3PAZA

Reduced native pseudoazurin from a. faecalis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
123
Chain Sequence
b'ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Site-directed mutants of pseudoazurin: explanation of increased redox potentials from X-ray structures and from calculation of redox potential differences.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Electron transfer
total genus 34
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 1997-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pazA00
2QT6A 1E5ZA 2IDTA 1GS6X 3CDZA 1BQ5A 1AIZA 7PCYA 2HX9A 3AG1B 4MFHA 1W6LA 4BWTA 3BVDB 5LDUA 2R7EB 1NTDA 4KNSA 5I6LA 1IKOP 3IEAA 4DP7X 1RKRA 7PAZA 3SBQA 5TK2A 1M56B 2B3IA 3ABLB 1NPNA 5B7EA 1YLBB 3OD3A 4F7KA 2J5WA 4YSRA 1J9RA 1SHWA 1T5KA 3GYRA 2W88A 4HHGA 2IWFA 3OMNB 1X9UA 1ILUA 2FTAA 2TSAA 3U25A 1BXUA 3QPKA 3FYIB 3FSAA 2IDUA 1ID2A 4GP4B 1EHKB 2UXGA 2EIKB 2XYBA 3QJRB 4PCYA 5ANHA 3DTUB 1AZCA 3ZIYA 2HRHA 3NP4A 2WSDA 2BW5A 1PLCA 1OE2A 2Y69B 1V10A 1CYXA 2CCWA 2YAFA 4ENZA 3H56A 2MTAA 2XV2A 1L9QA 3C75A 2DY2A 1NINA 4HCIA 3X1EA 1JVLA 2UX7A 2UXTA 3UAAA 3X1BA 2GIMA 1JZIA 1XB6A 1CC3A 1WS7A 2QPEB 2GHZA 1KCWA 5I6MA 1SNRA 1A8ZA 2IWEA 3HEIB 4YSSA 3TBCA 4A66A 3N55A 2HXAA 1AZNA 3CG8A 1PNCA 1OE3A 2XWZA 4WKXA 1HAWA 3WNIA 5I6NA 1AQ8A 1PF3A 2Q5BA 4E9RA 2YAQA 2EIJB 4A68A 2VM4A 1MG2C 3ZBMA 2AFNA 1AR1B 1PZAA 1RCYA 3ERXA 1OOWA 4PAZA 1NWPA 1CUOA 3ABMB 4M3HA 3TA4D 3NSFA 3MBWB 1NIAA 2Q9OA 3NJJA 1KBVA 4AZUA 2PLTA 2WO3B 3EH5B 1ASPA 2UXVA 3WKQA 2J56A 4YVUA 4BDVA 1I53A 3ABGA 4NERA 2ZOOA 1WAEA 2XXFA 1J9TA 3NJHA 4AKOA 3FQ1A 1JVOA 4Q8BA 4KOBA 3EH4B 5I26A 2BHFA 4A67A 4AKPA 2VW4A 4F2FA 3EHBB 3PAZA 4A2HA 2A3TA 4GXFA 1J5DA 4DPAX 1N70A 3NSCA 4G72B 3TASA 1L9PA 2NRDA 1ZV2A 2VM3A 4A2DA 4KO9A 3IE9A 4A2FA 4P5SA 4G71B 1BXVA 3ASOB 1NIEA 1FWXA 4HCFA 4E9QA 3FQ2A 1QHQA 1E67A 2PP7A 2UX6A 1MDAA 2IDQA 3AG2B 2BP0B 1AZUA 2YQBA 3WIAA 2H3XC 1XB8A 1OV8A 4DPBX 3FPXA 1TEGA 1KBWA 2QDWA 4HHWA 1BQKA 5PAZA 1UATA 1X9RA 6PAZA 4FA7B 2UXFA 3SBPA 1NWOA 3HB3B 2HX8A 1AS7A 1FA4A 5I5MA 1AZRA 4L0PB 5AKRA 2ZONA 3N2JA 3G5WA 4E9SA 2HRGA 2I7SA 4YVNA 1WA1X 5I5JA 2W8CA 4UANA 1B3IA 4E9VA 1NZRA 4KO7A 3FU7A 1E30A 2I7OA 2GBAA 3X1GA 3JTBA 3WNJA 1W8EA 2H47C 4HALA 1NICA 2HLEB 1BXAA 1DYZA 1M57B 4P5RA 2FT8A 4BXVA 5I28A 1V55B 4EF3A 3T6WA 2ZXWB 3H4HA 2XU9A 2YARA 2FNWA 2R7EA 3S3DB 3ZX1A 2IWKA 4Q89A 1OCCB 1XB3A 5I5IA 3FYEB 1L9OA 2YAMA 5A7EA 1N68A 1TEFA 3V9EA 4DP0X 2CAKA 1J9SA 4E9YA 4W1TA 3S3CB 5IY5B 3OMIB 2FT6A 4A2GA 4G7QB 2FQGA 4UF7C 5B1AB 2RACA 4AKQA 1PAZA 4QKTA 1BYOA 3IN2A 3CVCA 2XX0A 4GYBA 2YAOA 1ASOA 2EINB 1M9WA 1HFUA 2FT7A 4KOCA 3NYKA 3CVDA 3NJMA 1AG6A 1JXFA 3T71A 5B3SB 2ZWNA 2BP8B 4DP8X 4BK5C 1F56A 1L9RA 2TSBA 4DP4X 4YSAA 5I6KA 2VW7A 2EIMB 3NJIA 3UGEA 3T6XA 3UAEA 2BZ7A 3KW8A 3L45A 1EZLA 5F7BA 4AI7A 1A65A 1J5CA 2H5UA 4KNTA 4DP5X 2GI0A 3AZUA 2BW4A 3DIVA 1JERA 2XLLA 1ZIAA 2GC7C 3NJNA 1URIA 3NJKA 4K9JA 4AX3A 4DP1X 1ADWA 3OM3B 3WKPA 3FQYA 2YXVA 3D12B 3FT0A 3MX0B 1NIBA 1JZFA 4X4KA 1RZQA 3QJSB 4HAKA 2HZHA 2IDFA 3JT2A 4ZK8A 1A4AA 2P80A 4A2EA 2PPDA 2J57A 4W9ZA 4YSEA 1SDDA 2CALA 3OQRA 1HAUA 1ZIBA 2VW6A 3PPSA 1KDJA 4JKNA 4NAJA 4E9WA 3X1FA 2LLNA 1E65A 1SFHA 3X2QB 1ZPUA 1W6WA 3AG3B 1GY2A 1ET5A 3T6ZA 2DYSB 1AS8A 5I6OA 5E9NA 4KO6A 3PAUA 3QJUB 2DWSA 2PP8A 4YSOA 1ET7A 3NP3A 2XX1A 3UACA 3AY2A 2CUAA 4DP9X 1CYWA 1IBZA 3FPYA 3GDCA 2EILB 1CURA 4GP5B 3BQVA 1NIFA 5B1JC 4GP8B 4YL4A 2VN3A 3NJGA 4N8UA 4DP6X 3S8GB 2AANA 2Y1AA 4TXVB 3SBRA 3CDZB 3QJTB 3IBOA 2XXGA 4CSZA 1AS6A 1AZBA 2I85A 3FS9A 2MRYA 2VMJA 1JZGA 1OCRB 3H4FA 1KDIA 1OE1A 2AZAA 1J9QA 3UABA 1IBYA 2FWLB 5TK4A 2BP0A 2X87A 1GS8A 1MZZA 3QJVB 3S8FB 2CBPA 1JZHA 2GC4C 3IN0A 1PMYA 1WA2X 1TKWA 2PPCA 3CVBA 1OCOB 8PAZA 5FC9A 1GW0A 3FSVA 3NJFA 2QDVA 5EHFA 3T9WA 4F2EA 3SQRA 1GS7A 2XV3A 5I6PA 4G70B 1KV7A 2IH8A 4YSDA 4HZ1A 1GR7A 3TU6A 1XMEB 1BAWA 4JHVA 3NJLA 1TU2A 6PCYA 1QLEB 2DWTA 1SF5A 1L9TA 1AOZA 3ABKB 1BQRA 1PZBA 3DKHA 1PCSA 5B7MA 3T6VA 4G7SB 1AACA 1SJMA 2B08A 1VLXA 1OF0A 2E86A 2YAHA 2FJSA 1NPJA 2XUWA 2IAAC 2P80D 4YSTA 2JFCA 5D4IA 3GXUB 2BZCA 1AAJA 2IDSA 2CJ3A 1L9SA 1AG0A 1JXDA 5B1BB 4GY4A 5B1JA 2BO0A 2IH9A 4QLWA 2N0MA 2PPEA 3AW5A 1RZPA 2FQFA 3FSZA 1PLAA 4KO5A 1SHXA 5PCYA 2FQEA 2GB2A 1BEXA 1ASQA 1QNIA 2FQDA 2WO2B 1PLBA 4HCGA 2PPAA 4DP2X 1JZJA 4G7RB 4BWWA 3AG4B 2PCFA 3EF4A 1NDTA 4WTQA 2YXWA 4E9XA 4KNUA 2OV0A 3EH3B 3KW7A 1MZYA 4RH4A 1GY1A 1MG3C 1ILSA 2BP8A 3PLYA 1V54B 2YAEA 5B1KA 4BDVB 4E9TA 5B7FA 1A3ZA 3ZDWA 1SDDB 3FU8A 3PAVA 1NIDA 3FSWA 1OCZB 4UAHA 1ET8A 1BYPA 3RYMA 3PCYA 1PY0A 1IC0A 1ETJA 1KYAA 4YSCA 2BWIA 2PPFA 4NB7A 1GSKA 2OCCB 4YSUA 1SFDA 2GSMB 5AZUA 2DYRB 3CZUB 1R1CA 2JKWA 3ASNB 2VSKB 3NSDA 4JHUA 2X88A 3WI9A 2J55A 1JOIA 1KCBA 3TBBA 5D4HA 1ZDQA 2PCYA 3UADA 1IUZA 4FAAB 1A4CA 3PXLA 9PCYA 1JZEA 2VSMB 1WS8A 2XV0A 4HIPA 1JXGA 2QPDB 1FFTB 2BWDA 1AANA 4YSQA 4YSPA 3S3BB 2JXMA 4DPCX 1SF3A 4M4RB 3X1NA 5D4JA 5AFAA 3NT0A 3WG7B 2DV6A 1PNDA 2XVBA 2YAPA 3QJQB 4N4YB 1WA0X 5F7AA 2HX7A 1GYCA 3NSYA 3V9CA 2AVFA 4BWUA 3OMAB 3FU9A 3QQXA 2OJ1A 1KGYE 3FU7B 4BXSV 2PP9A 1A4BA 2AZUA 1PZCA 1DZ0A 1E5YA 1ZDSA 4CSPA
