5I8KH

Hhh1 fab fragment
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
218
Chain Sequence
b'EQLVESGGGLVTPGGTLTLTCTASGFTISNYHMSWVRQAPGKGLEWIGFIDTGGSAAYAPWAKGRFTISRTSTTVALKITSPTTEDTATYFCARGAPAWGTANVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDRRVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HHH1 Fab Light chain
molecule tags Immune system
source organism Homo sapiens
publication title HHH1 Fab fragment
rcsb
total genus 40
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8kH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8kH01
4LIQH 2CR3A 2B1AL 3OKEA 4S0TD 5CZVL 3IETB 1U95A 2AK4A 4YC2B 4W70A 2G9HB 1UKTA 3P4OA 5EUOA 4ZSOE 2J8UB 1UYWH 1KLGB 4FFWC 5FDWB 4AM0A 3QDJB 2VLRA 5ACZA 3MFFB 4UT6H 5DWUH 4XHJD 2X1XR 1RFDL 2L0DA 5D7SL 4LCUA 4L8BB 3LKPB 5HYIA 4OFYD 4Z7VA 1JIBA 1NAKL 3LKSB 2R9HC 1UG9A 4LLMB 4ODWB 4KGJA 4PJ9B 1OTTD 5HYJD 1I7UA 4OLWL 4PJ7A 3S35X 4WEUD 1KCVH 4U1HA 5I8KH 3LV3A 5FCSH 3V5HA 1MCJA 2YUZA 1YYLH 4GG6A 3BSZH 4LSSL 5J6GB 5D7KE 3T2PA 1WUNT 4APQC 4Z7WA 1J0HA 3ZYIA 4XZUA 3W0WB 4U6YB 2VDNH 3IKCA 2Z35A 5A2IH 2HFFA 4FTVD 3L3JB 4G43A 4MQSB 5D7JA 4RGND 4ELMF 1UT9A 1DDHB 3DSFH 5SX5K 1I9JL 2OSLA 3VI4E 4PG2C 1LILA 4FQ1L 5E99H 3QHFL 4B53A 3JV5A 2D7PA 2ZCHH 3IFPA 5KJRL 4K9EC 5GSRB 1DUZA 3ZDXE 1U36A 4K7FB 3QEQD 1R3LA 1NCAH 3E3QC 1QFUL 4N9OB 3FT2B 4UDTA 1T22B 2NY4B 2ZP0T 3RWGB 5DDHB 2C4XA 3WMSA 3ETBF 4J1UA 2QKIA 5IMLA 1OOAA 3MBEC 2MCPH 3DX7B 3T2NH 3CVHH 3HG1D 5I1EH 3EOBA 4NC1C 4PB0L 3WFCH 4ZAKA 4FHBD 4ZYKB 2MTPA 3CFJA 3VI3E 4FQ2L 3OKDB 2PW2A 3H3PH 5CBAA 3X3GH 1NGYB 5BZWB 3QUMA 5GSVA 1AXTL 4OLZL 5GGTH 5F3HB 3BZ4A 4DCQB 3P9MB 5GXBB 3RZCC 3GSRA 2VLJD 4TSBH 3QXAB 4QT5B 1OAUL 4RZCB 3V5KB 3ZKXC 1KJMA 4PJDF 1MAJA 2CXKA 2I07B 4KKAD 5DJXB 2YR3A 3MBXL 43C9B 5FO8A 3O6KH 1JYWA 4JQIH 4OLUL 3OKDA 4XBEH 4LSPL 3U9PL 4DVBB 5GGTL 2I60L 1AXTH 4OLZH 2X4RA 3V8CA 1ED3B 3P40A 2XZCL 3QFJE 3RHWF 1PVHA 1MCEA 3L5HA 3BGMB 4J4PD 1OAXH 3J7HA 1YEEH 3TBYA 1ZA6B 3UYRL 4M48H 4OZGA 3REWA 1P7QD 43C9A 3VWKB 1KYOJ 2PYEA 4JFPB 1EERB 1NCDH 1I3RB 5IK3A 2PYFA 3QDAA 4LQFH 5GHWL 4ZFZB 1CFNA 4BSJA 4HPYL 2XZAH 3SE4A 4MJIB 4J7RA 1X6NA 1FPTH 1JHLL 1DQLL 5KJRH 3JXAA 5CWSA 5TQ2H 3O9WD 1IEBB 5HHVH 5FGBC 1T89A 3WN5B 1QRND 4XPFL 1OGTB 4JFYA 4PY8J 5D7IB 2J5LB 5T1KA 3SQBA 1I9JH 4HKJB 4MCYB 3UZQA 5DJ6A 5GISH 1KSRA 4O9HL 2AJZB 2VDNL 3VXSD 1JWUB 4YX2L 2JIXD 3MMEB 5DJZB 2EYSA 3UBXB 5C9JB 3OG6B 4PJIB 4HKXA 1EJOH 3JWOC 1LK2A 3DV6B 3HE7C 4LRNH 4C56D 1GJIA 4OCYH 2VXTH 4HXBL 2C1PA 4CNIB 1HH9A 5GISL 3BO8B 3DHMA 1I7RB 4N0YL 5FM8A 2NQCA 1MCQA 5IHUL 4L29B 4WI7A 5IB5A 4Z7OF 4JDVB 4MAYD 1SY6H 3VGGA 3CH8A 5DJYA 4MNGA 3L3HA 5GPRA 1IEAA 2RCSH 3E3QE 1ZVSB 3GUTA 3ZDZE 2XZAL 1QNZL 1G7JB 1NCCL 2YD3A 1ZHNA 2EICA 2OMBA 3LS5H 3NPSB 3U30C 3V5HB 1HKLL 4K23H 5ISZB 4JRYE 1RUPL 1FVEB 3CDYA 1H3VA 1JYVA 4YBHA 4NKMB 4KRLB 3CLEH 5DLMH 4LCYB 5IV2A 1T2QH 2VQ1B 2K1MA 3ZKXB 3N1GC 1RIHL 3LN4B 1K4DB 1MEXH 2WBJB 3G5ZA 2FBOJ 3RPIA 2Y23A 4XNZB 5ANME 5MENA 3H0TB 3WSQL 3QI9A 1UEYA 4M3JA 2YMXL 1HH9B 4I3SH 2V9RA 3U7WL 5FXCH 5DHXB 3TH4T 4R96B 3GSNL 4QKXB 2RR3A 3ZE1F 3MBXH 4F7CB 1AQDB 3QRGH 5MHSE 5L2KE 3SOBL 3VWKC 5GGSA 2FLRT 2N7AA 4TSBL 2P7TB 1ZHNB 3RWCA 3P0YL 1W72B 5K9QG 2YKLH 1HK6A 1R3IL 1VGEL 4NFDA 2RB8A 3GMLB 1NDGA 3DHJA 3VMOA 3L3KB 3RVVC 1KCUH 4UTBH 3IJHA 1GPOL 3V4VL 1BGXL 3HZVA 4HWUA 4PS4L 3D69B 4MD4B 3D2UD 2R0KL 5HDLA 5EH1A 1H15B 3PGFH 1RZJC 4N0FA 3ORJA 4LLDA 4PY7B 1X44A 3QDMD 2DQJL 2D03L 3PP3K 4MD5B 4MZ3A 2WIMA 1MCPL 4LLWB 1JMZA 4NKDA 2VZSA 3NBNA 3PWNB 3K2MC 5DFTA 5MI0B 5DVNA 1MJ8H 5C6TH 3W9DA 4PGDB 3O6MH 2VUYA 3U0PB 1P6FA 1OGTA 5GRWA 3ZSTA 3DGCR 3NIDE 1FLRL 2EEDA 2VNCA 5C0AB 1IGML 1KIQA 4APQA 4YPGB 2W60B 5E5MA 3GMLA 3AAZB 1H5BA 3AREA 4NM8L 1EEYA 4UB0L 4H8WC 1XZ0B 4UV4L 3BSZL 5E2VL 5L0QB 5IVNA 1KJ2L 1W2KT 4K7PY 1DEEA 1FSKB 3MRMA 5JMRA 3L3DA 5CD5D 4PJ5B 4HK0B 4QTIL 5HYQB 1ZT7A 5DK3A 2HN7A 2IALA 4JFDA 5TF0A 4WW2A 4YPGA 4WFHD 2XTJB 5FF6A 4KRPC 2JK5A 4GO6B 2ICEB 4WW1B 1AE6H 1A6TA 2YSSA 1IC5H 1P2CB 1HIMH 2A9NH 1ZHKB 1DQMH 5EUKA 1T1ZA 2DQUL 4L4JA 5HYFA 1JZ3A 4JZJC 3SDDC 1WFNA 4NQEE 4OGAC 4NKMA 2QQKL 4YHIB 4KKNA 1UM6L 1FFNB 3VU2A 3PHQB 1OP9A 5F1OB 1ITCA 5IKCA 1VFOA 5L8JB 2IPTH 4NJ9L 2AEPL 3GUTB 2X42A 5C8JA 3QSKB 4BK4A 1TZHB 4ENEC 1Q94B 4WUUE 2IJ0C 3RRQA 3UJJH 2NZIA 4DN3H 4IEFB 1P7QA 2R56L 3D1MC 5CBAB 3QNXB 1CFVH 2PKDA 3T4YA 2NLJA 4L4TD 5DO2D 2W0PA 1RJYB 5A43C 1OT1A 4G6FB 4U6XA 5EU7E 1I8LC 3FQUB 1XR9A 2B2XH 2EC9U 3TYFA 4HT1L 5EO1B 4PRBB 5FUCE 3P4NA 2VH5H 3ARUA 3NMEA 5IVOA 4FA8A 4O4YH 4LOUC 3LS4H 3QA3B 3K3QA 5D6DA 1E6JL 1KPVA 2VISA 5HHOE 1T04B 4XP6L 4MJ5A 1DDHA 4FTVA 4HZLA 3FT3A 3DRTA 4DOHE 1A6VH 2FATL 3C8KA 4QRRE 5DD3H 3SJVA 5E1AB 4MB5A 4IOFD 3TA3C 2BRRL 1HN1A 3DUUA 4AEIL 4M5ZH 4HMEA 5GGVY 2NPLX 1BEYH 4PJGB 4FXLA 1BOGB 1LQSR 1IC1A 3IJHB 3SE4C 2VDKL 2X9XA 3DVFA 4O58H 2V2TB 1ZT4B 4UUJB 1VFBB 3GGWA 3QIUA 1N3NA 4NNYA 2AK4E 3O45B 4M5YH 3BW9A 4NP4L 4M62H 2X7LB 3QCTH 2VISB 1FSKC 3LKNB 2I25N 1Y6NR 1FNGB 1NLBH 3HMWL 1HXMB 2ZKHH 2KZWA 2HWZH 5FGCE 3WDHA 2ARWA 1P9MA 4N8VB 1BFVH 4WWKB 2APTA 4PRBA 4DKEL 1S9YB 3MV9A 3P73B 