3PAZA

Reduced native pseudoazurin from a. faecalis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
123
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Site-directed mutants of pseudoazurin: explanation of increased redox potentials from X-ray structures and from calculation of redox potential differences.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Electron transfer
molecule keywords PSEUDOAZURIN
total genus 34
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 1997-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pazA00
3PAUA 5B7FA 2BO0A 2PPDA 2UX6A 1XMEB 1SFDA 4YSAA 2FT7A 2YAHA 2QDVA 4PAZA 4YSSA 1GS6X 1F56A 1ID2A 2IDSA 1NWOA 4JHUA 1PLAA 4RH4A 4YVUA 2HRGA 1AZBA 1PF3A 2IH9A 3WI9A 4E9TA 3ASOB 3PAZA 4KO9A 1AACA 1SF5A 1WA1X 2BZCA 3JTBA 2AZAA 2DWTA 2UXVA 3T6WA 1TKWA 1A65A 1WAEA 2YAMA 4GYBA 1ZV2A 1N68A 3EF4A 3OMAB 5I6LA 1N70A 1XB6A 1ZPUA 2H47C 2UXFA 4BXSV 2EIKB 3FT0A 3UABA 2CALA 3SBQA 5I5IA 2R7EB 1ASOA 2FTAA 1NIAA 3S3CB 4GP8B 2DYRB 1T5KA 4G7QB 1ASPA 2I85A 1BYPA 2ZONA 2IAAC 4FA7B 2W88A 2GSMB 3N55A 4A2FA 2W8CA 3NYKA 3TU6A 5I6PA 3FQYA 1DYZA 2CBPA 4AKOA 2ZXWB 1NZRA 1EHKB 1AS8A 3MX0B 4AKQA 3H56A 1A4AA 1FFTB 1M57B 3BQVA 2QT6A 2J55A 3T6VA 2QDWA 5PAZA 3UADA 3NSFA 2HLEB 2BP0A 2JFCA 2ZWNA 2HXAA 1BQRA 2EIJB 1BXAA 5B1JA 2DY2A 4M3HA 4EF3A 3TBCA 2PLTA 3NT0A 4QKTA 1PLBA 5I6NA 3TA4D 4BDVA 2EINB 3OD3A 1MZYA 1NWPA 2H3XC 3IE9A 2IWEA 3X1GA 4L0PB 1HFUA 3ABKB 3OM3B 4HHWA 4E9WA 4DPAX 1CC3A 4HHGA 4UANA 3IN0A 1ZDSA 3NJNA 1BQ5A 1ZIBA 2XU9A 4NAJA 2EILB 2AVFA 1AZCA 1AG6A 3GDCA 1OCZB 1MG2C 2B3IA 2XX1A 4KO6A 3CVBA 1GSKA 2BW5A 3IEAA 3IN2A 1V55B 3FU7B 1J9RA 2PCYA 1ZIAA 1AZNA 1BXUA 1BYOA 3QPKA 1JZEA 2PCFA 1PCSA 1L9TA 3DIVA 4DP1X 6PAZA 1AANA 1ET7A 3NP4A 3X1EA 4A66A 1AZRA 4F2EA 4AI7A 3SBPA 2VM4A 3NSYA 3L45A 2OV0A 5E9NA 1KYAA 3X2QB 1ASQA 1UATA 2GC7C 2VN3A 3CVCA 2PPCA 4KNSA 2P80A 1GW0A 2GBAA 2FQEA 4BWTA 3S8FB 2TSBA 1GYCA 3G5WA 2BWIA 1L9SA 2PPEA 5AKRA 1KCWA 2XYBA 1RCYA 2YAFA 1BAWA 1PZCA 1NIDA 1RZQA 4YSTA 3X1NA 3GXUB 1RKRA 4E9XA 3BVDB 5I28A 4YL4A 4UF7C 5TK2A 2FQFA 4YSOA 1V54B 4DP5X 3FU9A 1OCOB 2XVBA 1AR1B 3QJVB 1E5ZA 2BW4A 1L9QA 4QLWA 8PAZA 4E9QA 2HZHA 3TASA 3D12B 3S3BB 2PPAA 2XV0A 4CSPA 3UGEA 3PPSA 4G7SB 2PP9A 2HRHA 1DZ0A 1OOWA 2QPEB 3NJLA 3GYRA 3CZUB 1W6WA 2PPFA 1URIA 3WKPA 1R1CA 4CSZA 3ZBMA 1KDJA 1W8EA 3EH3B 3FYIB 3NJGA 3RYMA 3UACA 1FWXA 3AZUA 3FSVA 4JHVA 1ILUA 4WKXA 5I6MA 2J56A 2GC4C 3EHBB 3EH5B 4HAKA 3EH4B 4HIPA 1M56B 1KV7A 3NJHA 4NB7A 5AFAA 2YQBA 3PCYA 1X9UA 2J5WA 1JVLA 1SNRA 2XWZA 3U25A 3NSDA 3PAVA 3ZIYA 4BK5C 5IY5B 4KOCA 4YSDA 1OCRB 3T6ZA 1B3IA 2YAPA 2XV3A 3NJJA 4HCFA 5AZUA 3S3DB 4M4RB 1SHWA 5B1JC 3DKHA 1TEGA 7PCYA 5D4HA 4DP8X 3AG4B 1SDDA 4DPBX 2YARA 1AS6A 4P5SA 3QJUB 2XXFA 3DTUB 3FU7A 1SF3A 4UAHA 5F7AA 3UAEA 2BP8A 2XXGA 2Y69B 1ADWA 4GXFA 3H4FA 4A2DA 4TXVB 1BQKA 1CUOA 3T9WA 2LLNA 1AIZA 1TEFA 2FNWA 4MFHA 1XB8A 1X9RA 2FT8A 2BWDA 4KO7A 1PZBA 2Y1AA 4WTQA 1GY1A 3KW7A 2XX0A 1GS8A 3ERXA 5B7EA 1NIFA 4W9ZA 1J5CA 2WO3B 2IDFA 4BDVB 1XB3A 2GIMA 2JKWA 3NJMA 5I5MA 1KGYE 1MDAA 1RZPA 1OV8A 4DP6X 1OF0A 3NJIA 3JT2A 4Q8BA 1PMYA 1WS8A 1QHQA 3FSAA 4N8UA 4YSEA 1SJMA 2FWLB 2IWKA 2FJSA 3NJKA 4HCIA 2FQGA 3ABMB 1J9SA 2IDQA 2J57A 2HX9A 2PP8A 2GHZA 4F2FA 5B1AB 9PCYA 4DP4X 2IWFA 5B3SB 1NDTA 3PXLA 4DP2X 3H4HA 1PNCA 1JVOA 1L9PA 2CCWA 3AG3B 4FAAB 2VSMB 4KO5A 4N4YB 1ZDQA 4ENZA 1OE3A 4GP4B 4G71B 1NICA 1FA4A 2UX7A 4AKPA 1ET5A 1OE2A 3ZX1A 2QPDB 1JXGA 1IBYA 1J9QA 4G7RB 4X4KA 4YVNA 2FQDA 2MRYA 4A67A 1EZLA 3CDZA 2VW4A 1CYWA 1OCCB 1SFHA 1ET8A 3OMIB 4G72B 1JXDA 3QQXA 1JZHA 1L9OA 3UAAA 3FS9A 4E9SA 1MG3C 3C75A 3T6XA 2AANA 1JZJA 4DP0X 1AAJA 3QJTB 3FU8A 2BHFA 2ZOOA 1NPJA 3KW8A 2RACA 2WO2B 2X88A 1ETJA 2BZ7A 1GY2A 5ANHA 5I5JA 4AZUA 2JXMA 2R7EA 1GR7A 1JZIA 5TK4A 4HCGA 1JXFA 1W6LA 2VW6A 5PCYA 1KCBA 1E5YA 3HEIB 3CVDA 2N0MA 3SBRA 3CDZB 1AG0A 6PCYA 2YAEA 4BXVA 1A8ZA 1TU2A 5LDUA 1VLXA 2E86A 2GB2A 3QJRB 7PAZA 3CG8A 2B08A 4BWUA 5D4IA 2P80D 3ASNB 1PLCA 3IBOA 4A68A 2YAQA 2I7SA 2CJ3A 1AZUA 1NPNA 1KBVA 3QJSB 4P5RA 2X87A 3MBWB 4K9JA 4E9VA 5B7MA 2VMJA 1AQ8A 1PNDA 3WG7B 4HALA 2MTAA 1QLEB 3ABGA 3FPYA 1ILSA 4GP5B 1IBZA 2H5UA 1PAZA 1A4CA 5B1BB 5I26A 2DYSB 3WNJA 1NIBA 2A3TA 2UXGA 3NSCA 3OQRA 4DP9X 4YSRA 1JOIA 4YSQA 5FC9A 4A2EA 5D4JA 3S8GB 2VW7A 2AFNA 3N2JA 3X1FA 1WA2X 2Q5BA 4A2GA 1BXVA 4F7KA 3FQ1A 3FYEB 1CURA 2TSAA 1A4BA 4HZ1A 1M9WA 2XV2A 3HB3B 1JERA 4PCYA 2CAKA 2FT6A 3WKQA 3WNIA 2VM3A 2YXVA 2I7OA 2BP0B 4KOBA 1JZFA 1CYXA 3FSZA 1AS7A 1E30A 2WSDA 1SDDB 3PLYA 4Q89A 3ABLB 1V10A 3WIAA 4DPCX 3FSWA 4E9YA 1PZAA 1I53A 3QJQB 4YSUA 1SHXA 2OCCB 1J9TA 2VSKB 3SQRA 1HAUA 4ZK8A 4AX3A 1A3ZA 4KNUA 4W1TA 1J5DA 3FQ2A 3AW5A 5I6KA 1E65A 2BP8B 3T71A 1OE1A 2IDUA 4DP7X 4GY4A 1NTDA 1AOZA 1NIEA 2YAOA 5EHFA 4BWWA 4YSPA 1YLBB 3TBBA 1JZGA 4JKNA 1IC0A 3NP3A 3ZDWA 4G70B 3NJFA 5B1KA 2DWSA 1E67A 2GI0A 1IKOP 4NERA 1HAWA 4A2HA 2NRDA 4KNTA 2Q9OA 3V9CA 1KDIA 5F7BA 2XUWA 1NINA 4E9RA 1WA0X 2UXTA 1PY0A 3OMNB 3FPXA 5A7EA 1IUZA 1QNIA 2HX7A 2IH8A 2DV6A 3AY2A 2OJ1A 1KBWA 3AG1B 1L9RA 1BEXA 4YSCA 2PP7A 1MZZA 2YXWA 2IDTA 2EIMB 3X1BA 3AG2B 5I6OA 1WS7A 2HX8A 2CUAA 3V9EA 1GS7A 2AZUA 2XLLA
