3GHPA

Structure of the second type ii cohesin module from the adaptor scaa scaffoldin of acetivibrio cellulolyticus (including long c-terminal linker)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
190
structure length
190
Chain Sequence
NLDMIKASYITMGYDKNAAEVGEIIKATVKINKITNFSGYQVNIKYDPTVLQAVNPKTGVAYTNSSLPTSGELLVSEDYGPIVQGVHKISEGILNLSRSYTALEVYRASESPEETGTLAVVGFKVLQKKATTVVFEDSETMPNGITGTTLFNWYGNRIQSGYFVIQPGEINSAPIATATPTTKPTAFAST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Cellulosomal scaffoldin adaptor protein B
publication title Intermodular linker flexibility revealed from crystal structures of adjacent cellulosomal cohesins of Acetivibrio cellulolyticus
pubmed doi rcsb
source organism Acetivibrio cellulolyticus
total genus 38
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00963 Cohesin Cohesin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.680 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ghpA00
2W1NA 3GHPA 1ZV9A 1QZNA 2O4EA 5G5DA 4WKZB 4UMSA 4IU2A 4UYQA 4IU3A 5K39A 3UL4A 4FL4B 3KCPA 1TYJA 5LXVA 3BWZA 2B59A 4WI0A 3F2LA 1ANUA 3FNKA 2JH2A 2VN5A 2VO8A 1OHZA 4UYPA 3L8QA 4N2OA 4DH2A 3KCPB 2XDHA 2OZNA 4FL4C 1AOHA 1G1KA 2BM3A 2VN6A 2CCLA 5AOZA 2ZF9A 4U3SA 2Y3NA
chains in the Genus database with same CATH superfamily
3AT8A 1PAMA 4ZMQA 4HF5H 4HS6B 4G1EA 3MRNB 5E6SB 1H3TA 2HLAA 1D7BA 3S97C 5T3ZD 4BEIA 5ITBL 2QGCA 1QNIA 4ONHB 2V6HA 4P4RA 2OMUA 2I9LB 3CHQA 4XX5A 1JNNH 1H19A 3NP4A 4FXGC 3OKMB 5FW8A 4AIZA 5F44A 4Y16D 5IP4A 3B2DC 5DHVA 2ZONA 3PPSA 3KVDD 5PAZA 5CUSH 3STZB 1GSKA 2R4RH 4I4WB 1H5BA 5MP6H 1NMBH 5J12B 5HYSB 3FT3B 1Z2KA 1M3JA 2XWJB 3RWJA 1NGZB 1I8KB 5DJZB 1MW0A 1L6XA 4XWOD 2LVEA 35C8H 3RFZC 1R5VB 4FXTA 1PD0A 3CTTA 3QCTL 4GRLA 2WINA 1JFQH 3L8QA 4QIRA 2P5WE 4ZMTA 3APFA 1CT8B 2MNUA 2EP6A 2IQAA 2R9HC 4Y16C 3DV6B 3IJSB 5A2IH 3NESA 3QDGE 4I0PD 4YDIH 3EIFA 1CN4A 2WXMA 4LQFL 3QXAA 1FORH 1FVEA 3B43A 3ZIYA 5I8CB 1I7TA 4J3OD 4N4YB 2BY3A 4JPSA 1DZBA 4KGJA 4UV4H 4HK0A 1A22B 1X5MA 1XGZA 1XH3A 4WHTB 3WHE0 3S0PA 3ATAA 3QUML 5K9KA 1NICA 1RZPA 1W72B 1F42A 3UABA 5AVTB 1GGUA 2FEEL 5AKTA 1FRGL 3B83A 3O3BB 5EOCH 3T1FA 4DGIL 3V7AG 3NSJA 3GB7B 1TLKA 4WAFA 2QPUA 4LOUD 1XFPA 4PW3A 4XMKL 4E42A 3BZ4B 4QKXB 4AT6A 2B14A 1CF8H 4RGOH 4DTGH 1UB5A 4P3CL 1FI8C 2V8MA 2VLKB 3PNWA 3WFHA 2VH5H 2DQCL 4KKQA 5CINL 1A5FL 2OMBA 3OJDA 1EA9C 1ZKAA 3EH4B 1S5HA 5ESAA 1NOFA 4HD5A 5FCUH 4HV8A 4B9GA 4F37K 5LGKA 1MRFL 3MCYA 4UT7H 4YSDA 4HJSA 5IREA 1BAWA 2ZOUA 2XUWA 3JWNE 4IRSD 4LSRL 4J4PD 1U8QA 1BPVA 4L4VA 5D4QA 1IKOP 2JJSC 5IGXL 1USQA 3MO1A 3APMA 3EYVA 3ECUA 2FWUA 3KPRA 1DL7L 2B1OA 2I07A 2NX5B 3D0LA 4FFYL 4W6WB 1V7ML 3UTQA 4KO6A 2H1XA 4F8LA 1AKPA 1CXEA 1HHJB 4N24A 2AGJL 1TZIA 2P42B 3QPXL 5ID1A 1YN6B 4MX7B 3I9GH 4XNYH 1SQMA 4UT9A 4DAGL 4NOBA 1FFPB 4MQ7B 2EE2A 1DCEA 1YC8A 3UYPB 2A1WL 2WO3B 4LLVB 4CMHC 1GGCL 4BE6A 4HCFA 5ABDE 1I7ZA 4F8OA 1IM3D 1IT9H 4HKBA 4AWJC 4OCWL 3CFCH 4OD1L 4ZFZB 2QQKL 4M7ZC 2O61A 4HSQA 5TDOB 5A2KH 2CHXA 4N0UA 1KJ2H 3NFNB 3VFNB 4NN5B 2ZNWA 1ONQB 3RY5A 3ZQWA 3RPIA 3WNKA 4F93B 4X7FC 1DVFB 2Q2EB 2PNDA 1YEGH 1ES0A 1OGPA 4O5LL 2W9LA 1DZ0A 4PJAE 3WY4A 1BJ1J 1BD2D 1A02N 2GAZA 3P9WB 1A3LL 5DJ2B 4NQED 2ZX6A 1INQB 1U92B 1RV6X 5CJOH 3EYSH 2CCWA 3BGMA 4WUUB 4MJ6A 5EDXA 4BH8B 4FKKA 3JBG7 1N5AA 1EAQA 3CLEL 3MNZB 4TTGA 1YQ2A 1JBJA 2XVKA 4KROC 2E75C 1GC1L 2GW5A 1KCVH 3W2DH 3TX4A 5DQ9B 5J7CC 5HJ3B 4JO8A 2EDLA 1WWAX 3ZJAA 4GBXD 1IC0A 4KC3B 3RJQB 1E2WA 3THML 3QEQA 4JDVA 2DOCA 3V4VH 3V52H 2FWOB 1MJJA 4P2YA 1ZHKA 2ARJA 4QR7A 4IRJD 3P0VL 3RDTB 4JHWL 4NNYA 1JAEA 4PTTA 2GBUA 1NKRA 2P5EE 3CVDA 4XNQB 3QRGL 2MNWA 3MRBB 5KOVC 1JPSH 3OXRA 1URLA 1ZMYA 5HGDA 5KYYA 5FWQA 4DT2A 1NBQA 3GBEA 3NJXA 4ZUUA 5GGRY 3GXTA 1NAMB 3ZQ9A 3QI9B 1WGVA 3GNMH 1FC1A 1FQ9C 1I9JH 4MHHI 3DRQA 1HQ4B 2BRRL 4U05A 3L9EA 2WP3T 4GBXC 1A7PL 1DN2A 1J9SA 1GOFA 4UI2A 4J7RA 5C6TH 2XNAA 3SDDA 3TT1H 1N64H 2PYEE 4OZFH 1D5ZA 2ITEA 4NKOB 3RVTC 4Q0XL 4BZYA 2Y2YA 1NPNA 2YMXH 3L7EA 3HNTL 1A4JA 2Y36L 4IRJC 2AEQL 4UIKH 1NBYB 4WF7A 5IEKA 4JQIH 2E9IA 3O6FC 4KRPC 2FB4L 2P8LA 3C8KB 2B4CH 4HFUH 2CBTA 2QSTA 1B4LA 1CYGA 2X5PA 4PMEA 1I1FA 3VFVA 1MFBH 5D9SB 5DVNA 3S8GB 2BIOA 4CJ1A 1ZLWK 2LV4A 4TQPA 1FL6B 1TJHH 5K1JA 4ZX3A 2CO6B 3CFUA 4MJIA 4PRPE 5E5RB 1TVDA 1WAEA 4E5XB 3LZRA 1MHPL 3MRCB 4JO3H 2WWNA 4AKQA 5IEHB 3V0VA 2AJ3B 2CHNA 4H2CA 4QXUL 3OPZH 1L0QA 4QRRD 1CICA 2H2SD 4X6FA 1MH5B 4YO0A 2XBDA 2FJUB 1WSST 4MA8H 3SGJC 4L0PB 3CPLB 1ZAGA 3NN8B 5EEUA 3N5AA 4WNQA 1XCQA 3ARBC 1J1XH 3MRDB 4JY6A 4Y88A 1UKSA 3RGHA 1KC5L 2YXFA 1A64A 4A7VA 3QXVA 5JHLL 2EDWA 4HCRL 1Y6MR 4H1LH 2HTLD 4LVHC 5DVPA 2WQSA 1L6PA 1PLCA 5E94A 4HLJA 4MWFB 1T20A 5JNYB 3NH7L 2W94A 4OUOA 1AOZA 1C7SA 1JDCA 2VLLB 3E6HB 3GMMB 3QPQD 5BZWB 1YYLH 5H4YA 3HI1B 1TUPA 3ZO9A 3IU3A 4G80B 4RA0C 4FFZL 4OF5A 3UMNA 4ZSOE 4BHUI 3IJEB 1E28A 3O8XB 5D1ZA 2HLFC 3IYLW 4TUOB 1OLZA 3RIKA 3UTSE 2JJWA 4X9GA 3MLRH 4Y7OC 3KPSB 5LWYL 1ROCA 2QVIA 1ZEAL 3L1FA 5I8KL 1LGVA 2ZKMX 3GGWA 5FUCC 3OMIB 2C26A 4NQCB 2PWHA 4JG9A 4KKLC 5AOLA 3MZTA 2F1AA 5DQDH 2FR4A 3JWOH 4OZ4B 5IJKC 5FWRA 3QPQC 4G8IA 2NW3A 1RK0A 4BWUA 3FU7B 3GWJA 3N3EA 1XF4B 4RNRA 