5I8KH

Hhh1 fab fragment
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
218
structure length
218
Chain Sequence
EQLVESGGGLVTPGGTLTLTCTASGFTISNYHMSWVRQAPGKGLEWIGFIDTGGSAAYAPWAKGRFTISRTSTTVALKITSPTTEDTATYFCARGAPAWGTANVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDRRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HHH1 Fab fragment
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HHH1 Fab Light chain
total genus 40
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8kH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8kH01
1CE1H 4MD4B 1UFUA 3QP3A 4NFBA 3DX9A 4ZSOA 2P5EB 3PGDB 4MNHB 1FHGA 3H42L 1QBML 2YD7A 4BZ2L 4OFPA 4C55A 1INEL 3RVUD 4BELD 1QR4A 1KFAH 1HCFX 2FYYB 4Z7UF 3KPOB 5EU6E 2DQJL 1IGCH 3EFFA 1OAQH 1B0RA 4GG6E 1G0YR 3DURB 3QR2A 4HS6B 1KN4H 3NIGF 1MI5D 2VDMH 3DROB 4LF3B 2FJFA 5EO0B 4YDIL 2L7UA 3GMQB 2ZUWA 4WFEE 2XTJD 5KN5B 2OP4H 1IILE 3RWGB 5J1AA 5SX4H 3QJFA 1UH2A 4HWZB 3MMEB 1HQRA 3MRGB 2E8YA 2ICCA 4KPHH 2YBRB 4GKZB 3P30H 4ETQA 2EC9U 4DN4L 3V5KA 5DMGD 3OR6B 4K8RL 5C6PB 1QSFB 5I15L 1OAUL 1AJ7L 3HPLB 1ZT4B 4IOIB 2QKIB 1CGVA 4X7FC 5E9DE 5JHLH 3LB6D 2VISA 5FO9A 1A5FH 4PJ9A 1TZGH 3WSQL 5I73C 1TETL 4YHNB 2VJXA 1WEJL 5TDPB 3SDDA 5T1LB 1KBGH 2X41A 2WIIB 2PTTB 3TVMA 2GT9B 3VFPB 5F7EH 1NDMB 3OKDA 3KAAA 3FQRB 3TT1L 1FYTA 3VXNB 2XA3A 1RQ5A 1U91B 5DMKA 4ZFOL 5C0CE 2I24N 1T3FA 4LCWA 1B9ZA 5L8JB 3P0GB 1D5MB 2Y5EA 3QG7H 3S98A 5HY9B 1NCBL 5EIIB 4YDVA 1QKZL 2HRPL 3U4BH 4XZUB 1HINL 4YFDB 5CCKH 4G3YH 2BNQA 1OGAE 4B41A 5ICYB 5D1XA 3TNNA 1G7PA 3VDCA 5IROA 5EG6C 5F97E 4M7LH 4JREB 4KI5C 2NTSP 4P2OB 1XR8B 3C6SB 3L95B 3VW3L 4WWKA 1RULL 3OAUH 5JQ6H 4XP9H 5FUZL 1OTSC 4WUKL 4YDLB 4WTXA 5CS7A 3ULUH 5IK3A 5E0QA 4OFYA 4MA3B 1L7IL 4ZOEA 5C0IA 3WL9A 3QQ3A 5FB8A 3EJZC 5C2BL 1A0QH 2ZKHH 3BMWA 1IFHH 4Q9CA 1EBAA 1HHHB 4IDLA 4FQJL 4M6MH 4U1GC 3SDCD 4B53A 1A6TB 5DUPH 3IJSA 4APQD 2PO6C 1TZIB 4GXVL 4NWUH 3K81A 2F54D 3S96A 4I48B 5EU7E 1A4JA 4MSWB 3L3OB 2Z4QB 2DLTA 2B8OT 3QO1A 3CFKB 2EKSA 1N5AB 5LGHH 1FP5A 1SYVB 4N8CL 4S2SA 3P0VH 1HDMB 3LKSB 2F9BT 3P3YA 3EOTL 3IU4L 1R5IB 4MNQA 3MGAA 1EO5A 1FFNB 2E9WA 3JUZA 1N64L 4PJXF 4S1SL 3FQTA 3VFOA 2X1QA 3HC3L 2BOCB 2OMNA 5HGBB 1UM5H 3QEQA 3WHXB 3CVHL 2H32H 4JZNA 1T5XB 4QHUA 3OF6A 3P9MA 3DTXA 1Y18B 5BS0E 4OD1H 3ES6B 2ZG1A 4P23C 4KI5F 5AYQA 3WKMH 4LVOB 2ZSWB 1YY9C 3VXOB 5FYKE 4DWHA 5DSCB 5HHNA 2FH8A 4Y16D 3RQ3A 3RDTA 5KS9B 1J0IA 2A83A 3OZ9L 2JE8A 3BQUC 3KPRB 4NO5A 4EI5B 4G5ZH 2A77H 2VE6A 5I66B 5I8CA 4JRWA 5EOCL 5BVJB 2AI0H 1SHMA 4OZFB 2H8PB 3D0VA 4HKJB 3I50L 5IR1B 5GRWA 3TIEB 3OAZK 2PTUA 5D1XD 3TT3H 5DK0A 1FPTL 1S7TA 1FO0H 4K07A 5EIQA 5AD0B 2B1HL 4HFUH 1N7MH 2Z92A 2I9LA 2DM4A 1Q0YH 1A9EB 2WQ8A 5KBNC 3C5ZB 3UTTD 1OB1A 2WP3O 1AP2A 1FJ1A 4X4ZA 5HHXH 2X9WA 2V7HB 2XWJB 4QXUL 3HZKA 3T0XA 1TQCC 1P4LA 2NY5H 3FCTA 1CXIA 5L2JB 5DJ2A 1LK3H 3PWPD 3WFEH 2BZDA 5EU5A 3QFJE 2ID5A 2AJYL 2IPKB 4QRRA 1XF3B 3GI8H 3DIFB 1WC7A 1XIWB 5IJVB 1YEIH 4N90D 3OKYA 3FQTB 2MNUA 2A6KB 1DBAH 1MCIA 1N8ZB 4JRYA 3R8QA 2HMID 4J1UB 5C0BB 5C0CA 3U1SL 2VN7A 3TCLA 3MRCA 1HXMA 5ADOL 4L3EA 4KDWA 3V4UL 2QHLA 2YA0A 4JZJB 1IGTB 1G7LB 4OZHB 3C6SA 5KSAD 4JPWH 3RWCB 1PZ5A 4WW2C 1I7TB 2Q76B 4G6FD 2VLLB 4UB0L 3VGFA 1CFVL 2W07A 1MHHA 4BSVB 5FDWA 4TN9A 4YQXL 4P2RE 3GJEA 5FF6B 1FLTX 3GSVA 1A14H 3VWKB 5E9DD 5C0CD 2QSCH 4YHLL 1MCHA 2BVTA 3QIBA 1X4YA 1YN7A 4XXDB 5DQ9A 5DRNA 4WCYL 4UT7H 3D2UD 4Z7UB 4R2GB 1ZMYA 1I8LC 3LKOB 4YXKH 3WN5A 1S7VB 1HSBA 1X5XA 3O8XD 4GRWE 1S8DA 1HHJA 3RVXD 2WBWB 1YN6A 5DRWA 1DP0A 1MQKL 3MRRA 4KROC 3RI5K 3CFDA 4BUGA 4KTDL 1G7HA 2PYEB 3TEUA 1G84A 3VFMA 4DVBA 5HHQB 4LLDA 1RI8A 2X4QA 1AP2B 1FJ1B 3QBTB 3SEPA 5FOJA 1F4XL 3QDGA 2XQYG 3TLRA 3HNVL 5F9OL 4LLWA 1DDHB 2I60H 4QXWA 1OGTA 2HN7A 5J6HB 3WFBL 2BFVL 4OGYL 2YD2A 4E41A 3SE9H 2K7QA 3VXQA 1R0AL 3DIFA 5ESVB 4ZXBA 1BD2D 4DKAA 1QFWH 1EEUA 1KC5L 4G7VH 3T2NL 3U7YH 2ZSWA 4K3GA 4WUUD 3NZ8B 4LLMA 5CEYA 2EDEA 3L1OH 3C2SA 4YHKH 4X4MA 1VFBB 4XPTH 1DQLH 4XCFH 1N26A 3HS0A 2ZJSH 1LE9A 1K6QH 4YFEA 3ZYJA 4H88H 5DQDH 4UT9L 5E8NB 4KHXL 1OAZH 5T3ZE 5EB9A 1CICC 1WBXB 4MXWL 3SQBA 3QCTH 3KJ6L 4L8BB 5C09A 2MFNA 5CZXD 2VLRB 5ITBL 2BMKB 4GS7C 1IRAY 3ESVF 2A2QT 5JW5A 2FR4A 4KGLA 5INCA 4KHTL 5HBBA 4DEPC 5I1AB 1MNUL 1ZVSA 3E8UH 1GGBL 1WBZA 4MSWA 4ESKA 3QNZA 5MEPA 1B4RA 4TTGA 3M45A 2XA8L 1UADC 4DKEL 1UCBH 5T3ZH 3N9GL 1EGJA 1KJ3H 2XKSA 3LKSA 3CSPA 1AY1H 3QDMD 4XMKL 1Q38A 4KY1H 3RGHA 5BV7H 4P4KB 3SDXF 4TUJB 3MFFA 2PYEA 2FEEL 4NYLA 4Y8DC 3LKRA 4OM0L 4J1UA 4P2QE 5KJRH 1P84K 4XP4L 5BO1L 3NTCL 1KG0B 5GJSL 4Z7OF 2NY3D 2EDRA 1JV5B 3FTGA 4JZJA 5AWNH 4KJWC 1ERNA 4L9LC 2AV7B 5D96C 1LO3H 4G6AC 1MREH 4Y2DD 1GL4B 2M26A 5BOPA 4I0PA 4X8JB 5C0IB 4ZS6D 1E4XL 2YZ1A 5MP6H 5C0AD 5I6XC 3GM8A 5GGTA 4HIJA 2Q20A 3O6MH 3VGEA 1B2WL 2IGFL 5IW6A 4U1SA 4RQQA 3GHBH 3QG6A 1AD9B 1OSPL 4CVWA 2LE9A 3SJVD 3ILQD 3VXSE 3DXAB 3OJDB 1GC1C 4PRPE 4OF7A 5FGSA 4JDVB 1LO4H 1TQBB 4NKIH 2OMBA 3OGCB 4CADB 1U8KB 5D6DC 3UMTA 4D0BB 1A9EA 1OGAA 3V5HB 2DDQL 2H32B 3TPUA 3E3QC 1OB1B 1PQZB 2AJXH 2ZCHH 3PNWB 5JW5B 4JJ5A 2ZPKH 4YFLI 1BLNA 4PJ5A 2L7JA 3FQNA 4OLZH 4QRRD 3IVKB 1CDCA 