chains in the Genus database with same CATH superfamily
2VSCA 1UURA 3P4OB 3RKPA 3NFPB 4F3FB 3KMDA 1EO5A 2DLTA 3DX3A 3BQUD 4GW5B 2NY6B 4ORGB 4MA3B 1CDGA 2J1KA 2B8OT 3BKCL 4KKCC 4YDMA 5ES4B 1ID2A 3SKOA 2MJWA 1F3DJ 4NZJA 1NEUA 3HBQA 4E41A 4RAUA 4DQOH 4WAFA 1MREH 1SF5A 2ZPKL 5C9KA 3QUYA 5IHHA 1UZGA 1OAZH 4L1LA 3KWUA 3V5DB 1HEZA 3LH9A 1O6TA 2DI7A 2EIBA 4PS8A 4UOW1 5AW8B 1GXEA 2BSRA 1ZJAA 1WZAA 4EOWH 3S36X 3LEVH 3RUGB 2B4CC 4BXSV 2D2OA 1SEBA 1MLCA 4C59B 2EIKB 2WGNB 1TETH 2UZXA 3MUUA 4PRPA 3TF4A 1LEKA 4UYQA 5I1EL 3GB7B 2R7EB 2VLMD 1WV7T 2ZQKA 3P40A 4PJCF 1J48A 5C0NC 1NFKA 5E9DD 4C58B 5BZDB 5D9SA 3RJOA 5EF1A 1CLYL 2C9UA 2YEZA 3ARDC 2W8CA 3I50L 4J3TA 1L5GA 3QDMA 3QNZA 5DQ9B 2OMYB 4JFZH 4JR9H 5BZXA 2NY6C 4R5VA 5T1LB 1D7FA 4QRAA 4A7UA 5DXWA 2AJYH 4KHTH 3H56A 3HBGA 3ARFB 3H2PA 3QUMB 1D9KB 3T0VA 4LASH 4A39A 1OHZA 2AI0H 4RNRB 1WISA 5PAZA 2ZAIA 3TXAA 3BWUF 3EBAA 1B2WL 3QUYC 1TQSA 2XWJB 3DX4A 3PWPE 4CC1A 1TXKA 3MR9A 3BGMB 1N64H 4JQVC 1XIWA 1BXXA 4QT5B 5IVXE 1FH2A 2G5BA 3WGUB 2CUMA 2FJHB 2CLRA 3MRBB 3ARBA 3ARGA 4P59L 3OM3B 4U6VH 2YGQA 5F72S 4PJCA 5GGVL 1AE6H 5IBLC 2G2PA 3VQLA 4W9FC 1NJ9A 3HBPA 3P0GB 2ESVA 3C60C 4Y2DB 1E4WL 3S88H 3K1KC 1P84K 5HHQA 1MCOL 2Z7YA 3D69B 3SJVB 3BN9D 4XWOD 2B3IA 3QUXD 5JZ7D 1FGVH 2APSA 5IB3A 3O3AA 3B9DA 3O4LA 1RD6A 2HFFB 2A77H 2ZWKA 2X2HA 3AITA 3CK0L 5F7UA 3ZGHA 5H8DA 4FCAA 5DI8A 2DJUA 5TFSL 1GCYA 3KPQB 4JRYB 3K2UL 1UWGL 3ZTDC 1Q0YH 4LL9A 4KKQA 3GXFA 3MFGB 1BJ1J 5KVEH 3ZYJA 2AJZB 1CFMA 4ZMOA 3QXVA 1BZ8A 3QNFA 1G7HA 1V7ML 4TNWF 2XN9E 4KXZI 4OFIA 2QKIC 3L45A 4DK5A 3FT2B 3L95B 5CBAA 3E1F1 5I18L 4GRWE 1XGRB 1QMUA 4NRXA 4F33A 1U8LA 2GBAA 2H45A 3OHXA 3VFSB 1J8RA 3FCBA 4KKLD 1X4YA 4AMKL 2Y9RT 3BVWA 3FFCA 3UPRA 2J1WA 5F3HA 4OKVB 4NQEA 4L3CB 3HI6L 4QGYA 3VD7A 1NUNB 5D2NC 2ZX7A 5BUPA 3OWRA 3QHZH 4RA0C 3UTZB 4CVXA 2YWZA 4GW4A 5K1NA 3P77B 4JHZA 1YEGH 1BD2A 4ZMZA 2BS71 5L9DL 4PS7A 4Z76B 4GSUA 4XAKE 1FIEA 5ICYB 1QABA 3CFKB 4KXCA 1NSNH 3TCLB 5GQBA 5J56B 1CFVH 2R2BB 3VA2C 4HIXL 1JPFA 3MAWA 5KVFL 4GLRH 1KGWA 1LP9A 2X4NB 3K80A 3OB0K 4L8DB 1UB5B 3NSXA 2GVYA 3POCA 1DQLL 2AGJH 4CSPA 5E70A 3KPRD 4K4KA 1YEHH 1TJXA 3VG9C 2OTUB 2WQVA 3MACH 4IRZH 4ONHB 4EDXA 3ULUE 1N4XL 3J07A 1RVFH 4RWYH 5EZOH 2V6HA 5FGSA 3QIBD 1NGQL 1IX2A 2CR6A 2R9HC 1NGYA 3FSVA 2F54D 4P48A 5D8JH 2X1OA 5DURD 2E9IA 1ZLUH 4B9FA 3QDJB 4U6HA 4WW2F 3CSFA 1M56B 1MELA 4QHNB 3PCYA 1J1XL 1I1CA 1PG7W 4FQLL 1RK0A 4U1JA 3N1GC 4JCLA 3NSDA 3V0AC 1MCWM 2NW3B 3VW3H 3TO2B 3T6ZA 4KKAD 1OLZA 3R0MA 4M4RB 1SHWA 4N85A 3TO4D 1WK0A 3DVGB 2CDGA 2IH1B 1BGXL 4DP8X 1KNOB 1NANH 3MV01 1T21A 3AM8A 4PJ9D 4PRNB 4RMBA 5L7XH 3Q44A 4U7SA 3QEGL 4IGBC 2YZ1A 2X1PA 3QQNA 5F96L 2WN3A 4WV1A 3NCMA 3ZMRA 5JQ6H 6CGTA 3OKNB 4PJIA 4GXFA 3RURA 5DUBA 5I0ZA 1AHMA 3OBAA 2B59A 4O2FA 5A2CA 1QSFD 1X9RA 3ZN6A 3WNMA 3HHSA 3NG5A 3SE4C 1N12A 5D5MB 4JFEA 5C9JB 1G6RH 3LN9A 3ZL4H 1U8MA 1VFAA 3O6KH 2P45B 5J0BA 2PKDA 4TULH 4X6FA 2XT1B 1TFHA 2WO3B 1S9WB 3CMGA 1PCXA 4MWFA 2JKSA 5IZ7A 2ZE0A 2R8SL 4AIZB 4RIRB 4J3XA 3KR3H 3MUJA 5CCJA 4MXWL 4Q2ZB 4K2UL 2B5IB 5KJ7E 3EDKA 4KTYA 2W65A 1WBXB 3DPBB 3FSAA 1Q94A 3Q8EA 3OR7A 5D6CB 5F88B 4GW5A 3RIAK 4BQ6A 3C6LD 5JW5A 1UXWA 1B6DA 4YHKL 2E7CA 1GYWA 4RCAA 3TJEL 3IVKB 4BYHA 1V7NL 4E42A 4YDKH 3QJOA 1S8DB 5C09A 1VCAA 3QFJD 1L9PA 2CCWA 2DKMA 2EICA 3BSZA 5CBEA 4MLSA 3I75B 1FGNH 5LQBL 4MXVF 4NQCA 5KSAC 1VJSA 3RVVC 1Y0LB 4J3VA 1P6AB 1OE2A 5ILTL 3E8UH 2MCPL 4OZIE 4KDTA 1JXGA 3DMMB 3P30H 2A99A 3EYQC 1AP2B 4ZMQA 1G7PB 4J2QA 1AQDA 1MCWW 2C1PA 1II4E 5CGMA 1DCLA 5C0FB 1W0WB 1PZ5A 1W72L 1NGZA 2HT4D 2WANA 3NGBC 4FFVD 4HHAB 1A6WL 3QUXC 5JZ7C 2P26A 2ZG3A 1KCRH 2VO8A 1F1GA 3N50A 1MG3C 4ODXA 1F3RB 4Y16A 4M29A 12E8L 4AT6B 5C0JB 1ZXKA 2XBZA 1VGKB 4QHUA 5AW1B 1MREL 2OQJB 1J05B 4KTEL 4X6DB 5DMGD 4JFPB 3LH2L 4MQXD 2X88A 3BWAA 4X4MA 1XWVA 3MJ7B 4PY7B 4CKVX 1KTLB 2JKTM 2CKBB 3BH9A 4JGJA 4O00A 5E9AA 4Y4FA 2OMXB 1F4AA 3OJDA 4H26B 4BH7A 5HI3D 2X12A 4JO1H 3SYAA 3QGVA 2BWQA 2WVTA 3O3EB 3LY6A 5C0CE 1OB0A 4AEFA 4JLRA 1CLCA 4BFIA 4OFYD 1S46A 1OTTD 4PN6A 2FX7H 5K69A 3OHXB 2XQYK 3UBGA 3H85A 3Q5YA 3B9AA 5JQIB 4ZS6D 4CVUA 4NEHB 4TF4A 3IB4A 2AXGA 2DZEA 1JD9A 4Y5VC 5DC2A 1JXKA 2BNUA 3VQ2C 1S9YB 4YIQA 2I7SA 3EFOB 1S7RB 1DLFL 3LKPA 5C0EA 4MJ5B 1S3KH 2R51A 2YPKB 4NQDB 4GMSH 3X13B 1CGTA 1YECH 3S37L 3TIEB 2EDEA 2W5PA 4UTAA 2AQ2A 4QHKJ 5EO1B 3O4LB 5EU3B 3W56A 1W0VB 3EFDL 2PW2B 3KXFD 4HUVB 4JPIA 3EJZD 3GF8A 1LMIA 2Z1KA 3V0DA 4LEEA 5AW9B 1CGXA 2Q3ZA 2JLPA 1M7UA 1JOIA 3IDYC 2RCSH 2VXQA 1W72H 1OT1A 1YUHB 4Y88A 5D5MF 2QVIA 3CC1A 3SBWC 2YD7A 3UTSB 1QSED 3U9UB 5GXBB 3MA9H 4JRWA 1ND0B 2MNJB 2VNCA 3CU7A 4PBXA 2NY7H 2Z9TA 5E1GA 4KY1L 4K94H 4AXWA 2EDXA 2BK8A 3ARED 4NDMA 4JFSA 3V52L 1SN2A 2X9XA 1H5BB 3IFOB 4NQED 2XDHA 3I74A 3KYOA 1XGPA 1G7MB 1Z66A 4L3EB 3H7BB 4POUB 1G7LB 3C6LB 1VHPA 2F53A 3O0RH 5ICYA 3GZQA 1SJEB 1ML0A 4ECNA 3L3GA 1M05A 2SODB 1BV8A 1MRDL 1X7SA 4X80H 1WT5A 1X5KA 1P4BH 1IU1A 4OF6A 4ZK8A 3WEMA 3MLPA 5F1SA 3PQYB 2CHXA 2Y1YA 1DBJH 3NABL 4UT6L 3MREB 4GY4A 3VWJB 3AACA 3QUYB 4JKWA 2BOLA 5CIPB 2R83A 2VRAA 4FQJL 3SKJH 5T5FH 3RDTA 