9LA 5I1DA 5AG8A 1Z66A 4YHKH 3UBFA 1MDAA 5FPIA 1UZGA 2QQNH 3NACH 4KY1L 5SV4A 1BLIA 3BAEH 1FNEA 1S5IH 1AR1B 1YYML 1WAAE 5IQ7L 3GT6A 1S3RA 3LQZA 3SDAA 4AMWA 1F4HA 4UOW0 3BMWA 1EA9C 3DVIA 5ETUA 3LQAH 4A7QA 4PJ5B 1OOWA 5I0YA 1ZPLA 3ZHDA 1GGIH 2EJ1A 2N1KA 4FKEA 1FFPB 4D9RD 1CO1A 2GB2A 3L16A 4WJ5B 3OAYH 2CJUH 3QDMA 1CICA 1WG3A 2HG5A 1F1AA 3TBYB 4LL4A 4FFWD 4MD4A 3OJDA 4POZD 3W9EB 3X3GH 5DI8A 4JNXA 1PU0A 2BM3A 2VDQB 4R5XA 3GJEA 4Y16C 5GHWL 2X87A 2VW4A 3O2WH 4D9LL 5IB2B 2Q7NA 5KSBE 2RR3A 3FCGA 4ZUSA 1LXMA 2X12A 3OC5A 3SGDI 5JHAA 1E27B 2EO7A 4NJ9H 1FGVL 1MREH 4HLEA 4F80A 5C71A 2BVQB 3IF1B 4HSAC 1E6JH 4GUPA 1ZLSL 3KVQA 1RUMH 5L7XH 2MFNA 4MJJA 4WFEE 1FZMB 4XOEA 4NHCH 2QSVA 4Z23A 2JKIS 3OB0K 2XN9D 4M6OL 3W2DH 5C0NC 5EDSA 3HC4H 1IC0A 2FZ3A 1EUUA 2Y36L 5ERWB 3Q2LA 1D5MA 2OX5A 2LR4A 2AI0L 3IU4H 4G3YL 4X0KB 2P3YA 1BWWA 5CU5A 1IBHA 4LMQE 4ZTPL 3RX7A 2OL3B 3M7OA 3UC0H 3F12A 4BZ2L 4OD3H 2WKOA 3LS4L 4X8GA 1XL6A 4PI2A 1J05B 3TO2A 3VGGA 1L7IL 4N2FA 4TVUA 4HQQL 4H5SB 3FCBA 5DUBA 1NKRA 4D8PB 5I1HL 1BM3L 1ZVNA 4A04A 1CS6A 5FUCE 3KPLB 2BNQA 1PQZA 1F56A 1W72A 1V3MA 2UXTA 5CZVL 3QDJA 2C9SA 3PHSA 1KBVA 4LDOB 1JF1B 1N64L 2N56A 3IGFA 4FLQA 2DL9A 2JIXB 4PJAB 4TSAL 2ZCKH 2JKWA 4KHXH 3TO4D 5B39G 4CDHA 3C08H 1YMMD 3HMWL 3OZKA 5IK3B 5LDUA 1DLFL 1XB8A 2DTSA 3EBGA 1ZLVK 1CI3M 1T1WB 5J56B 1MHEA 4DTGH 1TQBB 5ILTH 4L4VB 1EXUB 1U3HA 3PIQA 4P3CH 4AG4L 1FGNH 5DMKA 1BGXH 5C97A 3HKFA 2WLKA 2BIPA 2GKIA 3TA3D 2XXCB 1NIDA 4KMTH 3VB8A 3LKSA 3QHZH 4QYOB 3VXMB 4UTBA 5LAXB 3IJSB 1ZJBA 4U2YA 5ENWA 1I7RB 4YJZL 1UURA 4B41A 5I6XB 3O0LA 3ZZQA 4ZTOH 1I8KB 4W6YB 4Z7VB 3EYVA 4N8PA 3M45A 1ZTXL 2WSDA 4U6XA 1FJ1B 3DHMA 5I1AA 5JTWA 3PP4H 4X5XB 4F9LC 1VGEH 3HRZC 1GCFA 1NWPA 3EJYD 1O6SB 1DSFL 1M1SA 2C5DC 3ZSSA 4XNDA 4MDIB 5BVPL 5DUMH 5T8IA 3ILDA 3L1GA 5MP6L 4G8IA 2EO1A 3G5VA 1JXDA 1XF5A 2H32H 5ABDE 4X9YA 1PS3A 2A74B 1AQDB 2X7LB 2EUXA 2WWKT 1B4TA 3BH9B 4U1GC 4YNYA 1CGUA 3KGTA 1OP3H 1JF6A 3PWPA 1FAIL 3EHBD 4BGLA 3WFHA 3GI8H 3B3BA 4IGBB 2VJXA 1F41A 3NN8A 2DYPD 3F65A 2QQLL 1W16A 2FQEA 4XBGB 4Q9QH 2GUYA 3WENA 1AC6A 1FL3A 1MCOL 2NMSA 1M7IB 4PRHE 2BVUA 5AOLA 1PJWA 5FUCC 2HT3D 2BMKA 1RFDL 4W9GC 4DGUA 2Q6WA 3JV0A 2X6MA 3MBEA 1UB5A 4MNQA 4K4KA 3ARVA 2IAMA 4NQDB 2IDQA 2XJLA 5AQ0A 4LAQL 3WJJC 1OL0A 2JJVA 1BQKA 5E56A 1KYAA 1TZOA 5IQ7H 4QY8A 1E6OL 3FB6A 3S88L 3FXIC 4MCZA 5FLVA 3GHEL 3LPOA 2YOAA 2NTFB 5GS1A 3LX9A 3C09C 4GI8A 1O75A 3MLTA 2JH2A 1THAA 2DQTH 5F7KC 1DTUA 5JLZB 4ODXB 4X8CA 3MRRA 4X6BB 5DRXA 3RIFK 3U6XS 3ZKND 2L3BA 2MKWA 3T77B 2XTJD 5FR3A 1A65A 3HI6H 2BHFA 2NY0C 5JDSA 1KULA 1PLGH 2DQIH 5CN1A 2FO1A 2C1OB 2B7DT 2R9HD 1FGVH 1MREL 2F53E 1S9XA 5A7EA 3T4YA 5E8DH 3A3YB 3VXSE 4Y9EA 3PXJA 2NNCA 3PRZA 3PNWA 2A6DA 4PRPE 1NQBA 