5I8KH

Hhh1 fab fragment
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
218
Chain Sequence
EQLVESGGGLVTPGGTLTLTCTASGFTISNYHMSWVRQAPGKGLEWIGFIDTGGSAAYAPWAKGRFTISRTSTTVALKITSPTTEDTATYFCARGAPAWGTANVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDRRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HHH1 Fab fragment
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HHH1 Fab Light chain
total genus 40
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8kH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8kH01
5EU5B 4A6YA 3SGDI 4JHAH 3IFLH 1CXIA 1WFNA 1MQ8A 3S5LB 3IDGA 2V2TB 2PO6B 1S9WB 5DRZA 1EEZA 2DF3A 2YPLD 4PR5A 4P4KB 3RGVB 3LB6D 3O4OB 3FOMA 5SWSE 3RHWK 1ZGLB 4QHNA 1F11A 4CNIA 1RY7B 2D7PA 1JN6A 4AEFA 2R0LL 4EJ1C 5IESH 2BNQD 3VFMA 4MSWA 1SBSL 3ME0A 4HXAH 3D3VD 2GSGB 1T7WA 1FNSH 5GGQH 4K2UL 2IMMA 1PYWA 2EZ0D 4RWYL 4KFZC 3EFFB 2IPUK 1U91A 1IZKA 1NLDH 1JYVA 1XGRA 5DGRA 3BZEB 4N8PA 2H6PA 1FL6B 1LGVA 3KLSA 5IF0A 5IQ7L 4OI8A 1S5HA 3MRQB 5D93C 4GG8B 1CQYA 1TVBA 2D7TH 2AW2A 3QEQA 1UJ3C 4S1DC 4JDTL 3VFUB 2R1XA 1SY6H 4NJAL 4LAJH 2Z93A 3VDCA 4JRXD 1DUYA 3BIKB 4POUB 2VUOA 1UWEH 1A6WL 1X4ZA 4I3GA 1JMZA 1S7TB 1IGMH 1FJ1B 1JGDB 2Q87A 1BF2A 3HE6C 3NZHH 4NQVB 3HMWH 3HAEG 5DJAB 3B8YA 3IFPB 1JHLL 1A3LH 2YHGA 5D1QC 1X7QA 2CO6B 4LEXH 2D7NA 4EN3D 1WICA 4IRJC 4M48L 3GRWA 5HYJA 4PJHE 4P9ML 4U4BA 5F3BB 2WIMA 1R0AH 1YY8B 5D6DA 5EWIL 3V4PL 3GZKA 3TA3B 3RDTA 2L7UA 4XNUH 1ZAGA 1AD0A 3SKOB 2FIKB 2NY0D 2R4SH 1GYAA 1AIFB 2PF6A 3MRMB 1OM3L 3RL1B 4HC1A 3ESUF 4PJBA 3ARWA 5EIIB 3IDNA 3P9LA 1IM9B 2EYSA 4NRXA 1INDL 3NZ8B 3QNXB 1A4KB 4OF5A 3RY6A 2XQBH 1IGCH 2HFGL 3SDAD 4K94C 3DI2B 4XP6H 4MNQD 2DOCA 2D0HA 4KJPC 1T1XB 4LHQB 2NY1D 5IGXH 3L3GB 4JY5H 5T3ZD 5HYSA 4JFHD 5L8KB 1JNHA 1SY6A 2I5YL 3C60A 4DVBB 1OHQA 2HTLC 1FFOA 3QG6A 3V7AE 2VDRL 4HLJA 4LLVB 5D7IA 4PJFB 5EBMA 4C58B 1C16A 1P6FA 3T3PE 4WHYG 2DJ4A 4JHBA 2IAMD 2IMNA 1UFUA 1WT5A 4G7VL 3VMPA 4PRDB 4OFYD 5D7KD 3W5MA 1NUGA 4X98B 4PTTA 2R0WL 4XI5C 2B7DT 1MIML 2AXFA 1N64L 5LWYL 4PS4L 4XX1E 4HUUA 3O11A 3MLZH 1UXSB 5KVGH 3G6JF 2E7BA 4S1RH 3RWGB 4LDEB 3LIZL 2IBGA 4X99A 1BP3B 2I5YH 1QSZA 5FCSH 4LSPH 4N0UB 2WUCL 3QEUA 2F8XC 2JCCF 2VKWA 2CK2A 5I18H 4IMLA 3LKNA 3BESR 3D3VB 4G8GD 4TULH 1E4XH 5TGBB 5FO8A 1CE6B 1U0QA 5FEBA 3ULSA 1L6XA 4QRTA 4WEBL 5EOCL 1CLOL 5SX5H 4M7LL 3MXVH 4F7MB 2GYSA 5TE6H 4PGEB 2AEQL 1KV3A 4GW1A 3MRNA 2A38A 1RIUL 3O3AB 4PP1C 4L9LC 2VDOH 4X9BA 3QDAA 4R0LA 3UTZA 5ACZB 3HNTL 4KQ4L 1EPFA 5I1LB 4R8WL 3VA6A 5JOPE 4J23A 1DANT 3CC5A 3VG0H 1MAML 4OGXL 3KPLA 1KLUA 3GSQA 1WEJH 1IAIH 3CU7A 3HG1A 4PRBA 5JORB 1HILB 4O00A 1QR1A 5GRVK 1M4KA 4LCCB 2ZSVA 5D71H 1N7ML 4KK9C 1CWVA 2LAAA 4YEFA 4HF5H 2WBWB 1DQLL 3SDXF 4WEMB 3VXUD 3S4SG 1H5BB 3KXFB 4JFYB 2R9HC 4X0KA 3ARBB 2UY7A 4HZAA 1KEML 2IH1A 4MMXC 3GKWH 2IH3A 1FV1B 2IPKB 1XCTA 3OAYH 4G9FE 4IRSB 3VWJB 3BJLA 3DX8A 3L3DB 3H42L 2FBJL 3WV0A 5DSCB 3GI9H 4J12A 4PRHD 2D7OA 1IC1A 1YNTA 3GHEL 5F7DB 4PJ8B 4MXQC 1QPPA 3LPGA 4MVBC 1ZWIB 4X4XB 1MFDL 1YN7A 2DQHH 4GKSB 5C0AB 4H26A 4LQFH 3TYFA 5J57B 2Z8SA 1Z9LA 4DAGL 2WQRA 3OJDA 1GGBH 4YDKH 4K8RH 5ALCL 3VXRB 3WO3B 5D72H 5C08E 1HKFA 2ADFH 3KDMA 2UZIH 3RVTC 3QWRA 3S5LG 5JDSB 1TMCB 1KXTB 5IMLA 4TUJB 4Z9KB 5D72L 4AYFA 4CU6A 3FT2A 5C0FA 3BKJH 4M7LT 5CILL 3T2OA 3IRZA 3A6CH 3UTOA 4ZUVA 5JXEC 2VLJB 4S1QL 4Y4HA 4AL8L 4ZPTA 1BBJB 1HOCA 2MNUA 1IAKA 5L8JB 3I75B 4LVHB 4DQOL 5CZXC 4LGRB 4HKJA 1YEDB 1ZKAA 4FOMA 1N6UA 1CFVL 1S3KH 1BREA 2HT3C 4X5WA 3RUGF 1FFNA 4GT7A 1OP5H 3KPMB 2NX5A 2M2DA 4YAQB 3CVHB 1O0VA 4R97B 3CMOL 1JPSL 5BZWB 3OPZL 4L4TE 2Z92A 5CILH 2G60L 1U2CA 1VFBA 5HHPB 1VFMA 2GJJA 4GH7B 1CDCA 4G6AC 2ZZUT 4O4YL 5IGXL 3IKCA 4NUJB 1HKLH 5CSZB 4NBXB 4LSDA 2R23A 4OFPA 4PRIA 5JUEH 4F7PA 1ACZA 2DQEH 5C0BD 4PREA 4L8CB 2VABA 3JZ7A 4B5EA 3I6LD 4OD1L 3PWJA 5F1NA 4WFED 1G7IA 4I9WE 5EO0B 4HUNB 3ARGA 1GAFL 2V7HB 3CXDL 5D1ZB 3HC3H 3T0EB 3ARBC 3IT8D 3PWLB 5DD1H 5IJVA 1HZHH 4G8EB 1XF4A 1RULH 2R0LH 1U41A 2UY6A 4U1JA 2PR4L 5IESL 3T4YB 5KG9B 2QTEA 4WWKA 5EWIH 4QF1A 4BUGA 5A2KH 1QLRB 3NACH 2W9LA 4IHOB 4CAGA 1E4KC 4F9LA 1T7ZA 3H7BA 5FKAA 3MRDA 5FDWA 4UOW1 4LSTL 5IFAL 1GZQA 3AM8A 1XIWD 5E0QA 3TV3L 4FABL 1JHTB 4RDQF 15C8H 3Q1SL 4H20L 1IM9D 2MQ0A 1C5BH 1I1FA 5C0AD 4QCIA 3LCYA 4JFZL 5DSCA 5CP7B 5CUSH 3L7EA 3SDAB 2X1WL 1J1OL 5J13C 5CJOH 1P2CA 1C12B 5GRWA 4E0RA 5SX4H 4NQEE 2N7AA 1H15B 3UJTL 1AKJB 3IS0X 1XGUB 1FORH 5CJQH 3G5VB 5ACMA 3S34L 1T4KB 5EG6C 5JDJA 3A6BH 1FO0L 3FO9A 4NO5B 3ZHDA 4EDWL 4KRPC 2APVA 3EFFA 1R3KB 4XVJL 2OTWA 2CQVA 2Z35B 4J7RA 4X80H 4Y1AD 1VADB 1EK3A 1UJ3B 2DDQL 4G6FD 2FL5A 4WHCA 1YUHB 4MA3B 3GB7B 3O3AA 5ETUA 4WIQA 4WVRA 4CNIB 2VERN 4CU8A 2AK1H 3P4NB 5EZOH 1KB5A 2J2ZA 1TLKA 2BNRD 1A6TA 2WIIB 3U48A 3GB7A 2MFNA 2LV4A 3UJTH 1AP2B 4JRYA 2WAHA 5ICYA 4TTDC 2JJTA 1T2QL 3CFCH 2VLMD 2DMCA 3TJHC 3ARDD 5AD0A 1LD9A 2X4PA 2HFFA 4JM2A 5BZDB 3LN9A 4KPHL 4XX1G 4R3SA 4U2ZA 2D31A 2R0KH 4R2GD 4PRPD 4GG6B 1VKXA 2NX5E 1F42A 2OL3B 5LXGH 1GRWA 3K8MA 1L9MA 4U0QB 2XWTB 2EKSB 5GIRB 4DKEH 5F93C 1U3HB 2D7TL 8FABA 4X6EB 1NL0L 1I1FB 2HVJB 5TJWK 3RY4A 5MEND 4NQEB 4BQBA 3QXUA 