4YFDB 1VEMA 4NIKB 1OAKH 1W72H 5I0DA 3OJ2C 5DUBA 4OF6A 4EJ1C 1JPSL 3MNZA 1H3PH 3MV11 1YECL 5E8DH 1HHGA 4FFYL 1NCBL 5D7LA 1S7WA 4OCXL 1LDPL 3MMEA 3LKPA 4C56E 4PREA 5LGHH 4PG2A 5J57B 4WJ5B 3VA6A 1CDJA 4AT6A 1ND0A 1INQB 4E0RB 4NYLB 3DV6A 3CNKA 1FL6B 1LD9A 1J5OL 2YPKB 1C5DA 2Z8SA 1N6QL 5BZWA 4PTUB 5IHZA 3O4LE 3LPGA 2P43B 4I0PC 4APQB 4MJIE 4PJ9D 1ZHKA 1BLNB 4PJXF 4F9PC 4QCIA 3HAEB 1HHIB 2QQNL 4O2EA 4MNGB 3I2CL 2DD8L 1II4E 1JRHL 4LRIC 5D2NB 3LQZA 3CLFL 1AR1C 1CDIA 3WO4C 4P46A 2P5ED 1A6TB 4HJ0C 3ZT7A 3RWFB 3IU4H 5D1XD 4QRTA 1IL1B 3MLWH 2D31A 1WSST 3B8SA 3W11C 1BWMA 4R8WH 1B4JL 4JR9H 5EO0B 3CX2A 3CXHK 3QWQB 4XP4L 1KTLA 1YDPB 4Q97A 2XN9A 3IVKA 3MJ8A 3U48A 2F58H 4P3CL 2Q76A 2Z4QA 5CGTA 3SCMA 1VDGA 3OPZH 4RWYH 4AENA 3GMRA 5TDPA 1KJVA 1EZVX 2I9LA 1MRCH 5AD0B 2QSVA 4IHOA 3DIFA 1JPFA 4MGXA 2FYYB 3ZL4L 2E7BA 3GJEB 3GMNB 3O2WH 5C0BB 1NBZB 2VERN 5SWZB 3G04B 3IB4A 3W2DL 2JIXA 4X7DC 3QUZA 1IKNA 2W9DH 3EBAA 1YDPA 4ZS7L 1U3HA 4YAQA 3TFKD 1SJHA 4RGOH 1HNGA 2DLFH 3VXRA 4KVNL 1I9RL 3NACL 2X41A 5IQ7L 3EJZC 3MA7B 2VZ3A 3STZB 4PRAB 4DAGH 4WEMB 3ZKMC 1W0WA 3LQMA 1KLUB 2CKBH 2ZZUT 4LLWA 3VWJC 3M07A 1BIIA 3ZE2F 4JPKH 3S36X 3IDIA 1G6RB 3EGSB 1FBIL 1QYGL 1FBIH 1QYGH 2AK1H 1OW0C 1HH6A 3FQRA 4U7SA 4KQ3H 1B0RB 4X5WA 1FCCA 4OTXH 1ZLUK 4BH8A 3RZCB 3HCVB 4D9QE 4NQXA 1MIEL 3OSKA 1T7YA 4KTEL 2AK4B 5BJTA 1OARH 2NY2C 2DLFL 5KAQG 4E41B 3SY0A 1A1NB 4QNPE 2IPKB 4OCWL 2IANB 1DR9A 3E8UH 1HI6B 3UTSA 3FQRB 4XCNA 1ZGLM 3GGWB 3QIUB 4GUPA 3VFUA 4U33A 4UDUB 5IVXF 2B1HH 2YBRA 3L6FA 4LSQH 3D87B 4BQ6A 4WFED 5M7QA 1XF2B 4BH7B 1R3HA 5GS2H 1BVKB 4RGNE 1W0WB 4Y4HD 4B50A 1R0AH 3WN5C 5A1AA 2X4UB 2YXFA 5AAWA 5I15H 2XRAH 4PJ9A 2LU4A 1RU9H 1YMHA 2R1YA 3B9EA 4YQXL 2XWTB 1DBMH 2CRMA 4JDTL 3TO4C 1LVEA 1OD9A 4IDJH 4UQ2A 3W0WA 3HKFA 1H0DB 3CFBA 4Q0XL 4BFIA 4FS0A 3VE0A 3WO4B 4AL8H 3OKLB 2H32B 1UH2A 2IH1A 3EYQD 3IAQA 3H3KA 4UTAL 4LSRL 4JKMA 1KN2H 1FZKB 1Z3GH 4P49A 2J2ZA 1UA6L 4K8RL 4UQ3A 5EZJA 5DJZA 1NUGA 3HMXA 3SBWA 3CFKB 3B6SA 2Q3AA 1V7NH 4D8PA 1V05A 2DD8H 3I2CH 1BVZA 4D9RD 4O02H 2GSIB 2C4FT 5TH2A 3TYGL 5C0GA 1BX2B 4NQCD 4BSWA 3MRCA 5BVPH 2DMCA 3KJ4C 2NY3C 3MV01 4XX1E 4LFHD 4XNYH 2DWDB 1VFMA 3OB0K 4PJEE 4YK4B 5I1CH 5IEKA 2RGSA 2Y7QB 2RQ8A 2X4OA 4OZHE 5EU5A 1KN4L 3OJMB 4EDXA 1MQKL 4JEGB 4RA3A 4M1CD 3AY4C 3VCLB 3F8UB 4FZ8H 3C5ZD 4NC2B 3PWLA 32C2A 1G6RH 4KXZI 1JF1B 2HT4C 4PR5B 4ZNEA 1U93A 4G6KH 1FNEB 2FEDD 2LU7A 5I2IB 1CDYA 3KPRB 3QULB 5E6ID 5FO8B 3FONA 3VD9A 3ARFD 2ZG3A 4YDIL 1UKSA 4ISVA 3BZFB 2EDQA 1S7QB 3VI3F 4NQCE 1EAPB 4RFNB 1J11A 2ORBL 1CTNA 3QUMH 5ILTL 4KTEH 5IVZA 2NY7L 3QCTL 1JGEA 4FOMA 1J1PH 3B5HA 5FCUH 4GAFB 2NY2B 4TUKL 1QLRA 2BZDA 2VDKH 2BHUA 3EYUH 4I48A 2GIYA 3QIUC 1KJVB 3EO1B 5DD3L 3RVUC 1N6UA 3C5JA 3TBYB 5JORA 2WWKO 4K3JL 1FGVL 1U8LB 5DMKA 5B3JE 1R3JB 1S7SB 2FSEB 2PNDA 4CVWA 2PYEB 3CSPA 3QCVH 3QUXD 1QBLH 3FB6B 2ITDA 1ED3A 5I16B 3K2UH 1TITA 2HT2C 1AD9B 2CLZB 4JKPL 2YK1L 4ODXA 1MI5A 4TNVF 4HWNA 4PJBE 1N59A 2JJSC 4ZPVB 2NX5A 4Q9QL 1YEFL 4KU1A 5D2LA 3OG4B 4CDGC 4RMRA 5I18L 5I66B 1HYSD 1LK3H 2HLFD 1L0QA 2X1PA 3PWPB 4DGIH 1CLOL 2HJKA 2OL3H 2E9IA 5FYLH 5LGJA 1LEKA 2BVQA 1ETZA 4M7JH 2EH8H 1KC5L 1T7WA 3BKCH 1BQSA 2H32A 1Q8MA 1FC1A 4HUUA 4PRPB 3HPLB 4DUXA 3V4UL 2DDQH 1YEGL 3PV6B 1G7IA 3RWJA 5E56A 1NGWA 3VFMA 3FB7B 2ZWLT 2MMXA 3D48R 4I0CC 4YK4C 4A6YA 1X5XA 3IDJA 1JRHH 3GSQA 5DDHA 4KTYA 3SDXA 3S34L 1FG2B 1CLZL 1HHHA 4AEEA 1N7MH 2EO9A 3VD4A 3TIEA 4KI1A 1DUZB 3QB7C 3ARGC 2XWTA 4Z77A 4GQ9L 4MB4A 3VFGL 2EKSA 4R26L 2GTZB 3LSOA 4YXKH 2UWEF 5IBLC 3QQ9D 4LCYA 2DIJA 5HDOA 5CBEA 2HH0L 4G6JH 1MRDL 2B5IC 5JHDE 4WI5A 5E2WH 4JY6B 2GSIA 4KJQD 2DS4A 1Z5LB 2EECA 3HUJB 3MFFA 4OCNC 1OTUD 3FCTA 5ESVB 1ZA3B 2DIAA 3S97C 3GSUA 2HT2D 5J11B 2Y6SD 5ETUA 43CAB 5IVXE 1FFPA 1HHJB 4X6DA 1VFAA 4K94C 3SO3C 4B7LA 2V2TA 2Y36L 2Z35B 4KRPD 1IAMA 4LKXB 3I6KB 5T33L 1DEDA 3FOLA 5IMOB 4M6ML 3STZA 1W8NA 3D18B 3EYSH 2CLRB 5I9QB 2IADA 4MAUL 1LO0L 5K93A 5IB2B 4KRNA 5E5UB 1BQHG 3OZ9H 1RUMH 1J0KA 3M17A 3VWKA 4OKDA 1JPST 4GH7B 4TSCL 1S5IL 3LKQA 1LE9B 1URLA 1OCWH 3O6FC 1F13A 2WBJD 3MXVH 1PKQE 1CS6A 3U4AA 5C09A 3QUKB 4A6YH 1AKJA 4EN3D 5IWLA 4PRNA 2AJ3A 2ZUSA 1IQDA 2F8OA 4LCIH 4F7EB 1CVRA 3AB0C 3ZDYF 1CQYA 1DQJA 1CWVA 1JYNA 5GGVL 1A9BB 4PRPD 2F53A 3MRJA 1KFAL 4POUB 3S35H 5JQ6L 4KTDL 4RAHA 3T8XB 5JDSB 2DL2A 1S5IH 2YKLL 5J9PB 1YMMA 1EHAA 3UJTL 5C0NC 4R4BB 1U8JA 4U6HB 1K4CA 5I1IL 4MA8H 3MCLL 4GLRH 2FDBP 4HCRA 1A7RH 2PTUA 3ARDC 1F3JB 1H15A 1I8MA 3PP4H 5FUZH 2B0SH 3CAFA 4ELMA 3T3ME 3DX6B 2UWEB 4NZRL 3RWEB 3MV8B 5IQ9A 3SQOH 4YWGL 5IB3A 3BEWB 1H3UA 3T0EA 5BV7B 3QXWA 2V7NB 5D5ME 1AD0A 3VFTB 4LEOB 1BFOA 2ZOKB 1QR1B 2XPGB 1VFUA 2CXGA 1EVTC 3CMGA 1QRNB 4F7EA 2AEPH 5I6XB 3FO2B 3SGJA 3QI9C 3V0VB 5C08E 4PJAF 3T0BA 4NRZB 5E2WL 3RBGA 3ARGA 3VRIB 5C6WH 2HKHL 2ESVA 4LEOA 1JN6A 3LS5L 1AXSB 2QV2A 2FYYA 5MEQB 1DQML 5F9DC 4HQQL 2W0FA 3INUL 3AUVA 4G9FA 4JHBA 2FCBA 3CCHA 4IRSC 4U1KB 1YEJL 5E7FA 1FZOA 2P8LB 5MP6L 3OKMB 3BIBX 4WY7H 2DM2A 1DQTA 4XCFL 5CSZA 1FN4B 3HAEA 5CJQH 4CMHC 1T0NA 1DSFL 3V4UH 4WFFD 2J6EA 4UNTA 3TGXA 2XV6B 1OSZB 3WHE0 1P7KB 1F42A 1DVFA 4JAMB 1CU4H 2WMPA 1XH3B 