5BPPA 2R0LH 2O5NA 5HHMB 4X6CB 2ALWA 1S4IA 5DD0L 5IW6B 2XWCA 5ISZA 4MJ6A 3QEHB 3US9A 1KV7A 1HZKA 1CE1L 1I1AA 1TG8A 1S3KH 2BWIA 4F27A 5C70A 3PREA 3LEVL 1IIKA 2FIKA 3ULSA 1HCZA 2OMXB 2GUOB 4JRXA 4NPYA 5JIPA 2VDOB 4CGTA 1U8LA 5EUKB 2O5ZH 4JFPB 2EIKB 2JELL 2FE0A 5GSVB 5IMLA 2WGNB 4WW2C 3DO7A 3MR9B 5EV7A 2IAND 2FJUB 4XZUB 1UD8A 4QHNA 4KDTA 2AJVH 5T5FA 2PO6B 3BPLB 1U8PB 5CSZA 1HE7A 4Y9BA 1E9PA 1J0HA 2OV0A 3OXSB 4TSAH 1LE9A 3OLIA 1WK0A 5HPMA 3VFRB 5C0ND 2YAOA 2PKDA 4KVNL 4S1QH 2BP0A 1ZANL 3EFDH 1ZT4A 3ZX1A 4FTVD 4Z7VF 3EG9A 3VFTB 1JGLH 2J1ZA 1YEHH 3LNGA 1U4EA 4P3CL 1EGJL 1PJ9A 1BVNT 4H0IA 4M9OA 1Y6KR 1FRGL 3HG3A 2IFGA 5J11C 4YDJA 3FQRB 4KKQA 1LQSR 1IGJB 4G6AD 4O02L 1KJVB 4UQBA 3MZTA 3FN3A 3QFJE 5D2NC 3ILQC 1H9DA 4ODHH 4E5XA 1DUZA 4L48A 4UV4L 3TBWB 1GGBL 3UG4A 5I8CA 3DVNA 3ARWA 1YEKL 2BDNH 2AC0A 2E3VA 4YGVB 3UMNA 3CK0L 3ZSTA 5I18L 4NUGH 3FH7A 3G6JF 2YD9A 1RZIA 4KY1H 3GZKA 4ZDHA 4HIEB 3CFDA 1U42A 5AKVA 5T5FH 2P8MB 2Y5TA 4OCMC 1FG2A 3LQAL 4FP8L 1VPOH 1EEZA 4IHOB 1JYXA 2AQPA 5E2WH 2D0GA 4JKPL 1EHAA 2R7EA 3PWNA 3EH4B 5AVTB 1EPFA 5AKSA 5DURB 2ED7A 4OGAC 4X9BA 4YLBA 4M7KH 1UGKA 2CLRB 2AZUA 2WXNA 2BSTA 3QH3A 2HRLA 3V0JA 2YAFA 3DTXA 2ZKXA 3GBMH 1XVSA 3RIKA 5J6GA 3VU1A 3JUYA 3M07A 4ZOBA 3TTYA 3TCXA 3WS3B 3L8QA 3JWOC 5C3LD 4G71B 1XSIA 4OT1H 3VQ1C 5AVQB 1SVBA 4PJDA 1XGZA 3WUWG 1S7RB 1SOSA 5C0CE 4ZXBB 4RZCB 5F9JB 3ULVD 1COBA 4FXGC 4IRSB 4APXB 4NKOB 2H2PD 2OMWA 4BWUA 2VR6A 2X88A 4OF5A 4ONFH 3U6RB 5CEYB 3UEZA 1HE8A 2FBJL 1G7QB 3TVMD 3E8VA 2HX8A 4FQ2L 1Q9KA 1UACH 4ZFGH 4AKOA 5TPWH 3C5ZA 1MHPL 3HB3D 4FS0A 4M61A 4BZYA 1SUHA 2DPKA 2NQ3A 1WEJH 5AOIA 2EQDA 5IJBC 3C5JB 4OW6A 4WO4B 3QCTL 1IC7H 1B0WA 2VXQL 2B59A 4R4ND 3ULVL 3SKUD 4CVXA 4HPHA 1J0IA 3L4WA 4X0NA 3FCTB 4MCMA 3T2LA 1FE8L 2YPLE 5DFVD 5F7LB 1I9IL 2EVHA 2LABA 5CKAA 4QHLB 1XF3A 2DQJH 3V0WH 3QZWB 3S6CA 1KXQE 3ZVVA 2LLLA 2CLVA 4LK4A 2BOBA 2VMEA 1CDYA 2Z91A 5AOJA 1JD9A 4RAVB 3KCPA 5J9PB 1VCBC 5IQMA 4UQ3B 3L81A 3GBEA 3QIBC 1RJZB 4NS0A 4JFZL 3VD7A 3IGAA 1QHOA 2D7TL 3S98A 2Y24A 3QO1B 4L0ZA 1OOAA 4DF9A 4L4JA 2BSTB 3QH3B 4WFGD 2VQ4A 1A6TA 1KJMB 1WAEA 1J86A 3NACL 4ZUTB 2EE0A 1G7PA 3IPEA 1BVKB 5E08H 1Z9OA 4J39A 2NZIA 4QEGA 3I9AA 5K1JA 3LXCA 4KAQH 3MZGB 5K9QG 3IGLA 5JHDB 5C6PB 2VRQA 4TSBH 1XR8B 2I25N 2OMZB 4Z7WB 3C60D 5IFAL 5FK9B 4MMXB 4HC1L 3N42F 1U8QB 2R56L 1MFEL 5J1SC 2ZCLH 5D1XE 4B9YA 5AFAA 3MRIA 4P2QB 4F2ME 4G7YL 5AYUL 1BJ1H 1KENL 3VGBA 4QRPB 5CCGE 4Z77B 2P5WD 1X3DA 3BPOC 3JV6A 2Z1PA 3DMMA 1TEGA 4PJXB 3TEZA 3LH8A 4K3EH 5TE4L 4AQAA 4ZJ9A 3C60A 2WLIA 1NCAL 3P9WB 2MHAA 2OL3L 3VRLF 5IHZB 5F2FA 1B3JA 1DHKA 2Q3ZA 5DJDB 1IGTA 4HEME 3D9AL 2MQ0A 5JHDE 3VXRB 2IQAB 2HLAB 4NM8L 5DRZB 1ZLVH 3LIZL 3VE0A 3GMNA 3VQ2C 1MJ7H 4OJFL 4YSRA 4QHKI 