5I8KH

Hhh1 fab fragment
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
218
Chain Sequence
EQLVESGGGLVTPGGTLTLTCTASGFTISNYHMSWVRQAPGKGLEWIGFIDTGGSAAYAPWAKGRFTISRTSTTVALKITSPTTEDTATYFCARGAPAWGTANVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDRRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HHH1 Fab Light chain
publication title HHH1 Fab fragment
rcsb
source organism Homo sapiens
total genus 40
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8kH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8kH01
3WYRA 5E8EB 1A3QA 1MF2H 3HMXH 1P7KB 2IBZY 5HYFA 2BVTA 5I75B 1TXKA 2X42A 4IS6B 5DJXA 1MCSA 5MEND 1C8PA 2GJJA 2Z8WC 1VGKA 5F7UA 3UTQA 8FABA 1LE5B 1KOAA 1KCRH 3BP5A 1UEMA 1GJIA 1TLKA 4EKXA 3OKLA 3P77A 1NCCH 1JZ5A 3D1MC 5IK3B 5D72H 3HNVL 4NQDB 5D1XB 1G7MA 1FLTX 1OLZA 1JHKL 3WJJC 1T83C 4B53A 4MQTB 5KSBA 3OKNA 1Y0LB 4KKBC 3DYMA 3HNSL 4NO0B 1UADC 4LPYA 1FCGA 2VL5B 3U36A 4D94A 5CD5D 1A4KB 4H26A 4S1SL 1YYML 4PR5B 5TDOA 3F58H 4JPKH 4KJQD 4OV5A 4DAGH 4M61A 4LKXB 2P5EB 2BVOB 3DVNA 4J4PD 4OIAA 2FX8L 2GUOA 1H3PH 4YO0B 3ARFD 2ICCA 4RFEB 5I75C 4HS6B 3H8NA 3NACH 1AFVL 4MJID 2F54D 2HFGL 3G5XB 1DN0A 4Y1AB 5H8DA 3GMNA 4MD5B 1B0RA 2XWJB 3MLTB 3U79A 4OIBA 4KJPC 2HVKA 3ILPA 1AXSB 1QFWH 4F9LC 1JZ8A 3IFLL 1X5YA 1MCKA 4PJ7B 5D1XC 5IEKB 4AIXA 5F89B 4XBEL 1FE8L 3FN9A 1UWXK 1RURL 3ARXA 4UILL 2ICWA 1GCFA 3B2VH 5I8KH 3QUML 1OQOA 5DUBB 1KENL 4KMTH 4ZOEA 1IAMA 4PJEB 4ZTPH 2PO6D 3L3KA 1VB9A 4FXGB 5LVEA 3PWUB 3BUTA 3TH2T 4ENEC 2NY1D 2AEWA 1BJ8A 5C70A 5ICYB 3RPIA 3G9VA 3FO1A 1B9ZA 3GMQB 5EU6A 4CN1A 5T1DH 1FHGA 1TJGH 1NBZA 4AM0B 5IR1B 3O6KL 1ZEAL 2R2HB 2R39A 4KY1H 4ZAKA 3ALPA 4X9HA 1KB5A 3FZUD 2IF7A 3TA3A 4HKBB 4AL8H 4APQA 4DQOH 1RZGA 4LASL 1F5WA 4K3DL 2NY3D 5IW1A 3ROLB 4L3EB 5I1JH 1PJ9A 4BQ8A 1C5CL 5EOQL 1LO4L 4G7VL 4RAUA 3MNVA 4ONHB 1CT8B 4ZFFB 1EJOH 2VDPL 1JNJA 1FVCB 1H0DB 4HQQL 3CMOL 1R3KA 2VDQH 2WBWB 1XH3B 3G5ZA 3OB0K 2HRPH 1OY3B 3C60C 1JIBA 1ZA3A 2A6DA 3BVNA 4IOSD 4MAYA 5SWZE 3IFPA 3U0TA 3OAYK 2O61B 4XMLL 1CLOH 2BJMH 4EN3D 2JCCB 2V5MA 4PG2C 4PJHE 2NXZB 4KK8D 4PRID 3JWDL 1ULVA 1J5OH 5DWUH 3KHQA 5ITBL 2Q20A 3DO7A 1DE4A 4JY5H 3WUWG 1U91A 4P9HH 1RZ7L 2HFTA 5JIPA 3JWDC 3D0LA 4YDVA 2I9TA 5DDHB 2V5TA 3TT3L 3M8OL 5DEFB 2I24N 4OZHF 5I0ZA 4HFWB 4XHJD 2VXTH 4Q2ZA 5F3BA 1GAFL 1T2QH 4ODXA 5TFSL 4NGHH 4KUZH 5LGKA 1RULL 4M1GH 5D71H 3K81A 1EGJA 4WU5A 3CCHB 1OP3K 3W11C 4TUJA 5CSZA 3FQRB 3TVMC 3B8YA 4Z7OF 5ETUB 3DSFH 4PJGA 4ZFGL 3OB8A 2W9LA 1RMFL 1P7QD 3GMRA 5JNYA 3NCFB 1KIQA 4WI5A 2WP3T 4H1LB 4JDTH 1U8LA 5C2UB 2NXZC 2ICWI 1DLHB 3E3QE 5GGRA 5MEQB 3GSXB 5A2FA 1F4XL 5C07D 1NCDL 1J1XH 5IBUG 4L8BA 4TSCH 2WMPA 1U9KA 3MNWA 1JTTA 1FZMB 4JFZH 4UNVA 3WLWD 1IEAA 1ZHBB 4M02A 2AJ3A 5EOCJ 3VD3A 5GRUH 4JRYA 4OZFG 4TUKL 1KNOB 3HUJA 3I6KB 4O2CB 2WINA 5JIIA 1A4JB 5TE4L 3HPJB 4HIJB 4M1CC 4R7DB 3BEWA 4U7KA 5DEGB 3CVHL 2NY5L 5ISZD 3VG0H 2CPCA 1AJ7H 3IFOA 4M6MH 3FTGA 3F7YA 4LCYA 1YUHB 4R4BB 2NXYB 5F96H 1N0LA 3T0XA 3MV8A 3NGBB 1KGCD 2NY5C 3FB8A 1IGTB 1WBXA 2R8SL 3T77A 4S11A 1QEWB 4JFDB 4JRXB 5D6CA 5I19H 1H3VA 5I18L 5D2LA 1OF2A 2GJZB 4HAGA 2CDEA 4WI4A 3X13B 1ZVYA 2AEPL 4KMLB 4XWOD 4KDWA 4U1JB 3O6FB 1AIFA 4Y4HB 3EFDL 4BFGA 4MSWB 4U1KB 3MOBL 3EUUA 3EO9H 1KEMH 4WHTA 5E2JA 3V52H 4AMKL 4RWYL 1Q1JL 4E0RB 4WWKA 4KQ4H 1PYWA 2EDKA 3OKMA 1NLBH 4NHCH 3RUGF 4CKVX 3QR2A 1YY8B 3BQUC 5JPNA 1JPFB 4PJFE 5IQ9B 4I4WA 1RZJL 4DN3H 1E6JL 3BMWA 1XGRA 1MFCL 2G75A 2NY2B 3WS6C 2WM0A 3RVUC 1UXSB 5D7IA 2IBBA 2BVEA 5C0JA 2V2WB 4ZFOL 1OGTA 3TEUA 3LV3A 4GKZA 3NGBC 5IKCA 3KYMA 4U1IB 3MOAL 3CFJB 2DM7A 2XG4A 2FNBA 1EHLH 1AQKL 1X5JA 1KULA 1A6VL 3VGFA 4H0IA 4XAKD 3SJVB 3IDUA 5EU4B 3WMSA 4ZD3L 1FVEA 4QRQB 3EHBC 2A6IB 2CRYA 3O6FC 4Y4HC 2BCKA 2OL3A 2H32B 1RQ5A 4HKJA 3C2AL 2EC9T 2UWEA 4UB0H 4GG8A 5EUOF 1NC4A 3DXAB 3EYVA 3B4NA 5DRNA 5HHPA 4CDHA 3H2WA 5KN5B 4TYUA 5C08D 1ZA6A 4JANA 4LU5L 1D5IL 5BS0E 4YPJA 4KHTL 2AJVL 3GJEA 3UTTD 4BM7A 1J88A 4X4MA 4JREB 1R24B 1AY1L 1C5BL 4M1DH 5FK9A 5HYSG 2NY2C 4TVPH 2MQ3A 1V3MA 2X4SA 5DD6B 1FCCA 5D7JB 1RUPL 1IVLA 5IEHB 1TDQA 2EDWA 5I1DB 4YK4C 4ZPTA 5FYJE 1UACL 4UTBH 5DQDL 2O26U 1NGPH 3MLRH 4JZJB 1TQBB 4LSDA 2MCPL 3BKYL 1KUMA 4CVZB 1BFVL 5E70A 4J7RA 3MRPA 3GNML 4K8RL 2Y36L 4IHOB 1AGEB 3KAAA 1N64L 4JFFA 4MCYB 1JZ3A 1MCOH 4IDJH 4PP1C 4GG6B 3JSSA 2AI0L 1KB9K 1AI1H 1T0MB 1M05A 5AZEL 4K8RC 1RJZB 2EC8A 4XCNA 1IAII 2AK1L 3F7QA 3VCLB 4GAJL 1DBAH 2GIYA 3DARA 1FIGH 1TTGA 5L2JA 1T5WA 5J57B 1GGBL 1HXYB 1X7QA 4JRYE 1FV1A 3UZEA 2HP4A 1NDMA 3QFDB 1F00I 4JREC 1GOHA 2FECI 5D7JC 3ARDA 3ARUA 1QSFB 1FG2A 1MIMH 2IBGA 3QIUB 3T2PA 1NFDB 5EPMB 4JZJC 4QRRD 1TQBC 4MA1B 5EOCH 2ZJSH 3WKML 2FR4A 3FCTA 4MX7B 5K9OA 2V5SA 3FFDB 3ZE0E 4HBQA 4HKXA 4L8SB 1EXUA 1MCDA 4BELD 3WIHL 4XPGH 1WISA 4WWID 2ICES 3LQZA 1IAIM 3VI4F 5DEZA 3MBED 2DYPD 4PJDF 4U6TA 1SEBA 2UZIH 4JVWA 3QQ9C 3PWVB 4ORZC 1KPVA 1U8KB 1X44A 2FDBP 1Q94A 1FG9C 1GYAA 4WJ5A 4MA8H 3MV9A 1A0QL 4NZRL 3RVWD 4PRDB 1MCNA 4GAYB 3ES6A 3GBNL 2VDRL 3ZTNL 1UM4H 2CUHA 4OF7A 3MLZL 5A2KH 2HT4C 3LKNA 3S96B 5ITFA 2V2XB 3O3BA 5FYLD 1NJ9A 2R0WH 3UTOA 5ACLA 4GJTB 5EA0H 2YZ1A 3MLWL 