4PREA 2Y7NA 4I0KA 3FSOA 3ZDWA 1KLGA 4N2CA 3V6FB 5C2BL 1E67A 3QZNA 4XPGH 4FQQB 4J3SA 4GKSB 1DVXA 2WTRA 1P69B 5F7YC 5FW7A 1R46A 5L4FA 3A22A 3BDBA 1I1YB 3ECUA 2R8SH 4Y9EA 2HVKA 3QUYD 1K2DB 1C16A 1X6NA 4J7RA 4OZHF 3ZHFA 1IO4C 3P11H 5EORH 1OB1B 4ONGL 2A83A 4FYSA 5F0PB 1N5YH 4WU7B 1OXYA 2YEZB 2N7BA 2OJ1A 1OD7A 1UUSA 3BAYA 4XNYL 1ZHNB 1RHFA 5LAXB 3EJCA 5JHAA 5KYXA 1KBPA 2BSSA 1HOEA 4K23H 3MA9L 4G6ML 3WEAA 3O6FC 3CQPA 3RJDA 1JPTH 4P2CG 4N0FA 2VMEA 4WCYH 3V9EA 1I7RB 3QIBA 3SCMA 1NGQH 2WVSA 3LEXA 3LB6D 3IU4L 5KSAD 3HFMH 1P1ZA 1I7ZB 3PG2A 1DQDH 2MCPH 3RY6C 1RUML 5DJCB 3VXME 3V5HA 4CU6A 2R39A 4YSSA 1IEBB 2K8QA 1F56A 4X6CB 4KHTL 1B0GA 3D08A 5LLIC 3ULVE 4OCMC 3MJWA 5C09E 4QXGH 1Y6KR 4Y19E 1A7NH 2A5UA 1JF1A 2HT4C 2K45A 4QJ5B 4ZO8A 1SZNA 5KS9F 3UTSE 1WQVT 3FZUC 3O9WC 4KRPD 1XH3A 2WIIB 4GBXD 2Z31B 3QQ9D 3B1UA 2B1OA 2Q0ZX 1ZGLA 1WAAF 1VZIA 3NZ8A 3JWOL 3L4XA 1CFSA 2A6IB 4AH2B 1F00I 4XO4A 2XC8A 4K3GA 3HG0A 2XXMB 3F7YA 3QNYA 4KHXH 3G5VA 4F7EA 5I1CH 1KFAH 3APDA 3EH1A 4B60A 5D1QE 1BG9A 3ZL4L 2R9HD 4H1LG 1YY8B 3MHZA 3FQNA 4PGZA 4HUNB 2FJUB 4AKOA 3K72B 1INQB 3KGTA 3KWWB 2H8PA 4CNIA 2Q76B 5CILH 5KOMC 4PI0A 5JXAH 4ZMPA 1XCXA 3F62A 4IKLA 3T8MA 1WIUA 4V1DA 3BDYL 5KVEL 4U1SB 2F7QA 1OSZB 4PJDB 1OP9A 4LRIA 2R0ZL 1TSHA 4PGDB 1LE9B 3KJ6L 2EC8A 2JFCA 3LDBC 3LIUA 4JKPH 4MVBD 5EC1B 1TETL 4BK4A 5HHOB 2HH0H 5J11B 1MFDH 3EIFA 4XHQA 1M7IB 4H2CA 4QNPF 5FFGA 3OWEA 1T7WA 2C9PA 2PWDA 2XTJB 1E6OH 1OOAA 4Z23A 3IE9A 1C1EH 4KVPA 1ZPLA 4IBWA 1PU0A 2V3DA 4AGOA 5IWLA 2CNYA 3BUYA 1X6LA 2FJHA 4PRDA 3V6OE 4CDGC 1CC3A 4UANA 5CEZH 4WF7A 1U91A 3SJVD 2DW5A 2CKBA 2QPFA 3BH9B 4K7FB 4QTIL 1ZIBA 5JPMC 2AVFA 1S5HB 2NY6D 2VLRD 2GG1A 4KO6A 4X5WA 4XB3A 3CVBA 3BCFA 2GK0B 4N6RA 1A02N 1CDIA 3OAUH 4NBZB 3HE7A 3BMWA 3IDNB 3P3RA 3MLRL 5E1AA 3TT1H 2CM6A 3DBXA 2FCBA 3SGKA 2XVKA 4HD5A 3WIIL 4Q74A 2IGFL 3LN4B 3LZFH 3DHJA 3ILQC 3QFJA 4DOHE 2MHAA 1MI5B 3IFNH 3C6LC 2WVUA 4UMGA 5JUEL 3UO1H 5FO8B 4IRZL 1UA7A 3DJRA 1EO8L 1LWJA 1UATA 5BJTA 4PP1C 4UQIM 5EO9A 4MDRA 5EIIB 2JXMB 2F19H 3DJZA 1CICB 2P8MA 3UXFA 3SPIA 3VXMD 1E4WH 3S88L 2XN1A 4OZIF 4PRID 4FG6D 1FZJB 2VOTA 2XY1A 3UCRA 3VJ6B 1EXGA 3O2VH 1XGQA 4KTGA 3ZRCC 4J1UB 4YDJA 1EZUA 1IGIL 4NUGH 3RVTD 2GUYA 3MRBA 3G6JF 3ARBC 2JWYA 1B4RA 1XL6A 3H3BC 1IAOA 5DFAA 2WAQA 1T0OA 1BIIB 3Q1SL 5I73B 3O6LH 3ISYA 5LWYH 4O2EA 2NT1A 1UM6L 1OWWA 2IADA 1EXUB 1HH9A 1WUNT 1ETZA 1E3FA 2EDMA 1JPSL 5LNDA 3J27A 1LO2L 3C12A 3MRDB 2OMVA 3R7QA 2BFVL 1I1FA 1A2YB 3GZKA 4Q9BA 1MH5B 3PY9A 2EKJA 4XNXH 1DBAL 1NMBH 1QVOB 3HR5A 3O2DA 5J1AA 4MJ6B 1TO4A 3QYMA 3EJTA 4M6OH 1ZRUA 3NFNA 1JZ6A 3QUKB 3FUMA 3CZUB 5TPWH 2FYYB 5J9PB 2EXYD 5I71C 1JGUL 3P4MB 4PV9A 2ADGA 1QLEL 3P2TA 3RVVD 4WU7A 4HK3J 3WKPA 1DE4B 1A21A 1F1AA 3KL3A 3LQAC 4KJYB 4PJGF 2YC1B 4MJIB 3D0VB 4U1GC 1KYOK 2AXFB 3V4PA 1PSKL 3TYFB 3IDJA 1HIMH 2HFGL 1RZFH 1MW0A 3TT1L 3W39A 3ZQ9A 4HAFA 1TVDA 3NZUA 2GJZB 2OXGB 1LE5A 3QIUB 4ABUA 3KPRE 4NZRL 5BS0D 5HDQH 3L3KB 3V4VB 2BJMH 4HUMB 4KDVA 5AWNL 3AROA 2OL3B 3ARGC 3WE1A 2VLRE 3EZ8A 2BRQA 2R23A 4XAWH 1WZMA 2WNXA 2E9WA 3T4YB 4FNTA 3WLBA 3OKEB 3JSSA 3DMMA 1V7NH 1DEDA 4PLNC 3SZKC 2XG5B 1FG9C 3TYGH 2NY5L 3GBML 3I6SA 5AW7B 4XMLL 2N0KA 3CFDB 1RURH 3VD2A 4N6QA 4MFHA 2XWJA 3HB3D 4LEOB 3ESOA 2YLHA 4PJ8A 4TSBL 1LP9E 2FJGB 2H6OA 5LXGH 2CJTA 3KHOA 4UT6H 4BHUA 3PQYD 1T3FA 1NIFA 1ZVYA 5K1VA 2ZP9A 3GTVA 2IDFA 2Z34A 3L7EB 4KHXL 4LMQI 5KVEE 4AGQA 1A6WH 4EZJA 1FLRH 3O11B 1ORSB 4R8WH 3QEGH 3BZEA 1U8OA 1F1DA 5JDJA 4PGEA 5JQ6L 4RX4A 5GGSY 2GEEA 5I24A 1OPOA 1MLBB 4ISVB 2BY1A 4M61B 4UOW0 4Y1SA 1KG0B 4Z7VA 1IQWH 4OGYH 3AM8C 4WDIA 1KZQA 4HWUA 3QQ3A 4FXLA 5HDBB 4OTXL 5ICXA 4CA4A 5KJ4A 4CJ0A 5AD0A 4BHUI 3F6LA 1KULA 4HPHA 1Z5LB 4G1EB 4G9FA 5IOPB 3OKNA 4IBQA 2JIXD 3M8OL 4PJIB 3V9FA 4UTAL 4P3DB 1C1EL 4I0PC 5EBMA 3N41B 4BSWA 3D05A 3RDJA 3ES6B 2BX5A 2QGBA 4PLKC 3PE9A 4TSCH 1EWHA 1ZVSA 4I77H 2V9RA 4GRWF 3RL1B 1DQDL 2XA8H 1AIFB 1R3IH 1ZT4A 3E1ZA 4FQHA 1ACCA 4M62L 4APQA 5CP3A 1YEFH 4MCMA 3UYPA 2WINA 1F58L 3KDMA 4PV8B 2VQTA 3HAEH 3N1PC 4QYOA 3T8XB 3ULVL 1Z3GL 3H42H 4E9SA 2BH0A 1QBMH 3KPTA 1JZJA 2NY5C 2JB5L 1NH6A 2OSWA 2KZWA 5KAQF 3U4EA 5KZCD 2WNKA 3UTSA 1E6JH 2VLJB 3WHXB 4RSVA 2WO2B 4HWBL 5DYOA 5JYMA 2IAMC 4B7LA 5J6GB 5IW3A 3LZFL 5ANHA 3VDAA 5ANMA 5CCGE 3TT3L 5I76B 5DT1H 1EEZB 3ZDZB 4BGDA 1GR7A 1CICC 3TJPA 2QQKL 3FTYA 4OCRL 3LZLA 5CGBA 1LJMA 1MQKL 1TJMA 3HB3C 5F0LB 4BFRA 4ZS7L 3CDZB 3EYSH 5ID1B 4Z8FH 1FL5A 4IDJH 3GIZL 5IOKA 4KXBA 4JUSA 1TCMA 4LOVA 4PWEA 4F2MA 5AZEH 3H2WA 3O9WA 5JPNB 3T2NH 4TM9A 1P4IH 5SWZE 1BPLB 1BOGA 2WXGA 4NQVB 1AHWA 2NY7L 3OPUA 3SGJA 3U30B 2HG5A 5EB9A 2LW3A 5FOJA 4LCCB 2EEDA 2D0FA 4ABQA 1E28A 1KTDA 4RQQA 3WY4A 2LVEA 2AXGB 4NQDD 4B97A 3F3HA 4UINL 2EDRA 4RZKA 4JDTL 5IW1A 4ZMWA 1YYLL 4P5RA 1AI1H 5EBLB 4AK2A 4G42A 4Z9KB 1UCTA 5D1ZI 4WTZA 4CSSA 1CLOH 4KRNA 2B2XH 3UPCA 2XOTA 3RP1A 2H2PD 2AVGA 4JG1H 4ODSL 4OM0L 4QJ4B 2J25A 1MRCL 3PNWA 4OVUA 3VFVB 2Y1VA 1MFDL 2FSDA 3FZUD 1ILSA 3OLEA 1URZA 3A6BH 1U8QA 4FQIH 2NZ1A 2LQRA 1HESA 4M4RA 2YRBA 5IJBC 5L2JB 4BD4A 3UPAA 4N3TA 1OARL 3CVHB 4ANKA 3FJTA 1ROCA 1U2YA 3WAJA 3KG5A 1U6AL 4PUBH 4YSQA 