4P46B 1AH1A 1MF2L 1QQDB 2YUXA 4HCRH 5AWNL 4PJ7F 4JRXD 4JQVA 5DD5L 4LAQL 1DN0B 4Z7NE 4YE4L 1DBKL 1NBVL 1OT2A 2EKJA 4QXWA 4JFED 4H5SA 1Z2KA 2RFXB 4JG0L 4JKPH 1QFWH 3VD7A 1MCHA 3QH3A 4V1DB 3IFNH 4GKOA 2AERT 3FAXA 1WAAE 5FYJL 3WD5H 3EJZD 4MWFB 3KYOA 2DQTL 1OM3L 1WT5A 3DURB 4I0PD 1BFTA 3EOBB 4A2LA 1P6AB 4IRJD 3PIQB 4PJAA 1R5IB 4DWHA 5DVLA 5EZLB 1YMHB 2R1YB 4R7NB 2IBBA 3QEQA 3QFJA 3KS0J 1MAKA 1A6UH 1A3RL 1TTFA 4S2SA 4OKVA 4D9LL 1QVOB 1BGXH 4NNYB 3NCMA 3VWJB 4JDZB 2EYTA 2RHEA 3IJYA 1KCUL 1E4KC 5AZ2H 5I8EA 5D2LB 3WIIL 3IDYB 1MFDH 5DR5H 3T3MF 3EOAA 3OMZA 1NFDF 3P9WB 4M9PA 4RGNB 1U8NA 1K4DA 2WBJA 2DN7A 3AFLA 4FTVB 4UINH 3WFDH 4Y4HB 1IGFL 4OD3H 3HAEH 2OJEA 3BXNA 5FOBB 3ZHKA 3NH7L 2ZCLL 1AI1L 3TJEL 2J6EH 2XKNA 3BQUC 1U95B 4LP5A 4WHYH 2AJYL 4QOKB 3KYAA 1BQHA 5CJOL 8FABA 4FG6D 5EPMB 5HHXL 3LVEA 4JM4H 5D5MB 3R8BB 1C5CH 1MUJB 2FBJH 3SDXB 5F9WB 1G1YA 2MJWA 4WI9A 2CO6B 4HPOL 5JPMB 1A5FL 3VGDA 5KOMC 1AGBA 4FXGA 5C0EA 2AJSH 1YNKL 3FRPA 3ARZA 5DLML 5D93C 5CHNB 4YDJA 1JI2A 3PV6A 3T2NL 5I1EL 2YD4A 1DQQB 2GKIA 3EFDH 3A6CL 4KKLD 5D7IE 3BI9X 2JK5B 1MCLA 2CD0A 4XNYL 1JN6B 4M8VA 1Y18A 4YUEL 3FN9A 3GKWH 3QDJD 1HCFX 3VXOB 3BP7B 3UX9B 5I71B 3HNTL 1MWAB 2FEDC 3MRDA 2OXHA 1EAPA 1VHPA 2DQIL 5FO7B 5IESH 1RZ7H 4OI7A 4HS8H 1V7NL 1PAMA 1AGCB 4HGWA 3K4AA 5DO2C 4F58H 3L3IA 2YPKA 2OS7A 3L5IA 3GEWB 1AXIB 3D39A 4LCWB 5C0BD 1PKOA 3JUYA 2ARJQ 2P8MA 4QRPD 4PBVC 1C16B 1VACB 2FGWL 4TSAH 5FUOL 1DL7L 1G9NL 3HE6C 3S4SG 1MCBA 2D31B 4I18C 5T1LA 4X6CA 4CN1A 3DMMA 1UJTA 3OL2A 4M1GL 5JHLL 1EBAA 1FN4A 2CRZA 5GS3A 4WU7B 4YFLI 1F58H 4XPFH 3G04A 2P8MB 3MZTA 1KPUA 3JWDL 4H88H 4YHZH 2VN4A 2D9QB 5TE6H 3RWHA 4HXAL 5I1KH 1KPRA 4X80H 3QG7H 3MLXH 1EHLL 4FQQA 2YHGA 3OHXB 5DWUL 3JTTA 4JGUA 2FLBT 3LKQB 4GMSL 1TZIA 1UACH 4PP2B 3LAFA 4TQEH 1ZWIA 4DGYL 4DFHA 4MZ2A 4L3CB 5FKPB 5JR1L 3K46A 5DK2B 1AIFA 2XWJA 3D0LA 5L2KB 1U9KA 3BZFA 3ZTNL 3KAAA 3LH2L 1CDGA 1A14L 5C0RH 4Z7VF 1OAYH 4DKAA 4EBQL 3T77B 2IC2A 2LQRA 2CKBL 4R3SB 4LKCA 4KC3B 3DARA 3VXSE 1IVLA 7FABH 1HCVA 12E8H 1CICA 2F9BT 4IJ3C 4BQ9A 1G1CA 1UZ6E 2C4FU 2VN7A 2VIRB 5HVGB 3ZTNH 1QSVA 3BEVA 2ICWA 5DEGB 2XQYG 3RWIA 1K6QL 3QIBA 5IEHB 1E4JA 3CJJA 3IFPB 3RGVD 2VZUA 4G5ZL 5C08B 1SMAA 3HC3H 3P2TA 2HKFH 5D1QD 4M4RA 3VFOB 4L5FH 2VDOL 3QUYB 4P2OA 2Y07L 4OLXH 2BY0A 3RWCB 3UPAA 1FNAA 2P42B 5I0ZA 4KZDL 1Z5LA 3ZTJG 1Q0YH 3HZKB 3BN9C 3SDDD 1JGUH 1J05A 4U3CA 1XF4A 5IMKA 4HKBA 3FQWA 5TE6L 1N8ZB 4TTDC 1T03H 5F1KC 4OSUL 1Z9LA 4FRWA 1WWWX 4ODBD 1MFEH 1CR9H 5I8CB 2XXCB 4JB9H 5E8EB 1CL7I 2KPNA 2UZXB 5HYJA 2AAVA 2HVJB 3BO8A 5D71H 3FMGL 1NCAL 4FP8L 3EFFA 3CVIH 5CGYC 4KK8D 1V8HA 3JTSB 5GRUL 3HE6B 1HXMA 2CJUH 3HUJE 2Z31C 1ZAGA 2UZYB 2WIIA 3P0VH 4ZOAA 3HG1E 3QXDB 1INDH 2QQNH 2BSRA 1H8OA 3PWVA 5ERWB 5EOTB 5FDWA 1XH3A 3HMXH 4GBXA 4ODHH 1EMTH 1Y0LA 2YA0A 1CZ8H 1N64L 4MHHG 2F8XC 2NXZC 1J5OH 4NHUB 2N56A 4Y0GA 5GGRB 2JJTC 3ES6A 4L4TB 3QNYA 3S37L 5I8KL 2CDEB 4X6DF 2R0ZL 4MJ4A 3ISWA 2O5YL 4LPTA 4U1IB 5J6HB 4NNPH 1JNLH 4HUWB 3GO1L 5H35A 1S3KL 2F5BH 5JIIA 1QPXA 4UBDC 4Y19A 3FFDA 3T2OA 4JZOB 2UUDK 4X6CB 4YXHH 5MEPB 2APFA 1S9XB 4OIIL 3EKCA 5FIEA 4MDJB 3VCLA 2FD6H 1QA9B 5I1GL 1SJHB 2D4FA 4NZTL 1K8DA 1PGRB 2UWEA 5EBWA 4NP4H 3FFCE 3CK0H 5ESQB 4M5YL 3MA7A 3O41B 4P4KC 1HE7A 2PF6A 3W5MA 5HI3D 1GVIA 4U1SA 4HGMA 2C3WA 2V5RA 4FTVE 4OD3L 3Q3GA 4M5ZL 3UJIH 4PRDA 2W0KA 4DUVA 3KDMA 3QULA 4PJXE 3U4BL 3WXWL 3O4LD 3TBTB 3OXSA 1A6VL 3K80A 1A7QL 2Z91A 3VFVB 3KPOB 4ISVB 4G8FA 3AS1A 3GB7A 4Q6IB 4XNMB 3IRPX 1ZT1B 1MFDL 5CCKL 3DTXB 3H9SA 4L1HA 4Q9RL 3DX7A 3WFZA 3SBWC 4X4YB 3MV8E 3UP1A 3MJGX 1IAIL 4ZNCD 3P0GB 1T5XA 3W9EB 3FFDB 3LDBB 4KWUA 2Z8VC 4Z7UF 5J56B 4XC1L 3I02A 2O61B 1GXEA 1KTLB 3GFUA 3LIZH 4I3RH 3HI6H 1XIWB 2GAZB 1ZT4A 4UUJA 4YEFA 2FX9H 4M6NL 5FOJA 2NY6B 3IXAA 3RIFF 1I4FB 2EDHA 2AV7A 4NKOB 4PV8A 3O11B 4MD5A 4RBPH 3BKML 3TWCL 3U0TA 1KENH 1MAML 1JTTA 1ACZA 3GRWL 4YIQA 2IAMB 1JL8A 4WWKA 2AJ3B 5A40E 5DJAB 5I30L 3BH9A 4Z7UA 1T1XB 3TH2T 4EN3B 4PJGA 3ZE2E 4P0DA 1B0WA 3BUYB 4X4XA 4I18A 5D8JH 4S0SD 1P4LA 1RIVL 4F3FB 1JRHI 4NJ9H 3SJVB 2X4RB 1MFCL 2OL3A 4JFHD 4JHAL 4JFQB 3TJHD 2IBGA 3MLSL 2PETA 3QO0A 3VI4F 2BVYA 2AVGA 4YNYA 3GI8L 3BP7A 4PJEF 5J6GA 1KIPA 3CDFA 1U8HA 4NYLA 2Y5TB 5T1DL 3MUZ1 1HIML 3KLSA 5HVWA 4OF7A 3ZDZF 2O5ZL 3MACL 4PTTA 1AE6L 4KRPB 2GTWB 1BMGA 4G8GB 4U31A 1JNLL 4NNPL 5I8EB 5I76B 3KPMB 1T1WB 1X5LA 1D9KA 4XVTH 4D0DB 3GSOB 5ETUB 2WW8A 3ZHDA 3INUH 4W4OC 5HPMA 3X17A 3WFEH 4E42B 1I1YB 4OJFL 4L4TE 3UAJC 4O2CB 4LU5H 1YN6B 1IKNC 5AYUL 1GZQA 4MCYA 1N5AB 1XGPB 3GBML 3LQAL 3MUGA 4ZOBA 3LSOB 4I0PA 4LVOC 3GM0A 4F33A 1J0ZA 2OK0L 4YBLC 1C08A 4S1SH 1RIUH 1EEQA 3UTTA 2BVTA 2AABH 3M1BA 4NPYB 4LBEB 1CGSH 1T66C 4H25B 1WJ3A 3BQUA 2MHAA 2H2SD 1BIHA 1BX2A 2RIKA 2C1PB 4QXUH 4BZ1L 4Q6IC 4OFIA 4XNUL 1RZJH 3LZFL 2VQUA 4JY4B 5D1QC 3T08A 4RMQA 2IAMD 1QQDA 4Y5VA 3UC0L 3PHSA 5DZOA 1JGLL 3V0AC 3H9SD 4NOBA 2BNQE 3PP4L 1J8HB 1QZ1A 2J4WL 4JY5H 5D2NA 2DQJH 2F53D 2AI0H 2V7HA 2O26U 3GJEA 5GRXG 1BD2A 4RAUA 4GSDH 2BFVL 1KBGH 3LRGA 3WS6A 4TVPH 4QXGH 4U1LB 5KSAA 1F4YH 1P9MC 4PS4H 4P2RD 1FVEA 1GAFL 1U8LA 1EFXB 5AD0A 2IAMC 2EDOA 1P84J 3IFLH 