3TL5A 5J12C 5I73B 1OSPL 4TQIA 2EEDA 3LKOB 5CIPH 3SYOA 2G9HB 3MV11 2J8HA 4TMPA 4XNXL 5HYQA 2H0EA 2V7HA 3V8OA 5C8JB 2KI6A 5HYFA 3FB6B 1ZA6A 4GFTB 3S34L 1J11A 1GYUA 5EO1B 2W95A 3W1ZA 1L9MA 1Z5HA 3LEYH 3NIDB 1Z7JA 3KPMA 3O41B 4KKAC 5DI8A 5HGHA 1XF2A 5KVEL 2IWFA 1WFNA 4IBQA 1HINL 1FIGL 1A4KA 4HX1A 4JFEB 4G6MH 4YDLB 3U4EB 4QWWC 1AP2B 3ZUCA 3F58H 5MEPB 5FYKL 5G5DB 2BIPA 2FECI 5KBMA 3Q6FA 4L8DB 4CVXB 2ZUTA 4EI6A 1RZ7H 1QYGL 4APXB 4DP4X 3AABA 1RMFL 4J3SA 3F85A 4LBEA 4LDLB 4W9HC 3KBFA 1KLGB 3ZE1E 3LVTA 1SBBA 2C4FU 4QT5A 5DZLA 4C4BA 1SMDA 3HRZA 3RJOA 3GJFA 3KWUA 4OUUA 4D3CH 3P30H 4G9FA 4PUBH 3VFWB 4ANWA 2NX5D 1MQKH 1SJEA 4MLSA 4DKEL 1UWEL 2OSXA 4UQEA 1S7TA 5CZVH 3QCVL 1BZEA 5DXWA 4H26B 2WLMA 5GRWA 3RDJA 3MLTB 5CJQL 3QR1A 1MF2H 3OC8A 5SWSB 4JFZH 4J6RH 2EEBA 1QTSA 2BSTB 3L4VA 5AOKA 2R69A 4FI6A 3I2CL 4KKRA 3FUHA 2GEEA 1KPRA 5AVZB 4V1DA 1S7QB 2J1KA 2VN3A 1T7XA 4TKWA 1UA7A 3FT2B 4ALAC 4FRWA 3K8MA 3WN5A 4ENED 4ELMB 4LLUB 1DN0B 1SVBA 5C0AA 1J5HA 1AJ7H 3K3QA 4FLRA 2F6AA 2VUOA 4HSCX 1DVFD 3FJTA 3G7TA 4QY8A 1NCAH 4QMEA 2VDKB 4OJEH 2VNCA 3CFKB 4LP5A 4JY5L 4O2FB 4LB8A 2HVJA 2IQ9H 1BVNT 1EJ8A 2CDGB 1R0AH 4WUUD 5HHPA 4TULH 4BQ9A 1KTJA 3ARPA 5HGBB 4ZQTA 2IXQB 3LZOA 3VG0H 2KLTA 3O3AB 5HGGS 4ENZA 3FO9B 4NNPH 4ZO9A 1F3RB 1UXSB 1MCOL 4HF5L 1Z5LA 2QKIA 4ENEC 1UATA 2AZUA 4NN5C 4UMSA 4DUWA 3TU6A 1D5RA 3HJEA 4OVVA 4NQDA 5IMOB 1T3FA 3WMQA 1UB6A 2X1QA 4K3DH 1DVFC 2CUAA 4ZXBB 3S96B 5DS8B 1E4KC 5C7XH 5JR1H 3BFWA 5J6GA 3D4ZA 1JNNL 5KJ7E 15C8L 3HUJA 3LV3B 5I17B 3DSFL 4AVKA 3RDTD 1EEZB 3G5WA 4HUNB 3LKNB 2MKWA 5GS2H 1PAZA 1OAZH 1UQSA 4JFYB 5CUSL 2C9UA 1NEZB 3MNMA 2R4RL 1IC5L 1AH1A 2EO7A 1NMBL 2WYHA 3QZWB 4ZO7A 4Y19E 1IGTB 4P9HH 4QRQA 1ZT7A 4OF7A 4XCCH 3OC5A 2N7SA 1QFUH 1NCDH 4L8SA 3X1FA 1OQOA 1T1WA 35C8L 2IOOA 3OM3B 2NUTA 1ZGLB 2Y1ZA 2EH7H 1A0QL 1BG9A 2Z1PA 1KLUB 3QUKB 4NJ9H 4AL8C 5LUMA 4AMKH 3BAWA 4KI5E 4HH8A 3GHBH 5GHWL 2H4EA 4EDXA 2X4PA 3RDTC 2XKSA 4RRPG 4Z3FA 3BISA 4I1RA 3HLAA 3SYCA 4PJIB 2OBGA 3BKMH 1K85A 3DTXB 4MVBD 3HAEA 1MAMH 2MTPA 3ARGB 3ARRA 3EDEA 1DJIA 1UG9A 1FORL 1LO2H 2P7TB 4FYTA 4L3EA 3QI9C 3KPNA 5HDBB 1M6OA 1UKTA 2IGFH 4UV4L 4OF6A 2VDQB 5DC0A 1BBDH 4K9JA 1J05A 4UQ3A 3VXPB 2VR9A 2AI0H 4J3UA 5D7SH 3UROR 4J3WA 5EOCL 2GSGB 5HDWA 4CRPA 4GJTB 2IWEA 5KJ4A 4M6NH 3CU1A 5AZUA 1UD6A 2GHZA 5H2BA 2Z92B 4X5PA 3RWFB 4KKBD 4W9IC 4B9JA 2EYTB 1SLXA 2PMZA 4NOFA 4TYUA 5EZOH 1HEZB 3LAFA 4UQCA 4X7SL 5D5ME 4Z9KB 3UOAB 5EO9B 4UT7L 1KENH 4FP8H 3VACA 4WHYH 3C9NA 1HZHH 5EF2A 2XV0A 5CEZH 2BP8B 4N26A 4MA3B 1FG2B 5AAMC 3CCHA 1OP5H 1A9BA 4HWBL 3JVGA 1JTTA 3JZ7A 3CX5K 2AEWA 5EORL 2C1OA 2YPVH 3FT1A 3MA9H 4KQ3H 3VXSE 4JDTH 3SKMA 3ZKMD 5A2LH 1XAKA 4BSWB 3QPKA 2BW4A 3I9GL 4XNYL 2CUHA 3J27A 4P4KD 1D5XB 1KJMA 2L8AA 3O8XD 2OMTA 3DI3B 4N8CH 1DQVA 4L8BA 4Y5VB 1IBFA 2H3NA 5EORH 1P7KA 5JTWA 3SKNA 3CFCL 2WKLA 2V7NA 2P5WB 5DT1L 2JTDA 1KJ2L 3W9EB 1VADA 4MB1A 4JPIA 2F74A 4ZFFB 3B9KA 3L1GA 5DD5H 1JK8A 3QDGB 4DCQB 2LTQC 2WXJA 1J5DA 1BM7A 1YEGL 1NIEA 1U8NB 2VOTA 4R7VA 4XE5B 1CYXA 3RX5A 3S98A 4E41A 4PRNB 1SN0A 1G9HA 1DUYA 3KLQA 4OB5H 5F9OH 5KG9B 1KPUA 3ILPB 4F7CA 3QEGH 4U1SA 4ZQKB 4MAUH 4RAHA 3KYNA 3LQZA 1F18A 1IGIL 3O8XC 2HFTA 2YHGA 1JWMB 2JQZA 3LSOB 1IGJA 4X0NA 2YO3A 4PJIF 4YSOA 5JIQA 5E1QA 2ZOOA 3ZKSD 3ZO0A 1DQKA 1PG7W 2PO6B 4CL7A 1JZ7A 1COBA 5FX3A 4MQXD 3W2DL 3KLDA 1KCVL 3CXFA 3FOLB 4A7GA 1DSFH 2I5YH 2J56A 1SXBA 4W70A 1TTCA 2GJPA 4JGJA 1HE7A 2AVFA 5INDA 4ZOEA 3VW3H 3V4VL 3V52L 4PBXA 4Q2ZA 3ZN6A 3W0WE 2F7IA 1I7RB 2XRAH 3PP4H 4L3CB 3EFDH 5T5FH 1BFVH 5I73C 1KJVA 4UZSA 1QO3A 2RAMA 1TCMA 4NN7B 2WTPA 1OV8A 1V55B 4A38A 1F4AA 1HYRC 3FFCA 4G8GA 4R3SA 3VU1A 1IC7H 4MXWH 4HC1H 4XO8A 4DK5A 3GNML 1I9JL 5F7DB 2ZZUT 4AQZA 1DJYA 3DX9B 4M8QB 5F21B 3D6GA 3NCXA 4LSVH 2IOMA 5JOFA 5K69A 2EXYD 5C6TL 5SWSD 3MRIA 4YDLC 3TT1L 4Q8BA 1A7OL 4QXTA 2A6KA 1J86A 3BAXA 1PY0A 3FFDA 3X3FL 2O6PA 4X99A 3BZEB 3L13A 3DX8A 2B4CL 3KLHD 4KFMA 5I1IH 4ONGH 1MFBL 4Z0BL 4I0CC 2YD7A 1F97A 1NCJA 3FCTB 4NHUB 1TJHL 3QNYB 5EZJA 1OPGH 1YECH 4BZ2H 4JO3L 2VXSH 4M8VA 3FSWA 4DH2A 2DEWX 4L4VE 4PJ7B 3RGVB 2HLEB 2AJZB 2C7UA 2C34A 2GT9B 5T3ZL 1D5MA 3KPRE 5JPNB 3WENA 2J8UE 2ZOLB 4BFNA 5CWSB 2ITCB 4MA8L 2AV7A 4P07A 4WI4A 1FVDA 1YQVH 2D9QB 3MLXL 3A23A 3EYQD 1J1XL 4AGLA 2DI8A 2QPEB 1YJDC 3KLHC 1KB5H 4FQPA 1J8RA 2GK0A 2OPCA 4LLDA 1S7SB 5D71H 2GBVA 4P23A 2AXWA 4WJ5B 3FTSA 4WI6A 1W0VA 1FFOB 1HAWA 1JGVH 2R4SH 2W07B 1RK1A 4NQXA 3UBHA 4JN2A 4Y1AE 5GZOD 3HZVA 3QJHB 4Z23A 2ZNXA 2ZXEB 4OFKA 1FZOA 4N0UE 1BXAA 2P5EB 5JW3H 4FTVA 5T8IA 5IJDC 1SLWA 4GKLA 4MMXB 1M57B 2QV4A 5FV2A 1X5FA 4EI5D 2NY6C 4WKZB 2VXQH 4U1JA 2JI1A 4Z7NE 4K73A 1JI2A 3HW7A 1Y0LB 4RGNE 4ADIA 3RTQA 2YD1A 4TL5A 1L7IH 3K72A 4HYTB 5GJSH 5F7EH 5F0JB 4LKXA 3DURA 1GC1C 2AQNA 3UC0H 3MLRL 2DQMA 1SXNA 1KGXA 3B9DA 4KGLA 1BQHA 2PYEB 3T77A 4ZXBC 4EZMA 3F12A 4CVZA 3VMNA 3WDHA 3EOAB 5C0DB 2XZQH 2I25N 4CN1A 3V0WH 3BRDA 1NPJA 5IOPA 2BS71 1YVLA 1EFXB 1Q0XL 1HKLL 2C1PA 2CIKA 3NQKA 3DBXB 4NB7A 3TBYA 4XPBH 2N01B 5CMAA 3PABB 4OQTH 4KNTA 1FCGA 3T8MA 3WGVB 2HN7A 1SXZA 2V9UA 4GAYB 4YIQA 4M1DL 1OTSD 5GS1B 2NNAB 2O5ZL 3BWZA 5DVLA 3RIFF 3HPJB 2YEZB 4GQRA 3MLPA 2BZDA 2H0FA 2VUYA 3MUGA 