4KO7A 1HEJC 1LYQA 3BUYA 2FL5B 5F9OL 2IDTA 2EE2A 4JJOA 4Y5VB 1QR1B 1WAAF 3KYKH 4GINA 3WKNA 4Y19A 2H1PH 2UX6A 1I3GL 3CFMA 5D6DC 3MO1A 3QXDB 4YE4H 1MJJA 3U0PA 2Y2TA 4H25A 4EDWL 4XZUA 1FVDB 2BRRH 4JAMB 1RK0B 2BSBA 4HPYH 3H2PA 1VPOL 1RPQA 1E4XI 1Y1DA 3M88A 4JFPA 4GI9A 3SHSA 3TT1H 4BKSC 2GUOA 4G7RB 3FPXA 4HHGA 3RVTD 3U9UA 1L6XA 2FX8H 3HHRB 1E5CA 1I1AB 3I9GL 3QUKA 3ZT5A 2B1HH 5IY5B 3WMSA 1GKEA 2XY2A 4I48A 3FSOA 2BZDA 4JR9L 5I8KL 3VFNB 2DQEL 3SZKC 3FUKA 3VFSB 4XXDA 4G6KL 1W0WA 2OR8A 3P30L 1DBJL 2A3TA 1ROCA 4PJHE 4QOKA 3KWUA 1WFIA 5I76A 2YSSB 1ZXQA 2YPKB 4LGSB 3N85H 4G7VH 1W8OA 2HT2D 4N1EA 2G5UA 3QEQE 4G43B 1KZQA 5B3JE 3SB3A 1PNDA 4ZMOA 3OD3A 4FXTA 5TDNA 6FABH 5CUSL 3JYCA 3PP4L 1T2QL 3ULVF 1TO5A 2H9GA 4AGQA 4DZBA 1IAOB 2WC7A 5FWQA 1CD9B 2YKKA 1UHVA 4G59C 3VWJA 4O58L 3O3BB 2BZ7A 2IADB 4OF0A 5GGRB 5HYEA 5I0ZA 4IBWA 4F7TA 1L0XA 4QRFA 1KN4H 2V4LA 5FCUL 3E2HC 1FE8H 4LRNL 1CTOA 2MTPA 3VWKA 2H6PB 1WUNT 3S3DB 3NSCA 5F97E 2UVEA 4BSVA 5DO2D 1JHLL 5HJBA 2Z8SA 4HKBB 1KLFA 4U1LB 2QKSA 4NQDD 1A22B 4AEIL 4Z3TA 1I8MB 2QQLH 3DGDA 4G6JL 3UG3A 2KUTA 1SJEA 3DK2A 2Y7LA 1XGYL 4LLAA 1YEHL 3SJVA 1QEWA 4IIQA 5F96L 3QDGD 3FTSA 1C5DA 2ADGA 4H8UA 5GJSL 4YE0A 3GRGA 4G9FE 5B7EA 2YIHA 1ID5I 2GY5A 5I16B 1QFHA 5E6IB 4HHAB 2ZOUA 1G9MC 3MODH 4JRYA 4PJXF 1FIGH 1BJ1J 1BQRA 1RK7A 2CDEA 5I74C 3W0WA 3CFTA 4PS3A 4BE5A 2X7LA 3FN0L 4APXA 1LD9A 4W9HC 1I1AC 1GIGL 2CJSA 3MLRH 1FH2A 2X2UA 1L9RA 2AQRA 2L4OA 2OMYB 3T65B 4MRBA 5CJQL 3QG6A 4LOUD 4E42B 4RMRA 4XCNB 1XFPA 1RHHB 3MACL 4HFWB 4UZGA 3TGXA 5F9AC 2W8CA 2D31A 2PNDA 4A6YB 5I1AB 5F7MC 1JE6A 1NCNA 4J2QA 3ARDC 2Q2LA 1JPSH 4NNXB 4PB0L 4TYUA 3ZXAC 4YFEA 3P3YA 1JPGA 2I7SA 3QCVL 1FFOB 2H5UA 5KVEE 3KPQB 1I7RA 3EBAA 4AMXA 5HI5C 2ZUQB 1ETJA 3LOWA 2EYSB 4ZBJA 5J06A 2J43A 2X3CA 3ZE1E 1KCRL 2VZUA 3WD5H 5EU4A 2WTOA 4C56A 2PCFA 3BYTA 2LU7A 1BFVL 1U92B 4YDIH 5TGBB 4APQC 2A83A 4JQVC 4L4VA 1IBDA 5LNEA 2XKNA 4RAHA 1MHEB 3GLAA 1ZSHA 3GNML 1TQTA 4TVPD 4JGUA 1C12B 1S3KL 3AQZA 3M7FB 3RWEA 3EOBA 1T03H 2JIXA 4GQ9H 1AR1C 3LS5H 3HCVA 3WFCH 2K3TA 1A6ZB 3MJ7A 1ODUA 3CVHH 3QPXH 2CCVA 3ZYOA 2Z93A 2O5ZL 5GS0D 2ESVB 2AVFA 3QIWA 1BG1A 2MOVA 2BNQB 3QWQB 4TUJA 4XH2B 4NP9A 1D5ZB 4K7PX 4CNIB 4X4YA 1U8MA 2R59A 3FUDA 5T1MA 5TDPB 4EE2A 3EDEA 1G9ML 4TXVB 5KYUA 4DP7X 3DBXB 4HZ1A 2YUWA 1NFAA 4NWUH 5DR5H 4G8AC 4F24A 5LKNA 3L3KA 1U8KA 3NCYS 2IH1A 3L5WB 3CN2A 3F12B 5DVLA 3L3HA 1LO2L 3SKMA 4XNQB 4ENZA 3NZHL 4EPSA 4PS4H 1RZJL 3DSNA 2MH4A 4IBUA 2XG4A 4KXZI 4JZOA 1FO0H 4JFHE 3S3CB 1N6QH 2C1PA 4XTRC 3TIDA 4BJLA 2GAZA 3GS7A 4LOVA 2OA9A 5E1AB 1UASA 4BHUI 1HJCA 1DN2A 4QUOA 3R0MA 4PP1D 1IGFH 2CKNA 4S0SD 4XBPA 2XFXA 3JWOL 5GSVA 2YN3A 5AD0A 5C07E 1A7NL 3K81A 3ARGD 3GSQB 2ICWB 2YA0A 4U6YB 3QA3B 2OMUA 3E3QC 5MEOB 