1SN5A

Crystal structure of sea bream transthyretin in complex with triiodothyronine at 1.90a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
b'CPLMVKILDAVKGTPAGSVALKVSQKTADGGWTQIATGVTDATGEIHNLITEQQFPAGVYRVEFDTKAYWTNQGSTPFHEVAEVVFDAHPEGHRHYTLALLLSPFSYTTTAVVSSVHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transthyretin
molecule tags Transport protein
source organism Sparus aurata
publication title High resolution crystal structures of piscine transthyretin reveal different binding modes for triiodothyronine and thyroxine.
pubmed doi rcsb
total genus 25
structure length 118
sequence length 118
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1sn5A00
2ROXA 4FI7A 1BM7A 3DJRA 3A4DA 1X7SA 3CN3A 4Y9BA 4IK6A 1DVSA 1TFPA 4PWEA 4PWIA 1Z7JA 4DETA 4L1TA 1DVQA 3IMTA 3P3TA 4TQPA 4YDMA 5IHHA 5FW7A 4WO0A 3IWVA 1ICTA 4HISA 3KGTA 3QVAA 5K1NA 3OZKA 4TNGA 4MRCA 1GKOA 1ETB1 3GRBA 4PWGA 4Y9GA 1TTAA 3DJTA 3NEEA 4TQ8A 5CM1A 3OZLA 3P3RA 4TLKA 3IPBA 3NESA 4FI8A 5L4IA 3GS4A 4IK7A 2G5UA 3DO4A 3GRGA 4Y9FA 4WNSA 2G2NA 4I87A 5FO2A 1TLMA 2B16A 2ROYA 4ACTA 1QWHA 2H0JA 2B14A 4ABQA 5CLZA 5L4MA 1RLBA 2QPFA 4IKJA 3B56A 3GPSA 2QELA 4ABWA 4I89A 2QGDA 1GKEA 2G2PA 4Q14A 1IIIA 4TQHA 5L4FA 2FBRA 4HJUA 4YDNA 1TTBA 3GS7A 4DERA 4IKIA 4TQIA 1F41A 2GABA 3I9IA 3IPEA 2QGBA 3IMRA 3CFNA 3CN0A 4TNFA 5AL8A 4TL4A 4Y9CA 2H6UA 3TFBA 3D7PA 3IMVA 2GPZA 1FH2A 4DEUA 3CFTA 4N87A 3P3SA 1BZ8A 2NOYA 1U21A 3KGUA 4PMFA 3FC8A 4TLUA 3DGDA 1E4HA 3IMSA 4MASA 5EZPA 5EN3A 5E23A 2B9AA 5DWPA 4N85A 1E5AA 4HJSA 1DVYA 1SOKA 1TYRA 1DVTA 4KY2A 3FCBA 4TM9A 3I9AA 2G4EA 2G9KA 3U2JA 2TRHA 4PVNA 4QXVA 1IE4A 4ANKA 3GLZA 3ESPA 5HJGA 1KGIA 4QYAA 5JIQA 3BSZA 3CFQA 3CN1A 5E4AA 2PABA 3IWUA 4DESA 4TKWA 4PWHA 2G3ZA 2QGEA 2G4GA 3M1OA 5CNHA 3DJSA 3IMWA 2B77A 5FW8A 2H0EA 4HJTA 1E3FA 1DVXA 1SN0A 3Q1EA 1THCA 3DK0A 4Y9EA 1BZDA 1Y1DA 2TRYA 4PMEA 4IIZA 4DEWA 2H0FA 3ESOA 3NEXA 1KGJA 1ZD6A 3CFMA 1TTCA 5K1JA 4AC4A 3CBRA 3DJZA 3ESNA 3DK2A 3NEOA 2B15A 4ABUA 2F8IA 4PWFA 5AYTA 3HJ0A 3D2TA 1TSHA 3CN2A 3NG5A 4QRFA 5CLXA 1THAA 4FI6A 3IMUA 4TL5A 4IKKA 4TLTA 3TCTA 5JIMA 4IKLA 1ZCRA 4PVMA 5CN3A 5FW6A 3U2IA 1DVUA 5DEJA 5CLYA 5E4OA 1IJNA 2H1XA 4D7BA 3GS0A 1TZ8A 3CN4A 5L4JA 2QGCA 4MRBA 2G3XA 1ETA1 1IIKA 4I85A 1F86A 3SSGA 4ABVA 2WQAA 5CR1A 1TT6A 5AL0A 4N86A 3DIDA 4TLSA 2FLMA 4L1SA 1DVZA 5TTRA 5JIDA 4PM1A 1OO2A 3W3BA 2H4EA 3A4FA 2F7IA 1FHNA 4PVLA 1BMZA 1SN5A 1TTRA 3CXFA 3P3UA 1X7TA 4HIQA 5AKTA 1BZEA 3A4EA 3BT0A 1SOQA 1QABA 4PWKA 4PWJA 5AKSA 5BOJA 4AC2A 5A6IA 1SN2A 3I9PA 4TNEA 3KGSA 2IGLA 1G1OA 4WNJA 5AKVA
chains in the Genus database with same CATH superfamily
3K2MC 3I02B 3OKDB 4G1EB 1TKWB 3RJQB 3MLRH 4E9QA 1U8NB 1MWOA 2WQUA 5AVTB 1KGUA 1E9QA 2VE6B 4Q89A 3LEVH 5CD3A 5I24A 2AV1B 5KVDE 3HZYB 5AW9B 1RUMH 4FG6D 1ML0A 3IM1A 3LQZB 3DJTA 4H8QA 4BCYA 2EH7L 1HOEA 2G60L 4WV1C 5EC1B 4EKJA 1PCXA 2X5PA 2AJVH 1C8PA 4PJXE 4MJ6A 5JMRA 3A47A 2KBGA 4POYA 1S9WB 2BP8A 1I8KB 4HX1B 1INDH 3JT0A 4J1UA 2JB5H 3RWHB 1H9VA 4NFDA 4LAQH 4GFXA 3NACH 3EF4A 1H3TA 3NCEB 5ID0A 5CSZA 3LVTA 4DKFH 3QXAA 5FFGA 1F6AB 2EE2A 4F7EB 5INDB 4N87A 4HPOH 4GRMA 4JVUA 4MJ4A 4APXA 2DJMA 2NY1C 3TJHD 4PJBB 5JW5B 5C0DA 3BZEA 3BVTA 1WS7A 3QRGH 3L2MA 1ESOA 4HULB 1Z5HA 1MCFA 4YHIA 5HHMB 2OMWA 2NQ3A 3OWEA 4WUUA 3MCKA 3VQ1C 5F0MB 3RWFA 4FAAB 4AJVA 2H3NB 4G7QB 3KR3L 4KY1L 3GJEA 2QPEB 3KXFA 4O02H 4WI9A 4AQEB 3VFGH 3UTSE 5GIRB 1UD8A 2DLEA 4NJAH 1AY1H 1PNDA 1KGJA 2FQEA 1TTCA 3CBRA 3A6BH 1F4WH 3O6ML 3UTTD 5D4IA 1CF8L 1F0LA 5IBTH 3WXVL 2PXYB 2HKHH 2K78A 2IQAA 4Z0BL 5FYKH 1EHLL 2HKFH 3VMNA 3KPQB 1DL7L 5D55A 2HT3D 2MRYA 1DQML 4QF1A 5EO0B 1A25A 1A1NB 1DANT 4XBPA 5DD3L 5IQOA 2VLKD 4WW1B 4M8RA 1MFVA 3GSXB 4WI8A 1CZ8H 4WSJA 4HWEH 2OSWA 3AY4C 3NJXA 4FNPA 2WLNA 4PRIA 4WUUD 5FF6B 5MEQB 1AY1L 1BD2A 1QSEA 5GS0D 4I4WA 4HIQA 1L0XA 4PGDA 3VXRE 4GRMB 1ZTMA 2D03H 4ZOEA 4R5VA 3QXAB 2Q2EB 3HMXH 5GRUH 3HR6A 3NQKA 4LSUL 5AKVA 1WBZB 3EYFA 3PXLA 3F3HA 3H1ZA 1FYHB 4OZGB 3SGDH 3HI5H 2J5WA 1PX4A 1HESA 4YDMA 1G7HB 4HS8H 4AM0A 4MQ7A 4LHUA 3B1UA 5D1XD 2RD0A 4E41B 4R90L 3O6KH 1AGCA 4AYBA 1RP9A 4U1NB 5ALBL 4R4FL 3VFRB 2QFRA 2YIHA 4Z0XA 2CGRH 2UUDK 4G7YH 1MPAL 4LIQH 3WG7B 2C5DC 1J9CT 5C0GB 3SKMA 3QEGL 2NY1D 3TJHC 5GGTL 4WCYH 3IJYA 2O5XH 5AUMB 4P3WA 1ZLUK 1X9UA 1ODUA 1P1VA 3CVBA 3GO1H 3GPSA 4N8VG 3ARQA 4PY7B 4HP5A 1TKWA 4F33A 1SXAA 4LXFA 1KYOK 2R29H 1S9VA 2R9HC 4GQQA 4LKCA 2PF6A 1WZKA 2YEVB 2ZXBA 4TL4A 1JFQL 3HMXL 5GRUL 3W1ZA 3ABLB 1KLUB 3CC5A 2LU3A 4F24A 1P7QD 5FDYA 2AS5M 3C2SA 3WTYA 1BFSA 2Q3XA 5SWZB 1KGCD 1F42A 3IGUA 2BIPA 1EFQA 2GSIA 4L23A 5HHXL 5I5IA 1KGIA 1GGYA 1HL9A 3MV8A 1G9HA 2XVGA 1I1AD 1KF9B 4L1LA 5D6CB 2EICA 4Y16A 4R96B 3TT1H 3AGVA 4BHUA 4MJIA 2ZUWA 3MROB 2X6VA 1X9QA 3ZDXB 1EHLH 1I1RA 1OOWA 1IKNC 3QUKA 3WO4B 4IIZA 1VFAB 3SDAD 4FQIH 1LEIA 1UWGL 1SFDA 2Z4QB 3OKOB 1C1EH 1JHTA 3KM1A 4HFUL 4XRCB 3FT9A 3JT2A 3A6CH 2SEBB 1RIHH 2XFXA 3IAPA 3TNNB 1YO4A 4P4RB 3K71B 5IJCC 1OANA 2DKSA 2LOEA 1U6AL 4JRYD 2P46B 4GKLA 15C8H 1W8EA 4UYQA 2QSCH 4PRIE 4HJ1A 4D7PA 4H8HA 3C8DA 1X5XA 3CFKA 3H7BA 4YHOL 2I60H 4G8IB 2EDRA 2J8UA 1G6RH 2Z7YA 3FRUA 1HXYA 