1T2JA 3VFSB 1K8DA 2GC4C 1NBVH 5T3XE 3K2KA 3S48A 3H3KA 3QFDA 4PRBB 1PTZA 3VE0B 5ETUB 3RPBA 5DO2D 1NGWA 1N6VA 1FHNA 3LEYL 1G7LA 4GQQA 2Q3XA 2PLTA 4QJ5B 1BVKA 2QV2A 3FAXA 2C5DC 5EBWA 1EAPB 2OJZH 3QO1A 3O6ML 5TE4H 3SDXA 1TU2A 4X83A 4PJBF 5CEYA 3RPKA 1KIRB 3G6DL 4PJHF 4PJ7F 2XX0A 2QLVB 2Y24A 3ARGC 1OTSC 2YAQA 2R2HB 1PY4A 1MW1A 3MRRA 3PDGA 2WXOA 3V0AC 1RZ7L 2AXHA 1PU0A 5LXGL 5HHMB 4R8WH 4L1TA 2IBGA 4L4TB 1C12A 3RZCC 5ICUA 4TQHA 4JFTA 2BP3A 4L37A 3ROOB 3IGLA 1KT2B 3P30L 3BQUA 5DO2C 4PG9A 1MQKL 4PY7B 5CZVL 2XQYA 2G9KA 4I5BA 1HWHB 1E2VA 4MJIE 2AS5M 1T1YB 1LO0H 2JH2A 1MF2L 4ZSOB 1FL5A 2C3VB 3CZLA 4J6RL 4JFZL 1Q4NX 3UTSB 2V2WB 5GSRA 2A4ZA 2D03H 5AOZA 2MPVA 3GBMH 3GXDA 5ANMA 4DEWA 3UAJC 3KBPA 4NUMA 1PLGH 1ZXQA 4D9LH 1EANA 2Y25A 1HTYA 2JWYA 2XHNA 3KW8A 3LJ3A 3QUHA 4LSUH 2DM7A 1FNLA 2DQIH 3GI9H 4OZHE 2OSWA 3TEZA 3QDGD 2DI7A 5B7MA 3SSGA 1S8DA 1QR1A 4HJEA 1X7QA 1JHTA 3AB0B 4XMZA 3WFEH 4CILA 4S0HA 2Y1YA 4B6ZA 1HI6B 1QEXA 3TYFB 4L8CA 1YNLH 4BRVA 4P2CG 5TTRA 3UACA 4UZUA 1UZ8B 2IQ9L 1AOHA 4YLQT 4UTAA 1R0AL 4G7YH 4Z77A 4Y5VC 5F9JA 3EHBC 4P2OC 5D8JL 1ACXA 2YBRB 3VG0L 3GXMA 4D0DA 4PRID 4FA8A 4PP2A 4YX2H 2HTKD 4GI6A 1AMXA 1P4BH 2PO6D 3IKCA 4S1QH 2XWRA 1HH6B 2WZ0A 1SY6A 4JJ5B 3VD5A 5FKPB 1LE5A 3WTYA 1H8LA 4ZMNA 4FN0A 3Q1EA 1KXVC 2BSRA 3Q6GH 5C7XL 5LLIC 4E5XG 4CMMB 2GJ6A 3TCLA 4WTQA 1IQDA 3NFPB 1LWHA 1CI3M 3ELAT 3P4OA 2DDQH 4O02A 4ODVH 4WIQA 1AQKL 4X4KA 1OAZL 3UH8A 3ZE1B 3RQ3A 4PTUB 2UX6A 2OR9H 3BPNB 3PYCA 3B5TA 3FO2A 3M86A 2W0FB 2WO4A 4L9LA 1XZ0A 3FQ1A 1XR8B 2D73A 5JZ7C 2PO6C 2XSKA 1TYJA 2QR0A 5I9QB 5IVZB 2DY2A 4XAKE 4XCCL 1G7PB 1NCDL 2H6PB 3TCTA 1KPVA 2D4FA 2IOIA 1QRNE 3RL2A 2C9AA 4E9VA 5C86A 2QSCH 4E36A 3T0EA 4JPVH 4HIIA 4P5MA 2IPUK 2EH7L 4TQEH 1UURA 4OGZA 4NJ9L 4C83A 1JG9A 3T0VA 4AMKL 1S5IH 2E9JA 3GHBL 4OZFB 3RTLA 2Z0UA 4M4PA 4HUXA 4BDVB 4LDEB 3RKPA 3K4AA 4FFTA 4NN7C 4JQVA 1OKEA 3BKML 2D3VA 4PGZA 2AQ1A 1MAML 2Z91A 2ORBH 3FCSB 2QPDB 4K9EL 2IANB 1LO2L 1K5NA 1SDAB 3UXFA 5SX4I 1J5IA 2IGFL 2J6EA 3N40P 5IT2H 1HHIA 1LP9E 1F8TL 2PXYA 4A37A 3AS2A 4HZLB 3VGEA 1N70A 5E7BA 3UZQA 1NC2B 3D25A 3ABLB 4IMLB 4N0CC 5E6IB 3RGVD 3N1GC 1ZHLA 2VDPL 1OB1B 1C9SA 3MLYH 4G9FE 5CJXC 4KJPC 3EJSA 3VQMA 4MD5A 1TR7A 1J0KA 5I1EH 4P59H 2MFNA 3EH3B 2RQ8A 2AJXH 3TBTB 1CFQA 4UDUB 5A6LA 3O3UN 4YDVA 3H9ZA 3IETB 1KV3A 1RPUA 3VRLE 5HGAB 3SD2A 2FQGA 3ZW3A 3GIVB 5EZOL 2AQ2A 2J44A 2BNQD 2EUWA 1KENL 4FP8L 5JZ7D 3BKCL 4MNHA 1BQ5A 3H7LA 1HZHL 4LGRB 2X9YA 3UFIA 4V1DE 4DZBA 3HR6A 5DRZB 1KZQA 2ZF9A 3S3SA 5JQIB 4CW1B 4MJ5B 4NFBA 4D94A 3VNYA 3RGVC 2EVGA 2EYRA 3MR9B 3FS9A 4KQ3L 5EEWA 5C0AE 2EYSB 2NY7H 3GI8H 3IFPA 3V95A 3WJMB 1EMTL 5DFTA 4X5WB 5JPNC 3U46B 1B4RA 3C5SA 3VTAA 1XGRB 3EADA 4ZTPH 4FNLH 4J8QA 4ZMLA 3CE1A 2PP8A 3FQTA 4PBVC 4F80A 4N8CL 1OGTB 4JZNA 3G5VA 4YJZL 1E9QA 3V4LA 2GTQA 3MRLA 3S3CB 1G9NH 3GO1H 4X6CF 2PYED 3WE6A 2BNRE 2CU9A 1VCBC 3NZHH 4BFKA 4PGJA 1IGMH 3Q8AA 4ZD3H 3FB8A 1TETH 4DUXA 1DQTA 1U93B 1V5JA 3HS9A 3SKJH 2VUKA 3MUHL 3TNMB 4WV1B 5DEFA 2Q8AL 2XYBA 1EFXD 4FA7B 5DD5L 2ENJA 1HNFA 1QLRB 1DVTA 3AU1A 4AYMC 1OOWA 3HPLA 4MMXC 4NQDE 4PJFF 3CZFA 1KCSL 1IGYA 2VDRH 3WHE1 5A43C 3Q2LA 3FSZA 4OB5L 5F9OL 3ZRFC 4PPTA 2WLHA 4PRPD 4AV5A 3QEGL 3HUJE 3S35H 4MNQA 3E7JA 4CNIB 1KB9K 1LE9B 5FAAA 4HWUA 2QQNH 4JG1H 5CLTA 1XGQA 3QIBD 3IAGC 2CIIB 4MS8D 4MD4A 1XCTB 2D7QA 3SHSA 2BP0A 1P69B 4S10A 5CD3A 3BPOB 1SRDA 4FERA 1NDTA 1BVOA 1K4DA 5J1AB 3TTSA 4YGAB 3FQWA 4NO5A 2I5YL 1K2DA 2VKWA 1DFXA 3MBEC 2Z8WC 5IJBC 3OKOB 1AGDB 2WMPB 2E3VA 5ACMA 4JRYA 5ICZA 5D5MB 3VXTA 2B08A 5GS1C 3JV6B 2DBLH 2XRAL 3PP4L 1U91B 3G08B 4JO2H 4M3JA 5DMIL 1S9VA 3EFDL 1BFVL 5SX4H 5T5FL 3BP5A 2H32H 4U1NA 2HJFA 5DJAA 1A4CA 3GHEH 3ZKNC 5IMKB 2CO4A 4CBPA 1CFSB 1YEFH 4DEPB 3EUDA 4MS8C 2CJSA 2AJUL 3OLEA 3VXSB 3QFJB 3EBAA 3RI5F 3B9EA 3LKPA 4MXWL 5IK3A 3TESA 4HC1L 4HXAH 1L0PA 5KBDA 1F4YH 1HOCB 5I75C 2XXFA 4NRYB 4L3EE 1LMIA 2WXKA 3WN6A 5FK9A 4BK4A 4MJJA 1DFBL 3DIFB 1Z0NA 1UACH 3E6FB 3DSNA 3ILEA 3MRKA 3FN3A 5KYXA 2VSKB 2XV2A 4QHMA 1K72A 2AJYL 3IU4L 3OZKA 3ARFB 3WO4B 3R06B 5FO8A 5C0BA 2NRDA 3WEAA 4ZMWA 4D0BA 4C55A 3PGCB 3W81A 2BFGA 4HULB 3T8XA 5I1IL 4ONGL 1IM9A 3T04D 4S1RH 1NAKH 3MUJA 5IFJA 4P3DA 2HLAB 1XGTA 4NCC2 4BFEA 1JZ8A 1IZJA 1BVLB 4AI7A 3QZWG 4NO3B 1OPGL 1KIQA 4LP8A 3VG9C 4C4UA 1AGBA 1S9WA 1YECL 5DJ6A 3QQDA 4BZ2L 1H3XA 2WGNB 1CFBA 2EIKB 2DJMA 5DFVC 5GQBA 1ED3A 4N1CA 1RZJH 2E27H 4CC0A 2P28B 2BOBB 4AH2A 5GGTA 3MJ9H 1AQDA 3ZDYE 3L3KA 4JFSA 1L4IA 4ELKB 4TLTA 1OARH 4R4ND 2WGXA 5DHYA 3ETBJ 3R19A 1WG3A 3L81A 1YQVL 4RZKA 2ZT9C 1LQBC 2HVKA 4GRWE 2NT1A 1QAWA 4AE0A 1X4XA 3RI5K 5DZPA 4M6OL 3AB0C 1A1OA 3SGEI 1TTUA 3W0WB 1JGVL 1IIIA 2DKSA 2R4SL 1Q9KA 2DRUA 1CDYA 1FP5A 1NA8A 2WINB 1JF1B 2HJLA 2IADA 2X53A 2GTZA 4KTDL 5HD8D 3VXOA 4XCFH 1A3RH 4XVOA 1JMZA 2GSMB 4AJYV 2VABA 2JB5L 4F33B 2XVBA 3P73A 1LEGB 2HUEA 3BUYB 5JW3L 3DRTB 3PUCA 4DWHA 4RMTA 3QNFA 4HEPA 1JP5A 2P45B 1B2WH 1QTYT 4UQAA 4F2EA 2VXQL 1T04A 3MKKA 4R4NC 3QG6A 1VENA 3ZTNH 2B15A 5DJXA 2VC2H 1FVEB 2ZOKA 2EDTA 1I7TB 4HIEB 1R5IB 2DWYA 3FO0H 4TOYL 5F7EL 5DLLA 3EBGA 1XH3B 1S3KH 3AFLA 1DBKH 4DP5X 2XA3A 3CHSA 4MMYA 1KN4H 1UOLA 1P1ZA 2XZQL 3V0WL 4QRUA 3CBJB 2VT0A 