3PAZA

Reduced native pseudoazurin from a. faecalis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
123
Chain Sequence
ENIEVHMLNKGAEGAMVFEPAYIKANPGDTVTFIPVDKGHNVESIKDMIPEGAEKFKSKINENYVLTVTQPGAYLVKCTPHYAMGMIALIAVGDSPANLDQIVSAKKPKIVQERLEKVIASAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transfer
molecule keywords PSEUDOAZURIN
publication title Site-directed mutants of pseudoazurin: explanation of increased redox potentials from X-ray structures and from calculation of redox potential differences.
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 34
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 1997-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3pazA00
1MDAA 1XB3A 5I5JA 4NERA 1OE3A 1PCSA 1PNCA 2JFCA 2ZONA 1JOIA 1KDIA 4E9VA 2HXAA 3FU7A 1WA0X 3FPXA 1GY2A 4KO9A 2UXTA 1KBVA 3PCYA 2YARA 1OCOB 3PAVA 2B3IA 3NJMA 3NSDA 4GP8B 4BXSV 2YAFA 5B3SB 2QPEB 2HLEB 4A68A 4E9SA 1MZZA 5B7MA 2GC7C 1AR1B 1E5ZA 1T5KA 1SHWA 1IC0A 2I85A 5I6LA 2AZUA 2OJ1A 2YAOA 4Q89A 4AKPA 4JHUA 4A2DA 2GIMA 1J9RA 4E9WA 2RACA 2Q9OA 2VW7A 2BZ7A 3FQYA 1WA2X 1JZFA 2EIMB 3AG3B 1DZ0A 3HEIB 2VM3A 3NJLA 4F2EA 3X1FA 4KO7A 2HRGA 3RYMA 2YAHA 1SFDA 1AZUA 2HRHA 4BK5C 2QPDB 2PPFA 3AG1B 2BHFA 2BP0B 2NRDA 3MX0B 3OM3B 2IDTA 3AW5A 4WTQA 1KDJA 8PAZA 2GBAA 1BXVA 2IWEA 3D12B 2XUWA 3SQRA 1OF0A 4KNTA 5F7AA 1AG0A 1BXUA 1JXFA 3AY2A 4DP4X 1OE1A 3FU9A 4G71B 4HCIA 9PCYA 2DV6A 3OMAB 1RZQA 1NPJA 1NWPA 3NSFA 1OV8A 2BWDA 4HCFA 2TSBA 3X2QB 1NIDA 3U25A 3PAUA 4FA7B 2AFNA 1HAWA 1ASPA 4YVUA 1A65A 3TASA 4YSSA 1ILUA 2XXGA 5A7EA 2FQDA 2PCYA 1BEXA 2DWTA 3UGEA 5B1JA 1NPNA 2UXFA 3NP3A 3CVBA 4BDVA 2FT6A 2XVBA 2QDVA 4L0PB 1FFTB 3OMIB 4GXFA 2XWZA 4DPBX 4GP5B 4YSPA 1JXGA 2VMJA 3UAEA 3ZIYA 3DIVA 3OD3A 1QNIA 1J9QA 4HCGA 2EIJB 5LDUA 3QJUB 1W6LA 4K9JA 2UX6A 4E9XA 2HX8A 3QJVB 4F7KA 4ZK8A 2XV0A 2A3TA 3GDCA 2IH9A 3AG4B 2XX1A 3ERXA 4HAKA 2PLTA 2CBPA 4DPCX 1BQKA 2XV3A 5ANHA 5TK2A 2FQEA 1AANA 3EH5B 3CG8A 2LLNA 3FSWA 3X1GA 1JERA 4Q8BA 1A4CA 2BP0A 2BP8B 5F7BA 1HAUA 1N70A 2EILB 3X1EA 1KBWA 3T71A 3FSAA 4DP2X 1SHXA 2IWFA 1WS8A 1TEGA 4G7RB 4G70B 5B7EA 2DWSA 3PXLA 3KW8A 4PCYA 5I6NA 3QJQB 2CAKA 1BAWA 1L9PA 2QT6A 3QJTB 1ZPUA 1J5CA 4KO6A 1B3IA 2DY2A 3QQXA 1AOZA 3UADA 3JTBA 2R7EB 1AACA 3FSVA 3NP4A 2FTAA 2PPAA 4BDVB 1JZHA 3CVCA 1BYPA 1PAZA 4G7QB 4KO5A 5I5MA 3ABGA 4G72B 3TBCA 4YSAA 2FT8A 5IY5B 4P5RA 2N0MA 1XB6A 1ZIAA 3OQRA 4UAHA 4YSEA 1PNDA 2HX9A 1TEFA 4KNSA 4P5SA 4DP1X 3NT0A 1AZRA 1GS8A 4GP4B 3IBOA 2Y69B 5FC9A 4YSQA 4NB7A 2H3XC 3NJJA 2QDWA 4DP5X 2TSAA 3C75A 4YSTA 1PLCA 3ZDWA 1ZV2A 1GY1A 1PZCA 4KNUA 4M3HA 5I28A 4MFHA 1AS6A 1SJMA 2P80A 5I6PA 2IAAC 2IDSA 4HZ1A 2DYRB 2PPCA 1GS7A 5I6KA 3S3CB 2AVFA 3TA4D 1KGYE 1NICA 2FQGA 2IDUA 1NIBA 2BP8A 2YAQA 4X4KA 2CJ3A 4BWWA 1SDDA 1NTDA 1AQ8A 1X9UA 3FS9A 3QJRB 4DP7X 1ASQA 1AS8A 1OCCB 1GW0A 2XV2A 4AZUA 1RKRA 3KW7A 2JXMA 3S8GB 2FJSA 2GC4C 3AZUA 3WKQA 1A8ZA 1KYAA 7PAZA 3GXUB 4HHWA 1M57B 2X87A 5AFAA 1BYOA 3DKHA 1WS7A 2WO3B 3FQ1A 2R7EA 1KCBA 1IUZA 5PCYA 1PF3A 1SF3A 3WI9A 2XU9A 4W9ZA 4A67A 3NJKA 2I7OA 2YAMA 4E9TA 3NSYA 4DP6X 3DTUB 1PZAA 4BWTA 3IEAA 3ABKB 1J5DA 3T6XA 1WA1X 3TBBA 3UACA 2MRYA 1XMEB 4YVNA 5I6OA 4CSZA 3FPYA 1PZBA 2PCFA 5D4JA 1KV7A 1V10A 3BVDB 1L9OA 2BW4A 2ZXWB 5I5IA 5AKRA 1AZNA 3WNJA 2ZWNA 2Q5BA 4A2EA 2PPDA 2H5UA 3EH4B 4YSRA 3ASNB 1BQRA 3SBPA 1AG6A 2GB2A 1PLAA 1L9SA 4AX3A 3SBQA 3L45A 1SDDB 1NINA 3H4FA 2EINB 1JZGA 4AI7A 1QLEB 1PY0A 3CDZB 1A3ZA 2FNWA 2PPEA 3UABA 2VSKB 4BWUA 1MG3C 2AANA 4GY4A 2GHZA 3NJGA 1JVLA 3FT0A 2J56A 1OCZB 3H56A 3IE9A 4A66A 1A4AA 3T6ZA 5B1JC 2OCCB 1I53A 2J55A 2WO2B 2EIKB 7PCYA 2DYSB 4FAAB 2B08A 1W6WA 2MTAA 2VW6A 1QHQA 2J57A 3IN2A 4TXVB 1ET5A 1V55B 1BQ5A 2HX7A 4BXVA 4QLWA 1HFUA 3V9CA 1ASOA 1N68A 1JVOA 2GSMB 2P80D 2XLLA 1FA4A 2CCWA 2CALA 2XXFA 1ET7A 1UATA 4PAZA 1E67A 1R1CA 4GYBA 4E9RA 4YSUA 3UAAA 1CC3A 3NSCA 1V54B 5AZUA 2XX0A 1JZEA 1NIFA 3ABMB 3ASOB 3GYRA 2J5WA 3NJHA 4KOCA 3NYKA 2JKWA 1CYXA 2I7SA 2IWKA 1TKWA 2BZCA 1GYCA 4YSDA 1MZYA 5E9NA 1RCYA 2VW4A 1OOWA 3BQVA 1TU2A 1GSKA 1GR7A 3PLYA 5B1KA 1KCWA 1AZBA 1CYWA 1L9TA 2CUAA 4DP0X 4DP8X 1CUOA 3X1BA 1ADWA 1W8EA 1M9WA 1NIEA 2FWLB 2XYBA 3G5WA 4HHGA 4N8UA 3T6WA 1A4BA 4YSOA 1FWXA 3NJNA 2ZOOA 3WKPA 1AS7A 1L9RA 5TK4A 1BXAA 3H4HA 2BO0A 2H47C 4F2FA 2AZAA 4HIPA 5I6MA 1NIAA 3CDZA 3HB3B 2PP9A 1E5YA 4AKQA 3JT2A 3CVDA 3NJIA 1X9RA 3WG7B 4CSPA 2HZHA 2PP7A 1ID2A 3CZUB 5B7FA 4EF3A 1ILSA 3EH3B 2IDFA 5PAZA 1J9SA 2IDQA 4JHVA 2UXVA 4KOBA 1IKOP 1AZCA 4E9YA 4RH4A 3AG2B 4QKTA 5B1BB 3PPSA 4A2FA 1RZPA 1ETJA 2IH8A 3MBWB 3N2JA 2FQFA 5EHFA 3FU7B 3EHBB 3SBRA 2YQBA 2GI0A 3NJFA 2VSMB 3FSZA 1J9TA 1DYZA 1ZDQA 2YAEA 1L9QA 3PAZA 1OCRB 1ZDSA 4YL4A 2VM4A 1URIA 1JXDA 3ZX1A 2PP8A 3TU6A 4UANA 1NDTA 4G7SB 2UX7A 2W8CA 3QJSB 2X88A 3FQ2A 4HALA 1IBZA 2OV0A 4JKNA 3EF4A 3X1NA 2YXVA 1MG2C 3S3BB 2YAPA 4DPAX 2VN3A 3N55A 4A2GA 2BW5A 4WKXA 4A2HA 4E9QA 6PCYA 1E30A 1E65A 3V9EA 1OE2A 1PMYA 1EZLA 4NAJA 2BWIA 1SF5A 3ABLB 3OMNB 1JZIA 4M4RB 3QPKA 1NZRA 1VLXA 1GS6X 2E86A 4N4YB 1PLBA 3IN0A 3ZBMA 1NWOA 4ENZA 4W1TA 5B1AB 4AKOA 2WSDA 3FU8A 1AIZA 3FYEB 1YLBB 1ZIBA 4DP9X 1F56A 1CURA 3S3DB 1SFHA 4UF7C 1JZJA 6PAZA 1EHKB 3T9WA 3T6VA 1AAJA 4YSCA 3WIAA 2YXWA 2FT7A 2W88A 1SNRA 1WAEA 2UXGA 5D4HA 3S8FB 1ET8A 5D4IA 3WNIA 1IBYA 5I26A 2Y1AA 3FYIB 1M56B 1XB8A