2F8VA 3QXDA 4TUKH 2AK4D 1JNHB 1NANH 4H25A 2A6JB 3H7BB 2Y5TB 3W2DH 1N5YL 5J11C 3BW9B 2AJUL 4FQIH 5BMFH 3MV8D 3IDUA 2AV1A 3IRPX 3QNXA 2OSLA 1SJEB 3QP3A 1ZHBB 2NTFA 5KG9A 5C08A 3I6LE 1BX2B 1DBBL 1H3GA 4S1DD 4KKNA 3QO0A 3GSNL 3TBYB 4PJGF 4XNYL 2C1OA 3RWIA 3W9EB 4MXWH 3SY0A 1W0YT 2BP3A 1EZVY 4JHAL 4NFDA 5D1ZA 3HE6A 3QRFM 4QOKE 1CGXA 2YKLH 4AY0A 5DVNA 5EU3A 5MHSD 3IFOA 3EJZD 1CFTB 3GJEA 5MHSE 1EEQA 1N5AB 1RHHA 4K07A 2VISB 1T1WB 2YPKA 4JQIH 1EO7A 3PXJA 2V5TA 3QIUC 5E5UB 3SQOH 3QFJE 5FYJU 2B1AH 2QQLH 5HGDA 3AMLA 3V6OC 3VW3H 4WW1A 4H88L 1SYSA 3GI8L 4LGPB 2EIEA 3RQ3A 3G08A 4Q97A 3MUGB 1OP3H 1A6ZB 1JZ5A 3SDDB 2ED8A 3BUYA 3OJVC 5HY9B 1U8JA 3IDIA 4BZYA 1MCSA 2IGFH 5DK0A 1JGEA 3TCXA 1GH7A 1TVBB 1CD1A 2XXMB 4NQCB 4M62L 4CGTA 5J3HC 3CD4A 3UYPA 1WZKA 1EEYA 4X6FA 5TF0A 4Z77B 1XGQB 1KTDA 3NIFF 1O5DT 3CVIH 5D7KE 4HWUA 1HHGB 4MHHI 4Z8FL 4EOWH 2NZ9C 3QIBC 5JNYB 4YHLL 3AREC 4JZNA 4K23H 1I7ZB 3Q2CA 4GS7C 3C6SB 3MCKA 3V6ZB 1CD9B 3CFJA 1X9QA 3AGVA 3KG5A 5LBSL 3L3OA 4KGLA 1T89A 3CX5J 1NPUA 2GSIB 3P11L 5J8OA 1D5BB 3DLQR 3NCJL 3LV3B 5C0BB 4K71C 3X3GH 4M1CC 1UA6L 4UIKH 2PCPB 3EDFA 4FQJH 5IFJB 4PB0L 4RBPK 2XZAL 4LLDA 1NDMB 1MRCL 5D5MF 1I8MA 4N0RA 1HEZB 1MNUL 1N0LA 2BMKB 4Y5XA 5ESQB 1K5NB 2XTJE 3QT2A 5I9QC 1X4YA 3KS0J 5F21B 3RNQB 4PLKD 4JVUA 5E2JA 2QSTA 2HWZH 1G0DA 1IAIL 4JDVA 4MAUL 5E9DB 3NMEA 2DJSA 4L5FL 4ZOEA 2MCG1 1U8MA 1KLGB 4FXKB 4NRYB 1I8IA 3TO4D 3G6JB 3S37X 2C3WA 3BH9A 1OAKL 3UPAA 1S7RA 1BVLA 2R2EB 3OKDB 1J8HE 4Z78B 1AP2A 2B0SL 2Y07H 5DEFA 1B4RA 2QSCL 4OFKA 2R8SH 2H9GB 4E9LA 1CL7I 3ARYA 1OB1A 2R9HD 1AI1L 3IXTA 4N0FA 2VB5A 2ENYA 3GIZL 1YYMH 1AGEB 1DR9A 3WNMA 1Q0XL 5FO9B 1VGEH 1T1ZA 3IJYA 3MYZA 1FZJB 1S7SB 2J6EL 3MUY1 1LO0H 1KPRA 3D0VA 4OGAC 1PVHA 1KEGH 4KZEH 1OSZB 2GITA 1RJLA 1VA9A 1SYVA 3EOBB 4P23B 2EE3A 4LVNB 3RNKA 3H8NA 2VMFA 3GSXA 3IDMB 1NL0H 5ACLA 3B9KD 5FYKE 3RBSA 4YUEH 1CBVH 2VDML 1PG7W 4KV5F 4B50A 5I2IB 2B5IC 2NY3C 3E0GA 3NFPA 4WV1C 5F7NC 3S9DB 4Q9RH 1FYTA 1UH2A 2AJZA 4X8XA 3B9KC 1Q8MA 5EIQA 4GLRH 4P59L 5D1XC 2VLRE 1NFDB 4EI5B 2SEBA 3EJYD 4XCYB 3K2MC 4FQHB 1KJ2L 4I18A 1I85C 4O02H 5C2BL 4S1QH 4L3CB 3TZVA 2WUBL 3BPCB 4HIIB 5EC2B 4OD3L 1T1YB 1CFBA 2DLHA 2AXFB 2ICEA 3QEQE 2FRGP 5GRXG 3AB0C 3MLTB 2DM2A 4MJIB 4KMTL 4K9EC 3LKSB 5HI4D 4LFHG 1AGCA 2BSTB 2ADGA 3H9HA 1RI8A 3MJ8B 4UT6L 1Q9LB 1T7VA 5ITFB 5A2LH 3VRJA 3FQUB 2X70A 3OPZH 5HHNB 4XAWH 1EHXA 2H3NA 1CYGA 4BQ9A 2EE2A 2NY6C 5KOVC 5DEZA 5HYSB 2DDQH 2UZIL 1K4DA 1PQZB 4LVOC 1KJ2H 5EO0A 1HKLL 3GI8H 3TVMA 2AJYL 2W0PA 5F9JA 3BDXA 3V79C 3RVUD 2O61A 1IL1A 5GGTH 1MRDL 1XIWC 4M5YH 2FJGB 3PGCB 3QUXA 3ZL4H 4W4NA 3DNKA 3I2CL 5IHZA 4MQSB 5MENB 4PRIB 4NN5B 2FX7H 4QEGA 4PJBB 5EIIA 2R69L 3U82B 1MCLA 5T3XH 1NCTA 1XEDA 2EYRB 5CEXA 3GSNA 3RWDA 1EEYB 5DJ6B 5F7HA 1Q9LA 3MYJA 2ZCLH 2LVCA 3EFDL 4JQIL 2VOTA 1FFNB 4Z0XA 1FO0B 2Q8AL 2UWEA 3BD4A 1L0YA 1CXKA 4J3TA 5B3JF 5DJYB 4G9FB 3QDGD 2GI7A 4PP2B 4V1DB 4OZHE 1DDHB 4ZOBA 3M17B 5DD3L 2PYEB 5IK3A 3HFMH 1XT5A 3CLEL 5DC0A 1TQBC 1CDHA 2C3VA 5H35A 1FVDB 4MJ5A 2IANA 1MRFL 4JRXB 4MA7H 5EOTB 3A67L 4OUOA 1ZHKA 2ENSA 3B9KB 4I13B 1MHPL 4EBQH 5JDSA 3C9NA 3REWB 3RWCA 2HYMA 4DKEL 1X6LA 3SOBL 5DJCA 3UTSE 1TQCB 3CXDH 1MH5A 5GRUL 3MZGB 4IIQC 1NBVL 1YMMB 1BOGA 3D9AH 4JRWA 3IAGC 5C08B 1V3JA 4J6RL 5DC9B 4JVPA 4G3YH 3N9GL 3UAJD 3MJ9L 2DQDH 2ARJQ 3VFMB 3SJVD 3CFDA 2AJ3B 3ULVL 2Q76B 2P4AB 4K7PX 1D9KA 3ROOB 3MV8B 3OKKA 1IFHL 4EVNB 4LF3B 1CICC 2DQUL 3MGOB 2CUHA 3GSNB 5I6XC 5GS0H 4X6DE 1U93B 4ZPVA 5DR5H 4RWYH 2X44D 4RISH 3L3DA 4Y4FB 3ULUH 3QUXB 2FJGA 1D9KC 3DGGB 4XWGH 2EKSA 5DEFB 3O4LB 1FYHB 2P8LA 3P73A 1MHCA 3V6FB 2CPCA 1G1YA 4DKFL 1BZ7A 3QULA 2PR4H 4ODVH 3BH9B 5AAMA 1FNGA 3B3IB 1BD2A 3MXWH 2AGJH 4PRNB 4YPJA 5F7EL 1V3LA 3JV4A 4W6WB 2MKWA 2Q1EA 2V2XB 4N8CL 4NZJA 4P46D 3WIIL 2ICCA 4JY6B 2LVEA 5H2BB 3QDJA 5I8CA 1J0JA 3BX7C 4P3DB 3VGHA 3L7FA 3BJ91 4W6YB 4X7SL 4OZHB 1FO0H 4OLEA 2I27N 4M93B 5I1AB 5F9OH 3GSWB 5BV7L 2GJZA 3ZT5A 3FFCA 4R0LB 3UTZB 2A74A 1DLFL 4L9LA 5T1KB 4M4PA 1U8OA 2XV6B 1FZMA 3ZE2E 4PBWD 4G80A 4L3EA 2FHFA 3MXWL 4ZQKA 2FLBT 1EUTA 4BSWB 1JJUA 1A9EB 4O2CB 4HAGA 1VFOA 4ODVL 1WIOA 2X42A 4NM8H 3W9DA 3FJTA 4MDIA 1M7XA 4NPYB 4YDIH 1I8LA 4AQOA 1J0IA 3AMKA 1RUPH 3BE1H 2QSQA 3D3VA 4YE4L 1IQWH 2DWEB 2P44B 4WEUD 4YEEA 1PKQE 5M95B 4N0UA 5F7WC 1D5IL 3L1OL 3X13A 4PJ5A 1KJ2B 4G7VH 2GAZA 1KULA 5SWZA 5KSBA 2X4TB 3L5WA 1TVDA 1C08B 2CIIB 3BZFB 3ES6B 2GAZB 4N8VB 1CVRA 1RUKH 2JB6B 4KRPB 3UC0H 5D7SL 4PY8I 5MEPB 3F7YA 1L7TL 4L3EE 4P5TD 4P5MA 4WO4B 5JPMA 3S88H 4E5XA 5C6WH 3VJ6B 5GZOD 5F9DC 5B8CB 2DB8A 3MSPA 1UZ8A 3DXAA 5I30H 5CJ8A 2FYYB 1CFNB 3GSNH 3TBVA 3O4LE 4MWFB 1YMME 1NBZA 1I3GL 1ES0B 2E7MA 1F4YL 1AHWA 1P5UA 5E1AA 1T0MB 5HGDB 2HH0H 4GAGL 2YBRB 4YBLC 3MXVL 2Y9RT 7FABH 4HHAA 1F4YH 3JV0A 4MLIA 4Q6YA 3MC0A 2O5XL 3WHXA 3RWFA 4LU5H 3OL2A 4C56D 3TO4B 3BZ4A 4GXVH 4U1MB 1A9BB 3V95A 1R3IL 3P9LB 3GHEH 1ZGLM 2CH8A 5INDB 1R0AL 3QDJB 3QCUL 6FABL 1SJHA 3SGEH 3LQZA 5CCKL 2V7HA 1BD2B 2Y06L 1OTUD 4LP4A 4Y16A 1KFAH 1OAUL 1MI5A 2I24N 1MHCB 2P8MA 3T1FA 2CUMA 3HE7C 3C5JA 3QQNA 4BH8B 4NZUL 4KKAC 1YYLH 1J05A 4OZ4A 4Y4FA 4MHHG 1UKTA 1FNSL 