chains in the Genus database with same CATH superfamily
5SV4A 5K9KA 1MDTA 5C09B 4UQEA 3M6DA 2QJDA 5KBLA 5CN3A 5DUPL 1RJYB 7PCYA 1MJJB 3LKRA 3QI9A 2HMID 3O2DL 1KC5L 4MQXC 1FC1A 1QVOB 1WUNT 3IS0X 4TSBH 4JPKL 4JKLA 4CBPA 4KNSA 3C5SB 4X6EB 4JDTL 2GHWB 2EEBA 1LP9B 2R0KH 4U1LB 5B38B 5K69A 1LLAA 3VTTA 4Q9BA 1JK8B 4F7KA 5KJRL 1C7SA 2AXWA 4I8DA 2IVFC 3L3DA 5JXEC 3WTWA 3I3BA 1T66D 2K9FB 3CK0H 4XE0A 4P4KD 4XO4A 5IBLC 1N5YL 2QHRH 3C6LA 1TNNA 3PY9A 2ITDB 3CZSA 4QRSA 5AB1A 2FSEA 3P40A 3C6SA 4GJTB 5SWZB 3R8BB 1EDQA 2FB4L 3K4AA 2X42A 4PCYA 2IJ0C 1FH5L 2XPGA 3T3ME 4APQC 5EC2A 3ARZA 4MAUL 4NKDA 1CLZL 5C08E 1EERB 1X5ZA 4ZYKB 3HUJE 1RVFH 2XQBH 1AIFB 4O2EA 1T7VA 2P47B 4ENZA 1ZHLA 2A4EA 1HWHB 2I5YL 3H56A 4R6UA 5I75C 5B3JE 3O6LL 5DHMC 1A4JB 1O9VA 2TRHA 3BZ5A 3C60C 3AREA 3REWB 3X1EA 5IUCA 3B2MA 3DNKA 2UUDH 4HK0B 3U0WH 1ZK5A 4B9FA 2Y5QA 4X83A 1JGLH 4U1SB 4XXWA 5LNDA 4ADIA 3TBYB 2UVFA 1JNNH 5D1ZI 4OFKA 4O58H 2BERA 2X1WL 3WELA 2BIPA 3CG8A 1BZQK 3JVGC 3K74B 3EYVB 3ULVH 2HJLB 4JR9L 1EANA 4PB0H 5LWYL 3QI9C 4QYOA 2WLLA 2KQMA 3SZKC 5C1MB 2R23A 2Q5BA 3OLGA 4XBGA 4JFDA 2DQFB 1TVBB 3MREA 1TEYA 5B4MD 1X4ZA 4PJ9B 4J5VA 2J72A 4XR8C 2F8XC 1H5BA 1EAPA 1YQ2A 2O5ZH 2KERA 1OOWA 5BCAA 1QHOA 2Y07L 3JYCA 3QUGA 2PCPA 4YZFE 5C7XH 3GKWH 2YN5A 1T5XB 4S1DC 3MBWB 2FAUA 1TLKA 2FWUA 4P2OC 4XCCL 4ES8A 4NQSA 1K8DB 2WO3B 3MX0A 4HIHA 3TN0D 1QFOA 3SBWA 4C83B 5B39G 1Z9MA 3FRUB 3PWVB 5BZXA 3BO8A 3B5GA 4W9GC 5IB3B 4L1SA 3L5XL 4Y5VA 3SKOA 2ITCA 2K6WA 3LKOA 1CFQA 2A83A 2GG1A 2V7NA 2BCMA 3AUVA 1F4AA 1JFQH 4WU5A 4KOBA 1HHKA 4B9IA 3D4CA 4AKPA 4LE8A 3FTUA 1OP5H 5FA3A 3KYOA 2D3VA 4XPGH 1B0IA 1QG3A 3X3FL 2P24B 5JOEA 6CGTA 3U1SH 2EVIA 3IXAB 5F0MB 1HQRB 3ELQA 4OUUB 5DEZA 5FYLL 5EC1A 3C09C 4ELDA 3MDJA 3KGTA 1QSVA 3VXME 3MV01 1JWSA 4FJ6A 1FSKB 2IFFL 4XVSL 3KPRA 2QHLA 1G1OA 1ZTMA 3B9KA 1D7BA 3H85A 3P30L 4I3SL 3VDCA 1J8HD 2XIIA 4RWYH 3SY0A 4DPBX 4JL1A 3DXAE 2V8MA 2QDWA 4B50A 4U4BA 4WHTA 4R9HA 1JWUA 2AQ2A 3PHSA 1TTRA 1X9RA 5DA4A 4KK5C 4HZLA 4GXUN 4P23A 3W9EA 4DEPC 1KYFA 1WCBA 3L3KA 3HBPA 3OAZK 5F7WC 5CCHE 1BQUA 5IMLB 1YYLH 1MRFH 5HGBA 2A74C 1IKFL 2HFGH 5B22A 1NMCB 3IJEB 2NUTB 3EOBB 3FFCE 4G7YL 1KBPA 3FUJA 4K9EC 1CD8A 4RA0C 3T3MB 2IFGA 2YPVH 4HXBL 5FA4A 1BQHA 1N3NA 3DX0A 4QHLA 3P9MA 4XMKH 2IH3B 5C08B 1VKXA 5HDQL 3KPSE 3HUJB 3HG1B 4PP2B 4HHAA 4HWZA 1UWGL 3QNYB 3FHAA 1MQKL 2B0SH 1AGFB 5F97E 4XI5D 2JCCF 2GAZB 1VF5C 3UIZA 1Y6KR 3VXRD 2EDRA 1DO6A 3GDBA 4HD9A 4HIEB 5EZLA 2ZXWB 3R7QA 4IRSA 2M2DA 2ZKYA 1CGXA 3Q43A 3SKJL 4KTEH 3UG3A 4XO3A 2O5XL 4AYFA 4Q9QL 1G9NL 3O9WB 5EEXA 3KLLA 5EULV 4JFXB 1DLFH 1H15A 3QUMB 3B7TA 1CE6A 3KLKA 4M93C 3JTSA 3F7VA 3U4BL 3RBGA 4YHLH 3WIHL 4PWEA 2JJSC 3DURA 4RFNB 4LPCA 3OMIB 2I9LB 4FXTA 1Z0MA 4NHUA 3AB0C 4Z95L 4DGYH 4BFBD 4ANVA 4CUCA 5GZNA 1U91B 3DV6A 3TWCH 5DD0H 1FYTD 3ARFB 1KPUB 2EINB 4MXVF 2QVFB 5FF6B 4NQUA 2YD3A 4U6XB 4MAYD 1WWAX 2IGFH 5KS9E 3D2TA 2YGOA 3ULSA 5D8JL 4KTGA 4UWQB 3FT3A 4GKZB 5FB8A 2WCGA 4YJZL 4HUUA 4WWKC 2J5LC 3QBTB 1OF2A 4OZFB 3S35H 3WS3B 3IDNB 4GAFB 2Y7LA 3QH3B 3DVNB 5LCVH 5KBDA 2XZZA 4L4TA 1JERA 3BUYA 3V5KA 3V0HA 3S88H 5CAYB 4JRYE 2QPUA 2J12B 4DP1X 1NQBA 3DTXA 2ZG3A 4JFFD 5DFVC 3UH8A 1GC1C 3F2LA 4ZBJA 2DYPB 2N59A 4U0RB 1OHQA 2CCVA 3C6EA 2L7QA 2WOYA 2LHAA 2Y7MA 3VXMB 4QRRA 3QJSB 1BJ1H 4PJIF 5DJYB 3KPLB 1RIUL 3E80A 1J0KA 4P5TC 1KXHA 3BGFB 3MTRA 4Z78B 5JYMA 1CQYA 1DJYA 1YNKL 2CALA 1JPGA 3ILQD 1Q1JL 2MCPH 4N0UA 4XPAL 2D7QA 1UJ3A 2KT6A 2RIKA 3RB5A 2D8KA 3DXAB 1RLWA 3IMVA 4DIXA 5F0PB 2JXMB 3CFKA 4D9LH 4XBMA 4MJIE 3RZCA 2H3NA 4UYPA 2ICEB 1GY2A 1DVFA 3OC8A 1E8XA 2AJZA 1X7QB 5EZOL 4LLUB 3CUPA 4E41D 3BSHA 4D7BA 4UV7H 1EZUA 2K9UA 4ZUVB 5DHYB 3VFSA 5JHBA 1Y0LA 3FFCB 1OT1A 1ET7A 3P9WB 3UJTL 4DN4H 5BRPA 3AITA 2K8QA 3WE6B 1XZWA 1U3HD 4FQ1L 1UA6L 4AIXA 3OKEB 1W16A 3WFBH 3KPSB 1F6FB 3C2AH 3DDGA 4NZTL 3C5ZB 1U58B 1MFEL 4LDEB 4AIEA 1K6QH 3IKKA 3K0YA 3Q8BA 5FEBA 5I0DA 4FLOA 1PJ9A 2JELH 1UWEH 1A5FL 2I85A 2IPTH 3BKJH 4RFOH 1JDCA 1V5JA 1NM9A 2BCKA 2QADD 5TDPB 3UABA 1RPKA 2DQTL 3TTYA 2OR9L 1FHGA 1KNOB 1DQQA 1H6TA 3QJVB 1J1PL 1KEMH 4LZKA 2N7BA 4Q6IA 3M86A 4XCNB 1A7QH 1O6VA 5C0FA 4BEIA 1D5IH 1FGNH 4BSWB 2GKIA 3QDMA 3RG1C 2AJYH 5D1ZC 3ULVD 4QHKI 4POZC 1F45A 3Q9QA 5K9QI 3RIFF 2GITA 1GHFH 3SQRA 3BT0A 3GMQB 4UM8A 2IANA 4RMTA 4LGSB 3G5XB 2X4SB 5LBSL 3LNHA 3TV3H 5INCB 5T33L 3BVWA 1HOCA 3SCMD 3SE3A 5CZVL 2AEPH 5E8EA 3LEYH 1RIVH 5A2KH 4JO4L 2FO8A 2I9TA 4TS6A 2EIBA 4XPHH 3RU8H 5IB2B 3Q1SH 4RQQA 3IU4L 1WFMA 5DT1L 5T5FH 4FQQA 5EDXA 5DSCA 4S1QL 5KS9B 2WTPA 3PDDA 1KIQB 3D34A 1TTFA 2MEJB 5ABDE 2RALA 1E6OL 5KVEE 5D7JB 2R2CA 4G59C 1F6AA 4G8EB 1DO5A 5DK2A 4X9BA 2ITEA 2AJUL 3CHPA 4GLRH 4QJ3B 3DUUA 4N25A 5TF1H 4F1SA 2DL9A 2Q87A 2WIIB 3U6XA 4M9PA 3D87B 4JRYB 3TO4C 3EDKA 2OMVB 2P80D 1DVUA 3LXAA 3N6YA 1OXYA 4UQIM 1T22A 3RKDC 4EUPH 3GXUB 3HR6A 3T1WA 3HE6D 2W38A 1IB5A 2KKQA 4YLQT 1MLCA 4JFQB 1KOAA 3MRLB 2EDJA 5ACLA 5I6XC 3GSXB 3Q5OA 3K4ZA 2HJFB 4BE6A 3X14A 2D7OA 2GB2A 3O3EB 4U3CA 1NDMB 1RZKL 1UUSA 1UB6B 3DX7B 3KNBB 1JZJA 4PRBB 3RP1A 3NEOA 2CBMA 4EKXA 1NBYA 2FO4A 4WTQA 2AQTA 7TAAA 1A7NH 4MJIB 