5I8KH

Hhh1 fab fragment
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
218
Chain Sequence
EQLVESGGGLVTPGGTLTLTCTASGFTISNYHMSWVRQAPGKGLEWIGFIDTGGSAAYAPWAKGRFTISRTSTTVALKITSPTTEDTATYFCARGAPAWGTANVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDRRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HHH1 Fab Light chain
publication title HHH1 Fab fragment
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8kH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8kH01
1BZ7A 1KN4H 1JPFA 4U6XA 5TJWK 2I26N 4OZGF 1RZ7L 2P43B 1Y6NR 1FFPB 3T0EE 3V4UH 1DQDH 1I1AC 3QT2A 4OCYL 3AU1B 4JRXE 4XP6L 5D2LE 1KV3A 4WY7L 1IQDA 4DN3L 1WCQA 4MXVE 5C6WH 5T1MB 3MA9H 2ZPKL 4OJFL 4R9HA 1SBSL 3QIBB 4JRYE 1TPXC 1U8IB 3HMWH 5LQBL 3VA6A 1JGVL 1SJEA 5EN2A 2HLAB 2YK1H 4ZUWA 2QTEA 1P7KB 4QRRA 1X5HA 4UIMA 3O6KH 4P4KC 2J6EH 2XZCH 3VXUD 3PG2A 3DX8A 1KJMB 3SOBL 5ESQA 4YXLL 4EN3D 4BQ8A 4BFGA 3FFCD 2CGRH 4MAYB 4K3JH 3KPRD 2VLJB 3FOLB 2B0SL 2EIZA 3GUTA 1S5HA 5C0JB 1C5BL 1I3RB 4GW1A 1DL7L 2RAMA 5D7JB 1OGTB 1T0MA 3VRIB 4GKNB 1WEJL 2DQUH 3KS0J 2ATPB 2UVEA 5F7EL 3VDAA 4QHMB 2LTQB 5INCA 2YBRB 4KDVA 5C7XH 4OFYD 5CJXC 3VXRE 3MV7B 2KPNA 1KFAH 3FQXA 3AS0A 4PRHE 4O02L 1IGMH 1L6XA 3IETA 4JPKL 3L9RB 4KRPB 2Y36L 3OJMB 4ODWB 3E6FA 5DVMA 3P0VL 4HIXL 4TQEL 1QBBA 1RZJL 3RWIA 3FTGB 3U4BL 4F9PC 2IAMD 4ZD3L 1I1CA 2E7BA 1DBKL 1YN6A 2CKBA 1I1RA 4M62H 4WW2F 4UT7L 3VFRA 4LCWE 4X6FA 1N8ZA 3MLXH 1KB5B 4RFNB 5DD3L 3EFDL 1UM5H 4JM2F 4TUJB 1WQVT 4YO0A 4DVBB 1PLGH 4AM0A 1UT9A 3MRIB 1WTLA 1P69B 4PRPA 5GPRA 1E4JA 4HWBA 3VFOA 5FHAH 3RVVD 3CDGB 1LEGA 4HBQA 5BVPH 1XGTA 1NBZA 3C5ZC 4UQ3B 2D7NA 5LBSH 3N06B 2A6JA 3VFVA 3ZDYF 1MCCA 4NC1C 1QSEE 5D2NA 4PV8B 4WWID 1FIGL 3B5HA 1NCTA 2YUVA 1DJSA 3K1DA 4FQHB 3CLEH 1QEWA 3AVEA 3CFDA 1HYRC 5C70A 4NZRH 5FO8B 4JGJA 2WNGA 3P73A 2VJXA 4TRPL 3KPSB 1U8LB 2FX7L 4LPTA 4FABH 5TDNA 2AV1A 4U2ZA 2ADGB 3FT3A 3ZE1E 3DMMD 4WWKB 1DFBL 4IIQC 2Q76B 3VXQA 4D2NA 2CKBH 4F7TA 2I9TA 5GIRB 1HKFA 4PRDA 1ACYH 4MX7B 5D7LE 3UPAA 4MAUH 4QHKJ 5DF0A 5TE6L 1EAJA 1IGYA 1NGQL 2VLKA 1JPGA 2DMKA 1WWAX 2DICA 4JAMA 5H37G 5AAWA 1D5MB 4MYWB 1FV1B 4OLZH 4YEEA 5CJ5A 5A2KH 4OV5A 3TT1H 2X4QB 1S9XA 4AMKL 2B5IB 3A6CL 2DRUA 4N90E 2XT1B 2WV3A 5FOBA 1AIFA 3D6GA 3GKWH 1FZKA 1T89A 1E4KA 4NC0B 5L2KD 1TCRB 4HXAL 1CLYL 1U3YA 5HVGB 4JFOB 4LSPH 4MA7L 3V6ZB 1X5KA 5IB1A 3EO9H 3ULVL 3HZKB 3M17B 3M8OL 4NFDA 5HGHA 1I7ZA 1VACA 3HZMB 5EO9B 4X7FC 5GGQH 1DUZB 1A14L 4N8VB 2O5YL 3ARED 5KANI 1TJIL 4LSTL 1T2QH 1AGDA 1Q9WA 4JY6B 3GHEH 3HC0A 3NAAL 3OKKB 4U6YB 3EJJX 4Y2DB 1KLUA 4LMQE 5BMFL 4YGVA 4LHUA 3G5XA 3HZYA 3CSYA 5F96H 2C1OA 1U8JA 3DGCR 2MQ3A 1N5AA 4O2EA 1JCKA 3TA3D 3MTRA 4XBGA 1YDPB 4JN1L 4L29A 2WZPD 3PQYA 1HWHB 4JM4H 4XCYB 2DLFL 1P4IL 8FABB 2I24N 4YAQA 4BFIB 4I18C 4WI3A 2VTFA 5TF0A 4HWEH 3AS1A 5GGUA 5IT2L 3NCBB 2DQFA 3O3UN 4WI2A 1UB5B 3PWJA 5DK3A 5CCKL 3OSKA 1J8HD 4XPHH 1WBYA 3FCTB 1W0VA 4JKLA 4Y8DC 5EA0L 4HWUA 4QRPA 3BWAB 5F7DA 4OF6A 5JW3L 3LB6C 1NMCB 2PW1A 3ULVD 1QR1A 2NTFB 4NBZB 1I1FB 2J8UE 1D9KD 1FO0A 4U49A 5HVHB 4WW1A 5FGCB 3GMRB 3OKNB 4NKDB 4YFLI 5ACZB 2HJFB 5FA4A 3QDAA 4MDJB 4NNYA 1Z5LA 3PABB 2BRQA 3GNMH 1QBLH 4F8QA 5CLWA 5SX5H 4X8JB 3GSVA 1IC7H 4BKLA 4IDJH 4XPTL 5SX4I 4C83B 2JCCA 1R3HA 2BNQB 3TO2A 5EZOH 2AQ2A 4JHWL 5T3ZL 4CVWA 3FO9B 4WWKC 3CVHB 1IC4L 2C7UA 2EYRA 4NNPL 1VGKB 3NBNA 3MFFB 1Q9LA 4GMSH 4QXUL 5K9OB 3QUYB 5D7IE 4Q9QL 5DJAB 4R4BB 1MFDH 2MKLC 2YMXH 5DHVB 1DVFB 2YA0A 2DDQH 3QI9B 2J1KA 1GVIA 3QDME 1OAQL 3ALXA 1NMAH 2VQTA 1N59B 1RULH 3VFWB 5JUEH 4JB9H 3ZYJA 3DRQA 2FX9H 4J3WA 1TZHA 3FN9A 5T5FH 2P8LA 3VG9B 5DI8B 3ZYZA 2X1WL 4M9OA 1S7TB 5C0AA 5TFSL 4PB9H 2VISA 1OAZH 3BKYH 3JSSA 4FRWA 4DKFL 5DZLA 5MEOB 4S1QL 4OCMC 1UM6H 5LWYH 2HVJA 4G6JL 4N8CL 1SBBA 2ERJB 5AYUH 3GIVA 4NWUL 4J8RB 4KHTL 1DQTA 1F4AA 5FUZH 2PYFB 1J05A 2FEDC 5DMKB 1UJ3C 1KTLA 3CFCL 4NJAH 2FJFB 5B8CB 1T4KB 4XCCL 3MRNA 5CJBA 1G9NL 3SDCA 3MJ7B 3W9DA 4PLKC 4UQ2A 4PS4H 5KTEH 4M61B 4G6FD 3D69A 3MROA 3VE0B 1YPZE 2P24B 3BIKA 1VEOA 4LRNH 1U58A 1Y18A 2FHBA 4XAWL 4XHQA 3FJTA 4NQVA 2BRRH 1T1YB 3A67L 4YZFE 3RBSA 2AQ1A 2UYLB 5T3ZD 1Q0YL 2D2OA 5HBBA 3QA3B 2AI0H 4X6CA 4HQQH 1S3KL 1G1CA 4YHPB 1FYTA 4ODHL 3EDJA 5CZVL 4Z77B 2APTA 3DETC 2KH2B 3DROB 5IIEB 1NCWH 3BW9B 4KJWD 5JORB 1X6LA 1KCLA 3U83A 1A21A 3VD9A 2IGFH 4KI1A 5IJVB 3QUMA 1BQUA 4UDUB 3REVB 1WT5A 4HX1B 3V7AE 4MZ3A 3AXLA 4YHLH 1HN1A 5C8JA 1JTPA 3BP4B 2IJ0C 3KS0H 5GS2D 3K4AA 5E08H 2BJML 4J3TA 1OM3L 2IFFH 4WRLA 4OD1L 5HVFB 3K3QA 4GRWH 2FECL 5GS3A 2XQBH 5FYKH 1CFTB 1QTYT 4KQ4H 3C60B 4QNPF 2W0FB 4Q74A 5CP7A 3ZE2F 3GFUA 1MLCA 1WWBX 2ATKA 1CFQA 4X4ZA 4LBEA 2UUDK 2XNAB 3PWLA 2HA1A 4LGSB 3MOBH 3PIQA 4DKDC 3O4LB 3GI9H 2CIIB 4K07A 4DWHA 3VXME 4AJ0A 4UT6L 2BHYA 1QFPA 5F7YC 1I1AA 3DX7A 5TDOB 5HGBA 3BH9B 5DA4A 3DXAB 4FMFA 4FQLL 3WNPA 3MLUL 3V6FB 4EEEA 3MMEA 1NFDA 2MFNA 1J18A 2BVQA 5C0BB 4GMTL 2D3VA 1Q0XL 1T3FB 1HH9B 1V7MH 4YXKH 1YMHA 1ZT1B 5GS0L 1HWGB 3VXSE 5JHDB 3QUMH 1U41A 1IFHL 3KPPA 1HZHL 5DHYB 3VXUE 5F1SA 2CLVB 3MREA 4CKVX 5HSFA 4XC3H 3TH4T 3BQUB 4RDQF 3FFCE 1M71B 1G0YR 3KPRE 1MVUA 3SE9H 4PTTB 3T4YA 1BWMA 