1P53A 1ZK9A 5C0CD 1FJ1A 1WEJL 1PKQB 3ZKSD 4PYHA 2ZKHL 1CICA 3MLUL 1B6UA 4J8RB 5BXFB 2Q8BH 1K8DA 2VR9A 4Y2DC 1RZKL 1QEWA 4NWUL 3LEXA 2J8UA 4Y4KA 2KDGA 1Q9KB 3HRZB 4RAUB 4WI6A 1BQHB 2YK1H 3ZKMC 3MUJA 3R1GH 4M1CD 5T1MA 5EA0H 1QD0A 4PJ9C 1MJ8H 1KIQA 3KPRE 2DQEL 1SBBA 4NQUA 3DIFB 4OGAD 1KJ2A 2VXUL 3VH8B 3ULUF 4WTXA 1JL8A 3KPOA 3VFSA 1BVKB 3UTTD 3VFRA 1CN4A 1JE6A 5F7FA 3TZVD 3P77A 1KELL 5DZNA 2B39A 4R26L 2UWEE 4S0TD 2XIDA 3FZUC 3AY4C 2AERT 1RK0B 3BP5B 1QVOA 3QUYC 2XICA 3QEHB 2M1KA 4JM4L 2BRQA 4WFGD 3U7WL 3EO9L 1I9IH 5I1KL 5FYKL 3TNMA 2R4RH 3RZCB 1A1MB 1IGTB 4WO4D 1BIIA 1TTFA 3FFDB 2DQDL 2DQCL 1BAFH 1PSKL 1ZLWK 4WGWB 2GJZB 3S4SB 3FB5B 4Y16B 1J1XL 3R06B 1BIHA 4F33A 3U79A 3O3BA 1RUMH 3TIEB 3HE7D 1JI1A 1LO0L 4PJ8A 3I3BA 3MGTB 2X4SA 4C56A 1DBKH 5MENE 4YC2C 1F4AA 4JB9H 1RIHH 2BY2A 1T5XA 2GHWB 4K7PY 3CLFH 4HGWB 1ACYH 4LCIL 3VXMB 5BS0D 2AI0H 5DJ0B 4G6KH 1E6OL 4OTXL 3RWFB 1ZLVK 4XMLH 3VFOB 3WUWG 4NUGL 1UENA 4GO6B 2JJVA 4PLJD 3BMWA 3KGRA 5GGVL 5JZ7C 1DN0A 4G9DA 2ZSVB 1L4IA 4B41A 1XR9A 3BT2L 3MBXL 4I77H 4K3EH 4KTEH 4NQCE 3VWJC 5J9PA 5ESAB 2V2WB 2I9TA 4UDTA 5GS1C 2VLLA 5C7XL 3O3DA 1CFNA 3WFHA 2Z31A 3VJ6A 4NNYB 1RUAH 2X05A 1HXYA 1OAQH 2NXZB 2JB6A 2FX8H 5CWSA 4MVBD 4PGDB 1J12A 1KC5H 4EQ2A 2W9EH 2Y1VA 1MIEH 3OKYA 1T1YA 1YDPA 4OIBA 3QPXL 3ARUA 4G42A 1T0PB 5D1XD 3TNNB 3MNVA 1KCVH 2EIZA 3JWOH 2DL9A 4LGSB 5EU6D 4E42A 1SY6L 5GSVB 4KTDH 2FATH 2NCMA 5D7JC 2VC2H 1RUPL 3CU1A 3TFKD 3HLAB 1MCOL 3H9YA 5J06A 5GS3A 5A43C 4M6AA 4UBDC 1KCUL 3PWJB 1I8LC 1FVDA 4MJ5B 5I75B 2CLVB 1K2DA 1AY1H 4M7ZB 4L8CA 1KXVC 3MACL 3OB0K 3EKCA 1T20B 3TBTA 4QRPE 3VXSB 4QGYA 5ABDE 1AXSA 4DTGH 5LJYH 2WM0A 2WINA 3ZT7A 4PTTB 2UWEB 1QG3A 3IDYB 1AD9A 4KC3B 3OKMA 2X10A 1NMAL 4LPUA 4WEBH 2HN7A 5KVFL 3MLRL 1MCOH 1IKFH 3T0EC 2HFTA 1HE7A 3ZE0E 5F8QC 3CZFB 1QYGH 3QIWC 2F74B 2VH5H 5BRZE 1QBML 3O41B 4YBLB 2XZZA 3ZE0F 1XGUA 1FNGB 4CKVX 3LKRA 3S88L 1JIBA 4OCRL 1E27A 4Q7DA 3CNKA 4AMKL 1U8QA 1NCDL 1FZOA 4X6CB 4XBEH 5DK3A 1QFHA 3TVMB 2VLJD 5K59F 3AVEA 5HTSA 1Z3GH 3IDNB 5IFHL 5IIEB 1QACA 1W72B 4D9LH 1CD8A 3LQAL 5KN5A 8CGTA 3TIEA 3O3BB 4WJ5B 4NNPL 5T3ZE 2Q3ZA 5T3XL 1W8OA 3CFBA 2CKNA 2VQTA 1YY8A 3BVNA 2YD8A 1S9VB 1WBZB 2D9QB 3AFLA 4N90D 2XWJA 4LHUB 4RFEB 4TPRH 1TIUA 5T1LA 1CQKA 3GIVB 1GOGA 5GGTL 2O5ZL 2VLRB 1HIML 3SDYL 5C0BA 1ZANH 3STLB 4DGYL 5IB3B 2YMXH 4X6CA 3FO1A 4UQ2A 1OQXA 4OCLC 3VXTA 4FQHA 2Z93B 3QI9B 2NY2B 4HUXB 5EOCH 5I1DA 4RQQB 4P3CL 2FD6H 2NQCA 2ED9A 5C2UB 2FJFB 5I19H 4GQ9L 3QIBA 5EN2A 5CJOL 4BK5A 2F54E 3V2AR 3BGMB 4MXVF 3UYRL 2KZ1B 4MYWB 2E6JA 4TPRL 5BO1H 4BZ2L 2F58L 5I66A 3OJ2C 4XPHH 4LNRA 3KLAB 4U05A 5FECB 1JGEB 2WINB 1BLNA 5BZWA 3J8F7 4CL7A 3MYJB 5FHAH 4Y88A 3TBTB 4XHJC 2HG5A 1Q38A 1U92B 2HKHL 4CU7A 3MJGX 3BUTA 2WW8A 5B38G 4KRNA 5DJ2B 3OGOE 4XHJD 3BMVA 4M43H 3QIUA 1X5GA 4XBPB 4JRYD 1RULL 4OZ4B 5IV2B 5BO1L 4O58L 5TDNA 5GZOC 3VRIB 4DN3H 1MJUH 12E8H 5T1DL 3GNMH 4HJ0C 1N5AA 1EH9A 1OL0A 3HUJB 4OZFA 1XFPA 1NCBH 4BUHA 1DQDH 5GSVA 1P6AB 1MCIA 1Z0MA 2P5ED 5CWSB 1TQCC 4YXKH 4HMEA 3VXRE 1YDPB 1ZHNA 3S34H 1E4XL 3CVIL 2A1WL 3KNBA 3TA3C 2AI0L 1JK8B 4PGDA 3BKCL 4WI5A 3TYFB 4HUWA 5EO9B 3OF6D 2QQKL 1UVQB 2FECL 2VLME 4GKSA 5ESAA 4ZXBC 2B20A 4H25B 5D5ME 3HRPA 4ODSH 4D8PB 4ENED 4BH7B 4MAUH 4WFFE 2ZPKH 1PG7H 4NP4L 4P5KB 4QXUH 4WI2A 3VXQB 3NPSC 3PHQA 2X9YA 5FGBA 2IQAA 4CN4A 5IEHA 4UINL 1F02I 3BO8B 4IRSA 1JF1A 3NA4A 3ZYIA 2BSRA 3VA2C 2DQIH 3UP1A 3WO4B 2D7QA 2OZ4L 1FG9C 3IF1B 4N8VA 4Z95H 1HQ4B 3LS5L 4PB0H 1CU4H 5DUPH 4Z7OE 3GM8A 2EYSB 2YPVH 5E56A 4XMKH 1T5WA 5DA0B 5DWUL 1JHKL 4F33B 3CCHA 1H3PH 1UQSA 3Q3GB 1H3WM 3QH3A 3QEQD 4YHIB 1CE1H 3O6ML 4H5SA 2VH5L 3G5YB 5HJ3A 2CGRL 1LD9B 4XPGH 1YZZA 4Q6IB 4WW2F 3KPLB 1K4CA 3RDTB 2B5IB 4P23D 2OS7A 4JFDB 4PRIE 5E8PB 5EBLB 5ID1A 4DOHE 5A1AA 3DMMA 4UV4L 5ICYB 2JIXB 3MLYH 4DKAA 4NKOB 3X3FL 4FNLL 3JWDC 2X4OB 3HZMA 5AEAA 3BKMH 4FQCH 3TNMB 1RZJH 3DOSA 3LS5H 3FONB 5ADPL 5BQ7A 1FAIL 3BP6B 4LMQE 3RZCC 5DLMH 2EO1A 1ZT7A 1F8TH 2KH2B 3DMMC 2YA1A 1U36A 3EAKA 4M7LH 4POZD 4TNVF 3NBNA 5L8LB 1BVZA 4F58H 3FO9B 4NO5A 2XN9A 4WFGE 2NY3B 2FZ3B 1UM6L 4ODXB 4PG9A 5FO7A 1N0XH 4UB0L 1F4HA 5JOEA 3BHBB 3Q6FB 5TQ2L 1YNKL 3GJFK 5D5MB 1PEWA 2XI9A 1XAUA 2EXWD 1M71B 3O6FC 4OUUA 1M7DA 3HAEH 3ALWA 2QV2A 2Y06H 1WGOA 1F3JA 1D5MB 1FGNL 3CSYB 5I1IL 3MLVL 3L7EB 5MEOA 4OGXH 4NRZA 3WFEL 5I9QB 5D7IB 5EBMB 1MF2H 1ZGLA 1E6JH 1OWRM 3O4OC 4MMZC 1A6PA 4I5BA 4XP5H 2JELH 1EAJA 1YEGH 2E8ZA 1UACH 5KS9F 3L3GA 4HZLB 4URTB 3LZFH 5CEYA 2FR4A 1UCTA 1I85A 5JZ7D 3MV8E 1S8DA 2DQTH 2HP4A 5AZ2L 4LOUD 1NMBH 1QRNA 5IBUG 2VITA 5JW4R 5IVXB 1XF4B 2HKHH 3L3KA 4XVJH 5E00A 4K8RL 2AJXH 1WWAX 1MF2L 3DVNB 3QXAB 1VEOA 4NZUH 4OSUL 1A6VL 1ZA6B 3TGXA 3WFEH 1U8HB 5AD0B 2D03L 4LLUB 3V0AC 4HIEA 3PL6D 3QDHA 5BQ7B 5I1GL 1T3FB 4L8SC 3FOLB 3MR9B 5F6IB 4LCIH 3F7RA 1RUQH 2YC1B 4ZD3L 3M17A 3BP6A 1NGZB 4ZS6D 3IJSA 5IR1A 4PP2A 4UIMA 5ID1B 2CXGA 3BN3B 2HLFD 4PBXA 4IOIA 1LO2L 4YFDB 5IT2L 3GMOB 5F7YC 1R5VB 2BXYA 3HC4H 3WFDH 3MNWB 3BIKA 3LQMA 1HHIA 2R69H 4TUOA 2VISA 5E7BA 4C57C 3MBXH 3BT2H 1B4JH 2QKIB 2XWBA 4I77L 5F7KC 1IEBB 2Z4QB 5HHVH 1TTUA 3WE6A 4HEPG 1MCBA 4Y8DC 1VGEL 