4ZK8A

Copper-containing nitrite reductase from thermophilic bacterium geobacillus thermodenitrificans (re-refined)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
294
structure length
294
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
publication title Structural insights into the function of a thermostable copper-containing nitrite reductase
pubmed doi rcsb
source organism Geobacillus thermodenitrificans ng80-2
total genus 98
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4zk8A00
1NIDA 1XB6A 2ZXWB 2HRHA 1KCWA 2CBPA 4AKQA 4BXSV 5I6MA 4NB7A 2QDWA 2CAKA 2DWTA 5B7FA 2JKWA 3SBRA 4BXVA 3AZUA 4DP5X 1EHKB 1ID2A 2BW4A 4HCIA 3FYEB 4AI7A 1ZIBA 2BO0A 2TSAA 1M56B 3EH5B 1AZBA 3NP4A 1AR1B 3MBWB 2YXVA 3BQVA 4GP5B 1ASOA 4A67A 1W8EA 2VMJA 2IAAC 2IWKA 1NIFA 1SFDA 3G5WA 1CC3A 3ZBMA 1CUOA 5I26A 1W6LA 4N8UA 3UACA 1AS7A 2BW5A 2DYRB 8PAZA 3WNIA 3NJLA 2NRDA 3D12B 1KBVA 5FC9A 1GS6X 1WA0X 1PY0A 4KOBA 3S8FB 1PLBA 3FT0A 2XX0A 1I53A 1KGYE 1JZEA 2PLTA 4DP8X 2CALA 1E67A 4DP4X 2FNWA 1A4CA 1ASPA 3X1EA 2MTAA 3N2JA 1GS8A 3T71A 2XX1A 4HAKA 1OCZB 2HLEB 3CVCA 2IWEA 3T6XA 1AZUA 3H56A 1JZJA 1J9RA 1AZRA 1NTDA 4JHVA 3T6WA 3QJVB 1QHQA 1SHWA 1J9SA 3H4FA 3FU7B 4GY4A 3C75A 1R1CA 2GHZA 2Q5BA 2X87A 2BWDA 1DYZA 4WKXA 2GC4C 2GIMA 1HAWA 5I6OA 1L9QA 2XXFA 2Y69B 2BZCA 1ASQA 3ABLB 4YSPA 2AZUA 4ZK8A 1JERA 4KNTA 2H47C 1EZLA 5I28A 3T9WA 2VW4A 1ILUA 3NJHA 1ZDQA 4E9TA 4QLWA 3ABGA 3KW8A 1OE2A 5B1AB 1V10A 3S3DB 1CURA 4FA7B 4F7KA 1J9TA 2HX9A 2W8CA 3NSFA 2OJ1A 3BVDB 2YAEA 4YSOA 2A3TA 3UAEA 5B3SB 1PLAA 4UF7C 3NYKA 1UATA 4YVUA 2YAOA 5E9NA 4W9ZA 5TK4A 2XXGA 1L9TA 2UXFA 4A2FA 3NJGA 1KDJA 3OMAB 6PCYA 2PPEA 3QJRB 3TASA 4UANA 5B7EA 4Q89A 3KW7A 5I6KA 3SQRA 7PCYA 3IN2A 4KO6A 2AFNA 1WS8A 2QPDB 4YVNA 3V9EA 3ABKB 2IDSA 7PAZA 5B7MA 1XMEB 4FAAB 2DV6A 5I6LA 2VW7A 3FSAA 3V9CA 4BWWA 5D4JA 3ASNB 2E86A 4F2FA 3QJUB 4DP2X 1BYOA 1PF3A 3IE9A 2W88A 3OMIB 1IUZA 4KNUA 1BQKA 2PP9A 3IEAA 3TA4D 1OCRB 4L0PB 4HIPA 2HX8A 3NJKA 1L9OA 4QKTA 1QNIA 3X1GA 2UX7A 5AFAA 2UXTA 3GXUB 1JOIA 1NICA 3OD3A 2CJ3A 3UGEA 3OMNB 5ANHA 4DP6X 2IDFA 1ETJA 2J55A 5I5MA 4DP9X 4JHUA 2UX6A 2YARA 2J56A 1PLCA 3OM3B 3FSVA 4DPAX 3WNJA 2HXAA 2XV3A 3ASOB 2YAPA 3ABMB 3DIVA 3H4HA 4YSQA 4AZUA 1X9UA 1NPNA 4BDVA 1V55B 1JVOA 2YXWA 2FT8A 2GBAA 1JVLA 1OV8A 4G7RB 1E5YA 5D4HA 2IDUA 1ET5A 4P5RA 4E9YA 2FQGA 3CVDA 4HHGA 1MG3C 1YLBB 2CCWA 3DTUB 4G71B 4E9XA 1OE1A 1GS7A 2H3XC 