4YBQD 2R9HD 4PJHB 4ODSL 5EUOF 4LCIL 3CXHJ 3HC3L 4HK0A 4X0KB 5AUMB 1ORSB 1AD9A 4RMUA 4JO4H 5I1JH 3QJFA 4HJGB 3IDNA 4ONHA 3FT4A 2AQ1A 2DM3A 1AO7A 4Z78A 2DJ4A 1XCTB 2V6HA 3LHPH 5DQDL 4NOFA 5KG9A 4XBPB 1FFNA 1DZBA 1UM4H 2BSSB 1EHXA 4LLYA 3OAUH 3NABL 1OTUC 1QLFB 4OLYH 2EIBA 7CGTA 4YR6A 3OF6A 2BVPA 2LFGA 5GGQH 2YRZA 4P23A 4FFZL 1BZ9B 3EYSL 2EIEA 3KG5A 1KCKA 5T1LB 5CS7A 1D5IH 1AFVL 2EDLA 3U9UA 4OCMC 4AMKL 1RIHH 3IDIB 5GS0H 4UZGA 5E8NB 5EOCL 4RGNC 4BFBD 5JR1H 3GIVB 1AHWA 1MFNA 3B2VH 3LN5B 4D3CH 4ELKA 3VG9B 1HKLH 3Q6FB 2ILLA 4N68A 1NSNL 5D1ZB 2P49B 4NN6B 3B5TA 4MNGE 3C5SB 3S36H 2R15A 4HWZB 1D6EB 4RISL 2JELL 4HAFA 3KPRD 3WL9B 5DD0H 2D9CA 1ND0B 4E0RA 3JWDH 3S5LB 4YHZL 5F8RC 4J2XA 3FO2A 2E7MA 3BKYH 3MLZL 4JHWH 3V6OE 2ED9A 3G9VA 1N0XL 4G8EA 4PIRF 2CK2A 1MLBA 4MVBD 3U82B 5SWSD 2AW2A 5IB1B 1UVQB 5J13B 2A6KA 4GRLA 5J06A 4N0UE 1ES0A 3U0WL 3TN0B 2HLFC 4DZBA 4L9LC 1FH5H 3TBWB 4OZFG 1LP9F 4OZFA 1S9WA 1I1AA 3ARVA 1P4BH 2YWZA 4L3AA 1MCCA 4X6FB 5FA3B 3HPJB 4ZNEE 4J4PC 4F58L 5H2BA 1T7VA 1U8OA 3C8KB 3HG1B 5BS0E 2IADB 5IB2A 3N06B 3W82A 1N2RB 2OZ4H 3RVWD 1JWSA 1K5NA 1U8MB 4OUUA 4G7YL 1FPTL 3MUGB 1G7HA 3MV9D 2FIRT 4ONFH 1MFBL 1JZ4A 5GHWH 3QEQB 3UPRB 2WWKT 4YUEH 3KYKL 4BZYA 5INDB 1L9MA 4TUJA 2DMKA 4LLUB 5CP3H 3N85H 1WTLA 4HLJA 5H2BB 4G6MH 2I24N 2YK1H 3EDJA 1A4KB 2IFFH 1Q9OA 1E4XI 3MROA 4P2QA 4YPJA 3C60C 2A6JB 5ADPL 3K2UL 2MNUA 2IEPA 4WRLA 1QBLL 1A4JB 4U1GB 2IH3A 5DS8A 4JRXA 4LCCB 1MNUL 2HRPH 3QCVL 5JA9A 4JM4L 3GB7B 4Q6IA 2BNRB 5ACMA 3L5XH 3RI5K 3MX0A 3DROB 4U6XB 5FV2A 2DB8A 1KTRL 1GIGH 2JB5H 5C1MB 2VL5A 4M1DL 1PG7X 3SY0B 3T0EC 4E41D 4CJ1A 4Y1AB 4XXDA 5IFHL 3GI9H 4H8WL 4YHML 2NX5E 1H3WM 5DRWA 3VH8A 5FHAL 1IEHA 1KIUA 25C8L 2HYMA 3ILQC 25C8H 4OZFH 1YPZF 5E2TH 5CKAA 4WEBH 4XCYA 1BFOB 5FYJU 2CLZA 3SE3C 4FQ2H 3MOQA 4I13B 2Y06H 3AS3A 2F54D 5H94B 5EC1A 2C3VB 5ALCH 2YEZB 4JCLA 5BV7H 4P5KA 5KG9B 2DICA 5B21A 2P8LA 1WEJL 5IG7A 1FZMA 4U05A 1G6RL 3LY6A 2XA8H 1MCRA 2DQTH 2M2DA 4R97B 2FR4B 3TO4B 1ZT7B 3T8XA 4L8BA 4UAOB 1BJMA 4P48A 4PD4K 4QT5A 2ATKA 5EU3B 5IHBA 3L5WA 3QUYC 1JPFB 2XI9A 1XZ0A 3QFJD 2ZUWA 3AVEA 5I16A 4BFGA 4OD2B 4YEEA 4NQEA 1UM5H 2H6PB 5DD5H 3KPOA 3UPCA 2LVEA 5SX4I 3L3OB 1AGEB 2A6KB 4HCRL 4Z5RB 3FOMB 5BMFL 3TBSB 1F4WL 2I9LB 3QDGD 2NW2A 1ZSDA 2DLEA 3Q3GB 5CP7B 1LMKA 2WANA 1DQDL 1M7IA 1CXHA 5DURD 3BESR 5DQ9A 5F7MC 5DUPL 5F6IB 2NXZB 4ZD3H 3V52H 5INCB 4X6DE 3C5SA 3VD5A 4MJ6A 8CGTA 4KHXL 3DX6A 4DW2L 3HNSH 5F7EL 3R06B 1FZMB 3I9GL 3SE8L 1HHGB 4WY7L 1ACYH 2PYFB 3GSWA 4R7DB 1H9VA 1QSFA 3MJ9A 2V5TA 1I3UA 3WFHA 4YHIA 3DO3A 2ICWJ 5C3TA 4NPYA 2EDTA 4MA3A 5CIPH 2SEBB 3UTZB 5DSCB 4JFXB 4KQ4L 4G43B 4APQD 5IVXB 1YJDH 2GJZB 2YRPA 3HRZB 1E28B 1BOYA 2DRUA 2UWEE 4Z5RA 5EZIL 5JNYB 4QCIB 2CPCA 4QOKD 4ZDHB 3ELAT 3RNKA 3BH8B 2J7LA 3RKDC 4NUGL 4U1MA 4XH2B 1EHNA 5IB4A 4P3DB 1IQWH 5KVDH 2OSLB 4WWKC 3EYQC 4KUCF 5T3XD 1JP5A 5CINH 1UQSB 2PXYA 4AH2B 1GGBL 5DD1L 3K8MA 4WWID 2QSQA 2ID5A 4FABL 4XB8A 2V5MA 3E1F1 3B2UD 2OTWB 1E27A 4ZUTA 2X4TA 5J89A 5E1AA 4KQ3L 2RJMA 4QTHA 4GLRI 5FUZL 4TULL 2OTUB 5GGTA 4WWKD 5B38A 5LJYH 3IDMA 2Y1VA 5GGQL 1YY9D 4OFKA 5HGDB 4HZLB 4G3YL 3PJSA 1NCWH 4OLYL 5JIKA 1FQ9C 5JXEA 4PTTB 4NBYB 3QH3B 4V1DA 3GBLA 3V2AR 4MHHI 2X4SA 3UTSD 4ELME 1LO5A 4PLNC 1F90L 4POYA 4R9HA 4JKLA 4I0PB 3FQWB 5IV2B 5D7LE 1X4XA 5JW3L 4PV9B 1DCLA 1DN0A 3HZMA 5L7XH 1EX0A 3M1BB 4CMMB 2FB4L 3MJ9H 4ZPTA 3S3PA 1XGUA 1P5VA 2RFXA 5IP4A 3HC0B 3TF7C 3VJ6B 4KAQH 2VDPL 3RU8L 1WAAF 2VDRH 3RDTD 3C08H 3CPLA 4X7EC 5C08A 3I6LD 5E9DD 1X4ZA 3C09C 3MLRL 4W6XB 3LPWA 5EFIA 4ELKB 1U8KA 5SWSB 4KHTL 5GZOC 4P46D 5E4IA 4RIRA 1X5ZA 3I02B 2D0HA 2Q3ZA 4XP4H 3MO1B 1NC4D 2Z93A 5B22A 1I8KA 1DBAL 2NXYD 3C2AL 4KV5E 5K59E 3DOSA 4MAUH 4ZAKC 4JY5L 5KW9H 4NO5B 4HEME 1U3HD 4R6UA 1C12B 4Z18A 4PP1D 2G75B 1NEUA 4NQSA 1Q72L 1FYTA 1YEIL 1WWAX 3LZFH 5GS1A 5MEQA 5I1HH 4KK9D 1F11A 5DZLA 4JO3L 3M45A 1N0LA 1G6VK 5CEZD 3NA9H 1CXFA 3C60D 5HHPB 5TDOB 2IG2L 4Y8DC 3KR3L 1NGZA 1NH6A 2AGJL 4JO2H 3IDXL 4NRXA 5EU3A 1GHFL 5EORH 2X1QA 1SJVA 1DQQA 3CDCA 2VSCA 5L8LB 4FQIL 1ZHBA 5CP7A 2BXZA 4YNYB 3O6FA 1D5MB 5FA3A 5KSBF 5IKCB 4FZEH 1GHFH 3ILPA 1PZ5A 2K7PA 4Y4FA 3OKNB 1ZMYA 1KJ3H 4YHKH 1XEDA 4O51B 3CCHB 3STBA 2VUOA 1I3VA 1FDLH 4MDIB 2C9AA 2GY5A 35C8H 2YD9A 1AGDB 1KIRA 4N1HB 5IB5B 3D0VB 1M05A 4XTRC 2XN9B 3IVKB 3K0WA 2E6PA 3MV8D 4DKEH 2X4OB 2VLME 2C3HA 3WHXA 1I7RA 1S7UB 4XT1C 5J6HA 4LDEB 4IRZL 1EFXD 2DDQL 1FORH 3EJYD 3VXME 2HWZL 1L7IH 4IS6B 5DD6B 1IL1A 1FV1B 4Y4FD 3ULUH 2FNBA 5LWYH 2DM7A 3VGEA 4BUGA 1I3GL 5TDNA 4MLSA 5GGRY 4D9QD 1NEZB 5DFVC 1KGCD 4JPWH 1NQBA 1HSBA 3V6BR 1OQXA 1NCTA 3FN0L 1RJCA 2F53B 4HS3A 1RIVH 3V6ZA 4NRYB 5F3HA 2L7UA 3N50A 2R39A 3H9SB 1NMBH 1RZKC 3PQYA 2FATH 4HSQA 4XWOC 4X5XA 3JWOH 3CFIC 1NDGB 3AXLA 3SO5A 2CDFA 2NW3A 3L7FA 5JW3H 2JCCE 4ELMB 3MRKB 2GJ6A 1WZMA 4CADB 3QIBD 3LRSB 2D7QA 3JSSA 3BVNA 4K3JH 2OTPA 2CIIA 3NCYS 4M03A 4OGYH 4R2GC 4XPHH 3VFWA 4EDWH 5T3XE 1D7FA 5DT1L 4HJGA 1MHPH 3QEGH 4U3HA 4TULH 4PUBL 5DUBB 4NWTH 3D3VE 4Y16D 1RJZA 5FCUL 4UU9B 2NY5L 1CDUA 3K1KC 3UROR 4LLUA 4JFFA 4OIAA 1N4XH 1X5IA 1CGUA 4OB5H 4Y1AE 3CZJA 3QHTC 2P5WA 1X7QA 2EO1A 