chains in the Genus database with same CATH superfamily
5IHBA 1ZS2A 2AGJL 4CKVX 1ZLSL 4Z6AT 1BZ7B 5I5JA 1NAMB 3WUWB 5T1MA 3DJ9A 3FRPB 3OB0K 1BX2A 4GO6B 3HN8A 4L37A 4BCYA 1GOFA 4K3DH 1ULVA 3LIZH 5C7XL 4MNQA 4JG9A 2YKLL 4CGUB 1F1AA 2CMRL 1KBVA 1FFPA 3RVXD 1SXSA 3TVMA 4AENA 1GHFL 3QYMA 2B1AL 3GPEA 3U1PA 4DWHA 5BOJA 2VZOA 3BP6A 2HJLB 1T5KA 2WN3A 3WCYA 2EH7H 5SWSD 2ZXEB 3W57A 2BNUB 4XXDA 2MOGA 5B3JF 4FS0A 4G82A 1A1NB 1NA8A 2LVEA 3NCMA 4K71C 4PJ9D 4Y4KA 4R96B 3FQYA 2DQDL 1P69B 1UOKA 2KZBA 4JN1H 3U4BH 3GGWB 2NY6D 4HAGA 2VR7A 2AAAA 1E6OL 4OIAA 3PDGA 2BWQA 4M61A 3FCSA 4TSCL 5IR1B 4ONOA 3LNEA 2BSDA 2CXKA 4DK5A 5G5DA 3UZVB 2X2YA 1E7VA 2VRKA 3MX0B 3BWUF 2V2TA 4ODSL 1IFHL 3MRNB 3TXAA 3MCKB 5BJTB 1FNSL 3O3BA 1GVIA 3R1GL 2VZSA 2K3HA 3EYOA 2JJSC 3P3RA 3AY2A 1L5GA 5EWIL 4HOZA 1HXMB 2J8UF 3VGGA 5E8DH 4LEBA 3R0MA 4X9BA 4HU8A 1CDHA 1OV8A 2XZCL 2J8UA 2ZOWA 2CDFB 4ADIA 3WTYA 3QNZA 4LSSL 1CDJA 3IKKA 3JV5A 2QKIC 3O3EA 4XP6H 3CX2A 1R75A 2AXHA 4QHLB 4PS4L 2A9MH 1DSFL 4XHQA 4J3OH 3IJHA 4HFUH 5DYOB 5I19L 4IGBB 2OBGA 2HT4C 1DN2A 2D8KA 2WWOA 3BMWA 5J4MA 1WFOA 3F6IA 3FRPG 4L9LB 4JDTH 3VGEA 4AVJA 1D5MB 3K0YA 5ESVB 4FNUA 4OLWL 2O5YL 3D08A 4P2OA 4BFNA 4NQEB 5D7LB 1IKFL 3QIUB 4AIOA 3NZSA 5KJ7E 2HLAA 1HYSC 5F3BA 4PB9H 4WIQA 4S11A 4F1ZA 2UX6A 5GS0H 5JXEA 1CTOA 1JWMA 1KYFA 3PRZA 2BSBA 3ZZLA 3DX4A 3GDCA 4KU1A 2MKWA 1QFWH 3B83A 1SBSL 3KPLA 4KK9D 5DMGC 2DLIA 4NOFA 5I1HH 4WW1B 1K4DA 2AK4A 2ATKB 2R2EB 2Q0ZX 4GSRA 4XWOD 3U9UA 1BYNA 4I3RH 2R69A 3UJTL 5EG6C 5TK2A 4E41A 4I9XA 3W56A 1LMKA 3BPLC 2XNAA 4O51A 4XCEA 5D5ME 2FO1A 2W07A 3QCTH 5INDA 1A4CA 1EZUA 3BFQG 5CCKH 2HP4A 2FJHA 3IFOB 1TMQA 3P4OA 4HC1A 3BX7C 4EQ2A 4A1RA 1KBWA 4JKPH 3BAYA 4XN7A 1JMXA 3JUYA 2G3MA 1T0MA 4NC1C 2JXMB 1GYUA 3K2UH 4KJQD 4UTBA 4OKDA 5I0VA 4WI2A 3WFDH 1FV1B 4AIXA 3T3MB 3QUMB 5CP7B 3OX8B 1CF8L 4NQVB 3H42H 4N2HA 1IM9A 2QELA 3L13A 4LF3B 2R7EB 2WLLA 5C9JA 4NO2B 4IBTA 1KELL 1WFMA 5FYKU 5H2BA 3AVEA 3FN0H 5LGHL 3CX5K 3P40A 3KL0A 1OLZA 3O8XB 5KAQG 1M42A 2R0WH 2VL5B 4NPYA 4AITA 2EDLA 3GLEA 4QY8A 3OL2A 1UD5A 3BFOA 4LIQL 4U1KB 4RQQB 1OAZL 1D5BB 1DQLL 5F70A 4WW2C 3EO0B 1Q4NX 3O2WL 4KNSA 2ZAGA 3NT0A 3HI1A 4XPAH 1RK1A 2JI1A 3D1MC 5AKSA 2G2RA 1DQJA 2NY1B 2IH3B 4PWKA 4CC4A 1NANH 3PHOA 4HEMA 1E8XA 5SX4H 3NJJA 2PWDA 3OSKA 4AL8H 5HGHB 1UKQA 4BUHA 3AAZA 1S7RA 2HH0H 3PG2A 4UM8A 3WFZA 2YRBA 4K8RH 3MOQA 4HD5A 4QRFA 5DI8B 3TBTA 1RP9A 1MHPL 1JRHH 1TNNA 5DQ9B 2YGQA 3D3VD 1IGFL 2IDSA 4UV7H 3BUDA 5E1AA 2F1BA 2ESVB 5IVZB 2QJDA 1M9SA 5DD1L 2YPVH 4WHCA 1J86A 1BBJA 5FHBH 5BO1H 2AVFA 3OB0H 4R7DA 4WV1B 4H8HA 4Z8FH 2Z31D 3EJPA 1QQDB 3IGAA 5I17B 3FN3A 4M6NH 3HRZA 3BUBA 1H8SA 5DD3H 5CZXC 3C9NB 3CLEH 1R3KB 2VRQA 1AS8A 4J4PC 4Y2DD 1U8LB 3OMZA 5HDOA 1G7HA 1UACL 5HI5C 4Q9RL 1QEWB 4GMTL 1GZPB 3D4ZA 5I23A 3QDHA 4G5ZH 3NTCL 1KGCE 4YZWA 3ECQA 5BS0A 4G8GD 4PWHA 3QC5X 1BZOA 1V3JA 4R4BA 1LXMA 3ZTJH 4QD2E 1JGUH 1Q72H 3GXIA 3IDYB 2NZ9D 3D0VB 1Y18A 3WFEL 1F1GA 4UIMA 4ZOAA 3RTQA 4KGJA 4FQLH 1FZOB 1CLOH 2Y36L 5CD3B 1HQ4B 4E2OA 2WBJC 4FFZH 5IFAL 4TVPE 3MGTB 2DH3A 2GCYB 1YNLH 4U6YB 4OGQC 1E2WA 2UWEF 3W82A 5BRZE 2OMVA 4ENED 1C5BL 3CXHJ 4R7NB 4XPTL 4R0LC 2I07A 2FAUA 3JV6B 3GBNL 2IAMC 1R4XA 4MGXA 3GMNB 4WI3A 4GW1B 1NFDE 3QDGD 1K8IA 1YQVH 2ETWA 5EO9A 4YPJA 3DJSA 1ZGLM 1T0PB 4NZRH 5D1XA 4U1IA 2EEXA 4IRZL 1N12A 4DN3H 2DYPD 4G43A 4M62H 2ZOKB 2NOYA 1N0XL 1JXJA 4PJAE 2NUPA 1BBDL 1ZHKB 2FSEA 2V6HA 4NJAH 3OHXB 1UXMA 2DLTA 3LKSB 1L9SA 3L45A 4YHYB 2YUZA 3KCPA 4UBDD 2WLKA 3NIGF 2JB5L 3ZTDC 1NGZB 3FFDB 2IEPA 4LAJH 1YEKL 4QNPE 2AJUL 2C7FA 4XBPB 2L0DA 4F20A 1OXYA 2C9QA 4GRLC 3HMWL 5IK3B 3IDMB 4QO1A 3ZDYB 3ZHDA 4A38A 1BAFH 2F9BT 2ADIB 1CU4H 2XFGB 3BEVA 3GO1H 2BOLA 4XVOA 3UZEA 1I53A 3TJEL 3SJVE 2JTDA 5SWZE 1N59A 2WIMA 1J05A 1A64A 2ZPKL 4HV8A 5JW4Q 3QC6X 2XQYA 2G75A 4QRPA 2WNKA 4R83A 2X9ZA 2HMIC 3SD2A 3KXFA 1JWUA 3QK0A 1G7MB 4JO1L 3ES6A 2IOMA 1XCTA 1DBMH 1OAXL 1ZA3A 1OZUA 3BAJA 3PABA 4LVHB 1H15B 3SE4A 2AQ1A 3Q2NA 4X0KA 4JB9H 2ZUSA 4OLYH 1E8ZA 1MELA 1EO7A 3CZLA 1AMXA 2BPBA 4J3BA 2ATPA 1IB5A 2NY2C 5JW4M 4LIQE 1V54B 4HLZG 4M43L 4PVBA 2NDGA 4NJ9H 3RL2A 4JHBA 3LKRA 3TL5A 4R4NC 1GOGA 4K07A 2GG1A 4F92B 3EYVA 4AQ1C 4XMPH 1TKWA 4QXTA 1WVZA 4G3YL 4BKTC 1JSYA 1UURA 4WEBL 4C56A 4LLQA 5B1KA 4ZXBA 1Z9SA 3LS4L 4O2FA 1U3HA 2X10A 5ISZE 1GAFH 2PCPB 4A6YH 3WEXB 1QLFB 3MA9L 2BERA 3N85L 2B5IC 3CHPA 3OPZH 3SPJA 3Q3GA 1AMYA 3S36L 4MMXC 3RDTB 1ORQB 5C07D 1TVBA 4OZ4B 2X3CA 1ETZB 1A1OA 2D9QB 3HB3B 3JT2A 4YXHH 3OLGA 4XCYA 4GUOA 2B2XL 3WFHA 4CSPA 4PM1A 1RJLA 5SV4A 3US9A 2Y3AA 5HJBA 4C4BA 1Q0EA 3EH3B 2BC4A 1JAEA 4PJXE 3TO2B 4X9HA 5F9DC 4FC3E 3F58H 2E9IA 3SPHA 1MCNA 3H9YA 2FBOJ 4ZUUA 1MCIA 3AXLB 3NZ8B 4PJ8A 2APXA 4NQXA 4APQC 4OM0L 5I0XA 3FMGH 4EIUA 1ETJA 1MCLA 3GXMA 4XNYL 4RGMB 4WU5B 3AGVA 4Y19D 4IU2A 1QRNE 2DMKA 1JZ7A 3EGXB 3BSGA 4L5FE 4WWKC 3DSFL 1J12A 4ZO7A 1A6AA 3WD5L 1G9NH 4L1DA 1JNHB 3OB8A 5FA3B 1HE7A 1GW6A 4KTEH 1ZVHA 5A2AA 3UMNA 4AM0B 2WLJA 1AC0A 1FVDB 4Q14A 2VMCA 