1URIA 1JZGA 2N0MA 3WG7B 1MZYA 1ZIAA 1J5CA 3AG3B 1BXUA 3CZUB 4CSPA 3AW5A 1ILSA 2DWSA 1NPJA 2YAHA 3SBPA 4F2EA 1M9WA 1RCYA 2JFCA 4HCGA 2EILB 4Q8BA 3CDZA 3GYRA 1A8ZA 1A65A 4HCFA 1XB8A 4AKPA 5D4IA 1AOZA 2P80A 2ZONA 2EIMB 4M3HA 1BQRA 4GP4B 1RZQA 2GI0A 4PCYA 1IC0A 2WSDA 1BXVA 1FWXA 3L45A 1ZPUA 4EF3A 3NJIA 4M4RB 2AZAA 1NWOA 1KDIA 2PCFA 1B3IA 4TXVB 1WAEA 1NIEA 1NZRA 2YAQA 4YSTA 2BP8A 2PPFA 4BK5C 2FJSA 3OQRA 1SDDA 1SFHA 1W6WA 3GDCA 2QPEB 2X88A 1AZNA 3X1FA 3NT0A 1OCCB 2J57A 3FS9A 1JZFA 4A2EA 3WKQA 1GYCA 4YSAA 4YSSA 3S8GB 1PZCA 3PXLA 1PMYA 2VW6A 2PP7A 3AY2A 3UADA 2HRGA 1JXDA 1E30A 1T5KA 4A66A 3X1BA 2IWFA 2LLNA 1AG6A 1A3ZA 3PAVA 3FYIB 1AANA 2I85A 1MDAA 5AKRA 1L9PA 1PAZA 4HALA 1KBWA 3AG1B 1PNCA 2FT7A 2XV2A 5AZUA 2VN3A 3UAAA 4N4YB 1KYAA 2BZ7A 4NAJA 1AZCA 4GYBA 2H5UA 4RH4A 2BP0A 3S3CB 2VM3A 1BEXA 3ZX1A 4AX3A 4YSCA 2HX7A 2XUWA 3RYMA 4HZ1A 3JTBA 5PCYA 2P80D 1E5ZA 4CSZA 4E9VA 3CDZB 1SF5A 2R7EA 1AS8A 1GY1A 4JKNA 3NP3A 1MG2C 1SHXA 3AG4B 4GXFA 1IBYA 4G7SB 4BWTA 2JXMA 3WI9A 1BAWA 2PPCA 2FT6A 3QJQB 1AIZA 1ZDSA 2GSMB 4KO9A 1OF0A 2BP8B 4A2DA 1SDDB 3EH4B 3T6ZA 1NIAA 1NINA 1FFTB 3PPSA 2VSKB 4DP0X 3ZIYA 2ZOOA 1ZV2A 4A2GA 3NSYA 3FU8A 3HB3B 2OCCB 2UXVA 4WTQA 2XLLA 4KOCA 3FQYA 3N55A 4ENZA 9PCYA 3ERXA 1JZHA 3PLYA 1IBZA 1L9RA 3FU7A 1KV7A 3IBOA 5B1KA 4DPBX 1SF3A 4GP8B 1SJMA 3CG8A 6PAZA 1E65A 3QPKA 2CUAA 3FSWA 3WKPA 2BP0B 2XU9A 2FTAA 2YQBA 1MZZA 4E9RA 2IH9A 2FWLB 1AACA 1BYPA 1QLEB 2QT6A 1AS6A 1ET8A 4X4KA 1HAUA 2R7EB 1SNRA 3TBBA 1CYXA 1JZIA 4YSRA 2DY2A 3T6VA 1AQ8A 1TU2A 1ET7A 3X1NA 2Q9OA 3FPYA 4W1TA 1HFUA 2I7SA 2PPAA 3QJTB 1AG0A 1DZ0A 1L9SA 2I7OA 4MFHA 5EHFA 1J9QA 3DKHA 4KO5A 2IH8A 1WS7A 1PNDA 1VLXA 2VSMB 2YAMA 2VM4A 3UABA 2AANA 1ADWA 4KO7A 5I6PA 4G72B 4DPCX 3AG2B 2IDTA 2GC7C 1GR7A 4KNSA 3X2QB 1PZAA 1BQ5A 2OV0A 3TU6A 1PCSA 1A4AA 2EINB 3FQ1A 3NJMA 2WO2B 1AAJA 4G7QB 4PAZA 4HHWA 4E9SA 4BDVB 5B1BB 3PAZA 1GY2A 1N68A 4NERA 2XVBA 3NJJA 4A68A 1GW0A 4YSUA 4AKOA 2UXGA 3TBCA 1TKWA 1JXFA 1JXGA 2WO3B 2FQFA 3FSZA 5IY5B 3S3BB 2FQEA 1OE3A 4G70B 5TK2A 4DP1X 4DP7X 4E9WA 4A2HA 1F56A 1N70A 3QJSB 3HEIB 4YSEA 3JT2A 3NJFA 1X9RA 4P5SA 1NIBA 2IDQA 3WIAA 1J5DA 3NJNA 3EHBB 3FPXA 3NSCA 1M57B 4UAHA 4E9QA 5F7BA 5A7EA 2XYBA 3SBQA 2Y1AA 5I5JA 2AVFA 2PPDA 3FU9A 2DYSB 3EH3B 1NWPA 1OOWA 1NDTA 1A4BA 1TEGA 2FQDA 1BXAA 5LDUA 1OCOB 1PZBA 2HZHA 5I6NA 2BWIA 1IKOP 4YSDA 3IN0A 1WA1X 5PAZA 2B3IA 3FQ2A 1XB3A 2XV0A 3EF4A 4BWUA 3PCYA 1RKRA 2EIKB 2XWZA 2J5WA 2EIJB 5B1JA 1V54B 2PCYA 3MX0B 3NSDA 4K9JA 2GB2A 2QDVA 5F7AA 2MRYA 2TSBA 1RZPA 2ZWNA 1TEFA 4YL4A 1CYWA 5B1JC 2YAFA 1GSKA 3U25A 3CVBA 1WA2X 2RACA 1FA4A 3QQXA 3PAUA 2PP8A 3ZDWA 5I5IA 1KCBA 2B08A 2BHFA