1LQSR 5FYLE 3ULUE 4HUKB 4LEBA 1UYWL 3TBVB 4FLHA 4XNAA 1F02I 5GGUB 1OPGL 1P7QB 2ZUXA 4H13C 4PHXA 2OMXB 3FU8A 1BVOA 4ZOCA 4ZTOH 4NZUH 1NIDA 4LLAA 3D0AA 1KT2B 2VC2H 4RIRA 2VXSL 1ET8A 5KVFE 1HXKA 3OSKA 4WU7B 1SMOA 1F0LA 4LVHB 5LLIC 2Y23A 3CX5J 1HIMH 4LP5A 5T1MA 5I76B 5F7DA 4X6BB 4B5EA 2X88A 4BYHA 1OEZW 3BKYL 4P57A 1AHWB 3QQ4B 4MCZA 4XOCA 5IVXE 3SDDB 5KN5B 4ZMQA 3P0YH 3PXLA 4HA1A 4Y88A 4Y9GA 5AOLA 3HZYA 2ZWLT 3MZTA 2CNYA 3GJFB 2NY2C 3GZQA 4KK9C 1Z5HA 2XWJA 5E23A 1CGSH 1I82A 5I1CH 2BIHA 2XV6B 1FNGB 4YSPA 4C4KO 5HVHC 2QSCH 5LGJB 1F1DA 4ZX6A 1BOYA 1IKNA 1HU8A 3NFNB 5KBPA 5K9JH 1BD2E 1QLRA 2ZXCA 4FQCH 2HWZL 3CZLA 4WKZB 1KIPA 2XVBA 3QEGH 3PP3K 1YO4A 3QJQB 1MAKA 3DX8A 4O02A 1OB0A 5E8DH 1EGJA 1BECA 3ZDZE 2WBWB 5D2NA 4K2UH 2KZWA 4AVKA 2Z7UA 2YSSB 1R5IA 1K5NA 3DVFA 3E0GA 4ZNEE 4H20L 3GBDA 4ZT1A 2YSTA 4Y4HA 3BSZH 1K9TA 1IAIH 1OO2A 1E5ZA 1RUAH 1WEJH 3BP6A 4FTDA 4WUKH 5JW5A 4GKSB 3EJRA 4NN5B 3SO3C 1AIZA 4FERA 4FD0A 1BJ1J 1IQWH 4OLWH 4BWTA 2YMTA 2VAAB 4H8PA 5CEYA 5A2IH 2F5BL 4GG6A 4GI6A 2EADA 4TF4A 5DK3A 3DOSA 4M6NH 4U2ZA 3BH8B 5D1XD 1NGWA 4M6MH 5J13C 1UASA 3QXDB 1CICB 1MI5D 2VDKB 4IKIA 4YSRA 2NYYC 2W95A 1GZHA 3DA0A 4S0TD 2X0UA 5A6MA 3NQIA 5C92A 5KYYA 4FNRA 4RRPA 4B7LA 4NNYB 4WI5A 5IB5A 5EU7E 1SM3L 5I74C 1THCA 2TSAA 1JNJA 3AT0A 3CPLB 3L95A 3HR5B 4GP4B 3R1GH 3ZZSA 1JGIA 4V1DE 2EIEA 2OXGB 2WWNA 4YHYB 1HK6A 3F6IA 2PWHA 2V7HA 3TT3H 4KGJA 1C5CH 4IDJH 3QYCA 3QUYA 2ROXA 4OTXL 4OZIF 2XY2A 3VWJC 4O9HH 1CE1L 1G5AA 2IBZY 3L9EA 1E5UI 4U1HB 4HCIA 3A21A 5CBAA 3KBEA 3CZFA 1F3DJ 3MRQA 1DDHA 2ZSWB 3FN0H 1P6WA 4HGKC 3F3HA 2VLJA 4JAMB 4MLIA 4K8RH 3BHBB 5I6MA 1SNRA 2LGNA 1IZKA 3TBCA 3C87A 4P0DA 3W5NA 4IYKA 5AAMA 2BDNL 5J6HB 2YC1A 1DEEB 4NUPA 1J0ZA 4KGLA 4Y5YB 3C8HA 3B34A 3VDBA 5TDOA 3DK0A 4J3OF 4X5WB 2G0KA 2QSQA 1M6OA 3SDCC 4JZOB 4KHTH 4ETQA 3D0LB 2N4IA 3P3TA 2R8SL 1T2XA 3KS0J 4Z7NB 3ZZ1A 5IVXB 1JNHA 2H45A 4G6MH 4WGWB 4XCFH 1CG9B 1Z0NA 4NDMB 4DERA 2O6FA 2V4LA 4JO1L 2ROYA 3HPJB 1P4BL 1JF1A 1KENL 1MCBA 1NFIB 32C2B 4JGNA 3ABMB 2FHBA 3L3IA 3TA4D 3NSFA 1R3LA 5D7IA 5E8OB 5FUZL 4J12A 4RX4A 1F86A 5FM5M 4EUPG 2C9SA 3Q8FA 3UTQA 2HN7A 1BD2B 1F4XL 2GIYA 4HKZB 4L8DB 4LLMB 4JFDE 2BC4A 1CGYA 4FI8A 3HS0C 2ESVA 5JMOC 4G8GD 1CO1A 2ZOOA 4J3UA 1PPIA 1MJUL 2WANA 3N40P 4Y7OC 1U8NB 3DOIA 1QWUA 3WEBA 2NPLX 3ZDZB 2BSRA 3WUWG 2VZOA 2DQDL 3HRZB 3WE1A 1PZ5B 2NRDA 3GXMA 5GS3A 4LAQH 1U4FA 4WENB 4HPHA 1JZ8A 1FWXA 3PNWB 3OR7A 2H2SC 2LTQC 2X9YA 3DROB 4EQ3A 1NCGA 5JR1H 1EFXB 2GJZA 2XN9A 4JQXA 4OIIL 5T1KD 2JI1A 3BQUB 4N0FA 2YKLL 4MNHA 5AAMC 1G7QB 2G5UA 3MXWH 2ZCKH 2ZUSA 4P5MB 4UZSA 2QGEA 1NLDH 2RCSL 3GWJA 3DJSA 1YA5A 3HC3L 2CRZA 2DLTA 1NL0H 1RZ7H 5E51A 4KXAA 4G5AA 3B2UC 1H9DA 3HB3B 2EE0A 3BP5A 3MLSL 4Y0GA 2YZ8A 3CVIH 5K9KB 4L8SA 3U9WA 2BIOA 3SKNA 3KPRE 5A6IA 1YDPA 4PWKA 2ED9A 5DEJA 3VGEA 5E6RB 4M6OL 5TH2B 4TYUA 5I73B 2X2UA 1MHEA 3HPLA 4V1DB 1BZ8A 1RZ8B 1DP0A 3B7UX 3FT1A 4E9VA 2YD7A 4I18A 2ICWI 4ANKA 4X6DF 4X7SL 3SPJA 4B9KC 1MNNA 3L3DB 3N43F 3WLWD 2JLPA 4U1GB 3HLKA 1IEBA 1OTSC 1SXZA 3BWUF 1A7RL 3D3VA 2JCWA 2XZAH 4XMWA 5DD3H 4QRSB 2FSEB 3C6SB 3FQRA 5BO0D 1BZOA 5KVDH 1D2OA 1SJHA 1HINH 1QZ1A 5DO2C 1U6AH 2XPGB 4PRID 5HDBF 5EC2B 5EWIH 3T2NH 1L9OA 4GBXC 2IQ9H 4MYPA 2JIXB 4NKDB 1CT8A 2K1MA 2X6UA 3VI3B 3IGFA 4QHUA 4E9YA 1J9SA 2ZXBA 2Y0SA 4O2EB 4Q97A 3BZEA 2VRAA 2VXUL 1ZHLB 3RWGA 3U2JA 3A67H 12E8L 5IY5B 4XCYB 3RDTD 4G7QB 1G9MH 2BFGA 2FZ3B 3K2KA 4M1CC 5L88L 2O6DA 3BDYL 3AS1A 1KB5H 2GJRA 4JM4H 2L04A 2V5SA 2WUCL 1X5IA 4HT1H 4L8SC 1R75A 1UZ6E 4QTIL 1SGKA 1OAYL 1R47A 3LN5A 2BXYA 4QYOB 4P8QA 2WLLB 3PU7A 3VFPB 2R23B 4OLUH 4HEPA 4XOAA 4F93B 3Q5TA 2VDNL 3RX8A 5I6KA 4JFDB 1CS6A 3MREB 1YEGH 3GZPA 3L45A 3BPNC 2GIXA 3M8OH 4MD0A 5K9OB 5GHWL 1A65A 4HCRL 1IGIL 1CZ8L 2V0AA 4DAGH 4DP5X 3AZUA 3DIVA 5BZWA 4BQ6A 2R4SH 1HKLL 1EAPB 1P4IL 2ZUVA 2PCPB 3M7OA 3MLTA 4YFDB 5I30H 3SE6A 3OM3B 4HBQA 1FNHA 1BAFH 3MX0B 4HIHB 4X4KA 2V17L 2QGDA 5FO9A 5GRXG 4Z3TA 5AQ0A 3NGBC 5LBGA 4OCRL 5I0YA 3SKOB 2CDGA 2ITCB 3LKOB 1CFQB 2A83B 2V7NB 3Q13A 1FLRL 3HVNA 5FCUH 2H3KA 3PPSA 3GM8A 1YEIH 1HHKB 1PEZA 4L4TE 1CDJA 1FFQA 5FA3B 3TPUA 5HBBA 4QR7A 4D3CH 5E6SB 5GISL 5KVGL 2QSVA 3V7AG 5DQDH 2QLYA 1B9ZA 3OAWA 5HI3C 5EC1B 1U8PA 3VRLF 1GGCH 4QRRE 5F9OL 2YS4A 1GOHA 3EOTH 3QHFL 5J7CC 3KPRB 1SLVA 3HBZA 1IC7H 1PG7X 4MB4A 2A77L 1AGBA 4KKPA 5DFTA 3B9KB 4GXVL 5F21B 4N0UE 3WFDH 2VMFA 4JB9H 1IAOA 1UM4H 2AK1L 3GFUA 4OLYH 3ZTDC 4JPWL 4JM2A 3GDCA 5AWNL 1E7VA 2EDBA 4UNTA 3BCDA 1UOWA 4WHTB 1JWUB 3LS4L 4UM9A 2E9GA 4YX2L 5I0VA 1KZYA 4P23B 3EJJX 3W9EB 1L0PA 1WCBB 5L2KD 3IXTA 4PLJD 1CYGA 2JQZA 1MJ8H 2OZ4H 2FX9L 2EDTA 4L5FH 3QJTB 5HGBB 1M7IA 3WJMA 5JIIA 1C5DA 1OGAA 4ERSH 4G6AD 2P7TA 1J9QA 5KSBA 2J6EL 2PABA 5T5NG 1A1NB 3DECA 4D2NA 3L4UA 5FA4B 1N3NB 3UTPD 4QHLB 3P9MB 1MZZA 3KYAA 1GJWA 2Y3NA 4K8RD 5FYKE 1VKXB 2CBPA 1XZ0B 2R4RL 1F4YL 1OP3H 1VB9A 4HHAB 4HWZB 4RSYA 4RNRA 2IMNA 1T04A 3MNWB 1VFUA 3KLDA 4NZFA 3STLA 2VDPH 1N0XH 2IC2A 1HEZA 2EH7L 5FOBA 1JHLL 4HFWA 2BXZA 1LQBC 1MHHA 2M1KA 1XIWC 2C7UA 4JFZL 4UDTB 4ODTH 1MFNA 4AYFB 4DKEH 3DVGB 5JYLA 4IOFD 3V4PA 2E6QA 3PPEA 1H15B 3QXUA 4F24A 3MNZA 4EI6A 