4PY7B 4WFFD 3CCHB 3CH8A 3JTTB 1VEMA 2CIIA 3VGAB 1BFOB 1H3TA 2R15A 2W38A 4M61B 4NO3B 4OSUH 4RGMB 3RJQB 1KELH 1OP5K 5T5FL 2Y5EA 4JKMA 5SWZB 3NFNB 5GRZA 3H3KA 4PGCB 2GW5A 5I1GH 4PJ9B 3SPVB 5EFIB 3PP3K 5IHZB 3I75A 4PLJC 2VTFA 4L9DA 1OSPH 1DBKL 1HQ4A 4L4VD 2XN9D 2DLTA 2CDEB 3RVVC 3CUPA 2P24A 4Y2DA 3LEYH 4JFFE 2XRAH 4P5KA 4K2UH 3SDYH 3FO0L 2NY3D 5IQ9B 2WBJC 4OCSL 5FHBH 5ICZB 5HSFA 3RZWA 3VU2A 5L2KA 3S35X 2OJEA 4P4KA 3RGVA 4R6UA 2YA2A 4XMKL 1SVCP 2WBJD 1WWCA 4NZTL 3H9HB 4X83A 2CKBH 5GIRA 3TYGH 1BGXH 3WHE0 4JQXC 5H94B 4NQXB 4P3DA 5FKPB 1UWEL 1F4XH 3SE3A 4OFVA 2R2BB 1T83A 2DKMA 1UEMA 3E2HB 2JJSA 1T0NA 3MQIA 5D2LA 3MRIA 3QUXC 3QULB 4QKXB 3S96A 4XCYA 5TH2A 5KSAB 4JJ5B 4FQQB 4HLZH 3IJHB 4PRNA 2AEPL 5EU6B 5E8NA 2Q6WB 4AM0A 3QIUB 3CPLB 4XBPA 1U8KA 1YEHH 3C6LB 3HZKB 3VRIA 1AGBA 4EI5D 1P7HL 1A6TB 1EHAA 4JE4B 3DETD 3OAUL 4AZ8A 5D9SA 4JGJA 5C0DA 1OARL 3O81A 3W11C 4FZEH 4DKFH 2AJ3A 4LF3A 3FQXB 4JFED 3WIIH 3BKYL 2DQHL 1EFXA 4G8IB 3ULUL 4DZ8A 1XF2B 4GJTB 1UWGH 3JVGC 1IGFH 2RB8A 1NSNL 5F3HA 1EVTC 4OZIF 3OGCA 3MLYL 4YXHL 2X6MA 6CGTA 1CDYA 1G84A 4Q2ZA 5GS0C 5JW3H 1YJDH 3KWWB 3RUGE 5KVDL 4TNVK 4Y4HD 4ZTOL 4S0SD 1TDQA 3MJ6A 4HMDA 4OBRA 3U7YL 3G6JA 1F3RB 1G7PA 4HH9B 1R3IH 3ARFA 2H2SC 2IPUG 4LKCA 1UKQA 5T3ZL 2VLRA 5IMLB 1HDMA 5JXAH 1QUNA 1KTLA 3MLXH 2VO5A 4ISVA 3STLA 2VXVH 1H0DA 4TVPH 4X9IA 4WTWA 5EBLA 4BK4A 2ZUVA 3CFKB 4BFIA 5L2KD 4GXVL 1PG7L 3ZDXF 1VEPA 4GRLD 5FUZL 4RA3A 4YHIA 1WIUA 4D0DA 1F97A 3SKNB 3IAQA 4I3SH 1PG7X 5CFHA 2HJFB 1A7PH 1S7WA 5GJTL 4RIRA 4KJPD 5D7SH 4F9PA 2VDOL 3T0BA 3BD3A 1BD2D 3DJ9A 3OXRA 1TJGH 1A21A 3C6LA 3AXLA 4YO0A 1ZSDB 5HHQA 2B0SH 2YD2A 5DRNA 4M93C 1DVFA 4H8WH 2BSSA 4D9QE 2H8PB 3S96B 1T7XA 2AP2A 2R23B 3MODH 4M7JL 1T0NB 3T2QA 3GMMB 4ZNCD 2ZUSA 2AXGB 1AIFA 1J8HD 2VZVA 3CFIC 2HT2C 1NDGA 4MGXA 12E8L 1GJIA 3MBED 5F7EH 2W9DL 5EO9A 1UYWH 1PW3A 1G9NL 1P7QA 1ZEAL 4GUPA 1F6AB 1CDIA 5CSBA 1UKSA 2GCYA 1U6AL 3WBDA 5EUKA 4HFUL 3I2CH 2DQJH 3VGGA 3ULVH 1D5XA 1MJ8L 4P2RD 4LFHD 5TQ2H 2FH8A 3A0OA 2M8XA 5EC2A 2XY1A 4LKCB 2GT9B 1OAUH 2XT1B 4MCZA 1J10A 1NBVH 4HH9A 1G7PB 4XNYH 3QHFH 5KBNC 2CLVA 4RGNB 1BBJA 4CADB 1YNLH 4QRTB 3TESA 4YHKL 4PJDA 1C7SA 3OXSB 2EDLA 2VZ3A 2BY0A 2RQ8A 1RSFA 4ZAKC 2X09A 4HWNA 3VI4E 5IWLC 1KYOJ 1FVCA 3FB8A 5F1KC 3EDEA 4GAJH 2ZKHH 3ESVF 2DKSA 4HC1H 3QEUB 4P2QD 4F7TA 4KJQD 3QHTC 2YSSA 4PJDE 4JHZA 4YDKL 3RWGA 4KMTH 3ISWA 3N85L 1BFOA 2VDKL 1Z5LB 1KPRB 3LOWA 1OAKH 2GSGA 3O6FB 3LN5B 1RJLB 3EOBA 4P23A 4WGVB 2R2CA 3NIDF 5EZIL 3D0LB 5ADOH 3O8XB 4OZGE 3U36B 1BMGA 3REVA 1WFOA 1BEYH 2IAMB 3MFGB 5IOPA 2Z31B 1WCBA 4U1IB 5TDPA 1DN0B 1C7TA 1UZ6F 3T1WA 1ONQB 2BHYA 2LQRA 5J9PB 4GG6E 3CPLA 1U3HA 2VXQH 4G9DB 2ARJA 5F71A 4JN1L 1QR4A 4OM0H 1R6VA 1RVFH 3WNNA 1S3KL 5HI5D 4YHZL 2D03H 1ZA6A 5IB3A 3QDMB 3WN5B 4EUPG 5E9DA 2R2HA 5ADPH 1BEYL 3UBXB 1S7WB 1AFVH 4GG6A 3UJIH 5GSRB 3R06A 4NDMB 3DV4A 5BVJA 4PJCB 1MPAH 5GJSH 3NCBB 5KSAC 4V1DD 5D70H 1PZUB 5SWSB 3DRQA 2VXTL 3KLDA 1FGVL 3GSUA 4XVSL 3TA3A 4BZ1L 4JO1H 3G5XA 1BM3L 3D69B 3UC0L 5IMOB 1EHLH 5I8EB 4J1UB 3L3JA 1J7VR 4JGMA 1AR1D 5DD3H 4YHNA 3OQ3B 1KB5B 1Z2KA 2PW2A 2YPVL 5I75C 4B0MM 2HAZA 4ZO7A 3KPOB 3RKPA 1LK2A 2WP3T 2Q7YA 1KJMA 4KI5D 4DJMA 4ZOAA 3F58H 3VFUA 5B38A 2FO4B 1DL7H 2Q8BL 4ZS6C 3LAFA 4DUXA 4PGCA 4Q74A 2RAMA 3QQ4B 1OAXH 4NYLA 3MJ9A 4RGNE 3T3PF 1RZFH 3OX8B 1EX0A 2W0KA 4PTUB 1A7QH 5ID0A 3OR7B 4OJFL 4F58L 1U8JB 3IDIB 5I76A 3HMXH 4BSVA 2ZUQB 2VDMH 2X4UB 5FYJL 2JJTC 1BQHA 1MRDH 3V8OA 1IZJA 1CDUA 1OGTB 5D4QA 3GMOA 4LCWA 2DQUH 4MNHB 1UH3A 1NBYA 2ZP0T 2R1YB 1ZLUK 4MB3A 2HA1A 3ZHKA 3FONA 2VWEC 5TDOA 2CJUH 3O45A 4N9GB 4PBVC 5HHME 3U2SB 4PGBA 2V9TA 1P4BL 3MR9A 1R5WB 3W5NA 3HZYA 1VERA 4XVUC 5EU5A 4FP8H 5KSAD 1X5AA 4B53A 1QLRA 1MQKL 3C5JB 2IPTH 3HR6A 5SWSA 2IJ0C 2BOCB 1RZKH 3DVNA 3SO5A 5I1EH 4NDMA 1IM9A 4YZFF 5F1SA 3ZE1E 2EIZB 1CDBA 4K3HA 3MLVH 3IU4H 2CK0L 3LH2H 3BPNC 5CS7A 3SY0B 2K7PA 5L6YL 1WV7T 5EZJB 1T2XA 1ZV5A 1AD0B 3SKOA 3UTTA 1O7SA 3EFDH 4IEFB 2XZCH 5FGSA 4EXKA 4M1DL 4EZMA 5DJ8B 2NYYD 4KI5F 3ULVF 2XZCL 2CXKA 1FDLL 1TJHH 4X5LA 3D2UD 4HHAB 3F7VA 5CEZL 5LGKA 1NBZB 2EDHA 2DTMH 1FCGA 3ILPB 1F58H 5F96H 4L8DA 2OTPA 5EORL 3REVB 5D6CB 1X5LA 3FB7B 4DK3A 5JW4N 2VDKH 3TBVB 1A6VH 2F54D 1U42A 2YS4A 3QG7H 5L2KE 3ES6A 1S9YB 2G5BA 4MQ7B 3MNZA 2XWTA 4XXCA 4XNXL 3BHBA 4WI3A 3KVQA 1VENA 5MEPA 4IM8A 2D31B 3DX6A 1YEDA 1EAPB 5JPNB 1MWAL 1MAKA 3OV6A 5KZCD 4ERSH 1A6UH 1ZT1A 5FYLH 5CD3B 4APQB 2Z91B 2V9QA 3NFSH 2HWZL 5ALBH 5HHMB 2WK2A 4HS8L 2RGSA 1LK2B 2R56L 4PJEA 1U58B 4TUKL 4MDIB 4ERSL 4XVUD 4GS7B 1QSFA 4Z0BH 1MFBL 1DQDL 1HHHA 3MRRA 4PRAA 2NNAB 4D9QD 5DS8A 3HZVB 1UB6A 5M7QA 2DQGH 4M43L 4MA3A 3T08A 4J1UA 3RJDA 3VE0B 1K8IA 4K3JL 4BFBD 3MRRB 4PRAB 1AY1L 3VI3F 1F6LL 1EERB 4Y5XC 4M6ML 4QNPF 4UDUA 2KBGA 3PWPB 1I3VA 3KXFE 4YBQC 3MO1A 2UVEA 3OKLB 1HHKB 1I1RA 1OCWL 2NY0C 3RA7H 1MCCA 1CGYA 4FFYL 4MA1B 1T4KA 1BGXL 4U3CA 3VGAC 2V2XA 5GSRA 4ODBD 2EDEA 3N50A 4WU7B 5EZOL 4KMLB 1BZ9A 2AXJA 1MFBH 2VQ1B 2NPLX 5GGRY 5T1MB 2YEZA 4YHYC 4X4MA 1DVFD 3H3BC 1H15A 3LKOB 3RPKA 2BSSB 4NJAH 1PLGL 3HRZA 2BSRB 1WT5C 3DX8B 3ZTNH 3KR3L 4UUJA 3IETB 1MUJA 5JW3L 3RTQA 