4POZC 4K3JH 4A63A 2PW1B 4PCKA 4PP2B 4ANWA 1JGUH 5E4EB 1WA2X 2XKSA 3OKMB 2H41A 4FQJH 3SKJL 4WU5B 3MGOB 4LGPB 2XPGB 3SY0B 2Q86A 2FAUA 4FDWA 5CKGA 2WOBA 1E4JA 1FDLH 5CXPA 4UQ3B 2ICEB 3RFZB 1SXNA 2BSSB 2WKOF 2Y06L 4YPJA 3WKQA 3T0AA 4OBRA 5EC2B 2VM3A 5GGTL 1H15B 4J3OC 3QIUA 4P2RA 5ETUA 1SUJA 1AS7A 1D5BA 1E30A 3KE0A 4UM9D 5B4MC 4JL1A 5D72L 4P46B 1E2ZA 1YNTA 2YD9A 4WJG3 4XXCA 1PZUB 5C71A 4GS7B 5IW6B 1RXLA 3GIZH 1BG1A 2CHNA 4YSUA 2ZYSA 4PRPD 1SHXA 1HNGA 2XICA 3C8DA 3RKDD 1HHKA 4QNPE 2VSKB 4NUPA 4Y8DC 1EFQA 4YHIB 1PDKB 1ORQA 1XSIA 3O45B 4NOFA 2Q8BH 4DUXA 4W1TA 3WE6B 4D8PA 2VXVL 5I6KA 4QRPA 5L0QB 3EO9L 5HD8D 3PYCA 3ATEA 4LL4A 4E5XG 3AAZB 4YBLC 3FUFA 3MRJA 3K8MA 5EPMB 4DUVA 3K2UH 5I19L 3FRPB 4YSPA 2D3NA 1EXHA 4IOFD 5GSVB 1LD9A 3DECA 1H0DB 2IG2H 1XH3B 2WIIA 3NP3A 3TZVC 5K9JH 4PS4L 3N44B 5AKSA 3FO0H 1QBAA 4G8GE 4P5TD 4EN3A 5F7BA 4JDEB 1VPOL 2WTRB 5CGYD 4PJFF 2JE8A 5F8RC 3QIUC 3FPXA 5JW4M 3TO4B 1QW9A 1AKJB 1LE5B 4JRXD 4I5BB 4M5TA 1QR4A 3QUZC 5CEZE 1U8CB 5DCCA 3KS0H 2DV6A 1BCIA 1CBJA 3VXUA 2FATL 2B3RA 4ODWA 1JGEB 5C1MB 4R26L 1ZVNA 2PP7A 4AG4H 2YPVA 2LT9A 4G7VL 1BF2A 2H32A 4WEEA 5DHYA 1GGCL 1MLCB 4LVOB 4OGYL 4XP4L 4KXAA 3KZ8A 3N43B 1ZEAH 1GZPB 3PAUA 4Y7MA 1IIIA 1OSZA 3A6CL 5GGTH 1DQIA 2XPYA 5EU4B 2GITB 3HG4A 5KVDE 3U0PA 2KERA 3CFBA 1M7IA 2JELH 3RI5F 5D1ZD 2G9KA 1XBDA 5JXAL 1IAII 1ZANL 1YEHL 4ZX6A 3GXIA 3OAYH 1AR2A 3CSYB 2BXYA 4O58L 3E38A 3CHSA 1OAQL 1Z3GH 3EFFB 3DVNA 5IBUB 4K9EL 4K7FA 3JWNG 5EFIA 2AABL 2JB5H 2XV6B 4KKZA 2OTWA 4D9LH 2VAAA 2NY5H 1HKFA 4HPYL 5C07B 4O2FB 1D6EB 1JTOA 3GSXA 3GBEA 4U33A 4AYEC 3PDOA 2HVJB 1N6QL 1NLDH 3EXLA 1JNNL 5IQMA 4QTIH 3HBZA 1OHQA 3QZWA 2R69A 4J12A 4ZODA 3CFMA 3QJFA 4N0RA 1L4IA 4A2FA 1R5WB 4P4RA 2BNQB 3F7KA 3SQBA 4CBZA 3FQRB 3FQYA 4P9ML 5T3ZL 3DX8A 4CC0A 1P7QD 2HPOA 4QXGL 4U3SB 5GRWA 4CBPA 1BVLA 5ISZA 1R0AL 3NH7H 4OD3H 5AB2A 3QHFH 4APQC 4Z1PA 5MERA 5HGHA 3KWWA 1KJ2H 2DWDA 2UWEA 3BQVA 3K3QA 1Q94B 4PWIA 4UTCA 4W6XB 4Y5XA 1R3KA 4RESB 4UB0L 4IMLA 2QDWA 3UADA 3II3A 1U4FA 3VX0A 4EI5D 4UM9B 3GD1C 3TBWA 4QHMB 1ZSDB 2Y7OA 3L2MA 3K2KA 3L6FB 4LVHB 5DZ9A 2R4RH 4Z7WF 3ARVA 1U21A 2CRZA 3IFOA 3VI3F 4QOKB 5FB8B 5CBAB 4Y4HB 3DTDA 2NLJB 4HHGA 1OAZL 1HZHH 1TMCB 4HH8A 3LNHA 1IARB 5DJ8A 2YZ8A 1NEZA 3M17A 1AZCA 2XX1A 5LHDA 4O58H 3BPNC 5MEQA 3MRCA 2ED6A 1MY7A 4I2XE 4AGNA 1HXMA 1X5FA 3B9EA 2WB7A 1R3IL 3BXNB 4PJEA 3O8XD 1RLWA 4FP8H 4LNVA 5F6HI 1BP3B 3AWFA 5D7EA 4KI5E 4XP1L 4CNIB 4EN2A 1D7DA 2QPUA 4ZFOL 2Y06H 3VFTA 1PFCA 1N6UA 1CDUA 1ZAGA 3EZJB 1O7VA 3OLIA 3KPPA 4JFZL 2GJZA 3X2QB 2GC7C 3JVGC 2ED8A 2R56L 2VLJD 3SGDI 4PWJA 1KYFA 4JM2D 1WEJH 1CI3M 2AJXH 4G42B 3VI3A 1E8XA 1ZV5A 4FXGC 2WP3O 1KJMA 4NHCL 4Q6KA 2R1XB 3IK2A 4LKCA 5JHDE 3VFVA 4YHIA 2H0PA 2C3GA 3W9EB 1MJJB 3P9LB 4KK6D 3UTPD 3TFKD 4PHXA 2YRZA 1RZQA 3AADB 4L4VD 4OUUA 3GEWB 1V3LA 2BNRB 5KVFE 2DQDL 4OFKA 2HRPH 5JHDA 4QDGA 3VXPB 4XNZB 5I19H 1HXKA 1EEYB 3BP6A 4NKIL 3PQYA 2FX9H 1XO8A 2P24A 4U1NA 4DP5X 2JB6A 4NN7B 3F58H 2VDMB 4X6BB 1R3LA 3P3TA 4U1KA 1BVOA 2BIOA 3QULA 4CU7A 3JTTA 4OGXH 4OUOA 1YYLH 1HYSC 2J88L 1ULVA 4LEOA 2X41A 5LVEA 1A3LL 3TASA 2X6VA 5EO1A 1NL0H 5ELIA 5DRXA 2WIMA 3BSZL 1FLTX 3C8HA 3FRUB 3RFZA 1AHWC 3SGJC 4HSQA 3U2IA 3OB8A 3GSUB 2WVVA 2HRHA 1JGIA 1GGBH 1YAZA 1HXYA 1I31A 1WFUA 3WXVL 4IIQA 4KMTH 1KDJA 1JHTB 1EGJA 4M8UA 3T65B 4KV5E 4PJEE 1HL5A 1LO3H 2NY4D 3CIAA 2RFXA 3VFPA 1FWXA 2ARJQ 3BX7C 1CICA 1NLBL 2P8MB 5IIEB 1KPRB 2NNXA 3WYRA 4NXKA 5B3SB 5GGRB 2F61A 3PWNB 1CFSB 5IM7A 3O45A 1K4CB 2NNRA 1IB5A 2FX8L 5E94A 5B21A 1F18A 2YXMA 4X5LA 5DD1H 3S3DB 2QZ5A 3AAZA 4XVSL 4F7PA 3KBEA 4FQXB 1IFRA 1OW0A 2R0WL 4KU1A 4DK3A 1HCVA 4BFBD 2F8OA 2F6AA 2KZKA 4YDIL 2H1PH 2FGWL 3A3YB 4PRHD 1K72A 1QLEH 5D2LA 1J0HA 3GJFH 3FN9A 5JW5B 1NAMH 43CAA 1IBBA 2R29L 2XXCB 2P5ED 4RWHA 3KPRB 3FW6A 4JM2A 5ALCL 5DWUL 4Q6IC 2WD0A 1MH5A 4MDJA 4PMFA 5J1AB 4UZSA 5FFOA 5E5UB 4HJEA 1UWFA 4KI5F 2MQCA 4K94L 2NYKA 1GS8A 1JF5A 4FL4B 3UX9B 5CAYB 3VXRD 3BFQG 3IPFA 4AUUA 2JKXA 2CIIA 1DVFB 1EJFA 1J0IA 4JREC 1JZ8A 4MJ2A 2HVJA 2JKWA 3LS4L 4OJEH 1IGCL 5DHEA 1E50A 1OAKL 2NQDA 3LHPL 5KN5A 1ZTXH 4G3YH 3UOAB 3F85A 5K9KB 1RY7B 1ERNA 4ICXA 4X5PA 5EU7E 3DGGA 1DEEA 2VR5A 1D9KA 1H6TA 2DN7A 4AC4A 5IVXB 3SYPA 4DGYL 2CK0H 4L4TA 2ALAA 4JQIA 4F2MB 3HS0A 3WEOA 5D7LE 4XPTL 5B1AB 1NBYA 3CH1A 4F8QA 3CFCH 1SMOA 3QJHB 3S5LG 2GUOB 4G7YH 3UTOA 4LCCA 5TE4H 2EVIA 1I3RA 1J11A 4QKXB 2VSMB 4EIUA 1ZLSL 3UP6A 2YGVA 3DVNB 5JHLH 4WV1C 5AD0B 2K6YA 2A9NL 1ET5A 1W2KT 2F54A 1BZ9B 3WL9A 1NA8A 5EBLA 3ZX1A 2YKLL 1M7XA 3NDYE 5DRZB 1TTUA 5EEUA 4G7RB 4CILA 4ODUA 5C8JB 5T1DL 5EDSA 3ZR6A 1DUZA 2XA3A 4WW2A 4DETA 5GPRA 4X9HA 3BDXA 4XPFH 4DN3L 1QEWA 4IOFC 4PRAA 2ZUQB 3DSFH 2KBGA 4I85A 3BVNA 1YNKL 4I48A 5DI8B 3MOAL 1RJCA 4OR1A 2HYMA 2ZSWA 3A67L 4LSVH 3UTQB 1JYXA 2BHFA 5CGYC 1NPJA 1ORSA 3I9AA 2VGLM 3QQDB 1ZY9A 1XR8A 5CU5A 1KTRL 3W2DH 3BAJA 3MO1B 4AUYA 2C9SA 3DTXB 2NZIA 4TPRH 1TVHA 1G1OA 3BC9A 5DYFA 1AZZC 1OARH 3FF7A 5HJGA 2E9BA 4DKFL 4GAYB 4IMLB 5DK0A 4N2BA 1N8OE 4NQDE 4K3JL 1W6LA 4QHLB 4D9QE 1M3JA 3HJEA 3NRQA 2OS7A 1WHPA 1YSOA 3BW9B 25C8H 4LVHC 2RH0A 4QY8B 2Z35B 3QAQA 4NLHA 4DFHA 3U2SB 