3QO1A 2JB6B 1MRDH 5DMGC 3TEZA 1F3RB 1L9TA 1D2PA 4F9PC 3DURB 3QDME 5IQ9B 1MXDA 1RZFH 5F1KC 1VRSA 4IKKA 4P3CL 1SUHA 2QELA 4Q0XL 5MP6H 1TMCB 3N1MC 3VXUA 2IANE 4NHUB 3T6VA 3VD7A 2P42B 2EJ1A 4MA7L 1D7CA 3RVXC 1LJMA 2AP2A 2BVTA 3DV6B 4WF7A 1VLXA 3PGDA 4UTBL 5E6IC 5D72H 4G8IA 1OAZH 2XUWA 3ATEA 5TFSL 1LP9F 3OGCA 4Y2LA 3VSVA 1DJSA 5KVMC 1AYRA 1QFUH 3FRPG 1BGXL 3PREA 4J6RH 3VUAA 5LN4A 1R4XA 2VDLH 2JB5L 3FT3B 5FB8B 1DE4A 1NCTA 1YEFL 4WWID 5C7ZA 4PTUA 3ECUA 2FQFA 5HPOA 3NSJA 1OF2B 2P8PA 2KZKA 3ZQ9A 5DD1H 5D7SH 2A7BA 1BQLL 3LXBA 4JN2A 5IFAL 4L4TB 2W1NA 4P4KA 3W11C 4GB9A 3JV6A 1MN4A 4TNVK 4OGYH 1KGCE 3FU5A 4W68A 3ARWA 4Z76A 4CGUB 4KHXL 4NQVA 4PVMA 5AALA 1HEHC 4W9DC 3BDBA 4TQIA 3LKSB 4U7SA 1I8LA 3SYAA 5A2BA 3LX9A 4QRRB 2DI7A 1HSAB 2OZNA 2VXVL 2R0WL 3EOYG 3ZKND 4UBDD 2UVEA 4CJ1A 2YAEA 2Q8BL 5B1KA 3WFHA 5K9QG 1JXJA 3PE9A 2C9VA 1HKFA 3QIBD 4G3YH 4HPYH 1JPGB 4PQXA 5DO8A 1UJ3B 2W80C 3KH4A 4N2OA 4LCUA 5BVJA 3UBXI 3HMWH 2V2TA 1PFOA 3CFKB 3MRNB 4HLEA 3RZCB 3TEWA 4XNQA 5F9AC 1UADC 4PJ7F 2AJZB 1GYVA 1Z66A 3B37A 3NAAL 4HF5H 1LO0L 3CD4A 3CUPB 4FFYA 1JNLL 3R06A 5IESH 3TBBA 4QHKJ 3AWFA 1VERA 1J86A 3CDFA 2QV2A 4MQSB 1J11A 2D03H 4HWEL 1JHTB 3CSPA 1L4IA 4PR5A 4WSJA 4XWOD 4PREA 2H1PL 4CSTA 4LRNH 1QD0A 5DVLA 3VM7A 3RA7L 3TWYA 4YE0A 1W0YT 1XD0A 1SHMA 4WQOA 3HVDA 2WQRA 1HESA 3E7JA 4LL4A 4UU9A 2BCKB 3MACL 4HJSA 4OF3A 3S2CA 4LCWD 4WI0A 3VU2A 5IMMA 5CWSA 4AYEC 3TN0A 3MRIB 2HYMA 3OMAB 1DQQB 4G9DA 2VXQH 5LO7A 3VRIB 3THMH 1A0QH 1XCWA 2DMBA 1EEUA 2FBJH 2VRQA 3PQYD 3ZE1E 2CM5A 5HSFA 3TJHD 3PWPD 3GEWB 3B4NA 2PWEA 3QDMB 4FE9A 3HG3A 1CB4A 1F4WL 2GITB 4YC2B 4UM8B 2G0LA 2IANB 3MSPA 4OB5L 3RTQC 2Y5EA 4KUZL 5EEVA 5LDUA 3CU1A 1QSED 2J3SA 1BOGA 2YLKA 1HOCB 1CFSA 3HI5L 4K94H 4XXCC 1WG3A 1MKFA 5D2NE 3MV9D 5E8EB 2BIMA 5CCGE 1RL1A 2F5AL 2I9TB 4XO8A 4RQQB 4HV8B 3CFJB 1I9JH 5I8OH 4QO1A 3VGGA 5DSCB 3L17A 1SHWA 5IG7A 1CBJA 3O45B 4AGMA 2CGYA 1J8HA 4G9FA 2Z7ZA 5GJSH 3NABL 4Z0XA 4WSKA 4FI6A 2FEEI 3HE7C 3FYIB 1KN2H 4GG6E 4AQZA 3Q1EA 5AZ2H 3DUUB 5LGYA 2P5ED 2KI6A 3L3GB 1QKZL 3A4AA 3ZIYA 3LRSA 5LUMA 2WSDA 1PLCA 5B39A 4UB0H 4FX5A 1T22B 5GRVK 2ZE0A 3N1QC 3WN6A 2DM4A 1EUUA 3SGKA 3DPBA 4WZ9A 4Y4KA 3H9ZA 1MLCB 3C2SA 4L3EE 3TCLB 1L9QA 3BGMA 2MOQA 2OAAA 5KW9H 3X14B 2QPEB 3OJMB 3SSGA 3DJTA 2DKUA 4GW5B 3T4YA 3KPOA 1HSBA 3ZKSD 3VXRA 1AQKL 3FULA 3ZTNH 2LABA 2F6AA 5KYUB 5C3LD 4ABQA 4JQIH 4FYTA 3CLEH 5KVGE 4CNIA 3ZT7A 2F54D 2IAMD 1IMHC 3GIVA 1PLGL 1G7JB 3S36L 2DKMA 4R26L 2C9XA 4LU5L 1MCPL 3WTVA 3LTVA 1CLOL 5GS0H 3LN9A 3P54A 5IHZB 2WUBL 3IB4A 2C1PA 3VGFA 5AVQB 5CJXC 2AXGA 5I0WA 3PWLB 3LMJL 1JWMB 3H9HA 4KJQC 4X5XA 4YZFF 1BM7A 4OVVA 1KBVA 5F7DB 4D0CA 1FYTA 2HB0A 4FNUA 5IHUH 1PSKH 3QIUB 4P57B 4MCZB 1N8ZA 3MGAA 5ITFA 4MAYA 1CDIA 2XWXA 3BWSA 5DZPA 1DVTA 1CI5A 5DVPA 4X98A 3HZYB 3F7KA 5L9DL 3EHBB 2XIDA 2XWJB 3CN3A 4H40A 4N3UA 5CLXA 5DZLA 1NGPL 5D7IE 5A2LH 5AL0A 4AL8L 4IRZH 3MJWA 3QORC 3IE9A 3ZE1B 4P5SA 4TN9A 2ZQKA 4ALAH 5B21A 4Q9CA 5DD6A 1YYCA 1Z32X 4RGOH 5DR5H 1KIPB 2ESVE 3UZQA 4Y1TA 4JFFA 4O02B 2EDHA 3DX8B 1IC4H 1QHQA 3BAEL 3S0PA 3S48A 3AG2B 5C0EA 4CKQA 4FABL 1BW8A 4XAKD 1F5WA 2YN3A 1R5IB 1K5NB 1BQKA 4G1EA 5F6IC 1WWBX 3IBEA 1RURH 1OTUC 3L5JA 4PJBB 4UT9H 5EOQL 4G11A 2JJTA 2DEYX 2VJ0A 4Y4HB 3BAXA 3BP6B 4XAWL 3S2AA 3PDOA 5JW5B 4B97A 2VDNB 2IALA 3QRGH 4LLQB 4G6JH 1J8SA 3QR1A 2XN9E 4G8FA 3UERA 5GGVY 4GG6B 4KY1H 5CUSH 5CEYB 4AYSA 3GS4A 1NBVL 5DJ0B 1B2YA 2GTZA 4JG1H 3DOSB 4E41A 1N10A 2LAAA 3DIFA 1BYNA 4FKKA 1QTPA 1G7MA 2YJQA 1MNUL 2WIMA 4GMTH 4QKXB 5ABZA 3JTBA 5I2IA 3MLRL 4Z8FH 1PZ3A 4DOHE 1D9KD 3RNQA 4L3EB 1NICA 1U3HA 4P5RA 3ML9A 3NFSH 5DK0A 3LJ3A 3LQAH 3LQMA 4K15A 2YARA 5EFIA 5GZOC 4X6CB 4Y8DC 2XWDA 1JGDA 3MJ6A 3JWOH 1CU4H 1AHMA 3P73B 2YAMA 2J4WH 3PAYA 1KJ3L 3DGGB 4I85A 2CHDA 5D5MA 5I19H 1CTOA 1N6VA 5E70A 4CW1A 1MFVA 4HUVA 2B4CC 1SBSH 4EI5D 1E28A 4G43A 35C8L 4CSSA 3LZOA 3D3VE 4RGNC 4AKQA 1DANU 3MRQB 3CZFB 3CX2A 1VEOA 4OM1L 3IN2A 4NNPH 4R4FH 5CINH 2NY3C 3FB7B 5CN2A 4PV1C 3LKQB 1R3JA 1XGYH 1RIHH 3ILQC 5JIDA 1M9WA 3U36B 4YDJA 1YECH 4NSKA 2OTWA 2Q0ZX 1ZE3C 2FT7A 2CHNA 5TDOB 4P9ML 3NYKA 3SCMA 4I5BA 3CVDA 3RBSA 3FTGA 3R4DA 2VNCA 5K33A 1AGEB 4DGUA 4ETQB 5KS9F 2BP8B 1WHOA 5AVYB 1L9RA 4P4RA 1UURA 1JNHB 5TE6H 4GINA 2BZ7A 2Z4QA 4CVZB 1VESA 4JJ5A 2KDGA 4X80H 5A16A 4J3WA 3QGVA 1O6SA 3PDGA 3SODB 1I9IH 3P11L 4P2QD 3V5HA 1JF1B 1Q9KA 1UD6A 3L3IB 3QHZH 1DQLH 1R3LB 3RWIA 2ZWSA 5D7IB 3ZIMA 2O5YL 2B2XL 4HK3N 3UJIL 1EAOA 4ILDA 4O4YL 3H7BA 1IFGA 3EJCA 3UTQB 1A6WL 2E47A 2HN7B 3U30B 4YHKH 2BC4B 1A9EA 2P80A 4XPFL 4XX1G 1S7UA 2ESVB 5H2BA 2NT1A 2A6DA 4G6KH 1WFJA 3HE6A 4R0LC 3HTLX 1E3XA 2Z64C 3B8SA 3MCLL 1KDJA 2CKBH 3QDHA 4H26B 1ZV5A 3P9LB 3RX9A 3TEXA 2K78A 4AEHL 4E9WA 2Z9TA 4FS0A 4J8RA 4TOYL 3DYPA 2X4UA 4DKDC 1NANI 3TZVD 5KANI 2KLRA 5ID1B 5C71A 1CFVL 1MFCL 1H6FA 3S37X 2ICWJ 3I74A 2K70A 3PGCA 3QA3A 3N50A 2Y36H 2L0DA 4KO6A 1KTLA 3OR7B 1H19A 4HYTB 4UT7L 2MQ3A 3ULVC 2GJZB 2XN9B 3FU3A 4N0FB 2Y06L 1RFDL 1X7SA 3UEZA 4GS7C 3D5OF 2CE6A 4UQ9A 2E7DA 4DHLA 3U4KA 1Q9WA 3SGJA 1JUFB 4NNXA 4DQOL 5IQMA 3DBSA 2PCXA 5EIIG 4XHJD 3B83A 4DOHB 4A37A 4JKWA 2AANA 2NNAA 