1JL8A 2VITB 5JR1L 2J7LA 4H26B 3RWJB 4J23A 2C1PB 5I0DA 3KPLA 4MXQC 3VXUE 2V5MA 2NXYD 2DWEA 4JZOA 4KVCL 3G5VA 4M9OA 4F57L 4LLVB 1TVHA 3GKWH 1CGSH 1NC4B 4OCXL 4AIOA 4M6OL 5E2TH 3UBXB 2ADJB 1QHOA 1L7TL 4NBYB 5LJYH 2P4AB 4NSKA 1A3LH 4QKXB 2EZ0C 2X70A 5DSCA 5DMGC 4OZFH 4CW1A 1PLGH 2CO7B 3IJHA 5D7LA 4X80L 3NCYS 4DZ8B 4I2XA 1I9RH 3EBAA 4HPOL 5BQ7B 5I9QB 1NL0H 4GW5A 1A7OH 5HVWA 3GMRA 4Y4FC 5DR5L 2DQTL 3F7VB 4XNXH 5B39G 3VCLA 5GS0L 4X9GA 1BVKB 2YC1B 5MI0C 2B39A 2VISB 5FO9B 1JK8A 2H9GA 1I9IH 3NGBB 4NJ9L 1S9WB 1A6UH 4XT1C 4G6ML 1KPRB 3QSKB 4G9FB 5FGRA 4OGAC 5GGSY 2VAAB 3UTPE 3NAAH 3GBNH 5KZCD 4JO1L 2O93L 5JOFA 4MJIE 2RGSA 4HK3J 1TJGL 1BAFL 3U79A 1JF6A 1JTOA 2HLFC 5I1LA 1XF5A 3IAPA 3O4OC 1X44A 1PKQB 1LK2B 5CINL 3UTTA 1D9KB 1T7WA 5HDOA 3CFDB 4RISL 5AG8A 2P8LA 3ZDZE 3QULA 3G6DL 1P1ZA 3KG5A 4OCWL 1JGEB 2BVEA 5C8JA 1OTUC 2DTMH 1W2KT 3UJIL 2GYSA 1G7PB 4X5XB 3T0BA 3OB0H 1I9EA 3GIZH 3LKQB 3SDYH 1K85A 1DVFC 4YIQB 4FFYH 4XPAH 4I0KA 4F3FB 5I18H 2FHBA 1U6AH 3MRIA 4HFWA 1XZ0B 1GGYA 3FRPA 1I3RB 3RX8A 3GSXB 4LNRB 2PXYB 1EFXB 4M6NL 4F15B 3VFVA 3QUZB 1CXFA 2BNQB 5B4MD 4IRJD 5D1QB 5F70A 4XB7A 2QQLL 3QI9C 1LE9B 2CIKA 4WW2A 4WUUE 2A1WL 3GO1H 3SGDH 4MAYB 5SWSB 4GW5B 1MFAH 4CKVX 3RBSA 1S7WA 1WBYA 1C1EL 4X7TB 4K8RC 5GISH 3F7VA 3VCLB 2WUBH 4WTZG 1C5CH 3TBVB 4TRPH 1S7XB 1OW0C 5ID0B 3VMOA 3B6SB 3VWJB 1BZ9A 1OM3H 2H2SC 3U7WH 3MA9H 5L0QB 2XN9D 1A7QH 3CUPB 4RSVA 4N9GB 3THML 1IVLA 2VDKL 4NQCD 2KZWA 2MWCA 2YWZA 3U30B 3ULUE 3CXDH 1I1CA 3WD5H 4H26A 3CDGB 3QFDA 2ZG3A 4N0UB 4X83A 5EZLA 1FFNA 5E6IC 1VESA 3BH9A 4JRYD 3ARGD 3NCFB 2MQ3A 4UOW1 4JQIH 5GRZA 4Q0XL 5GS3A 4MA7H 5KTEL 3VA2C 1WCQA 4QHNB 5JLZB 3MCG1 1Q94A 4I0PC 2XG5A 3WNLA 3QEQB 3LIZH 1BZQK 1KT2A 2IAMD 4IMKC 4TULL 1KLUB 2NY6C 4X98B 1JI2A 1C8PA 2BNUA 3CFBB 3V0WH 3KJ4B 3HLAA 3P77A 3TWCL 3O6LL 2X4RB 1GPOH 3BEWA 1G7MB 1EVUA 3DV6B 3V2AR 1T1WA 2EIBA 4C57C 1KXTB 3WJJA 5HHMB 1H3PH 4XVSL 2OM5A 5B3NA 2V5RA 2NY2B 3EO0A 2A6DB 3BKCL 5L9DL 1RSFA 2FD6H 3O3DB 1K4CB 3RU8H 3LD8C 1BFVL 3HRZA 1CFQB 3OXSA 5DJCA 5HHVL 4FQCH 5L2KA 4LEXH 3SCMA 4Q97A 5DHVA 4RBPH 2V7NB 5D2NA 1MJ8H 3LSOB 4WU7A 3J8F7 1KTKE 2XZCH 4FQLL 4L4VE 2HMIC 3A0OA 4LPWA 4YPGA 3SE4A 5IJVA 3RA7L 1P7KB 4C54A 1T1XB 1TVBB 4QGTA 5EC1B 3B3IA 1ZXQA 3O2WL 4KKCD 2ATPA 4JRYB 3WO3B 4MD4A 5J06A 4P3DA 3AY4A 4AEFA 4EBQH 4OD2A 5GSVB 5DK2A 2W9DH 1PAMA 3U4AA 3TCLB 1MCOH 4U33A 3EYSL 3SE8L 4UUJA 3OL2A 4X6BB 3PHQB 3HPJB 1CLYL 2XTLA 1Y6NR 3PP4L 4NP4L 5C6TL 1K4DA 5E2UL 2IQ9H 3MBXH 3TC9A 1MHHB 5EC2B 2XI9A 3BFOA 4N0CD 4ODTL 4NC1C 4XVJL 3VXMD 3BP7B 5CMAB 4XPFL 3HE6D 3NA9L 4JPKL 1SY6A 4G6KL 3ZDZF 1QUNA 3HTLX 2WLYA 4RGND 1C16A 1F4AA 1VFUA 1ZT4A 1MAML 4ZPTB 4CMMA 1BVKA 3PGCB 4NO3B 2AABH 1JPSH 4JG1H 4ZTPL 4MZ2A 4AMKL 1MCNA 4YAQB 2DWDA 4QOKE 1E28A 1S9KC 3MLWH 3KXFE 3KPNA 1Z5LA 3NIFE 3CGTA 2Z91A 4ENED 4PJ5B 4DVRL 4RAUB 3D39B 2DJUA 3GRWA 1AE6H 4Y7MA 4GRWH 1XF5B 3IGAB 4U6HB 1V7ML 1ONQA 3NFNB 3SCMC 5ADPL 4TNWF 4HKZB 3KLAB 2HLFD 2HVKA 4N1EA 4NQEE 1WWWX 3HI5L 3VRLF 4Y4HC 3D39D 1MRCL 2VDLL 2ZOKB 2UWEE 3VFGL 4DN3L 5LBSL 3MROA 3GMNA 3QDGB 4L3AA 3SDDB 4ISVB 3LEYL 3UTSA 1EERB 3JBG7 2E7CA 3MLRL 4JHAH 3RVTC 3ARDD 3RTQC 2FGWL 4QHLB 1DDHA 4FXLA 4HK0B 3D5OF 3MUY1 1GAFL 3OXRB 1MHPH 3L3KA 1U8IA 4JKKA 4ELMF 4JAMA 1LMKA 1WAAA 2BY3A 3H7LA 1RK0B 1UEMA 4E41B 2X4RA 4LCIL 5BRZD 3T65A 5I76A 5INDA 4PJGB 3WL9B 2NY2D 3TV3L 2O5YH 2WQRA 5IK3B 4MA8L 4FQIH 1VPOL 3OGOE 4K23L 2HJLA 3NZ8A 4LVHB 3N1PC 1LO5B 2YPLA 1CXKA 2VKXA 4WFHD 4Z8FH 5IV2A 2H3NA 5DFVC 4D0CB 3S96B 3ZTJG 1CFTA 3QUKA 3S7GA 5KSUB 4PJGF 5DEFA 3VXUA 3WNNA 3U6RA 1MRFH 5F71A 5IIEB 1A4JB 5D1ZC 3INUH 3PV6A 1NBYB 4HC1H 2DKMA 3LN5A 4U2ZA 5I1HH 1KXQE 1N5YH 3S35H 5HVFB 3PGCA 4GKSB 2NYYC 1NANH 5T1KD 1I85C 2FSEA 1GGUA 2A0LD 4MA3A 5T5FL 3RTQA 3EHBC 1UH3A 1J1OH 2JLLA 2VLKE 3FZUC 4J3SA 4MD0B 4UQ2B 3SQOH 5JZ7C 1J5OH 4Z7QE 5HDLA 1Q8MA 5GS1B 1KCVL 1TFHA 1MCPL 2DQIH 3AS3A 2WANA 1T20A 3EJJX 3VWJC 3DPBA 3RBGA 4YXHL 4KVNL 2P46B 3G5XB 2NXYB 3HMXL 1DR9A 2Z4QA 5CD3A 4X6DA 4GG6F 4G8GA 1C7SA 1F58H 3ZTJH 1CFSA 3L5XH 5I1CH 4XI5D 4HIEA 3TBSA 1HEZA 1GVIA 3QI9A 3MCLH 3VXTB 2ESVA 3IETA 3O2VL 5DD5L 4DKFL 4JLRA 2B2XH 2R2EA 5CBAB 1JRHH 4WHDA 4QLRA 5GZOC 1U9KA 1XGRA 2FIKB 3AS0A 4KMTL 4I9WE 2P5WB 2FHFA 3QCUL 3W5NA 3FTGB 4FZEH 5FKAB 3KJ4C 3Q1SL 2MQ0A 2G75B 3LQZB 5DJDA 3RWHB 3LDBC 3M8OH 4CN4A 1XGUA 4I0PB 1HQ4B 4JN2A 4Z5RB 3FO2B 5JPNB 5D7IE 1T1YA 1MOEA 3VXOA 3ROOA 5KVDH 5AYUH 1K4CA 2JELH 5ICZB 2XKNB 5BMFL 1P6FA 3MACH 4DUVA 1RUKH 4LVEA 4JFQB 2CRYA 5KW9H 1SM3H 4G80B 5CJ8A 5FM5O 4KZEH 3ARGB 4JO2L 2OL3L 4FG6D 2UWEF 4U1NA 4OD3H 5L2JA 1VA9A 4D3CH 3PGFL 1PJ9A 2C1OB 3GGWA 5AD0A 4FG6C 4D0BA 1YC8A 3MGTB 1JPTH 4P2QD 1GIGH 5ECJE 2GJ6E 4YJZL 1ZHKA 4JJ5B 1EEZA 4P57A 4HBCL 25C8L 3QDMA 5JLZA 5CEZE 2HAZA 3MXWL 2QR0B 4JR9H 2WUCL 3DOSA 4PJIB 4O2EA 1D6VH 4PREA 1E4JA 2ZOLA 3NIFF 4XH2A 5E2WL 3KPLB 1LEIB 1KSRA 3F65A 1JWUA 5IB5B 3G5VB 2D9QB 2YUVA 5L7XH 3RWCA 3FN0H 3TO4B 2VC2H 3BN9C 1AI1L 1AGEB 3GNMH 4R26L 3IRPX 2ADJA 1NGPL 3STBA 4JFHE 3BUTA 3DMMA 2QLVB 3P4NB 3OG4B 1AO7A 1V8HA 2AJ3A 3B9KD 3CH8A 3IT8D 2YD4A 5DYOB 1DANU 3QAZB 3MBEC 5C7XL 1GRWA 