2NLJA 4AT6B 5E23A 1SOKA 3QHZH 2XKNA 3NRPA 2GCYB 3SE4C 4XPBL 5J57B 1UB5B 3PL6B 4OQTL 1SHSA 3BPNC 5ENWA 2BS9A 1BECA 3PNWB 2DQ6A 3WFHB 3FO1A 3INOA 2ZSVA 4OFYA 2XJLA 1ZTXH 1S5HB 2NY4C 5C0ND 1QHQA 2XT1B 5IWLC 3O6KL 2J21A 3NJNA 3QULA 5I9QC 3H0TB 4PLKC 1NBVL 2ICWA 1U8QB 4MJHA 5F6IC 1CTMA 4L4VB 1NC2D 5E6ID 1CYWA 2DQUL 2E56A 3ULUE 3ABZA 3S36L 4G8GE 2I07B 3D48R 3D0LB 2J8UB 2B8OT 3H7BA 4KTEH 3REWB 4ZTOL 8FABA 1HVXA 1B6UA 1QR4A 2BO0A 4QOKE 1H3WM 1TZIB 2AERT 2OJZL 1Q94A 2Z35B 5TE4L 2O5YH 2ITDA 2ID5A 1EHLH 5AW1B 2KPWA 4R0LA 5E4EB 2B4CC 1P9MA 5JHBA 5LAXB 5HY9B 4HKBB 4R8WL 5JHDA 4XMXA 4Y1AB 3HMXA 2WN3A 4KJQC 2O61B 2BWQA 2VLRA 4GSRA 4N0UB 5E6IC 2XBZA 1IX2A 5KW9H 3WOVA 4ANUA 4DQOH 3B3BA 2BVEA 3FF8A 1J0YA 3GSVB 5FHAH 2H5UA 3WKQA 2YGNA 2XTLA 2HSIA 4XVJH 3FW6A 5F88B 1ES0B 4U2ZA 3AITA 4Y19D 5AAWA 2OCCB 2BWIA 5KVMC 3ZQXA 1I7UA 4GKSA 2A0LC 5D2LA 3PDDA 3QISA 3IDMB 2O1AA 1FZMA 1PX3A 4JMNA 2KH2B 1AO7E 2WTOA 2XPYA 4QHNB 2HT4D 5L4MA 3SGEH 2K45A 5DEZA 2VXVL 4HLZH 2AEPH 1P5UA 4M02A 4DVBA 3AAZA 5B3SB 1PLGL 4D9LL 1G6RH 4KI5D 1G1YA 2YMTA 3SE3C 5DHEA 3B6SA 4UM8B 1DJXA 4ZW8A 5KJRH 2DQIL 3GI9L 4KUZH 4FTDA 1CBJA 2A77H 2F19H 3DUSB 4FNTA 3IDNA 3C75A 3WFEL 4YXHL 1U95A 4PJCF 2F1EA 4AXWB 2VLJE 3CC1A 1ZHKB 1QLFB 2ARJB 1WH0A 3LS4H 3VWJD 3SDCA 3UCQA 3CBRA 1QRKA 3VB9A 1PIFA 3WY2A 1UT2A 2XACC 4NNYB 5F3BA 2FGZA 3VQ2C 4DGYL 4U1LA 4FTVE 3D50A 1RZIB 2IDUA 2O26U 2HT4C 5CSZA 4ZUUB 3CDGA 4XB8A 1EV2E 4YX2L 1DVYA 4FCAA 1P4BL 4P04A 1OCOB 3QQ9C 4WV1C 1D2OA 3DTDA 2K4AA 1ZS8A 4HU2A 5E6RB 3V4UL 2HG5B 3AWGA 4M7JH 1ASQA 5KYWB 4JFDA 2DM4A 4E0RA 4LCYB 5I1DB 3Q6GL 3JWOC 5CNHA 2Y72A 3UJIH 3SDAA 1D5ZB 3IPBA 4LSTL 2J8UF 5EZLA 3HN5A 4TLUA 2WTRA 3L6FA 4UDTA 4ODVL 1QEWB 1FZKB 3SDYH 3OB0K 1F3JB 5DO8A 2OR9L 3SBRA 5I1LB 3V4PA 1K6QH 3E2HB 3VXSD 3B7SA 1I1FB 1QZ1A 1UGNA 1FNHA 3F7LA 3QIUB 5I18L 3BPOC 3P54A 1QSEE 5J8OA 4MJIB 2WLYA 1CG9A 2FUQA 3D05A 3NCBB 5E9DA 1FGNH 3OJ2C 4X8XA 3UJTH 1S7RA 4C56A 4EZLA 2CH8A 5D7IA 3EO9H 3V0VB 3CMOH 3EH1A 1BW8A 3CDZA 3HA0A 3ZIMA 3M1CA 5DWPA 4Q9CA 1J8HE 1IAKA 5C0IB 4X6FB 5TFSH 1S5IL 1SGKA 3Q2NA 3HC0A 1A14H 3QJOA 3ARFD 3BEWA 5T1KA 2QADB 4GH7B 4N25A 4NRZB 1MCSA 1MHHB 1LILA 1MJUH 2XQ0A 2E47A 3UYOD 3AWFA 3QDMB 3TCXA 4WNQB 1ZVNA 1EO8H 1A65A 4WW2F 3SDXE 3VM7A 3UEZA 3MYZA 4OZHB 2ORBL 4DEPC 2OL3A 3BP4B 3FU3A 5K9JL 1HL8A 1VGEL 1A1NA 4MJ4A 2X4UA 4RAUB 6PAZA 3ZGHA 3FTWA 4FFVC 1MCQA 3CNKA 5DK2B 1A8ZA 3QYMA 4KV5F 1T0MA 1J18A 3R4DA 1GZPA 4Y8DC 5SWZA 2YD0A 2KHAA 3D12B 1T20B 3IWVA 4Q6IA 5DSCA 1EH9A 3MLYL 5DJ0B 4WY7H 3DO7B 1NGYA 5I1EL 5F7FA 3WO4C 4P59L 4ZMOA 1PS3A 3C6SA 3IU3B 1LK3H 3KJ6H 4OCRH 4Q9BA 4RA3A 1WZAA 1TJIH 1A6UH 3APNA 2C4FT 5DRNB 3QYCA 4G1MA 1BIHA 5DWUH 4JB9H 2G3XA 1KB5B 1ZJBA 2C9QA 4WLCA 3SPJA 4ZFOL 3M8OH 3W0WD 2IDTA 4N22A 1NGQH 2VSDA 5ANME 2UXTA 4HKJB 2ESVB 3GGWB 3TIDA 3V5HA 4DGUA 4U1HA 4AVJA 3CVHA 5ICXA 3RP1A 3U48A 2FR4B 3OQRA 2EE9A 2BWDA 2NY7L 4XVSH 1OP5K 1FO0A 5HPMA 1SHXA 1UWYA 4CVUA 4G8IB 3STLA 1RK0B 1P6WA 5GGUA 4A7TA 1UD5A 4XNUH 3VGGA 4ZTPL 5L4FA 4RNRB 4AYFA 4C4KO 2D4DA 3NABH 3V6FB 1DQQA 5LDUA 1AGCA 1YCSA 1QRNB 5HVHB 1YYMH 1U3NA 5HYQB 1G9NL 1HILA 1HSBB 5JR1L 2ZAHA 1ZE3H 1NCTA 3QJVB 1TETL 1ZA6B 3L3GB 4Y5YA 2G60H 3GZKA 1EEUA 3RURA 4LQ1A 2ODHA 4H8WH 5HGHB 3KPMB 3QC6X 1ZPUA 3K80A 3FULA 1YEDB 3VNZA 2J57A 4LCIH 2X4OA 1F00I 1E6JH 1FL3A 3L1OH 4K71B 5DURB 5EC1A 5ADOH 3ULVE 3IXAA 1A6WH 4D0CB 3Q6FB 3IMSA 2GJ6E 4LVEA 1LP9B 3S35L 4EI6B 2YUZA 4JM2B 4W9EC 4HPYL 2IF7A 3ZXAC 1UM5L 2WLNA 2JI2A 4JG1L 2P80A 4P9HC 4L4VD 4GSDH 1CD1A 1AR1D 1G9MC 1MG3C 4LOFA 2WVTA 3RB7A 2CUMA 1PQZA 1U8LB 2CRZA 3KPRD 2FT7A 1WQVT 3ECQA 4XN7A 3ZDWA 4PJXE 2W0KA 1BQKA 1AS8A 3X17A 2EZ0D 2WQAA 2W5PA 3QJTB 4WWKB 2R1YA 32C2A 3GZOA 3VYOA 2WXLA 2B16A 3GIZH 1TEYA 1KGCE 3OD3A 3PL6C 5KYUA 3V9EA 4KJWD 4WRLA 1P5VA 1ZA3B 4LCWA 1SLVA 5DEGA 4TVSa 4BQ6A 1G7IB 1VERA 3FFOA 5HHQA 3ZDZE 4X6DB 4DKFH 4V1DB 5BV7H 3O9WA 2A73B 4UV7H 3GHEL 1FN4A 1FPTH 1HL5A 2N56A 4Y1AD 2VM4A 4G2AA 4N20A 2VMFA 1CDCA 1B0GB 5GS0H 1YEFL 1T5XA 4PWHA 1KBGH 1TZGH 3II3A 2BDNH 4NO0A 2NXYD 4B9FA 1F4YL 1H6EA 2V3DA 3ERXA 4WI5A 3BAIA 3DYMA 4QY8B 2FBJL 3ATBA 4HKXB 2Y07H 1ZHBB 1S7VB 3TFBA 4RGND 4DKTA 5HDQH 1UACL 3QUYC 4NZFA 3H4FA 5FYLE 3WIHA 2HVJB 1HJCA 4TQ8A 4KZEH 5E4EC 2CBPA 2BNRB 3G5YA 2FX8H 4JPKH 4QYAA 4RFNB 4PS4L 1G94A 2XTSA 5IQOA 1WYJA 3MXVH 4KVNH 3F7VB 5B4MD 1F3DJ 3MYJB 4G8FB 4Z0XA 3DV4A 2G5BA 5DHDA 2VXUH 1DJZA 2A2QT 2KZ1B 3PWUB 3L5IA 5AYQA 4P46B 1L7TH 2QKIB 1NAKL 3PRZA 3T3ME 3DMMA 5DQJA 2Q1EA 4JAMB 1SF5A 1PZBA 4NQDB 3LTVA 1UCBH 1T3FB 1J7VR 1I8IB 2COVD 3AQYA 2F54E 1F2XK 4PY8J 5ECGA 4H8QA 3HUJB 2E27L 4HWEL 5T3XD 4ZMXA 6FABH 1MCCA 2A9DA 2M83A 2X4QA 4DN3H 4QF1A 4POZC 4XOAA 3IDGA 1V05A 1OARL 4XP4H 1M2VB 4FNRA 4YEEA 4OZFG 4FZ8L 4DO6A 5KS9A 3KAAA 4K8RD 5B4MC 4FE9A 3MNWA 1T1XA 5EOTA 1KTLB 3RG1C 1ZLSH 4JM2F 2OMYA 1KUMA 1R3IH 3ASWA 1HHHA 1AD0B 4JO4L 4PS3A 4RQQA 1UA6H 1T1WB 4U3XA 2FJFA 2GITB 2NUTB 1DJHA 3EGSB 3QUXB 4MXQD 3WKMH 4B5EA 4MB4A 1SJMA 2RFXB 3SDDD 3RJDA 4F7TA 1OTTD 3MGOB 3MODH 1A3RL 3VFUA 4ABWA 4HHAB 4TN9A 3UTZB 2X4PB 3FCBA 2ARJQ 5E2VH 4JG5A 2F1BA 1AYRA 3Q8FA 4P5TA 5L8KB 1MWAL 2NNRA 4DESA 2W0PA 3ZTNL 1HESA 3ZL4L 1RI8A 