1LO0L 4CBPA 5E00B 4PCYA 3F7KA 3MQIA 3D12B 1LWRA 3LS5L 4PR5B 5FECB 4X6FA 4XPBH 4K3HA 5LBGA 4BDVA 4KXCA 1NCAL 5D7JA 2K6WA 3TPUA 1BJ1J 2CIKA 4KKLC 1MCHA 4JO3L 5C71A 4MX7B 3WN5A 3M45A 4HZLA 1JPEA 4NXSA 3BEWA 3G3LA 1M53A 2PYFA 4JPSA 2IEPA 5D1QC 5EH1A 2R4SH 4U3CA 2E9IA 3US1A 4PWIA 3ZIMA 1UUNA 2QADC 4M61B 4XVOA 5F1IB 2Q7YB 5C0ND 3MJ9L 1K5NB 4PW9A 1E4WH 1OSYA 1FH5H 2P7TA 4KVPA 5I6XB 4N0UE 5DRXA 4GI6A 2NSMA 5FGBC 2EH7H 1NKGA 2JQZA 3N85L 3TZVB 1A02N 1A1OA 4ZD3H 3TH2T 2FUQA 2KS0A 5DJZB 3OJDB 4XODA 4F9LC 2HJLB 3LXBA 3BKJL 1I9JL 3SYQA 4X5WA 1FL5A 1OARL 1GTNA 1NCNA 3ET9F 2WB7A 4FP8H 4PJEE 1KCLA 4V2CB 2FAUA 4IRSA 3MRLB 3LZFL 4K7PX 1FH2A 5FOJA 5JHDD 1RZIA 1F13A 1DVFA 4XC3L 3VFVA 4QLRA 5BV7L 4EE2A 5CCKL 1CURA 3VSUA 1KPVB 1J9SA 2E8ZA 3FL7A 3CZNA 4UTAA 2GJZA 1T3FA 1FYTA 4PJGA 3QUXC 4KWUA 1XIWA 2XQBL 4OLYL 1KCRL 1E6JH 4CMMA 1CC3A 3G04B 2BC4B 3QJRB 4XOEA 4XNXH 2YXWA 4Y16D 4JM2F 4F8TA 1QI3A 2JQMA 1FFPB 3TWYA 3TM6A 4N0FB 4WWKA 2GTWA 4FRWA 2OI9C 2ADGB 4X0KB 3VACA 1BEXA 2VW7A 1DZBA 2QQLL 1DO5A 4UAHA 3WD5L 1XF2A 2WW8A 4QWWD 5AWNL 4BM7A 5D2LB 1WE5A 1T1ZB 1U91A 4IMLB 5J5EA 1KYAA 5E2TL 1TVDA 3PGFH 1I8LA 3L3HB 4JREB 4PJ9A 3QNXA 3PXHA 4X7FC 3OXRB 2VO5A 1ZHNB 1C5BH 1UOVA 2FH8A 4PJ7B 3P4LA 2KYIA 4CAGA 3FKUS 1JV5B 3SE4C 3S3BB 5FCUH 3W9EA 4KJWC 1FL6B 2HLAA 4K5LA 4R26L 5F88B 2WKOF 4F58L 2FEEL 3SKOA 1MQKL 4XMPL 5JOPD 2E47A 1VIWA 2NZ1A 2I9TA 2H32H 1J88A 1T0MA 2NY3B 4JRLA 1FDLL 3ABMB 2XPYA 4HXAL 4FA8A 2FGWH 1ZGLP 3D4YA 3JVFC 1J1OH 1IBBA 5C0BE 3TFKD 5A7EA 3PIQA 1QO3A 5A6MA 2QQKH 2NR6D 1DQDH 2F54A 3QUZA 2ICWA 1Q72H 1XSJA 1FLRH 4G8GB 1X5ZA 4XWOC 1NKRA 1BXAA 1NGXB 2IDTA 3LZQA 3UZVB 2AZUA 4U33A 2JNZA 4JHVA 1LM8V 2WJ7A 4NO5B 5F8RC 3DX7B 4N25A 4JY5L 1BX2B 1F1GA 4JJ5A 1B3IA 5E9NA 3GXFA 2O5ZH 1BXUA 1HXMA 4JHAH 3ZKXC 3KHOA 4HIPA 4PJFB 1FHGA 1SOXA 1EZVX 3UP6A 3IFOB 1CGVA 3X1EA 12E8L 4Q0XL 1TZHB 4TVPE 3ME0B 4Y7MA 3AW5A 2XUWA 3BUPA 4YIQA 2GBTA 2R0ZH 1ET5A 1UTDA 1HXKA 5HVGB 1T4WA 3SE9H 1MWAH 4LU5L 2YARA 4NERA 2C3VA 2VL5A 3RILA 2IMMA 2WLIB 3PYCA 3O3BA 3SPCA 4FXGB 2F74B 3U25A 4CN1A 2PP8A 4UOW0 1PEZA 2GJ6D 1VHPA 5I1EL 1CCZA 1XAKA 3NSXA 5IVXE 4PJXF 4ESKA 1K8DA 4NN7C 1R3KB 2WTRB 5SWSA 5IMMA 1AIFA 3ZL2A 2OR9L 1D7BA 1JL8A 4U3SB 5I71B 3WAJA 3ETBF 1DLHA 3IMSA 1AQDB 4BYHA 2WXFA 4GLRI 4JZNB 7FABL 1A64A 2I5YL 2D7PA 1J5OL 2XSKA 2X4RA 3UO1H 4YL4A 5ICUA 1X4XA 2DYPA 4XP9L 4WFFD 1SJEA 1NDGA 4N0UB 5D71H 5T5NG 4E36A 1D6VL 1QD0A 4H1LA 4OJFL 1QFPA 1RL1A 4M56A 1C5BL 8FABB 4RBPH 4H7VA 4I3SH 5LHDA 5DFVC 1M7IB 4KVCL 3FFDB 1N67A 3MRKA 2AJZB 1HAWA 1PZ5A 1ZEAH 2KZ1B 3VI3E 4OZHB 2HG5A 4Y1AB 1CD8A 3FT1A 2E74C 1DQLL 1WG3A 2GHZA 3ZQXA 1AZNA 3EJSA 4E5XB 4ZPVB 3MZGB 1XSOA 1E6JL 1FCGA 2NCMA 4JO2H 3ULVE 1VFUA 1M6UA 2ZKWA 4U1JA 2GJJA 3EO9H 1NUFA 4JFOA 1IGJB 4WF7A 2DL9A 5BS0A 5EEXA 3D3VE 3SPVB 3SY6A 5FO8B 5CBEB 5IUSA 2OXGA 4UM8A 4JANA 2ADJA 4L8SC 3DIVA 3ARDC 4PS7A 3SKJH 1M7XA 5DUBA 4X6BB 4FL4B 5AVQB 3FQYA 3GM8A 1QNIA 4ZS6C 1I8LC 3L16A 3V79C 3O6LH 3O4OB 3HC0B 1OO2A 2VH5L 4G8GE 4LSPL 4A2FA 2WN3A 2I9LA 3GBNL 2AJUH 4DVRH 1CXHA 3PWPB 1ZK5A 3F7QA 5CZRA 4NWTL 1Y07A 4YQXH 1NCCL 1MDTA 2ZUTA 3WL9B 3TA3D 1QABA 5DJDB 5I30L 5LG6A 1A9VA 1DBBH 1NMAL 3HI1B 5A6IA 1GS8A 4NENB 1A5FL 2BJMH 3HRZB 4IIQA 4J8QA 3RJOA 3JWDC 1M2OA 1AQHA 3DO7B 3S35X 4W9CC 5E8OA 1XIWD 2ITEA 3C5JB 1PCSA 1Z7JA 4L8BB 1BVNT 4K15A 1ZDSA 5FX3A 4XH2A 3V0VA 1AAJA 4ONHA 1MJ8H 1ODAA 2Q76A 3UACA 4PBVC 1NCIA 5KAQF 3IGAA 3KBHE 4JZJB 1YN6A 2BSDA 2XLLA 1K6QL 2WXOA 4ONFH 1GZHC 1F18A 1K4CA 4E42B 4YX2H 3BIBX 3IDXH 1ZS8B 2JKLA 3J27A 5LDSA 1GA2A 2HT4D 2C3XA 2F8OA 1TLMA 5CHNB 1AR1C 1S7WB 5BO1L 3C60D 3WE1A 4L4TD 1E5BA 4ZK8A 3RY4A 5LKNA 3MR9B 3OXSB 2CGZA 4LOUD 1NUNB 4FQCH 3US0A 3HNVL 5ANMA 1F45A 2WUBL 4LU5H 3QNZB 5GZND 2B8OT 5IB4A 1H15A 2ZCKL 4EUPA 2EDDA 2JJVA 4OR1A 1MZZA 4Y8DC 4G83A 1U8IB 1S7QA 4XNMA 4QRAA 1IJ9A 1BJ1H 4PRDA 3ZYZA 1YEFH 2DQDH 5HHVL 2HZHA 2J6EA 5GSVB 2F7PA 4OLUL 4OD3H 3AY4A 1FFOA 2BXYA 3QXVA 5DLLA 4Z7VF 3UTOA 4K5OA 3E1F1 1YMMB 2IFFH 2UWEA 4YBHA 2X2HA 5DC9B 2V8MA 4NQEB 3WN5C 4P5MA 4N2LA 1FNAA 1G7PA 3FBQA 5CINL 5DR5L 2O6CA 3KPNA 4L3CA 3T1FB 1KMGA 2P5EA 1I1AA 1UZ8B 5IOPA 5AAMC 3JV4B 3NCFB 2DIBA 2AK1L 3TO2B 1Q9WB 2EDFA 1YQ2A 4IJTA 5EUOA 3WMQA 3KPSA 3L3KA 4IRZH 3X2QB 1OZUA 4MB5A 2BHZA 2GW5A 4C83A 3RHWF 3I6GB 5GSRA 3V4UH 3TV8A 3RY6A 4OD1H 2XWDA 2WWKT 4JY6B 3FQXB 4LCIL 4HG4K 5HD8C 3INUL 4XVSL 2FJSA 5TH2A 43C9A 2R29L 1Z66A 2GBAA 4KTEH 5F2FA 2HT3C 3T4YA 2WVSA 1DTUA 1DEEB 4KMQA 5G55A 3TJPA 4F3FB 4J3OG 5KS9E 3CVIL 5IMKB 3WENA 2BRRL 5ACMA 5TE7H 4LSTL 3MBED 2P5WE 3QEUA 3QPXH 3V7AG 4JKWA 4ENZA 3BLPX 3QNYB 1CMOA 1F8TL 2H32A 4CSTA 1PKQA 4LCCB 2L8AA 3C6SA 4Q6KA 3C5SB 3DJRA 4TPRL 2J43A 4MCZB 1HQRA 5DJ6A 3KWVA 5FFLA 4R90H 1JDDA 2OR8A 4HXBH 3MJ7B 5BVJA 4NQSB 1A3ZA 2MMXA 2EXSA 2F15A 1HNGA 1FNSL 4FTVD 4NUJB 4FDWA 1XGRA 4Z7VE 2J5LC 2GSMB 1N8ZA 2H6OA 1WO2A 1T20B 3RVUC 1AKJA 4K5NA 3OAYH 4HVBA 2Q76B 2X4SB 2B16A 4NO3A 4NBYB 5CGMA 4JFTA 3UJIH 3X1BA 2FBJL 2J8OA 5SV4A 3COOA 4PJCB 3X3GH 5E8OB 5IBUB 4PRHA 3QIBB 4AKPA 2DM7A 3MRMB 3FQ4A 5DMGD 2OP4L 3QFJE 4M4RA 3FTWA 3QZWA 3PUUA 4OLWL 3P2DA 4HMDA 1SLUA 9PCYA 4YC2B 5K9KA 