3P77A 3HKFA 1L6ZA 4TOYH 2HP4A 3SJVE 4M48H 2DM3A 3JV4A 3KR3H 3QJHB 4NT6B 4I13B 3ARVA 2V5MA 3CZFA 4U1KA 5BO1L 1A9BB 1BOYA 3KYNA 5CKGA 4L9DA 2DQIH 1KELL 3WO4C 3KLAB 4WEUD 1OAYL 2V5RA 4HIJA 1G6RB 3WHE0 2C3VB 3ZKMD 2PNDA 1FCCA 4P9MH 2FD6L 4RIRA 5CJXA 1F8TL 5L8LB 1JFQL 2NXYD 2NX5D 1X3DA 5KSBA 3ZKXC 3G04A 4JZNB 5GRXG 1R3IL 4UNVA 5KJRH 4ODXB 3GSXA 2VUOA 4XWGH 4PR5B 4OGXL 3O4OC 4Y16B 4F9PA 3V7AG 5CINL 2J4WL 5C09B 2X2YA 3WIHL 4S10A 1N64L 3MO1B 4PJ7A 2WIIA 3QEGL 4AEFA 2YD1A 3I9GH 1XCQB 3BN9D 5AZEL 5GS0D 4FTVE 3TFKD 4Q9RH 4XMLH 1TVBA 4N1HB 4YIQA 3HNTL 4NM8H 3N1MC 4WUUD 1Q94B 4L9LB 4UBDC 4JPWH 2YUWA 3H9ZA 2VKXA 4C4KT 1HHJB 5LGJA 4I48A 3OV6A 3C5ZA 1IM3B 4WO4B 1CFNB 2BNRB 1IC5L 3BD5A 5KN5B 3REWB 3QQ9D 4BM7A 4JO3L 1DBBL 2LABA 2P7TA 2ZKHH 1A0QH 5JOPD 3BH8A 3C08H 4ORGA 2EDYA 4HBCH 1AI1H 3P0YL 1YMMB 3V5KA 4XNUH 4R4ND 2WUBL 3LDBC 4WDIB 1JGEA 4OBSA 3L3OB 4PJBB 2F54E 4OCWL 1JPTH 1NEUA 4KGLA 4XPBH 4ZXBC 4IIQA 4Y88A 1S7WA 2HVKB 3W2DH 1CGSH 1TZIB 2GY7B 4GAYB 3DV6B 4YHKH 5AD0B 5T1MA 3H3KA 5GGRB 1L9MA 1CD1A 1EXUA 1ED3B 2JB5H 3HNSH 4YLQT 5TE4H 3PNWB 1G9EA 2HLAA 2VDQL 3OBAA 4EI5C 3BFOA 4BZ2H 1JTOA 1B0WA 4F7MB 4MCZB 2VDMH 1FG2A 2J2ZA 1U92A 3BZDA 3QCUL 3T1FB 5IVZA 4OZIB 3FRUB 3BZFA 4NBYB 1PBYA 4MAYA 4JG0H 4LNRB 2APFA 5B3JE 1KEMH 2DMBA 2IANB 1OB1A 3M1BA 3KXFD 3SKMB 3NA4A 1W0YT 4KROD 1J1OL 3D18B 5J6GB 2JELH 2BVUA 4K7PH 1WLHA 3VRLE 4GKNA 4YFDB 4XI5D 2AEWA 4XCFL 1ZVSB 1E0OB 1O0VA 5E5MB 3ARDB 4QGYA 5T33H 3SKJH 3TIEB 1MCOH 1U8QB 5K59F 1SJVA 4GG8A 1WWWX 4LLQA 4ETYA 1KXTB 2APBA 4UILL 3S7GA 4JRWA 3WDJA 1CK0H 1OAKH 1Y0LB 2HFGH 2P1YA 1OP9A 1EO7A 4LSQH 1B0RA 4HCRL 5GGTA 3ARFC 1CE1L 4E0RA 5ITBH 2DLIA 1BF2A 1FRGH 1IGTB 1KB5A 2W9LA 3LQAC 2ILLA 1RZFL 4L4VB 2EKJA 4TTDC 4M00A 1G7QB 1RZKC 3HRPA 2EC8A 1IM9A 3MRIA 3S34H 5KVGL 1QQDA 4BFEA 4CMHB 3L3DB 3ULVE 2X42A 2C4FT 2VL5B 4GT7A 1A6UH 3DUUB 1I7TA 3P40A 3LKSB 3VD3A 2X10A 3IFLL 4W81A 5I1LB 4NWTL 2YPVL 4JPIB 3NCJH 5GGSY 3QIWB 5FCSH 1XIWD 3IJSA 3BJLA 5LCVH 3VFMB 4G3YH 1LD9B 1AR1D 1WZLA 3D0VB 2Y6SD 3HFMH 1CLZH 1D3CA 1WF5A 4LPCA 5FDWB 3KPSA 1AR2A 1INDL 1MF2H 1CQYA 3MLWH 1TCMA 2BX5A 2ZSVB 2WBWB 4KJQD 2B1HL 4WWKA 5IHLB 1UVQB 5LXGL 3S5LB 4U4BA 2VLLA 5HYIA 2PYEE 3LVEA 3RAJL 3P3YA 2Y06H 1SHMA 1RZIA 2EECA 1AGCB 4CN1A 3VD4A 3L5XL 4ODUB 1DLHB 2G60L 3QRGH 3HTLX 4G5ZL 4KKAC 1M7DB 2EEAA 1B6UA 1JWUB 5C0CD 3QEHA 4HK3J 4HUVB 2ICWB 5I73B 4JY4A 5T1KA 1IL1A 3U9PL 5HGDA 2MNUA 4L3EA 5E2UL 3V6ZA 3JUYA 4WFGD 4NJ9H 5MEQB 4F15C 4OGYH 1CR9H 3G6DL 5EO9A 4WV1C 3U30C 3HMXA 3CSGA 4OD3L 4GG6A 2AJUH 5EZLA 2NY7H 4YNYB 3BO8B 1E4WL 4OM1H 4UTBL 2Q6WB 5EBMB 3WN5B 5A43C 4U6YA 1QVOA 3OGCA 3NA9L 3WLBA 5HDQL 4OI9A 4R90L 3B9DA 5I9QB 5EUOB 4UU9A 1LO0L 5HHNB 4LCCB 4JFFD 4JJ5B 3CZJA 4HUWB 3DLQR 2QQLL 3GEWB 2VWEC 3LOWA 4XNQB 4LARL 5DD5L 5DWUH 1YDPA 2A0LD 4OB5H 4LSVL 1A7RL 3V79C 2AGJH 4JY5L 2PETA 1X6NA 3CU1A 8FABA 2DQTH 1GOHA 1UYWH 4OFVA 4WEBH 5E9DB 2EH8H 2QQQA 5E2JA 1UH4A 1MCHA 4J3UA 3ULUL 3OKLB 1NBVH 4PJIE 1DQJA 4HKJA 3QDGD 4NYLB 3DV4B 2V2XA 3L3KB 1HQRA 3QXTA 3FCTA 4WFHD 1BZ9B 1SEQH 5HY9B 4Y5YC 2R2CA 1KYOK 1NCDH 3LSOA 5C0FB 5J56B 3TA3B 2JJSC 5CKAA 2A6KA 1YQ2A 1FL6A 3ARGD 2WANA 4M1DL 1KJ3L 1AHWB 3ARBD 2ARJB 1D5IL 1NSNH 2OR8A 4KKBC 2J88L 5ACZA 2OI9B 4UIKL 5BW7A 3CCHA 4JZOA 1A7NH 1MHEA 1ZAGA 1CT8A 1FP5A 1QP1A 2EXYC 3L5IA 3TBWB 1GRWA 4X0KA 1R5WB 2SEBB 4OGAC 1AGBB 1RUML 4XVTH 1K5NB 1KN2H 3DNKA 1ZT4B 4HWZB 3RVUD 1YNLL 3KPLB 5JR1L 1CL7H 1UC6A 3UDWC 3G6JE 2FYYB 3CU7A 4JFYA 5ESAB 4OD2A 1IGJB 1PG7X 1TQCB 1EJ6A 1N26A 4OLUL 4ZUTA 2ESVE 4OF5A 5IGXH 4LLMB 1XH3A 4NKIL 5HYFA 3GSNL 2CRYA 5I73C 1A3LH 1NLDH 4JFEB 5DQDH 3CAFA 4ODVH 4HSQA 3H9SB 5EU6E 3GMOB 4XP1H 2ZJSH 3W0WA 4LSRL 2ZWLT 3PWPE 2GKIA 4J8RA 4ZFGL 3EGSB 2PYFA 4O2FB 4HGKC 1RJLB 1A1NB 2W9EL 1MSPA 3RIFK 2FJFA 2NX5E 1T4KA 2CR6A 3SDXF 1RUAH 4GFTB 4MJID 4QT5B 1UKQA 4G7VL 4IS6A 4AIXA 3VE0A 5ISZA 4ZUUB 3UTPD 2P24A 3MGOB 1S7XA 2V7HA 4MNQA 3FQNB 4EBQL 2AJSL 3BAEH 3PDOB 4WHYG 4HG4K 5LAXB 4MLSA 2RFXA 4W68A 4G6AC 5E00B 3TT3L 4N68A 1FVCB 4HEME 1KG0B 4FG6D 3BD3A 2XWTB 3C6LD 1PQZB 4DGIL 3OAYK 4WUUE 4AEEA 2P4AB 4GW5A 3STZA 4GLRI 3F7VB 1TTFA 3MLTB 3RWJA 5L0QB 4DAGL 1XCTB 4MJ5B 1GSMA 3BP4A 4DFHA 2ZG1A 5FEBA 5HI4C 3T4AB 3FO2A 3KJ4B 1ORSB 3WUWG 5JOPE 5L9DL 2VL4A 3OG4B 5BCAA 4ERSH 4OZHA 2DL9A 1YEKL 4G8GB 3VW3H 2XNAA 5F7NC 1C08A 3A6BL 4NKOA 1AXTL 3FB8B 3FZUC 3R06B 5ADPH 2A74B 1RAMA 1ZOXA 4ZXBA 5AUMB 4DN4L 4X9FA 1IBGH 3D39A 4Z95L 3GRWA 2B7DT 1XGQA 3DXAA 1FC1A 1L7TH 3V6FA 3ZL4H 2L4OA 4KHXL 3PJSA 3SGDI 4NZJA 2CDGB 4ZYKB 3MRDB 2R69H 1EX0A 4EI5A 1BPVA 2VXSL 5IFJB 1Z9OA 2EYTB 2H1PH 4OM0H 4X4YB 1TQCC 4S1RL 5FDYA 3BQUA 1KNOA 5F7WC 3TP4A 4ACPA 5IBTH 5D1XB 6CGTA 4OCLC 5GSRB 3KXFE 1NFIB 1CICD 3MV9D 1NJ9B 1NGXA 2MJWA 2EH7H 3VRLF 1TJGH 3TPKA 4Z7OE 2CMRH 4RCAA 4HPOH 4PY8J 3VA2C 4Z7VA 1YNKL 3SEPA 4NT6A 4NQDA 5CBEB 3DPBA 5I76B 1ZANL 4LAQH 4KZDL 5EU4B 1IGCL 5FK9A 4PJXF 2Q86A 3V0AC 5GRUL 3QXDB 4JFHE 3KLAA 1WBXB 2JB6B 1G6RA 1TMCB 4D9LH 1GGBH 3GHBL 3JTTA 3CFBB 3V52H 3SE3C 2DLTA 4PRIA 1S5IH 3HC3L 3EKCA 4W6XB 3OKYA 3O3DA 3I2CL 4QWWC 3NCFB 4FP8L 2A1WH 3ARFA 5ANMB 1KSRA 2W0KA 