2YFNA 3H3PL 2DB8A 5T5FL 5FGRA 2G30A 2WSPA 5F7HA 5AYUL 4Z5RA 1G9HA 2X88A 4IRJB 4YK4B 5E8NB 4H40A 2VE6A 2YXVA 1QLEL 3A22A 1Q9WA 2K45A 1BDYA 5L4FA 4PJFB 4JQXC 4PG9B 4AC4A 5MHSE 3KVDD 4ERSL 1EAQA 1OB1A 4PGEA 4HGKC 5LNEA 3CFJB 1SXCA 3QEQE 4HZAA 4YO0B 4HIHA 3OJ2C 1I3GH 5F9WB 1FVEB 1Z9LA 2H6PA 3NAAH 3D0LA 2B59B 3RY6A 5E6IA 1L9NA 5A7BA 5LQBL 1IAMA 2R15A 1A6WL 4WHYG 3S4SA 4R5VA 1YLBB 1LO2L 4O02H 1C16B 1BOYA 5E8EA 5GIRB 4LLUB 2LOEA 1F6AB 4I5BA 3V4LA 2QHRH 4LKXA 5TFSL 5GGVL 1JDAA 5TTRA 4ZI8A 1RSYA 4QF1A 4WKZB 5F97E 1VEOA 4LRNL 2UXGA 2XIBA 3MGOB 1ZHLA 1LK2B 1IBYA 3SGKC 4KPHH 2DQIL 1U2YA 2RTTA 4K5OA 1I3RA 2FE0A 4PJ7F 3KPRA 4KI5E 1XIWA 4JGJA 5I8OL 5E2VH 3QJXA 4K3GA 4X5RA 5C0EB 5I71B 4B60A 4QHUA 2HXAA 5CBEB 3FU7A 4EQ3A 2Z93A 1MFBL 2FATL 1PW3A 1WF5A 3D39A 3NJVA 4ZMWA 2LAGB 4EDXA 1N4XH 3F6JA 4BZ1L 3PCYA 4Z7VF 3GI9L 4PJIF 1ED3A 1AQMA 1RFDH 3BP7A 1JN6B 1U8CB 3QUXC 2L04A 3JT0A 4L4VB 1P84J 1JYWA 1L6XA 1XXFC 4OCYL 4Z7VA 1JNNH 1DDTA 5KYWB 4PJDF 1N26A 3ULVL 4R7XA 1R33A 1H19A 4PMFA 4QCIB 4WY7H 5AAMC 4OZFA 2EIDA 3LB6D 3SE3C 1JZ8A 4BGDA 4EUPH 1JD7A 3GMQA 4K94L 4ZFOA 1KXHA 1T83A 1VEPA 3QAZB 4QAWA 1UXWB 3HLAB 1ANUA 2C7UB 4PLJD 2VW7A 1Q9KA 4UTCA 1RUQH 5DQDH 3VVWA 3CVHH 3AB0B 5C0GA 2ARWA 3EDJA 3GZOA 3K1KC 3AG3B 1BW8A 3BLPX 4ANVA 3MKGA 2XA3A 1J1OL 3DX2A 3LXCA 4KO7A 4QOKA 3V6ZB 3DIFA 1U92A 3TYGL 3QO0A 3FHQA 1R47A 3IDXL 2D31A 2QZ5A 4OT1L 2BZDA 4P59L 5ICUA 1ZHNA 4JBSA 5EZJA 5J1AA 4N2OA 8PAZA 1EJOH 4QXUL 5D1QB 3KAAA 2XT1B 2BP3A 2YMTA 1MFEH 3B9KD 4RZKA 3ML8A 5G4OA 4UB0H 1U8HB 3PXHA 1TTCA 3ELAT 1CT8A 1BVLA 3CFMA 3ZO0A 3L1FA 4RFEB 1CD1B 2OSYA 3BESR 2COVD 3FU9A 1BPLB 1E40A 1EWHA 3BH9B 1I8MA 3KBHE 2ZWKA 4TUOA 4H4NA 3TCTA 3MKKA 3NSFA 3WS3A 3EOBA 2TSBA 2X9YA 1MRCH 5I15H 4TNFA 3MLZH 4Z7QF 3PAUA 2HT3D 2ZNXA 4GXVH 1VFMA 1ASPA 4DEWA 1SM3L 3QI9B 1MW2A 2Q76A 2A83B 2JJWA 3I6LD 1VIWA 2YIHA 5C2UB 4OFYA 3QUYD 5B1JA 3T77B 1IVLA 1P6WA 2XPGA 3C09C 1MHEA 4MD5A 1QSFA 2XY1A 2YQGA 3HHSA 2WXPA 1AFVL 5EZOL 4ATTA 1T1YA 4ANXA 4N2NA 3B37A 4NWTL 4QRSB 3KPMA 5A16A 3UTSD 4LQFH 4F37K 2ZX5A 3IDJB 4XMKH 1ZD6A 1WWBX 3MNZA 1M7IB 5CGMA 5FYLL 5TDOA 3R8QA 2W9EH 4TF4A 3FU6A 4ODVL 5HHXL 4LAQL 4FA8A 1B4LA 1E5UI 4PEEA 1NCOA 4W4NA 3H0TB 4LVNB 3VRLE 2AQQA 4BKSC 1DJWA 5K9JL 2WZ0A 1I7TB 5IVXB 4JG5A 1EBPA 1FAKT 3W38A 2Y72A 4KI1A 3GLDA 3O6ML 1N8OE 3HS8A 4FTVA 3BSZH 1HI6B 4P2QA 2LLNA 2XC8A 3FTGB 5GISH 4CL7A 4OF6A 1J5HA 1K5NB 1KJ2H 1NGYA 3QUHA 4IRSC 3FUFA 1F3DH 1TG8A 2WUBH 3VFSA 2EO7A 1A7BA 4WJ5A 4GKNB 3VXMB 2B3RA 2DIJA 2VDML 4LCIH 2H0JA 3CN1A 1NBVL 4IMLB 1GGBH 5CIPB 1KENL 3UROR 7TAAA 4KROB 1NGXA 5JQ6L 1QW8A 3QDJA 2WXIA 4PVMA 5CSZB 2QT6A 2G3ZA 1XF4B 4JM2A 1S9KC 4KO6A 4JO3H 1GGIL 3REVA 4MSWB 1YRKA 5K39B 5KSVB 4JO4H 4N9GB 1CLZH 1IC4L 2XWTB 1WFTA 1DBKL 2PO6C 4ISVA 4RMRA 5GZND 4I18A 3WBDA 4ABUA 2IH1A 3I6KB 1KB9K 1O7DE 1EJ6A 1GTNA 5F7FA 3HG3A 4LHUB 5LHDA 2OJZL 2XOTA 4LVEA 1QTYT 3MREB 5LUMA 2IDCA 2A9NL 1MJUL 3EJZC 1WUZA 1XCXA 3BYYA 5JQIB 3UBFA 4K5LA 4X5LA 2A73A 4G8IB 1GS8A 3SGEI 2PYED 3IDNA 3BPCB 2FECI 3QE5A 3VXSE 2EEAA 4FYTA 1AKJA 3IYLW 4PGCB 2HTLD 2V2WA 5DJDA 3CFQA 4QTHB 5IESL 3VFNA 2OMZA 3SDXF 1B4RA 3BP4B 1MWAA 3PUCA 1T7WA 3MRQB 2CK2A 3T2QA 3HHRB 4PY8I 1NBZA 1ZT1B 1OAYL 3CHQA 3D30A 1Z3GL 2ENYA 3PGFH 2LT9A 2NY5H 2ZF8A 1SDAB 3HG4A 2DYRB 2WMPA 2DDQH 3V4PL 1CZ8H 4ES8A 1T7ZA 4K3EH 4D0BA 1KTBA 4X6BB 3GSNH 4YXLL 2IPKB 2JH2A 5DHVH 1TTBA 5DHEA 3WY1A 4JFEB 2Y7LA 3KNBB 5D2NE 1LYQA 1YYMH 4W93A 1OF2B 3FQNA 5E8PB 1MPAH 2XV2A 2C9PA 4YUEL 2D3NA 2JCCF 1EDHA 1GGCH 4L8SC 1A8ZA 2UY7A 5ITBL 3HZMA 4FL4B 1KJ3H 3K5RA 3ZT6A 3ZE1F 1HKFA 1JZDC 4ZMXA 1T5WA 2JCCA 1DANT 3IB4A 3MLTA 3QIWC 1IU1A 2X87A 3DKHA 3ZMRA 2B77A 3O6LL 4RLDA 3T3PE 2XN9E 2X9XA 5DURD 2J6EA 1A6ZA 3FT4B 4IOIA 2YAMA 2KZKA 5GZOA 3G04A 3NSYA 2AJZA 3ISYA 4HMDA 2PTTB 1I8KB 3D9AL 5T1KD 3ZE0F 1J1PL 1J5DA 2DWDA 1E9PA 5IBLD 4FFYA 4A2MA 4L3ED 1XBDA 1KBGH 3KYOB 3MLYL 1NGWA 2P8MA 1JF5A 1AXSA 4BEIA 5D70H 5I8EA 3VE0B 1OAUL 2QSCH 5MEQA 1Q1JL 3QWQB 4GG6A 1D6EB 1EHXA 1SEQH 2B9BA 4LHUG 2NUTA 3W9DB 3I2CH 3L3IA 2BW4A 2KI6A 5I1AA 3RVUC 1EHLH 4V1DD 1CYGA 2B4CL 2JSFA 5IHWA 1S7SB 2F1EA 3TWCL 3OKOB 1IAKA 4H88H 3E1ZA 1J0HA 3PWVA 3J07A 4JFPA 2NYZA 4D7BA 1SUHA 3LN4B 2BRRL 2JJTA 1HH9B 3ASNB 1T04B 3DMMD 3O81A 4PJGB 4HS3A 1BVOA 1AG6A 2GB2A 1NLDH 1E4XI 1P4IL 3QEHB 4AX3A 4Y5YC 2LU3A 3EYFA 4L3CB 5KVEH 1YECL 4F8TA 4LK4A 1BVNT 3A5VA 4AIEA 1S5HB 4NAQA 5HYSB 3RKDD 1LDPH 5E9DD 3P0VL 4PFEA 3CBRA 3WO3B 1MG3C 4NN6B 5MERA 5DJZA 2JV6A 2P42B 4XCNB 3CDYA 2FL5B 3UERA 3H56A 1M3IA 2ED6A 2J2ZB 5CZVL 4HJ1A 3KGTA 3SKNA 1MRDL 4UQ3A 3D25A 2J55A 5C08E 3INUH 3QNXB 3MPCA 3RWJB 2F6AA 4YLQT 1JGLH 5D8JH 4ELME 4IKNA 4AEFA 1AR1C 3H9HB 4LSQH 2JMRA 4NS0A 4YDJB 2FGWL 4M3KB 3I9GH 3HE6A 3ARYA 4KKAD 2ZXBA 3PWPE 3WJJA 2WQWA 5JHLH 2WY3B 1JVOA 3IKCA 4GAJH 4ONHB 4XP4L 4QHNB 1T6BX 4JKKA 2R69L 3D85A 2VDLB 2ENQA 4WENB 5A2BA 5DJAA 2OYKA 5HHNB 1LE5B 1XGZA 2E9JA 5FK9B 3L3KB 3WY2A 1S9YB 4JFDA 1UB6B 5L2JB 2ZX9A 2MSPA 4HC1L 2EKSA 2R1YA 2LLLA 2J5WA 2XPZA 3F7QA 1ZLWK 1SHSA 2Y7NA 2DWEA 5I18H 1GYWA 3W39B 3P4LA 3ZK0A 4YS4A 1NAKL 4LCCC 4F91B 4FQ2L 2B8OT 1OPGL 3QCVH 4OCWH 2D7OA 3CVIL 5GRJH 