1GL4B 2AQ1A 3FKUS 3V0WH 4GRMA 3QIUC 2EDQA 3UBXG 1QLEL 2VLRB 4U6HB 5F7EH 5FOBA 4MA1C 3X11B 3AGVA 2XOTA 4PRHB 3NIFE 3U82B 2Z92B 3V5DB 1KELL 5I1GH 5ACZB 1MI5B 4L8SC 5LAXB 3U1SH 3PQYB 3MUJA 1WZMA 3BRDA 4Q7DA 4Z7QE 5HI4C 1AE6H 5JR1L 4LIQH 3L3JA 3WFBL 1TENA 2QTEA 3D85B 1JI1A 3B8SA 4QEGA 3LSOB 4LARH 4M6NL 1IGCH 2ARJQ 2EO9A 4RBPH 4NCDA 2P48B 3RWFB 3OJVC 4P3DA 2GJ6E 2CIIB 3UJJH 1YEIL 3V4VH 4OQTH 3MYZA 1NEUA 3EYUH 1DQQA 4L4VE 3C87A 3WHE0 4XVUD 1KJ2H 4U2YA 3QCTH 2GSGB 4V1DB 3LEXB 3PF2A 4QTIL 3ULVE 3QUYB 1I1AD 1WBYB 5J06A 2F53E 2JKXA 1OLLA 5A16B 1OAQH 1YEKL 1C16B 3VFUB 3MOQA 4X6BB 3TN0B 4X4ME 3JWOC 3MRJA 2JB6B 2DQHL 4G8FB 1BPVA 1LP9B 2J4WL 3EKCA 2AJUL 1KCKA 2YD1A 3QDMB 1BVKB 4NCC2 2N7BA 3PABB 3B43A 4OTXH 4AY0A 4YEEA 3AS0A 3PP3K 4JLRA 1OQXA 4QHMB 4Q9RH 4PGEB 5I8EB 3TIEB 3ULUE 4K3JL 1OAXL 2AJXH 3HI5H 2VXUL 4YHZH 5K9KA 5FO8A 3NCMA 5E94B 4XX1G 5L2KB 1N0XH 1IRAY 4LOUC 2JLLA 2FSEB 2FX7H 2ZOLB 4GRWF 1CIUA 1RUAL 1PFCA 1OT2A 1XF2B 1BQLL 2XFXB 5F7WC 4TULL 3B9VA 5C3TA 4FQCH 3OGOE 1K8DA 3QUYC 4MXQD 2D7NA 1QSEE 1JV5B 1T4KB 5D1ZB 1AKJB 1TVDA 1A1NA 4NYLA 3AY4C 3TN0C 2OP4H 1HH9B 1ODAA 4XC1L 1I4FB 3T0EB 4DZBA 5IGXL 1B6DA 3VH8G 5C7XL 3FQUB 3CFEB 1J0YA 4MHHI 5GIRB 1LO5A 2R29H 2VOTA 3M17A 3WJJA 1T83A 3CPLB 2DJUA 3DUUA 1H8SA 1T1ZA 1MCWM 4MMZC 4YGAB 4OLWH 3VXRA 5CUSH 2R4RL 5BRZB 3WIFB 4NKMA 3LN5A 5GRVK 4Q6IB 2LV4A 1V7NH 3SDAB 4FP8H 3BKJH 3O2WH 1DJSA 4RMSA 1NCBH 2AXGA 5ERWA 4X5LA 1B4JH 1F8TL 3NCCB 5E8EA 3TZVA 2VJXA 1Z9OA 3MRKB 3VXOB 2DMCA 4EI5D 1P7KA 3G04B 4Q6YA 3TJEH 5KSBF 4ZUWB 2YN3A 4G8GD 1J8HB 3OR7B 5HI3C 2W38A 2VC2H 4FQ1L 4PJ9B 4YFLI 5D1ZC 4LLDB 1H3UA 2IPKB 4OLVH 3QQ3B 1LE5A 4XPBH 1AGFB 4FQ2H 3B2UD 3QQ4B 2NY4B 3AAZB 2UY6A 3T0EC 2Q6WA 2ZUVA 4F9LA 4NZDA 1KT2A 5IK3A 5IB2B 1U3YA 5IMKB 4NQCD 5D1XA 1JF6A 2GK0B 1Y0LA 4NO0A 3FZUC 3VFMA 1BZ9B 5E08H 2VL5A 1I3GH 4BSWB 5KG9B 2V2TA 1A4KA 2FH8A 3SO3B 1FYTD 4PRPE 4Q6IC 3SDAC 2OK0L 5KJRL 5C0GB 4LRIC 2P5EA 2BVOA 4HV8B 5I8CB 3F6IA 1HYSC 4K7FB 5ALBH 4XRCA 3Q48A 4YO0A 3MJ8A 3QDGB 2YPVL 4HMDA 1VSCA 4YC2C 4HJ0D 4KTDL 3KLAB 5HVWA 4HS6A 3MMEB 3TF7C 2LVCA 4A2LA 4HIEA 1BECA 5DC4B 4PJ9C 5B39G 3G5XA 1NLDH 3U9PL 4Y1AA 3RA7H 3L7FB 4MD5A 4OCRH 1H8OA 1F2XK 4OLZL 1ROWA 5C9KA 3I84A 1I85C 4GRLB 3VFNB 4ZUTB 1SEQH 2IANB 1AXSA 4Z7UE 3R06B 4IMKC 1UM6L 5GZOC 4HBCL 1CG9B 3PXJA 1YPZE 4KK8C 5IM7B 4XBPA 3P73B 5IEKA 5D2NB 4KKLD 3HG1D 5F89A 2SEBB 2JIXB 3QHFH 2PCPB 2FHBA 3SO3C 1L7IH 4OUUB 3Q1SH 1OSZB 3C60A 4PJEA 3ARBD 3X12A 3QG6B 4YDKH 1TVBA 4FXGA 3DX9B 4PY7B 1KTLB 4UQ2B 3HLAA 1KEGL 2Z91B 3ZKQD 1YMME 2FO1A 3UO1L 4L9LB 4UAOB 2JJSC 4HK3J 5BZDB 3I9GL 3GMQA 3FMGL 2KZWA 4PG2A 5DLMH 5DJ2B 3IDJA 2Q76B 5DJ8B 1ZHLB 2A77H 5IR1A 4PJ8D 2R2HA 4QHNA 1VADB 3S37L 4MNGE 5F44A 2G60L 1W0YT 1CR9H 1CL7H 3QRFM 3MCLL 4GRLC 2EE9A 2YHGA 1BZQK 2ZCKL 3ROLA 4L3EA 2BRQA 4ONHA 1CT8A 4ZFFA 4L4TE 5D2NC 2E7MA 1T3FB 1Z2KA 1FVCA 1H0DA 3OAUH 4LF3B 4N0CC 5ESVA 2P5WB 1A02N 2GYSA 1XH3A 3MC0A 2DDQH 3WLWC 1H3TA 3TVMA 3DROB 2QHRH 5KSVA 4ODUB 5CGYD 2O61A 3BH8B 3JXAA 4L9LC 4UAOC 2WQRA 3IXTB 2JCCA 1PG7L 1J9CT 5C0EB 25C8L 4FNLH 4HEPG 5DC0A 2AXJA 3WUWA 4N0YL 5CJOH 3R1GH 1KPRA 1KXQE 3VU2A 4PRBA 5AWNL 2R2EB 4HT1L 1WJ3A 4LSTH 4WFGD 1NEZB 1DLFL 4PJGF 2R0ZH 3H9SB 2VSCA 5CILH 5DDHA 5CMAB 2AW2A 1PKOA 5TDNB 4HWNA 3WFCL 2YUVA 3DHJA 3VWKA 5SV4A 2IFFL 5IFHL 3C5ZB 4NQDE 4GW1A 3MV7D 3ROOB 3MRGB 2ICWJ 4GW5A 1MCFA 3MRCB 4D0DB 5ETUA 1GGIH 4FQPA 4HUUB 3AB0C 3CSYB 2BSRB 3JTSB 1FJ1B 1Q0XH 3CVHA 4HXBH 4L4JA 4JPIB 3WFEL 3WKNA 4RRPA 4H1LA 4MNQE 4ZOCA 5E6ID 3HUJF 4GMSL 5C0BD 5I74B 2P49B 5MEQA 3GSXA 2D4FA 5CEZE 2J7LA 2B1HH 2XQBH 2ZNWA 5HYJE 3EOTL 3VFOB 5IVZA 2AJYL 2D03H 4U3XA 1FZMA 1MCLA 4NJAH 5KVEH 1ZHBA 5F9WB 43C9A 5JHDB 3SKJL 4KROD 1KNOA 3LAFA 3AM8C 3GFUA 5D2LF 3O6MH 3A67H 3BQUA 3HPJA 2HJFB 4R7DA 3C5ZC 4PJ7E 1U3HB 1RJLA 3GO1H 5DEGA 2WAHA 4GUPB 5AG8A 3BZFB 1YUHA 3Q6GL 2X70A 3MJGX 1NMAL 5KSUB 4KRNA 2CLRB 1PDKA 4UIKH 4U33A 4HH9B 4X0KB 5E9DB 1OCWL 1QEWA 4JFDA 3ZHDA 4JRXA 3SDCD 3WFDL 2DTMH 2CKNA 4G8EA 5I74C 4ZFOA 3EBAA 3BEVB 5B21A 3NVQA 4GRWH 3X13A 1QVOB 1T89C 1MEXL 4U1JA 4LL9A 5FUZL 3O6FA 1F58H 4Y4HA 4BYHA 1ZSDB 4MSWA 1IGMH 3P30L 4U1KA 4WUUD 4CJ0A 5EBLA 2V17H 4WI2A 1G7HA 2YSSB 5D7LD 5D7IF 4EXPX 4NHUA 5F9WC 4K94L 4PYGA 4ODTL 5FHAL 1U8QB 2XACC 4E0RA 1X6NA 4Z0BL 4P0DA 4H25B 4RGOL 1YY8A 1JPFA 4K94C 4LHUD 4YDIH 5HGGS 3W5MA 4PV8A 4OBSA 2D4DA 2DLIA 1EEZB 5J3HD 1E28B 3R8BB 3P4NB 3KPQB 4P2RB 1MIEH 1UXSA 2UWEF 1QUNA 2V2WA 5GXBB 4M43H 1G9NL 3TIDB 2RHEA 3CFJA 2MMXA 2D7PA 4JZOB 5SX4I 4M3JA 5CINH 3STZB 3SJVA 2IEPA 5EU4A 1G9NC 2A6IA 3NCJL 4YGVB 4N9OB 3AXLA 32C2A 1BFSA 4KZDH 2YWYA 4CVXB 2BNRD 3DXAA 3C6LD 3LQMA 5KN5A 3HZKB 1RZ8B 2LU4A 2FYYB 1BGXL 1CZ8H 4K7PL 1ZTXL 3TC9A 2IPUG 3QYCA 3CFIC 1OB1A 3W0WB 4XVSH 1G1YA 5AAWA 4NQEA 1H5BB 1YEFH 2JTDA 1R24A 4JGJA 1I3UA 3QQNA 3V95A 2CLZA 5DD6A 5D7JA 1RFDH 3MUGB 3PWPD 3IVKB 4FQIH 1JZ7A 5I1DA 2Y07H 4OCXL 3RP1A 5FYLL 1FRGH 1ORSA 2WUBL 4JFOB 5CEXB 4JZJA 1KF9B 2NLJB 2YRPA 4DVBB 4IIQC 2DOCA 4CVZA 1NGQH 3VXTA 5KW9H 4IHOA 1AGEA 3CJJA 5FCUH 4MCYA 2Z4QB 4U1LB 2CD0A 4OM1L 1NMBL 4GG6A 5SWSD 4QWWC 4D9QE 5T3XL 1LK2B 