5I8KH

Hhh1 fab fragment
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
218
Chain Sequence
b'EQLVESGGGLVTPGGTLTLTCTASGFTISNYHMSWVRQAPGKGLEWIGFIDTGGSAAYAPWAKGRFTISRTSTTVALKITSPTTEDTATYFCARGAPAWGTANVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDRRVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HHH1 Fab Light chain
publication title HHH1 Fab fragment
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8kH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8kH01
4GAJH 3FB7B 4DVBB 4FFWC 3S9DB 1WSST 1HHGB 4XPFH 2PTVA 1YEGL 3TC9A 5IV2B 1I8KA 4TSBL 3VGBA 4N9GB 1AO7A 1XH3A 1KYOJ 1OSPL 1X5XA 4WDIB 2QQLL 1JZ2A 4NO0A 4O02H 3PWLB 4FQCH 5T3ZH 1OOAA 1YQVH 5DMIL 3DWTA 3DMMC 2VLJD 3ZE2F 4FZ8L 4OIAA 1RK0A 5IHUL 4HIEB 3UTTA 5DK0A 1N3NA 5CEYB 4HX1B 1YY8B 4XPGH 3GGWA 4R7NB 4XWOD 1G7HA 4FQHA 2BSSA 4BFGA 4U49A 2H8PB 4PJ5B 3TBTA 1IL1B 2VUYA 2HYMA 3KYOA 4O5LH 1RK1B 1XGQA 5T3ZD 1QA9A 3B4NA 2A6DA 2D9QB 2B4CH 2ZSVA 3LRHA 2RR3A 4JDVB 2DOCA 3NIDE 4NJAL 5J11C 4LHUA 1NUNB 5C09B 3QEHA 3GB7B 3SOBH 5BS0E 5FB8B 1T1ZB 1PFCA 4KI5C 4LIQE 5ICYA 5C8JA 5H37G 1EHAA 1RULH 3OMZA 3PWPE 1F90L 5J57B 1NLBL 4YDKL 3JV0A 4I3RL 5INCB 5HHQA 3GSWA 1M71A 4NC1E 3I02A 1BD2E 5J1AB 3BH8B 2CMRL 3O8XD 1NMAH 1BFVH 1D9KD 3C5ZD 1RZJC 2X4QB 1U8JA 5C0EB 1XIWA 3TVMD 4Y5VC 4E5XB 1WZ1L 4FQXD 4UOW1 4N0CD 4PREB 1N4XL 2ZG1A 2D0FA 3IXAA 1IC4L 4M8VA 1RURH 2RFXA 5FM8A 1N2RB 2YC1B 1CG9A 2DKMA 4ZUVA 4LGRB 4FQQB 2P8PA 4LDEB 2YA1A 3CFDB 3P0YL 5BJTB 3CMGA 3MREB 1JE6A 1ZA6A 3WDIA 1OTSD 2QSCH 3U2SA 3IDJB 3LH2H 1EEYA 4U1SA 4QRPE 1AH1A 3MNVB 3ARTA 1G9NH 5KSBE 4Q9QH 5DD0H 1SMAA 4GAGH 5LAXB 2EZ0C 3BVNA 1HQRB 2JELL 4ONHA 4PRIA 4ZS6C 3ILQD 1RZKH 4JAMB 4PJBB 4OCNC 2YWZA 5KVDH 4ISVA 3MO1A 4KJQD 2A73B 4JGJA 4JRYA 4OFDA 3HC4H 1A6TB 1CXIA 3QCUH 4BQBA 1FDLL 4OI9A 3L5IA 3UPRA 1DTUA 4NC2B 5L8KB 4OZIB 1SYSA 5I71B 3BIKA 3MA7A 4CMHC 3LMJH 4PJCF 1UZ6F 2MNUA 5JHDD 3BQUD 4MA3B 4CNIB 1NCAL 1V8HA 2NY5C 1CBVH 3SDDD 4UOW0 4EUPH 4F7EB 3IFPB 5FYJU 1OAYH 1GOHA 1VSCA 4G9FE 1B2WL 1F4XH 3HAEH 1K4CA 5FGSA 3FAXA 1XF3B 1KPUB 5JO5B 3OXSA 1IGTB 3G08B 1P9MC 1K8IA 1QO3B 1MJUL 3LPWA 5E00A 3I6GB 1CL7I 4JY4B 3VDBA 3RIFF 4CU6A 1FORH 4WW2C 4MLSA 3C2SA 5JW3H 4ONFL 4M7LH 4JZOA 4ONOA 4C57C 3VRIB 5GGRB 4M61B 1AP2A 2ATKA 4QHMA 5C0RL 1ZMYA 1YDPB 5FOJA 5E8DL 4BSVB 2B8OT 4HH9B 2VDML 1CDUA 4LHJB 5F3HA 4CGTA 5FHAL 4N8VG 4B7LA 1LP9F 3GK8L 1JWUA 1SM3L 1S7RB 5EOTA 1CFNA 3WHXA 2DM4A 3G5YB 4K9EC 4WI4A 1MHHB 2FCBA 3QUYC 1S7UA 3LAFA 3VG0H 2OP4H 3TIDB 3TBWA 2HJLA 3L5XH 2DL2A 4G3YH 3U4BL 5CJ8A 1UJ3A 3C09B 2C1PB 2ZUVA 3I3DA 4XP9L 2VDNL 3RJQB 4TULL 4Z7NF 2PTTA 3G5XA 4IDJH 1TETH 4PRPB 1N6VA 4QGYA 1F13A 4G8FA 1AXSB 1U9KA 5EU6A 3VXUA 5A2IH 4YXKH 5IUSA 2W65B 1MCIA 3UZVB 5HJ3B 4YHZL 3KS0H 1Q1JL 4XZUB 5E6ZA 5CSGA 5L8JB 1U8OA 1KPRA 3DNKA 3MX0A 3ET9F 3QHTC 2D7NA 1UWXH 2K9UA 3RGHA 4BFBD 3BGMB 5A2LH 1DBJL 1J8HB 4S10A 1AE6H 2FHCA 1LWRA 4GRLA 4UDUB 4HKXA 4JKMA 1UVQA 4KTDH 4ZSOA 1I9IL 3H7LA 1IGIL 1XZ0B 4J3VA 3IDYC 3I6KA 5TE7H 5T1LD 3DUSB 4JG1L 3IDNB 2XFXA 3PWVA 1JHKH 1MF2H 3TNNB 4HQQL 4RGNE 3K1DA 3V52H 2WBJC 3CZJA 3RRQA 4IOSD 4J23A 1S7QA 1YYMH 1Z0MA 4LSUH 4XAWL 3ZYIA 3N0PB 3D39B 1WBYB 4G8IB 2V9QA 5FYLL 3HZKA 1AGCA 4FP8H 1DQMH 1T7WA 1R3JB 1JPGB 2YRZA 2PCPB 4WVRA 4ZOBA 4TRPL 5DEZA 5F7EL 1FAIL 4OGZA 1NAMB 1VFAA 4X6EA 4EDWL 4QGTA 1W72H 2ED9A 4GQ9L 1SVCP 4NPYB 3QT2A 3VD3A 2NXYB 2CUIA 2IALB 2F5AL 1ZT1A 3LQMA 3HG1D 3O2DH 4R26H 4M62L 3T04D 4PRNA 3QDJB 3JWOH 5JOPD 2IQAA 2NZ9D 4D0BB 5HXMA 3BWAB 2FX7L 2PYED 3VFRB 3ZYJA 1Z5LB 4LSTH 3HA0A 3JTSB 5CJXA 1LO3L 5J1SC 3VXNB 2J8OA 4NNPH 1OT1A 2H45A 3UX9B 4NZDA 5IT2L 4CUCA 4NKDB 5HHOA 1MJJA 2DQDH 3BHBB 4PJ7F 4WWKB 3TJHD 4HUVB 4X8JA 5IBTL 3VXRD 1CD1A 5EUOB 5SX5H 4P99A 5DUMH 3QXDA 4EQ3A 3D0VB 4JFZL 5C92A 1J12A 4K71C 5DJZA 2YN5A 2Z8WC 3QRFM 4HC1A 2Q86A 4AH2A 1OW0C 3STZB 4Z76A 4HF5H 3PV6A 3P4MA 4LHUG 4M9OA 1G9ML 3CLEL 1I1FA 5GS1C 1LP9A 5I15L 1KIPB 5I30L 4F33A 1TVBA 5F72S 4NZTL 3OKLB 4I0PA 3L3JA 4WIQA 5SV3A 3WFCH 3QDMB 5JW5B 2GK0B 4KK9C 1IAKB 4P2RA 1IEAB 4UQ3B 1FZMA 4GW1A 4L3EA 5I73B 1V5JA 4FFWD 1BBDH 1F4WL 4MHHI 1MFDH 4O2CA 5E1HB 4I3SL 3BKMH 5C9JA 4HS6B 3FFCD 3W9DB 4C83B 1PG7H 1H5BC 2BNUB 5IB4B 3MRDA 3BP4B 3MRCB 2J1KA 3IGAA 5DURB 4HPYH 3T0VA 3DMMD 1QD0A 1T2QH 3GIZL 1ZHLA 3LKQA 3ZTJH 1DANT 2VLJB 2GJ6E 2CLVA 2EDHA 1SHMA 1DEDA 2ZG2A 12E8H 1Z2KA 2LU4A 3LS4H 1MCRA 5D7LA 1JGUH 5FOBB 1S7WB 1BOGB 4XMLH 3PHOB 1BEYL 1RUKL 5D1XB 1MFBH 3QPXH 1V3MA 3IJSA 4LAQH 5DMGC 4NQDA 1J0ZA 1X7QA 1KELL 2X44D 3BW9A 3LS5L 1RZJH 1LE9B 3PP4L 3UYOD 2RCSL 4EIZC 1I8LA 4L4VE 1QG3A 4OGYH 4XXDA 3TYGH 4GW5A 5BQ7A 4KI5D 2XTLA 4HMCA 4Y5XC 1YNTB 3QAZC 1S9VA 3ZDXF 4LLMA 3L9RB 4R7DA 2QKIA 1Z9OA 4PGDA 1KJ2A 4MA1C 3CK0H 4C56A 5C0CD 1AQDB 5E2VL 4F3FB 4JY5H 3BZFB 5I6XB 3OR6A 3L95A 1FO0A 1IARB 5IF0A 4KRMB 1XGYL 4M6NH 3L5JA 5FO9B 43CAA 3QNZB 4HS8H 4F80A 2B5IC 5DD3H 4EI6B 2E7BA 4PY7A 4XVJH 1GOFA 3TIEA 4P4KB 2R0LH 1V05A 3C60C 3MUJA 2YKLH 4LBEA 5EO1A 2V5MA 5CHNA 3DURB 3LKPB 2CKNA 4DEPB 4PV8A 2BHYA 4DN4L 4R90L 3S36H 1EHLH 1YMMA 2VLLB 3G6AB 3FB7A 1H3VA 4JFEB 5BRZD 2EZ0D 5IFAH 5ITBL 