3QI9A 1UT9A 3QXWA 3V6FA 1FNLA 2ORBH 4RGOL 5H8DA 4I5BB 1OQOA 4JPVL 3DHJA 4HK3N 4QWWD 3WIFB 1V7NL 2NZ9D 5DYOA 1WZ1L 1TVHB 1CK0L 4DEPC 3LEVH 2X5PA 2AJVL 1HSAA 4Z8FH 1S5IH 4QCIB 4O02L 4PRHA 1D9KB 4XNUL 4YK4B 4D0DB 4MLSA 1LDSA 3GNML 4LKXA 4MDJA 3HG1B 1NKRA 2LTQB 1YEEH 4KHTL 4HAFA 3D0LA 3UPCA 3CFDB 4OZFH 5BRZD 2FWOB 4WWKB 5HDBF 3VXSD 4P99A 1YEIL 4WUUD 4M6OH 3ARZA 4OAWB 2Q76A 1AXIB 4FQXA 4V2CB 3PWUB 1IGIH 2X4NB 4I48B 1JNNL 2PTTB 4M9OA 4G8EA 3UTTB 3BYYA 2HJKB 4JHWH 1KYOK 5KN5B 1TNMA 3W0WA 5ISZD 4MCYB 1WZ1H 4O51A 3PGFH 1RZ7L 3MV9D 3FQRA 4XI5D 1AJ7L 3TIDA 1I1YB 1JP5A 1A5FH 4PJDB 4ONHA 5I8OL 2XZAH 4S1RL 5J0BA 4RGNC 1F2XK 4TNWF 1NJ9B 1NCCL 4JFOA 3HZYB 5D2NC 4M6OL 4AK1A 5A40E 4Y5VC 4G9FA 5KAQG 3I02B 4WI7A 4XNMA 3EYVA 2X4OA 5T33L 4M8VA 4XP1L 1FLRH 2RCSH 4UT7L 1IGIL 2ESVE 4RFOH 1F6AA 1RZKC 5DJYA 5HHOB 4LCWB 5FFLA 4F37K 2FGWL 4X98A 4HDIA 4OT1H 5D7LD 3V5DA 3UJJH 4NC1C 2Z92B 1H3XA 4TSBH 4GKZB 2BX5A 3MFFB 1BQSA 1NDGB 5FAAA 5HHOA 2C3HA 3VH8G 1MWAA 4AH2B 2LU7A 2J88H 3VFVB 1RIUH 2YXFA 5I18L 2EE9A 1EBAA 3IFLL 2IBBA 3SE4C 1EJOH 3MLSH 3KLHD 4K9EH 4P2RE 4WUKL 4RFOL 1MI5D 2E3VA 1SMOA 1HOCB 2Q7NA 4YDJA 4MAYB 3OXRB 3HE7A 2CIKA 5K9QG 2IALA 3EUUA 4KUCF 1KENH 3C09B 4KJWD 4RIRB 4TQEL 1LP9E 3FT2B 2P5EA 2FGWH 4YDLC 2I07A 4LPXA 3B9EA 3ZMRA 4LLYA 1ZVYA 1LE5A 1HH6A 2ADGB 4QRQB 5DK2B 3N9GH 1UM6H 5E8EA 1H3VA 3O3DB 3GRWH 2EC8A 1XF1A 1RUQL 4ZD3H 3S3SA 1DQML 3K4ZA 2ADIA 4LKXB 4MDJB 4ZOCA 5C0AA 2PKDA 5FUOH 3DBXB 1RIVL 2A83A 1G9MH 2FEDD 2GFBA 3IXAB 4PUBH 5E8DH 3VXNA 2ITDB 2ADJA 2N7BA 2LAGB 4K8RC 1KIUA 5K9QI 2NXYB 3D18A 3P73B 1VSCA 2Z9TA 3QFJD 2W1NA 5K33A 2M26A 3OMZA 1NFDA 4WNQA 1VFAB 4QYOB 2XG4A 1NC2B 5EU4A 5FIEA 1CI5A 2AJZB 2O5ZH 3K4AA 5EFIA 1KIRB 3L5XH 5F6HI 3NGBC 3BZEA 3WDIA 3WFBL 2DQTL 3SKMA 4LCCA 1FE8H 3U46B 1L0QA 2HN7B 2HG5B 4RGMC 3GSXB 3RKDD 2IAMA 2IPTL 3CC5B 1DQMH 3OKMB 1BLNB 2ZG3A 3FQXA 2GITB 3PJSA 1OSZA 2QKIA 4RZCB 1QHOA 3DO3A 3CDCA 3PWPA 1FC1A 3ZYOA 3D85D 1TQBB 3H9SB 4N8VG 3WCYA 1YPZB 2E27H 3IJYB 3CMOH 3GSRA 5HPMB 4LSSL 3OG4B 3MOAH 1AGEA 2MTPA 3GMNA 4XTRD 5FO9A 1QVOB 4WCYH 1PZ5A 4PJHA 4JFPB 3QISA 5HHOD 3MRNB 4UNVA 4Z78A 1BVLB 2AXHA 2R2EA 3OKDA 4NGHL 2CK0H 3LH2L 5CJBA 4G3YL 4M6MH 1FNHA 2CLRA 1WAAA 2AJSH 2CRIA 2OR9H 2ZNWA 3N85H 4YQXH 3RBGA 4HWZA 5DJZA 5FYKH 3MTRA 4PJAB 3VMOA 4XBGB 3EYOB 3FO1B 5GPRA 5ADOL 1UA6H 1ZT1B 2BHZA 3QRGH 3D48R 4PJAF 3H3PL 5ILTH 3P11H 3GIVA 3QDGB 3PHOB 4PRPA 1FO0A 5EUKB 1S8DB 4DZBB 3UXFA 5IVXF 2DBLH 5DD0L 3O6KL 1LP9B 5GRYA 1C16B 4IRZL 4DN4L 3DVIA 1X5KA 2BZDA 4GRWE 32C2B 4OZFG 3FB7A 3MGAA 3QG6B 3PG2A 2VZUA 3RVUC 3OAUH 4UV4H 2XG5A 5JTWA 2P1YA 5ALBL 4KI5C 3ULVC 5MENA 4KAQL 1CD0A 4JJHA 2IALB 1JWMA 1PJ9A 1I7ZA 2KKQA 4F8QA 4BH8A 3MRPB 4LLWB 1K3ZA 1YECH 5HHMD 4JO3H 5H37G 1IARB 1RURH 4FQ1H 3Q6FA 3ILQC 5EB9A 2CKBL 3TYGL 3KYMB 3D6GA 5EZJA 2H3NB 2VSDA 3ROLB 1EO5A 4JFEE 1A7OL 43CAA 3PGFL 3TBWB 2XKSA 3QCUH 1CIDA 2AJYH 2BVOA 3AC0A 5AUMA 4H8WC 1BPVA 4EKXA 4GKZA 4HPOL 5CCKH 3PGDA 1HWGB 4Y4FD 3RIFF 4JQVC 1V3KA 1MVUA 1ZHLA 2XA8L 1M6OA 5D2NB 2VAAA 4K94H 5B8CC 1OGAE 3VFWB 2X41A 5E1AB 4M1DH 1AHWB 2IADA 2ZUQC 5IBLD 4Z7QF 3MA9H 4ZS7L 2YPKB 1NC4D 4U1LB 1QLEL 1T3FA 3ARFB 3BWAB 1UZ8B 3DXAB 4JFDA 5I17A 2F54A 4PB9L 4ZFGL 1FVEA 3H9SE 1SEQH 4OD3H 4X6BB 4JPVH 5FA3B 2KQNA 5K9KB 4XXDB 4RMQA 3FCTB 4E42B 3RVXD 3KPSD 4QRRD 3Q3GA 3QH3B 4MB5A 3QO0B 4PTUA 3M45A 4G42B 4F57L 3BPLC 3WEXB 2YPLE 3KYOA 3FRUB 3V6OA 1A0QH 3LDBB 5CLTA 3PL6A 1P4BH 2OP4H 4HZLA 2FR4B 5DRWB 4HWBL 5B38B 1WFUA 3CSPA 4G8IA 3WJLA 4DVRH 5KSBF 4WFEE 5KS9A 3CX2A 2C4FT 2F19L 3VXQA 3MOQA 1TJIH 4UDTB 5KAQF 3LKQA 3BRDA 5GGSA 2JF1A 4TQEH 2V2WA 3DHMA 4M1GH 4G80B 3RIAF 3HMXA 4WUUA 1AQDA 1EA9C 1MY7A 1S7VB 3BGFC 1QSVA 3GSWA 1OP9A 4AM0B 5ISZA 4JY4B 3IDXH 3WFZA 5DVMA 2PYFB 1U8MB 5D7LE 3UYRH 3DRQB 1ND0B 5DI8B 3DV6A 4PG9B 5F9WB 1ZXQA 2ZUWA 4JFDD 1KB5H 3MGTA 2HKFH 3TJHD 5FV1L 1UH4A 4HK0A 3JTSA 4PV9A 4WHTB 3ARDA 4HXBH 1ED3B 4YHKH 1K9TA 2NXYC 3F65A 5C07A 4RMVA 4NHUA 3F12B 1CFQB 43C9B 3NFSL 3TPUA 5CGYC 3VXUB 3X12B 4HG4K 4NKDB 1CT8A 5D1QD 1HYSC 2PTUA 1TZGH 3Q5TA 4LQ1A 5DJDB 4JFPA 4B7IA 2EXYD 3LV3A 3DWTA 4PYGA 3QEHA 1U2HA 1UB5A 2XACC 4YBQD 5FXCH 3ZO0A 2HTKD 5HDQL 3DMMB 4I0PA 3NCEB 4QOKA 4RGND 2Y36L 1CGTA 5JQ6L 3TPKA 2X1OA 5KSBE 5D2NE 3U4BL 2AEWA 3U36A 3UROR 3NZHL 3PQYE 4N0UE 1R3KA 3L3IA 5FECA 4WW2A 5IVZB 3BEWB 3MA7B 3QEGH 4L8SA 5A16B 5M94B 2WQ8A 4ZFFA 3KPQB 5C0EB 4L29B 5E03A 3D3VE 4MAYD 1RZ8B 3MRFA 4V2BA 5I66B 4MXWL 1QOKA 1CS6A 1HYRC 2QQQA 4OF8A 5I19L 1EGJA 2ZPKL 4QHKJ 3EO9H 1JRHH 2YSSB 4ONFH 4PJ5B 3ARFD 4KKLC 4I8DA 1IGML 4Z0BL 4U0RB 4PRHE 3SE9L 1EDQA 1I7RA 3TT3L 2G5BB 5CEZD 4PY7A 3KPRA 4XGZA 4XCCL 1K8DB 3BRGC 1U3YA 2IBZY 2QR0B 4C83B 2ATPB 1TPXC 4HV8B 2ADJB 1NUDA 4BH7A 1XGYH 4IOIB 4EN3B 1MCQA 3CGTA 3G9VA 4UIMB 1QA9B 4P9MH 4OF3A 1WZLA 4PRPE 1AO7D 2BNQE 2A74B 1J05B 4RCAA 2R4SL 3O0RH 1L7TH 1X5JA 4QF1B 1X5YA 2H2SD 4ZMAT 3LRHA 4ZYKB 1SJXA 3HNVL 5T33H 3VFNA 4HC1L 3BAEH 2NXYD 1P7QB 4YPGA 5CZVH 4GMTH 4KU1A 5T1DH 4LCUB 1FH5L 2XPGB 5CAYB 1TETL 3E6HA 5CBEB 4RMTA 1EMTL 3L3KB 3S37H 1PFCA 4ZUTB 1P7KA 1Q9OA 3ABZA 4LHUG 4ODHL 3GHBL 5J6GA 4X6DA 