5K59E 4PTTA 1A3RL 1FVCA 1FZOB 5CHNA 4OJFL 4C83A 3MRQB 2JB5H 3LQAL 3VXME 1Q0XL 3KXFD 3KHOA 2Y36L 3KYNA 1CU4H 3F8UB 4Z7UA 3GK8H 4ODVH 3DWTA 3RL1B 1O7VA 2UZIL 2X2YA 3S4SG 2O26U 5CGYD 5J57B 1D9KA 2ZNWA 5HGGS 1MUJB 3C8KB 4QF1A 3KPNB 1RUML 4GLRI 4BSJA 5FF6A 5GS1A 1F90H 4KJPD 4UIMB 3WV0A 1MI5B 4XCYB 1MWAH 3SY0B 4IOFD 3BD3A 3U48A 5HI5D 3OAYH 2G5RA 2IWGA 2C3XA 5KANG 4FFZL 1EHNA 1FDLH 3IDJB 1OP5K 1IE5A 2BSRA 2GJ6D 4ZO9A 3ZHLA 5T5NG 2PYEE 3JXAA 3PIQA 4HXBH 1B90A 5B39B 3N06B 3MNWB 4M48H 4BFGA 2DMBA 4YDVB 3SKOB 1QBLL 4YHIA 5EC2A 5HGHA 4MHHG 4OLWL 4WY7H 4XRCB 1UEYA 4D9RD 4DAGL 4YK4B 1MELA 4IHOA 4L29A 2XRAH 1Q9KA 3MV8A 1TQBC 3O6FC 3QEHA 1FFQA 4NM4L 4EIZC 2HTKC 3RNKB 1QPPA 3LEXB 2C4XA 3BKJH 3BDXA 1KIRA 43CAA 3MV11 3GSXA 4LNRA 4BH8A 1U92A 1BJ8A 3M1BB 4JPVL 1CGXA 3GSOA 1CQKA 4PS4H 3TF7C 5IV2B 3KPRA 3EO9L 5DYOA 2UUDH 4PGCB 4PRPA 1V3LA 2YEZB 4JN1H 1KENH 4CDHA 2Y6SC 5ERWA 5IVXF 4MLSA 2AK4B 5FXCH 4UU9A 3TIEA 4I1NB 5BRZA 1T7VA 5E8NA 4GKSA 1OPGH 1PYWB 4U6HA 2XXCB 4J6RH 4X6FA 3OHXB 4YHYC 1UKQA 2IJ0C 3GGWB 4TUOA 4ZUSB 1ADQH 4GFTB 1F8TL 3DVNB 1A7BA 1EEZB 4PRPD 1U3HA 4MZ3A 1PD6A 3WNPA 4JFOA 1UA6L 5C1MB 4K3DH 4ERSH 3MLSH 4GQPH 4ALAH 1QSEB 4CU8A 3HLAB 5JMRA 3CDGA 3QFDB 4K3EL 1ES0A 1OVZA 2IH3A 2EYRA 5IKCB 1MAJA 2HTLC 5DJAB 4AL8H 5IQ9A 3BIKA 4JFZH 5IESH 3CLEH 5BV7B 3ARWA 1EK3A 4RGNB 3UPRB 3ARBB 3LRGA 3C5ZD 4NRYB 3VFWA 1D5IL 3MNVA 5EO1B 4XTRC 1KIPB 3RI5F 1YEEL 2B1AL 5C3LD 2R0LL 2EDQA 2CKBH 3BGMA 3D3VA 5A2LH 4DTGL 2OTUB 4WWID 4UV4H 1DLHB 1LO2L 1NH6A 1E4WH 1OQXA 1H3WM 1Q9KB 4I3SL 4FQXC 4MJ6A 4ZDHA 5IHUH 5TE7L 5TQ2H 5GZOD 1AD9A 1OARH 3SKJH 3D18B 4JM4L 2R8SH 1MCFA 5BW7A 5T1MB 2EH8L 1WFNA 2FJFB 1CZ8H 2OZ4H 5EO0A 3VG9B 2O61A 1S7UB 3SJVE 3K74B 3BE1L 2ARJQ 4BQ8A 1RUAL 1MUJA 4IIQC 4BUHA 2BCKA 5GGTL 1YECL 3VFTA 5GGRA 4P5TA 4UIMA 4XAWH 3G08A 4DFIA 4O4YL 4RQQB 1RZJL 1FIGL 3Q5YA 2H26A 2ICWI 1S78C 1Z6JT 2F74B 3SDAB 1YEGH 4ZO7A 5DJ0A 3QUXD 1KNOB 3E6FA 1HH6A 1NAKL 1P4BL 5DHVB 1HHKB 4OCSH 3S4SA 4YBLC 5K59F 5DWUH 4OT1H 1Q1JL 1BZ7A 1DL7L 4OBSA 4CADA 5GZND 3S36L 5EU4B 1EIBA 2J3SA 3VFUB 1NBVH 5DGRA 2NR6D 3ZKXB 1A6VH 1AFVL 2IBBA 4K7PY 3QIUA 3QFJA 1R3LA 1IJ9A 2F54A 2A6KA 5F7WC 3IXTB 3MREA 1F13A 3O8XA 3SDCC 2FB4H 3MV9D 5JOPE 2AJSH 4JHZA 3LH2L 3LKPB 1DFBL 1XR8A 1YEHH 4M62L 1YQVH 5KSBF 3DMMD 3L95A 4LGRB 1KTLA 1BEYL 1TQCB 3RGVC 5E2VH 1KJ2H 3G5ZB 1QSZA 2HLAB 3W0WA 5CEZH 1A6ZA 1FSKB 1GJIA 2AJ3B 1GOHA 4WUUA 4BKLB 3JWDL 4ZUUB 5DD0L 5EDXA 3QO0B 4Z0BH 3D3VD 3U2SB 3IJHB 1OWWA 1UENA 5D70L 4N8VB 5KG9A 2X09A 4P2OA 2VLJB 5KANI 4WDIA 4OLVH 1ROWA 4WV1C 1UKSA 5LGJB 5DD1L 3QUYA 4UTBH 4TYUA 1KTDB 4YBHA 1H3VA 2CLRB 1K5NA 1D3CA 2D0GA 1QYGH 1A1NB 4YAQA 5CILH 4P46D 4DFHA 1DUZA 1E6JL 1AGCA 1L0YA 2FL5A 2RHEA 3PXHA 2WIMA 4PJDE 4AYFA 2IFFL 5JW3L 4XC1L 3KYMA 1W72L 4PV8B 1TITA 1R3JB 5LCVL 1TNMA 4UTAH 3MJGX 3ARFC 4LFHG 5ACZB 1KJVB 1CLOH 1ONQB 1UYWH 3NFNA 1G6RH 2IF7A 3ULVL 1UWEH 5J6HA 2I27N 1H5BA 4XCEA 3VXQB 4JFFB 2BDNL 1DLFH 2DL2A 4MAYD 3QCVH 4Y5VB 2XNAA 3VXRE 3FOMA 3L9RB 3T0AA 3PGDA 1R3LB 3HCVA 2JB6B 5EZOL 2O5XH 2DD8L 2NXZC 5DURD 2VYRE 5CGMA 2E9BA 2BNQD 2P45B 4WW2B 3I2CL 4M1CC 4BSWB 5I1KL 2OR9L 2Z8SA 4AENB 1AQKH 5F1NB 1AGBA 1J05A 4R97B 3OPZL 2F5BH 4PG2A 2FDBP 5DC0A 4QEGA 1U92B 3GBLA 2HT3C 5ISZE 1DEEA 3CVIH 5EUOA 4PRNA 4OLUH 5C71A 4M1DH 1MLBB 5KVMC 4L5FH 4KJPC 1FLRH 4GSDL 1ORSA 2C3VA 3PDOB 4KWUA 5I8EB 1RVFH 2Y07H 2QQKL 5IVOA 1E27A 4F8TA 5D2NE 2J88L 1KCLA 5L6YL 1T21A 5FA3A 4OLXH 1S9VA 5TDOB 4RA0C 4OZ4B 3WS3A 2DYPB 4DQOL 1BD2E 4ZTOL 3U6RB 2H2SD 1CICD 1OAKH 4LHUD 3X13A 5DT1L 5FUOH 4KUZL 3GSNL 4YEEA 4JRXB 1HNGA 3HB3D 3FO1A 2ERJC 4PJ7F 4GO6B 4LSUH 3TH4T 3IFLH 4LK4A 3LPFA 1F3RB 2P5ED 4H20L 4S1DD 3MRDA 2R29H 3HZYA 3FONA 3VRJA 2EDDA 3GMMA 1IC4H 4HDIB 5DFVD 1XFPA 2DOCA 4FP8H 3I6LE 3ZTNH 2VR4A 2CKBB 3ZT7A 4Z7UE 3MC0A 5DF0A 1C12B 2FBJH 5FYLL 4PGEA 2DQDH 5IOPA 4TQEH 2BSSA 2F54E 3BEWB 2OJZH 5DLML 3MOAH 4WNQB 2DRUA 5DEZA 5DXWA 3GI9H 3UAJD 2IBGA 2BHYA 1N3NB 3Q6FA 4UBDC 1EMTL 4U6TA 3L3JB 2ZCLH 2OTUA 2YN3A 2HT4C 1QFWI 1N4XH 4NNPL 2CUIA 3AMKA 2R0KL 2ZUXA 4H1LG 4L4VD 1QHPA 4EVNA 4XHQA 3MBED 3EOAB 4U7SA 3GKZA 2VLJA 1G1YA 2WSKA 5F9DC 1AHWA 5I8KL 4U1NB 1QD0A 2AEIT 5BRZB 1T1WB 4Z76A 3QDJB 5KOMC 4LPYA 2CLRA 3HE7A 4MNGE 4GOSA 3OHXA 1T2XA 1H3XA 2VDRH 4JANB 2HFGL 3RZCB 2KUTA 1IAMA 5CJQH 4PJ7A 5C6WH 5IM7A 4IIQA 4UOJA 3LQMA 3VWKA 4JG0H 2EDNA 2PW2B 4UZGA 1KB5A 3GBML 3BZ4A 5CFHA 2Q8AL 1TJHH 3D0LA 3EYOB 1W8OA 5EUOF 3WIFB 1T0MB 4PJDA 3SGJA 4YHMH 1FNGA 1Y0LA 4H0HB 2DWEB 4M5ZH 1I7ZA 4ZAKC 1CBVL 1T66D 2GITB 3IDXL 4LEOB 4BZ1H 1JHTA 5I1IH 3MRDB 3UZEA 2HKHH 3ZSSA 3AY4C 4YEFA 5MENE 1IL1B 2P7TB 1BJMA 4P57B 3OR7B 3RY5A 2X70B 3BP5A 3QUMH 2MMXA 3BP7A 2F19L 2NLJB 1TPXB 2XFXB 2EICA 4MQSB 4PLJD 4YNYB 3CAFA 3QRGL 5FHBL 5FHAH 3CFJA 3VA6A 3NPZB 3HMXA 2AQ2A 5E99L 4Z95H 4WWKC 1OWRM 4AEHH 4P46A 4MWFA 2XG4A 4FQ1L 3UZVB 5D93B 5FO8A 3O6FB 3U0WL 1IC1A 4IRSD 5SWSE 3S37L 3BD4A 1RZKH 2XY2A 4ONFH 2PO6B 2HKFH 3BKMH 1B0GB 4WU5A 1NCAL 3MV7A 5E08L 1WCBB 1VB9A 5ENWB 3IJSB 4QHKI 4K3HA 2I25N 2XPGB 2J6EL 5EU6A 4IEFB 3SY0A 3DO7B 4XB8A 1TZIA 1FO0B 2D4FA 3SGEI 5ICXB 3MXVL 3O9WA 4ZD3L 4OZIE 