4L8CA 1N5AA 2WUCL 1FFQA 1ZWIB 3Q1SL 1H3PL 4CUCA 3PWJA 1W8EA 2W92A 3BZEA 1AP2B 4I9WE 2DS4A 3RQ3A 1MLCB 5I66A 1BVZA 3LV3B 2CJTA 4XO5A 4NZTH 1F90H 1RIUH 4FLQA 3I6GB 1XGPB 4QRRB 3E6FA 1L9MA 4NHUB 1UKSA 1WZ1L 1MKFA 2BIPA 4MNQE 3L5HA 3MO1B 5DRZA 3VWKA 4F33A 1DL7H 1F42A 2FJUB 4BZ2A 1U3ZA 5CUSL 3CVDA 1N9PA 1HINH 4TMPA 1UJTA 1D9KC 2RBLA 4JDZB 5GGTH 1OQOA 5I1LB 3BSHA 5EORH 3WLBA 1OANA 3SPVB 5ID0A 1JIBA 4TUJA 2OP4L 1QFPA 4MA1B 5FYJH 4RETB 4E36A 3KYMB 4NZDA 1RPKA 4P9HL 5HYSG 4TQPA 4AV5A 5B4MC 3EYQD 2ADYA 4WLCA 5ESQA 2Z35B 3MBWB 1W72A 3VQ1C 1EIBA 4YWGL 5B3JE 5EHFA 1SY6L 4H8UA 4P5TB 1IL1B 3V79C 2EVJA 2DD8H 1CXIA 3SBRA 3E7JA 5FDWB 2QADC 3RDJA 3W37A 4Z7OF 1B0RB 3UTTD 5I1DB 2ZXGA 4HH8A 3NQIA 5LBSA 5HHOD 3O9WB 4PU2A 1MCRA 3QP3A 4AOFA 5C0AA 4FQQA 1BF8A 4QRBA 4EN3B 4PS8A 1DBAL 2Q7NA 4UDTB 2BIMA 3BIAX 1IBZA 5EBMB 3RNQB 4GS7B 3GWJA 3N0PB 4Y2NA 2EDEA 2J88H 2OMNA 1MJJB 2RR3A 4XRCA 1KTDB 4NO5A 3M07A 1SLXA 4PRHE 1P2CA 3VXOB 4AEHL 2BX5A 1DVQA 2LAAA 2FIRT 3K3QA 2QVIA 3RGBA 3VSUA 3EYSH 1UM4H 2BWIA 4YQXL 4BFIA 2FBJH 1E9OA 3ABLB 4H0HB 3QFDA 3QPKA 2CO6B 3BAEH 5KUMA 5J6SA 2J8UE 4YDNA 4UINH 1QFUH 1KPUA 1G1KA 5AOZA 2QQLL 4MDIA 1PLBA 3B2VH 1A66A 4ZS6D 1YMMD 2V3EA 1NJ9B 2IF7A 1QI4A 2NY7L 1YY8A 2VM9A 4KZDL 1LEGB 4H20L 1NGQL 3RJOA 2Q20A 2X7LB 3D39D 4XNBA 6PAZA 3P4MA 3RFRA 1FH2A 4L4TE 4FXGC 1Y6MR 2W88A 1QLRB 3OAZK 1KEGL 4XMZA 4HS8H 3RFZB 1ZEAL 1AJ7L 4XN5A 1HTYA 4XPFL 3FYIB 3VD3A 4ZAKA 4RGOH 4JRXA 4YFLI 3TV3L 4KI5C 1G9ML 3OSVA 4KQ4H 1B88A 4YGAB 1YAIA 2L4OA 4B6ZA 3LKOB 3GSOB 4KO9A 5FO8A 1AIFB 2AEIT 2AK4E 3HTLX 2UXTA 1GJUA 3L3HA 3PAVA 4LSVL 1CVSC 4E41E 4CVXB 2D3LA 1NCWH 3DDFA 1MZZA 1WK0A 3L2MA 5KYXA 1FG2B 3PGDB 5TE7H 1I1YA 3M86A 4M48H 4MMYB 3TP4A 3LZFH 2KLSA 3EADA 3AQXA 2GIMA 4HT1L 4J3OF 5IMKB 1EVTC 4AVHA 4IW4C 4JPIB 3E38A 1DVUA 3QQ9D 1LNUB 3DHJA 1UZ8B 3DBXA 4ANKA 4P06A 2XWBB 5IHUL 3BO8A 5LGKA 1NCCL 3E8UH 3U4EA 4ZNCD 4F58L 1LTXA 4FG6D 4Y16D 3QRFM 1MEXL 2H1PL 1I7UA 3NGBC 4M4RA 4Z95H 5DJ6B 5HTSA 1U91A 4HUXA 2BH0A 4LDOB 3MRKB 1VDGA 4J5VA 1KG0B 2H9GB 4W9DC 4OZIF 3C60B 5C0BB 1CLCA 4LSPH 3GXNA 4DEUA 5IW6A 1PSKH 1XL4A 2HG5A 5LXGL 1KDJA 3D12B 4OZIA 1OY3B 1BFSA 1XF5B 2HFEA 3WLWC 3BE1H 2OS7A 3Q6GL 4FLHA 4LNRA 5F6HI 2RMNA 3LH2H 4NPJA 3PGCA 4JFFA 3UTZB 2EYTA 2X70A 1IKNC 3PPEA 1DO6A 3QQ4A 4JN2B 1G43A 4RFOL 3UDWC 4P2RE 2SODB 1P5VB 3LHPL 3WXWH 3RWFB 2VRAA 7FABL 1CVRA 4IHBA 4K2UL 3BXNB 2NNAB 5CNHA 1J8HA 1M71A 1WFUA 4FFVC 4GUPA 4KAQL 4ODBD 4EN2A 3IAQA 1H3VA 2ZCKH 1BZ7A 3FRPA 5D7JB 2GJRA 3ZZ1A 4CVUA 5IB4B 4XB8A 3WTXA 2EE9A 1J8SA 2XXGA 2YD1A 3ARGA 3BUPA 3QIBC 5J1SC 3NFSL 2F54B 4JPVH 4LCWB 3PREA 1QFWI 3QORD 1JF1B 2GITB 5JIKA 5EZLA 3WFCH 1CE6A 4NKIH 2P44B 4PCKA 2IAND 4GP5B 1Z5HA 4Z3IA 2J1XA 4P2QD 1YJDL 2Z7ZA 2VIRB 1BG9A 1MAJA 2AF2A 1NLBH 4NOBA 3ZYIA 3A4DA 4NAMA 2N3JA 4OAWB 4P8QA 3ZQWA 2HT2D 3TH2T 4ELDA 1C1EH 4K9JA 1A1NA 4Q2ZB 2WV3A 3BQUC 2DW5A 3T2PA 1DEEB 4KDTA 2IMNA 4R7VA 1TPXB 1S4IA 4KJPD 2DTML 5KJRH 4U1JB 5KN5B 3GGWA 2X4OB 4HAKA 5BS0E 1F2QA 4PW9A 3ZMNA 3JVGA 4N2GA 3HCVB 1Q9LB 1S9VA 4H5SB 3ECVA 4X7DC 3UTPD 5IR1A 4P04A 1PZDA 3T4YA 3ARFB 3UZVA 2QMKA 3MX0A 1HAUA 2CQVA 2Z8VC 4AIZB 3SO3B 2R23B 5C0NC 1MVUB 3MRNA 1KGCD 1AOHA 5BJTA 2IXQA 5E6SB 5LG1A 3GSVB 3VRIA 5C0FA 4F1SA 1YEEH 3N6YA 5AW8B 4Q4EA 4YR6B 4HOWA 1JHKH 4K9EC 5JW4N 3EJYD 1P4LB 2C3XA 2OTWB 5T3ZL 2G3XA 3O45A 4P4KD 2UWEE 2V8MA 3PNWB 2CDFA 5BZXA 1KCRH 4EXPX 1RUML 3EH2A 5D1XE 2DQJL 2EDXA 2PUQT 4BM7A 3S37H 4X80L 1A3LL 5F1NA 3QNYB 4ZPVA 1KB3A 4QHLA 4RGND 5BRZD 1NANI 1OSYA 2YUVA 4C8XA 5SX4I 1O7DC 3NK3A 4A7TA 1C12A 4F8NA 5DYOA 3BN9C 4IGBA 2W80C 3PDOB 3G5ZB 1JZ3A 4P5RA 2XHNA 1JPFB 2E74C 1JRHI 1A7PL 3IRZA 5ACZB 1C8QA 1D5MA 1YEGH 2YD2A 5ESVA 5I75C 4JO8A 2KL6A 1DFBL 4AEIL 4ZFFA 4NQEA 3CFBA 4ZO8A 5DHYB 3QIUA 5F7MC 4X5XB 4K94C 2H3XC 4HBQA 1KCKA 3QZWB 3NIFF 3IVKB 3BEWA 5CEXA 1EFXB 2HCZX 3TIEB 5I28A 2MPAH 4N3TA 2M8XA 1KT2B 1DO5A 3ATEA 3OAZH 5JO5B 1Z9PA 1AS6A 2CCLA 2P80A 2V17L 3AT9A 4WNQB 4WW1A 5EEWA 3OKMA 5INCB 4QRPE 4I0PD 2XRAL 5F6HJ 2PPCA 4S0SD 3PV6B 3SE6A 3KXFE 1F3JB 1CXFA 2HUHA 3CTTA 1T7VA 4DGIH 1SYSA 3IFOA 4B9JA 2C3HA 3HRPA 5D2NC 1OLLA 4PB0H 3ZKNC 3O3DA 3L3JB 1JV5B 3PY9A 3TOPA 1CFTA 3OKEB 2JXMA 3SPCA 5BMFH 4N5EC 1FV1A 3IDIB 2AQ2A 2VO5A 3QUMA 5CP7A 5DR5H 4EI5B 1NBCA 1BFTA 4N90D 3TJPA 4NQVA 1H5BB 1T22A 3MBED 1UXLA 1WS7A 2JE8A 2GFBB 2TRHA 4LF3A 2WO3B 3IPFA 2R7EA 1KCBA 4C56E 4HIEB 4GUCA 3G5XA 3WXVH 4K4KA 3BDYL 5F89B 4FNPA 2IPTL 3BHBA 1AD0B 3DXAB 3THMH 2ZUVA 3TCLB 2O26U 3T6XA 3QG7H 4B95C 5LCVL 5FAAA 5DWUH 4RQQA 1MDTA 1D5BA 1DCLA 1RZKL 5DFVD 1FGNH 4YVNA 5GHWH 4K3HA 1PZBA 3KLHD 1UZ6F 3IM1A 1KV7A 5ISZD 4KJWC 2J4WL 5I1CH 4DOHE 3NRPA 1TU2B 5HVGB 1CJYA 2APTA 4P5KB 3VD5A 4WGKA 5CZRA 1ZLUK 4GFXA 5HGHA 2Q5BA 4QGTA 4YFDB 1A47A 2FD6H 2DQCL 2N7BA 4YSRA 5DI8A 4BA8A 5LN4A 4FLRA 4J3VA 3SDAC 3MI6A 3N0AA 4OFQA 2ESVA 3EYUL 5IVZA 1KJVB 5ILTH 1D9KD 1JI2A 1INDH 5E1HB 2V4LA 3QZWG 2DMGA 4NRZB 4WV1A 4MAYA 1FPTH 5KS9B 4G83A 5I17A 5GGQL 2CLVB 1TSRA 3FT1A 4K3JH 1E4HA 2Z64C 1OCZB 2CJUL 2IBBA 1QFHA 2Y1ZA 2PKDA 3GUFA 4YDKL 3QZOA 3SE8L 4JRFA 2EIKB 2O5ZL 3TIDB 1UWYA 3PIQB 2GUYA 1W6WA 5J11C 2HVBA 5T3ZE 