2LABA 1FBIL 3QPQC 4Y4KD 3VI3E 4IDJL 1HN1A 4JN2A 5ANMB 1DFBL 1YECL 2DI7A 1FNFA 5I1KH 1HWHB 2H26A 4JM2F 2I25N 2CO7B 3QIBD 3NAAH 1RK1A 2CD0A 3PWPE 4F8TA 4ZPVB 3EYQD 5FYJD 5DURD 1P69B 3IKCB 1YEIH 3SKJL 2KPNA 4M7ZC 1H8NA 1A7NH 2DIJA 2CR6A 5J3HD 3SE8L 1YPZE 4CMMB 2VZSA 1CLOH 1MOEA 3UTSA 5IWLA 4WY7H 2Q86B 5CEZE 1I9RL 2V5YA 3VXUE 4GW5A 4AJ0A 5E6ID 4MX7B 3CJJA 1BHGA 1HXMB 4XXCC 3M07A 5JIIA 1A3RL 4P57B 3VXME 3DVFA 1YMMA 1N59A 1T20A 3MBEC 4XVSH 1NGPL 3PV6A 3PQYD 3TZVC 3BGMA 3BPCA 4JFFB 5DHYB 5A3IC 1KTLB 5CIPB 1B0GB 4LCYA 4Z7UF 3C9NB 1I9JH 4MD5B 3MREB 4HKJB 5TE7L 4GBXB 2J88L 1MFDH 4PJAA 1U3ZA 2HFFB 1E6OH 3GRWL 5B39G 1AFVL 4ZUVB 3JV5A 3RWHA 3FQTB 5KTEL 1BOYA 1CE1L 2IANB 3O6MH 3SKJH 3JXAA 3E6FB 4PJGE 1J5OL 3MRLA 5IK3B 5SWZE 1OD7A 2J8UE 4LIQL 4BSWA 2WIIA 4LRIC 15C8L 3Q1SH 4J3XA 4QNPE 4LCCC 1JGVL 5SV4A 4N1EA 3QXVA 2P42B 4CRPA 5D96C 1KENL 3I6KA 1RUAL 1B6DA 5DA4A 5KVEH 4U1SB 2PTTA 5JIHA 5I1AA 5E8PA 4OGYH 1FAIH 4NNYA 4QRUA 1I1AC 1XIWA 4XPHL 5DHXB 1S7QA 4PJIA 2D9CA 3H7LA 1NLBL 2PETA 3LRGA 4H26B 2DLEA 1W72A 2UZXB 3TO4C 1TZHA 1EFXD 1RZJC 5D9SB 2K1MA 3JWDH 1J88A 4QYOA 4OIIL 4WNQB 2OI9B 1W0WB 4X80L 4P2OA 2YN3A 4HIJB 1U8QB 3ARBA 4JVWA 5BV7B 4TTGA 3WSQL 2BVPB 4UUJB 3BO8A 4HGWA 3FHQA 2QQNH 1IAMA 4LCWE 3QIWD 4GSDL 4NN5C 5TH2B 3RKDC 3DPBA 3F62A 1MQKH 3DX7A 4L4TA 4L1DA 5I74C 1RJZB 4WHDA 3T04D 3MROB 3QUKA 5C71A 5HI5C 4PUBL 5FYJE 5HGGS 4H1LH 3KYKH 3DXAD 5FUOL 4JDTH 1LE5B 1XR8A 4XBEL 4XRCB 1AXSB 1NC4A 3RUGB 1A1MA 1IGTA 3G6DL 1IAOB 4GW1B 2X89A 4LP5A 2PNDA 3WXVL 2BVTA 3VE0A 2BSED 3PWLA 2BOBA 3HZVA 4U1SA 3WXVH 3HE7B 5DEGB 1OAZL 4CN6A 3D25B 3W0WE 3HUJA 3NIGF 4OZFB 3X3GL 1ZEAH 5GGSY 3GGWA 1Q72L 4KJYB 1NCWL 5TGBA 2VIRB 4DGVL 3ULVD 3MRLB 4GMTL 4MD4A 5HI4C 4JAMA 1I7TB 3HS0B 4UILL 4Q0XL 1QPXA 4FXGB 5CSZA 4RRPG 1Y18B 4RAVA 5C0JA 1JYWA 3NFNA 5SWQB 4TOYH 1QBBA 5HHPA 2AEPH 1Q9KA 4M61A 5DK0B 4XPAH 2KZWA 5F44A 3QBTB 1MPAL 4YIQA 2NY6D 2YMXL 2ZUYA 4WI9A 4OLZL 2A2QT 4X5WB 2C7UB 4F7EA 3NIFE 4ZODA 3PXHA 2XRAL 2EDYA 3VGDA 4QO1A 3A6BL 5IR1B 5AYQA 3GFUA 3F7VB 5DQJB 1JPTH 2OR8A 3DX9A 3ALXA 1C5CH 1NGXA 4MJ2A 4NCC2 4OZGF 4QT5B 3SBWA 1NFDF 1S7RB 3K4DA 4UIKL 2DD8H 2O61B 3FOLA 4POYA 4NRYA 3LPWA 3WIHL 2EH7L 1T1XA 4IS6A 4JDVB 5ERWA 1KSRA 4HLZG 5DD6A 3VXTB 4MCYA 1T04A 3MJ9H 1SJHB 4L3AA 3F58L 4M48H 2HJKA 3MLWH 3KDMB 1QQDA 1YJDL 4JREB 3TH4T 1ZLWH 1KC5L 3U4BH 3MPCA 1FFPA 4P2RB 2BNRE 3TN0D 3OJDB 3S4SA 1NDMA 2N4IA 1RQ5A 4YWGH 3ARGD 5C70A 3RVXC 4FTVB 1CXEA 1OT2A 3QWQB 3WHXB 3B5GA 3BW9A 3C5ZD 3FO2A 1DQJA 1KB9J 3CFBB 5IB4B 3MV9E 5L7XH 4R2GC 3BDYH 5DMYA 2Y7QA 1R5WA 4WI4A 3K3QA 3QXDB 1CLYH 5TDOB 1A7RL 2QR0A 5HPOA 1UWXK 5DJAA 3DURB 8FABB 3CFJB 5F7UA 4CVUA 4K7FB 3O6LH 1JMXA 1CDGA 1F13A 1S7TA 4NQDD 1CICD 1R5IB 1FN4B 3ZZ1A 2KQMA 4DTGL 3VH8A 1IKNC 5F89A 4HPOH 3ZTNL 2PXYC 4QRPD 4ALAL 3MLXL 1JUFA 4P4RB 3C8HA 4NYLB 3KPSB 4QRRB 4CUCA 4GG6F 1FNEA 2I26N 2YOCA 4R3SB 5D2LF 5D1QA 5BVPH 1I7RB 3VWKD 4RAUA 4MD0A 3BE1L 1ZTXH 5IJKA 1Y6NR 5IVNA 4IOFD 3MUGA 1KUMA 3OSKA 4NKQB 1F00I 4Y5VA 1S7SA 1WSST 4MZ3A 4J8RA 2EZ0C 4P59H 2WWKT 5IVOA 1DBBH 3QZWB 3WIHA 1A1OB 3GHBH 4WW2B 5IVZA 4ZQKB 3FT3A 4YXHH 1CLZH 3F7QA 4K9EL 3TPUB 4KKBD 3V6BR 3OWEA 1YNKH 4N0CD 2CRZA 4NHUB 1RU9L 5CKGA 3QUZC 2QSVA 1MI5B 1CFTA 1U8KB 3GJEB 3WS6C 3T4AA 1ERNA 1ADQA 1UB5B 4AIOA 4F57H 1K4CB 4FQQA 2EH8L 3PWNA 3LSOA 1WF5A 5HVHC 4CBPA 3RWIB 3NCFB 2V17H 2F53D 2XOTA 1WZMA 4UT6H 4OT1L 2UUDK 2ZUTA 3GIZH 1N8ZA 4FQXC 1WQVT 2BDNL 4PJ7F 2ZOKB 3OHXB 1T21B 2RJMA 1J0YA 3IF1A 1UM5H 4OF6A 1IMHC 4KKCD 2J5LC 4KKAD 3W82A 1RU9H 4NQXA 2FIRT 2IGFL 5KSUA 4I3SL 1MHEA 5EBWB 4B7LA 1CLZL 5IG7B 2OK0H 5DI8A 2IQAB 3C2AL 5E5MA 4P4KD 3RGVD 2J4WL 5FUZH 3JWOC 2AK4B 4F80A 4HQQH 5EC1A 1KBGH 1NCAH 5HGAB 4EVNA 4JFFD 4U7KA 5E5MB 3BH8B 4OCYL 3SQOL 3GI9L 4Z76B 4LVEA 3HAEA 5GGSB 3CSGA 1JK8A 4QRSB 2KUTA 4ODSL 4Y5VB 1MREH 1KJ3L 4PJGB 4U6VH 1J5OH 2DLGA 4OBSA 4PJ9A 3W81A 5BJTB 3NH7H 1WC7B 3IFNL 1IILE 4J2XA 3VRLF 2W91A 5IJVB 4TVSa 4GXUN 4YBHA 1J9CT 4NKIL 3P0YH 1X5IA 4O2FB 3B9KA 3R0NA 4GW4A 1KBGL 3RPIB 3JTTA 4HS6B 1XGPA 3EJJX 4FRWA 1KCSH 2F53A 1T2JA 4JQVA 4YHMH 5C1MB 1CXLA 4P4RA 5LQBL 4WTZG 4AEIH 3VD3A 2W0LA 3H0TA 3TT3H 2DWDA 3ZDZF 3AY4A 4YHML 3HUJF 1G9ML 4JZOA 5C0RH 2UUDH 1R5IA 5ETUB 2GTZA 1B3JA 1CK0H 2CGRH 2YR3A 1CGWA 4MNHA 4Z7UE 3MRKB 4U1LA 1YEJH 5JIKA 5D2LE 2YUVA 1RIVH 4M5ZL 4YWGL 1A7NL 5D7JA 5I76B 1MCRA 1ZLUH 4JR9H 1P5VA 4Q9QL 4LAQL 3Q48A 4LSUH 4GG8A 5DJ6A 2V9RA 3RVWC 1EV2E 1W8NA 3QXAA 3W9EA 5E5RB 3ROLA 4R9HA 4PP1D 5C3TA 4GRMB 1AXTH 1KIQB 3JV4B 4OQTL 4NT6A 2HRPH 1PX3A 4YGVB 3RVWD 5T5NG 1I1AD 2P5WB 2YD7A 2N56A 3EYQC 2P8LB 5LWYH 2VLJA 4WENB 3BPOB 1JWMB 4Y4KB 4QHLB 4YDIL 3QHZH 4K7FA 5I8OH 4M5ZH 1KNOB 1UZ6E 4OZGA 5C6TL 2XTJC 5CZVL 4LLMA 3RU8L 3PIQB 4QHUB 5FGBC 2X70B 1GZQB 2HVJA 1XCQA 4Q9QH 3RX7A 1LP9A 5IMOA 5F9AC 4OD1H 4UT9H 3FZUD 1D5MA 1W0VA 3CSYA 3BSZH 5CBAB 3BQUD 2QHRL 3T1FB 2VR5A 4RFEA 3Q5YA 2B4CL 3QDGA 5HGHA 2FBOJ 1QZ1A 4HW6A 1ORQA 1BJ1H 1ORSB 3G6AA 4P2RA 5CJ5A 4WJ5A 3LQZB 3PL6C 2R2HB 3HI5H 2BY3A 3F8UB 4ISVB 2YN5A 4XPGL 5ENWA 1HI6B 1YNTB 2VXTH 3B5TA 3O2WL 4LASL 5D7JD 5HVFB 3TN0B 1FL3A 3MV7B 3ARGB 1LO4H 