4JZNB 2R4SH 1INQB 4I2XE 1KV3A 1Y6NR 2P46B 4KVNH 3WIHA 4LAQL 1HZHH 1BFOB 1CF8H 2RAMA 3GMOB 1KJ3H 1GC1L 1TZGH 2VR9A 1J10A 5KTEH 1P4BL 1MCBA 3SKMA 1HXYA 4Z77B 1ZS8B 1H5BC 3C6SB 2PYEE 1I9EA 3CLEH 3KYKL 3QBTB 1CGSL 3OPZL 3L3GB 5GJTH 1CD9B 5JW5A 5C0DB 3IDMA 1JI2A 4P23D 2XT1B 5JA9A 1AD9B 1KB5H 2X7LB 1KCUH 3RBSA 3QIUA 1C7SA 1NFDA 5EPMA 1QBML 1FNSH 4GKSB 3L7EB 1MHEB 5JDJA 1I1AC 1TIUA 3FFDA 4L8SA 1EEYB 4NQXB 3BMVA 1JTOA 2ZZUT 3FRUB 2DL2A 4YWGH 4E41D 5FGSA 1OM3L 3INUL 1MAJA 2W60B 3PWVA 3NOIA 5J1AB 1U8KA 1LEKB 4YHML 1SVZA 1I1FB 2I5YH 1BX2A 1KPUA 4R8WL 2ZKHH 1JE6A 1YEJH 4PRDA 1EH9A 3T1FB 2F5BL 2EXWD 3IT8D 2FGZA 3C5SB 4GQPH 4U1NB 3S96A 4QRUB 2VXSL 1C08A 2V2XA 2ZUWA 2C4FT 3HR6A 4YFLF 3TBTB 4I8DA 1AGDB 2B20A 3H7LA 3ZT5A 4R26L 1RJYB 2VLRA 4GXUN 3X11A 4OAWB 1CXIA 2Z92A 3V5DA 5MENA 3QJFB 3CDYA 5LAXA 2F5AL 5TQ0H 1QLFB 1VGEL 1UVQA 5CJ5A 2Y5TB 3MLVL 1OAUH 3EJYD 1NQBA 4QXWA 2C26A 2ZNXA 3W2DL 3D85A 2VZTA 3LSOA 2A38A 4WCYH 1EGJH 4YJZL 3RWFA 1JPTL 4JFYA 3VGDA 3QWQB 4Y19D 1CLZH 5F3HB 2UYLB 2BVPA 4PRAB 4XWGH 3UYRL 2FEDD 4XMPH 1YQVH 2GSGA 3LEXA 2CR3A 5EZOL 3QUYA 1F4HA 5INCB 5EBWB 4P2YA 2XY2A 1IFHH 2ZCLH 1IBGL 1C16A 3VFUA 4KI1A 4X6BA 3QDJB 4OLXH 3TN0A 2HTLC 2FX9L 1JJUA 1NBVL 2VISA 3LKPB 1A7OL 3WL9B 4OZGB 1DDHB 1C1EH 1PEWA 3MRFB 4Z8FL 3QDMA 1BVKA 2X10A 3QHTC 4MB3A 3OJDA 3PABA 4ZQKA 4X4XB 7FABL 1HKLL 4LEOB 4KGJA 4QHMA 5CZXD 5IESL 4V2BA 4PGEA 3ARPA 5FGCE 5ID1B 5E94A 5L2KA 3HZVB 2FL5A 2FSEA 4FZ8H 5A3IC 3MODL 4NZTH 1HI6B 1WCBB 1KG0B 2ZOLA 1N5YH 2VAJA 4KRLB 4NQVB 3QDAA 1XF2A 3IAQA 3B5GA 4R7NB 3HC4L 2XFXA 1WV7T 3O3AB 5FA4B 3KPRB 5C0IA 4IRZL 5A43C 4AJ0A 1IAIH 35C8H 1MHHA 4OGXH 4QXUH 3RL2A 1JV5A 4Z7NE 1WT5A 5D1ZA 4O2EB 5I71B 5KSAB 3L95B 1S3KH 5I9QC 1HH9A 4KAQH 1I4FA 2DLEA 3T0EA 1G6RL 3UEZA 3FQUA 3CFEA 3HNTH 2XZQH 1P5VA 3AC0A 2L7UA 5GIRA 1QSFE 3CFCL 2PR4H 3LEYL 1XF1A 3CPLA 1BM3L 1CE6A 4E5XB 4BA8A 5HXMA 4ZSOB 5BRZA 4JO4H 4AEHH 3WIFA 5I30L 5FO7B 1WF5A 3SDAA 1AR2A 4P5TB 4PJXB 5H35A 4UI2A 2BDNL 4LRIA 4IRJB 1MWAH 1YC7A 4KKLC 5DF0A 3H3PL 4MQSB 1I9JL 4XP1H 2EIDA 4JR9L 3LQAH 4X9IA 2CUIA 2NR6D 4P4KD 4ZUWA 4YH6A 1J8HA 1REIA 1YQ2A 3RGHA 3N1GC 4JFEE 4BZ2H 4PJ9A 2ZWLT 4Z7VE 3D39D 2IPKA 5I71C 5KSAC 1KSRA 3GUTB 4OFPA 2YD7A 1YECL 5HHVL 1AGFA 3QQ4A 3AAZA 2OL3H 1XGYH 2EH8H 2IALB 3GSRB 3QZWG 1VEOA 3KXFD 5IB2A 5IMKA 2X09A 3GSNB 1VFOA 2NY0D 4MNHB 4C59B 4J23A 3P0YH 3MXVL 3D2UD 1BZ9A 1SBSH 2Z31D 2AV1A 4BSWA 3CZJA 5KG9A 1U93A 3K46A 1MJUH 5L0QB 1BF8A 4PRHE 3T3MF 5ICXB 5DMJB 1LHZA 1MI5E 3KYNA 4JY6A 3PQYE 4P5TC 4RGNE 5C0GA 3UX9B 3WNMA 4IRJC 3Q0HA 3OKEB 5ICZB 2R9HC 4K3HA 1QRND 3S35H 2JJSA 4HWBL 4OCLC 5C0CD 4Z6AT 5B39A 3QDGA 1ZLUK 2DQCL 3MMEA 3TYGH 1MAML 2D2OA 1TZHB 1HOCA 5IF0B 4JO1H 3L7FA 4V1DE 3NN8A 3GSNL 4PJEF 1W0VB 4GRLA 3EYQC 3NZHL 3QEGH 3VFNA 2DKUA 4OZIB 5AD0A 4ZUTA 1F3JB 1LO0H 2D9CA 2AJZA 3RX7A 3R06A 3VXUB 4AEEA 1CG9A 1BEYH 2VLJB 5IM7A 4KK9D 2HJLA 2YMXL 3P73A 2B4CH 4JPVH 4OI9A 1HSBB 4I0PD 5D2NA 5DUML 3UTSD 3QT2A 4P57A 5LCVH 4NKIH 5T5FH 1P4LA 2JIXA 5TE7H 4WGVB 4Y89A 4JKWA 2JJTC 1LP9E 5L0QC 2PCPA 4D3CH 3QDME 4OUUA 4BFBD 1MCQA 1OSZA 2F9BT 3QG6A 1SHMA 4NQSB 1DEDA 3TWCL 1KTLA 3SOBH 2RJMA 2Z91A 3VXNA 2PTTB 5HGHB 3C2SA 5ESQB 2BMKA 4JFXB 4L9LA 1F6AA 3C8KB 1IL1B 3CX2A 4BZ1L 2H2SC 1S7TB 2AGJL 3ZZ1A 2C4XA 4J3OC 2Q76A 5DJ8A 3BGAA 1ZHLA 5ISZA 3OX8A 4R4FL 2IH3A 1ZT7B 2XRAH 1KCSH 2FEEI 3FFCB 4FMKA 4YXLH 1QSVA 1VADA 1UWXH 2NZIA 4HLJA 5CCKH 1MPAH 1DVFD 3CAFA 2W0PA 1T1XB 2IAMB 4WO4D 5TF0A 4R6UA 3QIWB 1L7TH 1EHXA 5FYKH 2JCCF 1T3FA 2GT9B 3ARTA 5E5MB 4X80L 4N0UE 4BQ9A 7CGTA 4GBXD 5HGAA 5F7MC 1NPUA 3MCG1 2MWCA 2QJDA 3THMH 4ORGA 4EUPB 1EJOL 2P5WA 2YA1A 5ALCL 1A3LH 5EU3B 3RFZC 4QT5B 4LCWE 4GH7B 1Q9LB 2BK8A 2X6MA 4ODUA 2DQEH 3MRRA 1NC2B 4X5XB 4BFIB 1GGCL 3CX5K 4X6CE 4F2MB 3IXTA 4P46D 5C0EA 4YDJB 4I5BA 1KXVC 2YKLH 5DK0B 5TF1L 5J13B 1RIHH 3L3HA 2R2EA 1RUKH 4LHUG 1OD9A 3IDGA 1NEZA 2DQGL 1FO0B 1RIUH 1HHGB 5EWIH 5BXFB 3OB0H 2IAMC 3H9SA 1QNZH 1U58B 4GXVH 1MFBL 3OHXB 3QIWC 4J1UA 4A6YB 5CMAA 5TDNA 3OAYH 4U7SA 2PUQT 5DJYA 5F7LB 3SGKC 3AM8A 1BD2B 4K23H 3C5ZA 3LMJH 4GKOA 2P42B 1R3IH 4GMTL 1BBJB 3R4DA 5EU7E 1SM3H 3GIZH 1A7NH 1P84K 1T2QL 4D0DA 2EO1A 4HUUA 1OTSC 4HF5H 5C08A 3CSYA 2BSRA 3NCBB 3JTSA 2LFGA 2W07A 1FJ1A 4ZNCD 3T3PE 4ERSH 4XTRC 1DL7L 4ELKB 3RIFF 3MLUH 3MLYL 1CICD 4EVNA 4WFFE 1FO0L 4TNVK 5DJDB 5J3HC 3T65B 5J13C 3HB3D 1KYOJ 3REVB 4A6YL 2EDYA 1S5HB 1T89A 4LBEB 4JDTL 4RDQF 1U8NB 3PDGA 5EO0B 3VFOA 1OP3H 5E56A 3OG4B 4MWFB 4HWZA 3NIDE 3QXAB 5T5NG 4R3SB 4LQ1A 1HH6B 4JFZL 2XN9B 2NTSP 2IANE 3LDBB 3LZFH 5GRUL 3FRPG 1PBYA 2HJFA 4AG4L 4ZO8A 4HEME 3EJZD 4Z7WE 3U7WH 5DD3H 4ZS7H 2XI9A 3K7UA 2VXQL 2X9XA 3PGCB 3BZFA 4UUJB 1OSPL 2UY7A 4Z18A 2IWGA 2BOCB 3Q5TA 1GXEA 4HH9A 4EQ3A 4XNQB 4X0KA 2DD8L 5CJQL 4Y5XB 5J1TC 1P6AB 3QFJE 5EIVA 3DX8B 3BEVA 1EV2E 4L5FL 1XAUA 2GFBB 1QVOA 3BKML 1WFTA 3CSGA 2ZCHH 3ESUF 4QOKB 4Q74A 12E8L 3I6LE 3HNVH 4JKKA 1JHKH 1CFQA 1U8QA 1DFBL 3V7AG 1I1CA 3N1PC 3HNSH 4H25A 1FC2D 1QR4A 3LDBC 1JGUL 4TVSa 1KCVL 2ATKB 5F6HI 1YYMH 2X4NA 4P3CL 2OR7A 1P4IL 3MBEA 4Q0XH 3QEHB 3DETD 5T1LB 5JQHC 3RWHB 1E28A 1QO3B 4NN5C 2K9UA 