2R0KL 1QFOA 2BZCA 2X4OA 4NUGL 3ZDYB 5EO1A 1OTUD 1FFNA 4MNHB 1ZY9A 3GTTA 3R06A 4JPVH 1SQMA 3IB4A 1OARH 5IW6A 3DO3A 1MI5B 3IFNH 5A16B 3TLRA 2IMMA 3L2LA 4D3CH 3HC0B 1U8IB 1RI8A 4FZEL 3QJHA 1F4YL 4NO3B 1MCQA 4NCC2 4Y5YA 1VFOA 1JHLH 4Z5RB 2UWEF 1QLFB 2HFFA 4OCSL 4N1HB 3MUUA 1MRFH 1KEMH 3UACA 3F7QA 1IL1A 3B5GA 5C9KA 5C7XL 5EOTB 5K5YA 1CR9L 1IT9L 4Z7VE 1ZEAL 3CXHK 3FT4A 1TVDA 3QJVB 3GO1H 4GOSA 3CIQA 3NAAH 4ZSOE 5HGHA 2C4FT 4W70A 4MMYA 5T1KB 2V7HA 2XBZA 4Q9CA 4PJFE 3U4EB 4GS7C 5AB2A 3QUHA 2AEOA 3EFFB 2H41A 5FM5M 3O41B 4PIRF 1TLKA 1SJHB 1BF8A 2FB4H 1N6VA 1EO8L 2FYYA 3NZSA 3OPUA 3U2SA 3U30B 4M02A 2Y3NA 5CLXA 5D8JH 5DSCB 1UADC 1ACCA 5JIIA 2EE3A 4R4FL 4FFYH 4WV1A 2VMCA 5D72L 5L2KD 3RLSA 3V9EA 1LE5B 1CGWA 1BIHA 1YY8B 1WRFA 2Z31B 1OLZA 3WS6C 3EGSB 3RDTD 3RU8H 4B7IA 3H3PH 4X4MA 3CN0A 1HNFA 1ICTA 4KWUA 3QUXB 4KX8A 4P8QA 5CJQH 2G9KA 3Q48A 1V8HA 4U0QB 4N0FB 4QRRA 5CEXA 3QUXA 3K8MA 5LHDA 4XP6H 3QP3A 3DI3B 3TYGL 2LV4A 1GMIA 4PW9A 3Q8CA 2LQRA 4LDEB 7PAZA 5T3XD 3F00A 2GYSA 4H0LC 1R5WA 5FO8B 5IQ9B 3HUJA 1NOAA 2A9AA 3TT1L 1PLBA 3QPQC 4D0CB 3JWDC 4UDTA 2YAQA 2CLZA 5HI3D 4YHOH 3V7MA 1DANU 1UD3A 1ZLDA 2HUEA 4M8VA 5HHPA 2J6EL 3AQDA 3B5HA 3DGCR 3DXAE 2MEJB 2IPUK 4MRCA 2XV3A 2XJKA 4MMYB 4XCCL 3VD4A 1NEZG 1NMCB 1X5FA 2OYLA 4P46A 5ICXA 5EEUA 1UC6A 1RIUH 1NGXA 1L9NA 1IVLA 4YUEL 3M17A 5HD8D 12E8H 4LLVB 2HJKB 2XXMB 1TTCA 2J8UE 3LS5L 1Z5LB 2HRPL 3LEYH 3X17A 1X5MA 3IK2A 4R7VA 3MA7B 3L4XA 4ZX4A 4QKXB 4PB9L 4XMXA 4MXVF 4ZUWA 1H6TA 4G7VL 4HJGA 1F3RB 3QNYA 4R84A 5HJ3B 2XA3A 4LPYA 3LVTA 2CO3A 1IQDB 3TYFB 4ADIA 1R46A 2MKLC 4JFFD 3DROA 4M1GH 4NIYE 5E6YA 4UYQA 1YMHB 3FFCB 5FW7A 4MNHA 4CKVX 2LVCA 5I6OA 1WO2A 4YHML 2DKUA 1LEGA 5LVEA 4OLXL 2H3KA 1GAFL 4RNRB 1JCKA 3PIQB 1XXDC 3MJ9H 5E9DB 4YFDB 1JGIA 4U4IA 1KENH 2FHCA 4L8SC 1ZGLA 4BINA 3TNMB 2AQNA 5DQJB 4ODTH 4MWFB 1MVUB 1RURL 4ZZKA 2BCKB 3QE5A 2BVYA 2QGCA 2B16A 3RUGA 4OI9A 3ZDYF 2IGLA 1QKZH 4FX5A 5AW6B 2WPGA 2AK4B 1FNSH 1WLHA 3HN3A 2EVJA 3HNTH 5F93C 2ZUWA 1VKXA 3BZFA 3LEXA 2C1PB 3TIDB 1ACZA 3FN9A 2Y7QA 2C7UB 3UCRA 3MLXL 4AC2A 4Z9KB 1KIPA 3NIFF 5JOEA 1U30A 1W72L 2GVYA 3P1VA 4M3JA 5GJSH 4BSWA 2W80C 3AM8A 3L95A 1VZHA 1AMXA 4IDJH 4CADA 1WBZB 5SWZD 4DGVH 2YPLD 1Q0XH 4BFFA 2PP9A 1OAYL 4YE4L 2KPWA 1G84A 3G5XB 3MODL 4PRNB 4WHYH 2EKSB 2EAEA 3U7YH 1E9OB 5HXMA 5ANHA 3C8HA 3PQYB 5EEWA 1Q94B 3FO2B 3L1EA 4CMMA 2OTPA 2E8YA 5EO9A 2WB1A 3DETD 4JE0A 2CJUL 4PJGB 2UV3A 2ZYHA 2BJML 1IC4L 5E8NA 2J5LB 3LSOA 1IGCH 3NABH 4ZW3A 1Z7JA 5HYSB 4ALAH 4X7SH 4BA8A 4J28A 4DOHE 2VDRH 4FXLA 3UYRL 4JN2A 4PB0H 4OZFB 5HYJD 2DQEH 1L9QA 2FT7A 4L05A 3S8FB 2MOQA 3MGAA 1YPZB 5FCSH 5J7CC 3ME0A 4KK9D 4G1MA 5JIMA 3QGVA 4XNMA 4IBVA 2I5YL 5KBKA 4XO9A 1JMXA 2NXYC 3OSKA 4KOBA 4PJ6A 43CAB 5KS9B 