4RGNB 1OP5K 5FUOL 4K8RL 3SDDC 3QCVL 5DDHB 4TPRL 2RCSL 3QJFB 3WXVL 3OKEA 2XWBA 1BFOB 1NBYB 2CLRA 3CFEA 3HAEH 4NO5B 1DQML 5IMOB 4PUBL 4KMTL 3ULVF 3VG0H 5SWQB 4X5LA 1G7JB 5CZXC 1MY5A 1Q94A 4WFFD 5JQ6L 5T5NF 4PRPE 1HHJA 1WAAE 4MQ7B 4Y4KC 3GMNB 1FSKC 1P84K 3LN5A 3T77B 3BDBA 1S7VA 1RIUL 2QQKL 5CBAA 1WBZA 1EMTH 4C56A 1I9IH 1QKZH 3LAFA 1F6AA 1C7TA 2NY2B 1YQVH 4GKZB 4M1CD 4XNXH 2QSVA 2VNCA 3I6KA 3V4VL 5I0DA 3KPNA 1NAMA 3L3OA 1KF9B 2R2BB 2WWKO 3EYUL 3ZO0A 1Z9MA 4XNZC 3ABZA 4WHTB 3WLWD 2MCG1 4K94H 4OIIL 4PFEA 4XTRD 2HVKA 3UJTH 2XWJB 4H1LH 3EYOA 4GJTB 4MB5A 3DV6A 1F4YH 3LQAH 3TZVB 3WS3B 5FYLH 4P9HC 4WW2C 1WFTA 4P2YA 4N1CA 1RZKH 3BSZL 5IKCB 2C3GA 4ZAKC 4K8RD 1ED3A 5E03A 5GHWH 2VLKE 3PDDA 4JM2C 2DQCL 1JMZA 1J8KA 5C0CE 2X4NB 1OF2A 5DSCA 5L7XH 3CK0L 5D7KE 3F62A 4MCZA 3WEXB 1JGDB 4ELMB 4B5EA 3E1F1 1AJ7H 3F5WB 2FATL 3FQWA 4WFGE 3D0LB 4GUPB 4YC2C 5FV1L 4E5XA 3BZEB 4ISVA 1T2XA 1R3LA 3RWCB 4LNRA 3G5VA 4Y4FC 4WV1A 4MB4A 4Q0XL 4H26B 2P5EA 2YPKA 3MBED 5I66A 4KKCD 5CJOH 3O6LH 1NAMH 4JVUA 4LCUA 2UV3A 2J5LC 3IFNH 1U6AL 3RX7A 2MCPL 5I1IH 2ADJA 3NH7H 4EKXA 3KHOA 3MCKB 4OZ4A 4APQD 1CDUA 3ARDA 1JGLH 2W60B 3WFEL 1JZ6A 4LFHD 5D7SL 5F89B 3VXTB 1W2KT 3CX5J 1ZLSL 5EC1A 1GC1C 2NY0C 4RQQA 2XPGA 3NCMA 4L3CA 3L3HB 4LQFH 3O3EB 5BV7B 4LOUC 3O0RL 3G5ZB 1Y0LA 4PJGB 2QBWA 1LO5A 4Z8FL 1LE9A 3BKJL 3CSBA 2LV4A 4FQIH 1YY9C 5E5RB 1AD0B 4B7IA 3TN0D 1IILE 4HKZB 3G5YA 4M9PA 3RJDA 4A6YB 4JO1H 1YEGL 5BZWA 1JYWA 3OZ9H 5DMGD 1I8LA 3CNKA 2EDDA 2R2HB 5I1HL 3WKML 1J0KA 5FXCH 3BUTA 4FNLH 3VXPA 1F58L 1QFHA 4LK4A 1JUFA 4JFQB 2EDWA 1LO3H 4K9EL 5KS9F 4LLUB 4F7EB 4QRPE 2JJSA 1PY9A 3EJYC 3EOYG 3RPKA 2UUDH 5KVDL 2WBJD 2GYSA 2ICES 2VLRD 4HC1A 2OL3B 3O3BB 1IQWL 2W9DL 2D7PA 2YPLB 4UOW1 4DK3A 3HE6C 5FA3B 3VFMA 2ICEA 4CU6A 3NIGE 4M5YH 3QFDA 5I30L 5KSVB 1FLRH 4M7KH 3QHFH 4M6NL 2H8PA 4N0UE 4CNIA 4YHNA 3WNKA 4S1DC 2JCCE 3BDYH 2XQYK 3G6JF 1UVQA 4H25B 2BSSA 4ZNEE 3K2UL 3UDWA 5A1AA 3LY6A 4NN5B 2GQHA 4X7TB 5DJZB 2VXTL 5E4EC 3HUJB 2VE6B 1AGCA 1FORH 4RAVB 2VKWA 3R1GL 2HTKC 4GXUN 4PGDB 5K9JH 5I75C 3IJHA 3IU3A 4FZEH 1HYSC 4PRBB 4E41A 4M7JL 1G7LB 3LKPA 3UZQA 4P2OC 4GAJL 2ITCA 2DI9A 2VAJA 4BUHA 1A9EA 3BPNC 4PJ5A 3SDYH 1F90L 3F6LA 3U7WH 4R26L 3IU4L 4HC1H 1EEUA 5DJ8A 3PWUA 4N5EC 3BEWB 2AEQL 3T0EB 1NLBH 2R4RL 3HB3C 4FFWD 4JRXB 1F6LL 4YHOL 5DRXA 3VFSB 5BS0B 5D2LB 1RZGA 4GRWE 2G9HA 1KTDB 3CSPA 3TBTB 1NDGA 5FYKE 5A2JH 1QBAA 3BO8A 3UTPE 2EDRA 5SWSB 1A6WH 4L4TA 2ZNXA 5MP6H 4U1SB 4CVZB 3VXNA 3BKCL 5EOCJ 1SEBA 1K6QH 1X5AA 5ILTH 2PTVA 4FFYH 3DI2B 2R2EB 4PJEE 4RISH 5JIKA 1IE5A 2GJJA 4YGAB 3JWOL 2EDTA 3QEUA 3RWEB 3D9AH 3VFUA 4ZTOH 3R0MA 3GMPB 4YHYC 1G7MA 1KJ2A 3OWEA 1OQOA 3PHQB 4YHIA 5I15H 3VMPA 1XF3A 5TE7L 3D48R 1RFDL 4PJ8C 2DM7A 2AXHA 1G6VK 1V3JA 4P46D 1H3GA 1KOAA 2F53D 1AKJD 1PJ9A 5EWIL 5HTSA 5CGMA 1I9RL 1A1OB 4QTIH 5C0FA 3QFJD 3NIDF 4ODTH 4X6EA 3MRJA 1D6VH 5I1CL 3B9KD 4D8PB 1JK8B 3NACH 2V17H 3G6AB 3TO4D 2EIBA 1DQLH 3K81A 5J6HB 4PRHB 3KNBB 2G5BB 2ARJA 4ZFOA 3X3FH 2VLMD 1Y6KR 3T2NL 2VXQL 2DAVA 4X9IA 2Y4SA 3Q5YA 3ALWA 4UB0L 5EIIB 1FNEA 4X99B 3H7BB 1JYXA 1EBPA 2JK5A 2R4SL 4WUKL 3V4PL 5CJQL 5B39A 1EFXB 3QXAB 4PJFE 4HXBH 4LCWB 3Q0HA 1P7QA 5DT1L 3DYMA 3MRCA 3D2UD 1LILA 1BVLB 1A6AA 1WCBA 3FHAA 5JXEC 4V1DB 2AABL 2RHEA 4AL8L 4PJHE 1Z3GH 1MPAH 1NFDE 1ZT4A 4GXVH 2NZ9D 3EYFA 3FO1B 3RU8H 1G7HA 3V5HB 4OLVH 3QNZB 4MD0A 4NO0A 3HG1B 2FYYA 3HPLA 3ARBB 3RZCD 5DVOA 3GMLA 2VUYA 1IKFL 4CVXB 1QSEB 2VXVL 3QG6B 1F97A 1RIVL 4LLMA 5MERB 3CXDH 3LN4A 2H32A 2YD2A 1P4LA 1DBJH 3WFHB 5JDSB 2R29H 3F58L 4OF7A 4D94A 2ZOKA 1C12B 1R0AH 3VFTB 3GK8H 3BP5B 4NKMB 4N0RA 4X83A 5J3HC 3KHQA 2F5AL 3C8HA 2YD8A 1MJ7H 4CVUA 1FFQA 3BEVB 5GJTH 4OZGA 3QHZH 1RJLA 2AAVA 4W6YB 5E70A 5IW1A 2NY5L 4JQXC 2BOCA 3UJJH 4NZTH 3KLSA 4GRLD 4P59H 4U1NB 3P9LB 43C9A 4AENA 3SE3A 5I18H 1MI5D 3RGVB 4S0TD 5JW4M 3I84A 2MPAL 3VWKB 4AY0A 5CEZH 3SO3C 4F7PB 3DRTB 5IB5A 5E1AB 1U91B 3RWFA 3ROLB 2PW2B 1OTSC 4J23A 3SDDA 3PP4L 3NN8B 3QBTB 1FVCA 3EOAB 3MLZL 5I74C 1FGNH 3UC0H 3ZHKA 1KG0A 3V0VA 3KPMB 5HI5D 4I0PD 4HS8L 5FHBH 3UTSA 2RBLA 3U9UA 1T6WA 4U1MB 3L3JB 4IMLB 3EYSH 5BRZB 4NM4H 2CK0H 1FBIH 3RVXD 3H6JA 5KSUA 4UUJB 3N85H 4TTGA 4Y4KA 2FR4B 3L5WB 1FVEA 3U7YL 1KB9K 3GBML 3IDIB 4DKEH 5E0QA 4OKVA 5JIIA 1KGCD 2OJEB 1GGYA 4NC1E 2XN9D 3SPVB 2C1PB 2O5XL 4OF3A 5HJ3B 2EE3A 4BUGA 1BBJB 4RWHA 1CIUA 3O9WB 3ES6A 1T1ZB 3T0DA 1E27B 1HHHA 2VDOL 3CVIL 2AJXL 3R06A 2A74A 1BLNA 3D3VA 2PTUA 2X7LB 1T1XA 3RHWK 1NC4A 1PKQE 5DJ0A 5AUMA 3GSQB 5D4QA 4AG4H 1TENA 2ZUQB 5E8DH 2GJ6D 1LDSA 3H9HA 4KPHH 3WV0A 3O6MH 3GSNB 3QH3A 4WW2A 1ZV5A 3EYQC 3ZT5A 5ID0A 4G9FD 4UT9H 1JPSH 4ZMAT 4R4FH 4JM2A 2X4OB 4PJ9D 1BIIB 3HE7D 1EH9A 1WJ3A 5FGRA 1EA9C 2BZDA 1I8IA 4KTEL 5DR5H 3AAZA 4P2RD 3LV3A 4RMQA 1G7IB 2IG2H 2PXYB 1E6JH 1UJTA 3TGXA 2G75A 4YWGH 4YFEA 4WU7A 1QLRA 3QCTL 2VDNH 4P5TC 2E6JA 4JO2L 1J0JA 3SE8H 1PZUB 4LL9A 2ZUXA 2VH5L 3TVMD 1MQKL 5C9JA 4Y4FA 2YK1L 3UMTA 4NQED 4TSAH 4XP4L 1N4XH 4AT6A 2FHCA 3VGHA 5EZJA 4HMCA 4Y5VB 4YDIH 5CBEA 1F4XH 5I76A 3WIFB 2ITDA 4YUEL 1J7VR 3W39B 4JFDB 5TH2B 1ZS8B 2M2DA 1VGEH 2JB6A 4MQXC 5D7IB 2R1XB 4M7ZB 3P4NB 