4KRPD 3P4NA 5F97E 1VA9A 1EVUA 1B0GB 2FX8H 1CFTB 1DSFH 3TIDA 5CFHA 3X3GL 4KHXL 4TTDD 4JZOA 4TRPL 4Y5XC 4IIQA 4P2QD 1AFVH 4NT6B 2HFGH 4PJAB 5FF6B 4U1SB 4OLUL 3P9LB 3VXPA 1EHLL 1WLHA 4HWUA 1WWWX 1BLNB 4FZEL 4YGVA 4H0GA 4P23C 3B83A 5GJSL 3IGAB 5IVXE 4CVXA 3ARVA 1FDLL 5E7FA 3D48R 4NRXB 3VI3F 3O3EB 1AHWC 3HZKA 1JFQL 3RZWA 1RZ8A 5C09B 4J3WA 2FYYA 5T3ZL 3C09B 1RURH 5EO9B 2FLBT 1XF4B 3OAZK 3W0WA 5LBSH 1KENH 1CD8A 3BDBA 1ZANL 1Y6KR 4HC1H 4GG6F 4O9HL 1QA9B 2AVGA 3MUGA 3VXSD 4G9FD 4UBDC 3DMMD 3TO4D 4M1DL 2V9RA 5ANME 4JFHD 3ZT6A 5FM8A 4JFOA 1V5JA 1EFXD 2EXWC 4Z7NF 5CEXA 2NLJA 4DVBA 3T8XB 3O6KH 1FPTH 1ZEAH 1I1AA 4JVUA 4ODWB 1IGYB 5HDLA 2BSSA 4CU6A 4LNRA 4S2SB 3H6JA 3VJ6A 4K3DH 1E27A 4NPYB 1EEQA 1H15B 1LK2A 4NZUL 4WW1B 2KKQA 4G7VH 5LQBL 1T21B 1N59B 1MLCA 5DS8A 1OVZA 4IDJL 2YUZA 1BFOA 1AI1L 3OR6B 4HQQH 1NFDF 3C09C 3VRLF 4N90E 3CMOH 5HHQA 5JHDE 4YIQB 3FONB 4G6KL 1CBVL 3LIZH 1DBAL 2Q87A 4Q9CA 1MY5A 2XY1A 5F88B 3C6SA 3CGTA 3U7YH 1WSST 3L3GA 4XMLH 2A0LD 5C0DA 4UNUA 3IU4L 1BQHG 5GGQL 1K85A 1AD9A 3PJSA 4CAGA 2B8OT 3TYFA 2X7LA 4G6AD 3HZYB 3VMPA 2FEDC 4RIRB 3GM0A 5KS9B 1Z3GL 4LHJB 3JWDH 3U2SB 3V4UL 4GKSA 1MHEA 3L7EA 2YXFA 4YBQD 3BAEL 1F13A 2FRGP 2WBJB 1EEYA 3PWJB 4MJ4A 5E9DE 4NQXA 2VB5A 1KFAL 1XZ0A 1WVZA 1RZ7H 2FJFB 3AS2A 1CIDA 3FRUA 2GITA 4XPTL 5DURD 4HS8H 4LLWB 1MJJB 3TT3H 3M8OH 2W60A 4XPGL 1KBGL 1LEKA 5EB9A 3IFNL 4EEEA 1I1FA 3KPNA 1GH7A 3VGBA 5JORA 2UZIL 3EYFB 3QUXB 1I7TB 1R3JB 3OSKA 1RULH 3UPCA 5HVHB 4MA8L 4BQBA 1FIEA 4D9RD 5H37H 3S37X 1LVEA 3C5SA 3V4PL 4RMQA 2GQHA 3MRLB 4NDMA 4TOYL 4U1NA 4QRUA 5EZLB 4YZFF 1LILA 1RMFH 3O8XB 4XI5C 1EA9C 1VFUA 3TBTA 4KI5C 2NX5E 1AGDA 4EI5A 3BXNA 4X7TB 4KQ3L 2R0WL 4P2RE 4G8GA 1F4XH 4MZ2A 2I25N 4XHQA 2A9NL 1NCDH 3STLA 3MRIA 2WBJC 1AP2A 5HVGB 1P1ZB 1QLFA 5F7EL 2Y5TA 4MCZA 2K1MA 1MSPA 3O3UN 5SX4H 1RSFA 3QIBB 5DHVB 4UNTA 4TUKH 3VFSA 4QTHA 4U31A 4QNPE 1UT9A 2V9QA 5CHNB 5BVJB 3QUXC 5TE4H 2V5YA 3RTQB 1YYLL 1IGCL 2UYLA 5C2BH 3CIQA 3CVHH 5MHSE 2NY5H 5HVHC 2WBKA 4FFVD 4PJ5B 3V4VL 2BVQB 4OQTL 2LTQB 4M7JL 1CLCA 4H1LH 1YNTB 5EU6D 1TVHB 4YQXL 2G9HA 1ZGLB 2YPLB 3RHWF 1KJ2L 2NYYC 5I1KH 2X4RB 3IB4A 3CDCA 2AXHA 2DI8A 3BIKB 2R8SH 1AO7B 3TA3D 3R0MA 4APQD 5I18H 1IC5L 4OZGA 3P40A 1PKQB 4NN7B 4NNPH 1DDHA 4LMQI 2E3VA 1U8PB 2WWKO 3EFDH 4X4XA 4WDIB 3I50L 4LEOA 3MOBH 2CGRH 4UOW0 4YAQB 4OJFL 4AMKH 3DBXB 4P2OD 5DD0H 1Q1JH 3BD3A 5ID1A 1RVFL 4PLKD 3CH8A 3HZVA 4FQQB 5F1IB 3WLBB 3HG1A 1HI6A 1IM9D 1KG0A 1S7SB 1WCBA 5JIHA 4MAYD 3RTQC 3HI5L 4HWEL 4PJBB 2FX7L 3LKQA 1D5MB 2R1XB 2LTQC 1LO2H 2AK4B 4B0MM 3PP4L 3ARBA 5TE6L 3PP3H 5FAAA 2BY0A 4O2EA 5IB3B 4I9WE 3ZE1F 4PYHA 3SO5A 1NANH 1TCRB 3MOAH 2H1PL 4U6VL 5CGTA 4WW2B 2APXA 5DK2B 4AT6A 1HHJB 3Q6FB 3CU7A 1AQKH 3P4OB 3FT2A 1A6VH 1ND0A 4IRSB 5FECA 1BOGB 4NN7C 3NBNA 1PGRB 4CVUA 1OAKL 4PJ8A 1JRHL 5E7BA 4RA3A 4E5XA 4WHCA 2OSLB 4J6RH 3HE7B 3FO0H 4ZSOA 2R29L 3HS0B 2DIJA 5FO7A 1HEZA 4ELMA 1UXWA 1S9WB 3S3SA 4PJXA 4QRPB 2YZ8A 1U3JA 1CTNA 3BP4B 3HR5B 1D5IH 3JV5A 5FYJD 3RY6C 1V7NL 4KHTH 4F15C 5JLZB 1NCBL 1TNMA 2AJVH 3PWNB 4QO1A 4W4OC 5EORL 2WWMD 3CDGA 4I77L 1AY1H 1C5BH 5DO2C 5F1OB 1RUPH 4HWBA 1Q9KB 4RSVA 4QHKI 3GUTA 4ODHL 5C92A 4WW2C 1UACH 3H0TB 4AZ8A 1CQKA 3EZ8A 2H32H 2ZUSA 2MCPH 3GSRA 3N1FC 3BKYH 4IRSC 1WITA 1BFVH 4HKZB 3GNMH 4K8RH 4FQ2L 3GSNA 3TESA 1RHHB 4MNHA 5T1KB 4BH8B 4JY4B 1N64H 5ENWB 4JRYD 3WHXB 3HE7C 4LCCB 4QHLA 4IOIA 3P3YA 1LEGB 4B5EA 2AI0H 4KU1A 2JJTA 3NIDF 5AZEH 3OJMB 1VFAB 1YN6B 4MJ5A 4K9EL 5E08L 4GAJH 2XTJD 4LLYA 4U1GB 3TCLA 5B4MC 3EOYG 5ICZA 3Q5OA 5IBLD 2EDBA 3WFZA 2Q1EA 1GGBH 4K9EC 3MV8D 4JB9H 3GSUA 4ZYKB 1L9NA 4R4ND 1XFPA 4P5KB 4F7EB 3QWRD 4G42B 1TZHA 5DHXB 5IF0A 2IQ9L 5JW4N 4CN6A 1LMKA 5IW3A 4ISVB 3QA3B 3HI1B 1F3JA 3RA7L 5SV3A 3WKMH 3VXUA 5I8OL 5ELIA 4OCRL 4XNZB 5I16B 2VLJA 3QDJE 4K7PX 1N8ZB 3HAEB 5F70A 1M4KA 1HSBA 3MREB 2ADFL 4X7CC 4WWKD 1QRKA 3IJSB 4OZGE 2PW2B 3FQTB 2Q7YB 4NKOB 1UH4A 5IB5B 5D5MB 5C0FB 4U1GC 1FN4B 2OTUB 3QULB 5CLWA 2JE8A 1A0QH 4NZRH 5HDQH 5HGHA 2PTTA 3Q1SL 5FGBA 2VDRH 3ZTNH 4YDKL 1IL1A 2PYFB 3MLZH 1UZ6E 1S7TA 4NM4L 3IXAB 3VW3L 2CO7B 1D5ZB 2VUOA 2Y6SC 4HCRA 1FNHA 2XZCL 3MPCA 4H5SB 5D9SB 1ZT7A 5B38G 3FFCA 3L3IA 3PGDB 4D9LL 4YHLL 5EULV 3KPRE 3MLWH 1WFOA 1DUYA 2IAMA 3RWJA 1QLEH 4KFZC 4XNZC 3TV3H 4HIXL 1KELH 3B5HA 2ZSVB 1NC4D 4PGJA 3FHAA 2GT9A 3P2TA 4M8VA 5E5MA 3SGKA 5JR1H 3ZKMD 2VQ1B 3WFBH 3CFKB 3DPBA 1MCPH 1DTUA 5DI8B 4EUPA 3IU3B 3DECA 1YDPA 4M6NH 3UCRA 5EU3A 5K59F 1OD7A 4N8VB 3G6AB 2BNQB 1Q9LA 1UB5B 4PD4J 3RKDD 3RWDB 3NTCL 3BP6B 1YEIH 4ZSOE 2LAAA 1NC2A 4PB9H 3SGDI 4X5XA 3BUYB 5C0RL 2I60H 1AXIB 2F19L 5HDBE 4PJXE 4F2MA 2FIKA 1MLBB 3JWOH 4YDJA 1G84A 4UMGA 1FNEB 5DK0A 5FYKU 3I02A 3LEVH 1YEKH 2NW3B 4HG4K 3H7BB 1BIIB 4D0BB 2C1PB 2EH7L 1J0JA 3CZFB 4FABL 4LVOB 1FO0A 3EFFB 1HHGA 1AD0B 2X1PA 3VXQA 4JFFD 2DQHH 4A6YA 1B90A 2J4WH 4EI6A 4DK3A 5JOPD 3TCXA 4S10A 5I2IB 2QQQA 1OTUD 1ZK9A 2IGFL 3D69B 2A73A 3NPSB 2APWA 1BD2A 5E2TH 5C0AB 2HRLA 1QSED 4LLQA 1BBJA 1OAXH 4K3JH 5KOMC 3K3QA 2VXUH 3LPFA 2BNRA 4MXVF 1PZUB 3WNKA 3VFGH 2J12B 2ADIB 1RUAH 4NWUL 1IAKB 3OMZA 1BQLH 4NUJB 4ELKA 3JV0A 3ARYA 3ARDD 3CNKA 4LP4A 