1QFWH 2WKOA 3HAEH 4NBZB 2W92A 4CSZA 3DO3A 1SYSA 1XCXA 4L48A 2YPVA 4X9HA 1PTZA 1YDPB 3LRMA 2Y4SA 1V7MH 1BMWA 1FAKT 5DVNA 2P5WD 3SZ6A 1KCVH 2X87A 3HPLB 4ZZKA 4L37A 5IW3A 4I18B 4TUJA 3QNXA 4KI5E 3KWTA 4HOZA 3QPQC 4HXAL 2VXTL 1IEBB 1UGKA 5E08L 1JMZA 4D8PB 3D3VB 4QJ5B 4LSSH 3APFA 2W81C 3FQRB 2AJSH 2YUZA 3IJ8A 1SUJA 3MNMA 3OKMB 4FFZH 3BAKA 4ADJA 1QLFB 2ZCZA 5KSBE 2AVGA 2FE0A 3QFJD 2WOBA 5GS0D 1OLLA 1CT8B 1QO3A 4C56A 3OB0H 3ROOA 5JNYA 1Q4NX 3OKYA 4QHUB 5HP5A 6PCYA 4V2CB 1ND0A 3QHTC 4NQCD 3SGDH 1OAXL 1ONQB 2NY7L 2F0CA 2G9KA 4WV1C 3LS5H 4G7SB 1XTMA 4S1SL 4W6WB 4NRXB 3FO2A 4F7PA 1ZVSA 3RWHA 1F3JA 1OAQL 3T0EE 1FO0L 1IBGH 2IO5A 4QRBA 4JRLA 4QI3A 4Y2DC 4L1BA 2XN0A 3FXIC 2BZCA 4Z9KB 5IIEB 4GRLD 5HHMD 3D39D 3MLWL 4PY8I 3D69A 4KU1A 4PG2C 3ZTJH 4L8CB 1PDKA 3D2UD 3BFQG 5C6TL 4HU2A 1F8TH 5D1XA 4ADGA 5LCVA 2HUHA 3IMWA 3VXUE 4MD0B 1T03H 1MI5A 5PCYA 4LASL 4GIPD 3VAEA 1TZHB 4JPQA 1N7ML 4GQQA 2HVJA 4JRXD 2WINA 4LOUC 4LIQE 3MLTB 4L18A 4P9HL 3MO1B 1JP5A 2IQAB 2E9JA 5D2LB 2VZVA 3LNEA 4XMXA 1MUJB 3EYFA 2H9GA 3IRZA 1P7KA 5D4QA 1A1MA 4YHIA 1ILSA 3IDUA 3QXWA 4OI7A 1LWHA 4R7NA 2HLFD 5E5LA 4WI6A 1DFBL 2CDGB 2NZ9C 5EBLA 3S34L 4KQ0A 5BUAA 1OCZB 4UAHA 3ALXA 3TPUB 1VFBA 5F0JB 4C8XA 4EXKA 1ETJA 2CR0A 1WZ1L 5J1AA 3DLQR 3BEWB 4XNZC 5HHNB 1EZSA 3IT8D 1M4KA 2DYRB 4IS6A 1R0AH 1U8PB 2AAVA 3TX4A 1KWKA 4JKMA 4MBRA 2QZQA 4BE5A 2HKHH 5JQHC 3BGAA 4YHNA 3OKOA 5FGCB 5C0AD 1MCEA 5JDSA 2ENPA 3E1ZA 5C3TA 4F2MA 3GI8L 5ISZE 5ADPL 5CGYD 4JFYA 4YHMH 1J0IA 2RJMA 5E1AA 4B0MM 2AC0A 5DZOA 5HYQB 2C4FT 2XV0A 1E4WL 1P7HL 1JXGA 3PUUA 1H3PH 4H5SA 1ZGLA 4UM9B 4K55A 2QMJA 1HNFA 4DPCX 3P69A 5G5DA 5M94B 3WAJA 3J8F7 2NY5H 3OAUH 5DFAA 4UTAL 3O4LD 1JG9A 1ZCRA 3T65A 2ATKB 2R2BA 1T1ZB 3EDEA 1AFVH 2RBLA 3FMGL 3HBQA 1M7IB 3IDYC 4YR6B 3WJMB 5JHAA 1C5DB 4OCWL 2AXJA 5KSBB 3DJRA 4RISL 4IIQC 3BX7C 3RX5A 1E2ZA 4Z7WA 4I9XA 3MOBL 3IDXH 4G8GA 1R5VA 1ZWIA 3O0RH 2VR4A 3FFDB 3GZOA 1T04B 3D0VA 3STLB 3A23A 4RCAA 4HFWB 3UAFA 5EBWA 3AABA 2C7UB 1LWJA 2KL6A 3Q01A 1FQ9C 3GMNB 5T5FA 5D6DC 3T0EB 4PGZA 2E76C 3U2SA 3MNZB 1K85A 5T1KA 1P6AB 3QO1B 4LNRA 4X4ZA 4BK4A 4OD2A 1S5HA 1CDGA 4OM0H 1T5KA 1W91A 2Z8RA 3LPPA 1HH6A 2RH0A 2VDML 4LVNB 4P2CG 1WICA 4H7VA 4RSVA 1I8KA 2FBOJ 5C0BD 1T6VN 3U46A 5HJBA 3TM6A 1A6PA 3VXUB 4X5RA 3HAEG 2XBTA 5AOIA 3GSOA 5BW7A 1ES0A 4ZS6D 1XGPA 1Z5LA 5LQBH 1UD2A 4EUPA 3PGDB 1AVAA 1AZZC 2ATAA 5DRXA 2KPWA 2NZIA 4HLZH 1W0WA 4G8IB 3K2MC 3NCCB 1INEL 3KCPB 1LE5A 3OGCB 3X13A 1KACB 4DUXA 1HHHA 2EO9A 1ESOA 2ZWZA 1QR4A 3TBWA 1BZDA 3TESA 1J8HE 4YK4B 4G9FE 1AR1D 1DE4B 3QE5A 1RMFH 1FHNA 3QJOA 1IGCH 4PH8A 5DYFA 1OM3L 5F3HA 3WUWA 3ZRSA 4PTUB 4HP5A 2R29H 5E6YA 4MMYA 2P8PB 3UAAA 4WFEE 1ECZA 1CC3A 1QA9A 1TYEB 4HJTA 4JN2B 3N0AA 4UIMA 5I82A 4P06A 3IFPB 1MFBL 4JE0A 3OKKB 4P4KB 3CFCH 3JV6B 3WD5H 4Z76B 4DESA 5AW9B 2DEXX 3T5WA 2HH0H 1D6VH 4PRIA 5J11B 4ACPA 3C08L 3PWUA 4JE4B 1NCBL 5DJAA 4M8RA 1IRAY 2EACA 2MPAL 2R56H 5E5UB 2DWEB 3WFHB 4FQIH 1OL0A 5AZEH 5ISZB 3ME0A 4Y5XC 2XWCA 5J1TC 3EZJB 3MXVL 4NENA 1ZLVK 3RDTA 4YBHA 2VJXA 3VSUA 4LCUB 4M3HA 3NTCL 2EAEA 4ES9A 2FX7L 2V2TB 1TYRA 1F11A 3P1VA 4KY2A 4MXQD 3RGVB 4AZUA 1JFHA 4XNQB 1Q0YL 1X3DA 2VE6B 4RAVA 3U1PA 3NK3A 2J56A 1RJCA 3R06B 5F71A 4QCIA 1WAEA 3TF7C 1TZIA 4X99A 2VUKA 1R19A 1A02N 2PR4L 3HZVB 1GVIA 2BHFA 5E0FA 3FO9A 3T2QA 2GFBA 2OULB 3ROLA 1P84K 1A14L 4L1TA 1DSYA 4PREB 1X5JA 4J4PD 4XNUL 4DPAX 1QWNA 4ECNA 3ECBA 1I1YB 2R59A 2VN5A 1FYTE 3LPWA 3V4UL 2WZ0A 3RFZC 2ODIA 3D85A 5E2TL 4A7GA 1U3NA 1DBML 4UU9B 2LU4A 2DLFL 2IDQA 4WI0B 5FUOL 4CU7A 5IMMB 5CWSB 4CDHA 1SXSA 2JQAA 5E00A 1QPXA 2FJFB 4G9DB 5DTFA 2ED7A 4EXPX 2D9QB 4K9EL 2BNUA 3BSZA 5PAZA 3CWGA 4YUEL 1K4DA 2VJ8A 3A4EA 3V7MA 1I7ZB 6PAZA 4FA7B 2VZ3A 1S3KH 1NWOA 1DSFL 2ZOWA 4P49A 1WIUA 4JFFE 4R7DB 3DI3B 1CFSB 2QVMA 1J05A 4S2SA 3KLAA 1A22B 1B3IA 2UZYA 3FU6A 1Q72L 4FHBD 5GIRA 3WTSA 4KO7A 5E9DD 2MWCA 2GBAA 1U8LA 4QO1B 1M2OA 2IPUK 5IG7B 4XMPH 1XTLA 1P5UC 4P5KB 1J8HB 4XP6H 4G9FB 3MNVA 5GGSA 1DYZA 2PXYD 3II1A 4LDLB 1TFPA 3ALPA 4YXKH 2XXMB 1BAGA 1KY7A 2AQRA 2K7PA 1KV3A 4M1DH 2QTEA 2FNWA 4E36A 4PWJA 2EE2A 3GBNL 2EDKA 5L2KA 1GAFH 1FI8C 4CDGC 4E41E 3LRSB 1NLBL 5B39B 1DQMH 2DLGA 5AOJA 1CD1A 3AGVA 3DPBB 2Y6SC 4Z77A 2KPNA 4Y4KB 4H25B 1AC6A 2CA3A 3BGMB 4A2GA 4UOW0 3MLUL 4NXKA 2F8IA 4LDOB 5JORA 2UY6A 5IKCB 2HVBA 3GK8H 4KFMA 1XGQA 4M1GH 2FCBA 3KPOB 4XN8A 3CIAA 5ALCH 5BJTA 1TF4A 3GI9H 3US1A 1UHVA 3DK2A 1I8IA 3STBA 3PP4L 5D5ME 1BFOA 3VD1A 4FA8A 1K4CA 1JGUH 2GJPA 5LGHH 5FECA 2G5RA 5I17A 1UZ6F 3QUMH 4M48H 1E4XI 4MBOA 4DP4X 4YSAA 5C0DB 1X5GA 3NJIA 3UAJC 3U7YH 3LEYL 1MREL 1EZLA 4F8PA 4AQEB 1BEYH 4M5ZH 4TTGA 1LNUA 2C1PB 3K6SB 2GI0A 2BW4A 1KPRB 2DPKA 1ACZA 2AXGB 2VLRD 4UMGA 1URIA 2X09A 5ILTL 5MEND 4F9LA 5D70L 3M88A 1RUKL 5CXPA 4X7TB 1QSZA 3F7PC 3BN9C 2X0WA 4W9KC 1FIGH 3QULA 2C7FA 2JE8A 2PETA 4D0CB 1NIBA 4RGMB 3S7GA 1EHNA 5C6WH 5E9AA 4A2EA 3C9NB 4AV5A 1N8ZB 2LE9A 4PLJC 4MAYB 2DQUL 1A9BA 5IGXH 2VLMD 4X98B 4PJ5A 4RDQF 4OFYD 4AQ8A 4QPEA 1KCRH 2RA1A 4WEBL 3CHQA 5ALBH 3HCVA 4M56A 4MQ7A 2P48B 4ZDHA 1BBJA 3L3HA 3MZGB 1LEIA 2IF7A 3T6ZA 3HFMH 2FGZA 3I2CH 4ZFFA 5LAPA 1NAMH 3ARGC 