3BPLC 5A2LH 1T22A 3NH7H 4D9QD 1SXZA 5J13C 3NCBB 3R7RA 3KPMB 1FH5L 4E68A 4ODHL 1ZHLA 4PJEF 4CN4A 4Z7UB 1HVXA 3O2WL 1X9LA 1ROWA 2BNQB 5J12B 2ZAHA 3GC3A 4R0LA 2YKLH 3NH7L 2F5AH 1CF8H 1GCYA 3EO0B 5CIPB 1NPJA 3LZRA 4HIHB 3W9DB 2BW5A 1A4KB 2RTTA 4W6YB 1L4IA 3UJTH 1HCFX 1WFIA 2DQHL 1FAIH 2LV4A 2RR3A 3HI6H 1KYFA 2EDXA 1BZDA 2XG4B 4UI2A 1TITA 4LPYA 3HUJE 5HHPA 3IRZA 2VTFA 4N2CA 1QBML 4NZUL 4JFEE 4F37F 1D5ZB 3MLYL 1ACYL 4GG6E 4AC4A 4QRRB 3GXUB 4S1SH 3ULSB 2XWTB 5EBWA 1RQ5A 2X4QA 5KBPA 5D1ZA 5JO5A 2HFGH 4NC1C 2AJZA 3VRJB 1KIUA 3PWPE 1JFHA 4LNRB 4TL5A 4H2CA 3HBGA 4YHOH 5E70A 3ZR6A 4YAQA 8FABA 4NQTA 4OFIA 3DWTA 1I8MA 3NFSL 3D39E 2OMUB 3ARFA 3CLFL 1KB5H 3KYNA 4TQEL 3QEQA 4TPRH 2IDFA 4D94A 1G4RA 1CDBA 1NSNL 1L0YA 1FNLA 3AMKA 3PJSA 3U9UA 4JK0D 2ZYHA 1F6LL 1ZVSA 4N24A 2X53A 5ACZB 1L9TA 3RDTC 2BY1A 3L7FA 5F97E 1ZLWK 1IAIM 4TNWK 5KW9L 3SE8L 3GK8L 1K5WA 1PD1A 1Q1JL 2VZUA 3SD5A 4Z7VA 3VD0A 4IOSD 3SO5A 2ZOLA 4HUUA 3T1WA 5L0QC 3DURB 5HYIA 1NH6A 3MRQB 3WTWA 4N8CL 1RUML 4XN1A 2FWUA 2Z8VC 4O51B 4N90E 2WPGA 1SHXA 5DT1H 4BWTA 1P1ZA 2XFGB 3MCLL 4L29A 4CMHC 4DQOL 5BW7C 3BRFA 3U7YL 3Q9PA 3IPFA 1S78C 1X5AA 2IOIA 3C08H 2GTZB 1GSKA 3GSUB 4BSWB 3QORC 4N22A 4OCXH 2E7LA 5DZOA 1XF1A 3QIWC 2B7DT 1HXMB 5E5UB 2ZNWA 1XZ0B 3EJRA 4P2CG 3S3JA 4M8QA 2OMUA 2PCPB 4KOCA 3ULUD 1JIBA 3MTRA 5BRQA 4S10A 1FO0L 1LK2B 4EI5B 4LNRA 5KVFE 3UZVA 2J4WL 4NQUA 1Z3RA 2YD8A 1UM5L 4NHCH 1S5HA 3PQYE 3GRWH 1PU0A 3LTVA 4M3KB 2FX7L 5KS9B 5I1DA 3C6EA 4FERA 1WAAF 4JW3A 4DW2H 4N2KA 4LE8A 5HHPB 4GRWH 5HHOA 3HUJA 4JR9H 2VZ1A 2OZ4L 1JWSB 2A6JA 2EDYA 1DE4A 1MDAA 3HI5L 5ERWB 1ZLDA 1UOWA 2VLJD 3MLSL 1QRNB 2XWBA 1J8KA 1NLBL 2PO6D 1C16B 3JZ7A 1DQJB 5E1QA 1XD0A 3LN9A 3ZKMD 5F0PB 1PZBA 4KKRA 5H4YA 2YSTA 1KFAH 4JN2B 3RTQC 5LWYH 1DDHA 1P7KA 2WNKA 3O9WB 4GAYB 2BZDA 3A23A 1U91B 3C12A 2R2EA 4YNYB 5DK3A 3CHRA 5CCJA 3QWQB 1UB5A 2GC4C 4N1HB 4P46C 5IJDC 1YNTB 2GHWB 3GXDA 4U6VL 1BOGA 2F5AL 4MXVE 5T1MA 3FCUB 1SDDA 5BXFA 1TETL 1LEKB 3AREB 4I18C 1CBVH 4K9EH 2CO2A 4AMKL 2Y7MA 3ZKND 3Q6FB 4OUUB 1XIWB 4F7PB 1NCUA 3IB4A 4WW2F 5JIDA 2GJZB 4PLOB 4K71B 4OT1H 2GAZB 5K59E 3V4VH 1UYWL 3WKMH 2MPAL 3GIZL 4L3EE 8PAZA 3TEUA 5AB2A 2AQTA 2ZIDA 1H3PH 2OW7A 1J5DA 3VRLE 4EOWH 5SX4H 1YEJL 5DRZB 5D7LD 3RUGF 1FORH 1M05B 1TZGL 3DRTB 4JRYB 5AW3B 5INCB 4WW2B 3VFWA 4TSCH 1U58B 4L1DA 4DCQA 2B1OA 4HXBL 4Y1TA 1A1OB 1YYML 3NCWA 1F2QA 3OX8A 4OLZL 5E5MB 5K69A 2MNJB 3NIGE 5E9DA 2Y5TB 3R19A 2W5PA 5HJ3B 4JFDA 3SJVD 2N3JA 1EJOL 3FQWA 4XOAA 4G80A 1NANI 1XT5A 4KVNH 4DGVH 3DXAD 3OHMB 4BRVA 3OAZK 2E6JA 4FFWC 2JCWA 3P73A 4K71C 5I9QC 1W72B 3WJMA 1A8JH 3TO4A 3O4LE 1N3NA 1MJ7H 4IBYA 1ZEAL 1IQDB 4ZPTB 4GUCA 4LSTH 3QQ3B 4JY6A 3E0GA 2RGSA 4LEXL 1YC7A 3GB7A 4LVNC 3SGJC 5HY9A 1SMOA 4L2LA 1GGBH 5HHOE 3TPUB 1U21A 2FHBA 3O2DH 4NQVA 5HJBA 1U8HB 1J8SA 1JUFA 1RJZB 4Q9QH 5FECA 1CFBA 2FJHA 4PLJC 5H4ZA 2HCZX 2I07A 3DSNA 2LU4A 1P4UA 1QKZH 2AQNA 2Q0ZX 4QXTB 2FECL 3MACH 4XPAH 4MNQB 3ILQD 1CXKA 4OCRL 1JF6A 4IRJC 1UCTA 4KTDH 5I5RA 3DSFL 3EYVA 4BELD 3FTGB 3L9YA 1NBZB 1GW6A 1JK9B 1VFMA 1OHQA 3TNNA 3D3VD 5FHAL 2J2ZA 2YPLB 3PF2A 4FQHB 1NAKL 1BYOA 1MCQA 4KI1A 1MWAL 1DDTA 2EIZA 2QDVA 2YXMA 3IS0X 3M86A 4N2FA 1KENH 2PPEA 1FGVH 2BW4A 3GMNA 1CT8A 1XF3A 4IU2A 2OMVB 2B15A 4FNSA 1CXIA 3N1PC 3ZHKA 3ZO0A 4AENA 2DBJA 4DPCX 5IEKB 5IB4B 4XWGL 4X5XB 4YSQA 5T5FL 4MWFA 5F6IC 4M5YH 3DOSB 2EVIA 1LNUB 3MXWL 1MFEH 5FGBA 2CDFA 2NW2B 5GRWA 4JHAL 2EYSA 3MR9A 3OXSA 3QI9C 3BUYB 4MRBA 3CZUB 1BFOB 3OMNB 4JY5H 4QXGH 1D5MB 1FE8H 3FCGA 4GRLD 3WNIA 3ZTJH 4WO4A 3G5XA 5EUKA 1JERA 2NR6A 3KLQA 3UXFA 3GZKA 4B9GA 3ZRFC 1X7TA 4YUEL 1KCWA 2XTJB 2ZYRA 3QAQA 3N41F 4PRPA 1OVZA 4K94L 4BFFA 3SD2A 1EEZB 3GSWA 3DI2B 3W11C 2JIXA 4EUPG 3Q06A 3AQDA 1XTLA 3CXHJ 1UM4L 3ABKB 1MI5A 3MUJA 2APFA 4JKMA 3WNJA 4EEEA 2GJ6E 3FSWA 1MSPA 1HHKA 3HI1A 5CU9A 2LW3A 5EZIL 3ZK0A 3B2DC 3ZSTA 5TE6L 2AQSA 2OL3L 3AU1A 3UEQA 4UNUA 2P5ED 2XIDA 2AQQA 4MVBD 4POZC 5ITFA 3L1FA 3UCRA 1F02I 2YWYA 1NTDA 3VFRA 1PYWA 1L3WA 5JOFA 2OK0H 3PFQA 3IF1B 3MCG1 1RJLA 1NFIB 4X6BA 4MQ7B 5EU7C 3K5SA 5T3XE 5T3XD 5DRWA 5FHBL 3E8UH 1F2XK 4RISL 5FO8A 4F9LA 5HI3C 4LARL 2XV0A 5CGTA 4FN0A 1FPTL 1PGRB 5EO9A 2VH5H 4QRQA 3EH3B 4LDLB 5FGRA 3O11B 1GHFH 2XVKA 4MSWA 4OGXH 4L8DB 4UILH 1HKFA 4P2AA 3NTCH 4M7ZC 4LKXA 4OIBA 1V27A 25C8L 3WFHA 1NAKH 2CDGB 1U3HA 3RRQA 3RFZA 2A38A 2BCMA 4MYWB 3UGUA 3EG9B 5E0FA 5EBLB 4NZJA 2YSSA 3C6LC 1HOCA 3IWUA 4JHWH 1KNOA 3E6FA 4NRYB 4OCWL 5GS3A 4PJXA 4X6CE 1F58L 4XOBA 1P5VA 1ZV2A 2ZCHL 4OI8A 3TBYB 2VSDA 2FIKA 1T6BX 4PN6A 2F8VA 2EXWC 4DEPC 4P4KC 1M56B 2ZWNA 4AZUA 1ZHBB 1P4LB 4V2BA 1D6VH 2CGYA 2VDNL 4RGNC 4KRPD 4RAUA 3VDCA 1PG7W 4WK4B 4I3SL 4ZZFA 5EEUA 1AQDA 2DZEA 2O72A 5BV7C 3CVHL 4IYKA 1TNMA 3E9UA 2DL2A 1X6LA 3BPLB 3PWVA 3TCTA 1G0XA 4DVBB 2IF7A 2WTRA 1R3KA 5F7LB 1Z2KA 1G7MB 4OZFA 1T1WB 2EE0A 4FG0A 4U1KA 3DUUA 4MNGA 1E30A 4FLHA 2CCWA 3HMWH 4Y5YC 2Z35B 1NC2B 1X5FA 3N43B 3UDWA 1EAJA 5B8CB 2YR3A 4QYOB 2HTKC 5C0BB 3MBXL 3ELQA 4IJ3C 3T3ME 4WTZA 4ZO8A 5CJXA 2GY7B 2BVQA 1U95A 1U93B 2XQ0A 3LEXB 4F2MA 3KLAA 2WOBA 3JWOL 4K3EH 1XCTB 4N2EA 4PTTA 5EN2B 1EANA 3TEXA 4GAFB 1HINH 2NZ9D 4PG9A 4JL2A 