4J3UA 5D7KD 3T65A 2DIBA 1PVHA 4KRPC 3VE0A 3H3KA 4HSQA 1U8NA 1W72B 5J89A 3BN9C 2IADA 4LVOC 4OCWL 3V8CA 4XC1H 2ORBL 4MWFA 4LLMB 3RIAK 2XQBL 2B1HL 3QXAA 5C7XH 3O4LE 4R3SA 4TTDC 5IBTL 1QBBA 1JGLL 1HH6A 5BV7B 4JG1L 1SJEB 3ILQC 4NJAL 2C3WA 5FYKD 2XN9A 4OZIE 4DW2L 3MROA 3NPSC 3CC5A 3DOSA 2R4RH 1GVIA 2VLJE 3UTPE 4HUWB 2OTWA 5DD5L 5SWSA 1U41A 3DVIA 1B2WL 5SWZB 3O6ML 4DUWA 4PGDA 1F8TH 1EO7A 2BHUA 4UUJA 1U8OB 1MAKA 2C1OB 3QEQB 1WAAE 2BOCA 4DKDC 1VEMA 4XNQA 3BZ4B 3QNXB 4G9DA 4U0QB 3O81A 3ZKNC 5J9PB 1WIUA 2HT3D 4Y5XA 4B50A 4UT6L 3DX8A 3IJHB 2AEIT 1F45A 2GFBA 3WDJA 2DTML 3TBVA 1KN2L 3WD5L 4P23A 1IM3B 4QOKA 5HYIA 3FFCE 4ZUUB 3TO2B 2O5ZL 4KK6D 1IGML 5BV7C 3F12B 1AHWA 1FZJB 3MRHB 1BMGA 1OGAB 1JNNL 3C08L 2ATKA 3D18A 3DVFA 5J7CC 2W92A 1FL6B 2VDLL 3QEHA 5T1LA 5KJRH 3MLSL 4XXDB 3RWHA 1QO3A 4QNPF 1URLA 2HMID 4Q9BA 3ZDYF 3KPLA 4YPGB 1CFTA 4R2GD 3P4MB 1T03L 2YPVH 5JTWA 3MR9B 5GGSY 4KTDH 5A2JH 9CGTA 1EMTL 2WW8A 1LK3L 4M43L 4NT6A 2VZVA 3HTLX 3U9PH 1NAMB 4KDTC 4PG9A 5FF6A 4WIQA 5CIPB 4OLZH 1BLNA 5DQJB 3GSWB 3QCUH 4F57L 2DLGA 3IGAA 3GMLA 4HBCH 1CGTA 1CVRA 4LAJH 4S1DC 2APVA 1CS6A 1FNFA 5EO9A 2B7DT 3ELAT 5I66B 2X4TA 2YR3A 3KPSE 1Q9WB 3ZDZE 5GGRY 3GJFB 5DZOA 4JAMA 5IOPA 1BD2E 5DHYB 3VGAB 1KEGH 4QKXB 1OPGL 4XVSL 3UO1H 4G7YL 3LY6A 1N6VA 2Q7NA 3SEPA 2CK0L 1T20B 2P24A 3I9GH 4U1MB 3FMGH 4JQXC 5GGVL 3BWUC 3E3QC 4NWTH 2E9IA 5EUKA 4JCLA 3T8XA 3CXHJ 3S37H 3W9DB 4ODWA 2G60H 1IGYA 3K4DA 4JFPB 3MCLH 4NPYA 1HXMB 2R0KL 2ZCKH 4KKBD 5KW9L 2OR9L 3VXRD 1H15A 5BVPL 1CI5A 2KQNA 1T21A 4OUOA 1N59A 1ZT1B 2VITB 3WJLC 2ILLA 2R4SL 3OR6A 5L88L 1KIPB 1V3KA 3RWGB 1GHFL 4Y2DB 4UOJA 2VLLB 3LVEA 4YIQA 4ZO9A 3FONA 3KHOA 2PF6A 1G7LA 4EIZC 4X98B 1KJ3L 1NFKA 4OCSL 4XP9H 3KDMB 4LRNL 5KTEL 4PP2B 5KOVC 3VGAC 4GAGH 1EVTC 3K2UL 3EOBB 3BPCA 1WTLA 2GEEA 3CLEL 3VG9C 4YHIB 2DRUA 1PG7H 3HZYA 4RIRA 4LKCB 3ZKSD 4QXTB 4KJPD 4FFVC 3GK8L 4XBGA 4TNWK 3DURB 3G5VA 5AEAA 1H9VA 2BOBB 2EIEA 4HT1H 4X8XA 2XWTA 3LKOB 1KCUL 2WBJA 4YE4L 3PWJA 4OF6A 3U83A 2D3VA 3SPVA 2D7TL 4NM8L 4NQDD 2B1AH 5D1XD 1DLFH 1UC6A 1WWAX 1FNSL 1A9BB 4NO0D 1FFQA 4TUOB 4OZ4A 1EZVY 4ODVL 4PBVC 1MJJA 2ARJA 3K4ZA 3V5KB 3FN3A 4OKVB 2JK5A 1BZ7B 2IFFH 1F3RB 4YWGL 5FV2A 5GGUB 1P5UA 4C56E 5BS0B 5IFHH 3EYFA 3QUXA 1I7TA 4N5ED 2P5ED 1R3JA 2OTPA 4Y2DC 4ENED 3N1MC 5MEPA 5E6YA 1C7TA 2AXFB 2YD5A 3GI8L 3EO1B 2F74B 3TBWB 1DBBL 1X4YA 3CH1B 1IQWL 1K4CB 4WI6A 1PX4A 5EIQA 3WFEH 1TJHL 5F8QC 3GKZA 4Y1AD 5KVFL 4GMSH 2P45B 4X7TA 1DN2A 4WFED 1X5ZA 5IW6B 3L5JA 5D7SL 3MXWL 5EZIH 3P0VH 1ZLWH 3IDNB 2VR5A 2W9EL 4POUB 1P1ZA 2AJYH 3HZMB 3V6FB 3D3VB 4PJAE 2OZ4L 5DHVA 3LHPL 4F7TB 3KXFA 3SKJH 3UYPA 4C83B 4UTAH 4HXAL 5CHNA 5BVJA 4GW4B 1Z0MA 4IJ3B 2XA8L 4OZGF 3RTQA 3D2UA 3GBML 2HFEB 5DJ0A 5FUOL 3V7MA 2HLAB 5FYJL 1U8HB 2ZSWB 3CLFL 2BVQA 5C09E 4ODSL 1JWMA 4J8RB 2MPAL 1YMHB 4G3YL 1TVHA 3Q6GH 5E2WL 1ZGLA 1B4RA 2YPLA 1NMAH 2A74A 1G7PA 1YQVL 5FDWB 2X4RA 2J88L 4HUKB 3LS5L 1OCWH 2XNAB 1AO7A 4R0LA 3WFDH 1YNLL 4UV4L 3ZLQC 2YC1B 2ZCLL 1IC7L 3VRIB 2BSED 4OLXL 2D0FA 4L3ED 3AFLA 1MEXH 5FUZH 3WN5B 1NAKH 1U8PA 5JZ7C 2MNUA 3BJ91 3LRGA 3P30H 4WDIA 5I17B 1C1EL 4YAQA 4ONFL 5D70L 1OAZH 1MCWW 4LSUH 5J6HB 1F6LL 4K94H 3DBXA 4Y2OA 4ODTH 5FHAH 3V0VB 4MJIE 4Z0BH 1A7BA 1J0IA 2F54E 3W11D 4FQQA 3U4EB 4RGOH 4I0PA 3RY6A 3WLBA 1AQDB 4XX1E 4IJ3C 1LNUA 1FORH 4Y4KB 3OTTA 4DKEL 4PJBA 3DVGB 1N6QL 1D5MA 2GTWB 1M6OB 2NXZD 3OG6B 4ELMF 1G9NH 3EOAB 4NOFA 1TCRA 1U42A 4PJXF 35C8L 4OGXL 4WW2A 1HHJA 5E99L 3GI9L 3QPXL 4YBHA 1S3KL 3D25B 1BOGA 3KYAA 1RUQL 4KI5E 3W39A 1FBIL 1HCFX 3RX5A 4R4NC 3WN5C 5I1EH 2EEBA 5DC9B 2E5EA 3NCJH 2OSLA 4JN2B 5KS9E 4G80B 2LAGB 1DVFA 2Z93A 2PR4L 3IAPA 1FNAA 2FECL 4M1CD 2JB5L 4HJJL 1P2CB 2GJ6B 4OB5L 1F11A 4AEHL 1CFSB 2C4FU 3HR5A 4QHKJ 3CX5J 1NUFA 4K7PH 4L4VB 1ZTXH 3LH2L 3RU8L 1FGNL 1ITCA 1MRFL 3PWNA 4Y4KC 4E9LA 1MWAL 1QOKA 3IJYB 1YA5A 1TETL 2M2DA 1NKRA 2F53B 1D6EB 5E03A 4UINL 3SDYH 2OJZL 3I3EA 1T7ZA 4G6ML 1ZLVK 2DB8A 3L5XL 4D9QD 3GJFK 1IGFL 1LDPL 5I6XB 4OCXH 3UC0L 5FYLH 3K1KC 1I3RA 5EUOA 2WUBH 1A9EB 4PGCB 5B3JE 5DJAB 2X4OB 3HRPA 2ERJB 1RHHA 3B5TA 1X3DA 1XGYL 4R97C 4BH8A 2DQFA 2EH8L 1LDSA 5CD3B 5DRZB 5ENWA 4F3FB 4MB4A 1UZ8B 1LEGA 1HE7A 5T3XH 3DUSA 2DWEA 4PRIE 1YN6A 4ZDHB 1I3VA 3ULVL 4KRMB 1MJUL 3MO1B 5ECJE 1U2CA 3VA2C 4CMMA 2NXYD 1P4BH 5DTFB 3RVUD 3TPKA 1PY9A 1CFVL 3ULVC 2EYSB 4LLAA 3PV6A 3EIFA 3KYKH 1CGSH 5IMLB 4X6DA 4JFDD 4ZYKA 3OPZH 1NCAL 3QNYB 4JRXD 2EECA 1HSAB 3S35L 5DYOB 4P5KA 1JRHI 4F7EA 4G42A 2ITCB 1ZKAA 2ESVB 4PJ5E 5I6XC 2BP3A 3EHBD 3SGJC 3O6FD 1T04B 3QPQC 3QA3A 4Y4HD 4DVRL 1FL5A 2YPLE 3CDFA 1QBMH 3DX7B 1C5DB 1CICA 1MHPL 3KPPA 5I16A 2MSPA 3ULUL 2ERJC 1CXHA 4X99B 4I3RL 2E6PA 4PJIB 1N8ZA 3HAEA 3MREA 1LO0L 3VFTA 1PKQE 1JCKA 3ULUC 4NRZA 3FQTA 3INUH 4NKOA 2PTUA 2VLKB 4YHMH 5IB5A 3I2CH 5D5MA 5TE7L 5C07E 3X14B 5C0FA 4R8WH 4NNXA 1FN4A 2OTUA 5FM4A 1ZE3C 1I7ZB 3ME0A 2NY2D 3K8KA 2GAZB 1E4XL 4ZS6C 2F5BH 2PYFA 3SOBL 3IXAA 3HI6L 1D5ZA 1AXTL 4DN4L 2VXSH 1XIWB 3MNZB 5D9SA 1KC5L 1CXKA 1T6WA 3PGDA 5HHXL 3SJVD 4YX2H 1I7UB 1MJ7L 2AK4E 5IT2H 1GRWA 4R26H 2FATL 43CAB 2ZOKB 4PP1D 2D0GA 3TBSB 2ARWA 3G6JB 3RPKA 5C1MB 2ZSVA 