1OB0A 4ZUTB 2VC2L 3QIUD 2L7JA 4X6DF 4I7ZC 1WZ1H 3IPFA 4HJGA 1R5WA 3KPNB 1XWVA 4HIJB 4MJID 1CBVH 1PF3A 3PJSB 4MNQE 1JZ5A 1EFQA 1S3KL 1UYWH 1LWRA 2JCCF 3Q13A 3OX8B 1J05B 3VSVA 1KN4L 2HVBA 4FG0A 2MIZA 1P4LA 5H94A 1CICD 3P77A 3S37H 3UO1H 4PV8A 3VXNA 1TO4A 3ESMA 3HN3A 4R7DA 1OTTC 2QADD 3SE9H 5JA8B 3GSRB 3K8LA 2WLLB 5K39A 3WS3A 2WSKA 3QHZL 3WTXA 5AVSB 1XT5A 2ZG2A 2IDCA 2DWDA 2Y2WA 4P48A 3E2HC 3I6SA 1ZTXL 3UDWA 5HJGA 2ARWA 3GZQA 3D69A 3QIUC 1AIZA 3RRQA 1EBAA 1T0NA 5AB0A 3CCHB 1ZK5A 5FGCB 2OSYA 3OV6A 3M7OA 4KTGA 3O4LE 1GCYA 1S7XA 3II2A 1SDDA 3VO0A 3C5JA 3ZDYB 4XWGL 2TRYA 3ZTCC 2G30A 2K3TA 2R8SL 3VFMA 1WISA 4PI2A 3WY1A 5F1OB 4CC4A 2IJ0C 5LG6A 2XPGA 4DGWC 5BQDA 4GRWB 5CZXD 3LZLA 4NM8H 5IB2B 4L8BB 2AVGA 2E4FA 4XVTH 2HMID 2H3NB 1P7KB 3MLZH 1C16B 3EYFA 1MFCL 3BXNA 5CCKH 3CFEA 1J12A 1X4YA 5F6HJ 2J2ZA 5C0BE 2YAOA 3I50H 1JCKA 5C0CA 2V7NB 5CR8A 3VSQA 5IBLD 5CFAA 3SN6N 3O45A 4FQ2H 5KW9L 3T4AC 3AVEA 1QD0A 4DQOL 1CGSH 5FHAL 2NW2A 1JK8B 2GBAA 1XXDC 3FQNA 3K6OA 3OKEA 4JE0A 1W16A 1R3KA 5L8LB 3RLSA 4ZS6D 4KMTH 1TQUA 4O58H 4ZYKA 5E8OA 1PD6A 4JHAH 2FX7H 3TV8A 1LD9B 3ARTA 4XAKD 5CD5D 3S3PA 5DRWA 4NEHB 2Q5BA 2F2HA 2IDFA 5KVDE 1WWBX 3ILQD 4XN5A 4ISVB 4FXGA 3TBSA 4N6RB 1IGJB 4JFFA 4X5LA 4ODUB 2W0LA 3SCMB 4LCUA 4ZAKC 2NY0D 4LNRB 2D3JA 2Q0ZX 2Z3FA 3CU7A 4KMLB 5LVEA 5KJRL 4NP4H 3IB4A 4KUZL 3U4AA 4CU7A 2XWXA 1PKOA 3D30A 5C0EB 5DURD 4GS7B 4F1ZA 5BOJA 3QO0A 1KCBA 1E2ZA 2CO2A 4B9YA 3RFZA 5FOBA 3UZVB 3IEAA 3HE6B 2LLGA 5SX5K 5BJTA 2VDRB 3LS4L 4P2QB 4PW4A 3LB6C 1KJVB 2OULB 4Z7QF 3VCLB 5HVHC 1U8IA 2BY0A 2EUXA 4UT9H 4Q52A 3ZDXF 1T89C 4Y16A 4HKZB 1RLBA 4G8GB 4G9FD 1VFAB 2C3HA 2GVYA 1I82A 3AMLA 1OTUD 3L5JA 1O7DC 4QOKB 4WWKD 4DK6A 5LGJB 1UKQA 1KYOJ 2GY5A 1RL1A 4TUUA 2KMWA 4FAAB 1TQWA 1ZT4A 4M7JL 6PCYA 1MCLA 3RUGF 1SBSH 4K71C 1V3KA 4U4BA 3RHWF 1BYNA 1NFDE 3B7RL 3MRIB 3LNEA 3UJIL 5C70A 2AK4E 5FGBC 4BKLA 1NDGB 4QXTB 3JV0A 4OJYA 1WVZA 4GXUN 4V1DD 4M7LH 1AZUA 4JM2C 1EVTC 4LFHG 1IFHH 3SDYL 1D5BA 4PVLA 1XB8A 4X99B 1BZ7A 1IE4A 4AC2A 1TPXB 4MAYB 1JVOA 4XNMA 2YD5A 1K6QL 4UT6L 3I84A 4IKKA 4JNXA 2ZUXA 5C0AD 4CA4A 4FFWD 2XWBB 3L17A 1OTUC 1QSVA 3UAEA 1ET5A 4WWKC 1JD9A 2TSBA 5EZJB 3WY3A 1FGNL 1YPZB 1CGWA 4JHVA 4CN4A 1THCA 2WBJC 4PVMA 3EO9L 5E7FA 3CMOL 4J3TA 3NJHA 1Y7VA 4R2GD 5BXFB 3IK2A 3NJVA 2OXGA 5D1ZI 1AO7B 4HZ1A 5TFSL 4LLYA 2VR3A 4OM0H 2BNRD 4L0YA 4QRTA 2QFPA 5AOIA 1KBBA 1L9QA 1Z9LA 3VUAA 1MJUL 4FI8A 2LLNA 2OMWB 5IW1B 1Y18B 4NBYB 5BZDB 5FO7B 5DD3L 3KJ4B 3C5ZB 1CLOH 1YNKH 4NQDD 4LLDB 3NK4A 2X2UA 3MFFA 5GJTH 4NKDB 5CN3A 3QNZB 2VLJB 3DVGA 2DYPB 1X5JA 1N2RB 3DECA 1RK1B 3I3DA 2EECA 5JHDE 4BM7A 4JN2B 4W93A 2JKTM 5T1MA 4NRXA 1FZOB 3LKQB 5KN5B 3D33A 4Y5XB 4RRPA 2X28A 1H8OA 3B7UX 3O0RH 4RFNC 1SN5A 5E00A 4KZCA 5HYEA 4K3EH 3WMPA 3KJ6L 4H20H 2MTAA 4OCRL 5IKCA 4AM0B 3QEUA 4MCZB 2OTUB 4CVWA 3Q9PA 3P9MB 4P46C 1MFEH 3K72B 3FUJA 5FM5O 2F58H 4J8RB 5D2LE 2WYIA 3DURB 4W9CC 2VL4A 3MV01 3M8OL 2EVJA 1BQHB 1IJ9A 5FUOH 3F12B 3HI5H 2X70A 1NC4A 3KPPA 5LBSL 1RIHH 3ZT7A 4JX0A 4D8PA 5HHOB 4XVSL 5CMAB 2Y69B 3WIFB 5KSAB 3IBEA 1LDPL 4ZMPA 2PETA 3U2SA 3QUZB 3FN9A 3V79C 5D1QB 1N0XL 1EDHA 3LXUX 1A66A 3W39B 3ZMRA 1QSEB 4RAVA 1GPOH 3MUGB 4L3ED 5GISH 1K8DB 3PWJA 1YYML 4GNKB 1CR9H 1RJZA 3P3YA 4GG8A 1Q0YH 4N2LA 3GUTB 4NQEA 4XPHH 3QUXC 1EGJH 1J8HB 2CKBH 5EMYA 3QA3B 2G60L 3IDXH 1G7LB 3HZYB 1SNRA 3OJVC 4NXSA 1E8ZA 5I15L 1YPZF 2YKLH 5EBWB 1TZOA 3L1OL 1TMQA 3UGEA 3SDXB 4XMTA 1TU2B 2WIMA 3C08H 4YE4H 5ADOL 1PYWA 2IH1B 2DM2A 3ML8A 4JFDE 2VE6A 2N0KA 3L5XH 1A6WL 4TVPH 4PVNA 1NL0H 1B2YA 3LDBB 1CLZL 3GINA 3IGAB 1HZLA 4ZMAT 3VD2A 1J8KA 4ODXA 4GSDL 4PB0H 4XMPH 1N10A 3O6FA 1P84J 2OMXA 4OZGF 2YA0A 4PG9B 3NAAH 3RKDC 4YSAA 5T33L 1JNHB 2ZOTA 4HUKB 1RIVL 3RWCA 4G5ZH 4I5BB 7TAAA 3B2VH 2ERJB 2ZCZA 1GS7A 2YGOA 5F72S 1LYQA 5E9DE 3FSOA 3RA7L 4BUHA 1OSZA 4F2MA 5DMKA 5L2KE 4UINH 1E9PA 1XIWB 2EH8H 2QQQA 4K55A 4OLEA 4S11A 3VXRB 4F7PB 4ICXA 3CFDA 2RH0A 4JHZA 5GSRB 4DKFL 3NEXA 3S36X 1SQ2N 4X0KA 1FPTL 1M2OA 2OSLB 5MERB 1UJ3B 5HHVH 3ASNB 1OAJA 5I26A 2P8PA 2WVSA 5GS0L 5JXEC 3MRHA 3TP4A 1KBGL 2PCFB 4HK3N 5D6CB 4M61B 4I77H 3PV7A 4TNGA 1VFOA 3B9KD 4X7TB 4A6YH 3ARBA 1F1GA 1S8DB 1MKFA 1E65A 1X7QB 4GT0A 2IG2H 1RZ8A 4E41D 4L8CB 1MNUL 3ARWA 4I3SH 4XBPA 4ZPTA 2E7HA 3QQ3B 2F53E 5DUMH 1MCFA 3HCVA 4R96A 3E8UH 5HDQL 5KVFE 4XHQA 4YR6B 3UPCA 5TK2A 4KZEL 4JFOB 2C3WA 1U8JB 3W37A 2OZ4L 4JPKL 5I66A 4QRRA 3MXVL 5K93A 3BAJA 2NZ1A 4FL4B 3LIZA 2VKXA 2VXUL 4FQQB 1L7TL 4YDKH 1G6RB 2AMGA 5IF0B 1S7WB 5FF6B 1LE5B 2W81C 4Q58C 2A38A 4HS6A 1T7YA 4HAKA 2K3HA 4OCXL 2E6PA 1P2CB 2GJ6B 4WSGA 4ONHA 4A2EA 1IQDB 1OAXL 3A4FA 2F61A 2I9LA 3B2PA 3V7AE 2H1LM 4NZTH 4DN3L 3OKMA 2X0VA 1SFHA 3ULUD 3SCMC 1A7QH 3QQ4B 2AC0A 3FBQA 1X9UA 3FFCD 1EHNA 3ATEA 4G8GD 4WU7A 4PJXB 4L9LB 5IJKA 3STZA 1G9NC 2R69H 1ZLSL 2CJ3A 3H55A 4QOKD 2A3TA 2IAMB 2QR0B 4W9JC 4AUYA 2V5SA 2I24N 3U0TB 1UA6L 3FT3A 2ZUVA 5F0PB 2XWJA 4HIIB 2FO4B 2ZWSA 4GS7C 1I8KA 4P5MB 1WBZB 2F08A 4RDQF 5DJZA 4D9RE 4OIIL 2HT2D 3WEBA 3VDBA 4GSQA 3ZDZB 4C83B 3HE6C 3MODL 1HYSD 2VDNH 3V6OA 4L18A 4MQTB 5D2NE 5DK3A 2NY1B 3BUTA 4HUXB 5E2VL 4GMSL 2ADFH 1M05B 4XBEH 3ESNA 4OIBA 4K3JH 4AV0A 3P3UA 1CT8A 1P4IH 4I3GA 