3ARWA 3AB0B 5DS2A 1I1FB 2FD6L 3H3PH 1J11A 4CC0A 4BZ2L 1BWWA 1WT5C 5CXPA 4WENB 5EEYA 4JJ5B 4R84A 1TJXA 1RP8A 4FJYA 4L8SB 1TUPA 1KB3A 4CILA 4MZ2A 4C56A 4NCC2 3VGFA 3NYKA 4Y5YB 4DQAA 1QLEH 3TT3H 3JYBA 3BQUD 5GGTA 5KSVB 3G08B 1TVBB 2DLIA 5L2JA 3QJFA 3O4OC 1AACA 2AEOA 1WGVA 2UX6A 5IW6B 2VITA 1QYGL 2XTJC 3DO4A 3GSVB 5DQ9B 2QV4A 3WOVA 1E9QB 1KTRL 1CBVL 3LHAA 2ZSWA 3AS1A 3LH9A 4JGUA 4P2QB 3BDBA 3OKKA 1DQDL 2W65A 1BD2E 3E6HB 2OM5A 2YQGA 2BIQA 2VUYA 3B4NA 2I9TB 1NEZA 1VEOA 2E9GA 3PQYB 5TDOB 1L9QA 1JNLH 5IQ7L 1QEXA 2ADFH 1II4E 4RAHA 1CXLA 5HHXH 2DQIL 4Z3JA 5I16A 4A39A 4Y4HC 2NTSP 2YGPA 3C5ZB 4U6YA 3S5ZA 3WIAA 3T2NL 3QIUC 5AAWC 1Z1WA 4ZX5A 1FZOB 2V7HA 2XKNA 5LJYH 5F9WB 4NI6A 1LWHA 4JRWA 3EYUL 2J1ZA 3IYLW 4RX4D 1MFUA 1NICA 2NDGA 1YPZF 4PRAB 4YXKL 4L18A 5EORL 4YDIL 4ORZC 2I7SA 2FWOB 5E2TH 3T3PF 2X42A 1KB9J 4P2YA 3MV7D 4NJ9H 3X13B 1GZPA 5GJTH 1F4XH 4NT6B 3U0PB 4WSKA 2R2CA 5FUOH 4GKNA 1I7TB 1IM3A 4OJAA 3IRPX 1R1CA 4YSCA 1X5IA 2LGNA 2UZIH 1L9NA 3NUKA 3S3PA 5H37A 2QMKA 5E5RB 3T0EA 1RUPL 2AJYL 1TJIH 2Z4TA 4Y4HB 1YY8A 3CUPB 3HC3H 3PL6D 2DS4A 3FQTB 5E03A 2GB2A 4M6AA 4XNXL 2Y7QB 4NNXB 5J13B 2EDJA 3DARA 4MLIA 2ZKHH 3GI9H 4GW1A 4PB0L 3Q13A 1DUYB 2WINA 2C4XA 3RWDA 4DZBB 2X09A 3NA9L 3S37X 4HCRL 4D9RE 5FB8B 1H9DA 2MPVA 5GGRA 1BYNA 4P0DA 2FB4H 3VFSA 1H3VA 2YN3A 1OLZA 1BBJB 5GGUB 5IVZB 3RBGA 1H0DB 5I66A 1OARH 5EIIA 3QUMB 4KUZH 4DF9A 2NXYC 2X87A 3PGDB 4KKAD 1GW0A 1ZLVK 1A3RL 5F7WC 3MLPA 1USQA 4S1QL 4ELKA 2GUOA 1KGCE 1INQB 4YWGL 4HK3N 4MAUL 3TN0D 3BW9B 3Q5OA 5IFHL 1FVCA 5DFVD 3S9DB 2EYRA 2X9WA 3TWCH 3L3GA 1G43A 3MBEA 4G1MB 4K9EL 1ZDQA 2P44B 3UFIA 4GO9A 1FVDB 2PYFB 3N55A 2VAAB 5I0VA 2EYRB 5F7HA 2WLKA 1FVCB 4LLQB 1T5XA 3TIDB 3AT0A 1P84K 3M8OL 1K4DB 5D7SL 5D7JB 1ORQA 2VNCA 3LHPH 3P1VA 3B5HA 1NAMA 3H3KA 5C1MB 4OTXL 1N6QH 1KELH 4OF5A 3QPQD 5CCGE 4PV9B 4G8IA 2ZSVB 5DZ9A 3MUHL 3U4KA 1UXSA 4QRUB 1HQ4B 4OZHF 4UNTA 1IM9A 5DHEA 3WTTA 4L4JA 4K7PH 2CRZA 1OSPH 4NNXA 4N90D 1IC0A 3V4VB 2KZKA 2WANA 3RX5A 2CKBH 4EIGB 3CFDB 4PGCB 4UAOB 2J72A 2VDOH 4LMQI 1U2CA 4NN5B 1W80A 4AYFB 1XGQB 1FO0A 4Q56A 1UM5H 4X7DC 4ZAKD 4OBSA 5KSAA 5J6GA 4QJ4B 4X50A 1KT2A 4B41A 2RA1A 2J4WH 1IGFH 2Y6SD 3WEAA 3ALPA 1MF2H 2NXZB 2X2JA 2ZNXA 4PLKD 3TNMA 2QSTA 1P5UC 4JG1L 1YJDC 3KH3A 1BVLB 4UU9B 4MTMA 1PZUB 1E65A 2FO8A 1ERNA 4YSOA 4OCXL 1G1KA 3O6FA 1CR9L 2ZPKH 2PKDA 4HMEA 4OD2A 2E27H 4GO8A 5LG1A 2YAOA 5LXVA 3QYMA 3M7OA 2BFGA 4PJEA 4BSVA 2QPUA 2EDTA 3C5ZA 1J9TA 1JGLH 4JPIA 2D2CC 3RA7H 4G82A 3PPSA 4O2EA 1S4IA 2IAAC 5EZJB 1A7NL 1TSHA 5B3NA 4MXWH 4YE4L 2QEJA 1GGIL 4PS4L 1E9OA 4KU1A 5ECGA 5JZ7D 4DJMA 2FL5B 4R7VA 4BQBA 2EE3A 1RUAH 1T04B 4LCWB 6CGTA 3SPGA 5D7LA 4P2QA 3EXJA 4X9HA 1NCBH 4GXUM 5AUMA 2N1KA 2NNAB 3LKNA 5IJKC 2X89D 1FO0B 3KGRA 2XTJE 1AC6A 4CGTA 5I18H 4N86A 5JIPA 2RJMA 1GXEA 5JA9A 1J05B 3EOAB 4N6RB 2YFOA 2R9HD 4RMRA 4A6YB 2VAJA 2Z0UA 3NMEA 1MEXL 3A67L 4M1DH 4OQTL 1OIOA 2W9EH 4P3CH 4EI5C 3US9A 5C0JB 3UG4A 1Y0LA 3ARBA 4W4OA 5IQNA 2EIJB 2WUCH 4BE6A 5DUPH 5E2VL 4NGHL 3VXRA 4GKOA 4A2LA 5IG7A 2L7EA 4QRTA 3ARRA 1SF3A 4L9LB 2Z91A 3BPOB 5A40E 5JYLA 3FO0H 2HB0A 1WCBA 1WFJA 4HUVB 1FG2B 2MH4A 3I2CL 4TQ8A 5EORH 4I4WB 3CLEL 3DUSB 4NYLA 2QKIC 2WBJB 5TK2A 3TIDA 3UH8A 1KIQA 4HIXH 1EHXA 5GGSY 1KCVL 3ULUF 1NDTA 3KL3A 1ZS2A 4ZMQA 4PCTA 1XTMA 5LDUA 2B20A 1BQHG 2VMFA 4I88A 3DX2A 1W8NA 2VISB 4JVPA 1A1NA 3STBA 4LCUB 4DK5A 1NCHA 1MFMA 3GKWL 3IMRA 4ZFGH 4RFNB 3DTUB 1EAQA 1CE6B 4ZXBD 3V0WL 1FNHA 4XNYH 3ARSA 1MH5B 3EW3B 3TA3B 3BN9C 3S4SB 1V55B 4QNPF 2Q20A 1FC2D 1GTFA 1TYRA 4MS8C 4ZQKB 3RGVB 4A2EA 2P8MA 1W6LA 1QPKA 1F4WL 5E56A 2L3BA 5GRJL 5D1XC 1LP9E 2NTFA 4DZBA 3LDBC 4HYTB 4P2RD 1VGKB 3BP5A 3L4XA 4GW1B 4LFHG 1BREA 2GFBA 1YEKL 1B4TA 2A6IB 4KNUA 3RZCC 5J8OA 1IC4L 1DJSA 1G9NH 3RVUD 3MRHB 1EXGA 1OAXL 3FZUC 4FMKA 2XPGA 3BLBA 2QHLA 1OPGH 4PG2C 4Y2NA 2Z8RA 3QQ9D 3U36A 1NC2D 1XH3B 5HHQB 5IZ7A 5IFJB 4NSKB 4MNQE 1A7OL 5JR1H 4Y4FD 2VDRL 3LV3A 4PCKA 4R8WL 1Y1UA 2XIIA 3LRSB 2OTUB 1U4FA 2H2SD 2ZE0A 3OZ9L 4JO5A 5ID0B 5BO1H 2JCCA 1J1XL 4ZFZB 1CE1L 3IRCA 4LBEB 4NFBA 4V1DB 3RWHA 1S9WA 2N01B 4UB0H 4LLDB 3VXTA 2DIJA 2E6QA 3KCWA 4LMQE 4R9HA 1PYWB 5G2NA 1ZT7B 1T1XB 2AEPL 3FB8A 2A6DA 4PJGE 4R2GC 1PF3A 1JPTH 4WFGD 4G43B 2HJFB 4J27A 1G7QB 2WKGA 4YL9A 3RAJH 2MSPA 5BRZE 2VCOA 4KTEL 1A3QA 4I3RH 4TOYH 1QR1A 4JFEB 1X5HA 4JBSA 4DN4L 1E67A 1OQXA 2CM6A 4PJHB 4G1EA 2ZSWB 3LNIA 4G8GD 2Y1YA 2X05A 4PGZA 1G7QA 4QAMB 2FCBA 1OM3L 1IGTB 1WDAA 2EJ1A 2QR0B 4CVZA 4HEME 3L17A 2GSGB 1SQMA 4FTVE 2L7QA 3LYRA 5IQMA 1JZ8A 1KLGA 2YEZA 4ETQB 2G5UA 2YMXL 1LE5B 3SKJL 1RPUA 3I75B 1E6OL 1FFNB 5IFAL 1LE9A 3T3PE 3ECWA 6TAAA 1R6VA 2YGOA 2EYSB 3HRZC 3F7YB 4HQQH 2YA0A 1BVKB 2F54D 3QUZD 1C9SA 4DP4X 3LRSA 3TO4D 5I8CA 1QUNB 3ZDXF 4DGIH 2VQ1B 4OFQA 4F2MB 5GS2H 4LOUC 2DQGL 4JQIA 5EZPA 5GHWL 1E3ZA 3QFDB 2P24B 2VKXA 4MBRA 4AT6B 1A47A 1HSBA 1YAIA 2F0CA 4XOCA 3IXAB 4HWZB 1V05A 3KWXA 4F8PA 1EXHA 1ASQA 3S36X 3AG4B 1MVYA 2FJUB 3DJ9A 2HSIA 2V5RA 5CP7B 2K7QA 3DUUB 4HWUA 3ISWA 3BP5B 3GMPB 5LGKA 3LRGA 2IG2L 3AUWB 1E8XA 1LO5A 1UJ3B 2WAHA 1KWKA 2ARJQ 3LS4L 3KDMB 4RFNC 3AMLA 4ODTH 3KL0A 5I19L 1T2QH 3P30L 4XNZB 3T2NH 3U1PA 2ERJC 