4K8RD 3DXAD 2F5AH 4HIHB 5F7NC 5E8OA 4X9FA 1KGCE 3MLVH 4PRPB 3CFKA 2ZPKL 3NIGE 1JNLL 3W2DH 1A7PH 5DI8A 1XF5B 3EGSB 1YEGL 1FZKB 2E27H 2VH5L 2Y5EA 3WS3B 3G6AA 1JPTH 1KTDB 2BNQA 1UB5A 1YC8A 5ADOL 3DV4B 2DQUH 1A3LL 3BUYA 3UYRH 4XH2B 3J8F7 5D7JD 4MZ3A 4QRPE 4X9BA 2VXVL 1MLBA 5EZOH 2R23B 4XNXH 2A2QT 1FNEA 1MVUB 2XIDA 1INEL 1XIWC 4KUCD 4DOHE 3H7BA 3NFSH 1VFMA 1AD0A 1XEDA 3SE9L 1NBVH 3TBYB 2BVYA 4F7CA 1YPZB 1A7OH 1T1WB 3KPOB 3HHRB 3SHSA 1RD6A 5I2IA 1RIUL 4Z8FH 5DMGC 1QSZA 4AQ1B 1CVSC 7FABH 5JXEC 4AEIL 1HKLH 4POYA 5J6GA 2E9BA 5IESH 3S5LG 3T4YB 1NCWL 4MLSA 5DJZA 4XAKE 3O41B 3RJQB 1YMMB 4F37K 4QRTB 2R2CA 2HT4D 1T7WA 4EZMA 4KJYB 2ADIA 5D96B 1IAKA 1A6AA 3HC4H 1QSFD 2EYTB 4IRZH 4Y5VB 4LGRB 1JWUB 4MNGB 1LO3H 3QIUD 5F71A 3LPWA 5JMOC 1V05A 3JWNC 1LD9B 2ID5A 2VMFA 5BQ7B 5KVMC 1U36A 1BOYA 2Y06L 3TNMA 4CN4A 1IGJB 4LLMA 3UTTE 2DLHA 4CGTA 3QH3B 5FB8A 4EXKA 4JM2B 4L4TB 5ID0B 1CGVA 3CFCH 4RQQB 4XP5L 1SJEA 3MACL 4KV5E 3SE4A 5AG9A 5F9DC 5I30H 1YJDL 5IROC 3GDBA 1WIPA 5SWZA 2BDNH 1A1MA 4LP5A 1Q38A 2Y72A 4X7DC 3RZCB 3H3PH 1U8OA 1WCQA 4NFCA 1I9JH 3U7WL 1YJDC 2C1OA 4NN6B 1F90H 5HI5C 4XCYB 3BZ4A 3QNXA 4C4KT 5J9PA 4PJHA 3U6RB 1FL3A 1MRDH 1A64A 4Y5VC 1WBZB 2Y25A 4W6YB 1Z0NA 1EX0A 2VLRD 4KDTA 4BK4A 3U0PB 1FSKB 2Z35A 4PRHD 2R56L 1YECH 3MRMB 5HHVH 1MI5D 2ADGB 4O58L 1IM3A 3NZ8B 1EEUA 3FOMB 3PQYD 3ZDXF 2FCBA 4FRWA 5LXGL 4ZUUA 4WFHE 1NGYB 4JM2C 5MEOB 2ZCHL 2X1XR 4X6EA 3F12A 3D85D 1FZJA 1JGVL 4L29B 3MXVH 3MRHA 3KR3L 4WV1C 5F7KC 4LOUD 2Y23A 3DI2B 3OKOB 2WK2A 1FL6A 4MQXC 4QRRE 4BZYA 4BSJA 4XXDA 4YLQT 4FFZL 4EJ1C 3H42L 1RIVL 4V1DD 4U1HB 4M7KL 4Q0XL 3RZCC 1AGBA 3QUYD 4I3SL 2EDHA 5IV2B 4NN6C 4YPGA 4F7PB 4HWBH 3P4MA 4MNQB 2CRIA 1X5XA 4JQXA 2BNQE 4FFYL 1ZWIA 2DQCH 3TN0D 5T1MB 2YBRB 1MCJA 5M95B 1ZT4B 1DSFL 1MAMH 1FNGB 5HYJB 4K71B 5FCSH 3SDXE 4L8CA 4OZHB 5CIPA 1FSKC 2XZAL 3GSNH 3QDMD 5JPMB 5DQJA 3NZHH 5JHLL 4AYFA 1YZZA 3GSWA 4WU7A 4W70A 1CFNB 2FJHA 1RK1A 4BUGA 5EC2B 4NKQB 4OIIL 2YMXH 4PS4L 5C3LD 5DUMH 4MJ6B 1CCZA 5F72S 3FQXB 2R1WA 1T0NA 3WJLA 5L2KD 5DXWA 2IG2L 4Z76B 5I66A 1Q9WA 1DUZB 1EFQA 1PQZB 4OD2B 3UTZA 3JTTB 3GJFA 4WTXA 4DZ8B 1Q8MA 3O6LL 1ZHKB 3TWCH 5CZKA 5IQ7L 5C0AE 5LBSL 5HI3D 4KVCL 4N5UA 1S8DB 4N5EC 5D1ZD 3EZJB 2EDFA 1AKJD 2DIAA 4HC1L 4R90L 5E8PB 4U1MA 3PXHA 5E95B 4BZ1H 2AGJH 3SY0B 1NCNA 1MOEA 3IF1B 4LK4A 4R4FH 3RVTC 3PL6B 3T0ED 5GS3A 1KLFA 3MA7B 1OW0C 4JFPA 3OAZH 1FPTL 3VXMB 2K7PA 1HXMA 1TPXB 5BRZD 4KI5F 4DKFL 1ZT1A 2VITA 5E8NA 1X5KA 1PSKL 2R2BA 3SDAD 5I1LB 1G9ML 1K8IB 4X80H 4X7FC 4PJFA 5J12B 4WUKH 1RUML 4Y2DA 1S9YB 4RA0C 5B3NA 2VYRE 3MZGB 2VLLA 5ALCH 1HYSD 2KUTA 4QLRA 3L3DB 4KPHH 2X44D 1G9MC 4X98A 4P2OA 3KDMA 3RNQB 2VABB 4PP2A 1J8HD 3LIZL 4HCRH 3EOBA 1GGCH 8CGTA 4PJ9D 1IM9A 1QHOA 4YHIA 3U7YL 1NKOA 5F7YC 4LKCA 5TF1H 2GTZA 3LB6C 2NY4D 1D9KB 3O9WB 3PL6C 3QEQE 2BOBA 2X4QB 2UUDK 3PNWB 3LKOA 5GZOD 3SKNB 5GS1B 1ZLSL 4L8DB 3BI9X 2DQGH 1NMCB 3GHBH 4CW1B 1CGUA 5H37G 1A9BA 2CO6B 2MHAB 2QADB 2VIRA 1A14L 1MFBH 2WZPD 1WZLA 3UAJD 1TPXC 5DRXA 4EUPH 2HN7A 1BZ7A 4HS8L 5GGUA 5BS0A 4NC1E 5GGSA 5J12C 2OZ4A 4GMTH 4JHWL 4LDOB 4JM4L 1WIOA 3I85A 4AIOA 4POZC 1OGAE 3QDGD 3T04D 4XCFH 3CD4A 3CH1A 4Z0XA 1OAYL 4LGPB 1DL7H 5HGBA 3MLYH 1YEDB 1ZVSB 1NGXB 1T66C 1FO0H 4GRLD 1UA6L 1D9KC 3O9WC 5ESAB 2IAND 4A6YH 3IDNA 4WNQB 1A3RH 3KLHD 4M8QA 5GS1C 4JDZA 2M1KA 1G7IB 2DWDB 1NMCC 2XICA 3V6FA 4RRPG 2QADC 4H1LG 4I2XB 2JIXD 5KVDL 1Z9MA 4N0CD 3UJIH 3ULSA 5DUPL 1AC6A 4F7TA 3D0VB 3CMGA 2FBOJ 4C83A 4Y0GA 3KJ6L 3FO9B 1U95B 4GW4A 2UVFA 2GW5A 2C3VA 4AG4H 1VERA 1U8HA 2PYEB 2ZSWA 4UT7H 4J8RA 2VXQH 5C2BL 4NQCE 4OFYA 1OSPH 4XVTH 1HNGA 3MTRA 5FDWA 4JJ5A 4M3KB 1B3JA 1MHCB 2DD8H 3NABL 2XNAA 5CJQH 1DCLA 1FYTE 1FFNB 4RDQG 5I1KL 2YC1A 2MQCA 3VRIA 3WFHB 4JO2L 4HDIB 3N1QC 4L5FH 3BKMH 4PJBF 3WN5A 5D4QA 3K2MC 2XKNB 4M48H 3QWRA 5AAMA 3FAXA 4NNPL 12E8H 1L0YA 3RGVB 5J6HA 3RIAF 4C4KO 1ADQH 1IEBB 2P5WD 1DFBH 2CGRL 3V0VA 2VWEE 4UIMB 4WW2F 1A6TA 4F9PC 4U2ZA 3U4EA 1JGUH 5DD0L 1KCVH 3MV01 5DK3A 4P3CH 1P4IH 3LCYA 4Y4KA 5KANI 4RMRA 3DGCR 4O2FB 1G0YR 4ZO7A 2GTWA 4RX4D 4JHBA 1M6OA 1KIRB 4UDTA 1MWAA 4NKDB 3EOAA 1LO2L 4HZLB 3X3GH 2NXYC 4KHXH 4TRPH 3PV7A 4ZXBB 4P48A 4PJDB 1BVLA 5DR5L 5E4EB 3D25A 3H9SD 3DJ9A 4M5ZL 4N0RA 2WUCL 4OLUH 2ITDA 3GHEH 4ESKA 4YHKL 4FZEH 2HFFB 4G80A 4X4YA 5GJSH 3I6GB 3V6ZA 1NUNB 3RGVC 1FDLH 1KJMB 5TPWH 2DF3A 1Q0YL 3C5ZD 3QEUB 4J6RL 1YEHL 2GJ6A 3FO0L 1P2CA 1JFQH 1UM5L 1EO8L 3RDTB 5JO5A 5T3ZH 3TFKC 4XMKL 4L4VA 1IQDA 1DBKH 1ZOXA 2X5PA 3IJYA 2J8UB 1W0WB 2F53A 4RMVA 1ZANH 1V3LA 4O9HH 1BBDL 2QHLA 5TGBA 1QFWI 3WSQL 4LPTA 4ZXBC 4ACPA 1A9EA 1X6LA 5E4EC 5DJAA 1GGUA 3SE8L 2X4OA 5GRVL 1T7YA 4PJCE 2XQYK 5JHDD 4I0CC 5CD3A 3TNNB 4F3FA 2CIKA 3BD5A 5I0DA 5E2UL 4X6DF 3Q3GA 1UZ8A 3KWWB 5FGCB 2PW1A 4JQIL 4DWHA 4X5WB 4NZUH 1QPXA 2VDOL 5LQBH 3H9HA 1H8NA 1VFBA 1U3HD 3FO2B 3RDTC 1XGQB 2PNDA 3MO1A 1I8KA 1SJVA 4ZTOL 1M71A 3D3VE 2HLFC 3EDJA 4N0FB 1UENA 4FQHB 3OXSB 5AUMA 3DYPA 4G6KH 1CBVH 1J0ZA 1JNHA 3L1OL 2EIZB 2EYSA 2MCG1 5EC1B 5FM5M 1QSEA 5E9DD 5CEYB 1XCQB 5IMLA 3QNYA 4QHUB 5DYOA 1U8MB 3IU4H 4RFNB 5HHNB 4JPWH 4JB9L 5GGQH 5D5MF 3MV7E 1T04A 1Z3GH 