1V3MA 4GW4A 3UZQB 4FN0A 4JFFB 4BH8A 1RQ5A 1OVZA 1FCGA 2LU3A 4W81A 4NKMA 5C0EB 5IWLA 3BJLA 4AV0A 5CGMA 3BWZA 3MUZ1 2TAAA 5C09D 3MBEB 5AW5B 1NDGB 1AR2A 4G1EB 2A99A 3MRHB 4JG0H 3QIBA 3BUIA 3LPOA 2V9RA 3MLVH 4NN6C 3KYKL 2XZCL 1IV8A 1LMKA 1R3IL 1T6BX 2IALB 4L29A 2WXRA 4J3XA 4G8FB 2E7LC 4TV3A 2OMTA 1KDIA 1KIUA 3GSNL 3D4ZA 3OG4B 3VQ1C 1T21B 3FRPA 2GTZB 4E41B 1GS8A 4FCAA 3ZKXC 3DIFB 1UWXH 1NCUA 3WKMH 4KROD 2DF3A 1JZHA 4JLRA 4OAWA 1G7MB 5C9JA 4RETB 1M1XA 5I2IB 2ZCHL 4L9LC 3RWJA 4L8BA 1KG0A 3CJJA 3RNQB 1U3HB 1BLNA 1ZT7B 1T2JA 3FUMA 4WY7H 3EFDL 2B5IC 4ENEC 5DK0B 1E43A 3LOWA 5FS5A 4YDMA 3KPMA 4G70B 3KWVA 1JGDB 4MRBA 3N9GL 1N18A 4QXTA 4Y1SA 4HLJA 4HKBA 1H3XA 2DIBA 3RIFK 5F6HI 5D5MB 1GCYA 4N2EA 2QADB 1X5YA 4CW1B 4LCWA 3IGKA 1VEMA 4S0SD 4N87A 5HY9A 4MWFB 4G43B 5BO1L 3F7YB 1KB5A 3MJGX 1NGYB 4ZO6A 4TNFA 3SQOL 1SDAB 3UTSD 4AQOA 1MXGA 3RY6A 4F15C 5E7FA 4WTWA 3VXSA 3TA3C 4WDIB 1HHIA 3CIQA 4C56E 2RFXA 3WL9A 4YDJB 3RI5F 4NSKB 5H37H 1OAUL 1HYSD 2OTWB 5FKPA 2OLDA 3TYFB 1QSEA 1DQKA 4R5XA 4POYA 3I50H 3A6CL 3SCMB 4I5BB 3OZKA 4PJ9D 1TTAA 3MV9A 3FTGB 1SEBA 1KIRB 2R27A 4AJ0A 4LCCA 2BO0A 1ZY9A 2X1XR 4P4RB 2Z4QB 5DVMA 5IJBC 4JJ5B 4XBPA 3C8DA 5A16B 1O6SB 3GHBH 3H3PH 4NUGL 5DHEA 4XVUC 1Q9KB 4AUUA 4N6QA 2KQNA 3M07A 1SQMA 4KKLD 1SVBA 3N1GC 1PX3A 1YY9D 4TSAL 4KJWC 5D1XE 1B0WA 1A9EB 5H2BB 4AGLA 1MI5E 1A3ZA 3EYOA 1T0PB 4IBSA 3BIBX 4P59L 1SBBA 4JGMA 3BVNA 3AMLA 1BYPA 1TENA 4J8RB 3R8QA 3WN5A 5LXGH 1J0YA 3B2PA 4JO8A 2FRGP 2X4UB 1G9MC 3NRFA 1TMQA 3WFEH 2BWIA 5E1IA 1HH9A 3LKNB 4YDKH 1WDAA 3T09A 1NH6A 2G60H 2GABA 2JKWA 3NSDA 4NWTH 3QA3B 2FR4A 1KCBA 3TJHC 1KTLB 1FCCA 2BX5A 2F54A 3QZNA 1TJHL 4MJ6A 5DUPH 1CFNA 5HHPA 3O2DH 2F7OA 2R9HD 4V2BA 4KZDL 4JPKH 3CDGA 1Q9WB 1XXFC 3BP4B 2BWDA 4JDTH 1NOFA 1U2YA 4TRPL 3WY3A 4N3TA 3IDJA 4NP9A 4FL4B 2FHCA 2NNAB 1I3UA 5KJRH 4IGBC 1OY3B 2BOCB 1C1EL 5C08D 1TO5A 3RUGF 4F2ME 2R15A 4GFXA 1N5YH 4OQTL 3HG1D 1ROCA 3QEHA 3WTTA 4KKAD 1AD0A 2AV1A 1O5DT 3UGUA 3GRBA 4JUTA 3V79C 4L37B 1O9ZA 1IGML 2FB4H 3WJJC 5E4AA 1UFUA 2YMOA 2NSQA 1FH5H 3T8XA 1W8NA 3QNXB 2BRRL 4MAUH 4D7PA 1CLZH 1PZCA 1T7YA 2I24N 4YFLF 3ZE1F 3OHXA 4PY8J 4U6HA 3O9WD 1GS6X 1LO4L 4A6YL 4BZ1A 2I5YH 3QUZC 3NRQA 5LHDA 1JDDA 3O6LH 4KUCF 2R7EB 3KEDA 4WHYH 2ZP8A 1RKRA 4DKFL 1MAJA 1YPZA 5DF0A 3VD3A 4OF7A 4C56B 4DQAA 4OZGB 4G8GE 5B1CA 2ENJA 5B7EA 1FV1A 2RD0A 1DQDL 2ZICA 4IOSD 4OF5A 4YXLL 2J5WA 3ZY7A 3L1EA 1YVLA 2YR3A 5HTSA 2IAMC 4JR9H 1SY6L 4U6TA 3FCGA 5KAQF 2FYYA 1NMAL 3C09B 5LWYH 1QZNA 4LFHG 5GRWA 3CBKB 4HJGA 3MMEA 1X5FA 3FO2B 1KTRL 4GG6F 1CR9L 4MJJA 2NW2A 3ZHFA 2DQCL 4WFGE 4MASA 4DK3A 4YFEA 4ZFOA 1T5WA 3SPIA 4XRCA 3IFOB 4L1LA 2X4QA 2WB7A 2Y07H 2VN4A 3D69B 4ONHA 2W60B 2NY1D 4X0KB 4ZRGA 4XCCH 1IILE 1BVNT 3NVQA 3ZDYE 4Q58C 4PY7A 4BIKA 3HN8A 2W59A 5GRUL 5CKAA 1D9KA 2A74B 2HVJB 1M7DA 4JKKA 4PS3A 5AB9A 2WXFA 1OHZA 2PR9A 3L5XH 4UQ3A 4W93A 3U0PA 4HMCA 3VXMD 4BGDA 1KWGA 2WINB 2VAJA 5GPRA 1FE8L 3ARBD 2D0GA 5IM7A 1QHPA 4G80A 3CFMA 2ZG2A 4LMQE 3X3FH 2H9GB 4U6VL 1P7KB 5DRWA 2CGZA 3H6JA 4UDUA 5FFGA 4YHIB 1PF3A 2EZ0D 2WQ8A 4PP1D 2YO3A 5IK3B 3T0BA 4GQZA 5FYLH 4HVBA 3DXAD 4NFBA 4ABWA 3EO9L 1M7XA 3QEUB 4YS4A 4XVSH 2IFFH 4LFHD 4ODUA 3ZBMA 5JW4M 3KCWA 4EI5A 2EO7A 5FYJL 3ZL4L 1RJZA 5DD5L 4PAZA 3RILA 5JPNB 1U8JA 5FM8A 2EDNA 2UZXB 4PLOB 1N0LB 2YD0A 4I3SH 2XZQL 2YOCA 2BP3A 4FQXD 5H37G 2J8UA 4IS6B 4PRIE 4KI1A 1XEUA 5L8JB 1O75A 2EDXA 4ZQKB 4PPTA 3QRFM 1M2VA 1J10A 3JWNC 2DWYA 4FQ2L 5JDSB 1YN7A 4F2MB 3KPSD 8FABA 5EUOA 4JFYB 4Q56A 5E1AB 1IKFH 4X0NA 2VW4A 1DJIA 1EAJA 2AEIT 1WBYB 4G7YH 1FAIL 3MODL 2GT9A 1JMXA 3SPHA 1KCSL 4HXBH 4A2FA 5D7IF 5HDQH 1O7SA 1SEQL 4H0HB 2PW1A 1H8NA 3T65B 2R2BB 1UWGH 4KTDL 4WGKA 1S7RB 1MQKH 3ECQA 4U6YB 4YIQA 1CD9B 5FW8A 4NCC1 2VXQA 2UX6A 1IBHA 1MDAA 2FJGA 2J5LB 1A6AA 3L9YA 2NLJA 4NOBA 4P46B 4RZCA 2H32H 5AW0B 1ZGLP 3MRGA 5C07D 4TQ8A 4M7ZB 3SKJH 5CD5D 1V3JA 3FPXA 3QIWC 1R5VB 4BKLA 2JI2A 3RL1B 2O5XH 4Q9QH 1G9NH 1UATA 4L2LA 5C97A 1ZWIB 5FV1L 3ZTCC 2PTTA 3VXOA 4JNXA 1VFOA 2EVGA 4GAJL 4J27A 1QQDA 5FGBA 3U4BH 3VX0A 3CSBA 3TZVA 3WIHH 1XCQB 3INUL 4OF0A 3L6FA 3IJSA 5EBWB 4BK5A 2VSDA 4HK3J 3V4VH 2A73A 4Z95H 1H8OA 4R90L 4FXKA 2CQVA 4H4NA 2D2CC 5D7JD 2NY0B 2WXJA 3U2SB 5T1KB 3FU7A 4LNRB 2VSCA 5EF1A 3IMRA 4BH7A 3EH1A 1HH6B 4L0ZA 3ZDYB 1I8KB 5FK9A 4WI2A 5D8JH 4FG6D 3GB7A 4O2FB 4F80A 5D1QD 3UTOA 1KBKA 5C8JA 1ES0B 1S8DB 1XGPB 1VPOL 1Z5LB 1PKQA 2X89D 2IWKA 1D5MB 4EUPB 3M1CA 1A1OA 4OLXL 5DVOA 3ATDA 3R0MA 1LE5B 3X13B 2E7HA 5I8KL 1HHHB 2I27N 2P5WA 1T0OA 3BFOA 3FKUS 4UUJB 3ZO9A 4AXWA 1AGDA 1F58L 2XTJD 5F3HB 3WUWB 5C0NC 2KZ1B 2E5EA 3GXIA 4MMYB 5C2BL 3WNLA 2M26A 3ZT6A 2VH5L 5KOMC 1OW0C 1RIUH 3I9PA 1MCLA 4JQIA 4MJID 5L2KE 4JVWA 2X70A 4Z7OE 4W9LC 1YNKH 3AM8C 4WHYG 2BOLA 2H0FA 3H1ZA 1P7QD 4A7VA 1Q1JH 4XPAH 4LLYA 5MEQA 1PG7W 1JD7A 3UO1L 4PRIB 1AG6A 1TCMA 3QFJA 3OZLA 3CH1B 3M17A 3UTPE 2D3LA 4BK5C 5DJAB 2D73A 3TBTA 4FLQA 3UGEA 4TQEL 4BZ1L 3BH9A 4M9OA 5I1GL 3GSNB 3ME0B 5EZOH 1J5CA 4NO2B 3V7AE 5EU4A 3WMSA 4NAQA 4NQCA 5GGVL 5EIIA 1PX8A 1YMHA 1BZ9A 3QPXL 4NENB 3RDTB 4Y9CA 1RULL 3WUZA 1J0JA 3UJTH 3WY2A 3SDDD 1RZFL 4XXDA 3TT1L 1JF5A 4FQ1H 