2VW6A 1EDQA 4WUUD 5GS3A 2ICWB 3IBEA 4ZJ9A 2F74B 5F7DB 3E8VA 3O0RH 3T4AC 2ADFL 5DJ2A 4FQXD 4ODWA 1X7TA 4ODUB 4Y1AA 5CJQL 5AZEH 3ZT5A 4LE8A 4AVKA 1PD6A 5E5MB 5CD3A 2BSSA 3M6DA 3NFNB 5C70A 1JZ2A 3SY0B 2WIIA 4JFQB 1ZKAA 2PCFB 1N6QH 1CC3A 2ID5A 3DGGA 4J6RL 1TJGH 3P0GB 3PL6C 4KK6D 4KH9A 5D9SB 4R7NA 3GYRA 1AGCB 4G7VH 1BD2D 3JV6A 1RJCA 3GMNA 2YUXA 2FBRA 4GW1A 3TM6A 1WHOA 4EZLA 2QVKA 4JFXB 4X4ZA 3TO4C 2YS4A 1OOWA 1P7BA 3KH3A 2EUXA 4JZOA 2GBUA 4DP0X 1XGRB 3RVWD 1MCOH 4ZOCA 4FULA 3CDFA 1FFOA 3NRQA 3OZ9H 3Q2VA 1KULA 5E1QA 2FECL 1FLTX 2GI7A 1ZHKA 3DGDA 4YSOA 3OHXA 4BUQA 2O72A 3LKSA 3PAYA 3FOLB 2X89A 2IFFH 2AZAA 2VC2B 4J39A 5EC1A 2FEDD 4PJ7E 3VI4B 1C08A 1TCRA 2AABL 1HDMB 2CLZB 1BQLH 2EDTA 3FFDA 5KSUB 3QUZB 1U8JB 2FHBA 3NCWA 5ALCL 3B9VA 3TVMC 4XBPA 5JIPA 3GXDA 5IK3A 3IDMA 2IDFA 2PXYB 1KGJA 4QAMB 4Z7VE 5IQ7H 4PJIE 3SKJL 2ADIA 2OSWA 2XYCA 4NUPA 3UYPA 4BA0A 3ARRA 1FBIH 3J27A 3JWNG 5TGBB 4NT6A 4E9YA 5BV7B 1RU9H 4YHLL 1YPZB 5L7XH 2HFGH 1AXTL 3L6FA 4W9IC 2A4EA 4Y4KC 4M8RA 5EC2A 5KSAD 4X6DB 5AWNH 4M7LT 4PD4K 2Y7MA 3MJ6A 3EG9B 1H15A 2M2DA 1NGPH 2DQFB 3DRQB 3U1QA 4QOKE 3S36X 4DN4H 3EGSB 4UANA 1NBYB 5HYJD 5FCUL 4S1DC 1U8NB 2Z7YA 4HS6B 5AVQB 1I7ZA 2H2SC 2P5EE 2ZYHA 5E0FA 4OVUA 3X1NA 1MG2C 4XNUL 4NO0D 5E23A 5J3HC 3EBHA 3BWUC 1ESOA 3F05A 4WWPA 1J0IA 3L5XL 1T3FA 4Q9CA 3JSSA 3TN0B 1T5XB 2AXWA 4MJ2A 4NAJA 1RUPH 1YEFH 5FLUA 4N2DA 1S5IH 3VSVA 3PXJA 4KTGA 2B4CC 1KGUA 2CGYA 4QHPA 5FO9B 4KKZA 3CCHB 3MV9A 4XX1E 3WLWD 3PJSB 1JGDB 2ED8A 3VFPB 1FH5H 3ZGIA 2EKJA 2VR3A 5EU6A 1RJZB 4PRPE 1XD1A 4UQBA 3GINA 3RDTA 5EZIL 3VMOA 2OI9C 4OJDH 4PJBB 1CK0L 4OZ4A 3ZTNL 1ETZA 3HG1D 1U30A 4MXWH 1QSFE 3L2LA 4OBRA 2X0WA 1E4XL 3WIAA 4WO4D 2V2XB 2V9RA 3EIFA 4U6XB 3TO2A 3QDMA 4GAYB 5FUCE 4PJCB 3S0PA 4P2OC 4LGRB 1MI5E 2ENJA 2OR7A 3FO0H 1ETB1 1CDGA 4UV4H 5TQ0H 3NZ8A 5IEKB 4MDJB 5JXEC 4R97C 4E5XG 2WJ7A 3ZHNA 1ZLUH 3EGXA 5T5NF 5BUPA 3FNKA 4LARH 3V5DB 4ZMQA 1MIEL 3SKMA 1JNHA 1PJWA 5FA3A 3MLWH 4FTVE 4XP1H 2GC7C 4AM0A 3DETC 1I9RH 1FVDA 1UM5L 2CSPA 3BQUD 5DUPH 5B38B 4U1MB 4PW3A 4IRJA 2KUTA 5E8NA 2LTQC 4FNRA 3S35L 3MZTA 3U30C 1K2DB 3W9EA 4PJEB 3GXPA 3LHAA 4FABL 3HNTH 5F7LB 1PKQB 4UQDA 1EMTL 2P8PB 4MLIA 3RX9A 5F7UA 5MEPA 3GB7A 4LGPB 3QVAA 4HHAA 4PG9A 2EDHA 1WA2X 4ZT1A 2BXZA 3A6CH 3QDJE 1NUFA 3CFJA 5HHVH 5ITFA 4YO0A 1VF5C 5DC2A 4M6MH 4G6ML 3KE0A 3MJ8B 1TIUA 3MLXH 5CGTA 2B59A 2KDGA 4A6YB 2BP0B 3W0WE 1H6TA 1G6VK 1QEXA 1GGTA 1BXVA 3QAQA 4LCYA 5T1DH 1OL0A 3U79A 3K7UA 3ULUL 4LLUA 5D7IF 1F6AA 3DURA 5EIIB 5J6HB 5LN8A 3NMEA 5H35B 4RWHA 2VUKA 3A6BH 2DJUA 5D7IA 1DJGA 2COQA 3UZQB 1LK2A 5AOIA 1FN4B 3APCA 2D4FA 3CFEB 4HCFA 3U2IA 1MRFL 5AD0B 4LSRH 4IBZA 3BCDA 2RCSL 4FQ1H 4BD4A 3KPNB 4DFIA 3LZRA 4HSAC 4HULB 1XAUA 4S1RH 5JXAL 2AFNA 1HAWA 2I60L 2OL3H 3HE7B 3ATFA 1X5ZA 2BOBA 5C0EA 1FIGL 3ISRA 5CBEA 1J0ZA 3ME0B 3UG3A 2PCYA 2J1YA 3DX9B 4KRPC 1ZV5A 2H45A 4Y9CA 5M94B 1Q9OB 3SDXE 3TONA 4G8FB 3ULVD 1AGDB 1JHLL 5CGYD 5FGBA 1KMGA 1U8CA 1KN4H 1FZMB 3B3IB 3OKDB 5JPMB 3ZUCA 1EZVX 4ZX5A 1N18A 1T89A 2FGZA 4TTGA 3BPOB 2AEQL 3OGCB 5I9QB 1KJMB 3OD3A 2XDHA 3EOAB 3HRZC 3ATDA 1M05A 3MGAA 5DVPA 4WI8A 3ARBA 3I6SA 2YOCA 3HLAA 2C7UA 2IBGA 4DHLA 1GCYA 3C5JB 4KUCD 3UO8B 3DK2A 2XX1A 1XL6A 4M5ZH 1EO5A 2EXWC 2ZAIA 5B38G 3EAKA 3VFRB 2Y06L 4FKEA 2JCCE 4DPCX 4XNQB 4WNJA 2B1HL 5IBTL 3VNZA 2A7BA 3V6ZA 2GJ6D 3ZE1E 3BLBA 3EH5B 4IMKA 4Z7NB 4HZLB 3KPOA 4XN1A 3RTQC 3V9FA 5HYFA 2DI9A 3Q43A 4KHTL 2PABA 4MS8C 3GEWB 2RALA 5FS5A 1U3JA 5ABAA 3CSFA 4FHBD 2NXZC 1EO8H 1U8HA 1SHXA 1WIOA 1WS8A 4KMQA 4PLKC 5E99L 3KW8A 1CD1A 3QHZL 4OZGB 1NBQA 3T0EA 3RU8L 2DL9A 3MRFB 3ZE0E 3WY4A 4UUJB 2W9DH 4TPRH 5ABZA 5EF2A 2YPLB 4ZQKA 5LAXA 1UD4A 4GG6E 1AOZA 3KBEA 3GRWA 1R19A 1XH0A 4K3DL 4N8VB 1PVHA 1UA7A 3LIZL 5D1XC 1MCSA 2X28A 1DN0B 5EIIG 2PW1A 5D7LD 4MQXD 1DQMH 1G9MC 1MH5B 2OQJA 3FB6B 4PHXA 3NCEB 5DHVA 3QI9A 1SHMA 4ACPA 5JHMA 3Q06A 1FNGA 2VLJB 4MQ7A 2VJ8A 3QJFB 2H8PA 3N44B 1SN0A 2MQ3A 3T04D 4YJZL 2H1XA 1F4HA 4BZYA 3BYTA 2EH7L 2FT8A 5FYLD 2JK5A 4K73A 4QRSA 1DZBA 4IU3A 3GHPA 3ZKMC 43C9B 2V37A 4MMZA 4RRPA 2HX9A 3L1OH 1OAJA 2UYLB 4PTTB 3NZUA 4ODTH 3PHQB 4JRYB 1SXZA 3FONB 4JN1L 3DYMA 3U4BL 4YSTA 1T1ZB 2ED7A 3MXVH 3T8MA 3NCBB 1PZCA 4KNUA 3H0TA 3UZEC 3ZN6A 4BE6A 2Y24A 5C8JB 1I7TA 1U8IA 2GTZB 1NEUA 3EGDB 1QRKA 3I75B 3LZLA 4PI2A 4AJWA 3D33A 1IAIM 3G6AB 4X7CC 4ZUWB 2CR3A 3DO7A 1HI6A 3EJUA 1KCUH 4DEPC 2NW2B 1M6OA 3FTGA 3FSOA 4YHPB 3SE4C 2E56A 3NUKA 5J06A 3U36A 5EEVA 3O8XD 4KXDA 1H3GA 3ULUE 4JFDE 1N64H 2BVEA 2UVFA 3C5ZB 4IMLA 2YRZA 4OY9A 2R51A 4XP6L 2D7TH 5CSZA 1A22B 4UU9A 4ZX6A 1KLUA 1XF4A 2HVJA 4UWQB 2A9ML 4FNQA 3SDCB 1UT9A 2YR3A 4MSWA 2VLRB 5K39A 1KWGA 4N9GA 4IBLT 2NY1D 4HFUL 5PCYA 1DQQA 1G0XA 3STZA 1SF3A 4ZXBC 5FECB 4FA6A 1WLHA 4I3GA 2A9DA 1U3HC 1GC1C 2WCSA 2QFPA 4UM9A 2ITCA 1PG7W 1E42A 2HN7A 4F15C 2MTPA 4QHMB 4JDTL 2QTVA 4FYQA 3UO1H 3GNMH 4S1QH 1QWNA 1WZKA 4N8VG 3VCLB 4X6CF 3QHTC 3EO1A 1EDYA 1WFJA 1YNKH 4TVPH 4PB9L 5GS0L 5D4JA 3BPCA 4X6CA 5IWLA 4W9EC 3IU3B 1W2KT 5HDBB 2VUOA 1X5IA 2L8AA 4PGCA 1N5YH 1QFWL 4I9WD 1WBXB 2BSTB 3GD1C 1TYJA 4QTHA 1IQDB 2Y4SA 4AGOA 5I1HL 1ZA6B 1FYTB 1A6TB 1M6UA 1ZJBA 3BP4A 4I3RL 1A9VA 