1K72A 4TULH 2Y06L 4XO3A 4G6MH 4ZO6A 2Q86A 2PPFA 3HC4L 3WELA 1OY3B 3RU8H 2ZKYA 2MQ0A 1P4LA 1UT1A 1I9RH 1CFTA 5E08H 2JCCE 2ZCLL 2FIKB 3TBYA 4EBQL 4RGND 3FCTB 3KYMA 4IKKA 2CQVA 4ODBD 2GBUA 4UDUB 3UAEA 4UQCA 5LN8A 5CN3A 2X4TB 2YAPA 5B7EA 5CLYA 3TH4T 4LCUA 3CGTA 1MCSA 3AXLB 4W4OC 3MLZH 5I6OA 2HRPL 4EI0A 4KDTA 1I7ZA 3MRBA 3FUKA 3UYRH 1A5FH 1N3NB 2BJML 5F7EL 4AXWB 2XZQL 1O7DC 1JI2A 5C0EB 3QS2A 2YPLD 3DROB 3EFDL 4HETA 3DUSA 3UAJC 3JYCA 4LKXB 4XMTA 2A77H 1OSZA 1TYEB 4HUVA 4PV8B 1SOQA 2AVGA 1DBML 1DEDA 1ZVNA 4WTWA 3TV3H 2OZNA 3OX8B 3I9PA 4QDGA 2B2XL 1A3LH 3B8YA 5I1IH 2FD6H 3H3PL 2TAAA 3PP3K 4JMNA 1XF4B 4PLJD 5FUZH 2BOCA 4UBDD 5K9QG 2ID5A 4IDJL 2BWDA 4CN6A 5C0JA 3OSKA 5I2IB 3B7YA 1R9FA 1AFVL 1O9ZA 1KJ3L 2YQ3A 5KBDA 1UQSA 5SWZE 2C1PB 1FZMA 1UURA 1S3RA 3KS0H 3ILEA 4GIOA 1DQLH 3VFPB 1R3JB 5DZNA 3G7TA 5I5JA 5GZOD 2E7BA 3BQUC 1UFGA 1H8LA 4P5TD 3WJLC 4EJ1C 5D70L 4O02B 4MCNA 4QD2E 2ZX6A 4ADGA 1KBKA 5DUMH 2DWSA 5DVMA 5LBVA 4EUPH 3NFNA 1U8JB 4LCWE 4D8PA 2EDBA 1FRGH 2UY7B 4N2AA 2MOVA 4K73A 4U1MB 5BUPA 3FBKA 2ORBH 1TZIA 3B5TA 4KHXL 1R24A 2X1QA 4L4VA 3QZOA 1X7QA 4Z8FH 4M7KH 3BEVB 4LLUA 3BESR 1G7IB 5FKAA 2VDNH 4NC0B 4YNYA 3GHBH 1J5OH 5D1QE 1WC7A 2FLRT 4B5ZA 1EAPA 2IANA 4H5SB 1IAOB 5EZLA 5ES4B 1UA7A 4ZDHB 1SF5A 1MW2A 2XX0A 1KBBA 2E3VA 1W8OA 4F1ZA 1OE3A 4JRXD 2YKKA 2NW2A 2CXKA 3QDGD 4PJBF 4YGVA 4BZ1L 1NDMB 2WXLA 3AM8C 3TH3T 2AV7B 5D72L 3JV6A 4U1IB 3T71A 4DEPB 3IDMA 4ICWA 4J6RL 1XHHA 1IGCH 2VDMH 1UACL 1U92B 3OBAA 4UOW1 2H47C 5KJRH 4P04A 3BKCL 3KPRD 5HDQL 3L3DA 1T21B 5EIQA 2IPUG 3MLXL 4WWPA 5D5MF 4GSDL 5E6IB 1JI1A 3FTGA 1RIUL 1TJMA 1ZVHA 3V5DB 4E0RB 4AV0A 2ED9A 4RISH 3BP6B 2QVIA 2WXNA 5SWQA 5DEZA 4KKPA 3RY5A 3V7MA 3OKLB 1GOFA 3FH8A 1G1YA 4N5UA 4PJ8C 5F1KC 1OAZL 4NQED 4PBDA 5ANME 4HJ0D 2KUTA 4ABVA 4JM4L 3VXUB 1KB5B 3QG7H 5L6YL 4Z3IA 1A4JB 1Z32X 1JUFB 2IPTL 1NAMB 1MJUH 1WJ3A 3HOGA 1IU1A 4PGEA 3AWFA 5CFHA 3T6WA 1PEWA 1AJ7H 4WEUD 4JFFD 2DRUA 1UB6A 3X1GA 1NGPL 1S7UA 1S9XB 1DJGA 3RNKA 2VT0A 1X7SA 3D4CA 1S7TA 2WN2A 2ZTBA 3WS3B 3ZU8A 4C59B 3D52A 1KC5L 3QIUB 4X6DF 4Z7VB 5AYUH 3MBEB 4HF5H 3ARGB 5DFAA 2IWFA 1RIVH 3HHSB 3IWVA 4XVJH 4XPTH 4F9PA 3B6SB 1G7LB 5DMYA 3OZKA 2HFFB 1VGEL 3P30H 4JE0A 3BW9A 3SGEH 1JNJA 4OBRA 3C60B 3QO1A 2BY3A 5HYSA 4Z7QE 4XPBL 2GCYA 4UQ2B 4YXLH 2O93L 4JUSA 5EV7A 4J3BA 2IALA 1Q90A 5C08E 4AQ8A 5EFIA 3T9WA 1HI6B 3DVIA 4MAYC 5F7YC 1BQKA 1U2HA 4AGNA 2VRQA 3GSOA 1BM3L 2I32A 3MU3A 2X2YA 1M05A 3L7EB 3HZ3A 3FAXA 1I8MB 3E7JA 1CICD 3BVNA 1RZJL 5C7ZA 3IMBA 3BPCB 1FZKA 4MD0A 1WFNA 1KBGL 4P3DA 3RZWA 1XH1A 4X4YA 3CUPA 1JD9A 1NLDH 2XWTA 1A21A 2B3RA 2HP4A 1JHLL 2UV3A 3O2VL 4LP4A 4O4YH 5EBWB 5FM5O 3QR2A 3VG9B 3ZMEA 2MCPH 3BO8A 3MBWB 1NCWH 5DDHA 2D9QB 4K3JH 5AW0B 1CI5A 4X99B 3PWNB 3V52L 4PRID 5E4AA 3TC9A 4KTYA 5DT1L 2VXQH 5DCCA 3L5HA 3BWUC 3MGTB 2G4GA 4W9HC 2XYCA 1TENA 4Y4FB 1JZ5A 2DF3A 3CSFA 1BPLB 2ENYA 1I7UA 4N8PA 4WHTA 1MHPH 1WF5A 5CD5C 4OF8A 2Z9TA 1DDHB 1GPOH 1ZHLB 2NY5H 1R46A 3QCVH 4MDJA 2C9PA 2YJLA 1I75A 2Q3AA 3HB3C 3NG5A 3REVB 3BX7C 3NCJL 3INOA 2Z92B 3LKQA 3PQYA 4QI3A 3WNPA 5DURD 5EOQL 3QQDA 5KZCD 3AT9A 1TZAA 3O3UN 1V7MH 4WI3A 5HHOB 2W0KA 5AOMA 3ULVF 2A83B 2NPLX 2W07A 2VERA 1HWWA 1WYJA 4RWHA 3VD4A 2KPWA 4R5XA 5I1DB 2AF2A 3JWNG 4Y2DC 43CAA 4PIBA 4RCAA 3DKHA 4EXKA 4HAKA 5IW6A 1T66C 2VABB 5EULV 3U0TB 4IBLT 4X4YB 4BFIB 5I28A 1AHWB 1GL4B 5EA0H 1Y18B 1F00I 1MNUH 1QFWL 3FU3A 5HSFA 5E6ZA 4Y5YA 1JTOA 2A4CA 2QVKA 4R8WH 4UMGA 1QW8A 3MVSA 2ZOWA 3WFBL 1G6RL 2VJXA 2N1TE 2WXPA 3CN3A 3SJVA 2DOCA 2W0PA 1XZ0A 5KANG 1NCGA 3BVVA 1UOLA 3KCPA 3ZT5A 3IE4A 3FPXA 4JM2D 5H8DA 2WSDA 2B4CL 2K6YA 2YUWA 4Z3GA 4HGWB 2VDQB 4WTQA 1A1MA 4MA8H 1YUHB 2HWZH 2BP5M 3IPBA 2AC0A 2EDOA 1UH2A 3VH8G 3Q5TA 3ZSSA 2XZCL 3VI3B 4WDIB 2EUXA 1BVNP 1NEUA 1TQCB 1XCQB 2F7OA 4PJ5B 5D7HA 3VYNA 1V3KA 2QPFA 4ZFOB 1R3LA 3L3IA 5B7FA 3GUTA 1DLFL 3M1CA 4MMZA 5L7XL 2NY7L 2UUDH 2EXYC 3RNKB 5IY5B 2MIZA 4EMZA 3CSYA 5A16A 4GBXB 5LAXA 5IB1B 5IMLA 1LL1A 4IGBB 3HHRB 4D8OA 2NNCA 3MRCB 4LT7A 3VWKA 3NA4A 3HNSL 3KPSB 1AHMA 5LXGH 3LOWA 4ZFGL 5FUCC 4AEHH 2G0KA 4DP2X 5DWPA 4OF3A 5DD5H 2OULB 2OR7A 2WM0A 1PLGL 2VXVH 4HLZH 1M3JA 4L3CB 4Q74A 2PTTB 4L5FE 5GRVL 1TIUA 1P4BH 4JRYE 4M62H 5E1IA 3H0TB 5EU6E 3RNQB 2QGEA 1CGSL 4Y4KB 5HDLA 2NY5C 5BZWA 3WHE0 3FN3A 4FZ8H 4OZHE 2BNRA 4X5LA 4LVNB 4YK4B 3W39B 2JLLA 4CDHA 3EBIA 5GGTH 2DQJL 2YRLA 5GSVA 5HGAB 1UOKA 4ORGA 7CGTA 4GSXA 1UKQA 3MO1A 2CDGA 3P9WB 5HGBB 4DP0X 1AD9B 5FGCB 3FU7A 3D18A 1BEYL 2A1WH 2BMKB 2DDQH 1RULL 1ADQL 4NM4H 2CJ3A 3FB5A 3LZLA 2NY2B 4OQTH 2UXTA 1A4KA 2BOBA 3ECBA 4HK0B 3E80A 2C7UB 2R1WB 4JM0A 1KIPB 2FZ3A 3BC9A 4PIRF 2EO9A 3HE7A 3EO0A 4UINL 4I85A 4CADB 4EDXA 3GRWA 2P49B 2BNQA 1FAKT 1PZDA 4R7NB 3M1BB 5JOFB 4KGJA 5F9AC 3ZE0F 3VW3H 2RMNA 4LLUB 2YGNA 5MEPB 1LGVA 3I84A 3IDGA 4P2QD 3HB3B 1KTDB 1R75A 5DD6A 3OC5A 4MDIB 1XBDA 1AXTL 5EU4B 4GI8A 4OQ1A 1OWRM 1CTMA 4LCYA 1JYNA 3JTBA 2Y72A 3VTAA 5C09D 3C5JA 4ZXBC 4EN3A 4I18B 1ES0B 3BZFB 3MNDA 3NCYP 3F7RA 1KCSH 5IW1B 4WI0A 4DFIA 1JXFA 4M29A 2ZPKL 1R3HB 3V5KB 1ETB1 1R3JA 2G30A 2W60B 4KAQH 1MF2L 2NSQA 5IK3A 3DPDA 3F64A 3ZKMC 2A2QT 2W9DH 3O6MH 1QATA 2X0UA 4RGOL 4OD3L 