4PJ7A 5DD6A 2CDFB 1QQDB 2VLJE 1JPGB 4G2AA 2KS0A 4K2UH 3B9EA 5GZOD 2X4QB 2BIHA 4YVUA 4Z3HA 3B9AA 3S37H 3B2VH 1ZTMA 4FQXA 2GW5A 1INEH 5F7NC 4ILDA 1KPVA 3IJHB 4XNYH 1LEKB 4ZXBC 2YOCA 4YXKL 3RFRA 5ADOH 4HJEA 3FW6A 2OMUB 1PW3A 1BW8A 1ETB1 1YEJH 4GRMB 4JHAH 4KX9A 3H9HB 1KN4L 2HVJB 3JVGC 1EFQA 1SM3H 2V5YA 3LZQA 4M8QA 4WHCA 5DJCA 3LN5B 4H44C 4QXGL 2OQJB 4YSAA 1CQKA 3ZJAA 5PAZA 3PQYE 4LMQI 1RUQL 5DUPL 5HHOE 5D7EA 4OVUA 3RB7A 2B14A 1I8LC 3EYSH 4JO4H 4W81A 1I9JH 4CJ0A 5B8CA 4FTVB 3MYZA 4LPUA 2CQVA 5KSAA 4IOIA 3ZE2F 4GG6B 2CBTA 3DSNB 1I85C 3OL2A 2VLME 1AD9A 3FULA 5BZWB 3AUWB 1QVOA 2NCMA 5CFAA 2NY6D 4E0RA 4J3VA 4DGYH 3L5WA 1MCSA 3OLDA 4KTEL 3L3KB 4DK3A 3A47A 5IOPA 1RIVH 2EACA 4A6YL 1NGQL 4K7FB 3QQ9C 5B3JF 4FNTA 4I89A 2D3LA 5B7FA 3I2CH 4NO0B 1R9FA 3WEAA 3ULVE 1LO5A 2NY4D 3ZZ1A 1DQJB 4Y4FA 2D73A 3SDYH 1XTMA 4GG6E 3CFNA 3PHOA 5JQ6L 3EOBB 3NP3A 3Q01A 4KTYA 5FM4A 1V7NH 2Q7AA 2YD0A 4XNXH 4I3SL 1CDIA 3HG1A 3HC0A 3HUJE 3MBWB 3VYNA 1QWNA 3TA3A 1EEYA 4PRHB 5CILH 4G7QB 2F9BT 3ZK0A 4M62H 4JFDA 2EXWD 1C5CH 5D7LD 3B7SA 1OB0A 4PJ8B 2X4OB 3FH8A 3RUGF 2FH8A 1CFBA 4GMTL 1ZJAA 5IG7B 1FFOA 1JUFA 2PO6C 4HIPA 1J1OL 4RMSA 5DFTA 1OGTB 3HFMH 1BQHG 1YYLL 3UH8A 5LGKA 1MFCL 4NCDA 4PTTB 1A1MB 3DVGB 1H6UA 4I48B 2PTTB 4PD4K 2K4AA 3TH4T 1ZV2A 2X40A 1A9VA 3LXBA 1BZQK 4OUUB 1P4UA 4NN5C 4HCRH 4PJGF 2ODIA 1NZRA 5EFIB 5DC2A 3GPSA 1J1XH 4IDJL 4POUB 2YPVA 3DRTB 4PJXE 4U1IA 4HBQA 3SBQA 1B3IA 4JDZB 5I0VA 2YXFA 3PAYA 5A1AA 3PU7A 4K3JH 2F53B 1CF1A 4I85A 2DQGH 2VDKH 1ZV5A 1SLUA 5FX3A 1YEFH 3TPKA 4JJ5A 3R19A 4JFSA 1MHHA 4E41E 1R1CA 5E6IA 1K3IA 4D8OA 2CALA 3RL1A 5KYUB 4ANVA 1MCPH 5BS0A 4RWYH 1JXFA 3T3MB 2UYLA 1QEWB 1INQA 1XB3A 4OGYL 5IQLA 5FO7A 3EJTA 3U36B 1Z9LA 3NSFA 2C9QA 1FV1B 1ES0B 1N8OE 2Z93B 1QLRB 3WIIL 3DXAB 3B6SB 3ECBA 5T3ZH 3WUWA 3ZE1F 3FMGH 4UUJA 3WHE0 1KLFB 4FXKC 4OM0L 1UJTA 4PJBE 1R3KA 3CDFA 2BHZA 1TYRA 5B1KA 1VFUA 5KVGH 2VZSA 4N24A 3HN5A 1OSYA 4I9WE 5ESVA 1S9WA 2VE6A 3W9DB 4HUUA 4M93B 3FQUA 3V6FA 2H0PA 1UOWA 4YHLL 4Y2DC 3WNPA 3U7AA 3QIUB 2VKWA 3QDMD 3ARFD 1T5WB 4UQAA 1FGNL 2X3AA 3BP4A 5EIIG 1SOKA 1TVBA 3NTCH 3VI4F 1VENA 5M7QA 3I6LD 3RWFA 3LEVH 2GITA 2ZX5A 1O9VA 4P5TD 2F2HA 3HZKA 5GXBB 2IH3A 3VD2A 3WI9A 2HT4D 1UYWL 2C26A 2YKLH 4JM0A 4BFIA 3QIUC 4FXGB 2K7QA 4IRSC 2YPKA 2CO1A 4A2EA 1SVCP 5DJAB 2NDGA 4P4RB 3D0VA 5C07D 4HWEL 3MNMA 3QG6B 1SUJA 4JQIL 4XMPL 4ODVL 3N5AA 3FO9B 4GKSB 3QIBA 1MLBB 3CNKA 3IMRA 2CBOA 2X4TB 1I8IA 3EUDA 3EH2A 4OLVH 5AENA 4XPBH 3W0WB 1AKJD 1ZANH 4P4KA 4LSDA 1LWRA 1XCTB 4KQ4L 3TFKC 1KLUB 2AHIA 3WTVA 2D4FA 3U7WL 4I1RA 4OV5B 5MEQB 1WT5C 4YO0B 2VUYA 3BAYA 3OMZA 4WSKA 3OJ2C 1N70A 5DZLA 5CJXA 1GTFA 1LP9A 1OT4A 4L8BB 4NP4H 3GI8L 3S3SA 4WKZA 3O6LL 3WXVH 2OSLA 3NH7L 3CDGB 3E6HA 1PIGA 