3SKUD 5GS2D 2VLRD 1UM6H 3ALPA 4RBPK 1WC7B 4D8PB 4F8QA 4YDVB 4B0MM 4XPBL 1S78D 2GTWA 1OSPL 4P4KA 1UXWB 2EE6A 2X40A 4PGCB 3WNMA 2AS5M 4OZHA 4FXGB 5C0EB 4RWHA 4CU6A 2BNUA 3SDCD 1NBYA 2VDQH 1F02I 3SJVD 1KIPB 2ZUVA 3TT3H 4Z7VB 4ZXBD 3RTQA 3CH1A 1S3KH 2F5BL 4FQHA 3CFBB 4G8IA 2A6DA 4ODUA 5JLZA 5GRYA 4FQIH 4Z7WE 4F2MB 5ISZD 5DEFB 5DA4A 4F7TA 4HS6B 3A6BL 1FNGA 4TVPD 5E6YA 1U91A 3V52L 5MEND 2LAGB 4QO1A 1CD0A 1KELH 4M43H 5LBSH 3MRRB 1KNOB 4Z77B 3T1FB 5BVJA 2HFEB 1HOCB 4HD9A 5JOEA 4P46C 1I75A 5IT2H 1AJ7L 4JG1H 4P4RA 1E4KA 5F1IA 4NM8H 2DBLH 4MQXC 1IGYB 3C6LA 5GJSH 1X3DA 2QEJA 1HKFA 2EDBA 2ADIA 2EDFA 3RFZC 1WTGT 3PWPD 1IGMH 4GRWH 4JKKA 5F7DB 2J5LC 3MRBA 3HNVL 1J1XL 2YPLA 1D5BA 4PYGA 4OZGB 3REWB 2JIXB 1IGIL 5BRZB 1C16A 2F54E 2OI9C 2EYRA 2ZG1A 1Z9SA 3KHOA 1DBML 4YBQC 2MKWA 3KPSE 4Z0BL 1O7VA 3VGAC 5FB8B 2QR0A 3C08L 4JN2A 4LGPB 4WW2F 2C7UA 3HC4L 4U1IA 3WUZA 4V2CB 5F7WC 4GW5B 1MFEL 4BZ2H 2AQ2A 4GKZB 4QHLA 5DRXB 2ESVB 1CDBA 5J3HD 3C5JB 1T03L 4FQQB 3VA2C 4PRID 1YY9C 2O5XH 4OZHF 1MI5E 4YO0B 1S5HA 5IFJB 3DXAA 4KZDH 4U6VH 3MGTB 3JUZA 4WHYG 1MREL 4NSKA 5E2TL 4UILL 2XWBA 3KWWA 3C60B 4RX4A 4WU5A 3HFML 4JREC 3IS1X 4AIZB 1T1YB 2XT1B 1U2HA 3M8OH 3FKUS 2XNAB 4ZUVA 5DRXA 1GGUA 5K33A 1EO7A 4RFEB 1CN4A 3U46A 5BZDA 3OR6B 4F7PB 3X11A 3HR5B 5TPWH 4FFVC 4OBSA 1IGTA 4B41A 3U0PA 2EE3A 2J88H 4K71B 3GSNH 4QRRD 2F19H 4DGVH 4NWUL 2NMSA 3U7WH 3NFPB 5JORB 5HVHC 4ACPA 1F5WA 3FHAA 1QFWM 5DHYA 1S9VA 1QLFA 5KVEL 2W9DL 1JZ2A 1QBML 5C0IA 3U7AA 1T2QL 1VA9A 3WXVH 3VXRD 4LLQA 5D7LB 2FO4A 1RUPH 3QWOA 4MNQA 4RWYL 3HE6D 2CK0L 4GRMA 3AGVA 4XGZB 2EEAA 4I2XB 3MCKB 2F58L 4P3CH 1KT2B 3CFKA 1T89C 4R0LA 1M7XA 4MXQD 4PRIA 5I1KL 1AQDA 3IDUA 4HXAH 1PG7H 4NQCB 1FG2A 5K9KA 4LARH 2UYLB 3WEXB 2BHYA 3C8HA 3ZDXF 3MNZB 4N0CC 3VWJA 1IGCL 4LVEA 4RQQB 4Y4KD 3SE8H 4RFOL 4Z7WB 1JUFA 2Q8AH 3HAEG 1SJEA 2GI7A 3CLFH 4LRNL 1IKFL 2FRGP 4H20L 4IMLB 3TNNA 2RAMA 1UH4A 1B3JA 4K3HA 2D7MA 4R4NC 4C59B 2MHAB 3QUYD 4KZEL 1UXWA 1WBZB 4L8CA 5F1IB 2B8OT 4O9HH 1OGAB 1XF5B 3PG2A 3LD8B 1NGPL 3F6LA 3QWOB 4MNQB 2HFGL 1IC7L 1L0XA 1VPOH 1VERA 2MPAL 3BDXA 4GAJH 1OL0A 5CLTA 5KAQF 4NZDA 3PDOB 5EPMA 1ZWIB 2GW5A 5F6IC 1BREA 2D2OA 1TIUA 1LDSA 2AEWA 1DQLH 1MY7A 3RL1A 3QIUD 1OF2A 3FQNB 1CYGA 1ZK9A 3H7LA 2YUWA 1T3FA 1WZLA 2IANE 2IAND 4JAMA 4JZNA 1ZA3A 1LDPH 1TNMA 4HUMB 1N5AA 3KPSB 4W81A 1CLCA 3KPMA 1RUQH 4P2RE 1C5BL 3B2VL 1YC8A 3F6IA 4Y4KC 1W72L 1YNKH 4HIEB 4X83A 2VZTA 1A5FH 2AXGA 3BPCA 5D9SB 3OXSB 3D0LB 2APVA 2CLRA 4FMFA 4GRLD 4AH2A 5E6IC 1C5CL 5HYSB 2GSGB 4J3SA 4AEHH 2FHCA 4MWFA 5DK0B 5HVHB 2WBWB 3P77A 1SEQL 2CDFB 1GOFA 5K9OA 2IH3B 1KLUA 3BN3B 4LF3B 4LSPH 1T83A 4JFOB 4R7NA 3TPUB 1IFHL 4WGVB 5TF1H 3S6CA 1BEYL 1JNJA 3QUXA 2E3VA 3GMRB 3G5XB 1RUKH 4MXWH 1TCMA 2DQCH 1T1ZB 4GKZA 1VESA 1ZLUH 4ZFGH 5IFAL 2PN5A 1ONQB 1P4IH 3RNQA 4GAYA 1JE6A 4RFEA 2LV4A 4LCWD 5ALBH 4XP1L 5IB3B 1L7TH 1UENA 3ULVD 4IOSD 3E6HB 3ULUE 2FR4A 3WFCL 3PHOA 3TV3H 4LPVA 2GYSA 4HT1H 4PBXA 5F93C 1RJLA 3HRPA 1FFOA 4ONGL 5BQ7A 4W4OA 1T6VN 5MHSD 3NIGE 4DTGL 1BAFH 4Z78B 1XIWA 4CU7A 4PFEA 2NTSP 1QG3A 3KJ6L 2R56H 1XMWA 2ZPKL 3OGCB 3UC0H 1JTPA 2DKUA 2W38A 4G7YH 2M1KA 2FX7H 4JG0H 4AIOA 1GZPB 1AR2A 1CLYL 3BP6A 4R4ND 3UJJL 3B8YA 3QXDA 4LAQH 1WWBX 1PJ9A 1QR4A 1OAQL 2GITA 1HSBB 1JYXA 3F62A 4EI5B 1FO0A 3KPSD 3Q5TA 2LTQC 3MRFB 4NQDA 1M7DB 1CL7H 3MNWB 4MA3B 3O3BB 2BY1A 3VRLE 1SBBA 5D70L 5KSAD 4WUKH 3UTTE 2C5DC 3LN9A 2J8HA 3R1GH 4HF5H 5T3XH 4M7KL 5C0JB 3KLAB 5C0AA 4PJ8D 4C4KT 2IQAA 1DLFL 1Q1JL 1RJLB 2BNRD 2QL1A 5DUMH 1MI5D 3DETD 5C07A 1I8IB 4OLWH 2XFXA 3MREA 3DGGB 3WDIA 1FAIH 2OR7A 4KPHL 2YD5A 3G5ZB 4G9DB 4XMLH 1NAKH 2ADIB 4HUVA 1GH7A 4QHNB 2GT9A 3D9AL 4EKXA 3ARFA 2COQA 1RFDH 1DLFH 2JJVA 2YUVA 4HG4J 4LSUH 4PG9B 3DV4A 3VWJD 2FEEL 4UT9L 4XXDB 3IAPA 1YNLL 5IBTH 3MLTB 4XZUB 3TVMC 1DQJB 2A9MH 4BA8A 1LO2L 5CEYA 3SKMA 4JFDD 1GZQB 3HZKA 3PWPE 2GFBB 5L88L 4JHAH 3FQNA 3GSRB 2KBGA 4HLZH 4LHQB 2AEIT 4LPCA 2Z92A 1AKJB 4PRHD 4ZXBC 1TTUA 1FLRH 1EEZA 3PL6D 4QHUA 5D8JL 1QRNE 4MQ7B 1M1SA 2JLLA 3DVNA 4Q9BA 3SGJC 2XIDA 1Z9MA 3PQYD 3SDCC 4XVUD 3MXWL 3VXPB 3ULSB 4MLIA 2HFFB 1U6AH 4NKIH 3VXRB 5LQBH 4KJPD 4TVPE 1B2WL 5CD5C 5GJTL 3GMPA 5C3LD 5FM5M 4M02A 4DTGH 1BZQK 3ULVL 1D6VH 1GC1H 1NBYB 2IBZY 4WV1A 4P9HC 4QTHB 1XIWC 2BSED 4XPAL 3O8XC 43CAA 3C9NB 3FN3A 5E6ZA 3QI9D 5DJ0B 5J1SC 1DE4A 2G5BA 5SWSA 4G6FD 5T5FH 4I4WA 4QY8A 1GPOH 1Z9OA 4UTBL 3WE6A 2JB6A 3OB0H 3BHBB 5EUOE 3WS6C 2IQ9H 3I6KA 4LHUB 4M93C 3CPLB 3U0TB 5B3NA 1QRKA 4Q6YA 1TJIL 3K1DA 2DQFB 4JM2B 4OFYA 2FGZA 4XPAH 1K85A 1FNLA 1CDHA 1A1OB 2ZJSL 4JPIA 5DMYA 3ZKQD 3SOBH 1TNNA 3QUYA 4P2OB 2J8UA 4Z7VE 3QA3A 3WIFA 4R2GB 1OCWL 4X8JB 3BRFA 4GBXC 5FKAB 5IW1B 4MQXD 3GSWB 4HW6A 3DBXA 4TSCH 4XCCH 5CJBA 4HULB 2E27L 3MRGA 2EIZB 4KJQC 2VKXA 4PRIB 5DEZA 3WSQH 3MA9L 1LO0H 3BZEB 4LLYB 2P8PA 3S88H 3S5LA 4KRMB 4YXHL 3K81A 2YOCA 4LLMA 2EDKA 4ODWA 3EO0B 5HGHA 3WEXA 4U1KA 1A6ZA 3BMWA 1ZLWK 4OBRA 3LQAH 4FQCL 1VACA 3NTCL 5DFVD 2R8SL 4NSKB 2H26B 3I84A 3KPNB 4X4ME 3C6LC 5FYKL 1QFPA 3C5ZA 1Q9WB 1NUDA 4UT9H 5DC4B 1TETL 5L2JA 4QRPA 5ADOH 1QUNA 1NEZG 4MQTB 4MJIA 3IS0X 4YO0A 4O5LL 2F74A 5LGJB 2R1WB 1MIMH 