3VFOB 4RMBA 3RKDC 4RA0C 1U8PA 4S0SD 3MOAL 4XX1E 2EDLA 1BFOA 1CL7H 4KO9A 4CADA 4OV5A 1RURH 2AGJL 5A3ID 4WW2C 2ITCB 1XF4A 2J8UF 1OAYH 3GMMA 4ZMAT 1ZTXE 2NYKA 3GDCA 3QQ9C 3DXAB 3ULVC 4N2NA 3RX7A 3QNYA 2BMKA 2VZTA 5JDJA 4FQJH 2OMXA 4WWNA 2X40A 3D18B 4H40A 3N91A 3P11L 1X5MA 2DLFL 5EU6A 1BCIA 1XF3B 3G9VA 4IU2B 5IROC 2FTAA 4EQ3A 1FSKB 4NBZB 4OFYD 4OZHA 4HPOL 3S96A 2J2ZB 4X80H 5TH2B 5IB5A 4FHJA 5I73C 4TV3A 3NIDF 5IB3B 4B9FA 2YXFA 3I9GH 4G3YH 4RETB 2K8QA 3D4GA 1ZK9A 3FCTA 5F7UA 1ASPA 1NDGB 1PIGA 3CX5J 2J57A 2V4LA 5EUOB 1U33A 4Q97A 4R2GD 3Q8FA 2NY6C 4HKBB 1IZKA 3GBDA 4URTB 3CFMA 3V0HA 4H8WH 1MW3A 2XKUA 3P9MB 2VR8A 2B1HH 4AYDC 1HEHC 2P5EB 4M93B 3CVCA 1RMFL 2EECA 4EZLA 1S7VB 4U3SA 1UZ6F 3WEXA 4JFUA 2AJUL 1THAA 2JELH 2BNQE 4IGBA 4KRPC 3MRGB 2ZONA 4LSPH 1W91A 4DGYL 4FFWD 2IH8A 3QJZA 3VXSA 4OJCA 5EB9A 2IGFH 2DLTA 2CRMA 3UDWC 4AQZA 4FXGA 3A6OA 1EH9A 4QTIH 3S36L 2H1PL 1BQHB 1P0SE 5ICXA 4ZAKC 5DK2B 1W72A 1P6AB 1XV8A 2OSLA 2Y6SC 3A4FA 3PRZA 3G6JF 2FX9H 2G75B 5JQ6H 4HCRH 3WNOA 2PCFA 3TA4D 2CK2A 2Y5TA 1CLCA 4LLWB 3IFOA 3CZLA 3DXAA 4G2AA 4GJTB 5EU6D 3FCSB 4L2YA 2IGLA 4FCHA 5BW7A 4PJ8D 3U2JA 1BVKA 1RULH 2UX7A 1WZAA 1OGAB 3QDMA 2EABA 3L95A 1UD6A 4TQPA 3P3TA 4XMUA 4QXUL 5B1AB 1JPFB 4F91B 3FUIA 4UQEA 5TF0A 4OCNC 3L3JA 1ZIBA 4V1DD 4AYSA 4BFIA 1I3RA 5IBLD 1VCAA 3NZUA 1PG7H 1B2YA 3ZKXB 1SXSA 1R3HA 4CKQA 5FO2A 4NUGL 3SB3A 4BFGA 3QB7C 4XH2B 3V0VB 4NI3A 3IJSA 2JKWA 5D2NA 1OF0A 5HPMA 5E2UH 3DYOA 5LLIC 2ZP8A 1W0WA 2FJGA 4JPWH 3FUMA 4XAKD 4LNVA 3GBEA 2HJFA 3ZZ1A 1KZQA 5A2CA 2EVFA 3F58H 3EYQC 2A6DB 4K7PY 2WMPB 4ODXA 1P6FA 1VCBC 1J18A 5DWUH 5FA4B 3T0WA 3ECVA 4MASA 4CA4A 3ZQ9A 2X7LB 4IRJB 3V0AC 1NL0L 3QNXB 2WTOA 2H5UA 3U6RB 1RHFA 4OVUA 1YDPA 3QIUD 2FH6A 1AQMA 2C7UA 2R1WA 4ZW7A 3ZBMA 1QRNA 2VLRD 3FQUB 4XVUC 3MGTA 1WHOA 4FADA 3CCHB 3PWNA 3PP4H 3H9SA 1C7SA 1XX9C 1ZJBA 2BC4A 3IFPB 2EO7A 5KS9A 1GVIA 1FYTB 1KLFA 4R0LC 5J11B 2BIMA 4PRBB 1X5GA 3UPAA 1URZA 3HLKA 3W39A 3RVWC 2P26A 1IGCL 2P28B 1T2JA 2VDML 3WFBH 4E41E 2GFBB 1ETZB 1JPSH 3I50L 4NHUB 2E7CA 4H44C 1QFWH 4H1LB 3S37H 1FL5B 3IGFA 3L8QA 4HKZB 3F00A 4M8UA 1X5LA 2J1XA 1R0AL 3OJDA 3TONA 2C9XA 3MODH 3RGVA 1EHNA 1YQVL 5KTEH 5JPMC 1T0NB 4BUHA 3CSTA 2MHAA 2FLMA 4PM1A 4G6FD 4R26H 2J44A 3GGWB 4LP8A 3Q7JA 1JXGA 3QDME 5FCUL 4XP5H 2WYTA 3ARTA 5AVSB 3UP1A 1QNZH 3BH9B 5B1JC 1JZDC 2BSRA 4FD0A 3CH1A 2Z65C 5IOKA 4JFZH 2Q7YA 2A4ZA 1OAUL 1MFDL 1U9KA 3MRQA 2ADIA 1JHKH 2IWEA 3P0GB 4PS8A 1V54B 3DURA 4MA3A 1I9IL 3PWPD 2ZOLB 3QJOA 1ZSDB 4FXGC 3SGEI 4GUPB 4L4VD 4Z7AA 1KXTB 1S9XA 3O3AA 4PJ5A 4D0BA 4ERSL 1UB6B 4PPTA 1F3JB 2ALWA 2DI7A 4F37K 4OCWH 3S3DB 1LP9B 3B9KA 2BDNL 3GFUA 1TQBB 2XKSA 3F6JA 2CHZA 3ME0A 3SDDC 1ZVSB 1CLZL 1EMTL 2BWQA 2EXWD 4YZFE 4X6FB 3DX6A 2YPKB 4O58L 5EOCJ 2PNDA 5K9JH 3MJ8A 4L9LA 5L9DH 3UZEA 2CKBA 3P4NA 4JM2C 4Y2DB 3IKCA 4H8UA 3VXRB 2NCEA 3FS9A 1T7WA 3NSDA 3KYOA 4IS6A 2FATH 3IBEA 5C9JB 4ZUWB 4O4YL 3NIDB 3V5DA 4YR6B 4P4RA 4NCC1 2IBZX 4EIBA 5E6IC 4HUMB 5T33H 2IQ9L 3U4BH 2CBMA 3P3YA 2ZUQB 2A74A 3IFLL 5CZKA 1JHTB 4QRRA 2XY1A 1OCWH 1U92A 3LKNB 2CIIB 1EEQA 4KHTH 1T7XA 4TUKL 1N59A 3BZ4B 4J4PC 5DJ8B 5JXEC 1MAKA 1KEMH 3V4PL 4ANKA 5CKGA 5JIQA 2HJKB 2Y7LA 4Q9QL 5D6CA 4YDLB 4YGVB 2OK0L 3CSGA 5F88A 1IARB 1CFNA 3C5ZD 3G6DL 3MGAA 2VLRE 2V5TA 1NBVL 1JV5A 1CD1A 4DUWA 1GGUA 4PG2A 3GSNA 1RK0B 4J3WA 1TQWA 1JRHH 4NQEE 1R47A 2RHEA 2FWLB 3RU8L 1UWFA 4CBZA 1T22B 3NABL 4K8RC 4CC4C 2QADD 4PD4K 1VPOL 2JIXD 3ROLB 2VRAA 4IHBA 1ID5I 3G6JA 3QFJB 4OM1H 3CVDA 1RK7A 1UT2A 4PJCA 5BZXA 3ZTNL 3KVPA 1N0LA 2Y7NA 4P2OA 3BYYA 5SWSD 3MA7A 1UEYA 1KEML 4IBWA 4K3GA 1D7FA 32C2B 5ABAA 1OGTB 1SUHA 1E4XL 2AI0L 1U36A 3CFDA 3VFPA 3WN6A 4JZJC 4QPEA 4O2FA 1B9KA 3LQAL 4HBCH 5PCYA 2X41A 4F9PC 3CX5K 3BVUA 4OLXH 2J71A 2Z31C 1CIUA 5J06A 3MXWH 3QDMD 2YUZA 2R56L 3NT0A 3MJ7A 5BVJB 5BCAA 1TNNA 1BWMA 3HN3A 5I1KL 4C4BA 1HQRB 3EHBB 2FATL 3EGXB 1DSFL 1P53A 2HLFD 2HH0H 1IKOP 2Z7UA 2APWA 1USZA 1LK3H 3BRGC 1PAMA 1XGYL 3MRRA 2ODHA 4PV8A 3SGKA 3HN5A 1SHSA 3A4AA 3UEZA 5E99H 1K5NA 1W0VA 3NESA 3DROA 1EBAA 5ICZA 4KKBC 1Z9MA 3B6SA 2HTLC 5HYSG 4AX3A 5EF1A 1WLHA 4NKQB 3T4YB 4F3FA 2LTQB 1PSKL 4QWWC 4LGRB 2VLLB 3CDGB 2EUWA 4PBXA 3AXLA 4BGLA 2NNXA 4HC1A 3LCYA 2AQ3A 4DFHA 5KN5B 5I8OL 3WN5B 2M1KA 4NQXA 3T2OA 1XEDA 3Q43A 1OALA 4MS8D 2MCMA 5B39A 5C2BL 3MSPA 2D7QA 1NKOA 3ULVL 2JV6A 3IFNH 1A4JA 4FNLL 3FYEB 2B3IA 3WIHH 5GGUA 2YUXA 4HJGB 5IVZA 1SFHA 4QKTA 3WV0A 3RZCD 4DKDC 1GYVA 1MJ7L 3MODL 3OKLA 4P5MB 5FIEA 1D5BA 2BLFA 4BH7A 3ZTDC 3BP6A 3KZ8A 2M2DA 3G5ZB 1YMMA 1N2RB 2UWEB 5F1SA 1Y6MR 2YGVA 3MCKB 4XMVA 5SX4I 1E4KC 4JPVL 4WUUB 3T8XA 4OLYH 3KW7A 1AFVH 2VXSL 5L8JB 3ULAB 1GY1A 4UAOC 5TQ0L 4PJGF 2P24A 5F9JA 2NNRA 2H1PH 4PWFA 5EPMB 5I26A 1RHHA 3ZE1F 1QBLH 1QFWM 2ALAA 4NKOA 4AL8L 4BQCA 4EUPB 4WFEE 2PTUA 3ZE1B 4FG4A 4YDKL 5FW6A 1U8CA 1AZRA 4KH9A 3HHMA 2WLLA 4XAKE 4HOZA 4GSRA 5ALCL 1TPXB 5D8JH 4AZ8A 1MCWM 2VWEE 3QDGA 4QXWA 1NFDB 1Z3GL 2J3SA 1JOIA 2E46A 5DD1H 2QPSA 1SMAA 3II2A 1LE5A 2CMRH 3U9PH 4U6YB 1MCWW 2PPCA 1BMZA 1J5IA 4G72B 1YUKB 1BZEA 4XCEB 2X0WA 2DQUL 4KXBA 2HRHA 4ZMPA 4LKCB 5EEVA 5ILTH 1NEZB 2W0LA 3CBKB 4GRWE 1AYOA 4PY7A 2JKTM 