chains in the Genus database with same CATH superfamily
1SBSL 43CAA 4OUUA 4Z0BL 3DGCR 4YIQA 1MJ8H 1XZWA 4HS8H 2CBPA 4AKQA 4PRIA 2QDWA 2WB7A 2CAKA 2VLLB 3QIWD 5DA4A 2DWTA 2X7LA 2G5BB 2NY6B 2AK1H 4LLUB 1AJ7H 2NOYA 2Y3AA 4KVNL 1OAUH 1DBJH 5D2NC 1D9KA 4Z7VA 2D3VA 2TSAA 1HZKA 1DQDH 3CX2A 2ZXGA 3DXAA 1Z9SA 4OSUH 1A02N 2NY4C 1OB1B 2AQSA 1VEMA 2VR7A 3GM8A 3WU1A 1YEJL 3E6FB 4AMKH 3NMEA 1NKGA 5ID1A 1W8EA 3WKNA 1DUYA 3RZCD 4NWUH 1KCLA 2WQWA 5E2TL 2APBA 2R2EB 3CUPA 4WSKA 4Y7MA 2Q7YB 2X1OA 4NBZB 2B3RA 1MI5E 4RBPH 3L3HA 4K7PL 4ZW6A 1G9EA 1G7HA 1KXHA 1NFAA 4XXCA 4QRTA 5ISZB 4IIZA 4KKAC 2HLAB 1KELH 1AY1L 2VLRD 5F9WC 2PLTA 3MJ7B 3GSXA 1GPOH 4DN3L 4N24A 2F5AH 3FU6A 4RGMC 1ASPA 1J87A 4J3BA 1JYXA 5LUMA 4U1SB 4G2AA 3H7LA 1ZANH 4P4RB 4KQ3L 1LLAA 3LKOA 5AB9A 5IVXE 4MB3A 5F6IC 1NTDA 1GGCH 3CQPA 3MFFB 4KTEH 5CJ5A 1IGIH 3DX9A 2NY4D 2H3KA 3AROA 2OKMA 4K7PY 2YPVA 3QORA 1JDAA 1SPDA 1JHLL 5IBTL 3LRKA 1WRFA 1U8IA 2BWDA 2V0AA 4OT1H 4DK6A 1OB0A 4GUPA 3DBXB 5H94B 4Z9KB 1G7MB 3HW7A 2KLTA 1D5IL 3ABLB 1P4IL 4PMFA 3ETBJ 4LVOB 2LU4A 2GI7A 4KKAD 2DLIA 4KNTA 4PB0L 1U8CA 1ZHNB 4P5MB 3X14B 4KZEL 2G3MA 4YBQC 1CTNA 3DK0A 3WYRA 1ILUA 3GXIA 3CJJA 3VWKB 4JPKH 4RAUA 1QFOA 1SJEB 2CCVA 5DC9B 2UZXA 4X0KB 1IAIH 2YZ8A 2QQLH 3KLAB 2Y1VA 3NZHL 1N8ZA 4YLBA 3DPDA 2NX5D 4H13C 1TMCB 1X44A 1TJHL 3QG6B 1PLAA 2HKFL 1U0QA 3ZE2F 2MKWA 2Y9RT 5DS8B 1E4WH 2XWRA 3ROOA 1LL1A 4YHOH 4Q74A 5ITFA 2EUVA 3NJGA 2G75B 3Q6FB 2AQQA 5HI5C 2HN7A 2JKSA 5ID0B 2CKBA 5F1NA 3P73A 3VTTA 5I1LA 3FT4B 5J1AB 1GVIA 2OMZB 1NANH 1IAKB 3KW7A 4TMPA 3FRPA 1NGYB 3UTTB 3B9DA 3H7BA 3Q05A 4B9PA 4B0MB 3GXPA 4PGDA 4BZ1A 2APTA 2R83A 4HJIA 4Q9RH 4MMZA 3QE5A 4OCLC 2QSVA 4PJHE 2WQAA 3Q3GA 3ISYA 1O9WA 2LVEA 2IFGA 2WVUA 5D96C 1IKNA 4HJGA 3S0PA 3T3PF 2IOIA 3VXNA 2AI0H 4ODBD 4QHKI 4XPHL 1Q0EA 3GMRB 4HCRA 4OJCA 4RISL 4NRZA 2FSEA 5F1SA 1LJMA 2VTFA 1UYWH 1XFPA 3PWPA 3RWHB 1W80A 1KLFA 1IBGH 2QPSA 5EUOA 4Z3EA 4EUPH 2UZYA 4G1MA 1NLDH 5EU5A 3IPEA 2F8XC 1YJDC 3Q5OA 1XSIA 4NQCB 1OTUC 4XMUA 2R4RL 3NABH 5I73C 5HI5D 1FL3B 3C8HA 4ZPTA 1SXBA 2YMTA 3GIZL 2ATKA 4L3EB 4QHMA 5C0FA 1RIHH 3GTNA 1QSED 3UTSD 3V4VL 3QK0A 1BG1A 1PLCA 3FSVA 4JW3A 4LVNC 5DJ0A 5CD3B 1S9VA 