3PF2A 4HWZB 5DJZB 5CGTA 2ZCKL 4XCFH 1NLBH 3UZVB 5F1NB 1S7UA 2Y23A 5TF1H 1CF8H 4FZ8L 2FX8L 4Z7UB 4H20H 4TRPH 4PLOB 4BQCA 4NCDA 1S9KC 1Y0LB 3V5HA 4ALAH 3TCLA 2G75B 1W72H 3LPFA 5CUSL 3O41A 4IIQA 3P4NA 1RMFL 1DQLH 2F74A 1URLA 5IOPB 1AQKH 2X1PA 5BS0A 4NFBA 3KJ6L 1VACB 4G8FB 4NQDB 3VG9B 1KGCD 5B4MD 3TV3H 4FABH 3LN5A 1VB9A 2Y25A 2XQYG 5KVEL 1ODAA 3NCYP 5CZXD 4S2SA 5B4MC 3SQBA 1MCJA 1MCWM 4QXGL 1UQSB 3VD9A 3BZFA 5L6YH 5E99H 5KSVB 3EO1B 4A6YH 3KXFD 2F8OA 1OF2B 3EOYG 5KSBB 4KUZH 1G7JB 3AS1A 2MCPH 3TBSA 4JLRA 3T0AA 4IRSD 5DHVA 1P2CB 4LHJB 3T65A 4L4TB 3DX7B 3BDYL 3O8XC 5E8NB 2JELL 3GUTA 3N1PC 1IKFL 4OGYL 2D4FA 1MJJB 4BM7A 1XH3A 2C4XA 5C09D 3HN3A 1OARH 4MS8D 2ESVA 4DW2L 5E08H 5E8EB 2PYEE 2XTJB 3O11B 1W0WA 2W60B 2XZQL 4W6XB 5IM7B 1RZGB 3B83A 4KPHH 4DGIL 3I50H 3QNYA 4MJIA 2DQFA 4DGVH 5JOFB 1KG0B 4YNYB 5E24E 1Q0YL 3MROA 1TZGL 2R0KL 4PJIB 3LN4A 4DVRL 3H9SD 2B2XL 4OI9A 5HDQH 5MI0B 3K1DA 1QBLH 1RZIB 2W9DH 5IB5A 3VWKB 5EU7E 3B2VH 1K3IA 5FB8A 5JR1L 5JOPD 3IVKA 1AGDA 4JLRB 3B5HA 1H5BA 3KXFA 1KPUA 4K55A 4ZNEE 2NY4C 1F2QA 2R0ZL 5IROC 1P9MC 2YUWA 1OLZA 4MNQA 4DOHB 5ITBH 1HHGA 3WUZA 5DJ2A 4ZXBA 1U93A 1QSEE 3SKNA 4Z7WF 2X4SB 2EKJA 3A67H 3WLBB 3MFFA 1QSED 2D0FA 5DHVB 3QIWA 3RDTC 4Q0XH 4KI1A 5C0GA 3U1SH 1FNAA 5F7LB 5DVOA 2H45A 3CFKA 3PWVA 4BFGA 3W39A 3FB5A 3QQ9C 3CVHA 2ZWLT 4NWTL 2AJSL 5KSVA 5DUBB 1H0DB 3HB3C 3ULUC 1VACA 4G9FD 4U0RC 4ZAKA 1MWAB 1KJ3H 1MREL 4H1LA 1BIIB 4U6VL 4AH2A 4NCC1 1ADQL 2Y6SD 2NR6D 1ETZA 3QQ9D 1WTLA 3ARGC 4UZGA 3Q5OA 3SGJA 3M8OH 3OKNA 4HT1L 5AZEH 4G6JH 1LILA 2AKRB 2CKBA 4G8FA 2EDQA 1ZHKB 4NQDA 4RWHA 3S35L 4LSTH 1KLGA 1QNZL 3RWHB 3UTQA 5C7XH 3KWWA 1C1EL 3THMH 4IJ3B 4P2OD 4YDVA 4JHWL 4MJIE 3K2UH 5DQ9B 2CDFB 4Y5YB 2F58H 5HVHB 5CIPA 4EQ3A 5C08D 4NKMA 1DDHA 4GQPH 1IT9L 5D7IE 4YHOL 2NTFB 5D8JH 1BQLL 4DZ8B 4F2MB 4OAWA 5C09E 2G9HA 2DRUA 1XZ0B 4P9HL 4Z0XB 3S3PA 2FEEL 3CLFL 3BPLB 5CBEA 5JQ6H 3DUHA 2PCPA 2J8UB 3EZJB 4LSRH 2Q86A 4OFYA 4XPFL 3OKEA 1UGNA 4LDOB 4KWUA 4YPGB 1ZWIA 4NUGH 4YHYB 2V5MA 5EA0L 4BELD 1B0RB 4X7SH 2H32B 4HBCL 4KK6D 1NUFA 2XA8H 3RWDB 2NY4D 5DYOB 3BKCH 3E2HC 4X6EA 1LO5B 2VNCA 3S5LA 3QUZA 1DLFH 4XCCH 1GL4B 3MUHL 2A9NL 1UJTA 4RFNB 5C3LD 5MEOB 5IW1B 3IFNH 2BERA 4KK6C 5F9OL 2X4QB 5I15L 4R2GB 1SEBA 4A2MA 5FM5O 3DARA 4JFYA 2NY7H 2GUOB 3AS3A 4R96A 3VWKC 5J6GB 3MLZL 1YEHL 4XP1H 1MUJB 4NM8L 5EO1B 1X5HA 4MZ2A 4P5TC 1QFWL 4JREC 1CD1B 1GGYA 4OCNC 4Y2OA 4ZFZB 5BVPL 3L3HA 4NT6B 2VC2L 2VXSH 5I1LA 3QO1B 2WV3A 4P49A 1R24A 2XNAA 3K8KA 1DFBH 4AQ1B 5L2KB 2BHUA 1HHKA 4HJ0D 4Z7VB 1N3NB 4NQVA 3ZDYF 4NO2A 1AH1A 1HHHB 4HIIA 1I3UA 2WWKO 1Q9WA 4EN3A 1LO3H 1SM3H 5DUML 2HT4D 2IAND 5IEKB 3KPRB 4P4KC 3RGVC 4J3VA 1X5XA 5D96B 4YFLI 5DJDA 2P5WE 4NZRH 5FM8A 2ICWB 1FL6A 5DD1L 4HIHB 1RJYA 1E6JL 4KUCD 1I9RH 1C08A 4X6CF 3DUSA 3MV11 5I30L 2X4TA 4NZRL 2F53B 4KDTA 2K3TA 4E41A 3QFDB 4GRWF 1RFDH 3HAEB 3C87A 4XP4L 1NAKH 2DWEA 3BI9X 3D0VB 4LLAA 1ND0A 2RFXB 3F5WA 5JW4M 1F11B 4KHXH 4I0PB 5H37H 2X9WA 3X11A 1NGZA 4JZJA 5IKCA 4OZIB 5EH1A 3GDBA 4O2CA 1PD6A 1MCKA 4YXLL 2NY5L 2X1QA 4I2XB 3P40A 3SBWC 5D6CA 5BRZA 3WS3A 5FKAB 3QUMA 4HIEB 4HX1B 4BZ2H 4YUEL 3FFCB 1CBVL 2J7LA 5JXEA 5KW9L 3LKQB 5C92A 1T21A 1L7IL 4U6HB 3T4YA 5I71B 5E00B 4YDLB 3WXWL 1JGLL 1T83C 2DS4A 2HFEB 4OLXL 2J4WH 2Y07L 1UCBL 2FIKA 4JM2B 5BZDA 2X4PB 5FYKD 1OGAB 4QRPA 4OD2B 4WWKC 3WNOA 2PYFA 1KCRL 2ZOKA 3GO1H 4U6YB 5HYSG 2YK1L 4QXGH 1S7VA 4JANB 5IFJA 3FFDA 4NC0B 1NAMA 3MLRH 1T89C 1YPZF 1JYNA 3NPZB 4NWUH 3O6FD 4D0CB 4UTAH 2DM7A 1NMAH 2ZUUA 4U1GB 3UDWC 4HJJH 1HH9A 2GSIA 4ORGB 4QTHA 5E9DE 3IYLW 2X9XA 2H2PD 4NO0A 4ESKA 5CP3A 4OUUB 1JGLH 2BFVL 3C6SA 3S36H 1BVKA 3VFSB 3STZB 3OR7A 3EHBD 4KK5D 5C0IB 5L2JB 5HDLA 1LNUB 1FAKT 4PJXF 1OGTA 3G5VA 4AMKH 1MH5B 3L3HB 5GZND 3ZT6A 3T0XA 3OAZK 5AUMB 3KYKL 3RVVD 1G9NC 2DAVA 2GJ6D 2W65A 4PJXA 2OXGA 3B8SA 3DSFH 4ZDHA 2XTJD 5K9KA 3OX8A 2FJFA 1CGUA 1YEJL 3BUYB 3KPSA 4QRRA 4RQQA 4F37F 2A0LC 2VSCA 3BWAA 4ONOA 3HNVH 1JN6B 4KRLB 3C08L 2A6IB 4OF0A 5DJXA 5F89B 4DEPB 5HYIA 3ARTA 2FHCA 3EOTH 4N5ED 3SHSA 4P9HC 4J6RH 3LD8C 4QXWA 5K93A 1ZVHA 4WRLA 2UYLA 1UM4L 3W2DL 3MRGA 1IEAB 5E94A 1FLRL 2BNUA 3UYOD 1T1WA 4Q6IA 4K3EL 5BV7C 2NX5D 4I0PD 2Q3AA 2H32A 1MHPH 3FHAA 4EBQL 1T66D 1OSPL 3GMRB 3K0WA 1QQDB 4Y8AA 3AB0B 2FEEI 1U95B 2GQHA 2C5DC 4LARH 4DZBA 2EYRA 1NGYA 4LEXL 1MCNA 4IRJA 5HYFA 1LO3L 1SM3L 3ZE2F 1I3RA 4WU5B 1SJEA 4J3OC 3PDGA 2NXZC 5K9JH 4YJZL 4X0KB 1U8PA 1A3LL 2E7LC 3KYNB 3QCVL 1H5BC 4JKLA 1JWUB 1RHFA 3QUXD 3FB6B 3JSSA 3U9UA 1DUZB 4MJID 4KROB 5LKNA 1HILA 3QWOB 5HYJE 4R90L 2E7HA 4PRBB 4GFTB 3SE3C 2C7UA 3UZEA 4F7EB 5KVDH 5EIVA 3O6FA 4KAQH 3HI5L 2ARWA 3WN5C 4O9HL 4O2EB 4U1IA 1YEKH 2HLAB 3N1MC 4FZEL 1CG9B 3T8XB 2G2RB 4J3WA 2WBJA 2BJMH 1F45A 3C5SB 4EUPB 2EIBA 1FL5B 2YRZA 1NCBL 5C0NC 3EYFB 4DCQA 3AREB 1G6RH 1D5ZB 3HB3D 2ICWA 2CLRB 4F7TB 2H32H 4IRJD 5AWNH 4L4TD 4PJHB 3TT1L 2C9AA 1KPUB 4OLYH 2CUIA 1U92A 3GSRB 4RNRA 5B21A 2VDPH 2ERJB 1N2RA 3FQWB 3D25A 4LNVA 2OMBA 3GSVB 4LBEA 3SJVE 4FFWC 3V5KB 4H0IA 3EDDA 1IQWL 4WDIB 4YHPB 5JXAL 1XGTB 2FX7L 1UJ3A 2IWGA 4FFWD 3GMMA 5CJXC 3K46A 3RUGA 1TPXB 4WHYH 1KG0A 1AO7A 4YNYA 4ELMF 