3KD4A 1UA6H 4GUPB 4N2CA 4RAVB 4NZTH 5E95B 4NBXB 1MFEH 2YPLA 2V2XB 1A2YA 1A64A 5F44A 3CAFA 4QCIB 3DX9A 4GRLA 4X99B 2JKNA 5KBKA 4R3SA 4Z5RA 1A5FH 3D2UA 4JKNA 4QRTB 3FONA 4ZG1A 4IRZA 1W2KT 2GFBB 1YN6A 3AS0A 3ROLB 2DQTH 4TLKA 1ZV9A 2OR9H 3VFUA 2RB8A 1BVNP 1F00I 1K8IA 4XNMA 4PHZA 2Y5TA 5K5YA 3TO4B 4BM7A 1J1PH 2H8PA 3GSWA 3APNA 4JRXA 5FDYA 4GSXA 4RBPK 3NCJL 3ZE0F 3ZDXE 3D85B 1INDL 3QJUB 2XPYA 2MNJB 4J3SA 4MKTA 3QO0A 1U93A 3UTZB 3NP3A 4PJ5E 3I6GA 5E00B 5LBSH 1MVFA 1PGRB 4UT9A 5DTFB 5T33H 1JS4A 2C9PA 3OXRA 5E4EB 4A2LA 2BNUB 5CZVH 1AKPA 2K45A 4JO4H 1K4DB 2CPUA 5DEFA 3IU4H 5DJXA 5DT1H 1HT6A 2R69L 4S1QH 4AMKL 2BMKA 3LVEA 3FS9A 3FAWA 4LSDA 1DCLA 5K93A 2BHZA 4JDVB 1E6OH 1CICD 1OE1A 4FFVC 5AYUL 2BVQA 2YBRA 1P84J 5EO0A 2BS8A 2FWLB 1NCAL 3KLAB 3NOIA 3N3EA 2AJUH 2O61A 4HPOL 2UZYB 1HL8A 4FXLA 1EHXA 1EV2E 1XF1A 3DVIA 4PJDB 1KCKA 2GC4C 2GUYA 4MDIB 5GIRB 1BWWA 4MA1B 5C0AA 3D18A 4JM2F 2ZPKL 4ZODA 3VI4A 5I0XA 3FSVA 3L5WA 2NXZC 3MNVB 5GGSB 3ALWA 1ACYL 3ZMRA 3FCTB 1KGIA 1MCJA 4HIIA 2NQCA 1KTDA 2WBXA 5F9WC 4OJAA 5AENA 4FKEA 5KYNA 4K71C 4Z0BL 5IMKA 1ERNA 1JGVL 2X28A 4MB3A 5FYLD 5L2KB 1MF2L 2J1WA 3O4LA 4Z7OB 1P0SE 1XMEB 3LRLA 2CNZA 5E1QA 1RZKH 2JV6A 2EDLA 3NFPA 4ZMVA 5HGDA 1MIML 4U1NA 2IG2L 1CD1B 1ODAA 3UBHA 4Z77B 3M45A 2NNCA 1AOZA 4YL9A 4NFDA 1FN4B 3FOMA 5IJDC 3VD2A 4N5ED 2ADGA 5HVHB 4HH8A 4CMHB 1IEAB 5EUKB 4G83A 2Y2WA 4WTZG 1UYWH 5JORB 2UY6B 2ZYRA 1XGQB 2CR6A 1OPGH 3Q0HA 5BJTB 1CF1A 3OB8A 2IOOA 3NPSB 5FYJE 5ADOL 5AD0A 1I8MA 5K1VA 1E27A 5CM1A 3QZOA 2ZOLA 1I8IB 2EYTB 2VXSH 1BFOB 3DSNB 3TJEL 2JI3A 4ODHL 2HG0A 4LCWE 1FNFA 4FNSA 5I17B 4MS8D 5JA8B 3HNTL 1JZ6A 3HN5A 3L3OA 4UV4L 5IBTL 3QS3A 1PS3A 3BKYH 5TE7L 4ZUSA 4PCKA 4HGWA 2IV8A 3LD8B 2C5DC 4PB9L 3MCG1 4AYDC 1A3RL 4KRMB 2BNRD 4YDLC 3TVMB 2CIIA 3K91A 5CGYC 5C0BA 3VXSE 5HJ3A 3LB6D 1S9VB 3EF4A 2CA4A 4AQ1A 1QSEE 4R97C 3N41B 3ZUCA 4PJEA 3MV9E 1YJDC 4GSQA 1G7PA 3L54A 1L5GB 4A6YB 2CKBA 2QQNL 4ONOA 1N5AB 3O6KL 2DBLL 1B6UA 2HWZH 3SO5A 2QQKL 4Y16C 1SMDA 1XVSA 4PJ5B 2E75C 4ZX4A 1L9MA 4IKJA 1PY9A 4BINA 4PJ8C 2CK0L 3FB8A 3S5LG 3HCVB 4URKA 3LN4A 4ZDHB 3L3HB 2WKGA 3ET9F 1T0MA 4F8NA 2A6KB 4H20H 5J6GA 4XE5B 4LQFL 4NPKA 2A5UA 4WEEA 1GA2A 4BH8B 3QFDA 3N42F 4NKMB 3L7FA 3QUXC 2XBDA 3ESUF 3P4OA 5BVPL 3VH8B 3T1FA 2F5BH 4WHCA 1ORSA 4PJ6A 3ZVVA 3GUTB 1XT5A 2QPDB 5L2JA 3UJJL 3QIBB 3L3OC 1EEYA 1SF3A 3HAEA 4JMNA 4EN3C 5T3XL 4AVJA 3KDPB 1LGVA 2DV6A 1I4FB 1T3FB 4V1DD 1Q38A 1RP9A 1UB5A 2BP5M 4MRCA 2F54E 4UOW1 3SGEH 2OMTB 1KIUB 4M5SA 1AYOA 1SM3H 1HJCA 1M3IA 4DJMA 4KRPB 3FRPB 5B8CC 1LDSA 1JTTA 4LESA 3QQXA 4OAWB 4JLRB 4KTYA 5A2AA 4PS7A 5C9JB 2NSMA 1M1XB 3VXTA 3RWJB 2APVA 1E5YA 4L8BB 3FUKA 2QT6A 3FFOA 4OJEH 1QFHA 1BLNB 2EEFA 2MKWA 4FFZA 1FVCA 3I6LD 3LRGA 2JIXD 4J4PA 4U1JA 4OTXH 1EJ8A 2MQ0A 4EN2A 2DH2A 1CE1H 1UA3A 4TM9A 4X8JA 1W6LA 5DLML 3KPMB 25C8L 1E90A 3ECVA 3JBG7 4AYBA 4QXTB 4HKBB 3B9VA 4LSPL 4JO5A 3DJ9A 4TUKL 5ENWA 4AIZB 4ZUWA 1J12A 5EOTA 4LCWB 2BDNH 5HY9B 4OGAC 2IWFA 2CLRA 2JH2A 2ZWKA 2Z6FA 3JXAA 1IC4L 3OMNB 3TNNB 5C0CA 5I15L 1XH2A 1G4MA 1KB5B 1M53A 1DBAL 4DGIL 4XZ4A 5ACMA 2XFGB 3MBXL 2R8SH 4K7PY 5A40E 2IDUA 5IJVA 5JXAL 3OC5A 4Y4FD 1GGBL 1DL7L 1YPZE 2VN7A 3DTUB 3VXSB 5DHVH 1HHIB 2HRHA 3WL9B 3T4AA 4JFDD 4JO1H 4DZ8A 1PQZA 4ZMTA 3EXJA 1P4BH 1QSEB 1JRHI 1KENH 4CC4C 3P2DA 5BRZD 3TXAA 3WO4C 3MV9B 4J3OH 9CGTA 4XAKE 4LCCB 3A24A 3D51A 3NJVA 5FUZH 4MD5A 5E9DA 4FFWC 5BV7C 3CBJB 1YZZA 1F4XH 3P4MB 1SJXA 3GT6A 4A66A 3U6RA 2PXYA 2WWKT 1MJUH 3BWUC 4U3XA 2E7BA 1OE3A 3FT4A 4WKXA 4YBLC 3MCYA 3CV5A 2EKJA 3R0NA 2BM3A 3NJXA 5CJOL 2HT4C 1HNYA 2CLVA 2DQDH 1EH9A 4JFSA 3NRPA 1TPXB 1YEEL 2FO1A 3ABZA 1VGEL 2D4DA 3L1OL 4PJFA 2GTQA 4HX1A 2L7EA 4EAEA 3B2XA 2MKLC 2YZ1A 3MYJA 3TPKA 2VDQL 3EYOB 4A68A 5L4FA 3K6NA 4RAUA 4KKNA 4OIIH 1RCYA 4BQ8A 3WN5B 3FQ4A 2YKLH 2Q3AA 4PM1A 1HH9B 3QWQB 5HD8C 3PL6D 1T1XA 2RCSH 4PV8A 3U9UA 3UZEC 3HC3H 1CDBA 3H42L 5ERWA 2FATL 5I66A 2FR4B 1ZVNA 1NUGA 5I23A 2WGNB 1I1AC 3MLSH 2F54B 4NBYB 1IC1A 1VACB 2XA8L 1A6TA 4GAGL 3NJHA 2F7RA 3BUTA 4MJ6B 5HHPB 1CFNB 4A67A 1YEJL 1KY6A 4A2HA 2EE3A 2V5MA 4M6OH 1BZ7A 1J5DA 1KTBA 3NSCA 4W9EC 1KLGB 4MJHA 43CAA 1T1WA 3MOAL 3V5DA 2J8UE 3IDJB 3CNKA 2VLRA 2C3GA 4X7SH 5MENA 2ZAGA 3B7RL 3UYRL 4LGRB 4I87A 2H7WA 5EUOE 1A7RH 3LQZA 3RPIA 3AU0A 2WXNA 3QEHB 4IIZA 1AD0B 3IJ7A 3GSQA 1BM3L 1B2WL 3QXVA 4WNSA 3T8XB 1KBWA 4F7TA 3DPDA 3UXFA 2VDPB 4NGHL 3OHXB 4OFYA 4U6HB 3W38A 3LSOB 3ULAB 3PFQA 1TLMA 1J5OL 2VXUH 4NRYA 3QZWG 12E8H 2ID5A 2ZKMX 2OW7A 4LSVL 2HRGA 1RZIA 1B4RA 2W8CA 4KQ3L 2X10A 3VSTA 1W72L 3G5VA 5L88H 3BDYH 4FQPA 3D06A 3ARQA 4JQVA 4NFCA 5CZXD 3EO1A 2I7OA 1EDHA 4XNXL 3HI1A 4KRNA 1L6ZA 1GGUA 4HG4K 2WUCH 3TEYA 1TQSA 2VDOL 2HLEB 1M57B 1HL5A 4QTIH 4ABUA 1EXHA 1OAYH 4BGLA 5DWPA 2FYYB 2B4CL 1MJJA 3EUDA 3TTSA 1E8WA 4HJGB 2VDNH 3MMEB 1GIGL 3C5SA 4X6EA 3RWCA 1RJLA 2JQMA 1GJUA 1S5IL 5GHWH 3K1DA 4HCRH 1IGIH 1CZ8H 2W07A 4FG4A 4U1LA 4ZFOB 5A7EA 5JHDD 2OYLA 2X6AA 3FUIA 1HKLH 1P4IH 2VDLB 4YE4L 1OPOA 3AQZA 3I6KA 4ONHB 2R29A 1QSFD 1LM8V 2YFNA 4U3HA 3V0JA 2V17H 5JPMB 4WNJA 4UAOC 2Y1VA 3CVCA 3GMLB 4GFTB 4XMLL 4JY6B 1D9KB 4OCRH 3U0PB 1IE4A 2GQHA 4UQ3B 