5A7EA 3DV6A 3IJSA 2BSEA 1SXCA 1WBYB 1K5NB 1WZ1L 5E0QA 1XH1A 4GEJA 4HUCA 1QVOB 5JW4M 2VISB 1CBVL 4I48B 1MNNA 5GGSA 3MACH 1UYWL 2R2BA 2FHFA 4HQQH 3UZQB 3D25B 1TEFA 2WNWA 4ZMVA 4WHTA 4HS3A 4GUOA 3S37L 3HLKA 4PJGF 5JXAH 4LVOB 2FGWH 1W72A 2VZVA 1XSJA 3BPCB 3DJZA 3EXJA 4ZUSB 2ADGB 5CGMA 4L2LA 1MIMH 3GB7A 1ACYL 2NTSP 3ABKB 5D55A 1DBBH 4X4YB 4LEOB 4LLQA 1TPXC 3BZ4A 4MAYC 3W5NA 1UM6L 4M1GL 3K6SB 1OM3H 2ZTBA 4LSSL 1UFUA 3K6IA 1CE6B 2VLKA 4JUSA 3EZJB 3Q5OA 3MCLL 2Q76B 1OAQH 2F54B 2DYPD 2VLJD 1ASOA 1UH3A 3P11H 3N44F 4P8QA 4DZBB 2R0WL 4W68A 4NQSB 2AITA 4C47A 3RE0A 1NMAH 2C9RA 2EYRB 2ALAA 4FTVD 1TXKA 2X2YA 3IFPB 2DQFB 2ZP9A 2UY7A 3NIFE 2NX5A 2GG1A 2H3KA 5EEVA 5T1LA 5DEJA 4GAGL 1HHJA 4GG6B 1D3CA 1JXKA 1YN6A 2EUVA 2AABL 4HALA 4MX7A 3RTQD 2V3EA 3KJ4C 4A04A 3FB7B 4S0SD 3C5ZC 4JZNB 3PJLA 4P57B 3A6OA 5D7LE 1DQML 4LLVA 3S3JA 5CJ8A 3HAEH 4UOW0 4HOZA 4HA1A 5I1HL 4MZ2A 4ZFZA 2NNFA 5DEFB 1HX0A 1CGSL 2FQFA 3F3HA 3AC0A 3ILDA 3OHMB 4P2RA 1RZJC 4Y5XC 1VCAA 2YZ8A 2X41A 3AU1B 3GRWA 3NFNA 3V9FA 3VFNA 2OCJA 1ONQA 3CZFB 3PAYA 3LQMA 4KMTL 3T4YB 1TSRA 4O58L 5KVGH 1BOGA 5F3FA 4JHAL 2FX7L 1DVFA 2LHAA 2DH2A 2YLHA 1E4KA 1T80A 1VESA 4OIFA 1KSRA 1UOVA 5ABZA 4MNQB 1M1XA 4AM0Q 1BWWA 1H3GA 2AW2A 3P0YH 4NZJA 5DJ2A 2EEAA 1J8HD 1U92A 4MD4B 5AZ2H 5I6XB 3A0OA 4WEMB 4WUUA 4ZNEE 3RWEB 4BH8A 5KS9E 1WV7T 1NIAA 3MNZA 4NP4L 3D2TA 3UTOA 2A9NL 3FQWB 4GFXA 2F0CA 4NO5B 1TTBA 2IO5A 5DQ9A 5HJBA 3RU8H 1C1EH 1BQRA 5GGVL 5KSAC 3VXTB 3QUZC 5D1QC 1OAUH 5FO9B 5KUMA 1KGUA 4EBQH 1ITBB 1MCJA 5L4JA 1XZWA 4Z6AT 1UA3A 4XGZB 1REIA 4F8PA 4UT9L 3RDTA 1ECZA 2Q7YB 1QFPA 3O4LB 3V0JA 4R26H 1PSKH 3BQUD 4XNQA 4H8PA 1BXUA 1G5AA 2WZAA 5CS7A 3WLWC 1INDH 4M8RA 4P49A 2CDEB 3BP7B 4JO1H 1NAMA 2NY3D 1VIWA 3OZ9H 3QI9A 3S35X 3LXCA 4GOSA 2A83A 3MBWB 1ZV9A 1FFQA 5B38G 4GXUM 3BKYH 3LDBC 3KVQA 4M7LL 2BVPB 4NKOA 4L1LA 2DIEA 4QTIH 5BV7B 2JNZA 3KXFA 4G8EB 3MLUH 4OVUA 3L48A 4P9MH 4GG6F 1KJ3L 1NBYA 4HOWA 1QFWI 3QZLA 3FH5A 4BQCA 5BNXD 4P3DB 3C8KA 3HTLX 3PWVA 2AJVH 1LEKB 4IKJA 3B1UA 1FH5H 3WTWA 2QDVA 2UZIL 4IS6B 1KIQB 1J48A 5D9SA 2ERJC 1S9WB 2RA1A 1FL6A 1L9OA 2NTFB 1HWWA 1V27A 2CO6A 4E5XA 1B9KA 1ED3B 1BFTA 3JUZA 3AZUA 3MRCA 1WTLA 5AAMA 1XIWC 1CDHA 4OGYH 1Z0MA 4U7MA 2XY2A 2AJ3A 1AQDB 3L3KB 3DIDA 4H0HB 4YS4A 1HXKA 2ADIB 4Z78B 2DQDL 1E4WH 1PLAA 2Q10A 1UJ3C 4KH2A 4Q4IA 4KVCH 2YUWA 1PPIA 1CLOL 1YNKL 2J88L 3VXUA 3UBXI 4A2GA 3MRDA 5GJTL 3ULVD 1E4XL 1IKFH 5L8JB 3OSVA 1QLEH 3HB3D 3LZQA 1Q9KB 4M6AA 4P23B 2GJ6D 4K8RL 2CR3A 1MJ7H 3QZNA 1YMMA 4KI1A 2VABB 2TSAA 5IHUH 2PYFB 3P73B 4HPHA 5JDJA 5AAPA 4MWFA 4GLRI 4RBPK 4I1PA 4G9DA 5JNYA 5J1TC 4N86A 3G9VA 2FZ3B 1MI5B 3PF2A 3F5WA 4K3EL 1T04B 3QG6B 2X6BA 2VLLA 3VGHA 1AC6A 3GMMA 2YXWA 4B95C 4Z95H 2Q87A 2W60B 2A4EA 2GSIB 3HI1A 3WJJC 1MFEL 3KR3L 3ETTA 3ET9F 4BSJA 1JYVA 1KGCD 4LRNL 2ENQA 3CFQA 3T0ED 3WG7B 1NFDB 1CO1A 5GRZA 4J3XA 5DC4B 3O8XA 4NQQA 2AK4B 2W8CA 4MMYB 4TUOA 3VXQB 1IB5A 1HN1A 4MBRA 4A63A 1N68A 3KPSA 2YJQA 1BA9A 4QRUB 1RIHL 2NY1D 2NLJB 3ZE0E 3S8FB 3DXAE 1E3XA 4XCEB 4PRAB 1OZTG 4NQCA 3NA4A 1YA5A 3DX6B 3FO1B 2ZSVB 1HWGB 1MCDA 2E4TA 4N0YH 4OZ4A 3FQXA 2MCG1 1JGLH 2A9BA 2ED9A 2IAMC 1NCGA 3JWDH 1XF4A 4ZG1A 3HNVH 5I1CL 3UPRA 1CR9L 4Z7OB 1W6WA 1Q0YL 2ICWB 3DHPA 3LY6A 5C6PB 4XPHL 1UXWA 5FYLD 5E8PA 1EGJL 4OU3A 3KS0J 2AEOA 4WI3A 5C8JA 3H7BB 8FABB 3HIZA 5ISZB 3WDJA 1NFIA 3FB6A 4WSKA 2YKLL 2NY1C 3VFGH 4DP1X 1Q94B 3HHSB 3O41A 1DBMH 4HIPA 2ITDB 1XF3B 1SOQA 1ZWIB 3C08L 4KUCD 4YE4L 5G2NA 4X9FA 3L5XL 1QFWH 1BZDA 3D0VA 3EYOB 2EADA 4TVPL 4TSAL 5F7KC 1JPGB 4JFEA 4RFEB 3ZHKA 1KYOK 4CC1A 3W3BA 1AP2A 1JNJA 2APBA 2F54D 2YD6A 3VFRA 5IOKA 5G5DA 5MEPA 1W2KT 2Y5TA 3UMTA 2ISDA 5E1GA 4I18C 4L8DA 1GSMA 4CVXA 4KO7A 4OZIE 2IBBA 4Y9GA 3AG3B 5B7EA 5B3JE 1KLGA 2UVEA 3H54A 1JERA 1XL4A 4LMQI 4LVOC 4G5ZL 1LMKA 3B2VL 3VFWA 4O00A 1BAFH 5JW4Q 3IFLL 1MELA 1GS6X 4Y4HB 1KXQA 3NACL 2VZUA 1CGXA 4FFYA 5DD0H 4KU1A 4UINL 4H26A 4ABQA 3MLTA 3US0A 2EH8L 2GFBB 1TKWB 2FSDA 2G3ZA 1FZMB 4WEBH 4DPRA 2P3YA 2BFVH 2A74B 2YAFA 4JGUA 4K7FA 4JKLA 1BEYH 1PCXA 5H37H 4BFOA 4DVBB 4RDBA 3MUUA 1S7QA 4DVRH 3B6SB 3LHPH 4I77L 3J07A 3K81A 3FT2A 3IDNB 1TZHB 3AS1A 4GLRH 4LLUA 1DN0A 2IG2L 3TJEL 3X3GH 4I3SL 3L2MA 4N6QA 2R15A 3DJRA 3E8UL 5ALBH 1N7MH 4E9SA 3SDCB 4MNQD 3X1NA 1JL8A 5AKSA 5F3BB 3OWEA 3CFKA 3PAZA 4O2FA 3LQAH 4U1LB 5IJVA 3N43F 2R23B 5CSZB 4MZRA 2X4NA 1HCZA 4O2EA 3E9UA 3FHQA 4I9XA 3IXTA 3O2DA 2IXQA 4YDKL 4B3EA 3O3AA 4Z7OF 1PCSA 3FO9A 1UXSA 2RD0A 2CJTA 3N41B 2DLHA 5B21A 2XYCA 1BFSA 3ZTEA 1U6AH 1FNSL 3QDHA 5IMOA 4AITA 1IBHA 2AK1H 2NDGA 4ZXBA 3S96A 1CGUA 5KAQF 2WTRB 3L6FB 5JUEH 4GSXA 2X6MA 2X6VA 5DZAA 3LV3A 1U8HA 4NSKB 5I17A 1XSOA 1AXTL 2LU4A 4WI0A 1A7QL 3O4LD 3ZTDC 2VXTH 3LKNA 2D7MA 4JFYA 5I6XC 3FQUB 2R69L 2X3BA 1ZLWH 5I6PA 3QG7L 2MH4A 1CXKA 1CG9B 3MZGB 3JYCA 3QZWA 4H8WC 4XI5C 3WEMA 3A4AA 3MV8E 1S7RB 4MSWB 1IGTA 4AZUA 5L2KB 1YY9D 5FW6A 3CDZB 2Q8BH 4IK7A 3TJHC 2YD9A 1PZ5B 2UUDH 3Q8CA 2VTFA 1ZGLA 1WFMA 4EQ3A 1G0XA 1LVEA 5DJ8A 3ME0A 3HC0B 3BEWB 5KSVB 3QUKA 5C0BD 5DS2A 4M8UA 2ADFL 4U0RB 2X3AA 5E2TL 3DVNB 4K3JL 3MXWH 3Q48A 1IM9D 3MJ6A 2OL3B 4PJIA 1TT6A 3QIWB 3RY6C 4IOIB 4OSUH 1TIUA 1BPLB 3ARGA 5EIVA 4OCNC 1VAHA 1TVBB 