1S9VA 1S7WB 1Q38A 3QZLA 4U2ZA 3SKNA 1BIIB 3P2DA 1VJSA 3FCTA 4UV4H 2ZCZA 4A1RA 1SYSA 2WZ0A 1DVUA 3ABGA 3GGWB 3O2VH 4LLMB 4PMFA 3TJHC 4GKZA 4GPVA 4HKBA 1KB5H 2FWSA 2ATKB 2ITCA 5E2VL 5CEZD 3X1GA 3REWA 2DRUA 4LAQH 2P5WE 1HILB 1VADA 4NM4H 3LPWA 3O4LE 4KXCA 4S1SH 4YSPA 2DI7A 2C9RA 1P2CB 2PYEB 4ZNEE 1PD6A 4DEUA 3N44F 4DN4H 5DMGC 4Z7AA 4W6XB 3CD4A 3VNYA 3BKYL 3K6NA 1EXGA 4BZ2A 4OLZL 3NEEA 3OBAA 1NDMA 1P5VB 2XWBB 4U1NB 4UZUA 3TZVD 4M7KL 1EMTL 4HMEA 2VCOA 3LXAA 1TTGA 1WQVT 2ZIDA 2VDRL 3UROR 4BELD 1FNHA 3PF2A 1B0GB 4O4YL 2ARWA 4XVTH 2EIZA 4Y4FD 3W0WE 3X1BA 5LGHH 1HK6A 3RURA 1AYRA 3NQKA 5IJVB 2PPEA 4ZW5A 3NUKA 1DUYB 1OB1A 1OGAB 2XFGB 7TAAA 2CLRA 3DV4A 4Q89A 3E6FB 1QA9A 12E8L 4YUEH 4AYFB 5EZIL 1VHPA 1DUYA 1OB1B 1OGAA 4N8CL 1ERNA 1OT2A 4QF1B 3J07A 1WPCA 3T1FB 2VLJA 3RGHA 1SJMA 1Q0YH 1JNHA 4AGMA 3KYOA 3QDGE 3S5ZA 3FSAA 3GXNA 1BAWA 2C9UA 4JFEE 1D6EB 2KYIA 4W1TA 4Z7NB 2JCCF 3O3UN 4U1NA 2CPCA 3CSPA 3V4PA 3I74A 5I1KH 2UVFA 2JTDA 4UM8B 1A25A 5TH2A 2WP3T 5BV7H 1JI2A 1EDQA 3NJGA 3T04D 1OAQL 1M71A 4TRPH 2D03L 2VXVL 4GKZB 4X4ZA 1PIFA 1LTXA 3Q2CA 4ZX3A 3T0AA 4WFED 3RPKA 2QSTA 3TOPA 4E5XB 1XZ0B 1MNUL 2IDSA 1E40A 4EXKA 3N50A 4XP4L 2YZ8A 3ZUCA 4OFYA 2VM9A 4ZK8A 2JJTC 2OBGA 2IALA 4JZNA 4AV0A 4IBTA 4BFGA 2Z6FA 3CH1A 4XZ4A 2X89A 3FT3A 4MX7B 3HUJB 4YSQA 1U33A 4GY4A 3E6HB 2QVIA 4MNQE 5GS0L 1KLUA 2HRGA 1U8CA 2YD7A 2ZZUT 4P4KC 2ITDB 3C6LC 1Z32X 3RJQB 1MY7A 2XRAH 4W9CC 3W56A 5IHZA 3BWZA 3OXSA 1J12A 1LP9B 4L8BA 2NSXA 4YDLB 3BSZH 5IM7B 3QCUL 1HX0A 1TZAA 3KWVA 4FYRA 4MXVE 3VXUE 1HHHA 4J7RA 1PZAA 3UTQA 1HEZB 3X3FL 4L9LA 5E1IA 1HJBC 3S3JA 1BBDH 2XIIA 4PGZA 1CL7H 3WL9B 3CFEA 3O4OC 4N6RA 2Z31A 4J3WA 4P2QA 4KK8D 1OGPA 5I8OL 2GEQA 4Z8FH 1CFTB 1PDKB 4NNPH 4X9HA 3DJTA 4N3TA 3STZA 2DBJA 4K9EH 3U2SB 4PWKA 4TNEA 4YDNA 3PHAA 5F7EL 4YDZA 4AVHA 3ZKXC 3QHFH 2P8PB 5L2JB 3KJ4C 3AGWA 3WDJA 2HLFC 1VRSA 1KF9B 2P5EB 4IIZA 4NHUB 1PMYA 4BFIB 4YH6A 3SODB 2FX9L 4DW2H 3QISA 3U7WH 2E9BA 2VDNB 3VFGL 3UTSE 4RFNC 5HYJB 4M00A 3OHXA 5HYQA 4LHUG 4RMBA 4XT1C 5C0BB 4O51B 4YPGB 4NT6A 5CP3A 3T0WA 2HT4C 2SODB 1IUZA 2G4GA 1EBAA 3WGUB 2XX0A 5GRJH 4EZLA 1EX0A 3CFKB 4HLZG 5I0XA 3DMMD 5HHVL 4QLWA 2KDGA 3AC0A 3EIFA 1BEXA 1NINA 4HLJA 4PW3A 4RDQF 4RMVA 1IGYA 2BOBB 2G0LA 1NBCA 2P42B 1YEIL 4TULL 4X7TA 2HN7A 3NRQA 1RULH 4PSRA 5F3BA 1SXZA 1EAOA 2QEJA 4UOW1 5IBUB 3ZZSA 5DJ0A 4DP0X 2R69L 2EKJA 3VX1A 4TTDC 4DPCX 1DJYA 2BNRA 1XMEB 3QR1A 4HIXL 2CUIA 4JRXD 3HNVL 4PJIB 3MNVA 3AM8C 4UMSA 4WO4A 5AD0B 1UOKA 4ESKA 1AQHA 3JWDH 3Q43A 3D3VE 3F58L 4JGJA 4PRNA 3BKYH 4N86A 4Q0XL 3AQYA 1QFWI 4UV7L 2GC4C 3HVNA 3I9GH 3GMPA 3MRQB 3NRFA 2H3NA 1WFNA 5IJDC 2PPFA 1JZGA 3E9TA 4OCXH 2QFRA 4RFOL 3V7AG 1N67A 2WXPA 3NJKA 4O4YH 5FOBB 2RHEA 4XAWL 4F5CA 1LO0L 2VLMD 