5DMIL 3DGDA 2WVSA 3MA9L 4J1UB 1DBJL 1FLRH 3NIDE 3QWOB 3GF8A 1OLZA 4OY9A 4XX1E 5IM7B 1HFUA 4ZYKA 1KUMA 4S0HA 1AIFA 4G80B 2P5WE 5SX4I 4KKZA 5GISH 5DRWB 5KVGH 4UDUB 3T71A 4YBQD 4DP8X 4P48A 4IKLA 1A4JA 5F7EL 4DK5A 3K81A 5F7BA 2UZIL 2YWYA 1GH7A 4UOJA 5CGBA 3K3QA 3VO0A 2W9EL 5F9OH 1W8OA 4MD4A 4QAWA 3QHFH 2UY7B 4U1SA 1RJZB 1QYGL 3BI9X 2WNXA 1U4EA 2A77H 1XEDA 1E2WA 2ARJQ 1U8JB 4GXVH 3ULVF 3NCWA 2OSXA 2B8OT 2VO8A 1IT9L 3EYVA 4JGJA 2C3VB 3LIUA 1G94A 3OV6A 3UTSA 4TULL 2AK1H 1URLA 2J8UB 4IRJA 4JPWH 3QFJE 5AWNH 4NN7C 1WT5A 4QLRA 3LS4H 3L1FA 3LPFA 3U48A 4J3OG 4YX2H 4XC1L 2DQFA 1HC1A 5F7MC 1YN7B 8FABB 1M05B 5EUOB 1OB1B 2FX9H 4NM8L 4PJ9A 4NQCE 4XTRD 5JIHA 4TLSA 4PVLA 1FFNA 3X1FA 5T3ZL 4NQDB 1W15A 1FORL 4EDWL 4OD1L 2J6EH 5TD4A 4WO4D 2GT9B 2Z34A 4ESKA 1MFDL 1NCDL 3P3RA 4LSQL 5L7XL 4KK8D 5LXVA 2A1WL 2R4RH 2PW1B 1HL4A 2FEEL 1F4YH 4WSGA 2YPLE 3PWVA 2EIDA 1NBQA 4YIQB 5HHME 3P2BA 2FJGB 4RZCB 4GRWF 1A6AB 2NLJB 3NCXA 2EH7H 3QW9A 1JHLH 4KMQA 3QDMD 2HTKD 4WEUD 3MRGB 2W0FB 4ZMXA 4KITB 5FO8B 2P24A 2DI8A 2J20A 2ED8A 2JKTM 1CXLA 4JFZH 1TITA 4NO5A 4WNQB 4BKLB 4GT7A 2YD9A 5B1JC 1CURA 3I84A 3WY4A 3W39B 4GP8B 2W65A 4MA8L 4X4YA 4JRXE 3S8GB 2FIRT 2W0LA 4F5CA 4OV5A 5JZ7D 1A25A 2WZ6A 4F7EA 3VYPA 3TZVB 4W70A 4J3OD 3L6FB 4R2GD 1I9EA 4HQQL 4P3CH 4Q0XH 2GSGA 4JG9A 2J1XA 4FXKB 4MA7H 4I1NB 4XMUA 3EDDA 2W91A 3K6FA 4HUXB 4OBRA 4B9GA 2VWEC 1D7DA 1OSEA 4UTBH 5JHLL 1KTCA 4WWOA 3EO0B 2AABL 4LPTA 5TFSH 5BZZA 4BH7B 2X2IA 5KZCD 4HOMA 2CBTA 4PV9A 4HJ0D 1H3TA 1SYVB 5GRYA 4OKVB 5FK9B 4MVBC 1BGXH 4JJOA 3GJFK 2WKOF 3GB7B 1MQ8A 5C8JB 1G7LA 2JB5H 2UWEA 3IJEA 5I1KL 5INDA 1YQVL 2NUTA 1KYDA 3O11A 1YEFH 1TVHB 1XSIA 2B9BA 2XNAA 3D07A 1J1XL 5IZ7A 2ICWB 1L7IL 1PAMA 1E8ZA 3TU6A 4BZYA 1BAWA 1BQLH 1UUNA 4N2AA 3NIDB 2IH3A 4JHVA 5IFAH 2J8OA 3HUJA 3ARVA 3ZSTA 3QNFA 3HG1A 4PP2A 3UIYA 2P5WB 3QNYA 3ZQXA 4ONGL 4KHXH 4Y2NA 3V2AR 3ABKB 2RQEA 3I02A 1G9HA 3C5JA 1KPVB 1J9CT 1YY9C 4FFTA 3ZHKA 4MHHI 2BY0A 2MFNA 2VXVH 5KG9B 2R0WH 4ZMPA 1AACA 2XFXA 4PJXF 3O4LE 2X70B 5DZ9A 2Q8BH 5E24E 3O9WA 2HG5A 3IFLL 3CFTA 3JTTA 4JFXA 2EEDA 3D4YA 3BDXA 3KJ4B 3QUMA 5MEQB 2IDSA 3O6FC 5JIMA 3QFJB 4BQCA 3QQ9C 2ZOUA 1I9RL 2ITFA 3M17B 5I8CB 3TBTB 2I9LA 5GRVL 5G55A 4YO0A 4IOSA 3BH9B 5DJDA 3NAAH 3RRQA 1LO0H 2OA9A 1PG7L 1JNLH 5EU4B 1MCKA 4YAQA 1TETL 3ISRA 5EIIB 3S9DB 1BZ9B 3H54A 5HHVL 3FL7A 3UDWC 2CCLA 4BWWA 4GO8A 3QIUD 1M71B 1WFUA 4HWEH 3HG4A 1FL3B 1KB3A 2DMCA 4U6XA 2XQYK 4I0CC 4XXDB 4LSRL 5ACZA 2WXQA 2N7AA 3H2PA 2H1PH 4OT1L 1MG3C 2NYZA 1NMCC 3EHBD 4KWUA 3A5VA 2YPLB 5E2UL 1A2YB 3RA7H 4BDVB 3W1ZA 4NIYE 5HHMB 4R3SB 3WS3A 3P3SA 5F7YC 3X12A 4Z5RB 3D2UB 3G6JB 2ZXAA 2OBGA 1WWWX 1X5MA 3FONB 3HE7B 3FCBA 2QLVB 5C0BE 1G7HA 1O0VA 3MACH 2GI7A 3ARDD 4KKAC 4AVIA 3VFUB 4XNMB 3VGAC 1ID5I 2Y5TB 1NAMA 4Q2ZA 2WWMC 2WN3A 3OAYK 2GSMB 1WTLA 2D7NA 4KKCD 5JOFA 2H8PB 2OI9B 3GSWB 3L2NA 4JRXB 3E9UA 4PJEE 4YH6A 2J55A 3ARBA 1N19A 3I9GL 5D4HA 1IAKB 3VWKD 1PFCA 2NOYA 3UADA 3N04A 2NR6C 1F4WH 1XGUA 2AJVL 1A4CA 4OCXL 3QO0B 1U93B 2DIJA 4X9IA 4Z3HA 4OB5H 3I6GB 4Y4HD 9PCYA 3CCHA 4KUZH 2HUEA 2EVFA 4GMSL 3MGTA 4WFFD 2X44D 3HI5H 3OXRB 2ZXGA 4CVWA 5MI0B 2F5AH 2JXMA 4N1HB 4IJTA 1E50A 2ICEA 4BQ9A 1FZMA 3GRWA 3CC5B 5DEFB 3OZ9L 4PJGA 4LT7A 5DJXB 1ZVYA 1DVQA 2BMKB 4OBSA 2WSKA 3VFMA 3ARFC 4FQXA 5DHYA 2AKRA 4G1MA 3NABH 2BVQB 2YBRB 5KBMA 2VUOA 2E74C 5EO0B 4BK8A 2QGCA 3EFOA 4U2YA 2WNGA 3RNKA 3WE6A 4L3ED 2O61B 2ALWA 3OLEA 2HT3D 2OJ1A 5AW7B 3CGTA 3U2IA 3CHRA 1AP2A 1S7XA 1ZXKA 3D18B 1QKZH 3KPSA 4JHWL 1A6ZA 1U58A 4MCNA 1ZDSA 3FZUC 3L5WB 1J88A 4OJFL 1NSNL 1JPSL 2Z3FA 4HIIB 3K6OA 1B4JL 1ZLUH 4J3BA 2VDQB 1UXWB 2X1PA 3R4RA 4LSTL 5IMKB 1ACXA 5DDHB 5KUMA 3O4LB 4IK6A 5ICXA 7PAZA 1KNOA 2DRUA 4QHPA 1N9PA 4Z7WF 3NFPB 1BPLB 4KH9A 3RVTD 4U0RC 1YLBB 4U1NB 1AQKH 3RVUD 5J0BA 4HETA 1UQSA 3LNFA 5EU5B 4BSWA 5DMJB 5TTRA 3FOMB 3Q8AA 5C07A 3RVWD 2ADGB 3PJNA 4ZD3L 3L2MA 1PLGH 2XIBA 3S36H 4R26H 3BLPX 4ODXB 2EZ0C 4LU5H 1BXUA 3G5XA 4PP1C 2X4SA 1MCPH 1QPKA 4XGZA 5INCA 2EIKB 1U8OA 5AD0B 5H37A 4H88L 1FRGL 1CLOH 1I8MB 4M3JA 1E27B 4ELKA 4HU8A 2VZTA 3TGXA 1RZJC 1XGZA 4N8VG 2ZOLB 2B7DT 1WTGT 4J8QA 4M8UA 2EVHA 3L4WA 3LMJH 4LOEA 3TFKC 2BFVL 3G6AA 2ZX7A 2YA1A 4J23A 5ELIA 1K72A 5C0CE 4GKLA 4ODSL 5D7JA 3TEUA 3TCXA 4G8EA 4XO9A 5FCSH 2YWZA 3RIKA 4MCYA 2WXLA 2CUMA 5E56A 4ZUSB 4HGWB 4QXGL 3L5HA 4U33A 5MEPB 4OIBA 5T3ZE 5C0BB 3C5ZC 4KVCL 5BPPA 3O2VL 2OMVA 2DICA 5D1QA 3U4AA 2ESVD 5L9DH 2UV3A 4I89A 4JO2L 4PJEB 1NGPH 5I6NA 5EF2A 2E4FA 2ZZUT 4AL8H 1G7PB 2LLLA 3MRLA 4JHAL 2CKBB 5E2JA 5E94B 5LGKA 2Z35A 5E9DE 3U82B 1BZEA 3Q5YA 4PJAB 1OWWA 2YRBA 5JQIB 1UB6A 3DX7A 3U79A 1AR1B 3K2UL 4LLVA 1NWPA 3VW3L 4MJ4A 3BAEH 1WZKA 3FB8B 3LNDA 4FABH 3LN4B 2XN9D 1BV8A 1LEGA 4Z3IA 3TBVA 4L3AA 3DSFL 4PJFE 1ZLWK 2D7TL 1P7QA 5EOQH 2DQEL 5KWYC 2OMXA 3O2DA 4XAWH 4MNGA 3QFDB 1GCFA 3L7FB 4RGNB 1KT2A 1U8IB 3FQ1A 4Z7QE 3EH4B 4R84A 3BT2L 4Q6KA 3T1FB 2BWQA 2NY3B 1I3VA 1ORSB 2C1OA 5KSAB 1NBVH 2HKFL 5L2JB 2EDYA 4N0CD 4PJCA 1NEPA 3ES6A 1EEYB 2VIRA 3HAEB 2HT2D 5IROC 1E42A 2JSFA 1MNUH 5SWSA 3RJDA 2LU7A 2OSLB 1UB5B 3D30A 3MLRH 3DO7A 5ESAB 3SDDA 2COQA 3K4DA 5GSRA 5KN5A 3FQ2A