4NN7B 3KLHD 4P23B 4P9HH 5J1AB 3QDMB 5F88B 1QZ1A 2QADD 4QO1A 3TBVA 3RTQB 1ZMYA 4LLVB 5GRZA 1U8NB 2EDLA 4MNGE 4X6DF 2NXZD 2XTLA 4XP5L 1LP9F 5D96B 3HLAB 5D1QC 1CXHA 2NNAB 2R0LL 5DDHA 4F3FA 2KUTA 4PJDE 4I2XA 1U8KA 1QRNE 3QJFA 4O4YL 2FH8A 1XGPA 1NBYA 4PY7A 4NO5A 3X12A 4JN2B 5IMOA 1ZHBB 5IR1B 5CP3A 1BGXL 1IAOB 1G7JA 1TQBC 2PO6C 2VDKH 2AV7A 3WNLA 1IARB 1L4IA 3U6RB 5F9DC 4YFLF 5I17B 1ZGLB 5C07A 3TPUB 5MEND 5EOCH 1YPZB 32C2B 4U0RC 1RY7B 1CDIA 1MIEL 3VWJC 1CFVH 4PBWD 1YC7A 1MNUL 4DZ8B 4HH9B 3HE6A 1GC1H 1Q1JL 3L7EB 4LVOC 4M43L 4Z7NE 1KIPB 2BCKB 4I5BB 5B4MD 3R8QA 2D7MA 4JQIL 5EOQL 1G9MC 2Q7YB 3I3DA 1QYGL 4LSUH 3ULSB 1X4XA 2Z31B 4OLYH 5C08D 2DLHA 3LIZH 5DS8B 1OSPL 2DQEL 3NPSB 4I3GA 2P8MA 1OW0C 1PYWA 2DD8H 5FO7B 2DKMA 3OJDB 1JV5B 4HIIB 5E2TL 3TZVA 3FQTA 1E28A 4XZUA 4R2GB 5LGHH 2F19H 1YN7B 4G8IA 4NSKB 2EDBA 1F13A 5C2UB 5CP3H 1A3RH 1GZQB 3U36B 5H8DA 3MV8A 1LO2H 1H8NA 1NGZA 1KCVH 4RA0C 2CDFB 2N4IA 2X4TB 5TF1L 3H42H 2UWEF 2GSIA 1B90A 5F6HJ 1ZLWK 3WEXA 2IMNA 3ARSA 3MOAL 5JZ7D 4Z5RB 4GUPA 4ZS6D 3L1OH 3WSQH 2MHAA 2GK0B 4TNWK 1MCJA 4Z0BL 2X4RA 3FKUS 1QO3A 4Y1AA 3BRDA 1AD9B 3VXMB 1T5WA 3EAKA 4HWBL 4L3EE 2Z4QB 4OCXH 1M7IA 3HC4L 4IEFB 4HK3N 1MCBA 1A22B 4UTAL 1AY1H 3GKWL 4GG6E 1K8IB 3LS5L 2DIJA 3EO9L 2Z91A 5SWZD 3OR7A 3VXSB 3INUL 2C26A 1LWRA 2CR3A 2LQRA 5HHQB 3U2SB 3FONB 1KLGA 1MFAL 3O3EA 3P11L 1SMAA 1MHCB 1P4BL 3UPCA 4LRIC 5INDA 1INQA 5DD0H 2NY3C 1OSZA 4XMKL 3V7MA 1OLZA 2MOVA 3MR9B 2VDLL 3H3PH 3OAYH 12E8H 1G0DA 5E6IB 2P8PA 3SDAC 4HKZA 4QRTB 3MGTA 1B88A 3SJVB 1A6ZB 1UWEL 2R23A 3O41B 4PJ8A 4XH2B 5EOTB 2F53E 5DD1L 4JZJC 5T1LB 4XBPB 3SKNB 1QPXA 2ORBH 2AXGA 2N56A 4JFQA 3ECBB 5TDPB 1R5IB 3L6FB 2Y7QB 3K8MA 4MXQD 4LLUA 4AEIH 1QFWM 4XBEH 1CGYA 1MRFL 1F6FB 2CXKA 4ZUVA 2VLME 2ADIB 1H3PH 3MUGA 3WD5L 1XR8B 3X11A 4FA8A 3ESUF 3X14A 4Q6IC 4IRZL 1T7VA 4XP9H 3R8BB 1NCAH 3LEVH 4I4WA 3TYFB 3HN3A 2NR6C 5F7MC 3MODL 3FN0L 3KJ6L 2EZ0D 2UZXB 3BKMH 1E4XI 2OJZL 4PJHF 4RBPK 5DRWB 3O6FC 5IEKA 2VC2H 5EO0A 4JREC 5JXEA 4FTVB 3FQUB 5DUPH 3FFDB 3UYOD 4XPGL 3MA7B 3QULB 4UV7L 3S88H 1I3GH 4BSWA 4NQCD 2HJLA 5FYJU 1RIHL 4BSVA 4BH8B 5D1ZD 1I1YA 2EIDA 3VFNB 1OT1A 4HJ0C 4HFUH 1LGVA 1IC7L 2AK4A 4ZDHB 4MXWH 3B3IB 3HUJA 4EIZC 3VJ6A 4HS3A 4RAVA 3VI3E 3UTTD 2DQJL 4PGDA 3L5HA 3LHPH 1EO8H 4OTXH 3RL2B 3LD8B 3QUXC 1T03L 2XG4A 2Q8AH 3IDMB 4PRBA 4L8SC 3MUZ1 3BE1H 4UDTB 3S9DB 5I1AB 2DDQL 4MHHI 1NMAL 5E2VL 4ODSL 4HJGB 4TUOA 2F54B 4L8BA 5DLMH 4XAKD 3RWGA 1RULL 4I77L 4DUWA 3T0EA 4OIAA 1VERA 1HSBB 4GS7B 4OCSH 1BQLH 5KVEL 2DBLL 3W0WE 3ZTJH 5T5FL 3OGOE 3MFGB 4JQXA 3P4MB 2K3TA 2NW3B 5DJYA 3G9VA 1FO0L 3O45B 3H0TA 2E27H 2VQUA 5JPNB 4JRYA 1UM6L 2B4CL 3T1WA 5EO1B 4ODBD 5ISZE 1VFAA 2IQAA 5D72L 1YEEH 1IEBA 3QO1B 2BDNL 2L0DA 1N6UA 1RMFL 2OTUA 2HT3D 2J8OA 5C0EA 5HHXH 4LLWB 2WMPA 1T7YA 2HKHH 4EN3C 4M6ML 5DRZB 2Z35B 4LHUD 1S7SB 2EE2A 4N8PA 4ETQB 4RX4A 3N9GH 3S4SA 5D93C 3FQRB 2R8SH 2Y07H 3IVKA 1FPTL 2B1AH 1JNLH 2XV6B 3PHQA 3OB0K 1XGYL 3MYJB 4QRQB 5DC0A 3I3EA 5F93C 5E8OA 3W9EA 2AI0L 4GKSB 1ZXQA 3HI5H 5IOPB 4U31A 1EGJH 1KTRL 2YWYA 2BY1A 2EDKA 1U8OB 3T65B 1CG9A 4X5WA 4C58B 1K4CB 1QRKA 4PD4J 3MBXH 5I2IA 4D8PA 3VXRA 4HLZH 3G6AA 2P5WE 5IB4A 4IRSD 2OTWA 4PRHA 2DTML 4Z7QE 4HH8A 2WAHA 2IAMC 5GZND 4PLNC 5KSAB 4F7CB 3TF7C 4W4OA 4X99A 4G7YL 3H7BA 3KPQA 2GJ6E 2QHLA 3MCLH 4KQ4L 5F9WC 3QXAA 4LCWA 2O61A 3C5SA 4DGYL 1FGVL 1WFNA 2R15A 1WV7T 4Q9CA 3IXTB 4HIHA 1KENH 4NN6B 5EPMA 3QEQB 3SKOA 3RVVC 2A77L 5BXFA 5F7UA 3NTCH 1KTKE 5IFAL 4J3OC 5A16A 3C6SA 4CN4A 1XMWA 2Y9RT 1T21B 1FG9C 3THMH 3X3GH 4CADB 1A7QL 4P57A 5CAYB 2VABA 2AW2A 3U46B 4OUUB 4P5TA 3QG6A 1MCWW 5HHVH 3RZWA 3JWNC 2BFVH 1UA6L 3I6GB 3OR6B 3VDBA 2Y5TB 4QRUB 3Q1SL 3DMMC 3ZDZE 2X89D 3EOTH 3I50L 2I9LB 5ICXB 2VITA 3BP5A 4NQDE 3CMOH 3QAZC 5C0AD 3HZVA 5C71A 1I4FB 1QLEH 4WFEE 4A2MA 4LIQH 3RGHA 1I8KB 1D5XB 2W0LA 2PYEB 2BVEA 1NC2B 2J12B 5D7LA 2HJKB 2V5SA 4Q2ZA 1CGXA 3KR3L 1VFMA 1NUDA 3QUKA 1EUUA 1A5FH 2WW8A 1MFBL 4FZ8H 2GITA 3IAGC 4FQXD 1LEKB 3KYOA 3IAQA 1AP2B 2JIXB 5I1GL 3SDCD 2JJVA 1U91A 2VXUL 4HW6A 4JANB 3QWRA 4FQCL 3ROLA 3ZKND 4PP1D 3PF2A 5D1QA 2CUIA 1MWAB 2KZWA 2HFTA 3C09C 1MFCL 3LPGA 4MJ6B 5HHME 3RWHA 3KPMA 3WFBH 4KXZH 4U1MA 4IMLA 5FYLE 1N5YH 3FOMB 4WNQA 4D0DB 3AREC 1CI5A 1IAIM 4MS8D 5MENE 3B4NA 4Y7MA 1MHPH 1MH5A 2HG5B 4X6BA 3BT2H 4C4KO 3IS0X 3IDIA 4XMLL 5IVXB 1D5BA 4CW1A 4NM8L 3S37H 3SPVA 1QFUH 5D71H 3VWJA 1SVCP 5I8OH 4H5SB 2DLEA 5F7KC 1AQDB 1IMHC 5HYSG 2ZSWB 1JWMB 3B6SA 4G43B 1OARH 2OXHA 3QIUB 1BEYH 4OT1L 3IDYB 2X7LA 4GAFB 3DUHA 5I1DA 3GSQA 5T3XH 1EERB 1OW0A 4Z7UF 2GEEA 3ZE0E 4PGCB 4PJIB 2X1XR 4MSWB 2A83B 3HAEG 2X44D 2YSSB 3NCYS 5TPWL 5DJ2A 3TYGH 3ME0A 2FSEA 4LF3A 4O9HL 3O81A 5F9JA 4X9GA 2XA8L 2X4OA 3FB5B 4BFBD 2NY4D 1BBDH 4BYHA 4Y19D 1HH6A 3KPOA 3ULVC 4D0BB 1XAUA 1D9KC 4IDLA 2PXYA 4LSSH 2EXWD 1S9WA 2GT9B 3QDJB 4YDJB 4NQUA 3BISA 2J8UA 3MJ6A 3MNVB 4EDXA 2LU7A 1T20B 2IQ9H 1N2RA 3LKRB 5ECJE 3T09A 1QSFA 4Y4HB 5HYJD 5FKAB 4ZO8A 1OTTD 4MD5A 2X1PA 2PR4L 1HILA 2X09A 5LKNA 5F3BA 3MJ9A 3WUWB 1YYML 2FCBA 3GSOB 4BZ1H 5CEXB 2E9IA 4XCNA 1G9MH 2P5EE 4FFZH 1ZWIB 4YE4H 1JF5A 2Q20A 3BGMA 1LO4H 4HS6B 