4PGZA 5JXAL 2D7TL 1TETH 4Y2DD 4F15C 1M05B 1ROWA 4EI5A 3HI1A 1SMOA 4XMLL 2VJXA 3NTCH 4X98B 3O2DA 5EU6B 2VOTA 1OW0A 5D2LF 1SEBB 4NQXB 3BQUD 3IDGB 3FOMA 5CZXC 1DN2A 4U49A 5I2IA 3X13A 5E8PA 3BKJL 4DEPB 4OCSH 3EGSA 3RUGE 1BVLA 1J8HD 3R1GL 4J3TA 4U7MA 2GCYB 2YPLE 4PJFF 1G7PA 1MQ8A 1OQOA 2EDEA 1DUYB 4YX2H 3BPOB 4JY4A 2J12B 3CDGA 3MV7A 3S5LG 1XF3A 3CMOL 5IMOA 5KS9B 4KH2A 5ECJE 1JGEB 3S98A 2X10A 4X9FA 1MWAH 2DTMH 5A2FA 1MCSA 5BVJB 5I30H 5DRZB 1ORSA 4XI5C 3GJFA 2ADFL 2FX7L 3G5XA 1QFOA 2P45B 3DECA 4WHTB 1BPVA 4KK9C 2BDNL 3HN3A 3FCTB 2UZIH 3Q1SL 5FB8A 5I75B 3RZWA 3STLA 3P9MA 4N9GA 1DFBL 2VLJA 3G6JF 3J8F7 1BP3B 3HA0A 3L7EA 3WS3B 4LSDA 5C92A 4JPVL 4K9EH 4K2UL 3VGAB 1IC4H 3ULSA 4WTXA 4XP1H 3JV0A 5E8OA 1W0VA 4ZYKA 1B2WH 1ADQA 3ZE0E 4EI6B 3EOTL 4MXVF 2W92A 2C3XA 4XB7A 5IJKA 5TFSH 1A4JA 2BK8A 2XZCH 4GW1A 5IFAH 3O3UN 2DWDA 3G6JA 4L4VA 3VXTA 1U3HC 3U9PH 4F33B 2PO6A 2HMIC 5TQ0H 3RWDB 4GRWF 5EC1B 4Y4FC 1S9YA 3FJTA 5C0BE 5SWZE 3EYUL 4BYHA 1RZGA 3QIBB 5IEHA 3NZ8B 2CMRL 2QSCL 1WLHA 1KOAA 2VXUH 2VZ1A 3SPVA 2NYYC 5ICYA 3UTSE 3CK0L 4JJHA 4C57C 1X7QB 3NGBB 3DWTA 1UACL 4TQEL 5I1GH 2HJKB 2VDLH 5D1ZC 2QADD 5DJAA 1MVFA 1DLHA 4OIIH 4U3XA 1FVCB 4NQUA 5SWQA 3MGAA 4HFWB 4OKVB 4ODUB 4PGCA 3T3PF 2NZ9D 4G80A 1W0VB 5IMMA 1I4FA 5HYSA 4WDIB 3CU7A 2Z8RA 2W0LA 1C5BH 4F57L 2CRYA 2X4SB 2O5YH 4KPHH 3HC4H 4HUXA 3PWUB 1XGRB 1PDKA 3MOBL 3P73A 1JJUA 4G8EB 4I9WD 4M3KB 4HIEA 3GMQB 1Q1JH 2QHRL 3BX7C 3EDKA 2A6IA 4HUNB 4Y19E 4C56B 5T3XL 1KB9J 4XCNB 3O9WA 1YQVL 5ID1B 4NFBA 1WBYA 5EIIB 2P5WD 4PJGF 5DMGC 4ZS6D 4O2FA 5ENWB 3QQ4B 3TBWA 2VXSL 5T3ZE 1IC7H 3ECBB 4GAJL 2YC1A 3O4LB 1K2DB 1CK0L 1CK0H 5GRJH 2H6PA 4E42A 4OGXH 3LD8C 3REVB 3OJDA 5IT2L 3RWHB 1F4HA 4U1JA 4WHDA 3MLUL 1MCWM 5GRUH 1FZJB 2Y5EA 2Q7NA 3MUJA 3WJLC 2CR6A 2G2RB 4FP8H 4G8GA 1G7QB 2VE6A 1P69B 3CXDL 2V9TA 1KCVL 5C09D 1S7SA 2FSEA 3GKWL 1QA9A 1I9IH 3MUY1 1XGTB 2BSSA 5C0CB 1Q9LB 5DTFB 1WISA 4ODVL 5DMJB 2BSTA 1HQRA 1CQKA 2NY2D 4P2CG 2YSSB 3WJLA 3REVA 1UCBH 4EQ3A 1G7LB 4WHTA 4PJDA 1RK1A 1SYSA 3ARBD 5B39B 5L6YL 3U9UB 5D7SH 2VDQL 4X99B 1WZKA 2XOTA 3HS0B 3QHZL 5E8PB 3ZLQC 2DWEB 3CC5A 2MFNA 5I15L 5K59F 2PCPB 3RTQC 1TMCB 2CK0H 5LAXB 4AY0A 1PY4A 2QTEA 1A64A 3UTQA 1U3HB 2EZ0C 5E6IB 4HBQA 1LEIB 5EBLA 4G5ZH 1CE6A 4BQ8A 3MGTA 5DRZA 3MV7B 4CKVX 3O41A 1GZPA 1PZ5B 2W65B 5DMGD 5IBUB 1AI1H 1RUKL 1PX3A 2B5IB 3NH7H 1NC4B 4XWGL 1D6EA 4AIZA 3VFPA 5HI5D 3MRNB 5DJXA 1A7BA 5KTEL 4QHKJ 1IFHH 3I75A 1ZA6A 5TQ0L 4OZIA 1X5FA 4AQOA 4IDLA 4YGVB 3DXAB 4NWUH 4DGVL 1ZEAL 2FJGA 3BRGC 3RWEA 3SO3B 1ZLSL 4AEHL 3DNKA 3U2SB 4P23D 4HIXH 4XMPL 3QIWA 4Y2OA 3DVGB 1INEH 3BIAX 2VLKB 4K2UH 4NQVA 3A67H 4JPVH 3HFMH 4DAGL 4ZG1A 3HR5A 4YHLH 1AQKL 5HHME 1X5AA 2EXYD 2V17H 1NGQL 3QQ9C 1XF1A 4MD4A 2BVOA 5FYJH 3QP3A 3QCUH 2BDNH 3JBG7 4WTZA 2HT3D 3VJ6A 5DRNA 1JWSB 5L2JB 1T4KA 4ZUUA 3VXTB 4H88L 4OZGF 1AR1D 3PWVB 3CFJB 3WCYA 3PGDA 3NN8B 5FO9A 4Y5XC 4PJFE 4UQ3B 3VFRA 1ONQA 4XWOD 4LCCA 5BCAA 5KZCB 4N5UA 5C08D 1QSEB 3OPZL 5AWNH 1FIEA 4BKLB 4IBLT 5DC9B 3I3EA 3NZ8A 5F7FA 2A6IB 3DROA 3WO3B 3FT3B 4RGMC 1I3GH 3TNMA 3EOYG 4KZEH 1HXYB 4X9BA 5HTSA 5IF0B 4AK1A 2NX5D 3GSOA 3HNVH 3VDAA 4NNXB 1PZUB 2A77L 5DMIH 2BNRA 4LVNC 3RHWK 5HJ3A 3GMPB 5HYJB 5KSVB 5A3IC 3WLBA 3RAJH 1IGCH 2IGFL 1RHFA 1CFTA 1NFDB 2BCKA 2B7DT 2DL9A 5DJDB 1KB5L 2DQFA 4JM2A 3WNPA 2BJMH 1N8ZA 5I1AB 3TIDB 1X6LA 3R0NA 1PSKL 2B4CC 3C5ZC 2EXYC 1G7IB 4HFUL 4LPXA 4O5LH 3KPPB 3RWJB 1U0QA 5IB4B 3PGDB 1OSZA 4YHKL 1OF2B 3BFOA 4ZOEA 1NMAH 3I50H 4I4WB 4QY8B 1CF8L 3L3JA 1DUYA 1Z6JT 4AZ8A 5B8CC 2HFTA 1TVBA 3QQ4A 1ZTXL 5TDPB 1MH5B 2DLTA 2AJSL 1VEOA 3HE6A 5TJWK 3Q5YA 3N9GL 4JM2F 5KVEH 1UWXH 3VW3H 3MTRA 1CGXA 2QQQA 1SJXA 5DGRA 3SKJH 3MREB 4XBGA 4YDKL 2E7CA 1YEDA 2BVUA 2HG5A 4K3EL 5AAMA 5E8OB 5CZXD 5CAYB 4I48B 3IJYB 4G9DA 2YRLA 2AJYH 2F19L 1SQ2N 3MRPA 3VFSA 1YPZE 4Y89A 5HHOA 4OLVL 3TYFB 1GL4B 3L7EB 5KW9L 4QRPB 2CIKB 4Y2DC 3H9HB 3DV4B 5I1IH 1M7IB 1HI6A 1YJDC 2GAZA 4JVUA 5ISZE 4JRYB 1GGCL 5D7IA 5F7LB 1S7RA 1E0OB 4WUUD 2NY5H 2EH7H 2N1KA 5INCA 4KHTH 2OLDA 2E7LC 1F3DH 2AJZA 3LEYL 5SWSE 3PV7A 5D1XB 2FL5B 4YIQB 5GZOD 3BEVB 3T0AA 3G08A 3QEGL 1NJ9A 3R0MA 1YYMH 3RU8H 2VDPH 5JUEL 2LVCA 2VXQH 5FHBL 1A3RH 5EU4B 4DKFL 4S1QL 4U0QB 4OM1H 3X12B 2VLKE 2W59A 2YD2A 3UMTA 3WJJA 3MJ8B 1CG9B 2F5AH 5EBMA 2ZCKL 3D39E 1OM3H 5JZ7C 3NAAL 5F6HI 4CN4A 1MCIA 1IAKB 3VDCA 3D6GA 4PJ7E 1PKQB 3PGCA 4Y1AD 3PWNA 4JN1H 2HJFB 2WK2A 1MUJA 3VRJA 4WFHE 3VGHA 3FB6A 4CAGA 1BHGA 2GCYA 1NBVH 1TZGL 1PYWA 4X6CE 3QR2A 1N6VA 3MRHA 4NUJA 4FQJH 1U2CA 5F1SA 2ADGA 2NY3B 1SM3L 2Q86A 3G08B 4GG6B 4ZODA 5IBTL 1HSAA 3IDYC 1VFBA 1ZXQA 4N1CA 2ATKB 4WJ5A 4YDLB 3ULUL 4JVWA 1V7ML 1OPGH 5ELIA 3O8XD 4P5TB 3B2UC 1P7HL 4IRZH 4MD0A 4ERSH 5TDOA 1IQWL 4BSWB 1A6ZB 4NUGH 1IILE 3X3FH 1B6UA 1CXKA 2V9QA 3IT8D 4U1GC 3RA7L 1RZIA 3GDBA 3KPNA 1G7MB 5C86A 3RKDD 4BH7A 3BP4A 3MV9B 4H1LB 2UUDH 1EGJL 4IMKC 1PY9A 1WITA 3KLHD 4Y19D 3TC9A 4GKSB 4KQ4H 4LNRA 5F21B 4XAWL 3QIWD 4M7KH 4IRJB 1IC5L 1KEMH 1EGJH 2HKHH 3RTQD 4ZXBA 5CEYB 3FB8A 4FZEL 3C6LB 1IGYA 2D0FA 2WLYA 5ESVA 4ZUSB 1F4XH 2YD8A 5EU6A 2P1YA 2PYEE 5EOQL 3S34H 3SPVB 3K8LA 5JZ7D 3F65A 2VRAA 