1A9VA 4HXAH 4YQXH 4HUUA 4F8PA 3F65A 2W9DL 5I19H 2J21A 5GRVK 3VXOA 4JN1L 5JW4N 1YYLL 1S7SB 3W2DH 2IANE 3W9EB 1KXTA 3V52L 2WCSA 3ZUNC 1OSPL 3MJWA 1KN4L 4P3CH 2R2BA 5GGQH 3SDDA 4MWFA 3ZGHA 3C60A 3D25A 2MPAH 1WSST 3ZE2E 1CR9H 3VRIB 1GS7A 3G6JF 4CVZA 2J6EA 5JHDE 1R5VB 1T1WA 4PJ7E 1TCMA 2P9RA 3RTQA 2B1HL 3HE7C 2ZYSA 1DL7L 1OCWL 3NA9H 3PDDA 3WEOA 4PJAF 4XN2A 4M5YH 1BM7A 4F5CE 1USZA 1M6OB 1OTUD 4IBTA 4Y8AA 1M9WA 1N12A 5EBLA 2YKLL 3L3GA 1FNAA 5BRPA 1E4KC 1OGPA 3U4KA 1TZ8A 5DD3H 3S3SA 3EDDA 4C56B 1E27B 4TVPD 3UROR 2C9VA 4GRLA 2FEJA 1OY3B 3GYRA 4WI4A 3SJVB 1RPQA 1Q1JL 3O3EB 4K15A 2ED6A 2LLGA 1RY7B 3SPGA 3JV0A 5H2BB 3T3PE 3TEXA 4AH2B 3W5MA 2WSDA 3VGGA 5KZCB 3GMLB 3DBSA 4KRPC 1AZVA 4FFYH 3TGXA 5GGUA 5ESVA 1CFQB 3MR9A 1WZMA 1GW6A 4HFUL 2XQYK 3FNKA 3IDJA 4D8PA 3OHXA 1Y6MR 5CEXA 4I18B 1RAMA 3ILQD 4JFEE 3HE7D 1HHKA 3QJOA 1Y07A 4NQSA 4M9OA 3CCHB 5B39B 1N3NB 3UBFA 5I66A 5CILL 3IFPB 4QHLA 2PUQT 2XNAB 2BHUA 1YY9C 3M7FB 4HS8L 2V2WB 1MCNA 1RZFH 1WV7T 3MGAA 1ACZA 5JDSA 4GMSL 3C6LB 3DUUB 1A6TB 1CMOA 4LDOB 2AK1L 2VDML 4X98A 1OAXH 2F54D 2ICCA 3BIKA 4NGHL 3TTSA 5F7DA 1KXQE 1EXUA 1E4XI 1ROCA 4OSUL 1WBZB 4AT6B 3BAJA 3QHTC 3K80A 4ODXA 3TO2B 3HCVB 3KE0A 4KRPD 4NWUL 4QCIA 1P5UB 4JY5H 3G6JE 1LEKB 3B9KD 4U1KA 2WLNA 3NP3A 1INDL 1K85A 3GC3A 1FZMA 4G6FD 1IBYA 4G7SB 2V5YA 4F7TA 2NNRA 3P0VH 5KSVB 4FNLH 3ZIMA 2WAQA 3CFIC 5C0AD 3WFCH 4RAVB 1KG0A 1OAQH 5CXPA 3NACH 2Y24A 1PJ9A 1A6AB 2BVPB 4JFFB 5L4FA 1KELL 2WXQA 2O4EA 4PJBB 4KKNA 1JPTH 3VXUA 1GPOL 1YY9D 3WEAA 1A21A 1NA8A 1DP0A 2F5AL 2FLRT 3Q13A 4G42B 4BQBA 1FZOB 4IU2B 4DCQB 1QVOA 4RSVA 3NZ8A 1EFXA 2AW2A 3RWCA 3JWOC 2XY2A 4XN9A 4BCYA 1ND0A 4PJ9A 1GGCL 3HI6H 4KTEL 4U6TA 4MMYA 2OCCB 3R7RA 1IGIL 1FFNA 5EEYA 4OIBA 5H37H 3CK0L 1CICA 5F7WC 1HZLA 5LGHL 4OKDA 2BINA 3LNIA 1E50A 5FXCH 4X50A 1KTJA 2R0ZH 4ZDHB 5EIIB 1RSYA 2NNAA 2WNKA 4LK4A 3O8XA 2OXGB 5D5MB 4E5XA 1E28B 4O51A 3LMJL 4LSQL 3HG5A 3P77A 2FTAA 3VD5A 3US0A 1FO0H 5CP3A 3CFJA 2QKIC 1A1MB 1LK2A 2CO7B 2B4CL 4YGVA 3G04B 5DDHA 3TEUA 2JJVA 2N56A 4JPKL 2ERJB 1A47A 3BAEH 2Z92A 4L8DA 4QAWA 4R83A 5GS0H 2OK0H 2ZCKH 1IAIL 2QR0A 5L2JA 1YECL 2AJSH 2IV8A 1RJCA 3DUSA 1TU2A 3ZSSA 3UZEC 3JUZA 3KNBB 2ZSVA 3KPRB 3QJTB 1L6PA 3FH8A 5I8OH 3M8OL 2XN9E 3E0GA 4L5FH 1ZSHA 4MASA 1HH9A 4YHOL 2P8PA 2YBRB 1NEUA 2BVOA 1J05A 2M8XA 3L7FB 3FQNA 4TL5A 1T03H 1JF1A 1SLWA 2CZNA 4AYGA 5BOZG 3DX3A 3HPJA 3V4PB 4AJ0A 3EJSA 3MNMA 5MEPB 3VFMA 