1IC4H 3DX7A 4HK0B 1C5DA 3KVQA 3V4UH 4H20H 4LSPL 3BAEH 4X99A 1G7JB 2P8LB 3E8UH 1KFAH 1X4XA 4FFWC 2XPGB 4OT1H 4XPTH 3OKDA 5C0BE 2D31B 2E7LC 3BISA 1KBGH 3IFNH 1K2DB 3MRBB 5DJ6B 3X14A 1TQCB 2VNCA 4M7LL 4KKAD 2H3NA 2CRZA 5IFJB 1I7ZA 1E4JA 4X7SL 5TH2B 4P2RD 2GAZA 3GSOA 1K9TA 1G0XA 4HX1B 3KNBA 4JFEB 4M9PA 3V6OC 5HDQL 3V4PH 4TOYH 4Z7VB 3SDDB 2QSQA 1XIWA 1QKZL 3U9UB 4C54A 1I7UA 3EDKA 4EDWH 3MZTA 4KQ3H 2OS7A 1Z9SA 1VGKB 43CAA 4AQOA 1MFEL 1QG3A 2ZUTA 1P9MC 4QWWD 4TNWF 3TBSA 2A9NH 5CJXC 2FGWH 5MI0B 4H88H 1ITBB 4PY8J 4I48B 4HIHA 5JXEA 1WC7A 3P77B 2IH1A 3TV3L 1F2QA 4PRPA 1T1YB 2BY2A 4DGYH 5T3XD 2AJSL 4PV9B 1GGTA 4RGNB 2EDDA 3H9YA 3OKNB 3EGSA 1HHKA 3WV0A 3W0WD 1CDJA 3U36B 4X8JB 1TQCC 1MCPL 3CK0L 3DV4A 4H26B 2WP3O 1YYLH 4QCIA 2B39A 4WUUE 3U0WL 4OV5B 4M61B 5D7LE 3PUCA 3DVNB 2E6JA 3MSPA 5E2VL 4M7JH 2R23A 3T0AA 3IETB 4PB9L 4PB0L 4YQXH 1MVUA 4OV6F 4QF1A 3SDDC 1DQMH 2C5DC 2I60L 2YRZA 2GUOB 4OSUH 5DGRA 3JWOL 3CFBA 5IJKC 4MAUL 3D5OF 3LEVL 4RCAA 4Z7UA 4DEPB 5DFVC 3TBYA 3ZL4H 1YPZA 1IC5H 3ZKXB 1DN0B 2MOVA 4XCCL 2EDEA 3S5LA 5MI0C 5DHVH 4U6YB 5JW4Q 2DKSA 1LE9A 3I50H 3SCMB 2VQTA 1QBLL 2HH0H 4M4RA 3QJHB 1E4XI 4OJFH 3G08B 5IROA 4RGNC 4H8WL 2RR3A 5FO9B 3O41A 1RVFH 4K3GA 1YMMA 5E2TL 1IGIL 1XGUB 1JGDB 4KJYA 4AIZB 4H8WC 4MDJB 4HWEH 5E1HB 2X05A 5IWLC 2LE9A 2AQ3A 3VFGL 4BQ6A 2EYTA 4XCEB 1G9EA 1TNNA 3UJTL 1JYWA 4JHAL 3PP4H 1JWUA 4MNGA 2VR4A 5TE6H 2NZ9C 3FO1B 2H1PH 4U6VH 5BQ7A 3PDOA 3N0PB 5CZVL 3I3BA 3LOWA 4ZAKB 3ZKXC 3QH3A 4ZOAA 1X5LA 4J12A 2XXMB 4JM2A 4L4TA 4M00A 3IRPX 1RZGB 2ESVE 4XT1C 1OAKH 4N0UB 4PJHF 1JRHH 3QUKB 2DJSA 3PWPE 3P11L 2E8ZA 4WV1A 1PG7W 1DBJL 3SCMC 3MNVB 3HC3L 3MUY1 4LCWB 4PJIE 1F3DH 4KXZI 3F7PC 3FOLA 1OT1A 4UDUB 1J86A 3QAZB 3RZCA 1R3KB 4CU8A 3DTXA 4U49A 3VFRB 1QFHA 4X6CB 4U6XB 2VLKE 2E9WA 4XCYA 5EORH 1M7XA 3BVNB 4I77H 3NAAL 3U6RA 4G5ZL 2HKHL 4YFEA 4KKCC 3U0TB 4WI9A 3EDEA 2HTLD 4Z9KB 5LKNA 4IS6A 4OD1L 4ODHH 4WHYH 4M62L 3MRMA 2ADGA 5F6IB 3QI9B 4FG6D 1JPGB 2EEAA 3FOMA 1SYVB 4ZAKC 2DQIL 3UYOD 1DE4B 5MEOA 3IRZA 4OGAC 2MJWA 5GS0D 4L29A 2I9TB 3VD5A 4NQDA 1K6QL 2GKIA 5A3ID 1GGYA 3OKOA 2FEEL 3G6JE 5I1AB 3S7GA 2Z8RA 4K9EH 4XC3L 4Q58C 2XV6B 4Q2ZB 4PR5A 3QAZC 2OLDA 4U1HA 1IT9L 1R3HB 4LSQH 2W9DL 4Q9QL 5IV2A 4LKXA 4MNQA 4TQEH 4E41E 2V5RA 3O0RL 3QDJD 3E1F1 4Z5RB 4HK3N 2YBRA 5T1MA 3IDYB 3BPLB 2O5XL 5HYJA 1N2RB 4RFEA 4HC1A 2IQ9H 3U4AA 1OW0A 1EBAA 4WI7A 1A6ZB 5F6IC 1LQSR 1NH6A 3QI9C 5BW7C 5I8OH 3VWJB 2XWJA 3MLTA 4NUGL 5EC2A 3HC0B 2NY4C 2NY6B 3QCUL 4TVPE 4LPWA 2ADFH 4MYWB 4PJ7A 4Z95L 1EZVX 5EU7C 4Z7WB 3UZVB 1DUZA 4OD2A 1PQZA 2IPTH 3UAJC 4DZ8A 2V9TA 1BWMA 3PIQB 3KPRD 5DUBA 1JHLL 3GBLA 1L6ZA 5KSAD 5E8PA 1Q9OB 3PWUA 3FAWA 4LCYB 3SY0A 4NM4H 2QQNL 3QFJB 3VW3H 4F8QA 1T6VN 3IF1A 2ED8A 4PJFF 3IDYC 3BPLC 2XZCH 3PL6A 2F8VA 5ICYA 2Q8BL 4D9LH 2R69L 4LDLB 4YHLH 2PXYB 4HPOH 4Y19E 3T77B 4NWTL 3MA7A 5D6CB 4P2CG 4AM0A 3HAEH 3HKFA 5DSCB 1OF2B 4FQXB 1OOAA 2CDEB 1RPQA 3MYJB 3BGMB 4HKBA 3VWJC 3AREB 4HIXH 4MLIA 1DZBA 2NY6C 1D3CA 1K8IA 5T33H 4P5TD 3KLHC 4IRJD 5F9AC 1SJHB 2D9QB 3B9KB 3S35X 2R9HD 3L3DA 2MTPA 3MRNB 3NTCH 5JPNB 3T4AB 2VABA 4CUCA 2L0DA 1S5IL 4Z78B 2HA1A 4I4WB 5C0RH 2F19H 4XP9L 4ODBD 2G75B 4GAGL 2N7AA 5C0JB 5D7IB 3EYQD 1D9KA 3O9WA 3LV3B 2X4QA 4WY7H 3KYMB 3PNWA 5HDOA 2JELH 2ENYA 2PXYC 2EH7H 5GS1A 3O2VL 1A1OB 3W5NA 4FABH 2I9LB 2OJEB 5IVXB 5M7QA 4CW1A 2MHAA 1T2XA 4FQXC 5KBNC 4K7PY 3AREC 2B1AL 2OL3B 1ZHNB 3B9EA 3JV6B 3H9ZA 2IGFH 5JXAL 2QL1A 3PWLB 1NEZG 4CNIB 5DEFA 5DRNB 3B9KC 5HHPB 4HFWA 4YFDB 5L6YH 1CDUA 1N7ML 3QHZH 4JANB 2HAZA 3V8OA 5GPRA 1CE1L 2HT2C 2H2SD 1HN1A 3B9DA 5BOPA 3CCHA 4NWUH 3FQRA 1WK0A 3OZ9L 3P4LA 5ANMB 3GSVB 4K3EL 4LIQE 1ZVSA 1HQ4B 1NGXA 1Y6MR 5EFIB 1UQSB 2QR0B 2A6JB 4JVPA 4ZPTB 4WNQA 2O5YL 3VXUD 2VLJD 1DLHA 4OCWH 5EZIL 1G7IA 2DWDA 2ORBH 3P0VL 3HMWL 4I2XA 4YNYB 5IBTH 3T2NL 1JGLH 3RY4A 4OZHE 4JG1H 1F4WH 4FA8A 2DBJA 3LD8B 4F9PA 4D8PB 4DW2H 1HHHB 3D39E 1U95A 3NCYP 3RVVC 3ZE0F 5D8JL 5DD5H 3N85L 4UTAL 3I6KA 2PYEA 1B2WH 1BJ1H 4O2CA 4Z7OE 2KZ1B 1A4JA 4HIJA 4XNMB 4OCMC 2X2YA 4GSDH 3CXDL 1DQJB 4MVBC 2YD6A 1UWEL 1X7QB 4FTVB 1WZ1H 3FFCD 3VD9A 1PAMA 3WS6A 4R4BA 1FFNA 3EJJX 4RMTA 3WFHA 5FHBL 1IGTA 5BMFH 4UT6H 2IAMD 2YD2A 3QIWD 5GZNC 2BSTB 4U3CA 2ATPB 1KN2H 3WD5H 2GJZA 5C6TL 5C0CE 5I1IL 1NAKL 1EXUB 2O5ZH 1EERB 4WRLA 4CRPA 3LQZB 3GMPB 4UIMA 4MA7L 3LD8C 5GS2H 1OAZL 4LSUL 3VXME 1BJMA 3RWIB 1JNNH 1SEBB 3C08H 3NIFF 4ONGH 1OTSD 4JDVB 1KPVB 2KH2B 4JG0L 1NC2D 2VDLH 1Q94B 1A8JH 4XTRD 4Z7QF 3MLSH 4LSVL 4YHNB 4O2FA 3MV9B 1G7QB 1U3HC 1FORL 3UTSE 5IQ9A 2NX5B 3ES6B 1KIRA 4EQ2A 3MJ7B 1T03H 1G0DA 4I1NB 2NW2B 1U0QA 3MLXL 4ZXBA 1EMTH 1LK3H 3O3BB 4RFOH 4U1IA 3OF6A 2AAVA 2E6QA 3AMKA 4UZGA 3RRQA 4WTZA 3ULVF 1RAMA 3RI5K 3N9GL 4F57H 1TITA 3I6GA 4QRQA 5I15H 3U4BL 1BD2D 1KJMA 1UYWH 2EICA 4HFUH 3IKKA 4YR6B 3VA6A 5I1EL 1MFDH 1J0HA 2H32A 1JMZA 3RUGE 3RDTA 1U3ZA 4G6FB 1QLRB 3MRQB 2YXMA 5DVLA 2PKDA 4GFTB 15C8L 4NO3B 3LPGA 3T08A 5BOZG 3PHOB 3GIVB 1OPGH 4O4YH 3ULUF 2VTFA 1TZIB 4G7YH 5CSGA 4MQ7B 4KKAC 2BRRL 3SDYL 2CK0H 4NO5B 3BDYH 5CIPH 3TJHD 5GGVH 2XKSA 4ZMAT 4GT7A 5IEHA 2XG5A 4WEBL 4ALAL 5F9JB 4ONOA 4P59L 2YK1H 