4RDQG 3QW9A 5GS1A 1FZOB 4H5SB 1TZOA 1AFVL 1XH1A 2DQGH 5AUMA 3ARTA 3IPEA 4G9FB 4QHKI 4F91B 5IOPA 5IF0B 2V17L 4GKOA 2WKOA 5AL8A 5C0BA 1A6VH 1U8KA 5HJ3B 1D5MB 1N10A 2P5WA 2IGTA 4TNGA 1HHIA 2HJKB 5FYKH 1RIUL 3CUPB 1ACYL 3UAJD 1AQ8A 4IBZA 3HCVB 1A7OL 5D72H 3KPOA 3CZGA 1CD1B 2I27N 3RWCA 4KTDL 1I4FB 4P23D 2VLKB 1E4XL 3UBXB 1HYSD 3JWNE 5I1CL 4OCRH 1OGTA 4OCWL 4WWKD 3REWB 2B16A 2DYSB 2BHZA 1SLWA 5T1DH 2EXWD 3J8F7 3PHOA 4UM8A 5FA3B 3N42F 3II1A 3U48A 1DQKA 4HV8B 3EH2A 4XPFL 4DN3H 2ITCA 1AO7B 5KYNA 5D4JA 4X4XB 3S8GB 2Y7MA 2NX5D 4GOSA 4WI2A 3AQXA 2VUOA 1HXYB 2JCCE 1HZHL 1MHCA 4U1IB 1S2EA 3HI5H 1XT5A 2EDJA 3OC8A 2K70A 3MRPB 2VRKA 3KLSA 4IU2A 1ODUA 5EU6E 4QF1B 1LILA 1QACA 2RFXB 1PLGL 2PWFA 1RPKA 2QVMA 4X8GA 4DOHB 3FN3A 3K5SA 4K3DL 4M7LH 2VR4A 3MNDA 5TGBA 4LSSH 3S5LB 4FP8L 2QGCA 4I18C 4QTHA 3LDBB 4NBYB 2NNAB 1MRCH 1W72A 3FT9A 1MOEA 4LU5L 5H4YA 5IP4A 4KXZH 3GINA 4D9QD 1GZQA 3L1OL 3W9DB 4LSUH 4LLMB 3ZTNL 3TPUA 1T1WA 2SEBB 1JYNA 1DQQB 3HUJA 3EO1B 3O3BB 1KGCD 3QULB 2CJUH 2DLEA 3U2JA 3GHEH 1MW2A 4IBLT 1KIQA 1JDCA 2AJXL 3CHQA 4KNUA 1G7JB 2AC0A 4LPUA 2V37A 1XGQB 2M1KA 3LEYH 1UKTA 3ESMA 4PJGB 5D4QA 2WUBH 2E4FA 3WIIH 5D1ZA 5F1KC 4WHTA 4YLQT 4FTVA 2GI0A 4AEHH 3AQDA 2IDCA 1FL3A 4LAJH 1HH9B 5AYQA 4PYGA 3VB9A 2E59A 3O4OC 4M7JH 3RRQA 4L3AA 4KNTA 5IT2H 1G0YR 1KPRA 3LZOA 4UQ9A 2EH8H 4XH2A 4E9RA 1L9NA 4KRPB 3QIWB 1OAQH 1OAKH 3LHPH 3OR7B 4W9CC 2DLHA 2MH4A 1SEBB 4LIQE 4R7LA 5B1CA 2BHYA 5KSBB 1CIDA 2HFEB 1E8WA 1EO7A 2HX7A 1LO4L 1NC4A 1HJBC 4OLZL 4DGVH 1FNEA 4OV6F 5CU9A 2VXVH 2E9GA 3PIQB 3TPKA 2IDTA 5EZPA 2HTLC 4I3SL 4P04A 3BD3A 4W4OC 3DV6B 2CUAA 5E24E 5KVGH 3ZZLA 5CNHA 2B7DT 3PGCA 3RGVB 1RV6X 1QSZA 4OGZA 3HMXH 2VDKL 2G9HA 3CFJA 4LPCA 4X8JB 3APCA 4I2XA 4F57L 4Q6IB 4WHYH 4I9WE 3KXFE 4QHMA 5I0WA 5TDOB 3RIAF 1AGCA 3QFGA 1ED3B 1P4BL 2IDSA 3CIQA 3JQOB 4PWGA 1IKFH 4RH4A 1CPUA 2ENQA 1IJ9A 4L8SC 1ZT1A 2J8UF 5I2IA 3WAKA 2IF7A 2WWKT 5D2NA 1F90H 1MCNA 1SY6L 5BOZG 2EXSA 2EDLA 4JQIL 4AMXA 4WI0B 1BHGA 5FYKD 3IXAA 1ZV2A 1FFOA 4YR6A 4B50A 3CXHK 1H9DA 1LO0H 3QDMD 3WEXA 1WFIA 3P73A 1G87A 1TENA 4FTVD 4HKBA 3ZXAC 5LG6A 2CALA 1SLUA 4Z3JA 1FNHA 1IBGH 5DC9B 4I9XA 1NIAA 1S7SA 1EK3A 1FBIL 3D52A 3M1BA 5CD5C 3D85B 1TVHB 4AEHL 3ME0A 2VRQA 4LIQL 3BUPA 4ELDA 3T0EE 4XGZB 1UH2A 3N55A 1NBYB 4ZO6A 4XNYH 4JB9H 5JMRA 1SXBA 2BSTB 1AGFB 1LHZA 1R5IA 4PRIB 1QRND 4LVNC 2O5YL 1MWOA 4WO4C 3RA7H 4AKQA 3TWYA 1A4AA 4GQQA 3TN0D 3MODH 1H3WM 1XGTB 2BCKB 2AS5M 4QRUA 4K5NA 2X2UA 3B83A 2WZPD 2CKBH 3NJXA 4RMSA 3V6BR 2RHEA 1U8JB 2DEYX 5KSAB 5BRPA 3VXOB 2EO9A 5FDWA 2NW2B 3CLEH 4X0KB 4XZUB 3TA4D 3O3DA 1BECA 1TPXC 4TLSA 1BA9A 5K39A 5JHDB 4U1HA 3S6CA 3X1GA 3V0VA 3A4FA 1JNHB 3V0HA 2EDFA 3QXTA 4ZNEA 1G6RA 5ANME 2AK1L 3C08L 3FFCE 1H6EA 1DLHB 3GLEA 1ZHKB 2G3MA 2HKHH 5IEKA 2OSXA 3HN5A 1RHHB 1MG2C 1ND0A 1OZTG 1Y6NR 4LRNL 1CFNA 4XNQA 3VWKA 2JQZA 3TM6A 5GGSB 1J9RA 1KEGH 4YPGA 3AU1A 1MAKA 5DZOA 2PCFA 1VEOA 5FYJD 1YEKH 3F65A 3VXSB 3DIVA 4W9KC 5F9OL 4OZHE 2UY6B 5HHVL 3T3MB 3T65A 2R69H 2NTSP 2QKIB 5A2AA 1ET7A 3ELQA 4LF3A 2OR8A 3FUJA 2V8MA 1T20A 4FNUA 3MGTB 3ZVVA 5GGRA 5E9NA 2NY0B 2JQMA 1JGDA 2PPCA 1X9LA 3UC0H 2P80A 4AK1A 4BFKA 4QRSB 2FQEA 2NY1D 5AVVB 4BKTC 4J2XA 4MJ6A 1R5VB 2KQNA 1GYCA 5FUZH 2EDOA 2CIKB 4DZBB 5D7IF 4OLXH 1RK0B 4P57A 4L9LA 5HPMA 5JW4N 1DE4A 4FZEL 3HVNA 3PU7A 4C55A 4DKTA 2ZUWA 4NC0B 4XBEH 4C83A 4UNIA 2WWMD 4EI6B 5AAMA 4E9XA 2H6PA 1M9SA 1LNUB 5SWZD 5L88H 2CH8A 4YL4A 4H8PA 3QPQD 4MMZB 5DC4B 1I1AC 4F9PC 1GZPA 4XVSH 1DANU 1OCOB 2XVBA 3UBHA 1CF8L 3D3VB 3V4PH 3ZO0A 1PG7L 1CYGA 8PAZA 4DO6A 3DUUB 1A1NB 4RGMC 5IB2A 4X6BA 5D6DA 3IDYB 5SV4A 2R56H 1RK1A 2PPAA 5DD3H 3TO4C 1FVCB 2PP9A 2XWBA 4LCIL 4Y1AB 4EN3D 2QPSA 4NO0A 4PJ9C 1MFEL 1DZ0A 3MNWA 4GT0A 4N5UA 1ZHNA 4NO5B 2BNRE 5LAXA 3T4YA 5KYXB 4U6TA 1P4IL 1MUJB 1QZNA 5A43C 1NCWH 3BRDA 1R1CA 3LQZB 4MNQD 5KVMC 3U0WL 2ZP8A 1O0VA 3DIFB 3EG9A 2CR3A 3OKOB 4NO2A 3NPSC 3TO4A 5C0IA 1UACL 5IV2A 3CSTA 5BZDA 5JTWA 3ZSSA 4BUGA 2KPWA 4MCZB 2XPGA 4JDTH 4LARH 2FLBT 2FBJH 4NM4L 5IJVB 2A9CA 4O02A 3ZDYF 1XF2A 4JO2H 4UUJB 1PKOA 5DVMA 2DMCA 1JYWA 1JVLA 1CFQA 3TVMD 5M7QA 2WUCL 1R34A 3P54A 4XO5A 3G5YA 1O6VA 5AZUA 5GHWL 3WN6A 5KBNC 4FFYL 2VLLA 3QT2A 3VFOB 3ZE1B 3GI9H 5DK2B 3AMKA 2QL1A 4QO1B 2RQ8A 1ED3A 1AS6A 1U6AH 3FTVA 3QWRA 3WUWG 3RVXC 4DO5A 3PWUA 1KCSH 3F6IA 1UENA 2BP8A 1E9PA 3FONB 3GMQA 5E9DB 4HDIB 1M2VB 4BM7A 1NEZG 2NNCA 4UU9A 1TEFA 4K3EH 4DCQB 5INCA 1QFUL 1QSEE 3ARGB 1WZ1L 1MEXL 1JWUB 2DWXA 4I1PA 3ERXA 1QQDA 2J6EL 4BV1A 4OZ4A 4F8OA 4XNXL 3JBG7 4QRBA 3AWGA 4FNLH 3PGFH 5G4OA 2R15A 1MHPL 4N1HB 3M1BB 2CIIB 1WCBA 1MSPA 2AXJA 3DJTA 3DTXA 4AOFA 3B7RL 1ITCA 2N7AA 1GOGA 2VDRB 1VGKA 3SGEI 4DEWA 5B8CC 1XAUA 1OF2B 2ADIB 4X6DA 3UAJC 2M8XA 5BO1H 4WWID 4YXLL 3SBWA 1YDPB 4G6FD 5DHVA 2DMBA 1NCWL 3RNQB 2NUTA 3WLWC 3DYMA 5GIRA 3U0WH 5DK3A 1IM3A 2MPAH 4JFYB 5HVGB 1UT2A 4JAMB 1Q9LB 5JMOC 3U1SL 2EP6A 3OKDA 2IWFA 4P0DA 3H3KA 1REIA 1M71A 2XJKA 3QO1B 1SEQL 3APFA 3L3IA 2BJML 5DSCA 4AQZA 4EEEA 1O5PA 4QPEA 5FO2A 1ZGLP 4NJ9L 1WZKA 3MRQA 5HGDA 1VAHA 3FDWA 2Y07L 3VXMA 3TBWB 3KPNB 1QR1A 2CHDA 5I1LA 4RGNE 1WFOA 5GS2H 2JKLA 4N20A 1ZTXL 