3MV7E 1Q9LA 2BNQD 1TTGA 4P2QB 3W5NA 1T22A 5I1DB 5HPMB 3UAJD 4QTIH 4TNVK 1IGJB 5EG6C 3OX8B 3NCFB 1KC5H 2ATPA 1RZGB 1QHOA 4LAJH 1Q72H 1WVZA 4YWGH 2R29L 3DXAE 4Z7QF 1G7HB 3F7VA 4DEPC 3E2HC 1UFUA 3E6FB 2QQLL 2J8UF 2PW2B 2WAHA 5C7XH 3NCBB 3VD3A 5E4EC 2A0LD 4CADA 3EZJB 1F4AA 4FXKB 4OI9A 3MBEA 3QWRA 4YLQT 4XPHL 4CDHA 1K8IB 2D7OA 3U1SH 3GMOB 4X5XB 4LLVA 2VITB 5FA4A 4IOIB 2A73B 1U41A 3VGBA 4ZUTB 4M8QB 2DQHH 2WLZA 5JPNA 3WS3A 3HUJF 5MERB 4F37F 5CEZE 5HI4D 4QXTB 4WTZG 5T1LD 4OM1L 3MLYL 5HPOA 5E00B 4H26B 1F3DJ 2R0KH 4PJIF 1UWGH 2QBWA 1MRFH 5IGXH 3NA4A 4TRPL 3OXRA 3WJJC 1YYML 1N59B 4A6YL 3RVTD 3AY4A 3CGTA 2AV7B 2OTWA 1RD6A 1RUAL 5C0BA 2Q87A 4HJ0D 4TUKH 4C83A 1DE4B 1T2JA 5F1NA 4UU9A 2XPGA 3HZMB 1W8OA 2IPKA 4DK3A 3SDAC 1WQVT 2BVOB 5M95B 2VO5A 2XKUA 5F7NC 1L7IL 2CKBB 2NY1B 4M9OA 1WF5A 5ANMA 1ZANH 1GIGL 2W91A 4PV8B 3U6RA 1I8IA 3TT1H 3T0ED 1F3JA 2UVFA 4MA1B 1J9CT 4WI4A 35C8L 5IB1A 3T4YB 5DD1H 4P2RB 4HKJA 3EDEA 1MNUH 2HRPL 1YN7B 4MD0B 3FB5A 3QJHB 4NO2B 3DI3B 3FTGA 4LLDB 5L2KA 5GS0C 3NGBC 4GG8A 1AXSA 5DHVA 2W1NA 1XFPA 3I75B 5EZIH 4WFEE 1Y6KR 5E8NA 1ODAA 3ZMRA 2X2YA 3WN5A 5GS0D 5EOTA 2J8OA 2BHZA 3L3OA 1ULVA 2OL3B 2H26A 3VGFA 1CGYA 4KKBC 1HDMB 1X5JA 4PJHE 2R2HB 1NAMH 2Q86B 1FL3A 1ZSDB 4YFEA 1MCKA 3QDMB 3JWDC 1KB5H 1XF3B 4WIQA 2G60H 1S9XA 2HAZA 3AMLA 3MR9B 4QLRA 3O4OC 4HZAA 4HWBL 4XNQA 4JANA 5CEZL 4WHCA 1K8DB 5EBWB 2Y7QA 2OR9L 2ICEA 2DKSA 1YPZB 2VXTL 4HXBH 4P2RA 5IW6B 1CFSA 1YEGH 1KCRL 2DTSA 1T6WA 2V2WB 4RNRA 3QEHA 3OKNA 3FFCD 5K9QI 2A74A 4YHPA 4QRTB 1U3JA 3D85A 5GQBA 1DBAH 3RGVA 4XX1G 5TE7L 3QWRD 2Q8BL 1IJ9A 1I1CA 4TNWF 4J3UA 1KB9K 3LKRB 1G7QA 2VE6B 1F4WH 2Z31B 1Z0MA 1RU9L 4XNQB 1A02N 1LK3L 3QZWG 4CVXB 4LCWA 3NIDF 1A9BA 1GGIH 2VDMH 1CGVA 3OKKA 1TQBC 1XGPA 2ZNWA 4RCAA 3GMMA 5E9DA 2FL5A 1EO5A 1D5XA 3SGEH 2DBJA 5E7BA 1BBDL 1YEKL 4DOHB 4MX7B 3TVMA 4QGYA 3ZKSD 1BM3H 5DJ0A 1IM9D 2A2QT 4S2SB 5AZEL 3CH1B 4OZIF 2IWGA 5CFHA 3PJSB 1F6AB 4DVRH 4ORGB 1EO8L 2H32H 1MVUA 2P7TA 2V17L 3TPUA 1KYOK 1U8NB 4JDZA 1BD2B 4RAUB 5J7CC 3SDAB 1CE6B 1F00I 2XQYK 3UDWC 1VCAA 4KI5E 5BV7L 1XR8A 1TXKA 2NY1C 3T65A 1JPGB 1W0YT 2X9YA 2VITA 3QDGE 5CILL 2F15A 4HV8A 1KNOA 3H9ZA 3P4NB 4X6DB 4JPKL 1D9KD 5I6XC 2AXGB 1MHHA 1T80A 2DMBA 4MS8C 1CT8B 5D2LE 1J1PL 4MA1C 1NLDL 5HJ3B 1VADA 2WNGA 2I60H 1G84A 3L6FB 1FNSH 5ILTH 4ODTL 1FVCA 4I2XE 3NACH 4LL9A 4JKWA 4J1UB 4KVNH 2CUHA 3L3KA 3O6KL 5CINL 3GMMB 4F9LC 3BAEH 1A4KA 1X9QA 4ZS7H 3RKPA 4PV9A 2AJXL 3CFEB 2FIKB 3W2DH 4P3WA 1YEKH 2NR6C 2BC4B 4HV8B 4X7TA 5A16A 2UVEA 3MLPA 4JFDE 3H7BA 1GYAA 5HHNA 1BOGA 5C6PB 1LE9A 2VZOA 4U2YA 1R5VA 2OQJB 2EDNA 1KPVB 1VADB 3IFLL 4N5ED 1X5GA 3TCLB 3VXSB 3KLHC 3TZVB 1T1WA 1BZ7B 2ICES 3SDXE 5L9DL 1JI1A 3IFOA 3QZWB 4Z8FH 1T4KB 2ZUXA 1CE1L 3NVQA 3CSYA 4NQVB 5TE7H 4TVPL 3LDBC 1J1XH 4PJ5A 4IRJA 4CNIA 3ESVF 3O9WB 4Q2ZB 5C07E 3OKMA 3KYKH 3IDJB 4J3WA 3V0WH 2IH1B 5DI8B 3TCXA 4EEEA 2J4WH 1OB1A 4MJID 1RVFH 5GJSL 5D2NE 4C55A 2IMNA 3BGFB 4ZD3L 2WBKA 4E41E 1J0IA 5F71A 3MSPA 3RIAF 2GK2A 4JFEA 4JG1L 2G60L 1G9MC 4ZUVB 3MRDB 4HDIB 4E5XA 2AEQL 5C9KA 3DSFL 4XNMA 4OF0A 1YUHA 1BJ8A 1TQBB 3Q48A 1JBJA 3BDYH 3QXTA 3BEWA 4BM7A 4AL8L 4U4BA 3ARFB 1KACB 1N6QH 4WV1C 4D0BB 5DHYB 5EZOH 4QRUA 2FHBA 1AP2A 4XAWH 5L9DH 4OJFH 2OZ4A 1PYWB 4MAYC 4AG4L 4G9FB 5E6IA 1FL3B 4NJAL 1A21A 3HCVA 4G42B 1N0XH 3RVVD 3MV9E 4X5LA 2GT9B 5C70A 3MNVB 3DMMB 2VLJB 2PCPA 1FL5B 2AV1A 1NEZA 5DD0L 2GUOB 5BS0D 3ULUD 3AROA 4D0BA 4QRRA 1TJHL 1R3LB 5B8CB 2I9TB 5DQ9B 3BJLA 4YGVA 4UT6L 1BWWA 4KY1H 3HI1B 1N4XL 4PGEA 4MS8D 5D7IF 5SX5H 4ODTH 4KMQA 1FNSL 4LLQB 4MCZA 2BY3A 3D3VA 4U1NA 1UZ6F 5HHQA 2VXUL 5ACLA 1B88A 4OTXL 2R69L 1PQZB 4B7IA 4JZOA 5EBLB 2BRRH 1HYSC 5IFJA 1TPXB 4EDWL 1UWGL 4Z0XB 5FEBA 3OAUL 4ZFFA 5ABDE 1OP3K 2CUMA 2A6JA 5IQ7H 5HHOB 3T1WA 5D1QB 3A0OA 4KKLC 5DVKA 4LASL 1N3NB 1BM3L 2F5AL 2FX9L 3I85A 4M6NH 3JWOL 3O2WL 3H2WA 4BQBA 4C56A 3HI6L 4H5SB 1BJ1J 5F7HA 3O0RL 3W0WD 4G6ML 4G80B 1IM9A 1S8DB 5JUEH 1QKZH 3OAZH 3BHBA 3V5KA 2PXYD 5E03A 2XN9E 4RSVA 5J12B 1FNHA 2JTDA 3O4LA 1MFBH 4ZO9A 1DBJL 3EOAB 5CCKH 3CFEA 4HIIB 5H94A 1F4YL 5T1KD 2XQBL 3HZVB 1L6ZA 1NFIB 5HHNB 1BF2A 1XGUB 1CDCA 5GRVK 5AG8A 2NY4C 2AI0L 1KG0A 3IJSB 3WLBB 5IF0A 3MQIA 2APXA 2OR9H 4XMKL 3R4DA 3KPLA 1JHKH 3CMOH 3KXFD 1S7XA 3FQXA 4HWBH 3G6JB 4M7ZC 5EOQH 4MAYA 1PG7W 1MLBB 3X14A 3FZUC 4K3EH 4F9PA 3EYFB 5KSVA 2DYPA 1H0DA 1U3YA 1KEML 1AGFA 3ABZA 4TOYH 4PJIE 5JPMA 3RUGA 4S1DC 3B9KC 3UBXI 1CD1B 3ME0A 3CSBA 3NIFE 1XF2A 5ITFA 1ZTXH 4X6EB 4P4RB 1GOHA 4KMTL 1U58A 4JREB 2GFBA 4JLRA 1UWEL 1MIML 3IDXH 2FECL 1RHHA 1R24A 3VG9C 4ERSL 3RBSA 3WV0A 1PSKH 5F7UA 1LGVA 4DUWA 1U8MA 4MX7A 1NCBH 3TVMB 4OM0H 1V3JA 1QLEL 1ZVHA 2VL4A 1EJ6A 4K71C 1VB9A 2R8SH 1YEIH 3OBAA 2FJFA 3BPLB 3P11H 1JZ8A 1DANU 1LO3L 5HXMA 2KUTA 2FJGB 4Y8AA 4X4ZA 3FHQA 1MJJA 1AP2B 2R4RL 1X5HA 2I5YH 4IOFC 3TA3D 4J3OC 1J7VR 1UQSA 2P47B 5I74C 3V95A 2JJWA 4Q58C 3C2AH 3MRNA 2E27H 3P0VL 3S8WA 3W0WE 1A9EB 1QSZA 2P5EB 3F7QA 3JV4A 4N8CL 4PY8I 2HTKD 3AXLB 4POZC 4ZTOH 1WT5C 1B4RA 5T5NF 3TN0C 5JW5A 4PLKC 4L9LB 5DQDH 4BUHA 5EZLA 1PQZA 3MLRH 5D71L 1JMXA 4YHYC 4A6YB 5JW4R 1DBBL 4AEIH 4PJEB 3O3BA 3BP6B 