3B5GA 3HN3A 3NJMA 5DURD 1EWHA 1VKXB 3FQUA 3RHWF 3FXIC 1HHGB 4QRPB 4HKBB 4UT9H 5GZOA 1E6OL 2UY7A 2ZCHL 3R06A 4FZEH 3VXMA 4Z8FL 5FV1L 3VFGL 2NSQA 1CE6A 4NHUA 3C09B 1X5MA 2AI0L 4TQEL 5MP6H 4HG4K 2QQNL 1Q9LA 3TJPA 3QUXA 1W72A 2KHAA 4R26H 3L4UA 4NKOA 4FX5A 5D7JC 2AJYH 5B8CC 4M7JH 1UXWB 4JFHE 4BKLA 5CFHA 1RZIA 1A3LH 3D39B 3DSNB 2IBZX 4OM1H 3F83A 3BD5A 1DUZB 2AABL 4J4PC 1FO0B 1NLDL 3VI3B 3O41A 3U4EA 3CD4A 4EVNB 1EEUA 3T2QA 5MEOA 4BH8A 2FL5B 3OR7B 1RIHL 4X4MA 3LZOA 2K4WA 2Y2WA 3HZYB 4LCWD 1H0DA 4FFZL 3IGLA 4IIQB 4PVBA 1ETZB 3J7HA 3L08A 1OPGH 5FYJD 1U3HB 3S5ZA 5IKCA 5H4ZA 1AQKH 3UYPB 2GJZB 5I19L 2EH8H 1IKOP 3LV3A 1MVUA 5D55A 3CDGB 5K39B 1IL1B 4I4WB 1IEAA 1E5AA 2AXFB 3FQ2A 1Q9OB 2LU7A 4XN4A 1FFOB 3SY0A 2DICA 5B3JF 5I6XC 3CZFB 2HVKA 3ELQA 1N9PA 2BHYA 4XZ4A 1NDMB 4AYSA 1LEIA 3TV3H 2XBZA 5DJCB 2Y1ZA 1G0DA 3C5JA 3NA9L 4J4PD 4OJYA 2Z93A 2YLKA 5B1JC 5AW1B 3VRJA 1FZKA 1GSKA 1L9NA 2QPFA 2MWCA 3VFVB 4K9EH 4LPYA 5DD3L 2Q8AH 1NFIB 4M61A 4H88H 1JI1A 3LRLA 3T0EB 4AL8H 1T0NA 4XMPH 3MCLH 1FH2A 1H9DA 3WNPA 4BXSV 5I18H 2WUCH 4NQEE 4K5OA 1L3WA 2DQIH 5J5EA 5KSAB 2J1XA 1UCTA 4UM8B 1EGJA 1X7SA 3WY1A 3QWRA 1ZIBA 2VMFA 3LN4B 1KJMB 4PLKC 1EHLH 5GS1A 1M56B 1A6ZA 4G8EB 4EDWL 3TBTA 2V17H 4FFYL 4I88A 3TVMA 2VISA 1KGXA 4A38A 3QDJB 4B96A 2DMGA 2X3BA 1F97A 1ZHLA 1NMCB 1MRCL 1VFAA 5HTSA 3QWOA 1O6SA 3I02B 1T2QH 3VDBA 4KVCH 2QGEA 3RFZC 5C71A 4MJ6A 3W37A 3FRPG 4NNYA 4MA3B 3QEGL 1L6XA 1UA3A 3GHBH 1KN2H 2WHVA 3RZWA 2KPNA 3LZFL 1P6AB 2OSYA 2NXYB 3S8FB 5BVJB 3QPXH 4KKLC 2JJSC 1BLIA 5AOKA 2XX0A 1KGYE 4PRPA 1I7ZB 1ONQA 4H2CA 3DMMA 1PLGH 2EE0A 5TJWK 3ZE0F 4KJPC 3MROB 3QRFM 1VFUA 3ETBF 3T0WA 3EZ8A 1MCOH 2JB5H 5HJ3B 4XXWA 3LIZL 3JWNE 3VGAC 1VIWA 2XDHA 5DUPH 2YOAA 5C0BB 3C2AH 2YC1A 4IK6A 2ODIA 1AZRA 4JG9A 4PLKD 1JPFB 1QHQA 4S0HA 2H4EA 4JVWA 2FYYA 3KPSB 4JY5L 1MLBA 4KAQH 2Y7NA 1Z6JT 4HIHA 1R1CA 1HI6B 1RL1A 4LLWB 4EN3C 5E5MA 5DUMH 3THML 2QGCA 1N26A 2OL3H 2X87A 3IGFA 1YG9A 3P0VL 3EFOA 4FNLL 3P4NB 5IMKB 1Q90A 3RVVC 5D6CB 4GAYA 4JJOA 1OAQL 1JHTA 2XXFA 3NACL 4Z23A 3MZGB 3WL9B 5AVUB 4V11A 2ZF9A 4G8GA 5C0JA 15C8L 3RNKA 4KKLD 4J8RB 1JPSH 3L9EA 1XCQB 3LQZA 4HW6A 4R96A 4KJPD 1PX4A 3VWJC 5BO1H 1AGEA 3QO1B 1DEDA 3KJ4C 3GJFA 3BDYH 1I9RL 4D2NA 2JV6A 1ORSA 2MQGA 2ZYIA 3W3BA 1IMHC 1UUSA 5HVGB 1S7XB 3MRQB 1FFPB 4LF3B 2C3XA 5I17A 4IU3B 4L8SC 4R0LC 1D5MA 5JO5A 1AO7E 5FUOH 5I1JH 1KYUA 2R0ZL 2E7HA 5E9NA 4P3WA 1A7RL 3X13A 2CJTA 2ZYHA 