3RA7L 4DVBA 2IPKB 2EDLA 4Z7VF 1BQSA 2GJZB 4ZS6D 4PRHD 5FIEA 2NY5H 25C8L 5IV2A 2XQBH 2YK1L 4E41D 4D9QE 1QFHA 1KUMA 4HMDA 5FM5O 4WDIA 4Z7OE 1BX2B 2NTSP 1OGAD 5F9JB 1CE1L 4L8BA 3PWLA 2VDQH 5IJKA 5DJ8B 5HYIA 1I8IB 3VW3H 1FV1B 4YUEL 1D5XB 5I1EL 4HIEA 3SEPA 4OV5B 3RPIB 3WXVL 1EO5A 3C8HA 3WNOA 5E9DD 4L5FL 3X13B 4NBXB 3A6CH 4HX1A 1YY8A 1S5HB 1IGYB 4R7NA 2O93L 5D5MF 4EOWL 3H9SD 2H8PA 5T3XE 3N06B 5D2LF 2YD3A 4PJ5A 5ICXB 2VB5A 4LVOC 4I18A 3WJJA 1RFDL 1RK1A 4O58H 3KS0J 2B2XL 3K74B 1NGPL 4S11A 1U8IB 2VQUA 3QO0B 4JDVA 1NSNH 3WXWH 3JUZA 4JR9L 1ZAGA 2XI9A 3MRLB 4JHWL 5C09A 2DIBA 3MODL 3WJLC 1FGVH 5FB8A 3KPQB 3D9AH 3F7PC 1T1ZA 5EOQL 4K9EH 5KSAC 1M05B 2GHWB 2DQFB 4WU7B 1WEJH 4X9IA 4YHMH 2Q3ZA 4GW4B 4P46C 5EBLB 2WINA 5INCA 5J1AA 3BH8A 1YEKH 2APBA 4APQB 2X4QA 5C0EA 4G8GA 5IJVB 3HC0A 4E5XA 3QXVA 2DTML 4RFNB 4PREA 2OS7A 5BO1H 3TN0B 2P48B 5I1IL 4NC1C 5SWZD 1N2RA 2YC1A 3QUYD 4HLZG 2C3XA 3A6OA 3UJIL 2NY4B 3QG7H 4P49A 1KLFA 1MJ8L 3CFDA 5DLML 4DFIA 5BJTA 4NM8L 4YH6A 3MREA 4XX1G 2X4NB 2FD6L 2JE8A 5GJSL 3NCFB 4M6ML 2Y9RT 3MNVA 3QFDB 3HR6A 1L7IH 1AI1L 2ICCA 5IGXH 5LAXA 5F1IB 3U7WH 2NY3C 1OAQL 1HQRA 5AWNL 3VXPB 4AQ1B 4NYLB 3ALPA 3IDIB 5B38B 3VFTB 4FQIH 3MJ9L 4JAMA 4DK3A 1QLFB 4RCAA 4UT7L 3V5KA 1JVKA 1JF6A 3D3VE 4F9LA 3AS2A 2A73A 4JFDB 1OL0A 3KPRD 4D2NA 2VOTA 5EB9A 3RY5A 1A6AB 5D7JC 1AGDB 5LVEA 3PHSA 5M7QA 3VDAA 4OZIA 4NFCA 1A4KB 3L7FB 2QJDA 5K59E 4YPJA 3CGTA 4PS4H 2ZUSA 2VR5A 1BZ9B 3VGHA 4MA3A 4CNIA 1KCRH 2F8OA 3U9PH 2BNQE 2WBJD 4JY6B 5HHMD 3ARXA 1FG2B 3I3EA 5E94B 4G6AC 2ITDB 2ZJSL 4K3HA 4F7EA 2QQNH 3IFPA 3AC0A 2W0PA 1DANU 2GK2A 5INDB 1OF2B 2BSED 4CU7A 4JDTH 5D2NB 4GBXC 2VJXA 1XF3A 1KPUA 5JO5A 1IGTA 3G08A 4JM4H 3I6GA 3EGSB 4JY4A 2YPLB 3D87B 5EUOF 5ERWA 2EC9T 3ARPA 4P3CL 3D85D 5C0BD 3CU7A 4YHLL 4M61A 3MZTA 4KRNA 5BV7L 3EDDA 4WUUB 2LVCA 4BSVA 3U48A 2J8UB 4HH9A 5IFHL 3V0WH 1CLZL 5J6GB 1CXEA 2F58L 5JXEA 1EFXB 1VPOL 2K3TA 1CFSB 1HINL 3DX8B 3SDYH 1WK0A 1S7RA 5LJYH 3VXSE 2R39A 3T09A 4PV9B 5T1KD 4ZAKC 1RZIB 2IBGA 4YX2H 2HTKC 1JZ4A 1ACYL 3E1F1 5ACLA 1QRKA 3BMVA 4JPKH 4KMTL 3O6MH 1EA9C 1K3ZA 2C1PA 5CIPB 1JPTH 1TJHL 1BFSA 1KACB 1I8MB 1CT8B 4XWGL 3KXFE 4KY1H 1MRFH 2ADIB 2W65A 5HJ3A 4MSWB 1WZKA 1HN1A 4MD5B 1N6UA 2W9EH 4L4JA 5E6IC 4XC3H 4HDIB 5TE6L 2DMKA 1MCCA 4AL8H 3B8YA 4U6YB 1AJ7L 1RVFL 3BAEH 3BSZH 4KK9D 5DFVC 3RWDB 4Z7QE 1IC5L 4PRDB 1J8HA 2HLFC 2AVGA 2FECL 1IGCL 2OR9L 1XZ0A 4L29B 3IKCA 5DRWA 1QBLH 3AB0C 3IDNA 1OP3H 3H42H 3TNNA 4F8QA 2KDGA 3BRFA 4KUZH 1BQHG 3TFKC 2ADFH 3B43A 1RUAH 4UDTB 2R2HB 4TN9A 3D39A 1WBYA 4G8IA 1IMHC 4DUXA 4KK8C 1R3JA 4UNUA 3U79A 2PCPA 3QUZC 2JK5A 1NAMA 2X05A 5ALCH 4LLUB 4NPYA 4TOYH 4XNUH 2D7TH 1IEHA 3SHSA 2IALA 5IESH 4IRSC 1CLCA 4EBQL 3N85L 1HH9B 5I1CL 3V6OE 4MQSB 4Y4FB 4KGLA 1JPST 5DJ2B 1DJSA 4J6RL 5DMGD 5FYJE 4EXPX 2JIXD 3SGKC 1C12B 4D0BA 5DD5H 2LFGA 3BWAA 1N6QL 3VFRA 1Z5LA 1OM3L 1KENL 3F62A 4LCUA 3I6LD 4NN5C 2H32A 3JTSA 4K3DL 2W9DL 4DKEH 5DTFA 1OSZB 1A6WH 3TO4C 1SY6H 1YYLL 5FGBC 2CXGA 3VXNA 5FF6B 3OR7B 5F44A 5CKGA 2NX5B 4YHKL 1T6VN 5FV2A 4NKDA 3VJ6A 3ZHDA 4MJIE 2IBZX 4PJFF 2XZCH 1MH5B 2BNRA 2X7LB 2XN9B 4WWKA 5T5FH 4CW1B 4HUVA 2DD8L 5EUOA 2CGRH 3FB6B 5C0CB 3D0VA 3D2UD 2UWEB 4KRPB 4IMKA 4KDTC 4QRQA 1CVRA 4LCIL 2K1MA 1EXUB 5D71L 1KJMA 1NCWH 4HGWB 4PJGE 1OP9A 3RHWK 3QCVH 4N0RA 4E9LA 4UNVA 1UEMA 3TJEH 2GT9B 5IFJB 5GPRA 3UP1A 3BISA 1LK3L 3NA9H 1NANI 2XZQH 3C60D 3MRGB 4TNVF 1KIPA 4FA8A 1WTLA 3O4LE 1QHOA 5EC1B 3OKLA 1PYWB 3KR3L 4NKIL 4JFHD 3QDMA 1CGUA 5EOCL 1U3ZA 3GJFB 1IFHH 1IAKA 4KK6C 1KF9B 4QTIH 4GAFB 1L7TL 4OUUA 4LSQL 1BMGA 1J11A 5TDOB 3EZ8A 3LIZH 4BQ9A 1MAMH 2NYYC 4ZFZB 4YE4L 2FX8L 4HKBB 4HS6A 3EKCA 3W9DA 1G0YR 4C83A 1NFDE 2BNUA 5IB4A 3BP4A 2VYRE 3MRCA 2ZCKH 1IKNC 3OXRB 5IR1A 4BZ1H 1JRHL 2R29L 1OGAB 2EE9A 1VENA 1N59B 1EO8H 5CZKA 2VLJA 1FL6B 2Z31C 2DQHH 5C08E 4CMHB 1Z3GH 3K81A 3LPFA 1G6RL 3EO9L 2FJHB 3L1OH 1IE5A 2ORBL 4G42B 4PP1C 5FOBA 3GMOA 3CU1A 3PP3K 5D1XA 2UZIH 3FQRB 3MRKB 2R1YB 5CLTA 1XF4B 5IEKA 1RPQA 3ZKNC 4OCYL 4F9PA 3MV9D 4NZJA 5C9KA 1RIHH 1MRCL 1LE9A 3PGCB 4LIQH 3TBYB 4CJ1A 1X5FA 2DI7A 5DVNA 3HE7B 5KSAD 5FCSH 1VACB 4H8WL 4WW2B 1YNTA 3TT1L 4G7YL 4P46D 3ARBC 3L9RA 2DQJH 4PJEE 1U93B 2C9AA 3ROOB 2R0WL 1AQDA 2N56A 3M45A 3BZFA 1WGOA 2HH0L 3OPZL 1VERA 4P2YA 3C5ZA 1FNSH 1HWHB 3PWPD 1VHPA 5DQJB 3QNZA 5EN2A 1TPXC 2VXSH 3B9KC 5H35B 3Q1SL 4EI6A 2XA8H 4YK4B 1UXSB 4MXVE 1BD2D 1EAJA 4P4KA 1G84A 3AM8C 2H2PC 3QUYB 5ICZB 2VIRB 2G5RA 4HK3N 1HWGB 1DFBH 3LKPA 3DI3B 1RJLB 3PDOB 3GBNH 5JIPA 3BX7C 3DUUB 4LPTA 3R0NA 1A3RL 3T8XA 3UBXI 2VLLA 3GMLB 3G6AA 4PJFA 1CI5A 1BJ8A 4JFEA 4ELMB 1KCVH 2H1PH 5AD0B 2NY3D 3N50A 5KOMC 3N9GL 1T89C 2R2CA 3RBGA 2GJZA 4X8XA 4M7ZC 2D4FA 2WP3T 4Y16B 5TF1L 1TQCC 3GBML 5EZOL 1JNJA 4QRPD 4TSCH 3SKNB 1BX2A 3N1QC 3NCYS 3ARVA 5F9JA 5FO7A 2X40A 1MREL 1IQWL 2IPTL 3WIIL 2QEJA 4XH2B 5D7JD 4C4KO 5DJ8A 1TNNA 4M02A 5CMAB 1I8IA 1R24B 4JRXB 1ND0B 1DSFL 1FV1A 3T1FB 1D5XA 4W4OC 1GJIA 3RPIA 4Z8FH 5JPNB 5FYKU 3X13A 1A7RL 4BH7A 1INEH 2J8UF 4OZHE 1NGZB 1IGYA 3F7VB 4IJ3C 5DGQA 5JHDA 2VN7A 1KN2H 4G6AD 5HHMB 3SDDA 5ICXA 3CVIL 4EI5C 3HS0B 3ZDZF 1YEFH 