2EO9A 3RBGA 4MA8L 3W39A 3V0WH 3QXUA 4H20L 1JWSA 1IEHA 5GISH 3SGKC 4H1LG 4P2QA 5D7IA 4QXGH 3IDJB 4LVHC 3BI9X 5HGGS 1U3HD 4N9GB 4IRJD 4JE4B 1MUJB 4P23A 3S36L 4O51A 4LRIA 5J1AA 1RVFH 3WMSA 5ADOL 1IGFH 3IJYB 2ESVB 4LLVA 2VWEE 1U8NA 4RZCB 5FGSA 4QOKB 4HMDA 5J11B 5CGTA 3SDAA 3ZKQD 3JVGC 5IW3A 1BD2D 3DSNA 2XY1A 4YDKH 4FQQA 1WITA 5DQJA 2A6DA 2F5BL 5ID1B 4LHJB 5EU6B 4IHOB 5J12C 2QKIB 2E9JA 5IHBA 1P6AB 3PWPB 3B2VL 1KPRB 3K0WA 4HT1L 4MNHB 3VFPA 5I1JH 1PZ5A 1FH5L 1J5OL 3W5MA 3MJGX 2DM2A 2N1KA 3GO1L 4U1IB 3QUZD 3O2VH 3MRQA 4YK4C 3QWOA 1AE6H 3FB6B 4EQ2A 4OLWH 3G08B 2VZOA 3C8DA 1OAXH 4O00A 4Q6IA 4RWYL 1CBVH 5EU3B 5TGBB 1WVZA 1D5ZA 2VZSA 1KIPA 4I5BA 3GSWB 4XNMB 1WC7B 1A6UL 4U1JB 1QFWI 1U8HB 2DBJA 3SBWA 4KJWC 2OS7A 4DJMA 2V7NB 2GTWA 3NCJL 1H9VA 1A1MB 3IF1B 3OHXB 5GRWA 5DQ9A 3QHTC 3O2DA 1R3KB 5IB2B 3OJDA 2YC1B 5DGQA 2D7TL 2Z8VC 1KIQB 1I3UA 3KDMA 3BUYB 5J4MA 2DYPA 4OCRL 2KZ1B 3U36A 5GGTL 1U9KA 4N0FA 4DEPC 3C5JB 5J9PB 1CLOL 3QUXA 2Z93B 4NQTA 3MRBA 4L8SA 3RRQA 1A4KA 1MIMH 2VDPH 2X4UA 5ACLA 1KB5L 3QIBD 2BNUB 1A7OL 3BPLB 4RMTA 4E41E 3H7LA 4KV5E 3QQ3A 4OF8A 4HKXB 4D9QE 1GGUA 4Z5RA 1VHPA 3QO0A 3Q3GB 4PJ5E 1H5BC 1BZ7B 3NGBB 4NUGH 1A64A 4X4XA 4QHLA 5EB9A 2Z4QA 1QPPA 4FXGA 3SGEI 2X70B 4HV8A 4MAYD 5D9SA 2VLJD 4YX2H 1IQDB 3PGFH 4CL7A 3QP3A 2VSDA 1E4XL 4L4TE 5D7JD 4UINL 1IZJA 3MC0A 3RJQB 3VXSA 3O2DH 4CU7A 4F9LC 1CR9L 3U2SA 5CS7A 4X7SH 4JG1H 4R8WL 5FYJL 2A9NL 3KG5A 3VXUA 5EN2B 4PG2C 4ZUWB 5JHLH 3I3BA 1OGAE 1A8JH 1LEIA 4EN3A 35C8L 4QRRB 3RUGE 4JFZH 2R1WA 3FFCA 3Q6FA 3H9YA 3S36X 4U1GB 3KPRA 3MV7D 3MLYH 3DX8B 5E6IA 1MEXH 5ESQB 1FN4A 2ZCKH 2IADB 4KRPD 3L7FA 1DLFL 15C8H 2EIZB 2HKFL 3O41A 1MAML 3GUTB 1XF2A 4PJAE 1S5HB 1JIBA 2YD5A 3IAPA 1GPOL 4XBPA 1T0MB 4PJCF 2DKSA 1AO7E 4GBXC 5BZDA 4OFYA 5KOMC 1GGCL 1NUNB 3DVGA 4DGVL 1QSVA 1NH6A 3L6FA 1KCSH 5E99L 3EZJB 4JHAH 3O8XB 4ONGH 5C9KA 5INCB 2VOTA 3TLRA 3FQXB 3SDXA 2P46B 3DSFH 3FMGL 2IAMA 4IJ3B 3IETB 4PRNA 3BD4A 5MHSD 1SEQL 3KYKH 3E6FB 5CUSH 3UTQA 4PPTA 1NCDL 1GJIA 3BGFC 3HMXL 3RWIB 5GS0C 1OCWH 3HR6A 1DEEA 3UJIL 5GJSH 4JGUA 2CKBB 3TFKC 2W91A 4ZPTA 4XVJH 4X6FB 1QBMH 1N8ZB 4K3DH 3QQ4A 2X41A 3MUHL 1W0WA 5FYJD 3C2AH 4PLJD 4YO0B 3BYTA 4DQOL 1A7NL 1LDPH 1EV2E 4XC1H 1X5YA 2ZCHL 3KPSD 3EDEA 2NY6B 4UMGA 3VGBA 1J9CT 4PRPB 4OFDA 4Z6AT 4KDTC 3NZHH 3DO7A 2QSQA 4WWKD 1XR9A 1LEGB 3QQ9C 4JDTL 3V6OE 1XGTB 1NBZB 3S3PA 2OQJA 4Z7WF 5D5MF 1KN2L 2A6JB 3EOBB 4YHML 3VFVB 1RD6A 4EUPH 3FHQA 1RZ7H 4M4PA 1Q9OA 5I71C 1DTUA 1A6TA 3BZ4A 4UDTA 4WCYL 4OCYH 2F8XC 4XP6H 3JV6A 3BPOB 1QEWB 3CFDB 5ERWB 4WY7H 3DMMA 4DN3H 2WWKT 3JXAA 2ICWI 3DYPA 5CEYA 1C8PA 2F54A 2P42B 2ZPKH 4OJFH 1XF1A 5IGXL 5TDNB 1CGVA 2AV1B 3FT3B 5C3TA 3WHXA 1SBSH 2FGWL 3GMQB 4UOW0 3VXQB 5LQBH 2K7QA 1JGVH 4F7TB 1A3LL 2I9TB 2E7LC 2XZAL 5JXAL 3T8XA 1CXLA 2XICA 3TEUA 1HXMB 1IGYB 2VLKB 4XP1L 5JPNA 5DD6B 1JPGB 3SOBH 4YXLH 2AJZB 4JAMB 2ZP0T 3OL2A 1GGIH 4CAGA 4Y2DD 4OV5B 1S9XB 5L2KA 3IFPA 2Z35A 1C5BH 1RK1A 1S7SA 4J3VA 4R97B 5I8EA 1DL7H 2EKSA 5D70L 5FOBB 1AIFB 1FZKB 1DQQA 3CVHL 2FEEI 4Z18A 3SCMB 3UTSE 3FQRA 3B9AA 1WEJH 4P5MA 2E8ZA 5IB1B 4J3XA 1ETZA 5HGHB 1I7ZB 4KROC 1VACB 2X5PA 1LVEA 4LLDA 4N9OB 3MYJA 5F7EH 1PEWA 4XI5C 1QFOA 5GGRY 1WK0A 4UAOC 4LVEA 4O02H 4JPKH 2Y36H 3WFCL 1Q9WB 3OX8A 5B39G 1MCSA 3BXNB 4F37K 3P0VH 3HC0B 4OUOA 4HIXH 4RA3A 4TQEH 4XT1C 1RZJH 5IJKC 2GW5A 1KLUB 4GSDL 3U4BH 4ZD3H 1DBKH 4CDGC 4YGVB 1YEIL 4HZLA 3HZYB 4UT7H 3CSYB 1NUFA 5F1OB 2C1OB 1IAII 1N5AB 3N50A 4O2EB 5DD3H 3EFDH 1RSFA 4XBGB 2DQGL 4L29B 4HUXB 3PQYB 5K9QG 2JLLA 1LK2A 1DANU 1T6VN 1FZOA 1Y6MR 4YAQB 2GTZA 2X9WA 1NL0H 1CF8L 2DQFB 5HHOE 1FFRA 3PWJB 4Y19E 2BSED 4PRAA 4X80L 1W0VB 3U4EA 1FIGH 2BNQD 4HIEA 4D9RD 1INEL 4M1GL 4QRPB 4AK1A 1D9KA 1YJDL 4LLYB 2CDEB 4M8VA 2EDOA 3QUYD 2PW1B 4YBHA 5IHZA 2EEDA 1JNJA 1XIWC 4TRPH 1OWWA 2FX7H 1FO0B 3LH2L 1DVFD 1AR1C 4WW1B 3GJFA 3QI9D 2Y6SC 5FA4B 1TITA 2N7AA 4NNYB 1DFBH 1O7VA 4PGEA 1Z5LB 5DJ6A 1UKSA 4KJQC 3GSVB 2NCMA 1CU4L 3E0GA 1EEZA 5GZOD 4BKLB 2K9UA 4N0UB 1NGQH 4LEXL 1KCUL 1TVHA 2JCCB 1R3HB 4OGZA 1KIRB 1IKNC 3PHOA 3MRPA 3TCXA 3SGKA 3ZSSA 2PYEA 3DJ9A 1A02N 2XZQL 2C7UB 1NC2A 2EYRB 2QJDA 2WUCH 1Q9LB 4YBLC 4YPGA 3NFPB 2NY1B 1EVTC 3VFGL 4AMKH 1KACB 3A6CH 1RHHA 4WTZA 4JANA 5E6YA 1CLYH 4QKXB 2XTJB 4MA7H 1ZLVH 1LMKA 3M8OH 3ULVH 1I7RA 3RDTB 1MWAA 1SJXA 3GRWL 1TZHB 3JVGA 5CSGA 1YEJL 2P8LB 3UYPA 4MJ6A 1A14H 4Q58C 4I2XE 2CJUH 2VISB 3RL1A 4DW2L 2HYMA 2O5YH 2AJYL 1TJIH 4LSTH 3GJFH 4MA1C 4J6RL 1U8MB 1ULVA 3NAAH 2CRIA 3GIVB 4GRWB 5BMFH 2VERN 4RNRA 4BQBA 3RKPA 1KTLB 3T0BA 4BJLA 1CE6B 3WFDL 4UBDD 2V9TA 3W9DB 1KLFA 2F74B 3MRRA 3VG0L 4JN1H 3D69B 1UACL 3MROB 1NGPL 2DLFH 3BIKB 4PJEB 1P4IH 1U58B 1Y18B 1RJYA 4NQVB 1PY4A 2ZSWA 2A0LC 1OP3H 3BHBB 4JR9L 3QIUA 3T0VA 5IT2H 3C60D 4QTHA 3D1MC 2VZTA 3VRJB 5JLZA 4Z0XA 5CCKH 5HI3D 1I9JL 1FYTB 4QXWA 1QKZL 1G6RL 4OLEA 3O4LD 5EA0H 4U2YA 4TSCL 1U93A 2GFBA 4PGCA 4PJIA 3TJHD 3QUMB 1DP0A 2DL2A 5JW3H 3CFIC 1VKXA 4GQ9L 1QD0A 4KKLD 3AXLB 4Q97A 1UEMA 4LDOB 5C8JB 4H0HB 4NPYA 1KPUB 3DXAD 1FL5A 3ETBF 3U0TB 1BAFL 4KV5F 1YY8A 3ARGC 5C0BD 1YC8A 2GT9A 4YDJA 3UBXG 1L0XA 5KS9A 5JHDD 3RA7L 1MLCB 