3MRQA 2X4RA 5I1KH 2L7JA 1ZT1A 1CFQA 1KXVA 2CU9A 4PJ8C 3QCTL 2CBQA 2R0ZH 1U4FA 1VADB 5CCKL 1T2QH 2NNRA 3S98A 5FM5M 4GBXB 4NNXB 1XCQB 4JKPL 5IB1B 1BIIA 1PY0A 3AS2A 4G11A 4D2NA 5SWSB 4FG4A 1I1RA 4HIXH 2IPKA 4O5LH 4U1GB 4Z77A 3K2UL 3KNBA 3B7YA 4Z76B 5DK0A 3HUJF 3IWVA 4M93B 2ROYA 4YBQC 3WFDL 5E8PA 2G2PA 5C0AE 2O5NA 3FB5B 3H42L 2WO2B 4OD1H 5AW6B 4LGSB 2NY6B 3W81A 9CGTA 5CO1A 4N5UA 2MTAA 4LNVA 2G5BB 3WIIH 3FN0L 1G5GA 2W94A 4JY6B 4TXVB 5E5RB 4OFDA 3ML9A 1TFPA 2BIOA 2R0WL 1CICA 3CBKB 3B1TA 2H2PD 4S1DD 1WWCA 1FO0H 2NR6A 3DX7B 2F8IA 2CR6A 1T4KB 2PTTA 4DETA 3F7LA 1I8KA 3G08A 5F88B 4K5MA 4F80A 1AR2A 4HCRH 4XPAL 5E6IC 1U58B 4PRHD 3FULA 4I0KA 4XH2B 4NN7C 3KYOA 1R6VA 4B27A 5HJ3B 3AWFA 1IGYA 1KTRL 5CD5C 4AL8L 4JY4B 4UTAH 3FQRB 4YDLB 2HH0L 5IEHB 4YSDA 2HJKA 1HX0A 3W9DA 4YHMH 4K8RL 1QAWA 2ADJB 2DL2A 3VRJB 3EF7A 1BHGA 4JFOB 3C6LD 3FUDA 3RIAF 1JRHL 1S7SA 4UV7L 5EU4B 5D6DA 3BZ5A 2YPVL 5FHBL 5BO1L 1T04A 4JRXE 1OWWA 4NBXB 4Z8FL 1Q94B 3QEHA 3DJZA 1XIWC 5CN1A 1AXIB 5TK4A 2ZG1A 2D0FA 4NQTA 1HILB 1XZ0B 2HVKB 4L3CA 4L4TD 4M6NL 5DD3L 3OLDA 5FDYA 3SBWA 4IOSD 1S5HA 3CLEL 4NUJB 5CCGE 2EVGA 4XCNA 4L0ZA 3N04A 2FL5A 2IMMA 1CFNA 4G5ZL 5DD5H 3HKZA 4MJ5B 3TH3T 4AVIA 3NK4A 3CU1A 3ZSSA 4KOBA 3FU5A 1JGUL 1Q72L 4R4FH 3RURA 5IB3B 5F0LB 2B20A 3VXNA 2CUHA 5F3HA 4ZW6A 3TEZA 4FG2A 4FQLL 4AJYV 3H9HA 4IDJH 4XTRC 5LO7A 1KSRA 1CLOL 2L7QA 4FQJH 4Q9RH 4YDJA 3DUUB 4FFZL 2Y5QA 3BVNA 2YQBA 2VO8A 1HC1A 1YNLL 3K6SA 4ONHA 4QHNA 4GAAA 4B3VA 2C4XA 2JB6A 1DVFC 3JXAA 5F6IC 3ZX1A 2DRUA 3L3KA 3N40P 4P05A 1NDTA 5L2JA 1UB6A 2G4EA 2ICEB 1KIUB 3A4EA 1MJ7H 4L5FH 1G6RB 1UXSB 1YQVL 2WTPA 2AS5M 4DQOH 3WSQH 5DFAA 1RIHH 4NZRL 3KHQA 4OZIE 2ZX8A 1RZKC 4RIRA 5KANI 2AC0A 5ADPH 4JGNA 4A7SA 2WLIA 4DN3L 1VACB 4M62L 4MCYB 5HY9A 5HVHC 5IQLA 2QVFB 3MFFA 4NJAL 3BIKA 4MB3A 4FFWC 1J8HE 2B1OA 1S7WB 1AP2A 1QACA 2P8LA 2W65A 3Q05A 1CPUA 1T0OA 1GXEA 3QWOB 3LV3A 4IRZH 4KTDH 5FUOH 2EVIA 3I6GA 4LRIA 3FU8A 4QRRA 5DQJB 3KEHA 2AJSH 4P2RD 3UBXB 3KJ4C 3MO1A 3VQ2C 5KBLA 1WTLA 1BAFL 3NABH 1GRWA 1CU4L 3GO1L 1QSED 3PQYB 4IIQB 4UT6H 4Y4HC 1ZVSA 5B22A 4UQEA 1HHHB 5HD8D 3ZE2B 2ZUXA 3BZFA 4WFFE 3TS8A 1MQKH 4UQIM 5FUCC 3K91A 2C26A 2QL1A 2XZQH 2VDOH 4ORGB 2OTUA 3FCTA 1NUGA 1DBML 3D3VB 2Z35A 4RX4A 3MNWA 3MBWA 4GMSH 3ZL4H 4MB4A 3L4CA 4JB9L 4OLYL 4IBUA 4P5TA 4UOW1 4LPXA 1GGUA 1INQB 2C9XA 2ITFA 1B0RA 5L2KD 1CTMA 5I1DA 2H3KA 2VZTA 1Y1UA 5AVWB 2IADB 4NJ9L 3CWGA 1UT2A 3V5KB 4AK1A 2DICA 1E5ZA 1WISA 2I32A 4KHXL 2X4QB 4XMPL 5C09B 4YMPA 4UDTA 5HYIA 3KPPB 2A38A 1E27B 2B9AA 1J9RA 2RACA 2VXQH 1SLVA 1AO7B 1GAFL 3CSYA 4A6YL 3C6SA 4F7MA 3V52H 4MLSA 2DIAA 4Y2LA 3MRJB 3MV11 3OPZL 3RWIB 1XVSA 2DM7A 3RIFK 2CO6A 3LN9A 4I4WA 4JM2C 3RVTD 1PPIA 4MJIA 4JFYB 4NKDA 4TQ8A 3U2SB 5TD4A 4ZMLA 1WZLA 1ZSDB 3SDDB 4BK5C 2JCWA 2PPFA 4QT5A 5JIQA 4J3SA 1ZT7B 4YXHL 4P0DA 4I18C 2IDTA 1NJ9A 2DQHH 2NX5A 1UVQA 3K6FA 3POCA 1XHHA 2FJFA 3QDGB 5DFWH 2YFOA 2VL4A 1OGAD 4LDEB 3GJFK 4UT9A 5AQ0A 5JIDA 3IMTA 2X7LA 3F58L 5IF0B 5HPMA 9PCYA 4NCC2 4TNEA 3BVXA 1QLRA 2R2HA 2UY6B 2LU5A 3OKNB 2CWRA 4KQ3H 4L4VD 4P5MB 4N2KA 4XNZB 2DYPB 5DSCB 3RFZA 3FMGL 1OTSC 2GW5A 5ABDE 12E8H 4NQEE 3UBXG 4WFED 4G42B 1ML0A 4YHNB 2OMWB 2ZG3A 2DJ4A 4PGDB 1G9NL 1ILUA 4Z0BH 1IM3D 5GGUA 3UGUA 4MA8H 4HU2A 2AERT 3F3HA 3ZKMD 3LKOA 1WTGT 4KTEL 4NQCE 1TTUA 5B8CB 3D06A 3NIFE 3UAFA 3U1SH 4U3SA 4PVLA 4JREC 1ZS8B 2NT1A 2WWMC 3A0OA 4L05A 3OMIB 5DWPA 1A0QH 1ICTA 1JS4A 1UQSA 1FG2A 3PGDA 5D2LF 1JXGA 2CPCA 5D4QA 4H8QA 4YC2B 1T21A 4MMYA 1BLIA 2VMEA 4MZ2A 1ROWA 4PPTA 5B39B 2DJSA 3IGLA 5D2LA 1NC4D 5D1QD 5AB1A 3FTUA 2YEVB 4E9XA 1X7QA 3V6OA 5CCJA 1TYEB 3MCYA 3TNMA 1PQZB 1UZ8A 3L3OC 1U8OB 4MCZB 2H26B 1I3GL 2LU7A 3RI5F 3NAAL 2H41A 4QUOA 4OJCA 4IBSA 1NMCC 4ZPTB 5DJ6A 3V6BR 1RZFH 3MRKA 5E4OA 3GF8A 2EE3A 2OYMA 4ADJA 4O02L 4TOYH 2H9GA 3CFDB 5JYMA 1VAHA 3C60A 3DK0A 1WIUA 4WW2F 3UMTA 4X42A 2E4TA 1KLGB 4D9QE 1CGWA 1SYVB 2QHRL 1ROCA 4TM9A 5GZOC 3F7VB 4RDBA 1UEMA 2GT9A 5DRXB 3WIFB 4HUKB 4X7TB 1H9VA 4JL2A 4P46D 3T71A 4HD9A 2IWFA 2VQ1B 4G7RB 5EN2A 2EQDA 3UTZA 2XTJE 5ICZA 3K8LA 1BIHA 5EULV 5E7BA 4KPHL 4HH9B 2ZCLH 4RISH 2DQEH 4JN2A 1P5VA 4JG1H 3RWFA 4DKEH 5K9QG 1VZGA 1G1CA 2WTOA 3BXNA 4Z3JA 1UTDA 3LXUX 4K9EH 3QFJE 4NLHA 5DVNA 4KKLC 2BHZA 1UZ6E 1I8IB 1N4XL 2PPAA 1C7SA 3GIZH 1X44A 5IB4A 4KK5D 2X6UA 1RFDL 5C07B 3RNKB 1XAKA 2GBTA 4OZHB 5GS1B 4BQBA 2JJTC 4NDMA 5G4MA 1JNNL 2OSLA 4KBPA 2Y2TA 4WNSA 4YSAA 2NTSP 2Y6SD 4ZUVA 4B9KC 5A6MA 4OFKA 4WY7L 2GITA 5IY5B 3NA9H 5JA8B 2Y7OA 4YSEA 1CWVA 2ZXCA 4BINA 1J0KA 1HEZB 2K4AA 2YLKA 2YA2A 3QXWA 3ELQA 5BZDB 2VIRA 2V3DA 3IBOA 1RUQL 5DQDL 3CVHL 4OAWA 3WO4C 4B96A 4Q2ZA 4XXCA 5A2CA 2VB5A 1DEEA 5AW7B 3VXMD 2CD0A 4ZW5A 1KY6A 4Y19B 1GZQB 1WBZB 1L0YA 1P0SE 2OX5A 3D48R 4KROD 2EYSA 2X4OA 3MAWA 3E2HC 1IAIH 1DUZB 2AKRB 3B7TA 2AITA 2IAAC 3HCVA 5T3XH 1WGOA 4HZ1A 4H5SA 5B39G 4UNVA 1N3NB 1EJOL 1MUJA 5H37G 3V4VB 3HE6C 1MFEL 1RHFA 3GSUA 1VRSA 4UB0L 5LB1A 3WJJC 4Y1AE 1QHPA 2BNQB 3V55A 1OAKL 4WJKB 5AOMA 4Q97A 4HX1B 5CJOH 2R23A 1MVUA 5G2NA 3UJIH 2X1PA 3ULUC 4MZRA 4LHUD 1HHIB 1V05A 3S8GB 7PAZA 1MRCL 1MWOA 5I15L 3VXPB 3MLZL 1P4LA 2OTWA 4TN9A 4LFHD 3RL1B 4GXVL 4ECNA 