2CJUL 4GBXD 4JCMA 1UCBH 3D25B 4PLJC 1MHEB 2IMNA 3VI4F 1U8IA 1I1CA 5GS0C 4IBLT 3QO0A 4M1DH 4NRZB 2X1XR 3MRLA 4Z7UE 4Y1AE 3MOBL 1RUQH 5KVGH 3JV4B 3KPQA 3OKOB 4OTXH 1M05A 4G9FD 4J3OC 5DQDL 4H26B 4UAOB 4MQTB 3VWJC 3LV3B 4GW4A 4OLXH 5EBLA 5A2FA 3D85B 4JHAL 4RRPG 5C0BB 3WL9B 4EUPA 4U1HB 5FUZL 1CDBA 3M07A 5JIHA 3B5TA 4A6YH 1K9TA 1XCQB 2NCMA 5I18H 1ROWA 1QKZL 1W0YT 5E8EB 4APQA 3QUML 4N1EA 4R4BB 1CWVA 5F8RC 2EECA 3EYQC 5DEGB 5HI4C 1SEQL 1XMWA 3ZE1E 3MLXH 4ZAKD 2HTKD 5B8CA 1NBVL 3EJJX 5T1KB 5JW4N 2GY7B 1YN7B 4QHUA 3RNKB 5C0IB 3RDTB 5HDOA 4U6TA 1ED3A 3VFVB 4HJJH 1FN4B 1F97A 5F1IA 4E42B 1YUHB 3GJEB 3VXPA 1KB5H 4DGYL 2JCCE 2C5DC 1Q9LA 4GKOA 4NYLA 4QXWA 4PFEA 3MUY1 1QLFA 4FQJL 5E6ID 3UTSE 5CBEA 1AXTL 3UXFA 4F37F 4JFDA 4PJXB 2IEPA 5DFVD 5L2KE 1FGNH 4OKDA 4ERSH 2HLFD 2EEAA 1VGKB 5EWIL 4JFYB 4WHTB 1AGDA 3PWNB 4MDIB 3RTQC 5DR5H 1A4KA 1JK8A 5E08H 3CDFA 3L7FA 4X98B 4U7SA 5E7BA 4XHQA 2XRAL 3ZSSA 3VRJB 4JY6A 1KIQA 4LRNL 2BC4B 1FG2A 5E94A 5IBUB 3TFKD 2X9XA 1H5BB 2VDRL 3RVUC 4J1UB 4M9PA 3PXHA 2FO4B 1T5XB 1OAUH 3QSKB 2R0ZH 4FTVD 1AO7E 5INDA 4DGVL 1OF2A 3PJSB 4KK8D 2XWJA 5D2NA 1J5OL 3CFCH 4KI5F 3QUZD 4YGVA 1ZSDB 2Z0BA 1I1AB 5AAWA 3EGSA 1CXHA 4ODHH 3SDXE 2YPLA 3RZCC 3W5NA 1DLHB 1HHHB 1CR9L 3UTTE 3MBXL 1FIGL 3T2PA 4IRSD 3GRWH 3JWDC 4J8RA 2AS5M 5C7XH 4RSVA 5I17B 3NGBB 4R4FL 3KLHC 2J8UA 1T5WB 5SWQA 3BN9C 2JB5L 5J6GA 3WN5B 1T1XB 4MXWH 1NLDL 5EZJB 1KN4L 4XVTH 3IETB 1OD9A 2EDQA 3TO4D 1DQLL 1T83A 2IAMB 4YPGB 4F8TA 1RZIA 4W4NA 2E6JA 4ODVH 3ZDYF 5DMKB 5EZIL 2XPGB 4U6XA 4P9HH 4UIKL 3SKJH 5A16A 5CIPA 5E4IA 3KPPA 4GRWE 1U3JA 2HKFL 1I8MA 3T08A 1H3XA 4ZFGH 4XPHH 5BVPH 1CT8A 2BFVL 3JZ7A 3GEWB 4HZAA 4WRLA 4G6ML 4NQTA 4JDZB 4G6KL 1ZGLP 1CL7L 3KPOB 3QQ4A 4MMXC 3FZUC 4MD5A 2H41A 4MLIA 1H3GA 5ISZD 4HDIA 3C60B 1M4KA 3QIBC 3AU1B 4U6YA 1KB9K 5BW7A 3RWDA 1JYVA 4NGHL 4PRDA 4HXAH 4KK6D 3RL2A 4DOHB 5KN5B 2A77L 1YA5A 4WEUD 4M7JH 4L29A 3DVFA 2NYYD 2CIIA 1NMCB 3NCBB 4U6VL 3GSNB 3OAZH 2EO9A 2CRMA 2YMXL 1T7VA 1A2YB 3CVHB 5DVKA 1MHPL 4BK5A 4WO4C 1T03L 4RFOH 5D70L 2Z91B 1KFAH 2I9LB 1JHLL 3QQNA 1AKJB 4J3WA 5HY9B 2OM5A 4WW2F 3V5HA 1AQKH 4PJDE 2Z31D 3ARFC 4ZFFB 3LN4B 3RIFK 4LLUA 4L9DA 4K94L 5DDHB 2W0FB 4PP1D 2B39A 2EH8H 4ZNCD 1B0RB 1HH9A 4PB9H 4P9ML 4Y4FA 3ZKND 4WW1B 3IFLH 2HTLC 2GJ6D 1A3LH 5ABDE 5CZVL 2CDGB 5MEPA 2UY7A 3KGRA 4BFEA 1ERNA 1C12A 5C2BH 5IMLB 2WWMC 5JW4Q 4DTGH 4MHHG 1R5VB 3UJJL 1RMFH 1XT5A 3V6OC 3UJTH 2LQRA 5KJRH 2RAMA 5DUPH 1MELA 5CBAB 5FF6A 3OR7A 5KSAB 4JGUA 1KTDB 3ARBD 3BDYH 2X7LA 2XN9A 3FOMA 2XZAL 4L4VD 1VKXB 5DZOA 3FB6A 1AGBB 5C0CA 2UWEA 3HFML 1NDGB 5BS0B 5I1HH 2OJZH 1YQ2A 4Y5VA 1EXUA 1FAKT 3H3KA 3B9KD 3BKJH 1MCDA 5D1ZB 2GT9A 5IFJA 2H2PD 2RGSA 4O02L 1ZVSB 4FQCL 1YQVL 3NPZB 3GJFA 1T21B 3CD4A 2R0KH 3RKDC 2QHLA 4EUPG 4EVNA 5TDOA 1GGCH 3MV8E 4XPGL 5L2JB 3HB3C 1WIOA 3HAEG 5T1DH 1OP5K 1D5MA 3ARRA 5BRZA 2R2BB 3P9LA 2EYSB 1DVFC 4PUBH 3VFGH 2EEBA 1D6EB 4O5LL 3QI9B 4E41A 4X6CB 1X5JA 1JZ3A 1FLRL 4QWWC 4QHLB 1OGAA 1RZGB 3OGOE 1OD7A 3DV6B 4ODWB 4OZGB 5DC0A 3RPKA 5JOEA 5E6YA 5GS0H 2AV1A 1P84K 1G0DA 4JG0H 5F6IC 4KJYB 4XCEB 3KYNA 3I9GL 1V3LA 4UT6H 1WT5C 5E9DA 2FJHA 3QHZL 5HYFA 1MCQA 3CFBA 3MRJB 4G42A 2HP4A 1XR9A 5KVMC 4XCYB 3MXVH 4HCRH 3SN6N 3MRMB 4I5BB 3FQRA 3MRKA 4G8EB 1NMAL 1W0VB 2WUCH 1TVDA 1D7FA 1XF4A 4EI5D 3MJ7B 2E27H 3KLDA 1OTTC 4PLJD 1MY7A 3PWUB 5GS0D 4K7PX 3TBYA 1RURL 3LDBC 4L4TE 4PRAB 4P5KB 3BP7B 5T3XD 2CDFB 2R4SL 3O3UN 1XGRB 2A9NH 4WW2A 3VWJD 2QSCL 3LH2L 3RWIA 3MROB 3X3GH 1U93A 2NXZB 3OJDB 4LLWB 4WENB 1G9NL 4CADA 4Q9QL 5DD0L 5TF0A 4GAGL 3RKPA 3U4EB 2JLLA 3WLBB 4FQPA 4ESKA 3BPOC 3EYQD 3JXAA 1FNFA 5DQJA 5HI4D 4XMPL 2NY6C 1NUDA 5KVDL 3BJLA 1QZ1A 4LSSH 5DC4B 1UXSA 4NUJB 2OI9B 3HC4L 4ZAKB 2HFGL 4FXKA 4I1NB 3QCUL 4WFEE 1BJMA 1ETZB 3QUYA 5ANMB 5ICZA 3DYPA 4OI8A 5GSVA 2Q76B 1RJLA 3SY0A 3PDOA 3LMJL 2EE6A 3DUUA 4UQ2B 4BQ8A 4YHNB 2EIZB 1EAPB 4QLRA 2CKBL 3TBVB 3GMLA 2O5ZL 4ELMA 3G04B 1EGJH 2KUTA 5DZNA 1ZA3A 1TJGH 3O0RL 3O2VH 1OAYL 2BVPB 5ADPH 4L9LC 5LGKA 1CD0A 1FFNB 2AV7B 1F4XL 4LASH 3MXWH 3PG2A 3SKNA 4MDJB 4I4WB 4W6WB 3WO4B 4QRRE 2AEPH 1T0PB 3CLFL 4XH2A 4MNQE 4KAQH 4H1LH 5CMAA 3RTQD 1ND0A 3T1FA 2V5SA 2VZSA 3FOLB 5D93C 4XT1C 4G9DB 5JW3L 1DZBA 4M7LL 5JPNA 3D3VD 4LCWB 3HCVA 4N0FB 3V4VH 3ZL4H 5C1MB 1NGZA 4K8RH 3F7VA 3HUJE 3FCTB 3RVUD 4MA7H 1LDPH 1C1EH 4XPBH 3HS0A 2X6MA 1CICB 3D25A 1K8DB 1MHEA 3WBDA 3SQBA 4KHXH 2FJGB 3BPLB 1MFAL 2BNQD 4LPYA 4NRZA 3LEXB 4RGNB 3RZCD 4KQ4H 3VG0L 5JDSB 3JV4A 2CH8A 4GRMA 3IRZA 3OKOA 3RUGE 3L5XL 4G3YL 2FJFA 4H26A 5C6PB 5D7LE 3LV3A 4JFQB 3D85A 5C0BA 4IDJL 1TETL 1KYOK 4ZOAA 4NP4L 1UB5B 4TUOB 3WS6C 1U2CA 4U1HA 3KLHD 2RB8A 4HG4J 4OF7A 1XCQA 3BN9D 1R3LB 4WJ5A 5E8EA 4YXKL 2GCYB 4R8WL 1GRWA 5FCUL 5DEGA 3WFBH 1G7IA 4X7EC 3S6CA 3Q5OA 1CK0H 5IM7B 5F9OH 5T1KA 1WZLA 1QFWH 4D8PA 4U3XA 4S1DC 5CILH 4NZUH 1YN7A 1QSZA 3JVGC 1AE6L 3VGAB 4YAQB 3RNKA 4KTDL 3QYCA 1FFOB 5F96H 3MJGX 5C0IA 3RDTA 5TE7L 4JQVA 5I1GH 2BY1A 4OCWH 3VFVA 2DLFL 1D6VH 3KJ4B 1JHKL 1MF2L 1FN4A 4BQCA 4C54A 3V52L 4E42A 3CMOH 4DKDC 1YUHA 3GJEA 5FM4A 4XBPB 4KZDH 1YYML 3ZTJG 3W9EA 3FZUD 1UXWB 1YJDC 1FL3B 5J4MA 4YZFE 