4ENEC 5GS2H 2B4CL 5D7JB 3HAEB 3SBWC 1JNNL 1HSAA 2MCPH 1YQ2A 1WVZA 4KK6C 5I1EL 3X11A 4MJ5A 1C5DA 1HOCB 1FIEA 2ENYA 2VTFA 2YPVL 3KLHD 5H35A 1NAML 3JVGA 2VXUL 3P4LA 3MRPB 4DGIH 2MPAL 1KB5H 2VL5A 1V7NH 4OSUL 3S88H 2MSPA 3JWOH 1T22A 2COQA 2G5BB 4JM2B 5BZWA 1NUFA 4HJGA 5C08D 2AEQL 4P9MH 3ZZ1A 3ZDYE 3K7UA 5CZVH 4JFFA 3UBXI 4PJGA 1JHKH 4L4JA 4ZQKA 3C60A 4RAVB 4I4WB 3QAZC 2JB6A 2FO4A 4I0CC 4U4BA 1KT2B 5HI4C 4R4ND 2XTJB 3S36X 4U0QB 3VGGA 4O2CB 2VE6B 5KG9B 4LCWE 5I30H 2JIXB 2ZSVA 1SEBB 4F9PA 5JW4N 5CSZB 4AZ8A 3MRBB 4GLRH 4X6FB 3WYRA 2J5LC 5INDB 3KPSE 4E41E 1A1NA 3GSOB 3R06A 4TUOB 4ZUSA 2EO1A 4WFFD 4LSVL 4NZRH 3RZCA 1XF4B 1B6DA 4PJCE 5F7YC 4PRPB 4KQ3H 2C7UA 1FZMB 2GSIB 4QWWC 1BFSA 3IDIA 1HK6A 2QHRL 3SN6N 3HC4H 5JO5A 2NY1D 2F58L 2EH7L 2XWJA 4AH2A 4JY5L 4XX1E 1QSEA 2CMRH 4Y5XB 3O6KL 1J87A 1RK1B 3ZE0F 2NNAB 4MB5A 1IEAA 1QRKA 4JQXA 1BM3H 1YN6B 3AM8C 5DRWB 2CXKA 3I6LD 1FNAA 1I3GL 1RZ7H 4YZFF 3PL6A 5IB2A 2R2EB 4WIQA 4QYOB 1S5HA 4LVNC 1UACH 4MXVE 3RWDB 5J6GA 4ZNEE 1QRNE 1KJ2A 2J8UB 2FIKA 2BY1A 1Y6MR 5EN2B 1RD6A 5E4EB 1OHQA 5F7DB 2PW1B 5EOTB 4FQPA 4ODHL 3T09A 4C56A 1G9NH 3QDHA 4NNXA 2CUMA 3ARFB 4EN3B 4P49A 1ZT1B 4NCC2 3O4LD 1R24A 3MLUL 5E94A 4U1IA 4YR6A 4B0MM 5ISZB 1FRGL 5ITFB 1U8PA 2WMPA 4OFKA 5M95B 4XCCL 4O51A 3VXMA 3FO0H 4LKCB 4NQXA 4EKXA 2HWZH 1G9ML 4IRJB 2VH5L 3MOBL 4H8WH 3GSRA 3I02A 1NGQH 1IAIH 4P2QA 4PRIB 5F7HA 3T0EB 3SGJC 1I8MA 4HZAA 3IFOB 2AXHA 1T80A 4HF5L 3LS5L 1LK2A 1IARB 4R8WL 5T33L 1RIVL 4PJHA 1DBJH 4LKXB 4M9PA 3TBWB 2O61B 5C09B 1HHGA 3HZMB 3RJQB 2CGRL 1S9WA 4M4PA 5EU7C 1CG9B 4Z7OE 1DN0B 3S8WA 2IAMA 3GZKA 4G6JL 2YRZA 1DQDL 4XNMB 1BVLB 5IQ7L 3AFLA 3HZKB 5MEPB 3E6HB 1VGKA 4OGAD 5CEXB 4JRYE 2YA2A 5GGRY 1B0WA 3NH7L 2DIJA 3P4OB 5IB5A 5C07B 3MCKA 2GTZA 1JPGB 1XGQB 1FAIH 1YPZF 3IDGB 4GBXB 1AXTL 2LQRA 3GMNB 4XBPA 1U0QA 4GW1B 5D6CA 4WEBH 4AEIH 4LL9A 3WO4C 2C3GA 1NMBH 4KROB 3OKNA 4EUPH 3MMEA 1QVOB 4HWBH 1EAPA 1VFBA 2V5SA 1KTLB 4PJIA 4O02L 3TIDA 3MLYH 1C5BH 3B5GA 3T65B 4JDTL 1TTUA 3V5DA 2YZ8A 3L5JA 5DUML 2JKXA 3QHTC 1J1PL 1I1AB 3RP1A 1LE5A 2R56H 2X5PA 1RZJC 1Z3GL 3DV4A 2ESVD 1EA9C 3QJFB 2EDXA 3LOWA 2QADC 4PJEE 4G6AD 4ZUUA 3DX7A 4O58L 3PWPE 3F5WA 5GS2D 2VLMD 5HGDA 8CGTA 1S9XB 4N8VA 4L8DB 5GIRA 4HEME 5DRNB 5I1AA 3SKUD 4QXGH 4PLOB 3QIWC 3OKDB 4ONGL 4L9LA 3VFNA 3DHMA 4EUPG 1QSFA 4N0UA 4KTEL 2BERA 5MEOB 1LVEA 3FB6B 1L9MA 1S8DB 2IALA 3KPSB 3Q0HA 3VGBA 1L0QA 3GSQA 3D85D 3DGGB 3C08L 3MTRA 5DTFA 1SY6H 4POYA 1CLCA 3S34L 1SBSL 1EGJH 2R1XB 4P59H 3HUJF 5JIIA 3PNWA 1AGFB 3BYTA 1ZTXL 5IMKB 4OZIF 1F42A 2QEJA 1S9YA 3F62A 3OKEB 3TM6A 4XTRD 5JMOC 2VQ1A 5HHPB 3P9WB 3TFKC 5IEHB 4PLKC 2DQUH 2G5BA 1CT8A 5ESAB 2NLJA 5D2NC 1PDKA 5C0BE 1AQDA 4WWKB 4WFFE 3QEHB 5E8DL 3BPCA 4D94A 3EYUH 4FTVE 4OIIH 3ARRA 4TSAH 1FNHA 5B8CA 2XIDA 3CX5K 4PFEA 1N6QL 4NN7B 5IHBA 2KL6A 5D1QC 2AW2A 3SJVB 1QG3A 3BQUB 2FX7L 3K80A 2VERN 1YNKH 2W0KA 1XF2B 4Z7WF 5TH2B 2YKLH 1XGRB 1CXEA 4QTIL 5HYJE 3WIIL 4IJ3B 5C70A 2EIZA 3BDYH 3HRZB 3BOVA 1EDQA 4JKLA 4IRJA 2ICWA 4Z78A 1ZWIB 4YZFE 1GC1H 1FO0A 2DQHL 4M5YH 3TH3T 2D3VA 5DURB 3LRHA 4NGHH 3QEUB 4YPGB 5IGXL 1NUGA 1OAYL 3Q5OA 4NUGH 2R69H 3IJYB 1MLBA 4RFOL 5E00A 1Q9LA 2DKSA 3KS0J 2AJZA 2V9TA 1E27B 1IZJA 1ZVSB 4M8QB 4E41D 2G2RB 4XMPL 4JO3H 3LN9A 3K4AA 1NKOA 4NIKB 5JOFB 1NPUA 4B7IA 1WLHA 4UU9B 2FLBT 1K9TA 1ES0B 4K3JH 5GGQL 3V7AE 4APQA 1DQJA 1DUYB 2DBLH 1D5XA 1OP5H 3MLVH 4LAQH 3OB0K 4NKOB 4Q9QL 3W82A 5EULV 3RWEB 4QYOA 2Q6WB 1I9JL 3GEWB 1S78D 3U36B 2B5IC 5T3ZD 1J1XL 5I2IB 3WNKA 1PEWA 1C12A 2CKBA 1AKJB 3PWJB 3PJSB 1A2YA 5J89A 1XGYL 1UG9A 1HILB 4G9FE 1IMHC 4NQVA 4HUWB 1N0XL 5DJ8A 1BJ1J 1JIBA 4NO2B 3O9WC 1AGEA 1XF1A 5DQJB 4LOUC 3L5HA 5F3BA 4YDKL 4E42B 1E28B 3U0TB 1T1YB 3QXTA 1X5HA 4MQXD 2SEBB 3BPNC 3BEVA 1HHIB 4R7NB 2PW2A 4I3GA 2VZSA 2CIKB 2K3TA 4MGXA 1HN1A 2OQJA 4ZPVA 4GAJL 4PLNC 1ZLSH 1HHKA 1JZ3A 2ILLA 2FX9H 3KYKH 5A1AA 3DVGA 2WLZA 3X3GH 1EHLL 3TN0D 1WF5A 3HE7B 4YDJB 4URTB 5AAWA 2XTJC 1EO8H 2R2BB 2EEDA 3U9PH 2UZXB 2NW2B 3IJYA 4OF3A 2BY2A 4PBWD 4FQHA 3O3EA 35C8H 4KZDH 3W9EB 3VI4F 1P7HL 4F80A 3M17A 4K2UH 2R4SH 4Z7VA 2VZ3A 4LCUB 1MEXL 3RWDA 3ZDXE 5C08B 3A67L 4XPHL 1RZIB 2HJFB 4FFVD 1OAXL 4QRTA 4D0DA 4P99A 1U93A 1HH6B 3D69A 3AVEA 2PW1A 4KI1A 2ITDB 1JGUL 1IT9H 2VLME 4XP6H 1AXSB 2B4CC 3IDGA 2DM3A 2PETA 1ND0A 4NM8L 3CXHJ 5HGHB 5CSGA 2FZ3B 3SJVA 4JPIA 1F2XK 4RFEB 4OB5L 5C0CB 3MLZL 4O9HL 3FKUS 5C0BA 3UJJL 4PJEB 3VXMB 1SYSA 4ZOBA 4JQVA 1RUQH 5ESQB 4M93B 1RIHH 5IIEA 1R5VB 3QWQB 2APXA 4Y89A 4NJAL 3I02B 1YPZE 1FNFA 1I8LA 4HCRA 4G6FB 4HKBB 4DW2L 2CO6B 5HD8C 1T66C 4X9BA 1IKFL 5DZLA 3FFCA 4MS8C 2R0ZL 3LRSB 3RWIA 4U1GB 4PUBH 4YWGL 3FAXA 3O3DA 4I2XE 1U8HB 3HC0A 1F45A 1MFBL 3W81A 4GKZA 4WWKD 1JGDB 3BAEL 3B9DA 5E5MB 1NCCH 1NBYA 3PQYA 3P0YH 3RTQD 3ETBF 5IFHH 3VMNA 3FQWA 3QEQD 5GRJH 5LXGL 3Q6GL 2PR4L 3OKLA 4GRLA 3ZL4H 1DQMH 2Q3ZA 4U7KA 4WTWA 2FL5B 3BPNB 1JGVH 5I8OL 1P9MC 4FQHB 4LASL 1NDGA 1NLDL 4LMQE 5EZIL 1U3HB 5FM5M 4F7CA 1MCCA 1KEGH 2ZUQC 1JNJA 4EEEA 5FYJH 1OSZB 2HFEA 1Q94B 3KPQA 2Y1VA 3AXLA 1FYTE 4RMUA 3TNNB 5BW7C 5ANMB 3PJSA 3LHPH 2GEEA 3TFKD 3MGOA 4PJHE 4UDUB 5ALCL 2X7LB 3QUYC 3SPVB 