4EN3D 1KDJA 2VZSA 3UTTD 5ADPL 5CBEB 2HA1A 1GL4B 2D03H 2E56A 2MKLC 4FDWA 1JUFA 3RVVD 4UANA 2EDRA 2XWTA 3K71B 5INDB 1FO0L 4HK0B 4Q89A 3ZQXA 5HY9A 2B8OT 2A4CA 1I7UB 1QW8A 1DR9A 1E2VA 5FUCE 3W39A 4U0QB 2XIDA 3QFDB 3KPQA 5TDPB 3EUUA 1BFOB 3ZTJG 5I6LA 3ULUH 1FLRH 2OK0L 2ZF8A 4JFSA 2A6DA 2AJSL 2MNUA 1I1FB 4AZ8B 1BCIA 2HFFB 3L6FB 1XAUA 1R3JA 1LNUB 1WCQA 2ESVD 3VU1A 2O26U 3AB0B 3WEXB 4HJTA 4IRJA 4GRWE 1H8NA 4OGYH 1AYOA 3V7AE 4LARL 4JM2C 4NQCD 3X1GA 1PYWB 2CHXA 2W9LA 3ARPA 4FMKA 2HKHL 4FQHA 4X9FA 4F2MB 4YBLC 4L3ED 3IMRA 3JV4A 2ID5A 2J4WL 2ZPKL 4DAGH 3HPLA 2WZAA 3QDMB 3TOPA 5BOPA 4AM0A 4K55A 3VYPA 2WLKA 4GO6B 3K3QA 5DEGA 1M71A 1B0GB 5K1NA 4GAAA 3V0AC 3K6IA 2HT4C 2VKWA 5AYQA 4AZUA 5EOQL 4WI9A 3O4LA 5MP6L 2UVEA 3ZTEA 2X09A 1HX0A 4MCNA 2PW2A 4M7JL 3QUGA 4Y5VC 5IW3A 4PJCB 1MXGA 2CGZA 4OM1L 2HJLA 1F4WH 1FDLH 1MG3C 3KAAA 4KH9A 4U3HA 1MHCB 2EE9A 3VX1A 3O3DB 1DSWA 4JM2D 3LRMA 2ZAGA 1NOLA 3RWDA 2EDBA 4BKTC 1JGLH 4XWOD 2ICWJ 4NLHA 3UCRA 1ZHBB 1P4LA 3SKNA 5C86A 4YE0A 3BN9D 5AVWB 3CC1A 3CHRA 2K6ZA 4D0BA 3KPOA 3SJVD 4Q6KA 1OPGL 3UC0H 4KTGA 4PG2A 1NM4A 2J1ZA 2DQTH 3GD1C 4M1CC 3I9AA 2UZIH 3FBQA 2N3JA 4A63A 2KQMA 2K1MA 2DQUL 3LXAA 2EH8L 4IW4C 4J23A 5DJ2B 2HT4D 3RGHA 3GPSA 3IU4H 1XL4A 2BZDA 2WLYA 5F96L 4GP4B 2J71A 4BK5A 2ENJA 5L0QB 2I24N 3RP1A 5LDSA 3BUYB 3U0WL 5FS5A 1SYSA 2VZ1A 4AQ1A 1MRDL 2WZPA 1BXXA 4HIJB 1YCSA 5IJKC 4TRPL 1SFHA 1W6WA 3APFA 5JOPD 2UY6A 4B60A 4M7LL 1VADA 5DYOA 1TJMA 1UZ8A 3HA0A 1PZCA 3B7SA 4HFWB 3LNDA 2NY0C 1SVZA 2KYIA 3F7YA 3B9VA 3OJDA 3C6LD 1GGIH 4W93A 2Q8AL 4GT7A 3SE9L 1QSFE 2WXMA 4XMPL 5ILTL 3TN0C 3MCLL 2KT6A 2X4NB 4L9LA 1NC2A 2WUCL 2Y2TA 5DHMC 2DWDA 4M1CD 1W0YT 3ESMA 4NM8H 3P9LB 3I3BA 4JM4H 3WEBA 3MXWH 1HKFA 1EHLL 4O02H 3QHFH 4JFXB 4DGUA 2MH4A 1YMHA 3QNZA 3S3CB 4QOKA 3RYMA 4P9HC 3E8UL 4UV7H 2HKAA 2C7FA 1JP5A 1WZKA 3V6ZB 1CLVA 1I7RB 3DLQR 4ZMYA 1T2QL 3L1EA 3SDAB 3VD1A 3CAFA 4Y2DB 1QRNE 4JFFD 1QTSA 1N10A 3GHBL 1MJJA 4K23L 5BRQA 5AG9A 1AQDA 1DQTA 5EULV 1I8LC 2R8SH 2NY0D 3FUHA 4R97C 3FRUA 3TCXA 3BAKA 1IGYB 2DS4A 4Z7WB 4X4YA 4P5KA 4A2DA 5D7LA 4A55A 1ADQA 3QFJD 4KV5E 1KNOB 5CSZB 3TN0D 4DT2A 3FUMA 1JGEA 2VITA 4ZTPH 1T6VN 1MF2H 5T5FA 1MCOL 2JB5L 3WFHB 2PWEA 5I8EB 3T1WA 4RNRB 3NEXA 3UDWC 4B9GA 2HAZA 3CDYA 4NRYB 4A6YL 2YD0A 5IVZA 4P2AA 2VZTA 4LSSH 2VKXA 5DUPL 3RB5A 4MNHB 4E41E 5IHZB 3NSYA 4LNRB 3II1A 1C5BH 4JDVA 2DJSA 4P3DB 4PI2A 1WYJA 4P57A 4TULH 3LRSB 3ZYIA 4KAQL 