2ZKXA 3H56A 3QORB 5C6WH 1WFMA 2ENJA 4HV8B 1OB0A 1AE6H 2ATPA 2MOQA 1D2OA 5JLZB 3TZVC 3IKKA 4NWUH 4WU5A 3BFQG 3OG4B 3KR3H 4KY1H 5I1GH 1N9PA 1RZGB 5DMIH 1KN4H 4KOBA 3HNTH 4X8CA 2OZ4H 3OZLA 3PWUA 4XX5A 1DBJL 3HCVA 1HDMB 3PUCA 1UH3A 3HLAB 4FXKB 3HE7D 1KEGL 3THML 1JAEA 2K9UA 1CN4A 4AG4L 1P2CB 3HS0B 5DJ0B 3BMVA 1K8IA 1OAYL 4NQCA 1MFAL 2D7OA 4MJ2A 4DKEL 4CVXA 2BOCB 1GAFH 2OTUA 3WXWH 1HC1A 1WAAA 2W92A 5DUPL 5E2VH 5I6XC 1MHHB 3UC2A 3DYMA 1TVHA 4OI7A 5EU3B 5GHWH 5D7LE 4XNAA 5ESQB 1U95B 4PJ6A 5C6TL 5KSBE 4M7JH 4Z95H 3AAZA 4CJ1A 2WCGA 3W2DH 3ARBD 5IT2H 2Z64C 2B9AA 4ZTEA 3SDCA 1WWBX 5C0BA 2AXFA 1PAZA 2C8NA 4FLQA 3VD5A 3VXMB 2BPBA 3FQRB 4R7XA 4AE0A 1FL3A 3S36H 1AVAA 4ZYKB 3DHPA 3M88A 4MGXA 1J8HE 2UZXA 5KANI 4UT7H 2CRYA 2HUHA 4QF1B 5CMAB 2X4TA 4OAWA 1FBIL 5T1KB 3FUJA 3HG1E 1ZPLA 1TF4A 1H6EA 3T04D 4UOJA 4XGZA 1JGDB 4JGNA 1NM4A 4AUJA 3VVVA 2R39A 1X5KA 3TA3A 2WWKO 2BFVL 1RFDH 4X5QA 3SE8H 5IBUG 1D7DA 1JJUA 2F61A 4JFHD 1FC1A 2YOAA 5DZLA 3W2DL 5C0FB 5CMAA 4M5TA 5KW9H 4QHMB 4B5EA 3F7VA 4O5LL 1JVLA 4M7JL 2BSBA 4LL9A 5I1HL 4Y4KC 1XGPB 3I9GL 3GJFK 4NPYA 2BM3A 5I1AB 3TURA 3O3BB 2OMWB 3QULB 4HWZA 3IU3A 2IPUK 1KFGA 2I24N 3W5NA 1OK0A 2CGRL 3L9RB 5DYOB 5C0DB 5IHBA 1G5GA 2WO4A 4FQXB 2AMGA 4OZIE 1ZLSH 1BFVH 2CJUL 4GQ9H 1HSAB 4L8DA 4P2QE 5DHMC 1BBDL 3T0BA 1TOXA 2YAEA 5EO9B 4HKJB 2GIXA 3RIFK 4WNJA 3IU4H 4WNQA 3LKSA 4GXVH 1FFTB 5AZUA 4LSUH 5DRWB 1TU2B 3K6NA 2VXVL 4FL4C 3N2JA 1MCKA 5DD5L 3ROOB 1JGUL 1MFNA 3QWRA 2RB8A 3H9ZA 3HLAA 1KLGB 2YEZB 3CFJA 5DQJA 5T3ZH 1WK0A 4FLRA 1QP1A 2KZWA 1G6RB 1YEKH 2EYTB 2MJWA 4R2GB 4M9PA 3SYCA 1J1PL 2QR0A 1ZT4B 2YKLL 1QLRB 3PIQB 5CD3B 5F3HB 5FYKU 4YSAA 4GSQA 3FHEA 1N0XH 5EZOH 5KSBA 3RE0A 4MS6A 1JN6B 1DQMH 4KZDH 1T04A 5GRVK 1AS8A 4XCNB 1QR1B 4NZRL 3ZE2E 4P2OD 1FL6A 2HLAB 3QWOA 1L5GB 1EZLA 3K8LA 5MEOB 1A4CA 4HU2A 1JGEA 4O2EB 2EC9U 5DFTA 4PGBB 1M7UA 4MQSB 4F7TB 5AG8A 3EKCA 5ALCH 3L3HA 4NJAL 1XGZA 1NA8A 4QHNA 3HG1A 3O6FB 4HWNA 5D7EA 2HMIC 1UVQB 4YH6A 3L4ZA 1I3VA 5BRPA 4P23A 5E8DL 3EH5B 1IAKA 4QHLA 2CDFB 4YLCA 5C2UB 2A9NH 2LT9A 1KWGA 4LVOB 4AENB 2GTWB 3GM0A 4MJJA 3D9AL 5TQ2H 2R1YB 4JPVH 1CT8B 3MLWL 2OTPA 4CMMB 1AGDA 4MAZA 4M7ZB 2XI9A 4JQXA 4ABUA 1S7RA 4HW6A 2XZAH 4OW6A 3BAXA 2G2RB 2WWMD 4RWYH 3QUYA 5A2FA 2Y36L 1YECH 2VOTA 4DH2A 3KEHA 5I73B 3MX0B 3MNWA 4U4IA 1UXSB 2AEIT 3QO0A 4PHZA 5CIPH 3HFMH 1SEQL 4MNQA 4JHUA 2P8MB 4PLKC 4CW1A 5A3IC 3L4YA 1NINA 4TLSA 4DPRA 3BD3A 3DV6B 1JZHA 3W3BA 2JI2A 5CLWA 1EUUA 1M7DA 1MRFL 2WIIA 4HZAA 4AKOA 3CFBA 4AEIH 1FNEB 3Q2NA 5HY9B 4LSRL 3L3OC 1JYVA 3GXTA 5KVEH 1AD0A 3PPEA 5TGBA 5GGQH 4OFYA 4Z1PA 2VISA 3OB8A 1FVDA 1OP3H 3CDGA 4KPHH 4KDTC 1OB1A 3W5MA 5E8EA 3CZSA 4K3JL 3NQIA 1A9BA 3HG4A 4C8XA 1DQQA 1SMDA 3P73B 2ZOKA 1QOKA 5KWYC 1W0VB 3BGMB 4CSSA 3CFBB 1I9EA 2WIIB 1A6AA 2VN6A 4JFDB 4XN2A 1TJGH 2W81C 2LLLA 4CL7A 2OMTB 3MRRB 3NJJA 1YEHH 5GGVL 5I66B 2B1AH 2KQMA 4Q4IA 3PS6A 3T5WA 5KEZA 1J5CA 5GS1C 3SDDD 3ZHNA 4EVNA 1NIEA 5GGRB 2E7MA 4RQQB 1N18A 1UWYA 4P49A 1XCXA 1HIMH 3NIFB 1SJHA 3CFNA 1R3IL 3APCA 2CKBL 3QUYB 4ACPA 2G2RA 4OGAC 3HZVA 4HALA 4L3AA 1L6ZA 5E1HB 4Y19B 3ZUCA 4N6RA 2DWYA 3HS8A 3EHBC 4WJKB 4F7PA 5FLUA 3UTPD 4AWJC 3SYAA 2HVJB 3KPRE 4N8VA 5DF0A 3BT2H 3VRIB 1N0LB 4I5BA 4P2OB 2YAQA 5D7LB 3S98A 3VM7A 1EEYA 1YEDA 2WVUA 4D3CH 5JPMB 2I25N 4MJIB 1CLYL 1WTGT 3H42L 2NY1B 3FU9A 1H5BB 3G6JB 2QFPA 3MV8B 4DKAA 4UV4H 4XCYB 2CHXA 5CD5D 2CDEB 3U0WH 2KC0A 4N1EA 3PWLA 2B08A 2AABL 3OLDA 2PPAA 1F4YL 1IBFA 1FZOA 3ARGD 5BVPH 1AQ8A 3B9AA 3LIZL 2IPTH 3O9WA 1MFCL 4GAYA 5SWZA 1ED3A 4CVWA 2HFEB 2YO3A 2VZSA 3E9TA 4OD2B 2CUAA 4ZW8A 3GSNB 1P7QB 3MMEB 2JTYA 1MVFA 3DETC 3D2TA 5D1ZC 5ICYA 1L5GA 5HHME 3TWCL 2EDMA 2X6AA 3CZFB 3H4HA 4R4NC 3UIYA 4G6AC 3O6LL 4WI6A 1NCCH 2CJTA 5JW4R 2DW5A 4AQ8C 4WEMB 1U4EA 3FT3A 2WLZA 4M9OA 3GBNH 2OMYA 1IGML 4GRWB 2GI7A 2JJSC 3E6HA 3NJGA 2WY3B 4AV4A 4OUOA 5IROD 5KSBB 3BZ4A 4FA6A 5KSAB 4TVPH 4M3HA 3V7AE 4KNQA 5A2KH 4H88L 3N44B 4FQQA 1OAQL 3EJJX 4N3UA 3VFTB 3P0YL 4TRPH 5DQJB 3Q2VA 2X3AA 2WYIA 4PY8I 4BZ2A 3HE6B 1IFHL 4RBPK 1CQYA 2WVVB 4C56B 2OJ1A 3QDJE 3FU8A 5E5LA 4ZNEA 1HQ4A 5D5ME 1Q9LA 4L1BA 3DBSA 5FM5M 4E41D 3FT4B 4FX5A 2KH2B 5DUJA 5DXWA 1Q9OB 4A1RA 1ZA6A 3LKSB 1SDAB 2CKBB 3P4NB 3QUHA 5C86A 3E8UL 1U8MB 3EJZD 4HT1H 1Q0EA 4MCYB 3WDJA 3DGCR 3FTUA 5E8PA 2LLGA 4AIXA 4M43L 3NEEA 1KXVA 5T1LA 4BKLB 1K4DA 5FS5A 5GJTL 1VEPA 3BFWA 5E2WL 3AG1B 5MEQA 4G6JL 2OJZH 1JK8A 4RZKA 3HAEG 4WKZB 4XAWH 1HZHH 1RY7B 1KBVA 3LD8B 4QYOA 1VGEH 2VAAA 4DUXA 5HBBA 5TJWK 1RIVL 1ZSDA 2PYEB 4OB5L 4XO8A 1R19A 3W82A 1EV2E 5MEND 5C0FA 2J5LB 3QFJD 2AEQL 3D51A 4X0NA 4GMSH 4XZ4A 2DQIH 1RZ7L 1VKXB 1CLVA 1UCBH 3W11D 4TLUA 3W37A 2K8MA 2X9XA 1ZLVH 5ACZA 1H3UA 1MY5A 3B3IA 1N64L 1WWCA 2OX5B 2A9BA 2A7BA 1SM3H 2A9MH 2BP0A 5JXAL 3QQ4A 4QRPE 3TX4A 1FE8L 2CO7A 3D39B 2J88H 1NOLA 2GK0B 3VQ2C 3TCLA 3CAFA 4N5EC 5CUSH 5T1KA 2CUHA 4NM8L 1UA6H 1KNOB 4NRYA 3FQ2A 4RGMB 4UDTB 1G7JA 1E3FA 2Z0BA 3FDWA 1FVEA 4EN2A 5AKRA 4ZYKA 2DMGA 4HS6B 2RQ8A 5T3ZD 4XPFH 5JO5B 4Y4HA 3PP4L 2P47B 2X4QB 1ADQA 4CSPA 1RZ8B 4AZ8B 1D5ZA 4FKKA 3BAEL 5F7EH 4ETYA 3DVNB 1B90A 3K6SB 1SM3L 4MMXC 3UTZA 1FLRL 2BRQA 1JG9A 1S5IL 4XXDB 