3R4RA 2R56H 4YHZH 2W59A 2IOIA 3PNWA 3ZUNC 4I48B 3NCCB 4PHZA 2J1ZA 1KTLB 2AXGB 3CLWA 3ULUF 2WLYA 4ATWA 5MEOB 1PGRB 4LKCB 1XCWA 2FX8H 1XGTA 3UP1A 2EDYA 3ABZA 4UQ2A 1PZSA 2VAAB 3CXHK 3QT2A 3MLVH 1IBGH 1FNFA 2WXNA 4MX7B 4LQFL 5AL0A 3PDOA 2ZYSA 3G5ZA 4XMKL 2QKIB 2QR0B 3HS0B 5I6XC 1TDQA 3WTWA 2W9EL 2D7NA 1AVAA 2X9WA 5ANMB 2DIBA 3VWKC 3AGWA 1MLBB 4WAFA 1V10A 1N7MH 4DQAA 4JFED 5ENWB 4AH2A 1HSAB 3KYNA 3SSGA 5K1VA 4L3FA 5DRWA 3QZWA 3QUGA 3EJCA 3TIEA 2BFGA 1JK9A 1XF2A 3FF8A 5I5RA 4AWJC 4EKJA 3BSZL 4JFVA 3ESUF 2YK1H 4WNQA 3ZR6A 3SBPA 2JI3A 2NNFA 1O5DT 3L4UA 5GISL 3VH8A 2Y7QB 1KJ2L 3PV6A 5AKTA 2UVEA 3S5LB 3S8WA 1F3JA 2WUBL 3KPSA 1EAPB 1EXGA 3CDZB 1NC2B 4LCIL 1GGBL 2YZ8A 4BGLA 1IGIH 1CDYA 3BKJH 3N43B 3NJGA 2ZNWA 1T0NB 1IC5H 4W81A 1JF6A 1TETH 3ZU8A 3L3JA 1JV5A 1QR1B 4OJYA 1Z5YD 3GMOB 3OKEA 4JO3L 2CBOA 3L54A 4JUTA 3B2XA 3W11D 4JLRA 5FM8A 4JNXA 1YG9A 4JO4L 3P11H 1CLZL 1S8DB 4EI5A 5CU5A 1YY9C 4PJ5D 4AYFB 1Z5LB 3IJ8A 1H5BA 3MNMA 4TV3A 1DVFD 4XOAA 1A9EA 1DLFH 4HIEA 1LO5B 4HPOH 2R1XB 4NUGH 5L8LB 2GSMB 2FHCA 3P77A 5F89A 5CXPA 4LXFA 3LN5A 2P5ED 2WYTA 1AD0A 3MV9E 3SDYH 2CRMA 1R1CA 4OGAC 3REWB 3TCLA 3R4DA 1CN4A 3QDAA 4G6AC 5EU6E 3ABMB 3EZJB 5ICXB 4A37A 4RAUA 4YDMA 1T03H 4XMXA 1EXUB 3P4NB 4BYHA 1TU2A 4R5XA 2V7NB 4OFIA 2IC2A 4HWBH 2HTKC 3PGFL 3QDME 2NY5L 4PRPD 2YA1A 4PLNC 4GAFB 1NIEA 5FA4A 2DDQL 3R06B 3WGVB 3QUYB 1CZ8L 4G6KH 1S9XB 1SXAA 3NJNA 4K3EL 4Y4HD 3GSNL 1S7UB 2O61B 1AS7A 3FB7B 4NKMB 3H4HA 5KS9F 5L8JB 4F2FA 43CAB 3CN2A 3UTSB 2VDPH 1ZCRA 5I6MA 4IKLA 4Q0XH 1P4BL 1YYML 4KKBC 4NRZA 5KS9A 1MPAL 3KLLA 1JL8A 1I4FB 3CMGA 1GGCL 1MI5D 3RBGA 3N1MC 1KJ3L 5JIHA 3GFUA 3VGHA 3IFPB 3STLB 1FYHB 4JZJB 4F7PB 2UXVA 2PR9A 1IKOP 3S5LG 5FO7B 2AJXH 4XPGH 2NYYD 1T7YA 3KLKA 5HI3D 2A9CA 1R24A 5E4IA 2OZ4A 2F74A 4ODHH 2OCJA 5F7DA 1QO3B 3N2JA 2WCGA 3VD0A 2D2OA 5CFHA 1I3UA 4GB9A 3VM5A 1MCWW 4J3OC 1BFOA 5D7KE 2GTWA 5IB5A 1NM9A 4ABQA 1QBLH 3FSZA 4U3HA 3AROA 2AXFB 3MFGB 3NFNA 1KBGL 2VGLM 4DCQA 1NFIA 2VM4A 5JOPE 1CE1H 3WL9B 5D70L 2I25N 3VFVB 1K4CB 2QSCL 1K8DA 3DI2B 1ZLVK 5CMAA 3O41B 5D9SA 1SEQL 1W0VB 2FLMA 1JVKA 3I2CL 5F9AC 3AS0A 2Z8SA 3ARDD 4UT7H 1EHLL 2WGXA 5GS0C 3AS3A 4JFXA 2WBJB 4XX5A 4H88L 1OE2A 3CC5A 1DEDA 3HAEH 3N41F 5BQ7B 4FP8H 5D7IE 5CHNA 4DZ8A 3HC4H 2OZNA 5E6RB 1OAUH 3W0WD 1NLDL 1YEDA 4R0LB 2XWRA 1FL3B 2IAMB 3I02B 1YN6B 2ZT9C 1GJWA 4UI2A 5KVEL 3TPUA 3WDJA 3JTSB 3OTTA 1OD7A 4BELD 3VI4F 1LDPL 3UCQA 4E42A 3KYAA 1LO0H 3EBIA 4GAGH 3FOLA 4N6RB 2E4FA 5B1CA 3ARGC 4XWGH 4N6QA 3VI4A 4M6AA 5KSUA 3U4KA 1U8JA 1MFNA 2H0PA 1YZZA 5DD6B 1MF2H 1RZGB 1E7UA 5TF0A 3F8UB 3INUL 4PCTA 2R29A 1JGLL 5D8JL 3QFGA 3O9WD 4JMNA 2XACC 4LSQL 4WEEA 3TTSA 2F53B 4EN3D 3H2PA 2BVQB 2CIKA 3DECA 1YPZA 1TLKA 1DSYA 5JHLL 3DOHA 2A1WH 3QQNA 4GAJL 5EEYA 3CQQA 4KDTC 2FB4H 4RA0C 4A55A 2XQYK 1KDIA 3NVQA 4GRLB 4EI0A 5KSBB 1P84K 2E0PA 5JUEH 4HXBH 3D2UB 1LEIB 2BMKB 1NDMA 3JVGC 1KIQB 1U41A 4J3XA 5F1IB 5FWQA 5I0ZA 1N8ZA 1IBFA 3DV6A 2DQFA 3DRQA 1B0IA 4HUWB 4A68A 2VXTH 4X5WA 4BFEA 5FPIA 4XN4A 5I18L 1U8NA 2QLVB 4GEJA 4PRIA 1GPOH 4LASL 4OIBA 1WHPA 2R69H 3OHMB 1SHWA 3V5HB 3ILQC 4Z78B 5JW3H 3QCVL 4OCWL 5FW6A 5GRJL 5GGSB 2WGNB 4JRLA 1IE4A 2VLKB 3TFKD 1D5ZB 1N0LB 3NDYE 1G7LB 4HC1H 3T0EE 3D09A 4BFGA 2XBZA 2WM0A 2VDRB 1ACXA 5DURB 4Z7WB 1DDHB 3GSWB 4GT7A 1CTNA 3AUVA 3KWXA 4NZTL 1F90L 1RIUL 5FO9A 3VXQB 1DLHB 3QPQD 4PWFA 5CEYB 3CCHA 4FQ2H 4UTBH 5GS2H 2IOOA 1PZ3A 5J0BA 4HLJA 1XFPA 1IT9H 2R83A 3I9AA 3CFKB 1DL7L 2FNBA 1DJHA 3E6HA 3OPUA 1RJZA 2JTYA 1HINL 3IXTA 3NDZE 3V2AR 2EDFA 4PJBA 5HDWA 1L4IA 5GGTL 1GH7A 4IGBC 5EORL 1FGVH 1P1ZA 4J28A 4WWOA 2X1QA 5GRUH 3FTSA 5GSRB 2B5IB 5HDQH 5FYJL 3VXRB 3MRMB 3FUMA 3WE6B 2V2XA 1NPJA 4U6XA 4V1DB 2XZAH 4QRQA 1G7IB 2ZUWA 3RLSA 3S35X 2EJ1A 2Z8WC 4MMXB 4Q9QH 4PJCA 2DF3A 2JKNA 3KZ8A 2WXMA 3K0WA 3QIUC 2DD8L 5CEZE 4I3SH 5D5MF 5IEKA 4N20A 4OVVA 4U3CA 2DLHA 2Y6TE 1E9QA 4MAUH 4LHJB 2O30A 3DOSB 4FXKA 5HDRA 4D9RE 4Q52A 2CO1A 5HYQA 1M2VB 1BOGA 3V5DA 3NP3A 4BDVA 1E3FA 1FFTB 4NBYB 4MA7H 3ROLA 4APQB 5AYTA 3FBQA 5BVJA 2J88L 5B38A 4MCNA 4HJJH 4DKAA 5C0BD 1S7XA 4MNGA 2FX9H 1Y6NR 1IBBA 1L0QA 1K2DA 3EYSL 1UM4L 4PJEA 5LDUA 2FBJL 4MA3B 4JY5H 4AGPA 1PKQA 3BAEL 3VXUB 1WPCA 4UINL 3HNVH 3ISWA 1QFUL 3WKYA 5CJ8A 4KXBA 3OKKA 3U9PL 5ECJE 3DYOA 3B2VL 1SPDA 1D7DA 2IV9A 5T8IA 1YN7A 5FUZH 4M6OH 4I77H 3GSRB 1A14H 3RZCA 3VFOB 2BP0A 2LV4A 1J8KA 3TZVA 5GSVB 5D7JD 3MACH 3LQZA 5CZKA 3T1WA 3LD8C 4KMLB 4WTWA 2Z7UA 3G9AB 4G70B 2C9VA 4HS8L 5EIIA 5J6HA 2XTJC 5CKGA 1X5AA 2F54D 2FO4A 4LCWD 4N0YH 5D1ZA 4BH8B 1ZANL 2X42A 3IMUA 2C5DC 2A99A 5ELIA 3MUZ1 4RGOL 2ZYRA 3UZQA 4X83A 4JM4H 3BVVA 2Z4TA 1ZLVH 1IQWH 3O6KH 4F9LA 1J5CA 4KQ4L 4X6CE 2FYYB 5T1LA 3KPNA 1RJYA 4C58B 3JTBA 2TAAA 5LWYH 5TPWH 1Z3RA 3HE7A 1WC7B 2HKHH 4NC2B 4ZMPA 2QGDA 5EUOF 1S6NA 4JPKH 4LESA 2E7DA 3P73A 2M83A 1NCWL 1Q0XH 4AYID 5I5MA 2BNRA 4TYUA 5TE7L 2VJ0A 5EUOA 4AUJA 1AGDA 1CCZA 2BINA 3U0PB 4M48L 5GRWA 5ERWB 3BGMB 4O4YH 3LZFL 5JPMA 4AMWA 4WV1C 4MAYC 4JFHE 3MNVB 3RVVD 3ARFD 4L29B 3OGCA 35C8H 1KJMA 1WYJA 2V5MA 2VLLB 3MRPA 3VD9A 3E8UL 2LGNA 2CKBB 4NCDA 4TQIA 3GBMH 4N2EA 5DK3A 3CSGA 4Z95L 5JHDA 1ZV2A 1GY1A 5CR8A 3HUJE 