4JG1H 4DVBA 1OB1B 1YC8A 3P4LA 3WJJA 2H9GA 4FG6C 3MOAL 5F6HJ 3EOAB 3T0ED 5E08L 1AKJA 2FSEA 3SO3C 3TT1H 1MFAL 2AXGA 1IEHA 2H1PL 4YO0B 3D18B 2Y6SC 2O26U 4EDWH 4E0RB 4JG0H 5DJ0A 1INEL 3O2VL 2ESVB 4M7KH 3SDAA 1ZLSH 5DO2C 4N9OB 3B43A 4Y4HC 1SEBB 4HMCA 4DGYH 4OLXH 3KJ4B 4NSKB 4XCEA 4C56B 3DYOA 1YQ2A 4HXAL 4MNQE 3HTLX 1P4LB 4ZNEA 1XIWB 5E2TH 2ICWJ 3BVNB 2YRPA 3MRDB 4TSCH 4X7CC 1OAZH 5GS0D 5C0ND 1B88A 4LLDB 4NJ9H 3EO1A 2P45B 3R8QA 2VLRD 3S6CA 4XPTL 3EO0B 3LQAC 2AJVH 5FGRA 3H6JA 1IGJB 3P9WB 4OF7A 4GBXC 3IS1X 1CGSH 4I18C 5E94B 1P4IH 5DJCB 4HF5L 4JG0L 4XPTH 1EXUA 2OCFD 3UO1H 2XA3A 4P3WA 4HQQL 2R1XB 1DN2A 1PSKH 1C5CL 1G7IB 5E2TL 2NW2A 3OKOA 3ZYJA 2R0WH 4JZNB 4RX4D 2EH7H 5F7MC 1U91B 4ZDHB 1LQSR 4NJ9L 1N59B 1IAIM 4WV1A 3O9WD 4PGZA 1GIGL 3FAWA 1MFCL 3OTTA 4IJ3C 4J4PC 4PG2A 4MX7A 4M00A 3EYUL 1HI6A 2D7MA 4ZXBD 2J8OA 2XQYK 4HJGA 3LEXB 1KPVA 4YC2B 3KR3H 2X4NA 1YEGL 4I48A 1I7UA 5TE6L 1DBJL 4LLQA 3H3PH 1MJUL 3IDGB 5CBAA 1IQDB 3J7HA 1KACB 4G43A 5LQBH 2GK2A 1NJ9A 3QCTL 4C56E 2X2YA 1T22A 1PLGH 1A1NB 2E8YA 4GAYB 4WFHE 3TIDB 1U8NB 1DSFL 1QLFB 4MQXC 5FK9B 2FB4L 1EEUA 3FMGL 3LIZH 3RAJL 3U7WH 3TH3T 3TBYA 1G6RA 1LDPL 3FQUA 1K6QH 4EDXB 4LSUL 1N64H 5GQBA 3HMWL 2BY1A 3U7AA 1D6VH 5C9JA 2OR9L 2VLKD 2K7QA 2YD4A 4U1KB 4YQXL 3NCJH 2AV1B 5D7IF 1U9KA 3LKSA 3WFCH 1G6RL 2FEDC 4WU7A 4U6HA 3MRHA 5IW6B 3B9VA 1LE9A 3MLTA 1E28A 4LCUA 2OJEB 1YA5A 1TZIB 2DLFL 3A6OA 1NAKL 2X1XR 1QA9A 4KVNL 4O5LL 4X7EC 5D7JB 4LSQL 5F7DA 1LO4L 3UBXI 1YYML 4YR6A 3P0VL 5JHDE 5IVXE 1QRNE 5GXBB 4ZG1A 1UC6A 4UV7H 5DD0H 3RWJB 1KIPB 5DVKA 4ZSOE 3ULUE 3VXMA 1OW0C 1M1SA 3DI3B 3ALPA 4FQCL 3X11B 4E5XB 5DS8B 5HGBA 5JQHC 1MJJA 5FOJA 3X3FH 4U3XA 1UXWA 3IGAA 2AEQH 4Z5RB 3IDXL 2NW3A 3RTQC 4Z7WE 3E8UL 3TBSB 1GGTA 1C5BL 4XCNA 1I3GH 2K9UA 2QSCH 4Y2DD 5FF6A 1UACL 4L8SB 3O2DH 1L7IH 1YN6B 3RTQD 3T8XA 1LMKA 1U8LB 1G7QB 3ARRA 2OL3H 3T0DA 4JO4L 1B9ZA 2JIXD 1N7MH 4PJGA 4MJ6B 3ZKND 1OTTD 1RZ8A 3IJSB 3MRFB 2YD3A 4YX2H 2ZCHL 6FABH 1KIPA 1V05A 2JKXA 5I6XB 2W07A 5DRZB 1UB6B 4Z7NE 3L3IB 1FZMB 1R5VA 1U8OB 2UWEF 4JO2L 3Q6GL 3TEUA 3BH8A 1NCAL 3LD8B 3ARBD 3ULSB 3CZJA 5D1ZC 1UM5L 2EYTA 2XY2A 2VZ1A 3TC9A 1A7QL 4GXUM 1NFIA 35C8H 5J6HB 4WUKH 2Z91A 2BNRB 4KY1L 3L7FB 1FRGL 4FTVD 2Z35A 4XVTH 3BDBA 4HJJL 3U9PL 3P4OA 3KPPB 4I3RH 5KSUB 5C9JB 1JWSB 4UNTA 4GKNB 5EPMB 1G7LA 1TTGA 3ARDB 1G6RB 5SX5K 3V4VL 2VDNL 1S9YA 3MJ7A 5D6DC 3WNKA 4OLVH 5CZKA 4X8JB 5I1HH 2R1WB 3SE9H 4DFHA 1GZPB 3O4LA 4AEEA 4H0HB 1JCKA 1HNGA 2B2XH 3TF7C 5E1HB 2HLFC 3LB6C 3JUZA 1W0VB 2OI9C 5J89A 3BN9D 1LEKB 3U0TB 4N5UA 5FCUH 1F3JB 4YFEA 1A4JB 1ZOXA 3NA9L 3FL7A 5GS2D 2ICES 1U3HD 3S7GA 3CVHH 1T2QH 5F9WC 1M7DB 1KCVL 3JWOL 4MA8H 2YPLB 1X5FA 3L9RB 1NCUA 4L4JA 4ZUUB 5IB2A 2FJHA 1S78C 4KTDL 3D5OF 1NBYB 4PJ8C 1BF8A 3PQYA 4M1GL 5FA4A 4AG4H 3SDXA 4U1JB 3OAYK 3U7YH 5TFSH 3G6DH 1M71A 3HC0B 4K3JH 4NN6B 3IU3A 4YGAB 2FX9L 4JFZH 5GISH 5IUSA 3PL6B 3GMQB 1ZT4A 3WHE1 4GKNA 5EPMA 5DQDH 5DFTA 5IBLC 5DMIH 5DQ9A 2X7LA 1ADQH 3RP1A 1UADC 3UZQA 2ITCA 3U0WH 1MCWW 4HBQA 4EN3C 2E9IA 1B90A 4PJ7E 2JIXA 4RRPA 2AKRA 2CKBB 2FD6L 1YQVH 3VFWA 5D8JL 2NXZD 5I17B 1T66C 3QDJE 7FABL 5B8CA 2JE8A 4NQTA 1INEH 3O2VH 3SDCD 3HI1A 4PD4K 1ETZB 1A6AA 5A2IH 1ZANL 4NC1E 1EIBA 1BD2E 3KPTA 3G04A 1PX4A 3T3MF 4PG2C 5EOQH 4R4BA 2NX5B 4NQED 2HTKC 2A77L 3MLWL 3W39B 3WLWC 1M6OB 5D2NA 4HS6A 4X6CE 4TVPE 3W11D 3GSUB 2B1AL 2QQLL 3U30B 2E7LA 4W4OC 1KCLA 4FTVA 4L4VB 2J5LB 3GMPA 5GHWH 3PUCA 3DV4B 5BVJB 2BVOB 4NP4H 4ZXBB 1WCQA 4ONGH 3PDDA 4KK8D 3W9DB 1Z0NA 4I4WB 4NOFA 1NUNB 2AEIT 4UQ3B 4ZUUA 3WIHH 5EOQL 1JF1B 3ZKXB 5IB5B 4YK4C 2P43B 2B8OT 2VL5A 3QCTH 4BKLB 5I8EA 4I2XA 3V52L 4L3ED 4P48A 5ITFA 4P0DA 1NGXB 5DC4B 5E95B 5TPWH 4YR6B 1AGCB 2AK4A 2BSTA 5IKCB 4OZIA 3LN4B 1FCCA 2RFXA 3F5WB 1HHJA 4N0YL 2AK4E 4KXZI 32C2A 1PKOA 3QSKB 4LPWA 5FOBA 3CFEA 4L8BB 3DVGB 3BP4B 2YD6A 4K23L 2ORBL 3U4EB 3MRJA 2IF7A 4X7TA 2DN7A 4X5XA 4QXTB 1I8KA 3RL2B 3WL9B 3QIUD 4XP6L 1CL7H 3SGKC 4N8CH 2ARJB 3P4MB 4JPKH 1WBXB 2IH1B 4QY8B 5JHLH 4JFXA 2GJ6A 3NABH 1TENA 4U49A 3L1OH 1IGYA 2EYTB 3C6LC 3MGOA 5IEKA 4XPFH 3TLRA 1XF5B 1CZ8L 5DWUH 4R7DA 4ODTH 4IDLA 1QR1B 4OV6F 1IFHH 1CR9L 1RZFL 1MIMH 1KGCE 3KPRD 1YUHA 2OTUB 1NCNA 2JK5A 3G9AB 4LLQB 3HHRB 4NNXA 2HTLD 5IFHH 4DGIH 4LPYA 4HKXA 3H9SA 4JFQA 3SDCA 2XQBL 2APBA 3BFOA 4NNXB 3RDTD 5C6PB 4HJGB 1NCDH 2XXCB 1YN6A 3QIBB 3KLHC 2JTDA 2X4RB 4PJ7A 1RFDL 3CIQA 4DW2H 5KJRL 5DURB 3QUYB 1P1ZA 2DL2A 1WFTA 5K9OA 5JW4Q 3RHWF 5I73B 4XMLL 2C3VB 4Y16D 3SCMC 1CE6A 1CXHA 1I8IB 1HIMH 2PXYA 4XAKD 4Z7UA 4M62H 3WJJC 1JI2A 3ZTJH 1KB9K 2HT2D 2EEAA 5J1TC 4U7SA 1MY5A 4FQIL 3ZHLA 4A6YL 4UT9L 2DMBA 3QUZB 5E9DD 3TN0A 3SDXE 4OIIH 1HSBB 3GKWL 2BMKA 4Y5XB 5ESQA 1VESA 1CTNA 3PDOB 5ENWB 2GFBB 3IDJA 3IXAA 3VXOA 1RD6A 1OPGH 3ULVE 1HH6B 1IT9H 2HJFA 4ZAKD 3B2VL 3CFEB 4L8BA 4G8GE 5C8JA 5DZOA 1AR2A 1MCHA 4JDZA 3FO2B 2DYPA 4ZTPH 1HHJB 1G9EA 3JWNC 5J12B 2FECI 1I4FB 3VGEA 3SKUD 4F2MA 1MLBA 4KI5E 2ZCKH 3E1F1 5E2VL 1FZOB 2I60L 2P8PA 1G9NH 1A6WH 3QDME 3L3OB 1LP9F 2FLRT 1JGVH 1LEIA 3V6ZA 5IIEA 2I60H 5GS1B 5KANG 5FK9A 5C0CE 2DMKA 4KQ3L 4PJCF 2PW1B 3RX5A 3C2SA 2DI9A 4J4PD 2OK0L 1DJSA 2W0FB<