1OQOA 2VXUH 4MMXA 1GZPB 4AMXA 3ILPA 4G7VL 1OE2A 1UCBL 4XMWA 1UD2A 3CIAA 4GIPD 1NIBA 2VLME 4UNVA 4XMXA 1RV6X 4B7LA 1PZCA 1RK1B 3QDJA 2CD0A 4OH2A 4V1DE 1IUZA 4MJ6B 3HC4H 4YSDA 1A14L 1AYRA 4KK6C 3L6FA 3EJZC 1KTLB 2RFXB 3FU0A 5D7IE 1XR9B 3UTTA 3D25B 5E2UL 5F7KC 4RRPG 4HLEA 3U79A 4GG6B 5IJKA 2LQRA 3K72A 1E28A 4NUGH 1T2XA 3U83A 4E5XG 5IEHB 1A6UL 1TTUA 4LLYB 3VXPA 3FQ1A 4PREA 1AKJD 5AVZB 3UAJA 2R1XA 1MAMH 2DQMA 5E8NB 3K4ZA 1IKFH 3NIGB 1L0QA 4FA7B 3BUIA 5HYJE 1K3ZA 2Z6FA 1IFRA 1TVBA 2EDHA 3D0VA 3LPFA 4NUJA 1CG9A 1QFHA 5DGRA 1SYSB 3GSRB 5J0BA 2VR3A 3TBWB 4XP1H 5D93B 3UYOD 4GQRA 2V7NB 3HIZA 4M3JA 5J6SA 4FZEL 1R5IB 5CP3H 4IDJH 4NAMA 1FORL 4JFYA 1CGWA 3L08A 3RDTA 2D3VA 5E8DH 1R4XA 3NTCL 3WFDH 5BV7H 2J6EL 2OSYA 4LRIC 2DN7A 4QTIL 5K33A 2R2HB 2C7FA 2UY6A 3DHUA 3GMNB 4N2DA 5GZNA 4Z9KB 5ICXB 2R8SL 4OU3A 4IRSD 4RFOL 4GXFA 4KY2A 2UVEA 4K07A 4YJZL 5B8CA 1IL1B 2NR6C 4JRXA 2FR4A 3ARDD 5HVWA 5FM4A 4HJIA 4LOFA 3MYJB 3C6LA 3L13A 2EE6A 2HRPH 2EDNA 4H8VA 2NY6D 4NZRH 1KGWA 3KEDA 4HHAA 5LGHL 2AABH 3CJJA 3CQQA 2H2SC 1LDPL 2CG9X 5E08L 2DM2A 4EAEA 4UB0L 4KI5C 1CE1H 1GYUA 1OTUC 3EO1B 3VMPA 3R06A 1Z6JT 5I74C 4TLTA 5TDPA 2EIBA 2BSSA 1P5VB 4OGYL 2WXQA 3CZKA 4JO3H 3BKYL 5SV3A 4ZX6A 4FQJL 4YUEH 3K6OA 5F93C 2XWEA 4ZFFA 2QTEA 5E0QA 2ZX7A 3U1SL 3K8MA 1SYVA 2F19H 4XCFH 1TT6A 1FJ1B 2JMRA 2AJ3A 2M83A 4HG4J 5ICZB 5JHMA 2X3CA 15C8L 3JWNE 5F9OL 3QJTB 1WQVT 4WAFA 2XWZA 4GFTB 4P5TA 5GGVH 2YC1B 1H15B 3SEPA 3HUJF 4YSRA 2QSCL 4QRQB 5E5MA 2NY4D 1CL7L 5C3LD 4O2CA 1G1OA 4KAQL 1EXUA 1XDTT 3CDCA 5EBMA 3SPHA 1U8KA 2Y2WA 4Y9BA 3OJ2C 3TTYA 4DETA 4O5LH 2NX5A 2C4FT 3EDFA 1NFIA 3B37A 1J9RA 1OW0C 4JDEB 2GYSA 4XBGA 4UQ9A 5DJAA 1GKOA 4AEEA 3MREA 1NL0H 4ZBJA 4R97C 3SJVE 4WFGE 3SKNB 2GAZA 1IGIH 1YN6B 2HVBA 2XPZA 1PG7X 5FEBA 3ABZA 3DTXB 4MQTB 4J3OH 4OUUA 1QWNA 1L9RA 4G8EB 3R4DA 3D07A 5IW1A 4EF3A 4GMTL 3FONB 4Q6IA 5C3TA 5I1LB 3U2SB 5I8EA 3T3MB 3BN3B 1FBIH 2CWRA 4OZ4A 3IBOA 5F1NA 2ENPA 3RIKA 3PAYA 3O8XD 1SEQH 2AVFA 3E8VA 5D7IB 5JUEH 3O2DL 4YFEA 4P57A 1HHIB 3CFTA 1UB5B 2I9LB 5ETUB 1WFTA 2BSCA 1OK8A 1JMXA 1NZRA 5I76B 1RKRA 3FO0L 1EAOA 3BH8A 4F80A 4I3GA 3D85B 4LEOB 3L4WA 3HN8A 3ULUC 1IE4A 4Z76B 3HE7B 3BWAB 3BSZA 2NY0C 3DRQB 3M17A 1E2VA 1BSIA 3K6IA 1NM9A 5DTFA 2WUCL 1A6ZA 5CAYB 1KB5L 3CH8A 2DM4A 4HPHA 5LUMA 2HMID 3SDAC 3VSVA 2K3HA 5EEZA 3MA9H 4P2RE 5IEKA 2AAVA 2DQJH 4KQ3H 1AD9A 3A24A 1YJDL 1DO6A 2OMVA 1J12A 2I85A 4H4NA 4N9GA 4YHPB 2EH8L 1MI5E 2A0LD 2HFGL 1FSKC 1C08B 3EH2A 3ARDB 5JW4M 2EIZB 4MFHA 4KK5C 4NZTH 5BMFH 1ACYH 4Z7OB 1PZ5B 4GEJA 1XSKA 1DJXA 3VH8B 3MPCA 2ADYA 3FFCE 1FIGL 3V0DA 4EOWL 4PVBA 1RJYA 3EJYD 1M7IA 4EPSA 2ENSA 2XQYG 5F96L 4CRPA 2H3KA 1SXNA 3HE7C 3HNSH 3HZKB 2D03L 4HD9A 4M5ZL 4K2UL 3V4VL 2CK0L 1TZ8A 2IBZY 1FF5A 3ZDYF 2WKLA 2QDWA 4HA1A 3MLUL 1E43A 4P59H 1DJYA 4F57L 1NOFA 3N9GH 2BS71 3EZ8A 5FYKL 5F6HI 3UC0L 4RFEB 1TETH 3OGOE 4LDCA 4I9WE 3V95A 3ARBC 2AP2A 5IMMB 5DJCB 4DIXA 1I31A 1N0XL 3FTZA 1CYGA 1YNKH 1AZCA 4OIIL 1CS6A 2HKHL 3N43F 4OVVA 2R83A 1ZTXH 3A4DA 2XZCH 3KG5A 3F62A 2XN9E 3QQ3A 1IB5A 4RMTA 4K5MA 3EOYG 2H41A 4YHKH 2HWZL 1DJZA 2BO0A 5KVFH 3TASA 2LLNA 2ZF8A 3F04A 5AW2B 3B83A 4XVTH 5E7BA 3K8KA 1T7YA 4G80B 2AXWA 3FB7A 3VFUB 3K81A 5B3JF 4HGWA 4ZXBB 1MNUL 4ICXA 1ZLSL 3KPSD 3NSFA 1FNSH 3VFWB 4ODUA 3BPNB 4UQBA 2QGDA 4ILDA 2F53D 3HZKA 1S7SA 3QUML 1CGYA 4YAQB 4LBAA 3DX7A 1MCIA 1W0YT 2DAVA 3DVGA 3QT2A 2DKMA 3PNRB 3WS6A 1IEAB 3DPBB 3BIKA 3L5WA 3VRJA 3VH8A 2ZXWB 5D1ZB 5GS0L 3QI9A 1FUNA 2C4FU 2ZUUA 3M8OH 3QEHA 2H7WA 3L2LA 4QAWA 3IK2A 4PJ5E 5I1HH 5DC4B 3PDDA 4P2RA 1EIBA 4LPWA 2A83A 2ZJSH 5M94B 2VM9A 4LLVA 1KB9K 3GKZA 3O3DB 1RUAL 4OKVA 1VLXA 1VENA 4IBZA 5DTFB 1NAMH 1T4KB 1W6WA 3CBJB 3PGCA 3DRQA 3ZDZF 3T4AA 3D69A 4Y9EA 3CU1A 5CILH 2XZZA 3UAFA 4MXWL 3QWNA 4Z77A 3U6RA 2CBQA 2YAHA 1WRFA 3GMRB 1E5CA 2LAGB 2N0KA 4L4TA 3DK2A 2X7LA 4IRJA 4WHTB 2FJFA 5AYTA 3T4AB 3WY3A 1TG8A 3WSQL 1XGYH 3N1FC 5K9KB 3DV4A 1ZJAA 4OKVB 2Z34A 3SDAB 1W0WB 2FJGB 4LOEA 1QSVA 2ICEB 2O5NA 4HIIB 4NUPA 3FOMA 4X7CC 2VL4A 3BDXA 3RP1A 4N0FA 2Y1AA 1GC1H 4AJWA 1V5JA 1KTBA 2PPDA 5BZZA 4C58B 4HBQA 1YA5A 3G6AA 4KFZC 3N41B 4KROD 1KBGH 1MVUB 1NJ9A 4AH2A 1PTZA 4JFED 2X4SA 3SE4A 4ZUVA 2YA1A 3DMMA 1EJ8A 1XWVA 4L48A 2N7AA 3DTXA 4W93A 3CDZB 1AKJB 1FHNA 3V4PB 1A66A 1YEFL 2DQDL 2XA3A 3KWTA 3L5WB 3MREB 2CA3A 5JW3H 3MRLA 2IOMA 3MI6A 4NRZA 1DBJH 2VR5A 3FXIC 4N4YB 4YHNA 2D2OA 4FFZL 2FVNA 2YD5A 5ABZA 5CJOH 2PTVA 5D6DC 2GKIA 3AUVA 5MI0C 2NY4B 4XNQB 3MHZA 1URIA 3Q01A 5C97A 4LCCC 1QQDB 2K9FB 1ZE3C 4BFJA 2PO6B 1SDYA 3C5XA 4ZOAA 3Q05A 4JKPL 5FO7A 4I9WD 2QVTA 4MNHB 1VZGA 3GZOA 3QJHA 1KC5H 4YC2C 3VE0A 2AW2A 4Y1SA 1AGBB 4HC1L 1AXIB 4A6YH 5L88H 1IILE 1A6VL 4NRXA 1I1YA 4QOKD 3WS3A 1JZFA 2MQ3A 2X44D 3EYOA 1VFOA 3FTYA 4S11A 3WLBA 3MUY1 3APDA 1HYSC 2GABA 5E6YA 1T7ZA 4TNFA 4UUJA 2W94A 1LWJA 2DWDB 1WA1X 3QG7L 5L6YH 5J57B 4MAYA 4ENED 5FK9B 4YDKH 5E2JA 3S88H 5JW4Q 1QPPA 4RAVA 4ZMVA 3KDPB 3QIBC 4S1QH 4U6HA 3VXRD 1B0GA 3V6ZA 1OT1A 1I1AB 4JFQA 2N4IA 1U8LB 6FABL 4KUZL 5H35B 3CVHB 4G7RB 1AOZA 4ZTOL 3OTTA 3PDGA 1OP9A 1TXKA 5FYKD 1C5CH 2KKQA 1SY6L 1WUZA 3MV7E 3MXVL 1J8HB 3GF8A 4AEFA 5JZ7C 1BAWA 5KYNA