2ZUTA 4GKZB 1MAMH 4ZW3A 1A7OH 1GIGH 1M53A 1JDCA 1UOVA 3G5VA 3VFRA 1T66C 4POZC 4LSPL 1PSKL 4XNQA 1LP9F 2OJEB 3EKCA 3NJXA 3BE1L 4NNPH 5E00B 5F7NC 1TQBC 1U8MB 3LH2L 3S34H 1LP9A 3O4OC 1K6QH 4GQ9H 2FQGA 5CKAA 1KB5B 4X6FB 3KR3H 3QJRB 3WXWL 2G4GA 1ASQA 3UAJC 1TUPA 1F86A 2QQNH 4JFZH 2D3VA 4OZGA 1AZVA 5EPMA 1LE9A 2P9RA 2PF6A 5FYJE 3MRFA 4HHWA 3VX1A 2AV1A 2ZCKL 3Q8EA 4UUJA 4JHWH 4NN5C 2CE6A 3BD4A 5GRVK 2YPLA 3RY5A 5J6GB 3FT9A 1OEZW 4N8VA 5AW3B 3UJJH 3SB3A 3SYPA 5AVUB 1B3JA 5GJSH 5BQDA 1DN0A 1QVOB 3MCLH 1IEBB 1YMMB 1HXYB 2XU9A 4JPVL 1JHTA 1MH5A 3V0JA 3LKQB 3L7FB 1I75A 4G6AD 3SD5A 1G9NC 3GMPB 4R26H 2VLJA 1EFXD 1BQUA 3G6JF 3WFCL 4NKIL 2GHWB 4JM0A 3TX4A 3OHXC 1PYWB 4ALAC 1WA1X 1JPEA 4FLOA 5CU9A 3Q6FB 1GC1H 1FRGH 1NLBL 3G6JA 2IALA 4YHYC 4ETQB 4S2SB 3KLDA 2OXGA 5I6OA 1TTAA 2WP3T 1C1EL 3MLSH 4PV8B 1RZIA 4NX0A 1HNFA 2UYLA 1ADQA 4PTTA 3PHQA 4JRYA 4PGZA 3QXAB 4LOUD 5KJRL 1AQDB 1QWHA 4O2CB 3GPSA 1FCGA 3C09B 1UH3A 2W0FB 4QKXB 4CADB 4WJG3 4X9YA 3EH4B 1KYDA 2Q3XA 5C8JA 3K4AA 4ZZKA 2FH6A 2GTZA 1A4JB 3U0TA 1BVKA 3G6AA 2Y5TA 2DBJA 4ZUWA 4GSDH 2DMCA 3WEAA 4AI7A 3EDDA 2NW2A 3TYFB 4ZRGA 2FSDA 3OR6B 1YEEL 3AREA 1JHKL 1R3LA 5LJYH 3CD4A 2ZUUA 2GHZA 2AVGA 4D0DB 1I1AA 1V8HA 4U6VH 3FT0A 4FF9A 4H1LH 4ELKB 4XODA 5IMMB 2OXHA 3MV7A 1FFNB 3DXAD 5JIIA 3C5ZA 3TV8A 3D05A 5JMOC 2CK0H 1KCRL 4X4XA 2XG4B 2ZKHH 3GIVB 4W9JC 2B08A 4FG0A 2HLFD 3S37L 1ZSHA 3EBAA 2QFRA 4KDVA 1HESA 3QJHB 4PP2A 3SDCA 4IRSB 1F45A 1LWRA 2VLRA 2DQMA 5EMYA 4CU7A 5F9JB 3Q5YA 4PJHF 5E1GA 2P47B 3ECWA 5DJYB 5IMLA 3FUJA 5KBMA 2R1WA 3WKNA 5DK2B 1C5CH 4DUXA 1YEGL 2VYRE 4M4PA 3GZPA 4OLZH 2QSVA 4PJHA 2AJ3B 3LSOA 4CGTA 4JE0A 4QRRE 2HFFB 3RDTC 2R9HC 3MUY1 5KBPA 4WHTA 3HB3C 3VAEA 4D9LH 2IWKA 3IU3A 2J20A 5GGRB 2MPAL 3AADB 1WBXA 2BSTA 1GR7A 2R8SH 1NCNA 3K2MC 4HSQA 1U33A 1A6TA 4DP8X 3BFWA 4LSTH 2RFXA 1F1DA 1C9SA 3DO3A 1X5HA 4CC0A 5IKCA 4DPRA 3NIDB 4WDIA 1FWXA 3JVFC 4JVWA 1VADA 2GK0B 4DGIL 2YN3A 3BCFA 4NP4H 3P9WB 3TTYA 3MVSA 4NNXA 5AVZB 4RGMC 3ESNA 4PB0L 4KFZC 2BOCB 5SWSA 2OULB 2X41A 3WN5A 5CJBA 3JTTB 4ORZC 2FX7H 5C0JB 5F7WC 1G5AA 1IAOB 1HWWA 4Z76A 2YBGA 5BMFL 4N2FA 2XN1A 5B7FA 4PJ9A 1G7JA 4GO9A 4X8JB 4MJ6A 5DR5L 5IUCA 4OGXH 1XSKA 2FIKA 3HOGA 3WMPA 5C2BH 4IRJC 4YK4C 4JQIH 3RIKA 3H6AA 1ZGLP 3VW3L 1IVTA 3KWVA 4QXVA 2BSCA 2G5BA 2Z92A 1PX8A 4JCWA 3WXVL 3DDGA 5GGVY 3B2UD 1P1VA 2LU4A 3IJEA 5FOBB 4OZFH 3WFBH 3LPWA 1MVFA 1KBBA 3ILDA 1JWSB 3THML 4OTXH 2VSMB 3QG7L 1J9TA 5FF6B 5DWUL 3PAZA 1R17A 4Y5XC 4MJIE 4JMXA 4Y1TA 1T4KA 1FGNL 1RY7B 5GHWL 3QIWB 1OW0C 4HJEA 1U58A 2XCMC 1FL5A 1C7TA 5I1CL 1YA5A 2NX5E 2OV0A 4K8RD 1ZLDA 3N55A 2BW5A 4OD2B 4JQVA 4WKXA 3DPBB 5F7EH 3R0NA 3FQRA 3VTTA 3IAGC 5IEHA 1ZXQA 2AAVA 3QUZD 4GQQA 4KKNA 4OB5H 4OLEA 2FD6L 2ADJA 4U49A 4RGNB 5BRZB 2Q7YA 1KYUA 4JFOA 2PXYD 5EU4A 2J4WH 1X4XA 2AEWA 4RESB 5ILTL 1J5OH 1NFDB 3G3LA 1INDL 2TRYA 1QFWM 1FPTL 1Q94A 5IJDC 3L7EA 2HVKA 1XZ0A 4P2YA 1PEWA 2EP6A 5A2KH 4K3JL 2B15A 4GKLA 4NUJA 2AJYH 2EIZA 1LHZA 3IMVA 4NRXB 4WFGE 4LEOB 1IEAB 5FGBC 4PJAB 4GRWF 3NFPB 2FT7A 1XWVA 2Y25A 4P3DB 5I1IH 2I27N 4MJ5A 3S5ZA 1S9WB 4W9LC 1T89C 1M1XB 1LM8V 4Y5YB 4Y5VB 4U33A 1ES0B 5AENA 1WBYB 3O0RL 1EZVY 4NQCD 7CGTA 5JHAA 1QATA 5D2LE 2ERJB 1OE3A 1PCSA 4OQTA 3ARBC 5DJCA 3V6OE 1P53A 5MEND 4D0CB 3DUUA 1X4YA 3Q1EA 3AB0C 1E4KA 4MCMA 3TN0D 1N6QL 3VFMA 4PBWD 1F4AA 3SJVB 1L6PA 1TJGL 2RAMA 3VFGH 1RPUA 1NCAH 3QXTA 4O00A 4G7VL 4XI5D 4E9SA 1AR1B 4IMKC 1FO0B 1KIUA 2ICEA 3QISA 1G6RA 1UXSA 1J0JA 3TJHD 4BRVA 3WE1A 2X4UA 1USQA 2I24N 3DGCR 3WHE0 4ZZFA 5I6LA 5DZOA 1JPGA 4JHUA 3UTQA 5AVSB 3MBEB 2Q9OA 4PH8A 1MCOL 2P43B 3M8OH 5DUBB 3OZ9L 3T0EC 5IROA 1JZFA 1WO2A 3HEIB 4G1MB 3NEOA 4X4YA 1S7WA 3T6QC 2IFFL 2YAHA 1UT1A 4CC1A 1EHAA 1JGEA 1G4RA 3DLQR 1BXXA 1BQLL 5EIVA 2OR8A 4J8QA 3OKLB 2X6VA 4M7LH 3AW5A 4MJ4A 5DQJA 1MFAH 3Q5TA 2JJVA 2BY3A 3QXVA 1AG0A 5ISZB 4HF5H 1HU8A 4Z7UF 5IQ7L 4NM8H 4LDCA 2WWNA 3N06B 4G71B 1HHHA 1SN5A 4F7EB 2DV6A 5IBUG 4H8WC 1JTPA 4Z7UA 3I3BA 1RU9L 4MMZC 2HFGL 3NSXA 1EXHA 5IJCC 5AWNL 5H4ZA 2EH8H 2XICA 3D3VA 4F57H 1KBKA 3UPRB 2KZWA 5DZPA 1D9KB 3ZDZF 1NGPL 1LGVA 5GPRA 4DN4L 1GJIA 1WD9A 3ESOA 4PJXB 2Z31A 4IBYA 4WZ9A 3FTWA 3K71A 1MCCA 2WXKA 1INQA 4GI6A 4BHUI 1MWAH 1CD8A 1FLRH 3LS5H 3HG2A 2X5PA 4LOFA 4Y2DA 4JVUA 3V5KA 3TEUA 3EXLA 2ZKXA 1FVCB 2VDNH 4RDQG 1QRNB 3KPPA 5IW3A 4WUUB 2F08A 4G8GA 3APMA 1RUPL 1YEFL 4AW4A 2QADB 1S5IL 4LBEB 4JZNB 4FMVA 5DRNA 1UCTA 5CF3A 3AG4B 1NDGB 5GRXG 3S96B 5JORB 3ZL2A 4QJ4B 1FH5L 2OZ4L 3VTAA 2CHZA 1IX2A 2E7MA 3U2SA 2Q2LA 2N59A 4FJYA 3H7BB 3QR1A 3MRCA 2O1AA 2AXJA 3O3AA 1Y1DA 4MXWL 4Y4FC 2MIZA 5IM7B 4R7LA 4M7JH 1R5VB 1PS3A 4B9PA 4PYGA 3FSAA 3GLZA 3QEQB 5DTFA 3QDGA 3B8YA 2DWSA 5DJ8B 2J6EH 3HC0B 5HHPB 4QRUA 4U6HB 4MHHI 5IF0A 1AHWA 3D52A 3FO0L 3FQXA 4UV4L 5TQ0L 2UY6A 4P5MA 4PSRA 5HHME 4ZFZB 5IFJB 2EZ0D 4LHQB 2DYPA 5DSCA 4GEIA 3F12B 1BZ8A 2CHWA 3UIYA 5IWLC 4FFYH 5EU3A 3L3DA 2H0FA 1BLNB 2Q10A 4G42A 3RPIB 4LARL 1L7IH 4PGDA 4XHJC 4XNMB 4XMVA 3E1F1 1RIVH 3QSKB 1IGCH 3MLWL 4XP1L 5B8CA 1I9RL 3ARXA 4UZUA 3VNYA 4AW7A 3RKPA 2EADA 1I85A 5JLZB 3KH4A 1ZS8A 3IMWA 4BRJA 1IAII 3M7FB 3KPSE 1EEUA 1HS6A 3WHXB 4AQZA 5EU5A 4G7YH 3HNTL 3RWCA