2CNZA 2F53B 3MACL 3HG2A 4NC1C 4QCIB 2E46A 1GZPB 1ZPLA 1CGTA 5FDYA 4ZX4A 1BXVA 1YY9C 3FUMA 4H0GA 5DSCB 3EO0B 1PY9A 1E7UA 3RZCA 3NJIA 5JXAL 4CU8A 1UVQA 2FGWL 1TTAA 3VXPA 5KANG 1CDGA 4XR8C 4X9YA 2GSGA 1M1SA 4R5TA 5AW4B 4OM1L 4L3AA 1RVFH 5BV7C 1DBBL 1DEEB 3IRZA 1P84K 5DZJA 5D4JA 3MTRA 5EN2B 1ICTA 4O02H 3RWFA 4F2ME 2QVKA 1NCBH 4Z3GA 2QSQA 1BJMA 3MRGB 2WXIA 2EYTA 4N0FB 3DVFA 1CVSC 2H47C 3OPUA 1HEZA 4HXBL 4PWEA 5E5MA 3TH2T 4NXKA 4P23D 4J2QA 4F57H 4ACTA 1QBAA 1U2HA 2WKOA 3S4SB 1IKNC 3C60A 3UAJA 3N1FC 1MRCH 1NMAL 4HCRA 5I0VA 4U1HB 4MA3A 3OB8A 4QUOA 1FG2A 5ICXB 3VFOB 4BCXA 1W6LA 2IGTA 1T7VA 4EPSA 5L9DL 1CDBA 5HPMB 4KO5A 2A9CA 3F7QA 1CLVA 3WIAA 5I2IB 5D96B 4UANA 3I6KB 1RJLB 4NP9A 1HNYA 4AYFB 3ARSA 3A6CL 4BSWA 1DQQB 4QHPA 1NCNA 4O9HH 4U49A 5F1IA 2F5AH 2R1WB 3G5XA 2HKFL 1XBRA 2OYLA 1KZYA 1BG1A 5CSGA 4Y5VA 4P2OA 4MMZC 4P23C 3EOYG 5D2NB 3NA9L 1NWOA 3L3DB 3EOTH 1MAKA 3L95A 1U0QA 4RDQG 1SLUA 2P5WA 2KYIA 3PHAA 1FL3B 2COQA 3W9EA 4LOVA 3VRJB 5DU7A 4A66A 1T2XA 3IXAB 2D2CC 3CVCA 5FA4B 4DCQA 4OFYD 2FL5A 5F97E 5KVGL 3UG4A 2ED7A 4CN6A 2JKIS 3VFPA 3LXAA 4DPBX 3BFQG 4ODHH 4E9XA 1GW6A 4HT1L 1X5YA 4DIXA 1NGPL 5KG9A 3P0YL 3H9HB 3ILPA 5FUCE 4ZQKA 5E56A 4FG6D 1E5UI 3BUDA 1MFMA 5AKVA 5AZ2L 5I28A 1JWMA 3LSOA 4CSTA 1S3RA 2MMXA 1II4E 4H4NA 2CKBB 3D4GA 3R8QA 3H42L 1OE2A 2R1YB 4K5NA 4MCNA 2EIJB 2Y5QA 4Z1PA 1BHGA 4L1BA 4A1RA 2X2JA 3FOLA 3LPPA 2VDMH 5KYUB 1AVAA 4LGSB 3U2JA 5AVVB 1C1EL 3W11D 1R46A 1UENA 2BJMH 1P5VB 4PYGA 2EXWD 2FSEB 1I3UA 4PGCB 4IBVA 1O9VA 2Z31A 3FUDA 1CB4A 1NM9A 2FAUA 2X4TB 3HI6H 3EBIA 3V6OE 3PGFL 3PREA 3O9WB 4EBQL 1ACZA 1RUQH 1I7RA 3RVUD 5JHDD 4NZRH 2AQQA 1I1YB 2X4SA 4L3CA 4PS7A 2VLRD 4B3VA 1TO5A 1S78D 3N85L 4H88H 1UUSA 4FG6C 4R26L 2MOVA 5C3TA 3QJZA 1CXLA 4IYKA 2AEIT 1F56A 4XB7A 1BP3B 4F27A 3X1GA 5LGHH 3P3TA 1INDL 4HLZG 1NOAA 5IB3B 5BRZB 2FK9A 3MUY1 2WIIB 3OZ9L 1WZMA 5F7DA 2O6FA 4K5MA 4M8QA 5ITFB 1XGUA 1L9TA 1UGKA 4HGWB 3UTTB 3BKYL 4XRCB 5D7LB 3G5YB 1KYAA 1EZVX 4OF3A 1QASA 3DHUA 4QTIL 5CJXA 3RVUC 5C2BH 1HXMA 3MLUL 4Z0XB 3N42B 2Y4SA 1UFGA 2G5BB 3DV4B 3J2PA 5EBLB 4KZDL 5BUAA 1S78C 4H5SB 1WCQA 4I13B 4RVBA 3TTYA 3T0AA 3BZEA 4KK9D 1C8QA 2V8LA 5IB5B 2AJVL 1SYSA 4A6YB 4FHJA 2NR6C 1D5IL 2CO7A 5MI0B 4Y4HC 3SY0B 3P3RA 4ZJ9A 5AAWC 3VWKB 1J9TA 3SDCD 3U83A 2ZYSA 3OKYA 1KBWA 3HHMA 3QRLA 1MDTA 3GS7A 4HUVB 1QI3A 1V7NH 3GMLB 4K5LA 2ZXAA 4PJHA 4QF1B 4PJ7A 3DO3A 2A74C 2AJZA 3EF4A 4AGQA 2YQGA 3TO4B 1I8MB 2GT9A 2XWDA 5KS9B 1E4WL 2Y3AA 1MLBB 4QJ3B 2NPLX 5F7LB 5JPNA 2ZOLA 1T1XB 5EOTB 5CWSA 1N0LA 2ITCA 2ZWZA 4KVCL 2LT9A 2OMYB 1HHHB 1IU1A 4YHZL 1G1CA 5JMRA 4JFDD 5IMLA 4K5PA 3T6VA 4U1IA 3VX1A 5T1DH 1BF2A 1QLEL 2QQLL 2UXVA 1S7SA 2DYRB 3HS0C 3SDAD 1MJ7L 1EXUB 3PXLA 2YSSB 3N50A 5IHUL 3ATDA 2W07A 4Z18A 3D51A 2AQTA 3QJHA 2BY1A 4P2RE 1LL1A 2P5EA 2H1PH 2ZX8A 3V0IA 1QI5A 2C9SA 4KQ0A 2EDOA 1FH2A 1SJVA 2O5XL 4KNSA 2DYSB 3TZVB 1AGFB 1YHPA 4HJGB 1R5WB 3BLPX 1NZRA 5E9DD 3FONB 1Y0LA 1CI5A 2R0KH 4G6FD 1RPQA 3LZPA 3CHPA 4OI9A 1MUJB 4POYA 2DH3A 1X5AA 5H94B 3L2NA 3P77B 3VXNB 1PW3A 3AY4C 4UAOB 4PS8A 1AXSA 3QUMH 5T1KD 3OXSB 2Q2LA 2VDNB 1KG0B 4GYBA 1KGWA 1HDMA 1U2CA 3JT0A 1NMCB 5C0DA 5CM1A 2DWDB 5EC2B 5CILH 4ANXA 1EFXA 2XZZA 1FFRA 1WFJA 3DBXA 3MBEA 1RK7A 4LARL 3HG4A 2WNXA 3PABA 1QKZL 2CD0A 1JZGA 2BSDA 3OKKB 4JGMA 1P7BA 1JGLL 5I6OA 4GAYA 4RMVA 1IGCH 1B9ZA 5GS1A 5CINH 5L88L 2NNAA 1A5FH 3HNVL 2F53D 3HPJA 2YEZA 3M6DA 4LASH 4B50A 2JK5A 1JV5A 4QRFA 1MRFH 3HC4L 2ZG1A 2DAVA 5C08A 4IBZA 1X5GA 4NUGL 2UWEF 3VH8B 3TFKD 1MJ8H 5A2BA 2B20A 1GMEA 2J12B 1Q90A 2RIKA 5CFHA 1DL7H 1DBML 2BMKB 2NY5L 3QAZB 1K4CB 1D7DA 1V7MH 4U0RC 4QD2E 4PRHE 1YUHA 4PJ5B 1EAPA 1T0PB 1BV8A 5E2WH 4V11A 4DAGH 4FC3E 4XO4A 4Y2LA 5D7JB 3QIWC 4OLXL 3O2WL 1KIRA 1MSPA 1E3ZA 3SIKA 1WICA 3EYFB 1YEJH 4A67A 2A1WH 3S37X 3CFEB 1A1MB 2R2HA 1KYUA 4GKZA 4GSUA 1GGCH 2Q3ZA 2VAAB 3MNVA 3DROB 3R18A 2BX5A 1D6VL 3KHQA 3KXFE 3X12B 4OD1H 4OCWH 4JKMA 2W59A 4L4TA 3BJLA 3FPYA 5FS5A 1NKGA 2R2EB 3OKEB 5F7WC 3ROOA 1KT2A 2R83A 3TFKC 1R3LB 4PY7A 4YGVB 1A6PA 1MDAA 5DS1A 4ZYKB 4O5LH 5DRWB 4K07A 2Y7NA 4OY9A 5BVJB 1NDMA 3M7FB 2APFA 3NZ8B 3L4ZA 4PEEA 1T1YA 3MTXA 4WEBL 1R4XA 2BFVL 3TBSB 2C3VA 4D9RD 2K6ZA 3UTSA 4JFHE 5I5IA 3LPWA 4ZNCD 5AG9A 1HE8A 2V2WA 3M07A 3MA7A 3FT0A 3MLSL 3MRPA 2WZPA 1LO5A 3SOBH 3T2OA 4H13C 1CQYA 4WO4B 2ADYA 4DVRL 3DXAB 3IE4A 3LHPL 3ARUA 3C6LB 2P5PA 1I1AA 1R17A 3F7RA 3HZ3A 4Z7AA 3RBSA 3VXUE 4N2HA 1BQSA 2A6IA 1P0SE 3QO0B 2BIQA 4BINA 3K6FA 1KJ2A 5D96C 1HIML 4LLAA 5CLZA 3ZT6A 2YUVA 2FJHB 1QWNA 3TYFA 4N5EC 1YMME 3CDYA 1X3DA 1EJOL 2PW1A 3U6XS 2P80D 1U8IB 3LQAL 1JWSA 5GRUH 5CAYB 5CP3H 2DD8H 3SYQA 4X6EB 1HHGA 3IJHB 1IJNA 4LIQH 3NJGA 3K7UA 5D2NC 2YBRA 4N28A 3W57A 1KGYE 4AVIA 1HH6A 2B0SL 4EZKA 4LCWD 3EDKA 5FKPA 2VMDA 1U6AL 4ZUWB 4BKLB 1N5YH 2AK1L 1RZKH 1YEHH 4KXCA 2J25A 2WYZA 3GJFK 3KPSE 5JUEL 3O9WD 2RQEA 1JE6A 4CMMA 3V4VA 3GEFA 1KIPA 1RURL 1O0VA 1BZ7B 1Z9PA 2B1HL 3NK3A 3HNTH 5MENA 4OZIB 4LF3B 5AB9A 2DWSA 2VXTL 4NQCE 3SE4A 5C07E 2AEQH 2KBGA 3IAPA 2UY6A 3K5RA 3HVDA 4NO0D 4X6CA 2I69A 3CN3A 4PV1C 2Y0SA 4A7UA 3V2AR 3BI9X 4N2DA 5IHBA 4S1SL 1CZ8L 5IWLA 4FJZA 1XCXA 1QA9A 5IVZA 4DFIA 1G7PA 3EJYD 2H6PA 1G4RA 4PJFA 4WFFE 3VMPA 