2ZNWA 2ATKB 2VIRA 3HI1A 5H35A 1V7NL 2MTPA 3PWLB 4XPTH 4L8CA 4Y4HA 3CXHJ 5FKAA 1H5BA 4JHWH 5T3ZH 1O5DT 3BQUD 4NNPH 1IC4H 4PJFB 3MCG1 3WUWA 1CXKA 5I1KL 1I1AB 2VLJE 3LMJL 4QXUH 3WL9B 3GSOA 4MGXA 1S9KC 4Q9QH 5E8EA 1BIHA 1HEZA 2VR9A 4KGJA 3RVUC 1BF8A 1OAQH 3MMEB 1NFDB 1T22B 2WP3T 1A7PL 1ZHNA 2CO6B 3RIAK 1XZ0A 3DURA 1ZKAA 1QFWL 4F9LA 1IGIL 3LQMA 3MQIA 1YMHB 2YD7A 1TPXB 3RUGF 3G6JA 4N9GA 1ZT7A 5GS2H 2D03H 5DO2D 1NAML 2H26A 4O58H 3MRMB 3KPPB 5AG8A 3UROR 3IFNL 5TFSH 3K2MC 1UCBL 3MREB 3MV7E 4P4KB 4JVWA 4XGZB 5KZCB 4QLRA 4DKFH 1JGLL 3G9AB 4S1QH 4RGOL 2D0GA 3MXWL 4DVRL 4PJAF 3PUCA 1MVUB 1MFEL 3QYCA 4G6JH 4N8CH 4NWUH 3EFFB 4KHTH 3T4YB 5IROC 4Y16D 1FLTX 5F1NA 3P77B 1NKRA 3CFCH 5C09D 1GXEA 1A6PA 4XCCH 2P49B 3JV4B 3CZFB 4U1KB 4WHDA 2W0PA 3KYAA 3PWPA 3ARUA 4GBXA 1FDLL 1KPRA 4IOSD 4XAWH 2NX5A 4ZOCA 4I3RL 3A67H 1JN6A 3BESR 3I85A 1KBGL 4RIRB 3QXVA 5MHSE 5JW5A 1HE7A 5CD5D 5KSBB 1S3KH 3G04B 1Q8MA 2DQHL 4NP4L 4ODHH 5CZVH 4WO4D 1F2QA 1TETL 5JW4Q 2BNRD 1RU9L 3GSXB 2YKLH 2OYPA 2Z0BA 4S1SH 4FG6C 5CFHA 4CRPA 1MCPL 4OAWA 4K7FA 4U1JA 4QY8B 3C6LC 3L3GA 4C56D 1U8HA 3RVWD 3QWQB 3DVNA 4WUUA 5HD8D 3DX9A 1YMMD 1A1MA 1MHHA 3BPCA 3Q5TA 4BK4A 2BJMH 5BOPA 1TVBB 4OD1H 2QEJA 1KPVB 4GQPH 3TNNA 4KDTA 3MRFA 1VPOL 5LGJB 1H8SA 4XXCA 4DZBA 2AK4E 2VQ1A 2ZG3A 3C5ZB 2J6EA 4JDZA 1TFHA 5J9PA 2CPCA 2Z93A 4XRCA 2Q7NA 4KRMB 2DLGA 3GB7A 2CXGA 3SGJA 4UT6H 2P7TB 1ES0A 4XVSL 3BH8B 5HDOA 4ORGB 1PSKL 4FQLH 4QNPE 3MLUH 1JGEB 1PKQB 4XNYL 3ZE2E 5EU5A 1WUNT 4GMTH 1Q0XH 5GS0H 1VESA 4IIQB 5IF0A 2X70A 3STLA 1S7WB 1IFHH 3GBLA 3EUUA 3GBNH 2E7LA 2IAND 1HZHH 4TVSa 3BP6A 3S35X 5DVNA 3AB0C 2AVGA 3DVIA 1CS6A 3NFNB 1CD1B 1CFSA 3OB8A 3KAAA 1EXUB 25C8L 1GAFL 1JHTA 1C7SA 4JKWA 4NO3B 3ARDD 2IPTL 4X6CF 2NLJA 2BVPA 4RSVA 4U7KA 2XZZA 2XIDA 4HHAA 1CICC 1FG2B 5LVEA 1U92B 1SVZA 1K9TA 2Z9TA 3KXFA 3WJJC 5IVZB 2IADA 4TSBL 3BZFB 1C5CH 1KELH 4DKAA 5IP4A 1OAYH 1OB1B 3M1BB 1ZGLM 1YEDB 5IHUL 4WI5A 2FD6H 1JTTA 2QR0B 1AGFA 1F8TH 1JFQH 2EIEA 2CK2A 2AK1L 3PGDA 3ZTJG 1R3IH 4L4VD 1UWXK 4R3SB 2I07B 1X9QA 1DZBA 1NAKL 5CINH 3K46A 3O8XA 1OPGL 2AEPL 3WIHH 4GG8B 5JOFA 4LLQB 1N64H 2BMKA 4M03A 3QEGH 5J13C 1CDCA 5AZEH 1ZE3C 1EHAA 5F7LB 1TJHL 4MNGB 3UP1A 1V5JA 4HGWA 1B0RB 1C1EL 3HNTH 4Y5XC 2R56L 4R7NA 3F8UB 4E0RB 4I18B 3QIWD 4LIQE 3F12A 1JRHI 3EYVA 2FNBA 4GW4A 2E9WA 1IC5H 3RY4A 4ZTPL 4Z9KB 4CU8A 1IM9B 4EJ1C 5DFVD 4GH7B 1QQDB 4JO3H 1DBBH 1WAAA 4HXBL 4GAGL 3SKUD 2VZ3A 2HTLD 5I6XC 2FEEL 1I7UA 3P0YH 2YD3A 1I7TB 2WUBH 5A40E 1XIWA 1ZHKA 4J1UA 3EOBA 2BY2A 4JKPL 3ESVF 3VXOA 1KJ2L 1CTOA 4OCWH 4M1CC 2Q87A 1T1WA 1ZTXL 2EC9U 4HLZG 5E24E 3IJSB 1UXWB 3HS0A 4NRXB 1HHIA 5ERWA 4GO6B 4F58L 3WLWC 1F11A 4XTRC 1M6OA 1RURL 3OAUL 1IKNA 3ELAT 4JCMA 1K4DB 3CXDL 3GMQA 3M45A 1IAIL 1UM4L 4HCRA 3U1SH 2VDQH 2VLLB 4X8XA 5DZNA 5K33A 4E42A 4K8RC 1HDMA 1RZIB 2DIBA 3S4SG 2GJZA 4YDVB 1HXMA 5AZ2L 1NDMA 4RDQG 4NRZA 3KYMB 3QCUH 5DD6A 5C0CA 1MJ7L 2AJZA 4NO2A 3QHZL 1YYLL 4PJ7F 1BVKA 4NZTL 1YA5A 4P3DA 5T3XE 1X5XA 2YRLA 5IW6A 3MJ8B 3QEHB 3NZ8A 1J1OH 4JY4B 3WE6B 5T1KB 1IL1B 5CEZL 4W4NA 1CZ8L 2E3VA 3SCMA 4PGBA 5HGDB 4L3EB 3OF6D 3MBEC 4KKCC 2CD0A 2D0HA 4OCNC 5IBUG 4FHBD 3PP3H 3DTXB 1UJ3B 1UZ6F 4GG6B 5E9DD 4APQC 4UILH 5EZLB 3NABL 4FQJL 1JZ5A 4I3SH 5FKPB 5KVMC 4NM4L 3BXNA 2KDGA 1JE6A 2I25N 4HCRH 1JZ8A 1QVOB 4NOFA 3OGCB 5F8QC 5TQ2L 3WLBB 1CE1H 1BMGA 1S9VA 3RIFF 4UU9B 1VSCA 2BP3A 4J12A 1FFOA 5K59E 1RZFH 1IT9L 3TN0C 3HR5A 4HUXA 3O4LE 4FQPA 5KVGH 1MREL 4QF1A 5DMGC 3QDGA 2OK0L 4X6DA 1LP9A 4LP5A 1AFVL 5L2JA 4HAGA 1DQJB 4HKJB 2V2XB 1HQRB 3IFLH 4NWTH 2YPVH 5C0BE 1F4WL 2H3NA 1EO5A 3ARGA 2OSLA 2WBJC 4LLYA 5JHDE 3GIZL 3LSOB 2CDEA 1F4HA 2UZIH 4KPHL 2QHRL 5EBLA 2A6KB 4KDWA 1KC5L 5D6CA 1FL6B 3RVTD 1INDH 1JPSL 4HFWA 1HIML 1QSFE 1MCRA 2B1HH 3CCHB 4JZOB 5F8RC 1MHEB 1CT8B 5LXGH 4NHUB 4HD9A 1PG7H 4X0KB 2UY7A 3RAJH 4X4ME 4M6OL 1GHFL 4N0UA 4KC3B 3BRGC 4JFED 3L5XH 1KIRA 2XQYG 2FJGA 2G60H 2Y1VA 2E6PA 2OP4L 4ZNEA 4G5ZH 3H9SD 1W8OA 1YEHL 1DBAL 3MRGB 5IB3A 3NFPA 2R0KL 4P2QE 1ZSDA 3LEYH 5C3LD 2EYSA 1U2CA 2MKWA 2JJTA 1IRAY 4JFYB 3U9PH 4OD2B 1OOAA 3MLVH 3DHMA 5E2UH 4ZUTB 3PV6A 4AIZA 4CJ1A 3RDTA 3W11D 4JCLA 1XH3B 5C09E 2RIKA 3Q6GL 5JQHC 4K9EC 5IROA 4OD3H 1BFVL 3S97C 2LAAA 2UWEA 2AXFA 3GSRA 1CYGA 1P5VA 1OY3B 1E4WH 2HFFA 4FFWC 4HJJL 4UTBH 3PWVB 1TDQA 1JVKA 1U8MA 1I85C 5EORL 2EEBA 3W0WB 3NA9H 5HDQH 3TM6A 4R90H 3WO4B 1DDHA 5JTWA 1LO0H 5SX4H 1CE6A 3LZFH 2QQLH 2A73A 3QNYB 4X98A 2F74A 4LARH 4XPAL 5DD5H 3WIIL 2BNRE 4LSVH 4IS6B 3ZKXB 1A7RH 3BX7C 5ISZB 4JY5H 4PJEA 1S7XB 2V7HB 4MNQB 1W72A 2HMID 3TBSA 3O4OB 4LMQI 1EEYA 5C0ND 1PD6A 1U95A 2IBGA 3ULUH 2RFXB 1B3JA 2FX8L 3BHBA 3V5DA 3C6LA 5E94A 5B22A 3TCLA 1YMME 3VRJA 4G8GD 2YN5A 1FHGA 4UZGA 1ND0A 1YNTA 3D5OF 4ENED 4GW5B 3STZB 2FB4H 4P46C 5DFWH 2DQDL 3RWJB 1ZEAL 1CD8A 3NIFF 1JGUL 2IF7A 4M1DH 5I16A 1KJ3H 1D5IH 1KPUA 4U6TA 1S7RA 2J88H 2Y72A 3FO2B 3U0TA 3B9KC 4HUUA 4UIKH 4YQXL 1VFUA 3JWDL 2P5WB 4OZHB 3OXRB 5F44A 1UWGL 1KULA 1RUMH 1C08B 3LDBB 4LNVA 4NKOB 4ZQKB 2QL1A 4RGMC 4NDMA 3EO1A 1W72H 4OZIE 3WHE1 4NNXB 3VGAC 3MXVL 5J8OA 4PJFA 2BVTA 5GGVY 1RUQL 1YNLH 4ZXBB 5JR1H 3BYYA 