3UBXA 1DQML 1RZ7L 1L6XA 2X1WL 3QIBD 2VLKD 4TVPH 3PABB 3WUWB 3KXFD 3AMLA 1VGKA 5J3HC 5BZWB 4LLAA 5IW3A 4JFYA 1W72L 4WHTA 4MDIA 4G7VH 1HYSC 3SDAC 4HMEA 2HFFA 4X98A 5MENE 1MNUH 2EYTB 4GKNB 4P2OB 4AQOA 1UACH 2X1OA 2D3VA 3T0EE 1HZHL 3ZKMC 5T1MB 6FABH 3O2DL 4R26L 2BC4A 2OQJB 5IB5B 1H5BA 3JWOL 4J1UA 3RWCA 1K3IA 2FO4A 4WO4D 1BP3B 1T5XA 2KQNA 3CFIC 2OZ4H 1II4E 2IGFH 1I7TA 3PJSA 3EOBB 3RP1A 4DZ8B 4LSTL 3EDEA 5DJYB 3HPLB 4N1HB 2CLZB 3ARFD 5DT1L 2XTJC 3PDDA 1I1AA 4NNPL 3MLTB 2Z31B 4P59L 4KPHL 3FO2B 4NHCH 4Z78A 2DQDL 3NIDF 5FYKE 1BQUA 4KVNH 4NQEB 5KVFH 5DUML 5EU3B 3T2QA 1EIBA 5CEZH 1MVFA 2HTLD 5I17A 2NPLX 2AJUH 1BVKB 3F7QA 2X4RB 2EDBA 1T5WA 1GHFL 4RMQA 2WWMD 4HF5L 3HLAB 1VFBB 3KHOA 5LBSH 3WFHB 3CX5J 1T1XA 4KKNA 3WN5A 5IIEB 5EZJA 3WE6B 4CN6A 1JMXA 5D1QC 3V4PL 4YPGA 3WFCL 1UM4H 4OM0L 5FYJD 4N90E 4Z5RB 5DHVH 5DMKA 3VFUB 5ILTH 4WTXA 3V79C 2XPGA 1B90A 2CKBB 4O2FB 4U2ZA 4LF3B 4K3JH 4P4RA 1KEGH 5JLZB 3TO2B 1SQ2N 1M7DA 1BBDL 3GSRB 4GSDH 3SGJA 3CJJA 2EXWC 2QQKH 3BKML 5I75B 2O61B 3D0LB 4OCMC 1PG7L 4MJID 5KSBF 4UT9H 4X6DB 4JDZA 3KPOA 2A9MH 4JZJB 1IAMA 1SY6A 7FABH 1MUJA 2JJSA 2D0GA 1YZZA 1CU4H 3C60A 5JR1H 5A40E 3AU1A 5AYUH 4WTZA 3RKDD 5TGBB 2J2ZA 3SJVB 4FFYL 5KN5A 4CVUA 12E8L 4YXHL 4OZFH 3BDBA 3HB3D 4AIZB 1JGUL 4XMLL 1MIEH 1DVFD 1FRGH 1K5NB 1IGFH 3FO9B 4WI8A 5DK2A 3QIUB 3GSNA 3QPXL 3SE9L 4IRJB 1Q38A 4H0GA 3CVHA 3GNML 1KC5H 1RZJL 4PJBE 2D7OA 1Y0LB 2Z91A 2I9LA 4QWWD 5IQ7L 4NKMA 5HY9A 4OGYL 5FHBH 3TYGL 3VXOB 4YQXH 1BWWA 3OL2A 3DXAD 5D96C 4ZFFA 3LN4A 5JXAL 5FKPA 4Q58C 2W0FA 4XNMB 2I24N 2FH6A 5IQ9B 2E5EA 1FE8H 4XAKD 1Q9WB 5IOPB 3VFWA 3ARGC 1T80A 4JHZA 3VXMB 4WW1A 1NCBH 3CCHA 4HWBL 3FN0H 5C08D 4M6NL 1GOGA 1OTTD 2CDGA 4KV5F 3RZWA 3EO1B 4YDVB 1H3PH 1E6OH 2F54D 3HNTH 5DD3L 4BKLB 3PL6C 2FGZA 2IQ9H 4G80B 4QRUB 2R0LL 3K0WA 1G7LB 1Q0XH 2YKLL 1JFQH 3WJLA 2VH5H 1ZANH 1FCGA 5KSAA 1KTDA 1U41A 3VWJB 1PDKA 4AEEA 5JUEH 3ZYOA 1EHLL 5D7SH 3GMMB 1VKXA 1AGBA 5IFAL 1MAJA 3TGXA 2BDNH 3DLQR 1NDGA 5BS0A 2NY5L 2XQBL 1T1YA 2NY6D 3MPCA 3PWPA 3QEQE 2DI8A 3VFNB 4NN7C 5D1ZA 3MLZL 5FECB 1HHJB 1A9EB 1LD9B 1BD2A 5HYJB 2VDQL 3MLYH 4Y89A 3CPLB 2ERJB 1I9RL 1T21A 3ULSB 2J8HA 2HJKA 5B3JE 5A1AA 3A6CL 1QFWI 1UH3A 5L2JA 4PRPE 1U95B 4Z0BL 1JBJA 2R2BA 1D6EA 2DLGA 3EYVB 1UJ3C 1QLEH 3CUPB 3QI9A 4JANB 4O58L 1UYWH 4L1HA 4QRPA 5KSBA 1FIEA 1NSNL 2XOTA 3WXWL 5E4EC 1IAOA 4QHLA 3QDGE 3UEZA 1RZGA 3ZT6A 3DV6A 4HUXB 4ODWA 4OZGA 1FGVL 1CF8L 2AK4E 3D9AL 4K9EL 5DD6B 3HMXH 4KJYA 4XCEA 2IBZY 4YHML 1FNGB 1DBAH 3IU4H 3MC0A 3KVQA 1MCBA 32C2B 3MRJA 4XCYA 1PZUB 4I5BA 4G8EA 1IQDB 1W0VA 2M2DA 3T65B 2W1NA 1RIUH 1EK3A 1WLHA 3MJ7A 4GRLC 3UBXG 1I1RA 2JJUA 3RJDA 4QNPE 3QEGH 5BO1L 3K7UA 3IAGC 3KPMA 2QHRH 4ZXBC 3QULB 5CUSH 5LWYH 3FT3B 1EBPA 4P5KA 3WNMA 3BP7A 1JNHB 3GMNB 1EX0A 3QG7L 2CDFA 4NWTH 4LNRB 1I3RA 5HYSB 1T22B 3MROA 3KPTA 4MJ2A 3OJDA 4LLWA 1TDQA 1L7IL 2F8VA 3P9MB 5IGXL 4Y1AD 1NGQH 3EFDH 2APTA 3B8SA 3O3BB 3U7WL 3QDJE 2OMNA 1EO7A 1K6QH 1WC7B 2OX5A 5TDNA 3SO3B 2WIMA 3JBG7 3U0PB 4XP5H 3F6IA 3FQWB 3RX5A 4TNVK 1YJDH 4ZAKA 2J5LB 5E5MA 5FO8B 4S1DD 1TZIB 5F1NB 5I1DB 1TNMA 3I2CH 1L9MA 3G5VB 3H3PH 2Q76A 4UQ2A 4XBEH 2EIZA 1R5IA 2D03H 3TBVA 3LPGA 3VXSB 4TSAH 4ACPA 2V5TA 1WFOA 3G04A 5CP3H 1BVZA 1JF1B 3LD8B 4CVZB 2QQNL 5SWSB 2ENYA 4G5ZH 2DL9A 2EDFA 1FYTB 2BVPA 1FFNA 5FEBA 43C9A 5DRNB 1IKFH 4JDTL 3FB5B 5E6IA 4MDJA 4I4WA 2FEEI 4MJ4A 4NQXB 5MEOB 4JEGB 1A7OH 1QVOA 3OGCB 5J3HD 4K23L 3H7BB 1FC2D 3FHAA 1MFNA 4NCC2 1HYSD 5F7DA 3SDAD 4ZUTB 3ALXA 3FQNA 3FOLA 3NCYP 4XHJC 5KW9H 5DMJB 3UTSD 3S34H 1TIUA 1TVHB 5KVEH 4N0FA 1LILA 3ZKMD 4I2XB 5L2KD 1SBBA 3S36X 3STLB 4I0PC 1RJCA 3EFFB 1U8NA 3FCTA 5F8QC 4N8CH 3V6FB 3V0WL 2J3SA 4Z18A 1DBKH 4MJ5B 1CICA 1K8DA 4JB9L 3SDYL 3O6KH 4PJHE 1LEIB 2XTJD 2VSCA 3ARFB 4YX2L 3ULVC 3RU8H 3S96B 4JPKL 2R1WB 3O6ML 1AO7D 2FZ3B 1KJ3H 4OD1L 5HHXL 5JPMB 1I85A 4NO0D 1LO0L 4JFQA 4KDVA 1JPTL 2V7HB 1YEHH 2Q8BH 3H9ZA 3B2VH 1SYVA 1BF8A 1UB5A 4TUOA 4KUCD 5A3IC 1A1MA 4KY1L 3W2DH 3B3IB 3SDCB 1R3LA 2Z35B 3SGKA 3UTTD 5I8OH 3ELAT 2GCYA 3REWA 2AEWA 2BOCB 2JF1A 1FSKC 5I8EB 5CD3B 2HRLA 2RJMA 2W9EL 3L3DB 4P3WA 4XC3L 5D1QD 4JO4H 3TO4A 4XPTH 4FN0A 3TH3T 4AL8L 3TV3H 4ZPTA 5IM7A 3BAEL 4KI1A 2WK2A 3QXTA 3GRWA 3SE3C 4XCFH 4JHBA 2WZPD 4YAQA 1EERB 1FFOA 2M1KA 4WGVB 1QBLL 3J7HA 2EXWD 2W38A 3BH9B 4EXKA 4Q6IB 1UWXK 4HKZB 4KUZL 2ADFL 1HHKB 5GJTH 1QRNE 1UXWA 4TNWF 2LU3A 2DMCA 2XY1A 1E0OB 5FFLA 4DK6A 4X83A 2OMBA 5ALCL 4Z7OF 4PJGB 1MRDH 4TOYL 2DI9A 1L0YA 3T1WA 3GM0A 2D7TL 2EYTA 4GKNA 3BE1H 4P2OA 2IANB 4P2CG 3ESUF 3O4LB 4U1KB 2DRUA 4LSVH 1DVFB 5T1MA 3BGAA 2OQJA 5IB5A 5HD8C 3SBWC 5FYLE 5DD5L 1UA6H 4JO1H 4WY7H 3QXAB 3EOBA 3T0EC 2D0HA 1ITBB 4DKEL 3W11C 3HPLA 1A6WL 2CLZA 3O9WB 2OXGA 4PYGA 4MZ2A 4X99B 2Z31A 1F58H 2MQ0A 3FO2A 2HKHL 1QLRB 1FHGA 4LU5H 2XZCL 3OHXB 1JWSB 1M1SA 4NQEA 2CGRL 3FQXB 1B0GA 3ARGD 4JRYD 4P48A 2AEIT 3CNKA 5EU3A 4XNXH 1VEMA 3TWCL 1F42A 5GZOC 1BVKA 4HJ0C 2X4RA 2H3NA 5DK3A 3UMTA 1A9BB 5C08B 3RX8A 5I19H 3HLAA 3T0XA 1VFBA 3WFHA 3PL6D 3QCVL 1IAIH 4HWNA 5TQ0L 5IIEA 2FB4H 3TJEL 1ZT4B 3WE6A 4NQVB 3NA9L 2GJJA 4XMKH 2XZQL 4N0UB 4PRBA 5IW6A 3D5OF 5SX5K 