5JNYB 3IAPA 4G9DA 2H3NB 1NLDL 3DX7B 3FMGL 1EZVY 3G6DL 4YHPB 3QWRD 3Q3GB 1NUDA 2NNRA 3IFLH 3KM2A 4GAYB 1WCQA 4YLQT 3NIDB 5IWLA 4YXHL 1HXYB 4MNQD 1KTBA 4N0YH 3UO1H 1MG2C 3ZBMA 3RVXC 3KDMA 4JG9A 3PJLA 4U1HB 1G9HA 5KVGL 2DWDA 3DBXA 4U1MB 1HWHB 3H54A 3UAEA 4ONHB 5EUKA 4JHZA 1FIEA 2IFFH 1OP3K 3Q9PA 4C83A 3VXUA 2FAUA 4J23A 2XVLA 3TZVA 4I18B 3MJ7B 2UZIH 2BW5A 4QRPD 3X14B 4S0TD 2YD8A 3UBXA 4LLWA 4UT9L 5D70H 4N2OA 1F4AA 4M43H 4O58H 2HN7B 1J88A 5JO5B 3GZQA 4KV5E 4X4XA 5HHME 1CLZL 4TNVF 2GBAA 1NTDA 4Y2OA 4TSBL 2WBJC 4U6HB 1OGAD 2OTUB 3J8F7 5E94B 1DEEB 1LP9F 4N3UA 5DVKA 4JQIH 4XMPH 3HZYB 2DM4A 3FUMA 1Z5LA 1F2XK 5DDHB 4Y4FB 4M7ZC 1E67A 1RSYA 3CXFA 4DQOL 3F6IA 3FYIB 3O3AA 1GCYA 3QWOB 2HLEB 4GIPD 3D52A 3SPVA 5HVWA 3EYFB 5AUMA 2DWEA 2GK0A 1UVQA 2XA8L 4AQ1C 4JQVA 3DGGB 5T1LA 1A1NB 5D1QC 1MVYA 1M6OB 5DJYB 4FQXD 3T9WA 4IOIB 1WBXA 3BVVA 4LCWA 5HGGS 3ZDZB 1ZSDA 2F19H 2G3ZA 5EORH 3SYCA 5I0DA 5KVFL 4R4BA 2ZJSL 4PCYA 2NY6B 4NNYB 2OTWB 2UXGA 3WXVL 4BHUA 4TSCH 2WJ7A 3T2NL 2XQYA 3Q1SL 3P3SA 2WQWA 1NM4A 3QHTC 4H1LH 2VN5A 4KKCC 2FHBA 2GJRA 4LLDB 2PETA 1ZD6A 4MVBC 3K6IA 4FKKA 1SDDA 3N6YA 3ZRCC 2KZWA 2QLYA 4JRYB 1HH6B 1J05A 2E4TA 4L4TB 4ZFFB 4YHKL 1OAKL 1U4FA 2YD5A 2NDFA 4UQ2A 3TL5A 4TNWK 3HC3L 1MRDL 1MY5A 2X9XA 1UGNA 3ROOA 3X11A 1E28A 3GIZL 4ZPVB 3RUGE 4DN4L 4AV4A 3A4AA 1SJEB 4MX7A 4IKJA 2Q8BL 4NOFA 4I0PD 3L6FA 3EYUH 3I3EA 5JW4N 2FR4A 1HSAA 3VXQB 4LU5H 3DDFA 5C0DB 4G1MB 3BESR 5C08D 4GQPH 5C6TH 2AJZB 1FDLL 3BP6B 2YO3A 4NC0B 4PJIF 2A6KB 3SDDA 5FO9B 2CDFA 3CPUA 5KVDH 1QBBA 1BD2E 4NIKB 4XPTH 3SCMC 3UIYA 5I1IH 2DDQH 2XQBL 3BGAA 4NJ9L 4OZHB 1XL4A 5L4MA 2EEBA 2EUVA 2A73B 4XB7A 2L7JA 1N7MH 2YRBA 1SDYA 1I8KA 1XH3B 3PDOB 4EOWL 4G6FB 5FGRA 1NICA 4ZFZA 2O72A 3QUZD 2FECI 1JRHL 4UQEA 1A47A 2E46A 5ACMA 2G5BB 3T77A 3RJDA 3I02A 3BKJH 1P0SE 1JFQH 2EZ0C 2VLKA 3CZKA 3HMXA 4X6CF 2K4WA 2VLJB 3IDMB 4QOKB 1XGTA 5CD3B 2XYBA 1WBZA 4DAGL 5CZRA 3U4BL 1L7IH 3IJEA 4X98A 4JGNA 1PCSA 5KZCB 1MH5B 4AKQA 3WOVA 2EDJA 1URLA 4PJBF 5C1MB 4R90L 1CN4A 4NRYA 5LXGL 2P5WA 2EIBA 4HDIA 1IM3D 2WMPA 4FHBD 5I28A 2VDQH 1S78C 4G8FA 4GLRI 4QXUH 4BD4A 1KDJA 1G6VK 2G2RB 2PXYC 4YL9A 4EIBA 3DX1A 3TEYA 4ZMXA 2OP4H 3C6SA 4J3UA 1CDCA 3RVUD 1WGVA 1KBGL 3C6EA 1PAMA 2O26U 3NSYA 4X83A 1CGVA 4M5ZL 5D1ZD 1C7SA 4ZYKB 3CU1A 3RILA 3BUDA 3VI4E 1RK0A 2YEVB 1KB9K 3S5YA 4BDVA 3UTSB 1YJDH 1CYWA 1IM9A 3O45A 5A2BA 4Y9GA 1DQQB 4DESA 1IE5A 2BVTA 2IH1B 2VB5A 2ICEC 4M6NL 5DJ6A 1EHXA 4UT9H 1QR1A 2P44B 1AQDA 4DKEH 1WF5A 4N2GA 1BZ7B 1IFRA 2BIQA 5CGBA 4Y19D 3B4NA 2AKRB 4I9WD 4XVOA 5HVHB 1S7WA 3CN4A 3FU3A 4TPRL 1V3KA 1TJHH 3U46A 1YNLH 1LEGB 1XH3A 2ENSA 4QAWA 3S36H 2LOEA 5E5MA 3UTZB 5A2AA 4PJBA 2DLHA 5IEKB 4N0RA 4EBQH 5FYJH 4DQOH 1NAKL 5KJRL 3BDBA 3GSOA 3II2A 