3ZTNH 4M8QA 1E5UI 3QA3B 5GRYA 5AB2A 4P23C 2Y22A 5DUML 4H8WC 4JQIL 2OL3L 3WTUA 4TV3A 3BP7A 1MPAH 3QEUB 4F7PB 3TBVB 2N1KA 3HI5H 1L0YA 3MC0A 2IJ0C 4JEGB 4MMXA 1BPLB 1MZZA 3SKOB 1Q9KA 1WITA 3DJTA 1BREA 2YK1H 3BPNC 3N85H 2ZNWA 4ODTH 4YAQB 4YFLI 2JCWA 2ENQA 3TESA 3LY6A 1HCZA 1PY4A 3GSVB 1LDPL 3EFFB 3UTZA 2CM6A 4O02B 1WFUA 5DK0A 5DMKB 1SNRA 3BXNA 4LHUB 4ODVH 4Y2OA 3Q48A 1E2WA 4Y4FB 5HVHC 3WIFB 1PQZA 5L2KB 2XVGA 4ZS7H 3BDYL 1KLUB 1WEJH 3ZDYE 3RA7L 5K9QI 4KRLB 3QNXA 4PJDA 2HVBA 1WD9A 4MKTA 3KPNA 3HS9A 1DZ0A 2E3VA 1J8RA 1OAKL 1KFGA 3NCXA 1MUJA 1WS7A 5FUOL 2WTRB 3ENEA 3MRMB 4NQDB 1FYTB 1SY6A 3WGVB 4FADA 1VSCA 4KO7A 4P23D 4C55A 2VGLM 3VG9B 1IQDB 4TSBL 4JFQA 4AC4A 3T0AA 2D03L 2DRUA 3D09A 4HYTB 1A6VL 3DO4A 2GC7C 3QNFA 1BLNB 3WN5C 1KCKA 2ICEA 4I0PB 2G30A 3TA3A 2JKNA 5DHVA 4YBHA 5KYNA 1CIUA 5TTRA 3T4YB 3TBWA 5HHXH 5J13B 1FLRL 2EKSB 4I85A 4OFYD 2TRHA 3G5VB 5F3HB 1AAJA 4BFIA 2GQHA 3U83A 5T3XL 3C5ZB 1KCVL 2VQ4A 3U0PA 1GY2A 3TT3H 2BLFA 5C0DB 5ISZE 3FFOA 4BSVB 3TBCA 3UPCA 1XV8A 4OGYL 2WW8A 3FSZA 3V0VA 2FQEA 4NZJA 3T1FA 2ZX6A 4UUJB 1HL4A 4DP7X 4U6YA 5A2BA 3QISA 1MNUL 3KLHC 4RA3A 4XBGA 2P5WB 3HE6C 3NGBC 2J8UB 2VUKA 5BXFA 4DAGL 1QUNB 3SZ6A 4HWNA 1E7VA 3K1DA 4ZZKA 1CD1A 5IVXA 4M02A 5CEZH 2VNCA 1U41A 2IAMB 3FU9A 3ME0A 4X83A 2OTPA 1IAMA 4JFVA 1CTMA 4YOKA 4UWQB 4F7CA 2XG5A 3OAZK 1DQIA 2VSDA 1XR8B 5EC1A 4UT7L 5I6NA 3KDPB 3O6FC 4B41A 2P7TB 2YD7A 5IW6B 4U1LB 1MCLA 3D2UB 5IK3B 2O61B 1JRHI 5SX5K 4QJ4B 1X9QA 2X4SB 4CW1A 1SEBB 4A7SA 3EBAA 1U95A 1LWHA 2K3TA 1BMGA 2XWZA 1J1OH 2GK2A 4A04A 1EAJA 1DFXA 1WD8A 4DQAA 1KB3A 4PH8A 1JGLL 1J1XL 3HNSL 4JQVC 4B27A 1S7UB 2UZPA 3VSTA 3GI8H 3KLHD 3QUMA 4XNDA 3QVAA 1I8MB 1CYWA 2XG4B 3MRRA 1KFAH 3HAEA 1OGAE 3IDIA 1ZGLB 4YK4C 3CVBA 3BEWB 1HWWA 4XCEB 5D1ZA 1TKWB 4CUCA 1MREH 5IB1A 1OALA 4HWEH 5IQ7H 2GUOA 2P8LA 1XB6A 4RFOH 1AD0A 2VXQL 1X5XA 4OKVB 1PSKH 5KSAD 4XO8A 4ACTA 1OW0A 2UZIL 3BN3B 5ABDE 5FDWA 3HNTH 1K3IA 2H1PH 1Y0LB 2GSIB 3KBFA 3X3FL 2JKWA 4MHHG 2BOCB 3HIZA 3O6FD 5EZIH 5HGAB 3ILPA 3TWCH 2WN2A 2YD3A 4J2QA 1LGVA 2B59A 4N2OA 3JV6B 3TEZA 1MFBH 1ASOA 1UURA 3NIGF 1SFDA 3OLGA 5FWQA 2EICA 1IGTB 4PJHA 4LU5H 1JWSB 4U1HA 4WJKB 4MDJB 1KZQA 1MW1A 4YDMA 2X9XA 1OP5K 1EMTH 3EOTH 1GGIL 2B1OA 1GS6X 4P5TB 2WXRA 2CIKA 4PPTA 4ZRGA 4XNQA 1FORH 3QQNA 3QR1A 3AXHA 4FYQA 2OSWA 4BQ9A 3O0RL 3WFDH 3P3SA 4PRBB 5TH2A 2A83A 4JM4L 4N2HA 3STZA 3MXWL 2YD1A 1S78C 5FPIA 4J6IA 4O02L 4PW3A 