5D1XD 1DUYA 4HEPG 3WL9A 3OKOB 2QSCL 4MZ2A 3D39B 5C0IA 4LU5L 1XGQB 1MOEA 1LHZA 1CFBA 1WFOA 2NZ9C 2QQNL 4PJHA 5HYSB 1EK3A 3UXFA 1T22A 3JWOC 4KKNA 4OLUH 4HPYL 4LKCB 3LKOA 3PJSB 2EDFA 1VCAA 3RZCC 3AS3A 1MAKA 4NKIH 3MRMA 4EI5B 1N0XL 3GSNH 1CWVA 4P4KA 4WJ5A 1JL8A 4XGZA 3MV9A 1KNOB 3WJJA 4LSRH 3VD7A 1V8HA 4P3WA 2JJWA 3EFFA 4IMKC 4ZFGH 2GK2A 1NGXB 4U1HA 2W9EH 2HT2D 4RGND 5HHPB 5SV4A 4Z7VB 5DD0L 5TQ0H 1J0ZA 4G7VH 2YZ1A 4NQDB 4TVPL 4OF0A 2DWDA 4L4VE 1JHKL 3GM0A 4KUZL 4NQSA 1K3ZA 3AS2A 12E8L 4GRLC 5FK9B 4EBQH 2AJSH 2Q86B 2FBJL 5T1DL 4PYHA 5I1EL 3JTTB 1JYNA 4K23L 2D7OA 4WI9A 2G2RA 1LE5A 4PRIB 3L5JA 5KAQF 1NANI 4P0DA 2Y25A 3SDXE 4L1HA 3HI6L 3O3DB 2I5YL 4B0MM 4Y5XA 4DCQA 3ARFB 4KI5D 2C3XA 4LASH 4DOHE 5HI5C 4I0PC 4QY8A 4DAGH 5HHMB 2NY2D 3OKEB 2XWBB 2CLRB 3CFEB 3RVXC 3UO1L 4QXTA 1HSAA 3UAJD 3E8UL 3VH8A 5IMKA 1VADB 1KPVA 5BV7L 5L9DH 1EHNA 5B38A 1B0GB 1MJ8L 1YEKH 2V9QA 1S9YB 3D25B 3H8NA 3A6BH 3LN5B 3TZVD 1DN0B 1AXTH 1RJCA 1S7VB 2X4SA 5CBAB 2ARJQ 2DI8A 1WBZB 1AQKL 4C56B 4A6YL 5F21B 4DN4H 1DANT 1F6AB 2LU4A 4TVPD 4KJPD 5HGAA 2NQCA 4Z95H 4MWFA 3T04D 1CGUA 1HYSD 3DVFA 3I6KB 3LKQA 3KPNB 1J88A 1NAMB 2IPUG 1PKQA 3BJ91 4KHXH 2DN7A 3VI4F 5C92A 3PL6C 4G42B 5SX5K 2VXSH 2B2XL 3EYOB 1CN4A 1QOKA 4PJ9C 2OL3L 3HE7C 2Y23A 3NFNA 4HGMA 5I19L 1JRHL 3IGAA 4WTWA 4NO3A 5EUOE 1OF2B 1T7ZA 5DSCB 3CUPA 3NFSL 1YNKH 2X40A 4ZPVB 2E27L 4FQ1L 4OSUH 5L2KE 3TVMC 1ZANH 2H2SD 5I8KL 4JQVC 3FQWB 4EUPG 4KZDH 5L8JB 1IGCH 4E5XB 3MBEA 5IWLC 4ISVB 3NCCB 1R3LB 2P45B 3S3JA 3G5VB 1X5FA 4F15B 5F3HB 3QZWA 4WV1B 3GHBH 1YEDA 3U30B 5JDJA 2P5EB 2YPKB 4HLJA 2QR0A 5H94B 5I66B 4APQA 4LCUB 3MZGB 4NCC2 1GOFA 3PGCA 3HC3H 4K3GA 2ADJB 1RZ8A 3I2CH 4OZ4B 3KLHC 2B1AL 4KU1A 3LS4L 4R3SA 2I07A 4FP8H 2QADC 5EC1B 4PGJA 5FUOH 4K8RH 4RQQB 3QCVH 2XPGB 1GGTA 4PJXE 4TPRH 4L3CB 2NXZC 3U4AA 5DMYA 3ZHDA 4MNGA 1DQMH 5ABDE 1LO5B 4PUBH 1LE9B 4KMTH 3TNMA 3GI8L 1CDYA 1CGTA 4PJDA 4BH7A 3MBXL 4K94C 1QRNA 1R3JA 3EDDA 3HNVL 3EIFA 2BSTB 4I18A 5JQ6H 1QLFA 2YPLD 4NRYB 5C6TL 3ILPA 3G5YB 4YHZL 2YHGA 2CLZB 3GDBA 1J8HE 5BZWB 1JHLL 2BOBA 3ARXA 2WLYA 1JPST 2FH6A 3VXPB 5FO9A 3P30L 5HXMA 1RIUH 4GKOA 3MCLL 1P2CB 1L7IL 1JUFB 1XT5A 4Y5YB 2LAGB 4BA8A 2MWCA 3U79A 2WBJA 4YDLC 2BVOA 1Z6JT 2PTTA 3RNKA 4G6ML 3V4VH 2H45A 3BOVA 3N1FC 1EIBA 5B4MC 3AY4C 3OXSA 2YA2A 5GGVL 2ARWA 5DYOA 4OIIH 1UXWA 4NRXA 2ICEB 3B2UC 1KCRL 2HRPL 3QFDB 4JFEE 2RJMA 4FQ2H 4EXPX 3BSZH 2H8PB 3H9SE 4CNIB 4YHNB 3U82B 1K4DA 3C9NA 2DQCH 2O5ZL 1Z9SA 3MLRL 1C5DA 3DWTA 2BSSB 3T0ED 5J3HD 4NHCL 3CK0H 4Z7UA 4JRXD 1QHPA 5BS0D 5MI0C 4YDVA 4NKQB 3KYMA 2FATH 4NUJA 1QLEL 3BN3B 5SWSD 4G8EA 4R0LC 2DJUA 1TIUA 3IJHB 2X05A 3IU3B 5F9OL 1XGRA 1N6QL 1MAJA 4E41B 5JZ7C 4M93C 3MUJA 4ZS6C 2HN7B 3LKPB 4Q0XH 2UY6A 3MJ8A 2ITCB 9CGTA 1A9EB 3WE6A 4FZ8L 4PJ5B 1U6AH 2MCPH 2ZCLL 1ZK9A 1I85A 5DJ8B 3PWUB 1N3NA 3WFEH 5D7SH 2CH8A 2YRZA 1BOGA 4ZFFA 4RX4D 2JKXA 2HLFD 3DTXA 5DRXB 4QRSA 1UJ3A 4UV4L 1RZGB 1HKLL 2G9HB 2XY2A 3O0RH 1NDGB 3WFBL 3JBG7 3DX6A 3S96A 5FKPA 4L4TB 4Z8FH 4RFOL 3VXNB 4EVNA 3BKJH 1HOCA 4JPVL 4KWUA 1SEBB 1IAMA 1UFUA 5GRVK 1N7ML 1AC6A 5T3ZE 1BX2A 1OGAB 4Z76A 5A2LH 4PJBF 1BM3L 1YEGH 5EC2A 5KVFL 3EW3B 3VXRD 5I1HH 3QEUB 3WKMH 3VFUB 4PRHD 1F58H 4KQ3L 4XPFL 1LQSR 4YXHL 1G7MB 1KJ2B 4IOFD 5T5NG 1D6EA 3VGDA 4K9EH 4P46A 4YHIB 1MCKA 2F53A 1AKJA 1XF3B 1EFXD 4LVNC 1MCEA 4LCWD 4FOMA 3QFJA 4MXQC 5EBGA 1AO7B 1PKOA 5EBWA 4V1DD 3B9KA 2W9DH 5ALBL 3GKZA 3QSKB 1R5VB 1HINL 4X6EB 5IQ9A 5GS1C 3MRJB 3H2WA 2VZUA 5IK3A 4ZSOA 5I30H 3HG1D 4OZIF 5KS9E 2Q8BL 3IDUA 3L95A 1SYVB 4R7DA 4ZFOB 2XXCB 2EZ0C 4M6NH 4NGHL 4DTGL 5IMLA 1JNNL 3D2UA 1QSED 1FNEB 4NHUA 1UQSB 2A9ML 2JK5B 2JE8A 3LRHA 2D31B 4WTZG 4EZMA 5B39B 3K2UH 1N6VA 1P7QB 3MRCB 2X9XA 2I60L 3WCYA 3B5TA 2VXTH 1A6AB 1WCBB 3QPXL 2HAZA 5EULV 4ZNCD 3R1GH 6FABL 5D1ZC 3T3MF 2PCPA 3RHWF 1MRCL 5EIQA 1OD7A 1YUHA 3RZCA 3EYFB 3MRGA 1G7HB 4MD0B 3F6IA 4H0IA 4NO0B 5DURB 3WDIA 4GAJH 3HPLB 4MD4A 4PBVC 1I9EA 3K8KA 3GMLB 2V2TA 5C0GA 5L6YL 1F90H 1Q72L 4R26H 3IU4H 3RGVD 3ULUD 3VWKD 4IMKA 2R4RH 5ANME 5D8JL 4YHOH 3LN4B 1PFCA 1T04A 2H32B 2HWZL 1P4LB 2A2QT 4RRPA 4OQ1A 3A6OA 2ZOKB 4N90D 3Q5OA 1JZ2A 4U0QB 3PWVA 3U48A 2FLRT 3BKCH 4L1DA 4PG9A 1FL3B 4GRLA 1CLCA 1MI5A 2NYYD 1TXKA 1QG3A 4OZGB 5BRZD 1PDKA 2A38A 1T5XB 5IW1B 5EIVA 2WINA 2BOCB 4AENB 43C9B 2J8HA 3QNYA 4K71C 4WGWB 3JWOH 4MMZC 4U3HA 1EJOH 1FCGA 2Z8RA 1HXYA 1QNZL 2HT3C 4WEMB 5IB5B 3MJ9L 3RWFB 1P9MC 1HQ4A 4I0PA 3SDDB 5ICYA 4ZS7L 5TE7H 1RFDH 4OLWL 4CMMA 3V9FA 2Q1EA 3V0VB 3O9WD 4P49A 3UTSB 5KW9L 3U9UB 2IH1A 3E2HC 5EWIH 4JFXA 1I9RH 3WXWL 4XXDB 2C3HA 5I1CH 5KSUB 2FO4A 4AEHL 3LKNA 3OPZL 4Y4KB 5KG9B 4LP4A 3RY6C 1B2WL 1FSKB 3D85B 1FVDA 1FVEB 3T2NH 1AGEA 2VXQH 3AC0A 3UTZA 2AKRA 4F80A 2H2PD 4OKVB 4UB0H 4IRSC 3WJLC 3P9MA 4U6HA 2R4SH 4WUKH 3V4PH 2P5WA 2OLDA 3B9EA 4U33A 5GZNC 5DT1H 3I02B 3OXRA 4FS0A 3ES6B 3NIDE 4ELME 1HHHB 2AABH 2PXYD 4ZQKA 3N1GC 1RUKL 2L7JA 1BLNB 4AL8H 4NZUL 3D3VB 2GJ6A 1T1XB 4NNXA 1NC4B 4JKKA 5DJ0B 1K3IA 4XNZB 4M7LL 3PL6A 2XACC 2C4XA 5IFHL 3OKOA 4WU5B 3H9HB 5HHOB 1S8DA 2GIYA 4PJ9A 5HYSA 3HE7A 5E8PA 3QH3B 4WW2B 1KEGL 4GLRH 1IKFH 1I75A 5ID0B 4LKCA 