2MSPA 4U0RB 3MSPA 5D7LE 4BK5C 1JHTB 2LGNA 1QW9A 1FHGA 4Z7UB 3MRLB 1TJIL 1VB9A 2P8LB 2FH6A 4AYID 4HIQA 1XCTA 1L6PA 4LSQH 1DQLL 4MKTA 4PLKC 4NZUL 4R83A 5A40E 5DD1L 3W11C 3TBYA 2Z4TA 4ABUA 4YZFF 1TZIA 2GJZA 1HC1A 2WSPA 2FDBP 2XWZA 1XAKA 1RZQA 2RIKA 3GXMA 2JCCB 4M1DH 2A0LC 2RCSL 4XPAH 2B1AH 2E7LC 2NY7H 4CN4A 4FQIH 1QUNA 4O5LL 3OPZL 5I1JL 1HI6B 3KPOB 3FB8B 4UZSA 2HYMA 1XIWC 1I3RB 1U93B 2WOBA 3LPPA 5HP5A 3QQDB 4E41D 1UZ8A 4QGYA 4Z7UE 5KYYB 5IQ9A 2GITB 2GJ6D 2G4EA 3L54A 4QRBA 1AXSA 3ARGB 5HGAA 3WY3A 1HH6A 1TVBB 3OKDA 5IBLD 1WV7T 3UYOD 3ZZLA 4GW4B 3QIUA 4H5SA 2FSEB 3MJWA 4YDVB 4BCYA 4C4BA 4LCWD 5L8LB 3UP6A 1O9ZA 2LLNA 4WV1B 3RE0A 5HJGA 3KJ6L 1U3HC 5B38A 4N85A 1PL3A 2OL3A 1JZ8A 5CJOH 3SSGA 2Z91B 2RFXA 4FNLL 1NCCH 3L3OB 2YBGA 1X5HA 3RIAK 5DQDH 1DDTA 4TUOA 2H7WA 1TR7A 3P4OB 4NQVB 3APCA 4POZC 3CVIH 4O2EB 1MF2H 4PFEA 1PLGL 3IMUA 1NIEA 4GUPB 5FDWA 4CUCA 4UAOC 5I1IL 3LNIA 3VWKC 2YAPA 1UOVA 3O3AB 3LMJL 4NAJA 3ZQWA 4NQEB 1YNTB 5INCB 3ZKNC 5GS2H 2HTKD 3KLHD 4FFVD 3ENEA 1SEQH 4JFEA 4ECNA 2BNQD 3MRPA 5DHYB 3Q06A 3PWLA 3IYLW 1TTUA 5C0RL 2X44D 9CGTA 1WISA 2G9HB 1Q72H 5EU5B 4WUUB 4BIKA 3O6ML 1CE1H 2HG5B 4P2QD 1ET7A 5MEPA 2UZIL 2DI9A 4GH7B 5C2BH 3VXOB 4PJHB 1PEWA 2XBDA 3CHXA 1VAHA 1ZHKB 5D70L 2ZF9A 3K46A 5EC1B 1TMCB 1NC4B 4R97C 4JPKH 3PDOA 2ICWA 1F86A 4HUKB 1CLZH 3OX8B 1MI5D 4Q52A 2N1TE 1ROWA 3G04B 2YSSA 2TRYA 2ZXCA 4LKCA 2Y25A 3VFWB 1YLBB 3L3OC 1HN1A 1WAPA 1U8JA 4LVNC 3CUPA 4Z7WF 4RMUA 2GSGB 3LHPH 3FQ1A 1JDDA 1TQCC 4MB1A 2GI0A 5B39A 2NPLX 1NFIB 3D1MC 2ROXA 5KVFH 3B9KB 2RTTA 1EGJH 2V7NB 1W72H 4L5FL 4WFFE 3MBWA 3OAZH 4XNQA 1HL4A 1FRGH 2CIKA 1VFAB 3T2PA 3V6BR 1JNLL 1MXDA 2MJWA 3P4MA 2JKNA 1U8KB 5E0FA 2E9GA 4RDBA 4XC1L 3FS9A 2DLTA 2Y2WA 3D7PA 4TSCL 5FLUA 4H8WC 1LO5B 2YPLB 4MKMA 1T5XA 5CKGA 3LJ3A 3OV6A 5IW3A 5KEZA 2IBZY 2XACC 4PJ7E 5ITFA 2SEBB 3JWDL 4K73A 3FQ2A 1K4CB 4V2BA 4WFHE 4I5BB 4AUJA 4NENB 4GBXC 3ZOAA 3IN0A 4KUZH 1T89C 2A4EA 2BCMA 2CE6A 1W2KT 1E0OB 3HZVA 3EGDB 3HC3H 5F3BB 3DOHA 4OKVA 5T5FL 3CZFB 4XP6L 3NK3A 4RFOH 3D6GA 1MQKL 3VG0H 1IM9D 3EOYG 4PRAB 3D4YA 1UT2A 1OM3H 1JTOA 3BFOA 1LO0H 3FQTA 4XE5B 4XI5D 3CBRA 2GQHA 1KTLA 1U8NB 1FNLA 1IGTB 3P02A 2ZYRA 3HBZA 1E8WA 3BN3B 5CLZA 4YXHH 5IIEA 5A6IA 1L9TA 2V33A 2F8VA 2QZQA 2W0LA 4KPHL 2APWA 5E9DD 5HYJA 2APXA 1N2RB 3H2WA 3MLSH 3QRLA 5EULV 3ZDXE 3B9KD 1SMOA 3D4ZA 3MR9A 4YHNA 4ZFQA 2IFFL 4M8QB 2X70B 5DWPA 2PUQT 2X2JA 1FZOB 3AAZA 4LDCA 1V7ML 1WIUA 4DPBX 4OZ4A 1A14L 1E3XA 1P5UC 3VJ6B 3DO4A 1RHHA 5D96C 5B1AB 4UNUA 5GGSA 1WICA 3LKNB 2R8SL 4QRPE 1GVIA 3RQ3A 3B3IB 2JELH 3FO0H 4G8EA 4FFTA 1IZKA 1UKSA 3GSVB 5EBGA 2UZYB 4ZTOL 2B77A 4RWHA 3BEWA 2C3WA 3MV8B 3VFPB 5F7HA 3UTQB 1BQHB 2XVBA 2YC1A 5H2BA 3M46A 3D18A 2ZSWB 1KJMA 2IG2L 4D9RE 1N10A