4W81A 5I1AA 2FWOA 5F6HI 1IFHL 2NMSA 4ODUA 5IEHB 2DQEH 3VFUA 3BFOA 3BYTA 5TH2A 3UTQA 3E6HB 2BSTB 2BMKA 1J1OL 4O2FA 3R4DA 4K3EH 2W92A 1MAML 3TO2A 2MWCA 3CX2A 3HKFA 3GSRA 2WBKA 3BUTA 4R3SB 1JYWA 2KZWA 5H8DA 2O61A 4WEMB 3F6LA 3Q5TA 4X6DA 1YEDA 4PJEB 2ZCKL 4JZJA 1RQ5A 5F6HJ 3OV6A 4BZ1L 3EYFB 1RAMA 2PXYB 3FONA 4F37K 2R2EB 3S97C 1EO8L 4B53A 3EDFA 2J12B 2DQHL 2VO5A 1RD6A 1Z3GL 5HDBE 5D7IB 3IFNH 1A14H 3L1OL 2DDQH 4AIZA 4N0YH 2ARWA 1HI6B 1YEEH 1K5NA 3FO9A 3MUZ1 2UZIL 3QIUA 4GMTL 1M7IB 5K59F 4IRJA 3DX9A 4LCYB 3FN3A 4UTAH 1RIHL 2DF3A 4J12A 2YRPA 1Y0LA 4G6FD 4Z7WB 1FZOA 1I1YB 4JFDE 5JZ7C 3O3EB 3CFKB 3EOTH 4UV7H 5EU6D 3VXOA 1TCRB 2F53B 3BO8B 3KHQA 3MBEB 2YPKB 3O11B 4AG4H 5IQ9A 2J7LA 1Q9WA 5IOPA 4FFZH 5KAQF 3OKEB 4H5SB 1NQBA 3NCCB 4NKOB 2A83B 4GRLD 4OKVB 1FNSL 3PNWA 5I71C 4QOKB 2VKWA 4Y4KB 3KPLB 4YDVA 3E8UL 2VXSL 4ZXBD 1EHNA 2YXMA 5D2NE 4NSKB 4G80A 4OZHB 4QRUA 3IDGB 1RHHB 1X4XA 5E2JA 3EYOB 1G7LA 3ZTNH 2WLYA 1JHTB 3LB6C 2YPLE 1DFBL 4GOSA 2ICEB 4TTDC 3GBNL 4UILH 3VWJA 3IDXL 4ETYA 1UM6H 3O41B 1F02I 4L4TD 5B3NA 1JWMB 1X5ZA 1ZTXH 1KCVL 4WUUE 1FNAA 2XV6B 4Z7UB 4QHKJ 5CD5C 1GCFA 4NBZB 2HVKB 5ALBL 1EEUA 2E9JA 4U1MB 4TSCL 3VFNA 5JQHC 2J6EH 5FECA 1YNKH 4Q97A 1HHJA 4HFUH 1A9EA 1HNGA 5HYJA 4PIRF 3CPLA 4AEFA 3U9UB 1M6OA 4HC1H 3C8DA 4ZO9A 3V0AC 1A1OB 4Z8FL 4Z7QF 5I9QB 1INEL 4HIIA 1PAMA 4WFED 3IT8D 1LEKB 1Q72H 3QZWB 3BXNA 1J1XH 1KN2L 3DO7B 1A7PH 5HHOD 2VISA 1FFRA 4IIQB 5HDQH 3QIWC 3EYVA 3C09C 3IVKB 5HI3C 3CUPA 4JANA 1UCBL 4PGBB 2Z4QB 1MJ7L 3I75B 4M1DL 4L8CB 1F4AA 4M6OH 4HUXA 3BEVB 1YNLL 4OTXL 2VABB 4XHJD 4D3CH 1P1ZB 2JCCB 5AG9A 3ULVH 1P53A 3FRUB 2AKRB 3MLPA 3D3VA 1EGJA 1CFQA 4OBRA 4I0PD 3MOQA 1CDJA 2AABH 5L2KB 4MNQD 4A6YL 4BJLA 3SPVB 4P2RD 3QJFB 3T65A 2D9CA 4QXGH 5JHLH 4PG9A 1KCUH 4L3ED 1DP0A 1E4JA 1WAAE 1G7PB 1KXVC 3QULA 3MLXL 3FT3A 1XAUA 3ULVD 2BNQA 1HOCB 1JNHA 1GH7A 3EHBC 5CP7B 3MOAH 3ROLA 4LNRA 4ODXA 5HYSA 3O6LH 1T22A 2WNGA 5CSZB 1L0QA 5ACZA 4HJJL 2YD4A 5A3ID 2ZUQB 3P9MA 2M8XA 2W9LA 1ZOXA 3SDXB 1KB5L 3K8MA 4MMZC 5D7LD 1JCKA 1WC7A 3FRPA 4JREB 4X9BA 2XY2A 3NBNA 2PYFB 2NXYC 3U0PA 2W60B 3FQWA 2VSDA 1KJ2H 1T2JA 1FGNL 4PJGF 5HHNB 4ZPVB 5FO8A 4H0HB 1IAII 4OGAC 4YO0B 4HXBH 3TP4A 5I1DA 2OCFD 2NX5E 3U0WH 1HSAA 1UADC 5DR5L 3G5VA 1FO0H 5E08L 1PQZB 2ATPB 2IH3B 2G75B 1HXYB 5EFIA 2VZVA 3VXSA 5IVOA 4HWEH 4IRZH 1X5YA 3VFPB 5I76B 1KTLB 5SWSA 1OAUL 2R0ZL 4WWKC 4K7PY 4Q2ZB 4UZGA 5DRNA 4GRWB 3FB5A 4FRWA 1NFDF 3G6DH 5MEOA 3LRSB 3H7BA 3KXFA 4ODHL 5CINH 2FLBT 5D72H 4WTWA 1ZVYA 2BY2A 4ZUTA 1E4XH 4H25B 5IVXE 1TVHA 1DQDH 1BFOB 4R97B 4DN3H 4O2EA 1WISA 4CRPA 3STLA 4DGIH 4WFHE 4X7SH 1H15B 5HD8D 4QHNA 1BECA 1NH6A 5GGUB 3V6FA 2C3GA 3ABZA 2ARJB 4MXWL 5MEND 1YMMD 3ZHLA 3T0ED 1FPTH 4XVTL 3W11D 5KSUB 2X4OA 3GIVA 5FYKH 3ARFA 4Y4HB 3S96A 4JJHA 4HPOH 2FZ3A 4P9HL 3SKJL 3MUGB 4N8PA 5IKCB 4XI5C 5GZOD 4ZFGL 1IGMH 4HJ0D 4XPHL 4PJDB 5BVPL 3NH7L 4PJEF 1DL7L 3B3IA 3B9VA 3SDCA 4OLVH 2VXUL 3EUUA 2Z35A 2VAAB 1FFPB 5FYKD 2BOCA 3RWGA 5I8EA 5CD3A 3CSPA 5LQBH 1JPSH 3L3DA 1FH5L 3ME0A 3QNYB 5M95B 3V6OA 3ARWA 5D1XC 4PJ5D 1A7NH 4HXAL 4F9PC 1JNLL 2FATH 3MTRA 4NNYA 4MXVF 3LEYH 5LGJB 4MWFB 3MRFB 4ZO6A 1O0VA 1GZPA 2G5BA 5MERB 1CDIA 5DRZB 5C09D 5EA0H 4WV1B 3OG4B 2CRZA 5HPOA 4OFVA 4XX1E 4JFPB 1KIRA 2H26B 3BH9A 4Q6IA 1HHKA 3QQ3B 4MJIA 1ZGLA 1WCBB 4KMQA 1E6JH 4RFOL 5E03A 4ZODA 4HWUA 5I6XC 4GG6E 1AQKL 5B4MC 1OP3K 4NO3B 1JV5B 3HNSH 4U0RB 4PJGA 3P73B 4OD3H 1I3GH 2E9IA 1P5VA 3HMWH 1DE4B 1S9YA 4P4KC 2ZOKA 4ELME 4PB9L 3O4LA 4U1KA 5K93A 5CJQH 1DVFA 4JM2B 2IFGA 4F7CB 1A3LL 3BPCB 1T0NB 3QUXB 3LKSB 4NO2B 5C2BL 3G6JB 3T0AA 4DEPC 4DTGL 3MV11 4MNGE 3MV8B 4X80H 1QYGH 4QT5B 3GBLA 3QXAA 5JZ7D 1H3TA 1RZ8B 5E4EB 4UTBH 4NFDA 1S7VA 2BVYA 3OB8A 3UJTL 2BOBB 3FFDB 4JRXE 1B88A 1HCFX 4M5YL 3BKYH 5KJRL 5DUPL 4X99A 1NFDA 3KWWB 3NPSB 1V7MH 1QLRA 3MQIA 4PBVC 5DMYA 3BDYL 1X9QA 3V8OA 3FQXA 2Z92B 3QJHB 3NVQA 2DM2A 3QH3B 5ESVB 3C6LB 3C5SB 5I1HL 3IFOB 2RHEA 3PQYE 5C08A 2D4DA 1S9XB 1EZVX 2D7MA 3BKJL 1F4HA 2OL3L 1ZT4A 3JWNC 4NQVA 1EVTC 3BIBX 5F1OB 3LB6D 4N0UA 5C07E 5T5NF 4TTDD 2UY6A 2R0KL 3GI9H 5IEHA 3NAAH 3ZE1F 4QCIB 1UC6A 2A1WH 3E6HA 4NQCB 4MXQC 2BSTA 3NABH 3MLSH 1GGCL 3MLUH 3SGEH 5T1DL 1ZLSH 3C8KB 4FZEH 5L9DH 3ULUL 2L4OA 5CD5D 4R3SA 4YNYB 3VFGL 4KC3B 3HI6H 3SKOB 4AEIH 2YD6A 4H1LG 2HRPH 5FKAB 5KTEL 4CU8A 4JKLA 4PJEA 4KKCC 3LQZB 3EAKA 4M43H 5CEXA 3TESA 3EYFA 2EKSA 2PXYA 3U7YH 2R2EA 4U1IA 5GISH 1N8ZB 4APQC 1GGUA 4GFTB 1P5UA 4OM1H 4UT6L 4TSBH 3E3QE 3TN0C 3GSVB 1HI6A 5ITFB 2QQLH 3L3OB 3T0WA 4HCRL 2FO1A 4HUNB 2OR7A 5KAQG 2WUCL 1M7IA 3WFEH 2NY4C 3QIWD 2E27L 4LCYA 1B4JH 5HI3D 4JFOA 2Y1VA 1P7HL 3P11L 4X4YB 5HPMB 5ID0B 2CK2A 2CK0H 2EICA 1I1YA 4LCCB 4PRPD 4PJXE 3RBSA 3O3EA 3ZSTA 3L3KB 4ODSH 1AHWB 1NGYB 1Z0NA 1TCRA 2A9NL 2F53A 4ZMAT 3BO8A 1FJ1B 1HKLH 3MBEA 4MQ7B 4GMSH 2YPKA 3O11A 4KZEH 4KUCF 4BH8B 1VADB 3SDXF 3QDGD 4QRRB 5IMOA 3HZYB 1J8HD 3OKEA 1E4XI 4NJAH 4PJ7E 1UZ8B 3U4AA 2FL5B 4NKOA 3EOAA 4OKVA 3AFLA 3KPLA 1NAMH 3UTPE 2NY2B 2PKDA 4L1DA 5TFSH 1F90H 5C0JA 4LSSL 5GRJL 2A6KB 4NSKA 4OSUL 4OZHA 3IDGA 1RHHA 5GRVL 3EYOA 4NJ9L 4KQ3L 4CJ0A 3HMXA 3HUJB 3MLVH 1HIML 