3MRBA 5J13B 5CKAA 1H5BB 5IFAL 4GMTL 4ZXBB 5KVGH 5DVMA 5EBLA 4Y5YA 3VD9A 3U0TA 2VSDA 1AR2A 4ZMAT 5JZ7D 2EZ0D 3HS0B 2DLHA 1M71B 4CU7A 4M1GL 2P42B 5SWSD 5ERWB 4K8RD 5EUKB 3L3OA 4OZ4A 1YJDH 2JJVA 4NO0B 1GZQB 5C9JA 3QEUA 3LZFL 3FQXA 1W0VA 4IDJH 4LCCA 1XGUB 2PNDA 3DVIA 4KKNA 4NHCH 3BGFB 3RIAK 4GBXD 1PG7W 4U0RC 5F6HI 5CGTA 4RRPA 5IBLD 2YD5A 4R90L 2X42A 4CDGC 1CF8L 2YPLE 2R4RL 3STLA 1HH9B 4TSBL 3WLWD 3WS6A 2DYPA 3ALWA 4LDLB 3B2VL 5ESAA 5IVXA 1JV5A 5L8LB 4U1KA 3CK0L 4MNQE 3FQWB 2P8MB 4R7DA 4EOWL 5F8QC 15C8L 4YBQD 3ULVE 3UPRA 4L3CB 5ISZA 1Z2KA 3R1GH 3HI1A 4RDQG 3V52H 3VRJB 3NACL 2E27L 2Y23A 1PX3A 2CK0H 2FRGP 1XF2A 2W9EH 3DSFH 4NQXB 2F53D 2ZCKL 3K2UH 3RZWA 3WFDL 3GMOA 1QFHA 5ALBH 1DBML 3FJTA 3WKNA 1IAIM 2Z31B 2AV7A 3REVB 2VB5A 3EDJA 4C56B 1YNLL 5L88H 1JMXA 1LEGA 1INEH 2AXFA 4NC1E 1JRHI 4PJXB 4NZTH 4N0FB 4U1LB 1IGCL 1OAQL 3AAZA 3L3DA 1JWMB 3UO1L 3KLHC 3T1FB 3GSRB 4W6XB 2EO9A 1N0LA 2VDML 2H3NB 4D0CA 1M71A 5C0ND 4NN6B 2OTPA 4PB9L 5HYFA 3QUYB 3LMJL 3EJYD 1T6WA 3DYMA 5MERB 1EXUA 1CXLA 4PGDB 1XMWA 4GRWF 5JHDB 4BYHA 3CLFL 4FABH 3VWKC 3KLAA 5T1DL 3RGVD 4GBXA 1T83C 3F6LA 2P47B 3D25A 3FQNB 3JVGC 4K8RH 4Z7VB 4PJHF 1AJ7H 2CRIA 3OR7A 2X1PA 4IIQB 4CW1B 4AEEA 3ZHKA 1RZFH 3U36A 3QJHA 4R96A 2WWMC 2PUQT 5E6IB 5AZ2L 2M1KA 3RWJA 3EFFB 1WZ1L 3IXAA 4JZJC 1FH5H 4HUUB 3U30C 1JYNA 1S3KL 3MSPA 4UDUA 1L4IA 4GMSL 2I5YH 2FJHB 4DGYH 2H1PL 2NYYD 2ZG2A 1JHTB 4XNZB 5J0BA 4P3CH 5EBLB 3NCEB 5SX5H 3GMQA 1OTSD 3TT1H 4Q9RH 3C09B 5D6CB 1QO3A 4Y1AE 5D7LB 5CBAA 3N1MC 4YGVA 1JHLL 1LEKA 1Q72H 1VEOA 4Y4HD 5JUEH 3DXAD 1FL5A 2DLEA 4WJ5A 3O4LE 1NCBH 3BQUD 4QGYA 5H2BA 1CGWA 4M3JA 3D9AL 1FL3A 3OR6A 4G3YL 4J4PA 1IBGL 1DEEB 5TJWK 2B0SL 3LEVL 3WS6C 2Z35B 1I1AA 2VWEC 1HOCA 4D9RE 3N85L 4ZS7H 3M1BA 1IM9A 4U1LA 1MH5B 3WFHA 1L6XA 1KULA 5BS0B 5D8JL 4PB0H 2KQNA 1U8HA 1R3KA 4ZODA 4XXCC 3HNSL 4X9IA 1RULH 3OAUL 2A6IB 4U6VH 7FABL 2YRPA 5F1KC 1GGTA 2UWEA 4UV7L 4YE4L 4WRLA 4ZYKA 1EFQA 5HD8D 5J13C 1AIFB 3E3QE 5F96H 2UYLB 3ULSB 4QRTB 5DUPL 1KCSL 1JI1A 4R0LB 1JPFA 4JFYA 4Q9BA 3LD8B 5DVNA 2F5AH 4RZCB 3QULB 3MNVB 4LCYA 1IC7L 3P11L 5F93C 5TH2A 5HXMA 4XP1L 4L8SB 2XZAL 5C0JA 4Y5YC 3HAEH 4P9HL 4YIQA 3IU4H 4F9LC 3CMOH 4R4BA 4Z7WB 1ZWIA 3RPKA 4S1SH 3MZTA 2APWA 4ZXBD 3VG0H 2FBOJ 3ARZA 3BSZH 5DUBA 3UPAA 2GAZA 1UM5L 1C08A 3VFVB 4NQEA 1I7UB 2PXYA 3RIAF 5A3IC 5KVEL 2X05A 4DJMA 1XGTB 4JO4L 2YPLB 2ZZUT 4QY8A 5CEYB 3RWFA 2CIIB 1KIUA 1IC5H 3PF2A 5I8EA 2C7UB 4LHQB 1FVCB 1DSFH 3LS4H 2CRZA 4NDMB 3UXFA 2WV3A 4NCC1 4OFDA 5E6ZA 4AH2B 2ARJB 1WBXA 4DCQB 3CZFB 3MRKB 5DVKA 3A6OA 5CJOH 5TE6L 1IEAB 4EQ3A 5I71B 4XC3L 4G5ZL 4Y16C 3HI6H 2BMKA 4PJ8A 2E5EA 4XHJC 5CJXC 4M02A 2AI0L 1DBBL 1UQSB 3TN0B 4DZBA 5I19H 1I8IB 3WLBA 4HSQA 4Z77B 3H9SB 4NOFA 1HYRC 2R1WA 1RURH 3EW3B 4NQCA 4BQCA 4RAHA 3O9WD 1D6EA 4S1QH 2JK5B 1K3ZA 2RCSL 4I18C 2AK1H 3HG1B 3VXRB 3KYOA 3B43A 2R15A 2O5ZL 4M43H 4H5SA 3VFRB 2Q6WA 5F3BB 2EDTA 1ACYL 3G04B 3C8DA 1FORH 4MNQD 2NY5L 1P2CA 4TNWK 1JGLL 4MNHA 2DB8A 1LK3L 4PJIE 3RHWK 2PCPB 3T2PA 1I4FB 5TFSH 3B8SA 1VDGA 2A83B 2X4TA 2AJYH 2VO5A 3D2UB 3GI8L 3ORJA 5FKAA 5FYKD 1OD7A 1YEIL 5D93C 4EVNB 1JWSA 1PZ5B 3FB7B 3G6JF 4I18B 3FRPG 1FZKB 3ARFD 3STZB 2YD1A 1LP9E 2NY0D 1VKXB 2GTWA 2WBJA 3PWPA 1OTTC 4ORZC 4D9LH 3MV9E 4BH8B 2ZUYA 3U1SH 3ROOB 1AGCB 4JGMA 5ADOH 2X4UB 4F58H 1HWGB 3KVQA 3CVHA 4FQQB 4NN5B 3T1FA 1AC6A 1HKLL 5I73B 3F7QA 4AT6B 5HI5C 2BJMH 4WFGE 5EU6B 3F7YA 4JPWL 5I75C 2W65A 2EE6A 1MJUH 1CVRA 3CMGA 1M6OB 1IAOA 3T77A 3IVKA 5GHWL 1FGVH 3H0TB 4ZFFB 4Y4FD 4WU7B 4KC3B 2V7NA 4E5XB 3JWDC 4NBZB 1PKOA 1O0VA 1LD9A 3MO1A 2B5IB 4GKOA 4OCNC 4WCYH 4OKVA 4UT7L 1J18A 5CLTA 3HI1B 1WQVT 4XNMA 5IT2L 5CMAA 1GOGA 4NRXB 4EDWH 4L4TA 4NRZB 1EAJA 2G60L 2YUXA 2V2WB 3CFJB 4GAGH 4I3RH 2V17L 2HVJA 1YEFH 3QDJD 3HPJA 1MCSA 3S6CA 3TJHD 2DJ4A 4H5SB 4XNUL 2NX5A 2JF1A 3MJ8B 4X6CE 3ARTA 3K4DA 3SKNA 2FATH 4NSKB 4RFEA 4X6CB 1MFEL 4YGVB 1EO7A 1YMMD 4U1JB 3UTQB 4ZFGH 5F6IB 1QFPA 2H41A 1YEDB 3FO9A 4ZO6A 4X8XA 1TZHA 3WFBH 5ESQA 4PYGA 1R0AH 4RX4D 5ENWA 5IVXE 5EA0L 1U41A 3MV7E 2AKRA 4TUKH 3T2NH 3U7YL 5KSBB 1IAKB 3OMZA 1BGXL 4N68A 3SOBH 3OKKB 1GSMA 3K3QA 3AMLA 4YHKL 5JA9A 3PWPB 2NZ9D 5I9QC 2GKIA 1KN2L 2ZJSL 3TNMB 1K6QL 5INCB 4DK6A 4H88L 5DQDL 4PJBB 2Q86B 2Z9TA 4IS6A 3IDNB 4MXWH 4FTVD 3BH8A 3QCTL 2Y7QA 1GHFH 4NQCB 1QNZL 3DUSB 1ZA3B 4M7ZB 4WEMB 4UT6L 3MGOB 4I5BA 1IZKA 1FG2B 1FV1A 3BW9A 4FQXD 1QTYT 5CUSL 2IH3B 4KHTH 4HUUA 1AGDB 4POZC 1QPXA 3V6ZB 2LU7A 3E8UL 5I1JL 4LFHD 3IFPB 3KYOB 3DRQA 3JZ7A 4NUJB 3FONB 4F7CB 3KNBB 1GGIH 1TMCB 3G6JE 5C92A 4HK3N 4HIHB 2FO4B 3BZEB 1XH3A 4IBLT 1MRDL 1KJ3L 4KKBC 1TVDA 2V9QA 4GKNB 4HS8H 3V4VL 4A6YB 1FFPB 3P73B 4KY1L 1RY7B 5IVNA 4XP5L 4OZGF 5I1DB 4LHJB 3S37X 1IGYB 2EEBA 4NQEB 4TVPH 3BPOC 3G5ZA 1SEBA 3HNTH 1OOAA 4Y5YB 3GRWL 5BVPL 3IKCB 3TBVA 1X5ZA 5GJSH 3ZKXC 2C3HA 4MQ7B 4P4KC 4XMLL 5AWNL 5FDYA 5AZEL 1CLZL 5HHOE 2RB8A 3G08B 4JKPL 2YHGA 4H0GA 2P5WD 1T0NB 3H9YA 3MV9B 3ZLQC 1I7ZB 3O6ML 3P40A 4HIEB 1B2WH 2IGFH 4EXPX 1CG9A 2IBZY 4F7EA 4PJ9D 1DN2A 3VFUA 5EUOE 3MO1B 2LFGA 1CIDA 3KPRE 1IL1A 2RIKA 2IQAA 4OF5A 3EDKA 3NVQA 1X4ZA 3FMGH 3NPSB 1ZLWH 1HIMH 3KWWB 2DDQH 