3OGCA 4G3YL 4OU3A 4TNFA 3TYGL 4XMLH 1KIUB 1Q9WB 3EJPA 1SBSH 3O9WB 3TIEA 3RTLA 4GSDL 1JXDA 4B9IA 4X6DF 2WSPA 3MLSH 4NP9A 4PRAB 4W4NA 3TLRA 5MI0C 1Z5HA 2GJ6D 3CQFA 2RJMA 1FG2B 1A7OH 1QP1A 5HY9A 2X3CA 3H6JA 3WXWL 5H35B 2AK4E 2P8LA 1EEYA 3BP6B 4WFEE 2RACA 2I69A 4Y1TA 3CMOH 4FZ8H 2PXYC 4XHJC 4U6YA 3OQ3B 1LEGB 4J3UA 4IU2B 3ULUD 4PJ7E 5FGRA 4D7BA 3DHUA 4MA7H 4TQPA 4X9GA 3SQOL 1D6EA 4BFIB 5T3XH 2DM2A 4I3GA 3EJZC 2IPUK 1FFQA 5IJKC 2X0UA 1OKEA 4PJ6A 1AG0A 3RWFB 2Q8AH 6PCYA 2N1KA 2NDGA 1FBIH 4BXVA 5E8NB 1TU2A 3I6KA 1ZT7A 5I75B 1E4XI 4Y2LA 3G04B 5FGBC 4K94C 5LG1A 4HUUB 1PLGH 3STBA 1JZ4A 4QHNA 4WJ5B 1KBBA 3MRIA 4B9YA 2WBJC 5LKNA 2EUZA 4OQTH 1XL4A 4KJPC 3VAEA 2P48B 2VITA 3Q43A 2FD6L 3FB6A 4JY6A 5ENWB 2BS8A 2FJFA 2XZCH 4HAGA 3VFSA 4EI6A 1SEQH 2V3EA 2Y7QB 4LDLB 4RX4D 2OCFD 2VDQL 3V8OA 1SLVA 1MHHA 2WMPB 2ROYA 4MJHA 1XZ0B 4WWKB 4M62H 1U36A 1FZMB 3KJ4C 2DOCA 4PJ9B 3SKUD 5I26A 4PJHB 4Z7VF 2W9DH 3FUKA 2X7LB 3ESNA 1JN6A 2K1MA 2AJYL 5FK9A 2XN9D 4NT6A 4YSRA 1RK1B 3KPSE 5I1JH 1J8HB 1T22B 1P7HL 4JNXA 2AV7B 1TJGL 1R9FA 4HLJA 2WQ8A 4JFEB 5C9JA 2OYPA 1MIMH 4M56A 5IFHL 1S7XB 3HMWH 3SKOB 3ZHLA 3EOTL 1A4BA 4G80B 3SDCC 4ZI8A 4XZ4A 1JZDC 3IJYA 2RMNA 4NFDA 5HYFA 4M5YL 2EH8L 3I6LE 3QR2A 4UAOC 3KYOB 3BAIA 1CE6B 1CU4L 2PWGA 4ZTOL 1D2OA 1RZIB 2YUZA 3STLA 3ZPDA 2DDQH 3VGAB 3AREA 3L2LA 4NNXA 3T1FA 4A6YB 4M7ZB 3ARYA 4Y9BA 1P2CB 3LNFA 5T3ZE 2OMNA 2Q7YB 4PY8I 5DS8A 1LWRA 1NFDF 1QFPA 4FFZL 3FFOA 4ZMXA 1KPVA 2F18A 3IMVA 3HI5L 1G1KA 2NY0D 5KOVC 4I9WD 4LPXA 2F1EA 2PWEA 1HHJB 1NCJA 1T7XA 3MDJA 2Y7SA 3E80A 4YEEA 3R4DA 5D2LB 3MUY1 1VFBA 3EGSB 3IETB 4IS6A 3B37A 4G6AD 35C8L 4Y4KD 3NAAL 2GFBB 2OL3H 1EQWA 3D51A 3O41A 1MVYA 4B9PA 1VENA 3F7VA 5ICZA 2P24B 4U1NB 1RAMA 5I1HH 3QXWA 1AD9A 4N25A 3WUZA 3VWKC 4PB9L 4AQ8C 2AJVH 1OAYL 2Q3XA 2PO6C 3HI6H 1HHGA 4AE0A 3KLDA 4FE9A 4ZG1A 2I9TA 5I23A 4CKQA 3MCYA 5GRZA 2KL6A 4QHUB 4XGZA 2X0VA 5E2TL 4KZDH 4ETYA 2ISDA 3PJSA 1FDLL 2IH3B 4HEPA 2G3ZA 1KBWA 4CW1B 4EZLA 1UEYA 4HMEA 1NGYB 3B5TA 3RNQA 3W9DA 1DBBL 2EIMB 3UTSD 5FKAA 3U1SH 3CH8A 4HIXH 5HHQB 3U6RB 4CADA 2R59A 1DVUA 2VKWA 1RSFA 4ZAKA 4KWUA 4MD5A 1KJVA 2ZG2A 3FONA 3GMQB 2A9BA 3MBXL 5JIKA 4EI5B 3SDAC 5DEFA 1S7UB 4BQ8A 4ZZKA 4UIKH 4ETQA 3TS8A 4LPVA 1MW1A 2YAHA 3NPZB 4TVPH 4GH7B 1R3JB 5ID0A 1Y1DA 3QEUA 1L9MA 2I9LB 4PLOB 1HINL 1EPFA 3WI9A 4AGPA 3U9PH 4DW2L 4Z7VE 3KL0A 4XB7A 4NO3A 2Z0UA 4L5FH 1NCAH 1UZ6F 2HUEA 5EBWB 3E3QE 3V4VL 2APWA 1DBKL 4LCWA 1TLMA 4PJ5D 4MNQB 3RVWD 4D0DB 5LGKA 2OZ4H 4M8QA 5EU6B 3WXWH 3H6AA 1XCQA 4IRSA 4PRHE 4PS4H 1FFOB 3FT0A 3CQQA 3RX8A 3UABA 1DJHA 1DVSA 5F3HB 3RIFK 4P05A 3SBQA 3QORD 4E36A 2DD8H 2NUTB 5DC0A 3W81A 4L9DA 3WNPA 2N4IA 4XMKH 1F02I 4RFOL 5IHBA 1YMHA 4N86A 3TURA 4AENA 2HKHL 2W88A 3FTZA 3DIDA 3IDNA 1CL7I 4PM1A 4X98A 5G4NA 5E1AB 2CLVA 1DYZA 4P23A 1YPZF 4EUPB 2ZKWA 2QEJA 1LDSA 4ZFOB 2H1LM 2HG5B 1XCWA 4XI5C 2KS0A 3SDDC 3JZ7A 3REVB 4XX1G 1T7VA 4JRYA 5CR1A 4L8DA 3BVUA 1OD9A 1W8OA 2F53E 3Q8BA 1WC7A 3VRJB 3ZZQA 4Z7OB 4PJEB 1SHSA 4A38A 3LKOB 3A6CH 4PJFA 4KNQA 1H5BA 5AVRB 3Q5OA 1T2QH 2F5AL 4LCYB 1D6VH 3CX5K 3DOSB 2DY2A 4FGMA 4EF3A 3EYUL 5T8IA 4B3VA 5AENA 2B39A 4KBPA 1KN2H 5JO5A 1OALA 3EBHA 2J2ZB 3ZE0B 3WY2A 3AXHA 4XZUA 4LLVA 4W9LC 4TQEL 4Z0BL 4HWZB 4NN6B 1S6NA 1UT1A 3VXTB 1EFXA 3G5ZA 4OKVA 3FQWA 2HT3D 3L3JB 3Q2NA 3CC5B 4Y16D 1OPGH 4PJIF 4Q0XH 2SEBA 3TGXA 2ADYA 3VH8B 5IMOB 1PTZA 2VMCA 2ZXAA 3B9KC 4JKLA 3H9SD 4U6YB 5DA0B 2BSBA 2Y5EA 4XCFL 3P77A 1GYVA 4RMRA 1J8HA 1U92B 1S7SB 3BQUC 3LPFA 5FOBB 3S4SB 2NQCA 5FA3A 1C08B 4LDEB 4DGIL 5CM1A 1YEDB 3ILPB 4G6KH 5E8PB 4HUVA 4P5KA 4B95C 1N67A 2ZUYA 1UCBL 2E47A 2VXTH 4FLHA 1FQ9C 1G6VK 4G59C 2JCCF 4HMCA 5KYWB 2G0LA 3HNTH 1WHOA 4OBSA 5F9JA 4KK8C 3NCWA 5C0IB 4NQXB 4F15B 1BEYL 4JX0A 5H4ZA 2ZYIA 3IDGA 1FHGA 3MRIB 4JJOA 3LRSB 4MKTA 2WQXA 1HILB 4G9DA 1E5UI 4OD3L 4NZUL 1O7DE 3HRZA 1LDPL 5IK3B 3UBXG 1FZJA 3RL2A 3S5ZA 2JJTC 3PHQA 1A7QH 1NFAA 4IGBD 3ZSTA 3GSUA 1JCKA 4FD0A 4PWFA 3DSNB 4Z78B 4QRPB 2ZF8A 1YNKH 4JE0A 3SGDH 3V0VB 3ECBB 4LARL 5DZVA 3DYOA 1RZKH 3KDPB 1T1ZA 2P28B 1DQQA 3HUJB 4N24A 4ADIA 1EHNA 3X1NA 1QPPA 4ZOBA 3GXUB 5AVSB 5E5MB 1WSST 4XI5D 2OL3A 3H7BA 3BWUC 5KW9L 3NIGE 1CDYA 4OJCA 4R96A 2UZIL 4UF7C 2W65B 5DJCA 1XMWA 3TVMA 4DKEH 1HHIB 4TOYH 3CV5A 5EEVA 4KQ0A 3IRZA 5BCAA 4JPIB 4DCQA 2HT2D 1QYGL 4W68A 5DJDB 2X4PB 1KBKA 3MNVB 4IGBA 1HH6A 3G9VA 2ARWA 1F4WL 1ADQL 3C87A 2K7QA 1EJOL 2NY3D 3GYRA 3VB8A 3QCTL 2H9GB 4NPJA 4W9EC 5FM8A 4LK4A 2YK1L 3FT4A 3SDYL 4CSZA 4S1SL 1EFXD 4XP1H 4E5XB 5EU5A 5BUAA 1DFBL 2HT3C 4PW9A 5KSBA 1M7DB 2EZ0C 3FKUS 4G6KL 1B6UA 5L88L 1CI5A 5DRWB 1R5VA 2UUDK 1KACB 3D2UB 3IMSA 3NRPA 3QORA 3RWHB 1ZLDA 2HWZH 4HCRH 3EGDA 3NN8B 1BBDH 3ZE0E 3IU3A 3ZIYA 4D2NA 1B3IA 1WAAE 1SJHA 4NZUH 4KKCD 5IQ9B 2H6PB 3AGWA 1A1MA 5B1JC 1RZ8A 2Y5QA 4J3OF 3BWAB 4JMNA 1GZHA 3QRGH 2J6WA 1KG0A 5LBVA 3AQYA 43C9B 3OSVA 1CBVH 1ZOXA 4O51B 4XHJD 4YWGL 1YN7B 4OFPA 4WKZB 4TUKH 3FU7A 5JLZB 2HRPL 1KGJA 4UAHA 1IT9L 1DANT 4QYAA 1AGDB 4WHCA 3R06A 4L8BA 2XXGA 4XCNB 3L13A 2K9FB 1UA3A 3O6FB 4Y7OC 2EUWA 4XP9H 1JD7A 4MQXC 5KSAA 1GPOL 2OZ4L 5IB1A 4Z7WE 3D30A 5DQ9A 3BGAA 4R2GB 2Y07H 1NEPA 3CSGA 