1MRFL 4HWBA 5IGXL 3SDXF 1IM3B 1SYVA 1CD8A 1S7QA 3WL9A 4ZFFB 3DIFB 3E2HB 2VTFA 4XHJC 1ZGLA 2I26N 1S5HB 2DQHL 3V4VH 3WDJA 3LS4L 3KS0H 4TTDD 2C1OB 3VFVA 1Q38A 1FC2D 5C0FA 1XGYL 1JWMB 2ZUQB 3F7RA 2VDOH 4PJEA 3WFBL 1TZHA 1IM9B 4QXGL 1INEL 2NXYC 1K6QH 3B43A 3L5WB 1PX4A 4KKCC 4P2OC 4X99A 3QT2A 1MJ7L 5HBBA 5JDJA 3FO0L 4DQOL 5CMAA 4LNVA 1QSFE 1U6AL 4NKIL 1JF6A 7FABL 5EBMB 2DLHA 1WGOA 1BQUA 1AGEA 3DX9A 4FABH 4R0LC 4RRPG 2CDGB 1GGBH 1JNNH 2E9JA 5DGQA 5BRZE 1A14H 2EIZA 2J3SA 3F5WA 3HE7A 4MSWA 3UJIL 1U92B 5B4MD 2EC8A 1I1FA 1MEXL 4JFFD 3ESUF 5L88H 5CEXB 4A2MA 1NBQA 3FFCB 4XNXL 1RAMA 1OTTC 1TVHB 3ARQA 1NC2B 4DGYH 1F4XL 3LEXB 3MYZA 4EZMA 3O6FD 4KK6C 4V1DD 5IJVB 5TH2B 1R5WA 3ZKND 4RDQG 4W6YB 15C8H 4XP9H 1CXIA 4JQXA 3RUGB 4JFEB 1NCCH 1A3LH 5IMMB 3QG7L 1NGZB 4X9HA 5EZJB 5HY9A 4XAKE 4JFZH 1CIDA 4JRXB 4UQ2B 4E5XB 1XGRA 5SWQB 1VGKB 4G8GE 3GSVB 3KYMA 4KI5C 3FAWA 5FYLD 5IHUH 2O5ZH 3MACH 4P4KB 4ZFOL 1R24B 2X1WL 3KXFA 4HUXB 3HHRB 1QPPA 2NR6D 4U7KA 1KUMA 3BH8A 4N8VA 4YHOH 3BDBA 3LKSA 2CUIA 2WM0A 5JOPD 1DQDH 2R2BA 4TSAL 4ETQA 3VFRB 2PR4H 2G5RA 4IIQC 1YN6A 2IMMA 4JY6A 2HLAA 4NRXB 4R90H 3GZKA 5IJVA 3BRDA 2HMID 2XG5A 3SCMC 4P5MB 3ARDD 4HS8L 6CGTA 3GIZL 4NGHL 4XH2A 3P9LB 5FA4B 5C0ND 2VAAA 3U79A 3VG0H 3T1FA 4B5EA 3HI5L 2W9LA 3QNZB 2VKWA 5LCVH 4PD4J 5I75C 2VMFA 5JPNB 4ZQKA 1V3KA 4X7CC 1OB1B 3IYLW 3UCRA 3DLQR 4ONGH 5JHDD 2X4PA 1G9NC 5BXFA 2MQ0A 3U83A 3V8OA 1BIIB 1T20B 1LEGB 3QRFM 3H9YA 4EN3C 5ID0A 3I6GB 4U6TA 3B3IB 1EXUB 1OAXL 3K4ZA 4GUPB 3VFUB 4M6OH 1MVUB 1P4IL 3BIKA 5DK2A 5L0QC 4LKXA 3ARGB 1FYTE 1NKRA 2QJDA 1R3IH 5IVZB 4FN0A 1NC4A 2HKFL 4PJ5D 1F97A 1UB6A 3BD5A 2CMRH 2QSCH 1U8HB 1KJ2A 4LGSB 1HZHL 2E9BA 3QUZB 2OR8A 5J1AB 4EQ2A 2Y72A 3O3AA 5IVXA 3L95B 3QUXC 1FCGA 3OKEB 3U2SA 2YPVL 2NY0D 4N8PA 4NZUL 4NZTH 1EPFA 3X3GL 2HA1A 3VFWB 4QNPF 5KSUA 5AZ2L 2GHWB 3LH2H 1T5XB 4QRUB 5T3ZD 3LRSA 4GJTB 4JFXA 1G6RA 4D9LH 5TE4L 1KLFA 4KJWC 3ULVF 3CLEL 4Z7QE 1M7DA 4K3GA 4D0CB 3N85L 2AP2A 2UV3A 5KSBA 5BQ7B 4GS7B 4L8DB 3D2UB 4Y4KA 2FH8A 3FB7A 1T1YA 2KQNA 2E8ZA 3O6FB 5EA0H 1QR1A 1NC2D 4UV7H 2ARJA 1YZZA 1R3KA 4XP5H 4M00A 3BGFC 4GAGL 1NMCC 3GIZH 4NGHH 4IIQB 3SGKC 5IQ9B 2AJUH 2VC2L 3F5WB 4K7PL 4O2FB 5ENWA 3L3GB 4C58B 4HS6A 4HGKC 3OWEA 3QAZB 2A77H 5DMIL 3SDCA 2XZZA 2ZOKA 2EDWA 2HVKA 5IUSA 1MF2H 1NAMA 1SBSL 2APWA 5HI3C 3BZEA 2VAJA 4GRWB 4QYOA 5EU5B 5C2UB 4N0UB 3WHXB 3QG6B 1UXSB 3DPBA 4IMKA 3U0WH 32C2B 3O8XB 4P5TD 3D85B 1WICA 1ZHLA 1RZFH 2ED7A 4OD1H 3RDTC 3TO2B 3DUHA 3OKYA 3U7YL 2Q8AL 3CZFB 5CJQL 2JCCA 4D0CA 1A6AA 5HGBB 3OGOE 4JB9L 3F7PC 3PABA 3G5VB 3F58H 1ERNA 2FO1A 4N90D 4OAWA 2CLVA 4EIZC 3BKYL 3HLAB 3MLZH 4BK5A 3T0EE 4OSUH 3X13B 1ORQB 2DQIH 5MEPA 2AXFB 1RK0A 4ZPTB 3RX5A 2GK0B 4Y16A 4Z76A 1YEDB 2X44D 5FOBA 4U1LA 3S36L 2E9WA 4X98A 1S7TA 1AHWC 5ISZA 4QOKA 1KIQB 4K8RD 1AQKH 4D3CL 1WIPA 4YHLL 1UYWL 2VZVA 2CO7B 5F1NB 4P23C 1MFAL 3VXOA 3HB3C 4M48L 1YMME 3B3IA 4LIQL 4OFPA 5J3HC 2DQDH 3T0XA 1SVCP 4MQ7A 2VL5B 4OV6F 3I3BA 1XGQB 1I7TA 4NZUH 2YPVH 4JCMA 1NPUA 4G7VH 5DJ8A 3THML 3VXPA 3HZYA 5I1LB 1FYTB 4EBQH 4Z95L 2FIKA 5C0RL 5KVMC 5CGYD 2X7LA 5EDXA 4LBEA 1U8QA 3NFNA 1BFSA 3RX8A 1MLCA 3SKOB 5JA8B 1CI5A 4FNLH 3EUUA 1FFQA 2X4PB 3WHE1 3M8OL 3TVMD 3GMOA 2YPLD 5I1JL 4F15B 3OKOA 3DUUB 1JPTH 4ZAKD 3WFBH 2PYED 4KDWA 1NGWB 3VFOA 5HYEA 5EIVA 1MREH 5JQ6H 4GMSH 3S35L 5EWIH 2HT4D 5SX4H 5DRWB 3OR7B 1P1ZA 4EOWL 1KFAH 4GMTL 1AY1H 4PJCB 5GGVH 1H5BC 2HTLD 3AREC 4X80L 2NNAB 5L6YH 5J13C 3EDFA 1CD9B 2EC9T 3BUYA 3T3PE 4ZFZA 1WIOA 4M1CC 2AJVL 2NTFA 3KLAA 1FV1A 4LFHG 1MPAL 1KBGL 2BFVH 1MWAL 2DTML 4OZFB 4U6YA 3BPOC 3H42H 5D1QA 3VWKD 3CXDH 1A7PH 4CL7A 4PBWD 3MRFA 4NQDB 4Z0BH 4YDVA 1QFWL 1AIFB 1MLCB 3CX5K 3KXFB 5F96L 2F54A 2XKSA 1RUML 4PJBF 5ICXA 1S9VB 5HY9B 2EYSB 4GKNA 3IGAB 3BJ91 5BOPA 2I5YL 4JO1L 3BE1H 5FGRA 2X4UA 3RI5F 4NQEB 2YS4A 1MCFA 3VRLF 5FKPA 4X9GA 4HIIA 5T1KB 2PR4L 1CU4L 3ZE0F 1LO2H 2A9ML 3SE3A 1RZ7L 2XTLA 5IESL 3Q6FA 4LSSH 4HIHA 2W07A 2Z92B 3L3DB 4OM0L 3C5ZB 4J6RL 1DSFH 1FGNH 4HWZA 5CHNA 4YDJB 1E28A 1RURH 2NX5B 4M7LT 1S7VB 1F6LL 3ZTJH 1UWEH 1BVLB 1CXLA 4YC2C 4FFWD 4P5TA 2AV1B 5DQJB 3FO1B 5JQHC 2XG4A 5CKGA 5E5RB 3OGCA 4FQLL 3NCYP 5KZCD 2QADC 4JFZL 4Z76B 3TT3L 5KN5B 4R26H 4XVJL 4JGJA 2CDGA 3AS2A 4XPTL 5IBLD 3MA9H 4M7LH 2VDLL 3MRIB 3VXMA 1S7VA 1Y6MR 5LXGL 3G5VA 2XACC 1CLZH 3B9KA 3QIBC 3GI8H 3NIFF 3K74B 3FRPG 4PJ9C 5E2JA 5I74B 5C71A 4XCCL 3DSNA 3O45A 1CL7L 3MRLB 2ICCA 5HD8C 3K4DA 3BWAA 2B1AH 2KDGA 1J0YA 1L9NA 3BYYA 5HHQB 2R2HA 1YMMB 3ET9F 4KJYB 2Q7YB 2X4NB 4YHYB 4OB5L 4UIKL 2Q6WA 1NBZA 5SWZA 5F88A 3PQYE 5A16B 4I5BA 4NBZB 3LB6C 5DR5L 3SQOL 1DBJH 3JWNC 5IOPB 1HQRB 4CU8A 3V6ZB 1NKOA 2BP3A 1A7RL 2D4DA 1NUFA 1K8IA 2X1OA 4CGTA 5HDBE 3WIHA 5ITBH 1PBYA 3LIZL 4I3RL 1KTDA 3UJTH 5FGCB 2VWEE 4KDTC 2CGRH 2ZUQC 4FXKA 4K7FA 4XAKD 5HGDA 3SKNA 3PP3H 5EFIB 2AK4D 3IU3B 1ZLVH 1QSFD 1UZ8B 1XGYH 3O3AB 4LASH 2OI9B 4N0RA 5GJTH 1I7ZB 5CUSH 1SY6A 3RWFA 5FFLA 3WKNA 3PDGA 4GOSA 3QZWA 3MXWH 5KVGL 1T21A 4WDIA 5FYJD 5MERA 2DQCL 3U4BH 4JFFE 3ARBB 2ADJA 1MJUL 3U36A 2EXWD 1A2YB 3MOAL 3OQ3B 4J8RB 4Y4HA 1JGVL 1DANT 1PEZA 4JGMA 2VWEC 4UDUA 4PJCA 4JPWL 4L8SC 4Q7DA