3EHBD 1JHTA 5IB1B 2N7AA 2ICEA 3D39D 1EMTL 1CFVH 4XCNA 2JJTA 5FV1L 3VCLB 1WZ1H 1A21A 5D2NC 4DQOH 3WS6A 1LVEA 1T66C 3U30B 2AJVH 3JV6A 3W82A 2R8SH 4Z7UA 4Y1AA 2HVKA 5B21A 4B7IA 3ZO0A 4U1MA 1TJGL 5ADPL 3FO1B 2NXYD 2VLME 3W0WE 4LASL 3MXWL 4DJMA 4A2MA 2P44B 1MWAB 4K7FB 1YN6B 2AEPL 4OGAD 5FUOL 1QTYT 1NDMA 1FVEB 4KAQL 4FXGB 3QDJD 4JKWA 3NIGE 1IJ9A 1C5DB 1WIUA 2JELH 4FMFA 2BVOB 3ZL4L 3QFJE 2E9BA 1OY3B 4K8RL 1T83C 1LEKA 3QZWA 2DIJA 2EH7L 3DO7A 1C1EL 1FDLH 4L3CB 1RZFH 4WWKD 5DJ6B 3IVKA 3VD5A 2LABA 2P46B 3OWEA 3DTXA 3QHFH 4KHXL 3I75A 5ACMA 2VXTL 1JGVH 2I5YH 1NCAH 3MRIB 4HT1H 1GYAA 3BEVA 4KQ4L 1FLTX 4O9HL 1VFOA 1IM9D 2I07B 1P1ZA 2JCCA 2JJVA 1RV6X 1U6AH 4PJDF 2Z9TA 3UTSA 3HZVA 2AKRA 2DMBA 5L2KA 3QDMD 3V7MA 1GXEA 5BW7C 4MJ6B 5EZLB 4S1QL 1MJUH 2CUMA 2O5XH 3SPVA 4IHOB 3QJFA 2OL3B 2A74A 3BPNB 1F45A 3FN9A 1INDL 1NCNA 1G7PA 2LE9A 1F8TH 1PLGH 2YHGA 1WIPA 3HRZB 1J86A 5F9OL 4YDIH 1A47A 5K9OB 5CILL 2COQA 4NZUL 1ZE3C 2EIBA 3G9AB 5DURD 5F96L 4PJAB 5LCVH 1G7QA 4XI5D 2ZCHH 4B5EA 4OCWL 1D6VL 2YD7A 3CIQA 4Y88A 1DQJB 3K2MC 3SDXA 4KZDL 4JQIH 2D31B 2WP3O 1T2XA 4ZUUB 4ZOEA 2PYFA 1QOKA 4GXVH 2W60A 4XP9H 1LDSA 2VDNH 5D1XD 4OZFG 4TVPL 5D1QA 4Y4FC 5HHNA 4YO0A 3V6BR 4G7VL 4QTHB 1BF2A 1PY4A 2LTQB 3BKCH 1PQZA 2ATPA 2Q20A 2G75A 1INQB 1MNUL 3OX8B 1UACL 1G7JA 4RMWA 2OBGA 3P40A 5F9WB 3WD5L 5GSRB 4XPAL 2LAGB 4HSQA 3CXDH 1D3CA 4F7PB 6FABL 3GSQB 3KG5A 2E8YA 3VFPA 5I76A 8FABA 3FT4B 1DBJH 1KTLA 3SGEI 5J9PB 3VWKB 3N1MC 3QO1A 4YHPB 3IJHA 3WS3B 2OZ4L 5KS9B 1OGTA 3BEWB 4Q2ZA 1IGIH 1WWBX 2P8LB 3MCLH 4WHDA 3LRSA 1O7VA 5B4MD 4KRPC 1CYGA 2X1PA 4HQQH 4RAVB 1QRND 1IVLA 1TJIH 2AK1L 1OVZA 4NN6B 4LLVB 1MPAL 4P4KD 4KVNL 1DBBH 1BFOA 2ITCB 5CEZL 2GW5A 4OCXH 4KROB 2EYRB 1KGCD 4TRPH 5F7EH 2AI0H 1FAIH 4Z0XB 2X1QA 4KHTL 2EDRA 3CXHK 5GGUA 5D8JH 1C08B 2P8MB 4EDWH 5KANI 2E7LC 5J0BA 3Q6GL 5LBSL 3W5MA 4GQ9H 2ARJA 4X6CE 1HHIA 2ENSA 2PO6C 1URLA 4JFED 2C7UA 5KSUA 1NEZB 3VH8B 4OZGE 1UM4L 1IT9H 4OQ1A 1HEZB 4J7RA 5ILTL 4M62H 4M3JA 3MUGA 1QBBA 4K3JL 1KEGL 3S4SG 5IKCA 1I7RB 2ESVB 4JFXB 3ARGA 5ENWA 3QISA 3CFJA 4GSDL 4PJDA 2P42B 2QQKL 5I66B 4WFGE 3BP6B 2WQRA 3DX7B 3Q6FB 1LO5B 2VAAA 1FFPA 1I9EA 2A9ML 2NW2B 3PL6A 5GGTL 5DVMA 2YBRB 3Q3GB 1MCJA 7FABL 5J7CC 5I2IB 1CU4L 4JQXC 5KBNC 3QNYA 5JR1L 2YSSB 3GSXB 5AYUL 2DQGH 2IWGA 3P2TA 2FSEB 4JPVH 4MXQD 5CKAA 5LGJA 5I8CB 1QUNA 4HFWB 1JMZA 3KAAA 4MWFA 1RJZB 2OYPA 5DRZA 2P5EE 4BELD 3CLEH 1FRGL 3HE7C 1IGFL 1WV7T 4WV1A 5I15H 1GVIA 5I30H 2DB8A 5HVHB 4P23B 4LQFH 1U8MB 4JFPA 1EUTA 1KC5L 3QQ3A 4KKCD 5CWSA 4F15B 1KTRL 2Z8SA 1OPGL 5ANME 4YQXL 4APQD 2F15A 2NLJB 2F8XC 4OI7A 1A3QA 1VGEH 5CLWA 3MRRA 4ZFOB 4HG4K 3OAZK 1JV5A 1MCKA 1A6ZA 1QSEB 3P73A 2UZXB 4N5EC 3CH1B 3QEQB 3TN0D 2IJ0C 4HIHB 1DE4A 4YK4C 1EVUA 1FE8L 4Y2OA 4OLYH 3F7RA 4U7KA 2K7QA 2F9BT 2NY4D 4JM2A 1ZLVK 2Y23A 1NCBL 3V5DB 3LEVH 3BPCA 4PB0H 3QUXA 3QIWB 3LKSA 4NO2A 1H3PL 1E6OL 2GQHA 3HNTL 3LOWA 2DQTL 1OT2A 2ZPKL 4ZO8A 5EBWB 3ULVF 3MV8A 1DR9A 2IQ9L 3RWHB 5B39B 1EEZA 1RZ8A 1TITA 2BRQA 4NQSB 4XC1L 3GHEL 1Q0XL 3NACH 1RUKH 3QRGH 2BOBA 1A6UH 2NY0B 2VH5L 3FFDA 4Y19B 5T5NG 1I3UA 4Y16C 5GGVH 1JUFA 5JUEL 1W0WA 4LCWE 4JFDD 5D7SL 5CJBA 2Z92A 4P5MA 3QH3A 3QDGB 4LVEA 2IBBA 4Y0GA 3R8BB 3RUGF 1NKRA 2BDNL 5ESVA 3C5SA 2AK4B 2MHAB 4P3DB 1DN0A 1OHQA 4OGXL 1Q0YH 3IFOA 3MA9H 1S9XA 4RA3A 3VA2C 4F58H 2PN5A 3S88L 4ZXBA 4UNTA 4I9WE 4DFHA 5KSVA 1U3YA 3MLYL 2DJSA 3T77B 3C6SB 4JO3H 1XGYH 2R56L 4NQCA 5JORB 4PLKC 4ONGH 4WI3A 1T66D 4L4TA 3C8KA 1RU9H 4EN3B 4TUKL 3V4UH 2YPLD 5F7KC 3SKOA 4ZS7H 4POYA 5FKAA 2ICWI 1QLEL 5I1KH 4UAOC 2KL6A 3DRTA 4M00A 4OLWH 4R90H 4WUUD 1MLBB 4MD4B 5CIPH 1P2CB 3QG6B 1T7XA 2ZSWB 3DSFH 2CLRB 5ITBH 3RA7H 1N8ZA 4YZFF 3IB4A 5JNYB 1EFXD 5CS7A 4LEXH 4X6BB 4H20L 3IU4L 3C9NB 3OQ3B 3CX5K 3IDMB 3GSVA 1PVHA 5ITFA 3P9WB 2ICWJ 5FDYA 3E2HB 1CE1H 1NCDL 3NA4A 1RIUL 1UWEH 4OCLC 2J6EA 5DI8B 4OQTA 4X4YA 1QFWM 5ID0A 3U36A 5AZEH 2QHRL 3E3QC 3RDTC 4NO5B 4LCCA 4OB5L 1PD6A 4JQVC 4L5FH 4ZTOH 1KCSL 4D9LH 1AC6A 1JGLL 3CDCA 2ADJB 1R3HB 2VXQH 3L3KA 5DHVB 3DROB 4CMMB 3T3PE 1AHWA 1NGYA 4EOWH 4OD2B 1J88A 4NWTL 5DJXB 1BGXL 1CGVA 3QCTH 1IM9B 1Z6JT 1K4DA 4LGPB 4U1JB 4JN2B 4MQ7A 1NBZB 1MCOL 3IDUA 1VADA 1ADQL 4X5WA 5ID1B 2ED8A 4QRRA 2JJWA 1ORSB 3EFDL 3HZYA 4MNQA 4PG2A 4NKQB 1TLKA 1UZ8A 2FL5A 5F7YC 3MODH 1T0MB 3QWRA 1X44A 3D69B 4M4PA 4XP5L 4X7TB 3TA3B 4YHYB 1ZHKB 5F9DC 3H0TB 3HUJA 1NC2B 4WI6A 4KKLC 3I2CL 3H3PL 3VG9B 4JPIB 1DUZB 5D9SB 3U83A 3VCLA 4F7TB 4MYWB 4NQEE 4OZ4B 2DTMH 4PJHB 4TSAL 2AP2A 3JTTA 4QYOB 5I1IH 1I1AC 2CO6B 4H8WC 1UQSB 4LSDA 5GRVK 5HGHB 1IC7H 3RUGA 4G5ZL 3FO1A 3HI1B 4LPCA 2BVUA 4UV4H 1IKFL 4CL7A 2I9TA 4Y4FD 1MWAA 1B3JA 1YN6A 4M6MH 5AG8A 1BIIB 2CXKA 1AI1H 1FVEA 3NGBC 5IB3B 3NZ8B 4HKJB 2BCKB 3MRHB 1ZEAH 1YEIL 3SE3A 1J1PH 1OAQH 5KW9L 1P7KB 2ICWB 3WN5C 2XWTB 2R23B 2NY1B 2V2TB 3S34L 1S8DA 5KVEL 2BVOA 1ZT7A 1A64A 1HILB 2IAMC 4B41A 2EC8A 4U4BA 4MQXC 5IVZB 2NX5D 1ZGLM 1FBIH 1QR1B 4L3CA 3P0GB 4X6DE 2XN9D 5C6TH 1DBKL 2DN7A 4Y8AA 3AUVA 3GJFH 4HHAB 2GYSA 3JUYA 5IHZB 3O6KL 2VN4A 4EIGB 3OKNB 1P7QB 2HVJB 3QA3B 2JTDA 3REVB 4KRPD 3SGJC 5I16A 1CD8A 3MRIA 4PJBF 3RU8L 