4RFEA 3GUTB 2OMUB 3L9BA 4P2QB 4S10A 5AQ0A 1BBJB 1HVXA 2H3KA 2XY2A 1AXSA 5KANI 3UCQA 1NCHA 1L7TH 3ULUL 1CMOA 3MLZL 5DQDH 1OTUD 3SGKC 4DGUA 2C4XA 3L2NA 1QW8A 1FORH 4QTFA 2G75A 2BVOB 1FE8L 4H13C 1IE5A 3FH8A 2FWOA 3KXFA 2D3LA 1LO3L 3NJIA 1PY9A 4TNEA 2QTEA 3RBSA 2ZX6A 1ZA3A 2C3HA 1RJYA 2F1AA 1QHQA 1AO7E 2X89A 4N8UA 5KVGE 4RSYA 3BVNB 1SJMA 3FU3A 3MNZA 4F8PA 4MB4A 3K46A 1QLFA 3TNMA 3NCEB 2FQGA 1C5BL 4AW4A 1FNEB 2D3JA 3PS6A 3UTTE 1GYAA 2ESVB 4Y2DA 5ICXB 1YVLA 1SGKA 1FFPB 2OI9B 3MZTA 4H0LC 3OJMB 3FQNB 5ALBL 5T3XL 3FO1A 3OKDB 5CUSH 1DTUA 2ARJB 2J6EH 3D6GA 1SBBA 5GS0C 4LESA 4MBRA 1GGTA 4DO4A 5MEPA 1AKPA 1CICD 5CEYA 4Z7NF 3UTPE 1G5GA 4CMMB 4OZGA 5D93C 2XN9A 2OXHA 3VGAC 1XCQB 4MMXC 4Y16C 4BSVA 5J4MA 2ZKHL 1NAML 2BVUA 5IHUH 4NDMB 1UVQB 2VXUL 3IGAA 3AS2A 2WLIB 3MRCB 3NTCH 2Y6SD 4PRHB 1FAKT 3D50A 3QG7L 5JXEA 4IJ3B 1L9OA 4KKAC 4WCYL 5DZAA 1BQSA 3FS9A 4HJGA 4BCZA 3C75A 1MJ8H 3H3PL 3T6XA 1SXZA 4O4YL 2BNQD 3FU8A 4M6MH 4P2QE 4PD4K 3KHQA 4XVJH 3QUXA 4N9OB 5DFVD 4RGNB 2GTWA 4XNZC 4BKSC 2DTSA 4JE4B 2IC2A 4YL9A 3GSQA 3KPSA 3FTGA 3ZRFC 5ID1A 3OAWA 2RBLA 1I7TB 4GW4B 4K9EC 3MJ9A 4PJ7F 3VH8G 1KCBA 4HFUL 3IDXL 3C5ZA 1NUFA 5CZKA 2YMOA 3AFLA 1FORL 1A8ZA 4DNLA 2E6PA 4F1ZA 4NN6C 4KH9A 1IFGA 3CG8A 5AALA 3MLUL 1FNLA 4X5QA 4QRSA 3EG9B 2XKNB 1E27B 5I1LB 4A68A 5MENE 1CE1H 1AZUA 1N59B 1GJUA 4QRQB 2OTUA 4ONHA 15C8L 4UV7L 4EDWL 1KELL 5KVDH 1BZQK 1Z9SA 2VJ8A 3FB5B 3EYVB 4WJKB 5CUSL 1MN4A 5EZJB 4JZJB 3WG7B 3FB6B 4JY6B 5ENWA 4DTGL 5B38G 1J18A 2CGZA 4EJ1C 3L3GB 5F21B 3POHA 4G8GA 3VSUA 4LLMA 2UXGA 1F6AA 1HH6B 1T1WB 1JAEA 4P2OD 4WVRA 3HNVH 3H9ZA 2VXUH 1G6RB 2FSEA 4KFMA 2WCPA 4MASA 3SY0A 4X5XB 1KYUA 3VNYA 1BXVA 3BZ5A 4O5LH 4FG4A 3FOMB 2Y2WA 5DHMC 4XB8A 3D18B 1KB3A 2B1HL 2BC4B 5KTEH 4R0LC 4FFVC 1BQHA 4Q9QH 3VXRA 3MU3A 4PCYA 1FI8C 3CHRA 1NCCL 4P4KD 4P2RB 4PB9H 4NQSA 1MFAL 2DWEB 4JFDB 2O5ZH 2QBWA 5FYLH 3MCKA 1OB1A 5DUPL 1P7KA 3UZVA 2WSDA 3Q0HA 1DJIA 3D1MC 5F3BB 2W9DL 1JV5A 4HGMA 5CJOH 4XH2B 5DFVC 6FABL 3FSWA 1PZAA 2OLDA 2YO3A 1J5OL 3COOA 1DBBH 3BVVA 3W0WD 4XPAL 4B41A 3LKRB 4YWGH 3A6OA 4AWJC 3CDGA 5ACLA 1EUUA 4Y19D 2F54E 4WY7H 1A3ZA 2KLRA 4CU8A 1E4KC 3VCLA 3TEUA 1U3HB 4PD4J 4HUXA 4X4ME 3MX0A 2IGFH 1I1RA 4L8BB 1JN6B 2J12B 1RIHL 1MFCL 1G0DA 3VGHA 3B8SA 3D5OF 3VFWB 3ZYIA 3QCUL 4YZWA 3TBBA 3UTTA 1WT5C 2CO7A 3C2AH 5IJCC 2A7BA 3L1EA 2PETA 1V27A 3I02B 4UQCA 5IROC 4EAEA 1PVHA 2UZIH 1BVKB 5HYSA 3KCPA 1FN4A 3UG4A 3QRFM 1S8DA 5ECJE 3SKNA 3JTSA 3PL6C 1SM3L 1RJZB 2E56A 3B56A 1A7PL 1WIPA 1DQVA 4X98B 3U4EB 3CJJA 3AY2A 1KWKA 2YFOA 2NY0C 4YE4L 1N6VA 2JIXB 2NY1C 4HS8L 4HIIB 1MZZA 1OGAE 3AG2B 3LRKA 5G5DB 4ZRGA 1KTBA 1JGLH 4G8FA 3OVUB 2ZT9C 2MCG1 3VRJA 4D9RD 4NRZA 1SOXA 2XIIA 4WZ9A 5LCVL 1T5WA 3GTTA 3LKOA 2CO2A 1YMMA 4IKKA 2OMTA 4X42A 4OZIA 2QSQA 5GS0H 3SEPA 3K6SA 2Q76A 2FUQA 4PAZA 2G0KA 2OQJA 2HVBA 1QEWB 5ABDE 2ROXA 2YQ3A 1PLAA 2LTQB 3VA6A 4WEBH 2CLRB 1PZ2A 5HGDB 1N0XH 3FF8A 4KAQL 5I66A 1CLVA 2ORBH 2ZCHH 3PAZA 5MI0B 1KGCE 1T0NB 3GMPA 1DL7H 1IM9B 1YNLL 1C12B 1KT2A 5E6YA 2YAMA 1ZLWK 3BYYA 4KQ4H 2XIBA 3HS8A 4HZAA 3WKML 2FWOB 3KXFB 2I9TB 4JREB 3HUJF 4LCWB 5DMGC 4M8QB 1KMGA 5HHXL 4AM0A 3HN3A 4O2CB 2FTAA 4QRRD 4H8UA 1TQCC 4PTUB 4IBVA 4Q7DA 5ADPH 2JTDA 2XYCA 2I85A 3KPQA 4F37F 4HZLA 1T1YB 2WLNA 4L4VE 4PP1D 3H9SA 4DGVL 1L0PA 1ZCRA 4XO3A 1IFHH 3QG6A 4LB8A 1A6AA 5LXVA 5I6PA 2MWCA 2NXYD 5IVNA 1TG8A 1USQA 1I7UA 3S36H 3U9PL 3B6SB 2UZPA 4WFHE 3HLKA 4Y2OB 4XCYB 1KB5L 2VLJE 3KGSA 3B2PA 2HJKA 1QFHA 5E8NA 2ID5A 5BQDA 4F7CB 1M1SA 1J1PH 2X4QB 2Z0BA 2MPVA 4R7DA 2YQGA 4K15A 4KKPA 5TE7L 3DPDA 4YNYA 4JAMA 3PUUA 3CN4A 1TJIH 3JUYA 4YDLB 5LDSA 2DD8L 4NC2B 5B3JE 2NY2B 3QUZD 4K3HA 2GBTA 4NIYE 3V0GA 4BDVA 1MZYA 3E7JA 3LEVL 3OTTA 4CC4C 3NFPA 5C0GB 5IFAL 5L4IA 1ZK5A 3E6FA 5ALBH 1P1VA 3PWJB 4YE0A 4HWZA 4IRSB 4KROB 4G1MA 4LCUB 4HOZA 1U3HD 2Q7YA 3KPNA 1IGJA 2WXRA 4Y8AA 4P2OC 3UERA 1AC0A 1XXDC 1ACXA 1NUDA 3CVIL 3J7HA 1B2YA 3QEQD 1OCZB 4Z95H 3GEFA 4GB9A 4LP8A 1TPXB 1F86A 3JTTB 3BN3B 2XFGB 2QMJA 3MXWH 3CZLA 2EJ1A 1UXLA 3LPGA 2Y3NA 1HHHA 1JZEA 3D0AA 3SE3A 1EGJH 3Q2CA 4MJIE 1VFBB 5EF3A 2BC4A 4UAOB 2XACC 3FMGH 4ZUSB 2J8OA 2OX5A 4BRVA 4X50A 4LOFA 4X9YA 5E5LA 3F7VB 2ZAHA 2VM4A 1KCUL 4LSTH 3VMNA 4QR7A 2OV0A 1PKQE 2W59A 3CVCA 4GG6F 4KNSA 4FN0A 3RTQC 4GXVH 2HJLB 5F9DC 3A24A 3KVQA 2N59A 2H2SC 2JLLA 2HUHA 3G08B 2AEOA 1RZIA 4PJBE 3U7YL 3HIZA 4N8VB 1URLA 1HDMB 4HIEB 1F5WA 4Z3IA 4WTXA 5FS5A 1OO2A 3OL2A 1EHLH 1G4RA 2OA9A 3V0WL 5EF2A 1V3JA 3CXDL 5E6RB 1PZCA 1WTGT 3V79C 1NIDA 4HJIA 3DX9B 1CLZH 4OB5L 3VQ1C 2XPZA 2AEQL 3DHPA 2VDLH 4JFWA 1HWWA 1DJZA 5DS1A 5MP6L 2IEPA 3CMOL 1RUPH 1X5JA 3ARFD 3U4BL 2D73A 4I1RA 4E9QA 2HZHA 1S9KC 3V7AG 2G3NA 5BVJB 5JXEC 5E4AA 2QHRH 2J21A 2EE2A 4O02H 3Q05A 2PXYD 4CMHB 4Z7WB 3MNVA 2YD8A 1VCBC 2QPEB 1UH4A 1H8LA 5HSFA 4WTZG 1I1AB 4YLCA 2NOYA 2PPFA 3DV4B 1H0DA 3GRGA 2O61B 5HI3C 1S5IL 4PH8A 4N2EA 5F9OH 5HHVH 3KEHA 4X7TA 2AV7A 3D2TA 1C5DA 1I85A 3WFBL 2VM9A 2W60A 1J10A 4U4BA 3MROB 2L7EA 2B4CH 4LLWB 3B2XA 3TTSA 4ANXA 2FO4B 2FD6H 2Y23A 4HIJB 5F71A 3GB7A 2YQBA 4HBCH 3UC0L 1X9UA 5T3ZD 4R4FL 3D2UA 2YOAA 5IQ9A 2BVTA 3DVIA 2AJZA 1QYGH 3K7UA 