5B3NA 3VVVA 5AD0B 2VERA 1I8LA 1T66C 4YSPA 3D7PA 1KTBA 4OZFA 4PRDB 4WZ9A 2NOYA 4AVHA 3Q5YA 4BDVA 1BGXH 1VFBA 2IIJA 3DMMD 4UTAL 1PEWA 3OAWA 1EDQA 4OSUL 2XWCA 4JQIA 3SQOH 3ZHNA 2ILLA 3MJWA 4JFEE 4HFWA 3FCSA 2IANA 4RRPM 5A6MA 3D8MA 1KY6A 3PAUA 4KKNA 5JHLH 5JIPA 3IMTA 4Z7WE 4GP8B 3VWKD 3W38A 1AZZC 4EIBA 4BZ1A 4HG4K 1SY6L 1TCRB 2JKWA 4HZLA 4MKMA 1VKXB 3E1ZA 5I6KA 3A6BH 4IMLA 5E6IA 1BLNB 1ODUA 3RVVC 2EC9U 3STBA 3ULVL 2JB6B 1OB1A 4NHCH 5E00B 1NUGA 1RVFL 3KVPA 2DIAA 1KXQE 3DJTA 1K8IB 2GPZA 4EN2A 4O02L 3TBTA 3WTVA 4PSRA 4TNVK 2ZQKA 4WWPA 4ABVA 5HGAA 4JHBA 1SPDA 1UTDA 5CN2A 1X6LA 3X13B 2YIHA 4AQ1C 5MI0C 2Y7OA 5B22A 2YD3A 1E7VA 5DRXA 1U8PA 3VWKC 5CEXA 3KPPB 5LWYH 1MRCL 4WK0B 5DRZA 1UASA 2CKNA 4KROB 5AW9B 3SE3A 4D8PB 5I8KH 5F7MC 4CW1A 2UXGA 2AQSA 5JOPD 2OZNA 4HGKC 4MCMA 3MR9A 3BIBX 3TO4C 3WJMA 4RMWA 4BWTA 5KAQG 2EACA 2ZCLL 4X5WA 3U46A 3P3SA 3DARA 4NUPA 1TJXA 4O9HL 1DLHB 4PLOB 1U3HB 2F5AL 3MV8B 2FWSA 5IFAH 3MOAH 1RJZB 2CAKA 4XXDB 3U25A 9PCYA 3N04A 1EZVY 4X5XA 1OGTA 4JO5A 2E6QA 4K2UH 5E4IA 1WZKA 2ZIDA 2DN7A 1ZIBA 3EOTL 4F91B 1JXGA 4RCAA 4Q56A 1OZUA 2N0MA 3L7FB 5DUJA 4EIGB 2J71A 3F8UB 2G2RB 1J5CA 5AENA 1OLLA 4PJDE 3A67H 2B9BA 1HU8A 1YRKA 4WV1A 5H4ZA 5KVEH 4XPAH 1PYWB 2QTEA 1HINH 4LDOB 1QLRA 4B53A 1AE6L 1FIGH 2V2XA 5CBAB 3TZVC 4Y4KB 2L7UA 4ODHL 2LABA 2FATL 2KL6A 3WKPA 5FYKH 5J13B 4F8QA 2OCFD 3BLBA 1KY7A 2OW7A 3KL0A 2BOCB 5E8DL 1SHWA 1A6TB 5CIPA 4UYPA 3WHXB 1AQMA 1XCTA 1OVZA 2E74C 4JN1H 4OJFH 4UAOC 3AQXA 5BCAA 1QFWM 4ONFH 4X4MA 1RUKL 1UWEH 1NMCC 5J1AA 1ET8A 2OKMA 4GW1B 4F2MB 1AAJA 3RGBA 3HZMB 3N9GH 3CVHH 1AGDA 4NBXB 1SOXA 3QARA 3UDWC 1N67A 3ETSA 2WMPA 3HI6L 2BC4B 5TPWH 4LL9A 1PJWA 1U91A 4MA7H 3FAWA 3RZWA 4H88L 2PTVA 5IMKA 2D7NA 3QB7C 2HRPH 4UIMA 1CFSA 4PJIE 2GB2A 4FG4A 2XXCB 5LGHL 2FBOJ 3VXSA 3QFJA 4UTBH 2D8KA 1RZ8B 4JPQA 4CC4C 1EQWA 3US9A 1HOCA 2IH8A 4NRYA 4R96B 3D34A 4UOW1 1UD8A 5IQNA 3TBWA 1SEBB 3Q2WA 4JZOB 4MB5A 3IFNH 3LMJH 3DIFA 2KDGA 2DQGH 2YSTA 3BN9C 1HL4A 3PWNB 4JFFD 5D7JC 3PV6A 4FS0A 4JQXC 2NDFA 2YD4A 3UBXB 5I66B 4UAHA 1O9ZA 5C2BL 3WE1A 2D3NA 4AQEB 3DNKA 1OHQA 2IALB 4NCC1 4Z7UB 2H0PA 3CLWA 3R06A 3DXAD 2QELA 1CDUA 2Y23A 1N8ZB 3PGCA 4EO5A 3EJJX 2OXHB 4ODSL 3BP6B 3JXAA 4AG4H 1MCOH 2XI9A 2WWMC 2BK8A 3Q01A 4PREB 2Y7QB 3VGBA 1BVLA 1MVUB 5E8NA 3VI3F 4NO3A 4ETQB 5DZNA 3EAKA 1RHHA 2AAVA 1OW0C 3GKWL 1V7NL 15C8H 4I9WE 2JE8A 3DSFH 4P5RA 1R24A 2R9HD 4HUWA 2BOBA 2VW6A 3ESVF 4WU7B 4BHUA 2CDFB 2HFGH 2R1XA 4GO9A 1IC5H 2ICWJ 4WO4C 4ELKA 2EIZA 4F37F 3K1KC 1TLMA 3Q2CA 3C6LC 5KYNA 1JF6A 2EJ1A 1NIBA 4TUKL 5C71A 5IM7A 3TEXA 1DP0A 4M4RB 2WXRA 3RWHA 1DQLH 2NSMA 5T1DL 4WI7A 1FBIH 4Z8FL 1B3JA 3IDYB 5TH2B 5E6YA 1G4MA 3W0WA 5KSBE 2WC7A 1A0QH 5CJBA 1BJ8A 1JF1A 4E9LA 1A6VH 1AS7A 1G7QA 5IB4B 4EMZA 2LFEA 2YQBA 3NSFA 5GHWH 5TE7H 5LCVH 4F33A 1T6BX 1LEGA 3KPLA 3BUYA 4IM8A 2H1PL 3WIHH 3DRTA 2XIDA 1CD9B 4M5ZL 4XTRC 3INUH 4IKLA 4N87A 3DOSB 4CDGC 5E99H 2YZ1A 2VITB 3NCJH 2VDLB 3CWGA 4EXPX 4U0QB 5GGSB 2R0KL 2R2BB 1J9CT 3R7QA 4HIEA 4FQHA 1R5IA 3ZE2B 4F15B 5EF1A 4HS3B 5DA4A 1NQBA 1KWGA 1GH7A 1OP3K 3WBDA 2WXFA 1QPPA 4PJCA 5IG7A 1ADWA 3QJUB 3S4SG 1NBCA 2WANA 5KOMC 3K1DA 4BIKA 5CILL 4LLQB 5K5YA 5K9OA 3E80A 2GCYA 1GL4B 1D9KB 2DLEA 3PL6A 5AW3B 1ZSHA 4MNGA 3H2WA 1IGCL 3OTTA 3FUFA 4LASL 4X7SH 4XP1H 5ICYA 3B56A 3TURA 1ZXKA 4Z7UF 1QHPA 4E9YA 1JV2A 2ZXWB 3H0TA 1OSYA 1U3YA 4IEFB 4HK3J 3QGVA 3LKRB 4HD9A 4IJ3B 2VQ1A 2B59B 1MJ8L 4HWBH 1MCHA 4YFEA 3Q7JA 2UY7B 1UEMA 2J8UA 5T1LB 5F6IB 3PS6A 3REWA 1CGVA 4BWWA 2C9XA 3CXHJ 3LCYA 2Z35A 4XO3A 5E2WL 1O5PA 3QUYA 1CFVL 2VZ1A 1QUNB 2Y6SC 5HPOA 3QWQB 1YEJL 1SXAA 4UTCA 4EKJA 1E8YA 2FLBT 5LAXA 4AYSA 5HY9A 1NIFA 1NC4D 1FSKB 3T0BA 4Y1AA 1UC6A 4KROD 3E8VA 4P2RB 5TDNA 5DT1H 2WB7A 5I19H 2J5LB 5GGVY 1KEGH 3GSVA 3S5YA 2YC1B 1BOGB 2YPVA 5F88A 5M95B 1WFUA 3CDCA 1X7SA 1NLBH 1JK9B 5B1CA 2QGBA 3MV8D 1BF8A 1JTPA 1M1XB 2AQ3A 2HPOA 3MNDA 3MRMB 4OQ1A 3T65B 4CSZA 4WW2A 1F4XL 4PJBE 1MRDH 2F5BL 4PJHE 4PJ7E 3IDMA 4QGTA 1IGIH 4EI0A 4PFEA 4XPFL 4QHNA 3SOBL 2Z4TA 4YMPA 4N2AA 4NNXB 4GP5B 4H0IA 5KUKA 1RUPL 1U58B 5EUOB 4UM8A 5TQ2H 3CSTA 1JGDA 1FIEA 3ZE2F 3KL5A 3FBKA 3DUSA 4X7EC 4PD4K 3SZKC 1A8JH 2ZWLT 4XP6H 3SQRA 2R39A 3RVTD 4AXWA 3QR2A 2B1AH 1U3HC 1QLFA 4DP8X 2HX8A 5GRUL 2WB1A 4HJJH 2DD8L 3O6FD 1MFUA 1YNTF 4KRPD 4ZT1A 4YHOL 1V3LA 3GMOB 3CFNA 4LIQL 1RZIA 4OD2A 4AUJA 3HG0A 3NCCB 4EEEA 3GKZA 4BJLA 4LRIC 1UOWA 3PIQB 3HMXL 4PGEB 4PRHB 3AWEA 3KGTA 3M17B 3QZBA 5SV3A 2A83B 3U9PH 5FYJH 4MYPA 4NFDA 5KYWA 2VDMB 2HG5A 2Z6FA 4PCYA 4F24A 3DIVA 1JF5A 3GSNH 1N5YL 1EXHA 1RZKL 1YEHL 4LCYA 5I1DA 5IQ7L 4Y4KC 1A7OH 4MZ3A 4BFBD 1A6AB 1HH9B 5J13C 1OHZA 3WCYA 4G6AC 1NCHA 2FBRA 2WLJA 2N3JA 3JWDC 2XQYK 3KXFB 3X3FH 4B96A 1QEWA 1FZKA 2BCMA 3VM5A 1F3JA 1WHOA 3U9UA 2E9WA 4QO1A 1WT5C 1PMYA 3ARBD 5I1LA 3SD5A 3PWVB 2A4CA 5EEYA 4C57C 4Z0BH 3QIUA 1JWUB 3BCDA 1I53A 3GLDA 4U31A 1G84A 3FOMA 3X14A 4MBOA 2WVVB 5C08E 2WCSA 2VN5A 2BERA 1DTUA 1TYEB 5I76B 1X9QA 4TM9A 5HJDA 2CJUL 5C0IA 2UUDK 4GMTH 4HBCL 3FTGB 4WSJA 5T3ZH 5IQMA 5MHSE 3VGAB 1KIUB 5IFHH 3M46A 2DZEA 2F68X 4NRZA 4AJVA 1MHHA 1BGXL 4FYRA 3G6JB 2VJ0A 3D07A 4OLUH 4UQBA 3DHMA 2M2DA 3QDMA 3VXUB 1JOIA 3MLXH 3SQOL 3ZLQC