1L6ZA 3SJVE 5CGYC 4W6YB 2I07A 1QRNB 2XXMB 1KJ3L 5DGRA 3SKMB 1T3FB 1YEHL 2Q8BL 4GG8A 4BZYA 2QL1A 1FVCB 3MNWB 2VZOA 3B2VL 1L4IA 2JJSC 4OZIF 1ZLUH 4L8DB 3W2DL 1F5WA 4IHOA 3SBWA 1GGBH 2GTZB 3BZ4A 2OL3A 3ZT7A 5I8OL 1EBAA 2PO6D 5MENA 5I0DA 5GIRB 2AJZB 3T0EA 4P3CH 1NMCC 3V0VB 4WFHD 5HVFB 5I8KH 4XPTL 3HRZA 4DCQB 5C0GB 1HHGA 4WI9A 4OIIL 4AENB 5K9OA 4WGWB 5A2JH 4NBYB 4XCFL 4N9GA 1GSMA 3U6RB 3UZEA 3LCYA 3VXME 3ZE0E 1PSKH 1DQJA 1G1YA 1QBML 3K8LA 5GJTL 4KMTH 4ZUUA 5GQBA 5CEYA 2XIDA 4AEHH 1T04B 1OQXA 1IL1A 4QTHA 1CZ8L 1MRDL 1MCWW 3X11B 2Y25A 3BE1L 3NCJL 3OX8A 4X0KB 3HE7D 1HDMB 5HTSA 4N8VB 5J6HB 4LSVL 1SJXA 1MCPL 3IJYB 3HG1E 3GSQA 3GB7A 4Q9BA 4F7PA 2GUOB 3FQUB 5B3JF 1AJ7H 4RMTA 5J9PA 3VWKA 5HHPB 1IZKA 3WS3A 2MMXA 4P2QB 4JO1L 1BIHA 1QNZH 3BEWA 4WY7L 1IGCH 2FBOJ 4FQ1H 2OR9H 3DI2B 2BX5A 5HYJE 2P8LA 4N5UA 2X70B 1ULVA 4WWID 3FJTA 1NANH 3VI4E 4RAVA 1F58L 4N5ED 2YXFA 4LU5L 2R9HC 1PG7W 3S98A 4LLVA 5D1ZC 3DECA 1BQLH 3MLRH 5L88L 2ITCA 1SJEB 2FYYB 1H9VA 4XNXL 4FQQA 1J8KA 3CC5B 3EYSH 4Z0XA 1C08A 2P8MA 4M6AA 4YHOH 3IDJA 2P24B 2FB4L 4ZUSB 4BZ2L 1JF5A 4TUJB 5IG7B 4CVXB 3F7YB 1NEZA 1LE5B 3NZHL 5KZCB 1FC1A 5JA8B 4QNPF 1WQVT 4Y16D 3AY4C 1MQKH 2DQEL 4KVCH 4Q6YA 3QI9C 1CDYA 4PJBA 3GI8H 4K3EL 3HE6B 3KPSB 5JA9A 1N6QH 3GMRB 2L7JA 4JFXA 1A6TA 2HFEB 4JRXD 2W9DH 2VZ3A 3ETBF 1YYLH 5I66A 3BP6A 3DX7A 3Q6FA 4RMSA 1LO5A 4P57B 3FFCE 2BXYA 3T4YB 4YGAB 1NGXB 1UJTA 2YBRA 5L7XH 4JLRB 3B5GA 5I2IA 2DD8H 2P5WE 2VR4A 2WWKT 2YSSA 3PQYD 3SO5A 4DKAA 1EHXA 4LCIH 4PLKD 4HFWA 1A14L 2DDQL 5IWLA 1RJZA 4N0YL 3SQOH 5M94B 1YEEL 4X7CC 4TYUA 1QO3A 4PTTB 1QSFE 4P23A 2VE6B 1U8MA 5DHXB 5LKNA 4NKIH 5F93C 3DYMA 1GIGH 1RY7B 1RK0B 1E4WH 4JO2H 3D18B 4XNZB 1L7TH 4LSQH 2NXZC 5GGRA 3VRIA 4XP1H 2A2QT 1U2HA 5EIIB 2R4RL 3GGWB 2Z8VC 4DKFH 1TFHA 1HK6A 1YDPA 3EOTL 4UV7L 1G7HB 4RISH 2DKSA 1KLUB 2NLJA 4HAFA 3RI5K 4ZFOA 1PX4A 2ZNWA 1VCAA 5DVLA 3KYOB 3CH1A 1XGQB 3QEQA 2EDYA 4CN1A 1QA9B 4POZC 4BSJA 4HIHA 1D5ZB 3G5YA 3I50L 4FFZL 1JRHH 2OI9C 1MHHA 3MR9B 4LHUB 3V5DA 3TIDA 5SWSE 3QIWA 5L0QB 1FYTE 3MFFB 5ICYB 3NCMA 1HYRC 3BD5A 3RDTD 2Y36H 5EBWA 3DV4B 3RWHA 4PRPA 1M71B 2J4WH 5D4QA 5AZ2L 3ZTNL 3CH8A 1AXSA 4Y19A 4M7KL 3IU3B 3QDHA 4PJHF 2Q3AA 1NEUA 1XIWB 3VGFA 5LG1A 4XZUA 4UILL 3MCG1 1MRCH 2KH2B 2WANA 4I2XE 1ZTXL 3WO4C 3IXAB 3BD3A 3QDGA 3BGMA 2VZTA 2AK4A 2MHAA 4P3DA 2P1YA 4UDUA 1MFEH 1J0JA 1P6FA 1KCLA 4MVBC 3V95A 3ZZ1A 4PRHE 1QFOA 3VRLE 1EEYB 1YNKL 3DUSA 4HFUL 1JL8A 5D7KE 4JPWH 4KKLD 4MGXA 3OB0H 2G2RB 3C6SA 4ONHB 3UTPD 4PRIB 4HC1L 5E5RB 4OT1L 5JORA 1CICC 1UH4A 1LMKA 1S5IH 1DBMH 1JPGA 3BPLC 3Q1SH 4Q0XL 3MO1B 1I1AD 1Q72L 4PJ9C 3PXJA 4EN3A 1X5LA 1OAZL 4RGNC 4X7DC 2MQ3A 1BZQK 5HDQL 2IH1B 3X14B 1LGVA 2HT2C 1I85C 2O26U 4XNYH 4JFFB 1XGPB 4KH2A 1MLBA 2XQYG 4MD4A 2ZSWA 1GGIH 2CLRA 4MCZB 3QDJA 1Y18B 4OCRH 4D3CL 2VLMD 1XF5B 3ULVL 1RUPL 3GBMH 1WZMA 3GKWH 3C9NA 2FLRT 1HQ4B 3IS1X 3BGFB 2IAMD 5J12B 1IEBB 1C5BH 2AABL 1EEQA 4FHBD 4MQXD 2AQ2A 5E00B 1MREH 1IQWH 3WIIH 4ZQKB 2A6JB 2K7PA 4QXGL 5DI8A 1KCUL 1DSFH 1EZVY 3BHBA 3VGAC 3DYOA 3E0GA 4LVNB 4NO5A 1DQQB 5CCKL 2KZ1B 3KJ4C 3FO0L 2ATKB 4QHMB 2ADJA 4CMMA 5SWZE 5CGYD 4LSPL 2FECI 3STZA 3MOAL 4OD2A 4QKXB 4GXUM 5DJXA 3GSNH 3VMOA 1IM9A 4OF6A 1NFIB 3O6LL 4JN2A 5T33H 5DF0A 2CJUH 3CVHH 2IANE 1KULA 5HGBB 5ID1A 4QY8B 1A7QH 4NHUB 1BZ7B 5JW5A 2E8ZA 2GK0A 4PGCB 5E99H 1BPVA 1IEAA 4UQ3A 2IMMA 3VDCA 2HJLB 1UKSA 3D69A 2PO6B 3L3HB 5DHYB 4P2OC 5IVXB 4ZDHB 1RUML 4X7TA 3G5XB 3TA3A 1KJ2L 4WI5A 3H0TA 1ZS8B 4HXBL 2GEEA 1NC2A 3KPRE 1U8KB 1GAFL 3U0WL 3VXUB 1OAKH 2YD8A 1FO0L 4JPIA 4F7TA 1AKJD 4PJHA 1U8OB 1R3KB 1XGTB 4IRZL 4QYOA 2X09A 4GS7B 1IRAY 1NBVH 1MI5E 5HGHA 4PJ8B 5FDWB 2ZCLH 5EU5B 3KDMB 1GPOH 4ODBD 1G9NC 5BV7B 3SE4C 4YHIB 1S7WA 1BOGA 3PHOA 5SV4A 3G6DL 3I6KB 4N0UE 4BA8A 4Y5YB 3BESR 4LP5A 5IB3A 3NZ8A 5CINL 4HKJA 2BCKA 5JMOC 2J88L 3MRHA 4KRLB 5D72L 4V1DB 4R2GB 3WIHL 3D6GA 2ICWA 5DA0B 2XWTA 1MFCH 2R23A 1JNNH 3PUCA 1Q8MA 2Y5TB 4KMLB 4DN3L 2FBJH 1HILA 2BRRH 1IAIM 4DGIL 3MV01 1PKOA 3DBXB 5IVZA 1B9ZA 4X6EB 4PGZA 1BVLB 1FPTL 4MAYB 5IHZA 5MP6H 1P7QA 2HVJA 1ZT1B 3QA3A 4F3FA 1KLGB 3REVA 1MY5A 2I26N 5BS0D 2XRAH 1XFPA 5I75C 4PJCB 5A2KH 5FO9A 5I1JL 2R9HD 4NZRH 4PRNB 4HPOL 1QRNA 1F3RB 4KU1A 5D1ZD 5D7IE 3SKMA 4JZJC 1IZJA 1J0KA 4GG6B 2W0LA 4L8DA 4AY0A 2GSGB 3DURA 4OLVL 4FNLH 3U1SH 2GTZA 1TXKA 5EOCJ 4W70A 2E7HA 5KOVC 1JRHI 1MJJB 4Z7WE 1OQOA 3ILPB 1JTPA 5LQBL 1JPSL 3MACL 3ARDB 5TE4L 4PLOB 4QXTB 3QIUC 2IPKA 2GIYA 4DCQA 1A7NL 5ETUB 2SEBB 5DJZB 3ZT5A 1G7MB 2FATL 3F58H 2F53E 3OAUH 4IRJC 4NWUL 4AENA 3QI9D 4NUGH 1HNFA 2JB5H 3PV6B 3P4MB 2YPVH 1H8OA 1Q9OB 4MNGB 4RIRB 1NLDH 3U6RA 1CVSC 1KBGH 4NT6B 5EA0L 1U91B 1LP9B 5CJOH 1DQLH 2FH8A 2MCPH 1YECH 3GHBH 4LSRH 4DAGH 2L0DA 4QOKE 4OV5A 4U1GB 1E6JL 1KIUA 2YUWA 4GW1B 3DX6B 1S5HA 2ZP0T 5KANG 3THML 2HKFH 4WFGD 3KNBB 3TZVB 1T04A 2WMPA 4CDGC 3HNSL 5C9JB 1ZK9A 3PQYB 5ELIA 1T20B 3X11A 1I3GL 4G6MH 1BAFH 3M8OH 2XWBB 3OJMB 4X0KA 1HDMA 5EH1A 4N8VA 1A4JB 5CJQL 5J6HA 5F89B 5C07B 1OB1B 1UENA 3IJYA 2GUOA 3FQUA 3LKQB 1IILE 1ZHLB 3QB7C 5C71A 2XT1B 4NGHH 5ECJE 2DQFA 4WU7A 3IS0X 5HHPA 1KSRA 2A77H 2NXZD 3O4OC 4P2QA 