1KCUH 4LOEA 3N91A 4GUPA 4UQEA 3MCLH 3RHWF 2Q1EA 5AVXB 4R6UA 5HI4C 1KGXA 4PJBF 5L2KB 3DKHA 4XMXA 4B53A 2CO4A 3RWIB 5AAMC 1L5GB 1HZLA 3WTWA 4XWGH 3X11B 4BKLB 3WIFA 4Z0XB 2FWSA 3FU6A 4OZHA 4XXDA 5F7LB 1SF3A 4KMQA 5GIRB 1UD2A 3T0WA 4PMEA 4D0CA 4IGBB 3K6OA 3CXDH 3O9WD 1Z9LA 4IHBA 4V1DE 1OAUL 4KQ3L 4PRHA 1AIZA 4YFLI 4ANVA 4FG6C 1UB6B 1E9QA 2J5LC 4F92B 5HHME 4LCYA 1D7BA 2H9GA 5ERWB 4EXPX 2QVFB 2BSRB 2MKWA 2OSYA 2PUQT 5GGQL 1YQVH 4G8IA 2W9EH 3QUML 3JWDC 3QG7H 4LEXH 1K6QH 4DP6X 2FL5B 2BDNH 4X83A 5D1XB 1AGEB 4KI5D 5AB9A 2DM7A 3GO1H 3ZE2F 4XNDA 2B1AL 1ZA6A 4IKNA 3HS0B 5DQJA 5TE6H 4PSPA 1S5IH 1TF4A 4F24A 1BF8A 4XCYA 2P1YA 1SJHB 3QDMB 3QNZB 3MNZB 4YQXH 1K4DB 4PGCB 2V33A 4NS0A 1I3RB 4YHNA 1PNCA 3FQRA 2OMBA 1JVOA 2L7UA 3IFPA 4YEFA 5GHWH 4UT7L 1YN6B 2ZUSA 2Z7WA 3GMPB 3ZE2E 1MCEA 4PLJD 1E3XA 5I74C 2FB4L 3MJGX 3QCVL 1DLHA 2DMHA 4MD5B 5CZXC 1EZLA 4HU8A 1CYWA 3PWJA 2XN9B 1KCSL 1UYWH 1ECZA 4N0UA 5BRZE 3RWDB 2CO1A 4H88L 3K71A 4XNQB 3VWKB 4OVVA 4HFWA 5D7JA 2AK4D 5JIPA 4M3KB 2FYVA 3L6FA 4JFFB 4P5TA 3UAAA 4QUOA 4XXWA 3QZLA 6TAAA 5BZWB 3INUL 5AYUH 2KLTA 5CCHE 1GKOA 5DJXB 1DO6A 1TTRA 4DP0X 1I82A 5BZZA 3QP3A 5FOBA 2ODHA 4KVCL 5AOIA 1ETJA 4J3OD 3VJ6A 3M6DA 2H26B 1KY7A 1NMCB 4HV8A 3MA7A 4JFOA 3VMOA 5BXFA 1MDTA 3PJNA 5E08H 1ZANH 3F12A 3SYQA 1JZIA 2W0KA 1BIIA 4H8WH 1L0YA 3SPHA 2C34A 1JK8A 1COBA 2IIJA 2XZZA 3DX8B 4JG0L 2ZF9A 1R3HA 2NTFB 3EO0B 3IRCA 4ZO9A 1UZ8A 2F2HA 3QXAB 4HEPG 5I17A 2DKUA 3SDAB 5F1OB 1E8YA 3IDGB 4PG9B 4BJLA 4S1QL 3HMXA 4XN8A 3E8UL 2GSGA 1KLFA 1X7QB 5TH2B 1P9MA 2A6KA 3BUQA 4S1DD 5DFTA 3V5DA 1OAJA 1XGRA 3T0BA 2QJDA 5ESAA 2DQTH 2NPLX 1UXSB 3RL2B 5C97A 4L5FL 4E5XA 4Q9QL 1JI1A 1BFOA 3MXVL 4GI9A 3ZQWA 2UZXB 4LASL 4N90E 3V4VH 4BSVB 5DRWA 5E5RB 5C0BE 1QWHA 3CBJB 2GJRA 3KLLA 3MBWB 4K9JA 1U3HA 4PJAE 1E9OB 5FO7B 12E8H 3SE4A 5C09B 5CJOL 3SPGA 2YUVA 5E95B 4NJAH 2NW3A 4KZ0A 4R7NA 1RZJL 4WO0A 4TLTA 3VXNA 4GP5B 4HQQL 5F0JB 1FIGL 3ZDXF 1ZLWH 5DHYB 1A1MB 4FHKA 3W11C 2Z8RA 2DJMA 1U95B 5J3HD 4GO8A 3BWSA 1VESA 2WGXA 4OQTA 1YEEH 1UYWL 2EYSA 5E6UB 2VLRA 3TL5A 2GTWB 3PPEA 1ZHBA 5IVOA 3F05A 5K9OB 4E0RB 4H25B 4WV1B 4ONFH 2X4UB 3HE7D 1GVIA 3M7OA 3KM1A 2ZD0A 1A6ZA 1AR1C 4MCYA 1O5DT 2KH2B 1RPQA 3FYEB 1CURA 2UZYA 3AC0A 3QEQA 3G6JA 1F3JA 3KJ4B 4AM0Q 3LQAL 4EDWH 3L8QA 3CSYA 4PB0L 1J05A 4LHQB 4L4TE 1CFQB 4I8DA 4JFPA 4ENEC 2WPGA 1LEIA 2YXVA 3W5MA 2BP0B 3NMEA 3QIBB 1CYXA 4TVPD 4Q89A 4CVWA 3IGKA 2JK5B 4MCNA 4UOQA 5IMMA 3S2AA 3WIAA 3F6JA 4JG5A 4LCCC 1KJMB 4KDTC 4M9OA 1KGIA 2DQFA 2UWEF 3DURB 4DZ8A 5IB5B 4JY4B 1N3NB 2ATPB 5I1GH 4AYMC 3X11A 5I8KL 3QJHA 4GXVL 1UOKA 2XQBH 4UU9B 2XZCL 4I1NB 1A6UH 2AERT 1NM4A 4Z7WA 1OE1A 1B4LA 1YA5A 1CK0H 4JZOB 5EO0A 1B3JA 1N26A 3CVHL 3GLDA 4BWWA 1CFBA 2Q7AA 3HNTL 3LKPB 4Z7UB 5CBEB 3GBNH 4OF0A 1SN0A 3L95A 1ZGLB 1KCLA 1IKOP 2PYFA 4JGMA 5A2LH 5HGGS 2EO7A 2NCMA 2FR4B 4AYDC 1LO5A 5C0RL 4MDIB 4NHCH 2MKLC 1NINA 1QI4A 2EDHA 1F11B 4LEXL 4XNUH 1ZSDA 4H2AA 3F00A 3JWDH 1MIML 4JFED 3QO0B 5K1JA 5BNXD 2OPCA 4PEEA 3LCYA 3RDTD 3TBSA 1NMAL 4ODXB 1GA2A 2VXQL 3MO1A 1DQJB 3FCSB 1NDMA 2ZXDA 5C7XH 4ZFQA 5GRVK 3IE4A 1G9EA 2ICWA 1RERA 4N2IA 1RJLA 2HX8A 4WO4B 5JOFA 2AZUA 3BH8B 3BAEL 4OZHB 3LKRA 4WWOA 1OAXH 4XXDB 3C2AL 4CRPA 3SDDA 1I9JH 1MRFL 4GQRA 3OJDB 3Q3GB 1QR1B 3DXAD 1T03L 5CD5D 4PY8J 1JUFB 4L1SA 1E43A 4WWPA 1D9KD 4JBSA 1WPCA 1ZT1B 1OP5K 1T89C 1Z9OA 1NWOA 1OP3K 5F1NA 2EABA 5IMKA 4TRPH 5D7LB 1L7IH 3HZMA 2QSTA 1XAKA 5F9AC 3FFCB 4TLKA 1LQBC 3REVA 1AACA 2IMMA 2NMSA 3O8XC 3Q8AA 5DLML 4S11A 4UQBA 5JXED 1WAEA 3INUH 5AYUL 1N68A 2DBLL 2WLIA 3NFSH 1ZPUA 3NCBB 3JTSB 3Q9QA 4PJ8D 5HYIA 2EKSA 3SD2A 3VD3A 2UVFA 3SDXE 1RUQH 1NFDA 4KK5C 1RUAH 1U8HA 1OAYH 1OAUH 1FCCA 1IE4A 3D3VE 1QTSA 2VAJA 4XOBA 2Z92A 1ASPA 3M46A 4MX7B 4PJ5E 4XN5A 3MV9E 3BYTA 1JF6A 3QZPA 4H8WL 4I0PA 1BJMA 4JY5L 2VZUA 3BO8B 3GMNA 4WEBL 2VXSL 4PJGE 4JPQA 1JZ3A 1NCTA 1XHHA 4OGQC 2X09A 3F01A 1XXFC 5HHOE 1CS6A 2BIIA 3B6SA 1I9EA 4L4VA 2CLZB 1ETB1 3CH1B 3GO1L 4MD0B 1RZGA 2VDRL 4QHLA 3WFEH 5GGRY 1CXIA 1BQHB 1H3UA 4JQXA 4R4BB 3TBTB 1BFTA 2PLTA 4HEME 1Y18B 3RJQB 1KN4L 2IAMB 2VCOA 3FRPG 5KYYA 4GXUM 2WXIA 2DRUA 3H8NA 5HDWA 1L6PA 3HS9A 1A3QA 3VI3E 3D87B 4XE0A 4U1JB 5EWIL 4TQ8A 3L5WB 4V2BA 4R2GC 1CDBA 1MXDA 2XU9A 1T80A 3UPRB 4POZD 4XPTH 2BSDA 4XE5B 3SKMB 3ECBA 1QSEA 3IEAA 4JN2A 1OTUC 1XCTB 2X4UA 4H88H 2JB6B 3KPLA 3PWVB 2Q20A 2FSEB 3S9DB 1TO5A 3VWJA 3K6DA 1KOAA 32C2A 1PCSA 1L9TA 5C3TA 4KRMB 4R7XA 2V2WA 4KI5C 2GTQA 3W5NA 3VFUB 3WFHA 3IDJB 4X7SL 2KI6A 2LLLA 1FHNA 3CFNA 1NCNA 1TQTA 4W9HC 3BPLB 4U3CA 3Q6GH 3P2BA 2FNBA 3HOGA 5B4MD 1N2RB 5AAWC 2O5XH 3IAQA 5GS1B 3MBWA 2F53D 3DROB 4ZUTB 4WI6A 2CKNA 5CCKL 1PY4A 2APTA 3KBFA 1T04B 3NTCL 3WJLC 2ZXEB 4A2LA 3VU2A 4AY0A 1L9SA 1KBGL 2FZ3B 1ZTMA 2I32A 4NXSA 1S78D 2CO3A 5AAWA 3ATBA 3BKYL 1QSFE 1SJEA 5I1KL 4XN4A 3GPSA 3ZL1A 5F7EH 3ILEA 1RU9H 1E8ZA 3RGVD 4IJTA 3TBYB 3T0EB 5I28A 2OMXA 5JPMA 1CJYA 5HYQA 1ZGLM 1THCA 1WLHA 4ZAKD 3MRLA 4NRZB 2OR9L 4MAUL 4LSQH 5EN2A 3WTYA 3WV0A 2P46B 1R75A 4Q14A 3VWJC 2XZAL 1GOHA 4Q0XL 2X28A 5I74B 4YC2C 2HKFL 1I9IL 3P4NA 4N68A 3K6SB 4UNVA 1Q72L 4P5TC 5MHSE 5GGVH 5FYJL 4S1RH 4P3WA 3BKJH