2W38A 4P46B 4MWFB 3WIFA 4WV1B 1A7RH 3UZQA 1L9NA 4QT5B 4G9FD 3T2OA 2NQCA 2VDOL 5EO1A 3QPXL 3ARED 4HV8B 4H0IA 4L1DA 5JXAL 4KVCH 4O51B 1OCWH 3TYFA 2LVCA 5EBWB 4KH2A 4MJ6B 4J4PD 4QRPB 1JWSB 4ZDHB 5ICXA 2BNUB 5DRXA 4OZGB 1HILA 4MB3A 1FZKA 4ETQB 3GMRB 1CGTA 2DN7A 2NX5E 4K7FB 4JM2F 5F1NA 1YYML 5I17B 2YC1A 3BKYL 3NZHH 1NLBH 5DJDB 2QKIA 1K5NB 3VXPB 4X80H 3ULVF 3AREA 3DHJA 4AT6A 1NL0L 3CDFA 3O3EB 1XCTA 4L8DA 4R3SB 4XNYH 3I6KB 5IBUB 2Y4SA 1A7NL 3H0TA 4ZFFA 3IDNA 2VDNL 4WI6A 1I9IL 5MEOA 4EN3C 3BP6B 5CEXA 2XV6B 3QYCA 4MMZC 3VD3A 2C1OA 4IOFC 4N0RA 1SJVA 2VXSH 4PGDA 5JHDA 4JZOB 4LHUB 1WT5C 3GBNL 2UUDK 3C6LD 4OM1H 4ZUWA 1NCDL 3VXSD 4FNLL 5MEQB 3UBXA 2VWEE 3LN4B 5F6IC 4OI7A 1VACB 1QLFA 5CINH 1BMGA 3OX8B 4PJAF 1CR9L 1QVOA 2XQBL 1R3IL 3PXJA 1CE6A 2DLIA 4YUEH 3MV01 2AXJA 4JE4B 3TBYB 2HT2C 2KDGA 4HKBA 3G6DH 4PGEB 3SDXB 1S7QA 1NCUA 4OCWH 2A9NL 3WXVL 2W0FA 1MIEH 4HKXA 4ONHA 1A8JH 3UJIH 2NX5B 5C0FA 4QT5A 4GUPA 1AXSA 5JW4Q 3MR9B 3RWGA 4H25A 5EO9A 3QA3A 1EHXA 1J9CT 4KTYA 1QFUH 1MFDL 4U2YA 5AEAA 1LP9F 4H1LB 2JJWA 4LSSH 4NQSB 4P4RA 4JHWL 1W72B 1CGYA 1E6OH 4NHUB 4JVPA 4U3CA 3CFKA 3SE3A 5EFIA 1HZHL 2Z35A 5DFTA 4RWYL 2J8HA 2HH0H 4LSRL 2CLVB 4R0LA 2IALB 4MJID 5E8EB 1UC6A 5E00B 4EI5C 5BS0A 1FYTD 3MJ6A 7CGTA 4NWTH 1IM9B 3OSKA 5HHOA 3W11C 4LSPL 1LDPH 5FV2A 3C6LB 1NKRA 3GHEH 1BJ1H 3TJEH 3OKEA 5GISL 5D6DA 2BRRL 2GJ6B 5TF1H 2WUBL 1KB5B 2YMXL 4TRPL 3OAZH 2D31A 4UILL 2R1YA 3MRJA 3Q3GA 1FFRA 1PX4A 2DQGH 1YEKH 4ODUB 1KJMA 5KVFL 4NNXB 4EN3A 3T0EC 4UMGA 3TZVB 3NPSC 1J86A 3U7WL 5HYEA 2ORBH 5DDHB 4CVZB 3JV5A 4GJTB 1EJOH 4P4KA 5HHOD 4LCYB 2AJUL 2DTSA 4FTVA 4WI2A 4IRSA 1OW0A 4LQFH 5C0RL 3C5ZC 3U4EA 3UC0L 5DFWH 2IH1A 1RAMA 1WWBX 2Y5TA 4X9FA 5LVEA 1CE6B 2D2OA 5KSUA 5A2FA 5F1OB 4Y19E 4LSTH 2ICWJ 2Q7YA 1KEML 1MCLA 4J12A 1W0VB 3LN5B 3BT2L 1GZQA 1YMMA 4HWEH 5ETUA 4HWUA 1RHFA 2YPLD 4TULH 5KAQG 1ZHBB 3GSNB 5D2LB 2A6DA 2SEBA 3AREB 4NC0B 4KXZI 4HQQL 2D7NA 3DARA 4PJCB 4UINL 1UVQA 4GQ9L 4Y2OA 3EZJB 3VXUB 2NY0C 2C1PA 5GGVH 5DEGB 5HPOA 1WWCA 5D7JC 1NMAL 3H3PH 2RJMA 1FNSL 4B7LA 1TIUA 3LCYA 5CIPA 4LCCB 2MJWA 5D7JD 1T2QL 4EJ1C 3PWUB 3R8BB 3V5HA 3HMWL 2EDWA 4M7LT 5H35B 5HGBA 4LEXL 5EOQL 3GMMB 5HYIA 5MEQA 3DX6A 5FCUL 3T3PF 4BQBA 4MCYA 4FRWA 3NFSL 2YXMA 5LWYL 2VITA 2XZCL 3IF1B 4FQLH 4XCNA 2VLKB 2PO6D 3RA7H 1A1MB 2VZOA 4Z7QF 3GMOB 1MCEA 4RFNB 3O6FD 3ZT5A 1G7LA 3ILPB 5FIEA 1RFDL 2EKJA 3Q48A 4NQVB 4EBQL 1WGOA 5IF0A 1ND0B 1RZKC 4LARH 1MVUA 5TDNB 1HEZB 5F9AC 4OV5B 4JGJA 4FZ8L 4X99B 1PBYA 4JN2B 1SEQH 4GW1A 3O4LA 2GJJA 3V8OA 4FXKA 2YK1L 2NX5D 3AAZB 5C3TA 2WWKO 3MRMB 5CD5C 3DX8A 1FE8L 3NBNA 4NP4H 1M6OA 5E2UH 1A21A 5D72H 1I1YB 1TCMA 3ET9F 1NCWH 3SBWA 3W2DL 1M7IA 1G0XA 1A6AB 3MX0A 1PG7H 1LHZA 3CX2A 1BBDL 1UKTA 2ADFL 4OAWA 4G42B 1JZ6A 3FFCB 4UIKH 1KCUH 5D4QA 1QSED 1UZ8B 3X11B 5F7FA 4G6KH 3VFTB 4BH7B 4E0RB 4LRIC 3GMPA 2BCKB 2OYPA 1MHCB 3ECBB 3ARXA 4MVBD 5IB4B 1YYLL 4OTXH 4EXKA 3IDIB 4P3DB 3M17B 2VXVH 3LKQA 3ZHDA 3VD5A 4HUVB 1TJIH 5D7IF 2HJFA 5FYKU 3TVMD 43C9A 3MLXH 1KB9K 2AJVL 2W60B 4KV5E 4ODUA 4JFEB 3UTTB 2ITDA 3BQUA 5ESVA 4DGVL 2KKQA 4NPYB 5GQBA 5KN5A 2QV2A 1MCRA 4OF6A 1P1ZB 1AGFA 3PL6B 1FGNH 1QO3B 4OCYL 5IMKA 5IB2B 1V7MH 2DQEL 2AGJL 2E6JA 2ENSA 2K9UA 3GJFH 4L4TB 1PVHA 4NRZA 4LPVA 3B2UD 4IRZH 1RU9H 3WEXA 3T0DA 5HVHC 4G9DA 2XWTB 3DURA 3SDXA 5F7DA 3MODL 1OF2B 2VDPH 3PDDA 1CL7H 4TOYH 3FT2A 3ILPA 1F6FB 3ARQA 3P2TA 4MJ2A 1YMMB 3QXAB 3IDYB 1A4KA 1LWRA 2VLRA 2N1KA 2HA1A 3VWJA 4Y4HB 3FFCE 1CFTB 4PTTB 5CWSB 3NN8B 3RVUC 1D5ZB 1YUHA 3QUZD 2FX8H 1NSNH 2QQNH 2YS4A 4K9EH 2V5TA 3FT4B 3BP6A 1X5FA 3EYFB 3QHZL 4JKWA 4PRBA 4Q6IC 1M05A 4QXTB 5T3XH 4C4KT 5DHYA 4KJYA 1RJLA 2APFA 2X89A 3WDHA 5E6ID 3OJMB 3RDTC 1FBIL 2GK0B 4G8GE 1MRFL 3KNBA 2V2TB 1H0DB 2GFBB 3QEGH 2LV4A 2VL5B 1VGEL 1BZ9B 1FN4A 1N5YL 3CFEB 1NGWB 3H9HA 1HXYB 2ESVE 2Q8BL 3SQOL 1ZSDA 1KJMB 1J5OL 2VRAA 1KF9B 3CC5B 1KELH 3SO5A 4APQB 3PIQB 1U3ZA 3E0GA 1E4XI 4S1RH 2VABB 5EU6D 4YXHH 5CP3A 3D1MC 3LB6C 3RUGB 4RAVA 4JLRB 2EDYA 2BNRB 4L3EE 5GSRA 4K71C 3SKOA 5I16A 2MKLC 3UYOD 5FEBA 3U4EB 4MA1B 1Z9LA 4WI8A 3AGVA 1F58L 4XBGB 5GGUB 2ZWLT 4K94L 4LLQB 4LSQH 2X4OA 5D7IA 1AGBB 1J05B 4RNRA 1YJDC 3MV8B 3BPOB 3TZVC 4XVUC 3C5SB 3WFCH 2VN4A 2B2XL 4U1HA 4UQ3A 3RNKA 1SYVA 1ZK9A 4N0YL 1HQ4A 4Z5RA 1T6VN 4NKQB 4FA8A 4JEGB 2VDQL 4K55A 1ZLWK 1G7QA 5HDBF 4DCQA 2C26A 3B9KC 4HIXL 5FB8B 4P5TC 1RUPL 1XGPB 2JCCF 5DC4B 2NY7H 4ZOAA 4MHHI 5IB4A 1AR1D 1LDSA 4MVBC 4RGNC 1VFMA 1J8KA 1INDL 5FA3B 6FABH 3SGKC 1I1FB 3C60D 1DBKH 2OQJB 4JRXA 4KI5D 3BRFA 3X13B 1A7PH 1TNNA 3A6CL 4Y1AB 2E6PA 4WV1A 5D7LE 4YX2L 5T1LD 5TE4L 3KPSA 1F11A 1F4WH 3UYRH 1X6NA 4M3KB 1NJ9A 1RUKL 2ADGB 4G43A 4HT1H 3G04A 3O45B 3NCJH 1S5HB 4JO2H 3MJ7B 2CDFA 4V1DB 3WBDA 4OD3L 5IVZB 2R9HC 2OL3B 4M7JL 3PGFH 5A40E 3D3VB 2DLFH 4Y16A 3SE4C 3BJLA 1SMOA 4GW4A 3U46A 4JZNB 3B9KA 4HXAH 1QSEE 1JPTL 5BVJA 1AO7E 4ODSH 1JWUB 3WN5C 4I18A 3ARFA 4G7YL 4ODXA 3CFCL 1AHWC 5IQ9B 3HG1A 5EORH 1PZUB 1KGCD 4CVXA 1A22B 5A16A 5B8CB 2VABA 4PY7A 2Y25A 4IRJC 4HPYL 4NRYA 1QEWB 4WW1B 1KCRH 1MFNA 1PKQE 5J12C 3MRFA 4U1SB 2Z91B 3I9GL 3BWAB 5F8RC 1WITA 4OLYL 1MIML 5E2JA 5EBWA 3P9LB 