3NA9L 1M7IB 1QFUL 5F21B 5IHUL 3D9AL 3MRJB 5E8DL 3TNNA 2R0KH 2XN9D 5SX5H 3KWWA 2OR9H 3Q2CA 1J18A 1S9XB 5BVPH 2E7LA 2HWZL 1ZXQA 1ZLVH 4NBXB 3FO2A 4FQLL 3GJFH 1XGQA 1T0MA 1RJZA 5L88H 2A1WH 4Y5YB 1GHFH 4N0FA 1WZKA 5DD1L 4FQHA 4Y16B 3VCLA 5K9KB 4PJIF 3AROA 1NL0L 4GS7B 5EC1A 4OCSH 4LRNH 1XCQA 2GSIB 4OF5A 3K2UH 4HJGB 5HHNA 3QFDA 3F6LA 3OV6A 5JDSB 1HYRC 5CKAA 3FQWB 5E5UB 3QUZB 3S4SB 4LQFL 5H2BB 5AYUH 3GK8H 1QSFA 2Z8SA 4QOKD 5BZWB 2YN5A 5CJXA 4LFHD 5HPMB 4YE4H 1ORQB 2VE6B 2D7TH 4NM8H 5I1HH 4MX7A 4BJLA 1AGCB 1A6UL 1LO5B 4ODVH 5F7FA 4G8IB 4L9DA 1T1ZB 2WNGA 1K2DA 1HNFA 2WANA 1OHQA 4HLZH 2FB4H 5T1LD 4NKMB 3DV6B 5T3ZD 4Y5YC 5IFJA 3I2CL 3RWEB 5TH2A 3G6JF 3MGTB 2V6HA 4Y16C 1NBYB 1DQTA 4HX1A 2AXGB 3IDIB 3GI8H 4GS7C 4JFEA 4UBDD 3TZVB 1TJIL 2VDNH 1DBBH 3L3OB 3SDDA 4Z7VA 4GAYA 3TGXA 4WI3A 1IQWH 2CDGB 3U9UA 2OYPA 1NDGB 2CK2A 4PLJC 5EH1A 1TJHH 5IJKA 3SE3C 5KVFH 1UCBH 1HKFA 3QUZC 4NNYB 5D7SH 3MXWH 4YX2L 4X7EC 2W9EH 5IT2L 2J3SA 3BZEB 2DQJL 4FHBD 3VI4E 3ARGB 4I48A 2Q6WB 4U6HA 4PJDE 3ISWA 1L6XA 4PRHA 4UT9L 3ZYJA 1KT2B 5C09D 1T1YA 5ACZA 1MI5A 4PV9A 1QBAA 4HS3B 2OZ4H 3PQYA 4O00A 3LHPH 3VFMB 2J8HA 4JCMA 4PLNC 4HXAH 4Z7UF 4X8JA 2V2TB 1A7PL 2WLZA 1YPZF 3QDHA 2XA8H 3GBMH 2E27L 5H94B 4DK6A 5FUOH 1F02I 1MCIA 5FYJH 5IWLA 2CIIA 1DP0A 1OARL 3CLFH 2DQUL 3OJ2C 4ODSH 3TZVC 2MPAH 3IETA 4G3YH 5E2WH 3QUMB 4JKLA 4XRCB 5FOJA 2H26B 4YXHL 4V1DA 3MJ8B 2J88H 5TQ2L 2A9MH 1WBYA 2J8UE 4XNXL 3LS5H 5A16A 1A47A 3T2OA 4HIEB 3VMOA 1YNLH 4UV4H 1IC7H 3RQ3A 3AY4A 3NFSL 4BUHA 3DIFB 5A40E 1Z9LA 2E7CA 5F1SA 4D0CB 3O2DL 4U6YA 3ARGC 2JB6A 2IJ0C 3BZDA 4G8FA 5E00B 1LP9A 3SCMA 3T0WA 4ONFH 1J1OL 3QO1B 3MGOB 5D70H 3QJHA 4GOSA 5GS0L 4XBPB 3KPTA 4FG6C 1I9IL 3G08A 3NCEB 2GCYB 4P2QE 5FO9A 4PBWD 3G6DL 2J1KA 5I8EA 1XGUA 3TIEA 4CVWA 3ABZA 3JUYA 1JGDA 5GS0C 3T0DA 4JM2F 4AIZA 3VDBA 4MDJA 4XI5D 4DKEH 2DI9A 3C60B 3X12B 4KI5D 1N6QH 1TVBB 4XCEA 3HLAB 2X9YA 4GAFB 2BC4B 5F7DB 5FXCH 3MJ6A 2DQTL 3IDJB 3V6OE 1O7VA 1T4KA 2WBJD 4KK5C 5I1CL 2CH8A 1LO3L 1AKJA 5E99H 3GI9H 3QPXH 1PW3A 4QHNB 1KJVB 2VZUA 1RUQH 2EE6A 1FBIH 3MUZ1 3MBXL 2VN7A 1QFPA 4GO6B 4N0UA 1IKFL 4A2MA 3QUKA 3VXSE 4G9FE 4ZFZB 3QUXD 4JFHE 2IQAB 2JB5H 4LCWA 4HJJH 4LVEA 2MKLC 3UROR 4OB5H 4M7LT 3LS4L 4GRWE 4UDUA 5HHOB 1UFUA 4Q6IA 5ESVB 3LH2H 3VFRA 4X6CA 3RU8H 1FGNH 1MRFH 4U6XA 2NYYD 3O8XD 3TVMB 5L7XH 1TETH 4PLOB 5KSVB 2DI7A 3MRKA 3VXOA 4UINH 3MLPA 2OJZH 1RI8A 1F90L 1HWGB 1JMXA 2P44B 3G04A 3BX7C 4G6MH 3NA4A 3L5XH 1IGFH 2DKMA 1LDPH 1MRDL 5LWYL 3OR7A 1WWBX 3UC0H 3WUWB 3QI9A 2N4IA 1JPGA 1EUTA 1KPRB 4LLDA 1SYVA 4PRBB 5E6ZA 5BW7A 3QQ3A 1CD1B 1I85A 4NC0B 3QIBD 1VHPA 3A6BH 4IMKA 4MS8C 5FUCC 3SKOB 1ACYL 2AV7B 5I1AA 2GK0A 1CDCA 3RTQD 3VWKB 2AEQL 5JA8B 3ULVH 4QY8B 4PJ5D 2BZDA 3SBWC 2HTKC 1R3HA 4GW1B 1KTKE 5KSBE 2YPLD 4GW5B 1MREL 3WXVL 1CFVH 4HV8A 5I8CA 4P9ML 4K7FA 1DR9A 4Z5RA 2Q8AL 1AO7D 4PJ7F 5L8LB 1NCAH 1EHAA 5CP7B 3TT1L 2FWOB 3CVHB 4EOWH 1MCCA 1N2RA 2RBLA 3DX6B 3KLAA 2CKBB 5IBUB 5IHZB 3S97C 4J3TA 3D6GA 1A6ZA 1J7VR 3O4LB 4URTB 4DVRH 4I0KA 2UVEA 4D9RE 1MHPH 1OP9A 2VKWA 3VWJA 5CAYB 3ULUH 5GISL 3HC0A 3IS1X 4I3RH 5IVZB 4XPHL 1E4WH 2CXGA 2IANA 4OZFB 2R0LL 3VGGA 3NFPB 3QXTA 3MFGB 1YEEL 5L8JB 43C9B 4Z7WA 3ZTJH 1MUJB 5ABDE 2YA0A 3VWKC 4RAVB 2SEBA 4PUBL 1FGVL 4QXGL 4KWUA 1BWWA 3PIQA 3BQUB 2NMSA 2AK4D 1RJLB 5DO2D 5JUEH 1F4YL 1E4XH 2CKBL 4PY7A 3DX9A 1Q9OA 4UQ2A 3UDWC 2X70B 3HI6H 3QFJA 1AXTH 4DN4H 1KC5H 5BZDA 4YXKL 5CJBA 4IRSD 4J3SA 5HHXH 2PXYA 5DJ2A 3ZE2E 1MJ7H 5DSCA 4G8EB 2GI7A 4PRNB 4ZFOB 4LPXA 2FATH 4FQXA 3HE7D 3MYJA 1X4ZA 3BGMA 4LVHB 1KN4L 3AREA 5EU6E 3HE6B 2A83B 1R3LB 3OKKB 3GRWL 5EBLB 1G7HB 1UKSA 4QRPD 1TMCB 4NHUB 2ZPKH 5B4MD 1SJHA 1JNLH 3B9KA 1J87A 1YEGH 2VH5H 3MRNA 4WUKL 2EXYC 4LF3A 4OD3L 5IUSA 4IOFC 5ADOH 3T4AA 5FIEA 4JQVC 4RISL 4KPHL 4Z78A 4PV8B 5HHMB 3DROA 1GZPB 2VXVH 4EUPG 4PGZA 4HCRL 3BH8A 2HVJB 4KXZH 1INEH 5D1QB 4CDGC 1RZJC 4YK4B 3CSPA 2BERA 4RX4A 1A1OA 1EPFA 3WE6B 2I9LA 2OJEA 2X41A 5IVXA 3SE9H 5T1KD 1N4XL 2RFXB 5C6PB 1BREA 1JK8B 5K9JH 4LVHC 1WEJH 3GGWB 3HE6C 3GHBL 3GSQB 1ZHNA 5DMIL 5KAQF 3JV6A 3AXLB 1OP5K 32C2B 4AEIH 3KPSB 3PWLA 4WTWA 4CNIA 5HBBA 4N1HB 4KJWC 1NCWH 2VAAB 2UUDH 1XR8B 2QLVB 2BY3A 4Y4FB 2H2PC 1D5XB 5HYSB 3ROOA 3MRGA 1OB1B 2Y6SD 5FV1L 1NUGA 3MRCA 4FXLA 3GSVA 5ANMA 4NQEB 4XGZB 4XCFL 1HQ4A 4YHPB 2CLZB 2DL9A 3EDFA 5EFIA 2J6EL 1UQSA 2QR0A 4JPIA 5D1QC 2A6JA 5LG1A 2C3XA 3V5HB 1G1CA 3ETBF 4PREB 4OGYL 3QISA 4PJGE 3UP1A 1ORSB 1VEPA 2Y06H 3KJ4B 3VXTB 1A3RL 1S78C 4YNYA 2QSCH 5KZCB 1KB9J 1KCLA 4RAHA 1KYOK 1FAKT 1CFBA 4XP5H 3MACH 5SWQB 1ZAGA 4IM8A 4D8PA 1HHHA 5JHDA 3UJIL 2K7QA 1JN6B 4RNRB 1YJDH 1HINL 3PGFH 4XNMA 3BFOA 4Y4FC 1U3HA 1DQJA 3SKMB 2DBLL 4FTVA 4NQTA 1TCMA 4GUPA 4UT7L 3HUJE 4WFHD 3BE1L 3BKCH 2KBGA 3ALWA 4XVTL 5KSUA 2CLRA 5JW5B 3IDMB 4W6XB 3WXWL 2XTJE 1U8IB 5E9DA 3FN0L 4M6AA 2BSTA 1U92B 4OCYL 2R56H 5GRYA 3L5IA 2ATPA 3MCKB 4O58H 4IMLB 3KJ4C 2PETA 3MV8E 3TJHC 5LXGH 3S98A 2H9GB 4M48L 1ZSDA 1JGVH 2YSSA 3GMPA 4NJ9H 4C56B 5D2LE 3BP7B 2DLFL 5HY9B 3KR3H 1IJ9A 2KQMA 4ZOBA 3RWIA 1JYNA 1RJCA 3NFNB 1ADQL 2BNQD 4JDVA 3P0GB 4FQJL 1BX2B 4LFHG 1KPUB 4FFZH 2JJVA 4YHNA 5FKPB