5EUOF 2VXVH 4ZAKB 1U8PB 3HPJB 4JM2B 3AGVA 1RIVH 4JFDD 1I8IB 3AAZB 2EC9T 2YD6A 3I6LD 3LV3B 2J3SA 3P4LA 5KOVC 3V6OC 1FAIL 1XGUA 2BHUA 3F58H 3D87B 2CIKA 3TVMA 2G75B 3HAEA 4QYOB 4P23D 4WU7B 4JQVA 4PJGE 1QLRB 4DUVA 4NQEA 4P4RA 3QDMD 4YC2B 3MRKA 3WS6C 1B4JL 4Z7WA 1X44A 1XF4A 2F5AH 5IWLA 4JG1L 3RTQD 3O2WL 4HDIA 5C9JB 5DK2B 4Y4FB 2VN7A 2AJVH 2NY5H 5E2WL 5F1KC 3ZZ1A 5ICZB 3UYRH 5HHPA 4AT6B 5EZJB 4F57L 2J5LB 3UBXB 2MPAH 4TNWF 2ITDB 1BREA 2ZUYA 3BP7A 15C8L 2NY0B 3LN9A 3PP4H 4FQXC 5AAMA 1VFOA 5BVJA 3SGDH 3MLZH 1WZ1L 3SDCC 1A6VL 3MNZB 3MLSL 4N0YL 3ZKNC 4PP1C 1H8OA 3TBVB 2OR9L 4G80A 4OBRA 4K3EH 3E6HA 1U3ZA 1X5ZA 1IAKA 5FAAA 4F3FB 4D3CL 3RI5K 4I2XB 4H1LA 1U8KB 1ONQA 1XGPB 2IPKA 4PY7B 2BK8A 3DSFL 3J8F7 3X12B 1ZA3A 3U7YH 3PHSA 3QDHA 1KJVA 4MS8C 3UZEA 4ZO9A 5CD3A 1VADA 4BSJA 2XRAL 5C0RL 2AV7B 2O5XH 2Z31D 5MENA 1KT2A 1B0GA 2BY3A 3ET9F 4G6KL 1S9YA 2YZ8A 3SQOL 1WT5C 3D25A 5C07B 2VDOH 1DEDA 3CVIH 1DN0A 3MOQA 1A2YA 2AJXH 4HJ0D 2D7QA 4K2UL 4R2GD 3AY4A 1QUNA 3HE6B 2P47B 5DHXB 2OMNA 5C08A 2KQNA 3DECA 1X5JA 5ALCL 4MCYA 1TZGL 5F6IC 5BQ7A 5FGBC 5FM4A 1GL4B 4J4PD 4N0CD 4G42A 4KTEH 4ZUSA 2P8MB 3VXMD 1PYWB 1UADC 5BS0E 5IESL 5ENWA 4B50A 2VSCA 3FQTB 1E28B 2NY4C 4XZUB 1GZPB 5DTFA 1NMBL 4G8IB 5E4EB 5SWSE 1CCZA 3QCTH 3TWCL 3QG7L 3MV8B 4JO2H 4XMPL 4FFVD 1NCBL 2EXWC 4R0LA 2R1YB 3EO0A 4ZOAA 1NGZB 5I75B 2VH5H 1MQKH 1OTUC 5EZIL 5HYQA 5J0BA 3OKMA 4KVNL 1AXSA 3VXSD 4XP4H 4P2OB 2GSIB 5DRNA 4ZPVA 1OTTC 1B6DA 3P4OA 4LGPB 5DJXA 3BPNB 2GAZB 2R0WL 2OR7A 1IJ9A 2MHAB 4JDVA 4YUEH 5GRJL 3RP1A 2X4RB 4GRMA 1QO3B 4Y1AB 1T5WB 1GGIL 1W8NA 5F3HA 5E6ID 1M7IB 5H94A 3OKDA 4LHQB 5C1MB 3R4DA 1UCTA 5SWZA 2FL5A 3SJVD 5CJ8A 4M5ZL 2V5YA 3MACL 5IG7A 1U3HC 1FJ1A 4IRJC 2Z91B 3EHBD 1RUPL 2HFEA 4G8FA 4XP5H 5T1LD 3CFJA 4YBQD 3OR7B 4JFFE 4OLXH 4HMEA 1KLGB 2R0LH 1GIGL 2ZOLB 1FYHB 4O4YH 4PV9A 1UB6B 4EDWL 1MCWM 5INDB 3NCEB 4XWOD 1INQB 1Q9KA 3DUSA 1OSZB 2WQ8A 5JNYA 1BGXH 4ONHA 5M7QA 3K4ZA 4Z78A 1IEAA 2DWEA 3FO0L 4HF5H 4YHYB 2P8PB 1L0QA 2BSTA 2NW2A 4NRYA 3BVNA 2M1KA 1RHFA 1J1PL 3QDGE 1SM3L 3CDCA 4X6DE 2CLZA 2GCYA 3MGTB 1LP9E 5FB8A 5CMAA 4H8WL 2R23B 4PJ8B 5CILL 4WFHE 4FMKA 2AP2A 4V1DE 4WTXA 2V2WA 1KIUA 1UENA 4FTVD 4MMXC 1P2CA 2BXZA 2AXGB 3QUZC 4Y5YA 1DBML 1MIEH 2LE9A 4TNVK 1MNUH 3KWWB 5E7FA 1Q1JH 1LK3H 4M43H 5GS1A 3FT4A 3HG1E 2OZ4L 1NL0L 4L5FL 2AERT 4ZUVB 2F58L 3ZT6A 4JQIH 4NFBA 5EOQH 3MUGB 4GXUM 3X11B 1QYGH 3X14B 5C2BL 4MA3A 4TULL 1OSPH 2DQEH 4I4WB 4JO4L 2N7BA 3MRHA 3EJZD 4F2MA 5E2TH 3CFKA 1OAUL 1WZKA 5IEKB 1MCLA 4NQCA 1S7QA 5EO0B 3SE4C 1CGWA 3TC9A 4X7EC 5D1ZA 1HHGB 5FCUL 4YR6B 4BSWB 3ALPA 2F54D 2HJLB 1MJUL 4L3AA 5TF1H 4BSVB 1I1YB 4LCYA 1JI1A 3UTTA 1J10A 2AK4B 3U0WL 2A6IA 3VJ6B 3ULUE 3MOAH 4HS3B 5DMIL 7FABL 4Z0BH 3QIBC 3ZTNL 4HWBH 5KANG 2WUCL 2XKUA 3GGWA 2HN7A 3TV3L 3HC4H 1YECL 4RMVA 3O11A 4UI2A 4ALAL 1FFNA 4UTAH 3QQNA 3BRFA 2UWEE 4ELKB 2H6PA 2AJ3B 5CIPA 3LS5H 3TBYA 4TUOB 4L8BB 4M8QB 4W6WB 4HK0B 3RWGB 2ENSA 5BRZE 4MAYC 3INUH 1MFAH 4LEOA 4MJIE 3P11H 4DK6A 1KYOJ 1P4BH 2CJUL 5D7JC 5DJYB 4KI5F 3H0TB 4TYUA 1EHLL 4XMKH 1KXQE 3JV0A 3GJEA 4JRYB 2VDLH 3SO3B 2HH0L 1VFAB 2IQAB 3RPIA 1P9MA 1XF5A 3K7UA 2LTQC 4S2SA 1IEBB 1S78D 1OGAA 3T08A 5CSZA 3RUGA 1NUGA 2OTUB 1UWEH 5C0EB 4MJ4A 5I74B 4KRPC 3VDCA 5DD1H 3WO3B 4XHJD 1SYSA 1MCIA 5A2IH 3S4SB 1T80A 4JKMA 5KSAD 3IVKB 1H15A 4LSDA 2WK2A 4PJAA 3WDHA 3T3PF 3P2TA 4RFNC 5IQ7L 1AH1A 1MRFH 5E8OB 3W9EB 3LRGA 5CIPH 3WD5H 1FNSL 3RY6A 1AO7A 2XA3A 5F1IA 2Y5EA 4IRZH 3BMVA 3C8KA 3K80A 1CG9B 1MWAL 4O5LL 4IRSA 3QEQD 4X5WB 3WJLA 4M7LT 1R5VA 2BXYA 4ELMF 3B9VA 3MODH 4AZ8A 3FN0H 3KJ6H 5I2IB 4HAFA 4U6VL 2OJZH 3VXRB 2ADFL 1E6OL 5IB4B 5IBUB 2OTWB 1SYVA 1HI6A 2GUOB 3IDXL 4PP2A 4KZEH 4PB0L 4C59B 3UPRA 4XPGH 4BZYA 4KTDL 4UV7H 1FAKT 1UQSA 3KPQB 4LKXB 5F9AC 1RIHH 2D31A 2FGZA 1H0DA 4PLJC 2O61B 1JF6A 3C5SB 2FO1A 2X1OA 2AQ3A 1FE8L 2W07A 4HIHB 5EPMB 1NCCL 3TJEL 3FB7A 3DHJA 3CLFL 2DQJH 4JFDE 3SKOB 1EZVY 5BXFB 3I6LE 1T03H 2WP3O 4ZG1A 4LDLB 5A16B 3C6SB 3L3IA 3V6OA 4PJGF 3EZ8A 4HG4J 4JFPB 2PYED 1C16A 1SY6L 1NC2D 1ADQL 4KVCH 4P57B 2VABB 2XKNA 4MVBD 5E2VH 4ODSH 4P5TB 4I77H 3WS6A 3MV9E 5KVEH 2DBLH 4EOWL 2X89A 1HNFA 2D03L 2FWOA 2JIXD 4O58L 2B5IC 4XCEA 5SV3A 3OAZK 1CTNA 4KK8D 4KK6D 1FO0H 1FZMA 2OTPA 1RPQA 4P3CL 2VITB 3P9WB 1F45A 1FL3A 3JV5A 2B4CH 3HZVB 5D72H 5E5UB 5DFTA 1T5XA 2BDNH 3ZYOA 4P5KA 5D7LB 1EPFA 1RMFH 4FQXA 4Q2ZB 5A3ID 3QUKB 4M6MH 1J1XL 4LCIL 1EFQA 1NGWA 2GITB 3CPLA 4X9BA 5JPMB 3KYOB 4Y2DC 1RK0A 5FYKU 1NEZA 4Y89A 1FPTH 3JTSA 4AH2A 5D1QB 4POYA 1XGYH 1P1ZA 4W70A 1OWRM 3FT2A 5FV2A 43CAA 2EDNA 4TUKL 3RWHB 3SY0A 2DTSA 3QIUD 3MGAA 2K1MA 3PWNB 4WFFE 2YKLL 5J89A 3WUZA 5J1TC 4S1SL 1TQBB 5AWNL 2PO6B 4XXDA 2CUHA 2ID5A 4WNQB 3ZSTA 3HUJF 1DE4B 4CJ0A 3GMMA 5KG9A 2DTMH 4ONFL 1MH5B 3IDGA 2WM0A 3D85A 4X6BB 2R9HD 1D5BB 1SMOA 4U0RB 1HHKA 4CW1B 2DM4A 4G7YH 2ED9A 3VWJB 4LVOB 4S0SD 3I02A 1NMCC 3RX8A 4DGYH 3B6SB 1FGVH 1DSFH 3LEXA 5HVHC 3QDJD 2Q3AA 5FGBA 2BC4A 4OQTA 5BW7C 4NIKB 5CHNA 1MRDH 2A77H 5D2LF 5I1DB 2HT4D 4Y4HD 2BSRA 5IFAH 4MXVF 5DC4B 5IMMA 3ROOA 3DBXA 4WU5A 1WISA 2WWMD 3K74B 5HHOA 3GSUA 4Y19A 3K8LA 1A7QH 5DJ2B 4QHKI