1IQWH 4H8WC 4WFGD 3H42H 1AHWB 3MJ9A 3DI3B 3E2HC 2EE2A 1LO0H 2EYSB 4FQXB 4NO3A 4LU5H 1S7TB 5C7XH 4XBEL 2DQJH 12E8H 5GPRA 4HZLB 4LEOA 5BJTB 1VEMA 1IM9D 4X7EC 3MGTA 4JB9L 1WAAF 2Y36H 3LRSA 3RWIB 3F12B 4ZSOB 4M8QA 1U36A 4U05A 4CJ1A 3EYOA 4X6EA 2GSGB 1M7DA 1ZEAH 3T1WA 5L2KD 4Q6IA 4APQC 2IG2L 4CMHB 4OCRL 3ESUF 1TVHB 3EOBA 1M1SA 1F90L 1BZ7B 1FC2D 2GTZB 3MNWA 1P4IH 3VWJD 2VZTA 4DN4H 3VXUD 5ILTL 3AB0B 5I15H 4PGJA 1OAUH 3LQAC 1FDLL 4OGXL 3BMVA 1JNLL 3SHSA 3O8XB 5IW1B 1F6AB 4M7KL 1EAPB 4KQ4H 5HDQL 5BV7C 5HPMB 1WJ3A 2C4FT 4RGOL 5GRUL 4YNYA 1AKJA 3PWJA 3FFDB 3WSQH 2VLRD 4CAGA 2ICWB 1TETH 1VERA 1X4XA 1RIUH 3HAEA 1WEJH 3CCHA 1QBLH 1U8MB 3QWOA 1TDQA 3W0WB 4JVWA 3X12A 1K8IA 1U8JB 3H3BC 5K9JH 1B0GA 3ARPA 4PD4K 4PGZA 2YD9A 5DHXB 2W0LA 1EFXD 3SDDD 3HG1D 4H1LA 5FYJD 1UJTA 1CIUA 3S5LB 3STLB 4KDTA 2VXQL 5DZNA 3QDGE 1HINH 2XZZA 2UWEB 3Q3GB 3CZJA 1CFSB 2DF3A 4Z7NE 2R0WH 4JGUA 4XX1G 5DHYB 5SWZA 3QQ4A 3IFPA 4YDJA 4NQDD 5E95B 3ZSTA 2BVQA 2P8LB 4JY6A 1KENL 1AGDA 3V6ZA 1UM4H 4MD0A 4UQ2A 3TN0C 1S5IH 2YSSB 3VW3H 1X3DA 4HIHA 5JQ6L 4XVTH 1D9KD 3JV4B 4JRXE 4WUKH 4NQTA 5EPMB 5A43C 4GKNA 1GGCL 1A0QL 2ZKHL 1FYTB 1QSFE 3KXFB 3MJ9L 4Q6IB 2D0FA 4PLJC 3X3FH 3CC5A 4M6ML 2J12B 4GRMB 3HE7D 1YC7A 5CIPH 3W0WD 2DKUA 4I5BB 1NC2A 3EOBB 5K9OA 1F8TH 3PQYE 5CP7B 3ARBA 1IGYA 4NWUL 3REWB 5LQBL 4KJQD 1E0OB 2FECL 3U7AA 1MF2H 4I77H 4ELMB 3W11D 5DQJA 2NY6B 3TO2B 5EUOB 3PHOA 3LKNA 3L9RA 5LGHL 5ID1B 1IGJA 1YDPB 4K3EH 3L6FA 4AL8L 4FQ2L 5IESL 3IAQA 4HAFA 3G9VA 3O3UN 2Z31D 2LTQB 5FGCE 1CL7I 3O11A 4O2CA 4GG6B 1RZ8A 1D5IH 3VXRD 2J8UE 4G8EB 4RIRB 4AG4L 1J0HA 1MJ7L 3WNMA 5CSZA 2IPTH 1Z0NA 1ZHBA 5JOPD 1K3IA 3GJFK 2FH6A 1Z9OA 4JFPA 5K33A 2UVEA 3WIHA 1JFQH 3B6SA 3HHRB 1OARL 1G7JB 1UM6H 3PL6C 3IDMA 2AEPL 2WK2A 3EFDH 4OD2B 1Z9SA 4OQTH 3HE7C 3E6FB 4X4YB 3EDFA 3O4OB 1TTFA 3BE1H 1H8OA 4Y4FA 4R6UA 4RGMC 3OZ9H 1DQJB 1FNLA 1OL0A 2JCCE 3UYPA 3TYGL 3BH9B 5IOPB 2MOVA 2ZNXA 4O4YH 4J3UA 4KKCC 3RKDC 4UOW0 4WNQA 2D03H 4HJJL 1NCTA 5J9PB 1TLKA 4HX1A 1P4BH 1SQ2N 3WUWG 3W0WE 2IQAB 2FYYA 1WZLA 2B1HH 2VIRA 5LG1A 4HFUL 1N7ML 3PWVB 3BHBA 5EPMA 4ZAKA 1S7SB 3UTOA 1SYSB 1E4KA 1Q0YL 1NBVL 4PRIA 4U3XA 1N59B 3KPMB 4EQ2A 1JUFA 1AFVH 1ADQA 4OZGA 1ZT7B 2XTJE 5HHXL 1QBMH 5HVHB 2RFXA 3OKMB 2FB4L 4X7DC 2WNGA 5TDNA 3ALPA 1U8PB 5EZJB 1KFAL 2AJSL 2V2XA 3LH2H 1IKNA 1I75A 1YQVL 4HV8A 2IAMB 3HE6C 1EHAA 4FXKB 5FGBC 1KN4L 1BEYH 4QRSB 4U1MA 4XNZC 5F1SA 5TPWH 2APVA 3RY6A 5IW6B 1BX2B 5J1SC 5CEZL 1SJEB 1VADB 2NY3B 5C2UB 5FUCE 4Y88A 3K0WA 2OP4L 4BFEA 1U91A 5DMKB 2NZ9C 2CQVA 3JWDH 3UTSE 5DJ2B 4Z0BL 1ZS8B 3QIWB 3RL1A 3FQXB 3RHWF 3WMSA 1T0MA 4WI3A 3C5JB 4JREC 1HWHB 5F1IA 4G8IB 1WFUA 1HHGB 2B20A 4KK5D 3P30L 1WZKA 5JA8B 5TDPA 4OLVL 2XN9A 2DM7A 5C0JB 1UXWA 4J3TA 1BWWA 1NDMA 1PSKH 3S9DB 1M7DB 4UB0H 4EUPB 1CFVH 3K8LA 5CILL 3DUSA 1A5FL 3QB7C 3BO8A 2W9LA 5D7KE 1OF2A 3VDBA 1FNGB 1TXKA 2BC4B 4LLVA 4JAMB 2CH8A 1U8QA 5C0FB 1KBGL 2OSLB 2XNAB 3M07A 3L7FA 2D0HA 2Z8RA 1ODAA 3ZT6A 2NY6D 4YXKL 2IFGA 3S3PA 4KRNA 3BZFB 4BKLA 5D1QD 1UXSA 1CLOL 5E8OB 1YZZA 2KQMA 3QZWA 5IMOB 3HR6A 4EIGB 3BGAA 2BDNH 4KTDH 4PRID 1QKZH 2HRPH 1V3MA 5EIVA 3U4BL 2PXYD 5CCKL 2ZUSA 4TTDC 5EZOH 3FT2B 1F4XH 1X5GA 2M8XA 1CK0H 3OJVC 4R9HA 2BK8A 3VJ6B 4P9HC 4HGMA 5HHOB 1CTOA 2DIAA 2I60L 4QOKB 1JWMA 4OGYH 1GZPA 4XNQB 3HC0B 4Y5VC 5HGDB 2F5BL 4XP9L 5FUZH 1MJJB 1LP9B 2Y06H 2N7BA 3PWLB 3O2DH 3CVIL 1I85A 1L7IH 3RGVB 5FECA 3H7BB 4OLUL 2CJUH 5C07D 4UI2A 1NGXA 4FQJH 4AQ1B 5FA4A 3MRJB 1S7VA 3QIWA 1I3RA 4U31A 2BVQB 4JY6B 1VFAB 1DQLL 1RZGB 1J0JA 2A73B 2P24A 2HT4D 2UVFA 4FTVB 2V6HA 1JGEA 4KUZH 4O5LL 1FFOB 4MJIB 4W6YB 3UAJC 4JFDA 5JQHC 3KJ6H 5GS0C 3P0VL 1FSKC 4DK3A 1DANT 4TSCL 4LP5A 3IFLL 3O3AB 1N64H 4PG2C 5IB1A 2R29L 2I9TA 5E4EC 3STZA 1JUFB 1IC4L 1GGBH 3RPIB 1JF1B 1G7QB 2XA8H 4XWGH 1WK0A 5EZJA 3IKCA 5T3ZL 4EDXB 3DUUB 3EYVB 2PCPA 4L4TD 3NIGE 4QNPE 5D1QA 3F7YB 3RJDA 5M94B 5I66A 5I8CB 1DLHA 2X4OB 1FL5B 3WKML 1JBJA 5DLMH 4RNRB 1P4LB 1ZHNB 1HI6B 1FL3B 3EUUA 2R23A 2EDOA 3QNXA 3VD7A 2ZCLL 2IBZX 5EU5B 4OM0H 4PD4J 2XZQH 1N4XL 4XP4H 2EEAA 3BRGC 2A77L 2OK0L 4P4KD 1JYXA 5EOCH 1P6AB 4L8CA 2C3WA 3DX6B 4QHNA 4LCWD 4N8VG 2LU4A 3RAJL 5FFLA 1HH9A 2J5LB 3UDWA 1FPTH 1KLUA 2P8PB 1X5AA 4MXQD 1IM3A 4EUPA 2VR5A 1A1MA 4N9OB 3RGVA 4LLAA 5FECB 4MDJA 2HFGH 4X7SL 4XPGH 4R7DB 5EZLB 4PREB 4KGJA 1QLEL 4NO2A 4Y19A 2UV3A 1VFAA 3V7MA 3FQUB 5L0QC 1KOAA 1T7YA 4N5EC 1U8QB 4QXUH 4E42A 3MUGB 4ZOCA 1QEWA 1KLFA 1TJHL 5FK9B 5HYQA 1LO4L 4MJ4A 3LKNB 4PJBF 4NKIL 4C58B 4FXGB 4U6YA 4YHML 1ORQA 4HD9A 3O3BA 4YHYB 4HIJB 3PP3K 1MHEB 3ARBC 3RL2B 3UJTL 1A2YB 4C83B 4NOBA 5I1IL 4ODXB 2NTFB 2ZPKL 2BSED 4ZNCD 1G7MA 2KBGA 2R39A 3G6AA 4N0FA 3QUML 5IJKC 1SJHB 2F19H 4L4VA 5E6YA 4PJHB 3QRGH 5FHBH 4AY0A 4OLEA 3V4UH 3MRFB 2VXTL 1G9NC 5ANME 4U0RB 3BP4A 4IMLA 3RRQA 4HWZA 1KPVA 4FQ1H 4F33B 3MYJB 3BH8B 2Z93A 1L7TH 1A3LL 5SV4A 1MWAA 2OXGA 1JVKA 4K7PL 4Q74A 3DXAA 4YQXH 4YHOH 5FKPA 1JZ7A 1MFCH 1YMME 3DLQR 3PV7A 3V7AG 1NCAH 1IGFL 4UDTB 2BRQA 4LKXA 1MCWM 2QSCL 2J6EH 1P53A 5BS0D 1G9MC 3DECA 4NPYA 3FB5A 1TVBA 5EC1A 3MRPA 4L8CB 3V6FB 2XACC 2OXHA 2E7HA 5DR5H 3PG2A 2DQTH 4XNXL 3TBTB 5GS0H 2WWMD 