2PTUA 4X80L 1QYGL 1F3DH 2P47B 2X70A 2Y07H 5DEFB 2GKIA 5IJVA 5BMFL 3DHJA 1V7ML 1UWGL 4POZD 4NQDB 2VC2L 3TN0A 3RX7A 5J89A 2YWYA 5DA4A 1JHLH 1SJEA 2FYYA 1SBSH 3TBSB 3VMNA 2ERJC 4GW5B 3MMEB 3F12B 2X4NA 2P24A 4ZUSA 4R7DB 1GC1C 2Q6WB 1UM5L 4PGDB 3QFDA 1KJ2B 4TUJA 4BK4A 4CVXA 5IG7A 3F7YA 1LE5A 2MCG1 3CZFB 1NMBH 1S9KC 1DLFH 3H2WA 4ORGB 3IDIA 5B38A 3VFTA 5MI0C 3NABL 3MLSL 1AC0A 3MLUL 3QNXB 1BQHB 3GMRA 3EBAA 5L9DL 3WDJA 1A6AA 2YD2A 4AEIL 4YDJB 4I77H 4MVBD 1JGDB 2HRPL 1G6RB 2OK0H 4P57A 4HEPG 4LCWD 4F2MB 1P4LB 1Z9LA 1NGXA 3GSUB 4PV8B 1VESA 1BZ9A 1MCEA 3U7YL 6CGTA 2Q7NA 1JTOA 2W0KA 4LL9A 5D6DA 4PJ7B 4OFIA 1N5YH 5GISL 2ITDA 2P45B 3HFMH 4OM1L 2DJ4A 1CICD 2MPAH 1J0IA 4GJTB 4I9WD 4HBCH 4PJ9D 4RGND 4PTTA 4L8BB 1KEML 3RAJH 4J3XA 2QSQA 2VE6A 3WFEL 4C58B 4FG6C 3X3FH 1B4JL 2HT2D 2EO1A 2UWEF 3WYRA 3D18A 3MV9E 2EDWA 2CK0L 5FA4B 2A38A 1BREA 5EIIA 3VMPA 4WUUA 1KLUA 4IOFC 4ODSL 5AAMA 3O3DB 5F7HA 35C8L 1A0QH 1HKLL 4I18B 1EFXA 4HV8B 3W0WB 2Q87A 4GMSL 3SO3C 1CFSA 4KZEL 3DX8A 1D5ZA 1CE6B 1DCLA 5E8OB 4PV9A 5EU7E 1FLRH 2R69H 2VXVH 2J5LC 5C0DB 3MR9A 4GKZB 4NM4H 3VE0B 2FX9H 5IVXF 2GAZB 4LP4A 3B2UC 3MFFA 1NAML 1YPZE 4KTYA 5TFSL 3I9GH 3QWQB 3QFJB 1D5IH 2WINB 3DV4A 4ODTL 2QSVA 3QHZH 4PR5B 2VERN 4YBQC 3MLVL 1CQYA 4YIQB 3LD8C 3IU3A 3LVEA 2ADIA 3PDGA 4Z95H 4K7PL 2PF6A 2VL5B 5SX4I 4G8GB 4MSWA 3BMWA 1CFVL 3WFDH 3HC0B 3P77B 2E3VA 2EDEA 5GHWH 2Q8AL 1G6VK 1CS6A 4DQOL 3S5LB 2AJVL 4LPWA 2R8SL 5CJ5A 2AEQH 5LXGL 2X4TB 4R0LC 2R4SH 4P2OD 1I7UB 4DUVA 4M5ZH 4EEEA 4XBGB 2VWEE 2VLRE 1S7XB 2X89D 4MS8C 4HBQA 5HHVL 2G2RA 3K46A 4UDTA 2R2HA 4R6UA 3NIFE 4DZBB 1LHZA 1MCSA 3T2NH 3OBAA 4XMPH 1WAAA 2P43B 3O3AB 1ZLVH 2VKXA 3V5KB 5GS2H 1HKFA 4B50A 1U8PB 2HFGH 1NBQA 3LY6A 5GRXG 1RZFL 2IH1A 2V5RA 2B1HH 2BK8A 3X14A 4NQED 1LO4H 5EG6C 4C59B 4JFFA 3QHFL 1XGPA 1PBYA 1KPVB 1JGVL 2CKBH 3MYZA 3RGVB 2I5YL 2F5BH 4JRWA 4LDOB 3QUMB 4HT1L 5DJ2A 2O5ZH 2FIKB 4MCZA 4RGOH 5F1KC 3SDCC 3UPCA 4YWGL 1Y18A 1XF5A 5GS2D 4GG6F 3O0RH 1U6AL 1T7YA 4Z7VB 1HQ4A 5F7LB 1IEBA 1OSZA 1FVDB 2CR6A 2BY3A 2VDOH 2APFA 2XKSA 4YFDB 2O5XL 3CLFH 4ZQKA 5C3TA 1OARL 2NX5A 2A6JA 4LPXA 4LOUC 1MH5A 4ELMF 4CW1A 5ERWB 1T1WB 4GAJL 1F8TL 1DQQA 1PLGL 5I74B 4KV5E 2H2SC 3TEUA 3WSQH 2V2WB 4YDIL 3P0VH 1W8OA 2XICA 4Q6IC 4XPFL 1O5DT 4HGWA 3MJ9A 4LVHC 3AMKA 1NFIA 5D5MB 5LCVL 2ZCHL 5D2LB 3MRGA 5HGBA 4YEFA 5T3ZL 5EC1A 3ARYA 4QY8A 1PYWA 4NHUA 1MFAH 1BZ7A 3HR5B 1TTUA 4PGCA 4OF5A 3SJVD 3L3IB 2E7LA 4JQIL 3G6JE 3S3JA 4HIXH 3VGEA 2PO6A 3L3HA 4GXVL 4LAJH 5DHYA 4ZNEA 5IVXA 4ZDHA 2QBWA 4XXCA 4ZFZA 3QIUD 3UYRH 5F21B 1F3DJ 4XP4H 3LKNB 4JKPH 1ONQB 4NP4H 1ZS8A 1LQSR 1J87A 4HKBA 4IRJD 4OFKA 5TPWH 1U3HC 1U8KA 5J06A 4S0TD 3BKCL 2B4CL 3OXRA 4R8WH 3Q0HA 5FCUH 1V7NH 1R3KA 1XGTA 3CXDL 4R96B 3O9WC 3SOBL 1N59A 5IHLB 4V2CB 1FL6A 1YMHB 3IYLW 4D9QD 1WCQA 4PJ8A 2FHBA 1RULL 4HEME 1AD0B 5FDWA 5EU5A 3KDMA 5T3XH 3PIQB 5DSCB 4FTVE 4YHIA 4JQXA 3IKCB 3VXMD 3MCLL 5DRWB 2R1YA 2DLFH 1BFVL 4Y5YA 3ZKQD 5B38G 5K33A 2AJYH 1U8QB 1TJIL 4V1DA 3LKRB 1KXTB 2CSPA 5HI5C 4NQCE 3U46B 3LZFH 3PGCA 4XVUC 1DBBL 2Y5TA 3HE7A 4OCXL 3MRQB 1RZ7H 4S1RH 3WNKA 2DTSA 2AI0L 3DBXA 1VACA 3GMPB 2JK5B 1PKQB 5D8JL 1D5BB 1ZLWK 4OFYA 3QXWA 1AY1H 4K2UH 1BVLA 4MAYA 3ROOA 1JI2A 2P5EB 2HN7B 5BXFB 1KLGA 2XQYK 3EJYC 1GC1H 1HZHH 1IT9L 2KPNA 4X5LA 4PJCA 1RZKL 2XA3A 3CDYA 4LLQB 4PJXF 4YBLB 3VFMB 5H35A 5CSBA 2VL4A 2OXHA 5HYJD 4UBDC 1H8NA 3HZMB 2PXYC 4LCUB 4GG6A 5F7MC 3S3SA 2H32B 2I27N 2WLZA 5DTFB 2VIRA 1WBXB 1ZWIB 5DT1H 2GSGA 3AREB 4OAWB 4DVRH 4CN4A 4P59H 1PJ9A 2BVEA 1NUFA 4KPHH 3L3GB 3VJ6B 2BNRB 3ILPA 4YDLB 2DAVA 4IOIB 4KK5C 3ARDA 5E70A 4MNHB 1CBVL 4QXTA 3BP5B 5AD0A 2GI7A 2DQGL 5ISZE 5ETUA 2SEBA 4GT7A 1G7MA 4Y16A 4JPVL 3FB8B 4QRQB 1GHFH 1J18A 2N7BA 3VGGA 1KJMB 1Q9OA 4X9HA 4MNGA 3UPAA 4RIRA 4NT6A 5E2TH 1TMCB 1U91A 2CRYA 3CFEB 1ORQB 4LQFL 3V4PH 2Y72A 1R24A 4JRXA 5DJCB 4OM0H 2G60H 4KJWC 1FORL 2EDOA 1C16B 3B9DA 1S7SB 3MBEC 1X5KA 5HGAB 2FGWH 4KJPC 4OUUB 3DX6A 5DD1H 1JZ8A 1C5CH 1E28B 1A5FH 3JWDH 1VGEL 3KNBA 4U0QB 3TZVA 3PQYA 4IM8A 4Y4KC 1T20A 2QTEA 2APWA 3UAJC 2G9HB 1FQ9C 2XWBA 5IR1B 3NIGF 2P5WD 1K2DB 1R3IH 4OLYL 4PJ9B 1A4JA 2WW8A 5F89A 5C07A 1OB1A 1WFNA 2E6QA 3LEVL 2OP4L 4FG6D 2EXYC 2HMIC 2YEZB 4PB0L 3M17B 2JJTC 3RVTC 4FFYH 1NBYB 3WL9A 3RNQB 4YXHH 3ARSA 2AXGB 1QSFD 4IOFD 5DEFA 3NACL 3GMOB 3QRGL 1A6UL 4D0CB 4R4BA 4RFEB 3SE9H 5GGVL 5IEKB 5K9JH 4ETQB 4J4PA 5HGDB 4HIJB 3GNMH 4LDLB 4XRCB 1MIMH 5F70A 5HYQB 5IQ7H 2ICES 1NUGA 3TBSA 2WQ8A 5EDXA 4YBHA 4CKVX 3B2UD 2PR4H 3MMEA 1Q0YL 5E2WH 3MA9L 3F12A 4I13B 4F58L 5JXAH 3NCEB 2NY7H 1E4KA 3VXSD 5I9QC 2Q6WA 2BJMH 1VDGA 2KKQA 4YBQD 3WHE1 5GGSY 3CZFA 2EDDA 5SWSD 1XGUB 2Q7YB 1FYTD 1MSPA 4IIQC 5F7FA 3O8XB 4JO3L 4ORGA 1D9KB 3C5ZB 4HWBH 4LSUL 1RI8A 1PW3A 3TVMB 5EN2B 4FP8L 4ONGL 4FQXB 3QNXA 2V9TA 1BQHA 2X4UB 4PJXA 1RU9L 3WNLA 3V4UL 3PWNA 4TQEH 4YDJA 4M93B 2DBLH 4ZS7L 1JGDA 1G6RA 5I1KL 4F2MA 1P4LA 3GSUA 2AQ1A 4OLWL 3T8XB 4MA8H 4MS8D 4G43B 2WM0A 3VRJA 4PJFB 3DSFL 4PJ7A 3WIHA 2V7NB 3QXUA 4ZD3H 4LEXL 5ADOH 4OCSH 4PJAE 3MGTB 2QLVB 5MHSE 3ULUE 5D7KD 3L6FB 3MLZH 4U1NB 1ZSDA 3EW3B 5FO7B 4NRXB 4MD0B 1UWEL 5JMRA 1I9RH