5GSVA 3KPSD 1FFOA 4MJIA 5D71H 4WI9A 1F2QA 3WJLC 3CSGA 2J4WL 4G6MH 4IHOB 5I1DA 1YMHB 5DD6B 5SV3A 1U93B 3PHSA 3V6OC 3NABH 4M6AA 5E9DB 1RJYB 1J8HB 2J8OA 3OWEA 3UTTE 3ROLA 3T3MF 3KLSA 3MPCA 3T0EE 1BAFH 2YPKA 1UJ3B 2X10A 3S88L 5FGCB 4XZUA 4Y5VA 2EYTB 4QRPD 5F9OH 4YHZH 2FR4B 2FEDC 5EO9B 2CKNA 2AEQH 3O0RL 1IGIL 3NIDF 2C5DC 3IFNL 1SJXA 4ZS6C 3RFZC 1KGCE 5BQ7A 2QJDA 5EOCJ 1QFWL 4AENA 4NQSA 2YRLA 1KC5H 4P23B 4KJQC 3ZYIA 4G7VL 1D5ZA 1YUHB 2D7TH 1EV2E 2LU3A 4JM2C 1QRND 4Y1AD 3L1OL 1BHGA 4NNYA 4FFYL 4QF1B 3GJFB 4W4OA 4XCFL 3RY6C 3X12B 5DD3L 4KJYB 3PDOA 4UT9H 4XCYA 2VLJE 5FO7A 3EGSA 1GYAA 5JO5B 1Q9OA 4KHXH 3KGRA 4YHPB 3ZKMD 4G8FA 4OCMC 1HXYA 2QSQA 1BBJB 1NGWA 5JTWA 4LIQL 4MAUH 1NGXB 3QUYD 3L3KB 1U8IB 4PJEF 4Q58C 3T0WA 4NT6B 4JVUA 1QRNA 1SMAA 3CDCA 3WE6B 3KHQA 3PWUA 1MPAH 3H6JA 4TUJA 3MBEA 2EH7H 1B4JL 4DKEH 1UCBL 1C1EH 1NDGB 3QEQE 5FK9A 5HYQB 1NBZB 3L7EB 3WHXA 1ZANL 4CU6A 3DVFA 2X4TB 4XMKH 4GRMA 1BM3L 3O11B 2DYPD 3P9MB 1IGML 5HJ3A 5BV7L 3N1FC 4A6YH 2Y5TB 1I3GH 3QXUA 3ES6A 4OFYD 3KPRD 3REWA 1OM3L 43CAB 4Z76B 1NC2B 3MA9L 1UACL 3THMH 4XPBL 1U8KA 5DJZA 3QQ9D 5KJRL 4IJ3C 5FYJE 1EX0A 3CXDL 1AKJD 4LBEB 5LAXA 2NCMA 3NTCH 3VI3F 3W39A 3WD5L 3ZYZA 5I6XB 1BREA 2DM2A 4U1JA 2W0PA 5JORA 4HHAA 3U0PB 4ODHH 4R3SA 4AJ0A 5D7LD 4XBGA 5GGUA 4OZIB 1F4HA 3MA7A 3V9FA 1LO3L 1PFCA 1A6AA 4NZUH 1MREL 5SWSA 3HA0A 5KTEH 2R23B 2VZ1A 3QNXB 5D2LE 1E4XH 5MP6L 4X6DE 3QWRD 3ARYA 4M03A 3IB4A 3KR3H 3LIZL 5IFJB 1QQDB 3MLPA 2IPKA 4OIAA 4QRRB 1DQQB 1G9MH 3TBSB 1EEQA 2H32A 3TPUB 3GHBL 1DN0A 3DETD 4V2CB 4BH7A 5HTSA 1EUUA 3L5WA 3TWCH 4G43B 4OKDA 1NMCB 1Q9OB 3AREC 3LS5H 4Y19D 2A9MH 4GT7A 4R8WH 4XVSH 3MRLA 3G5XA 4KKAD 3RVWD 4Y4FB 4S0SD 3VMPA 2P49B 1P7QA 2G75A 5FO8B 3RU8L 2P8MA 4UNVA 1BFVH 4OLZL 3DV6A 2GITA 4ZUWB 5HHVH 4QO1A 4FQCL 5C0AB 5FDWB 3QI9B 1P2CB 1IEHA 3DBXA 4HX1B 3L3DB 2F8VA 4EI5D 1N8ZA 2ICEB 3RZCC 4JDZA 5ITFA 5DI8B 3BP5B 2WM0A 3GKWL 3PQYD 1QZ1A 4OCXH 5BOZG 4F37F 1A3QA 4P23D 2JJSC 5E2TL 3CFBA 1ZT7A 5HJ3B 5D1ZB 3O2WH 1Y6KR 4JFED 2W9DL 2X1XR 5AUMA 1UWXK 1F4YL 1KPRA 4MB4A 4X6CF 3EYSH 3F5WB 1RHHA 4HS3B 3EO0B 5HSFA 5BRZE 1CLYH 3LV3A 2FWOB 3QXDA 3QISA 4PTUA 4FFVC 1PEZA 5C6TH 1A6WH 2XPGA 5H8DA 5IBLC 5TQ0H 4PP1C 3TO4C 1YEJH 3H9SE 4ODTH 3B8YA 5EH1A 4X6EB 5FYLD 3TCXA 1OGTB 4OF0A 2WP3T 3NA9H 2BC4A 1EZVX 3ZE2E 5B38A 4J3XA 3UX9B 2BVPA 3NAAL 3CSYA 1D5MA 4JO1H 2GK0A 1P7KA 4M00A 2P5EA 3DRQB 4RRPG 2MHAA 4MX7B 5HHPA 3OBAA 3TA3C 3HCVB 5ELIA 3BZEA 5DJXB 4MQTB 2ERJB 4PP2B 1ZGLA 1DTUA 4GRLC 4X4XA 1CDUA 3T0ED 2R1YB 3MLWL 3WIHH 2BVYA 2HVJB 4GAYB 4QRPE 1EFXA 2DTML 4DVRH 2DIBA 1A6ZB 2YD6A 3ZE1E 4MS8D 1K8DA 3GIZL 3SDYL 2DJSA 3JV0A 5HYSB 4XPAL 3DBXB 4XI5C 1YEDA 2OLDA 3FO9B 5I18L 3VGDA 1UXSB 4AK1A 4LIQE 4X4ME 5J3HD 3SO3B 4Y4HA 5E8DH 4OIIL 4WHTB 1N6QH 1AH1A 2CUHA 1T21B 3BYYA 4M6NH 4P23A 2VDLH 5DMIL 4ZYKB 1S7WB 4KAQL 1WBYB 4X7TA 4DN3H 1YNKL 1WAAE 5C0DA 3ARSA 3LEYH 2CDGA 4PBXA 2YWYA 1AXIB 4LAJH 2DMKA 4BQ9A 3T04D 3VXPA 3B5HA 1DEDA 2A73A 1RV6X 2CK2A 2P24B 3BDYL 4DEPB 1CFBA 2DLGA 2A1WH 1BQLL 5ID0A 4AM0A 3ME0A 5GRVK 1T03H 4R4FH 3C60C 1KCKA 2DQHH 1MI5A 1BPVA 4M5YL 1FYHB 2WWKT 3S35X 3S5LA 1W0WB 1W8NA 1CDHA 2E8ZA 5IEHA 4MA8H 1VPOH 2X9YA 2CXGA 4RFOH 1VENA 2HTLD 3ULSA 5GS0D 3UCRA 1RMFH 1AIFA 5C0EB 1BP3B 2ADGA 5CSBA 4YXLL 1L0XA 5K93A 5SWZB 4JO3L 1QSFD 3SDAD 1A7QL 3ROLB 5I76B 1X5IA 1CD9B 2FJGB 5FGBA 5D2LF 4L8SA 1DQTA 1MCKA 3A6BH 4PRIE 4W6WB 3S35L 4HCRH 1NEZB 3T0VA 4YBQC 3DX8B 2NR6C 1J0ZA 5IMMA 5T1KA 4NN7C 5D96B 5LKNA 1JYVA 4JQIL 5DEFB 5DJ8B 1CYGA 2DQFA 4Q0XH 5GJTL 2E7BA 4G8EA 4RIRA 4GAYA 3RPIA 1I9JH 1S7RB 2BNQE 5H37H 4KVNH 4Z9KB 4LNVA 2OJEA 3BXNB 3DRTA 3C2AH 3QQNA 1FAKT 1XEDA 1EVTC 4X99A 4HWNA 5K9KB 1OP3K 3VU2A 5JORB 3QA3B 1G7JA 1UZ6E 4DUWA 1XIWD 3H8NA 3BEVB 1ZVYA 3L3HB 3L6FB 1S9VB 1FC1A 1H3PL 3SCMB 4WGWB 2DQCL 4OFVA 4X4YA 3O2VH 5DD5H 1Q9WB 1HYSC 4P46C 1JRHL 3TP4A 4WHCA 3PUCA 5L9DH 2FD6L 5F7KC 3QIUD 3TA3B 4NKMB 3MUGA 3W9EA 5E7FA 3SCMD 5J7CC 5E1AA 4GAJH 1UQSA 2MHAB 4MX7A 4Z77A 2FX9L 2LAAA 3DVNA 4M4RA 2Y72A 3M8OL 4LSDA 5JHDD 5KSVA 5IVZA 4QHUB 3QFJD 3VRIB 3DTXB 5KSBE 1J11A 1D6EB 4X4XB 2NTFA 3UEZA 3VXRA 35C8L 1QACA 2BSSB 4XAKD 5DC9B 2EYRB 5B38G 3MACL 4P2CG 4CVUA 3CNKA 2R4SL 1CCZA 5C0AA 5KW9L 1MAKA 4YFLF 5A16B 4CVXB 5B3JE 1LEGB 5DJZB 3L3JA 4BSVA 5DI8A 2J8UF 4HGKC 3SE8H 4WW1A 2P1YA 4TVPD 5HPMA 3GB7A 4LPXA 4QRPA 5CP3H 5CWSA 2GIYA 1S7SA 4XP6L 3T77B 2IQ9L 1GIGL 3ZO0A 3MBXL 3ULVD 3HFML 2YUZA 3ARGA 3T3PE 4HBCH 5AUMB 1YY9D 1J0YA 4NHUA 5FYKL 4XVJH 2IAND 4CBPA 3PE9A 4XPFH 3O41B 4HKZA 3UJJH 4JPKH 1S7UA 1LQSR 3GSNA 1FCGA 4YLQT 3CPLA 3H9SD 1D5BA 1BD2A 5C8JB 2OI9B 5FYLE 1UXWB 2Z8WC 4DW2H 5F9JA 4P5TB 3MYJA 2PXYC 2XWBA 2E7MA 2VC2L 5DJYB 5FOBA 4NRXA 2A74A 4JG1L 1IKFH 4ZTPH 5A2IH 3V4PH 2V2WA 1H8SA 3VD4A 1ZSDB 1QSVA 3VDAA 3WLWC 3MRIB 4C4KO 3NCBB 2Y6SD 3TH2T 3UPCA 5IUSA 4OZHE 4FFWD 4LMQI 3BUYB 5DS8B 4OJFH 1N6UA 3RUGF 2JB5L 3LQAH 2BNRA 5GSRB 2FO1A 4M8VA 3GK8L 1CXHA 3QNYA 1AD0A 5DJ6B 4ODVL 3RKPA 3V6FA 2FZ3A 3X17A 3P4NA 3CFEA 4JDZB 3DUHA 4LRNH 5ADPH 2H6PB 4CRPA 4NO0D 1YMHA 1WICA 5D1ZD 1MCDA 3PV6B 1UZ6F 3HPLA 3VFGH 4ONHB 1NC2D 3CCHB 3EO1B 4TNVK 1T7XA<