1L7TL 5IM7B 3KPSD 1ID5I 3HS0C 1BJMA 4MJJA 4HGWB 4UV7L 3S5LA 4JY6B 2BPBA 3BVNA 5BQ7A 3V0DA 4YNYB 2HPTA 1S7RA 4N8CH 3BDXA 4MD5B 2A7BA 2ZJSL 3PP4H 2XXCB 3DO7B 1I9JH 4MAYB 4N8VB 5L6YL 3RQ3A 2GC4C 4F8TA 3WAKA 1IGCH 1ASQA 1H19A 1HQRA 4G7VH 4BRVA 1IEHA 3WS3A 3BZEB 3CH1A 1G1YA 5DEFA 3BJLA 3L4VA 4YDLB 5MENB 4CMMA 1NGZA 1ZDQA 3OL2A 4ZTPL 1CZ8H 1DJIA 2ARWA 4HMCA 3FKUS 4LLMB 4TKWA 2IIJA 2C1OB 1MH5A 4U0RC 5B1AB 4EIZC 5JHDA 4ZW7A 3D7PA 1OWRM 4PJ7A 4XMLH 1BEYH 5CEYB 4LSSL 5LBVA 1S78D 3CTTA 3DX1A 1C5BL 1M05B 4F5CA 3MU3A 1O6TA 4TULL 1QFPA 3ZTNL 5I16A 1SUHA 1WTGT 4W6WB 4HIIA 1UATA 4C56E 4DGYH 5C07D 3INUH 1T21A 4FERA 1MPAL 3JTSA 2VXVL 1VFMA 1RZJC 2MOGA 2X89A 1C12A 1PG7L 3FO2B 6PCYA 1SZNA 3MXVL 2DQCH 2GBUA 12E8H 5DJ6A 1EEZA 3LEXA 2J1WA 3LXCA 3QRBA 3QUZA 3L2LA 3UO8B 3N85L 4ODTL 1RSFA 1N0XL 3G5ZA 2R1YB 4RETB 4JUTA 5E95B 5FV2A 4ONHB 4QXTA 3TCLB 2DV6A 3FSAA 1OSYA 5D4JA 2VE6A 1QPPA 2UUDK 2HJFB 3EZJB 4NUQA 5AW4B 1NGWA 5E8PB 1BZOA 2DZEA 1U8QA 3F3HA 4JFEA 1CLZL 4PCTA 3G6DH 5TQ0H 4JO1H 2PR9A 5EOTB 5ETUA 3ARGC 4QF1B 4F33A 32C2B 3FW6A 1PFOA 2X4OA 4XB3A 4KZCA 3D2TA 2IC2A 4YUEH 5DUJA 3QI9B 4WCYH 3P2DA 3PY9A 1PGRB 2IGLA 5CINL 5T1KB 4YXKL 1G7QA 4WV1C 2IDFA 4IRZH 1ETJA 4M7ZB 2ZKXA 4F9LC 3BKCH 3OWEA 3ZKXB 3W57A 5I5MA 1XF3A 3O3BA 4BFEA 4JLRA 5A3IC 2QSCH 1UVQA 2NNXA 1UOWA 1V05A 4PJGB 3FN0H 2CJUH 5I1KH 5KVEL 1HU8A 2YUZA 1NDGB 3AT9A 1NBYB 5HJBA 3G6JA 1KYDA 4PGEB 1BFTA 3TT1H 4PP1C 1Q72H 1X9UA 2VWEC 4U3SB 4XMXA 4YHNB 1OM3L 3GTTA 2DL2A 5F7FA 3TPUA 3P4MA 1Q0YH 4JKPL 1G5AA 4ONOA 3T4AA 4ZTOL 2ORBH 2IDUA 2EVFA 1HQ4A 4WSJA 4XMWA 3FQ4A 5EU3B 4PJBE 4YEFA 1UKTA 2DI7A 2BNRE 2J2ZA 4N2EA 2H2PD 3DTUB 3TZVA 5I75B 4L48A 4RDQG 5F89A 2VUYA 1I7TB 3L9RA 1BXUA 2CRZA 4GW5A 4OZGB 3A67H 5DWPA 3IXAB 4DOHB 5ICYB 1OIOA 3QJXA 3E9UA 1N5YH 5CEZL 2VO5A 5LCVA 5LNEA 4F37K 4RDBA 3VA2C 5DYFA 1HH6B 3EHBC 2VDQH 4WFGD 3FTUA 4XRCB 1YJDL 2L3BA 4GS7C 5D5ME 3SN6N 4TNEA 2CMRH 3TIDA 4DGVL 1A6WH 2NZ9C 2PWGA 3DV6A 4PP1D 1IM9A 1NCBH 3WY4A 2ZAIA 2OP4L 4OCMC 3V5DA 2IH3B 1D7BA 1URZA 3ARBC 3D69B 5E8OB 3QJFA 1WAEA 4N1EA 1NZRA 2A6KB 3RWGA 1YEKL 2YHGA 3DJRA 3O2DL 4FCAA 4HPYL 4Z76B 3I74A 4FQXB 4N2GA 1TJGL 2J57A 3MBXL 3WTSA 4TVUA 1LD9A 3SKJL 3TH2T 2VUOA 3SSGA 4GQZA 5IFAH 1C5CH 3LKQA 2P26A 1MREL 3JVGC 1C1EH 3KPRE 4HWEL 4KY1H 4A66A 7FABH 4W9GC 3ATDA 3QYCA 4RFOL 1F18A 2XTSA 1HYSC 1PSKL 1ZVSB 3A6CH 1G7JA 2F19L 3Q9QA 2H1PL 2DDQL 4ADIA 2XN9A 3W0WB 3EHBD 1R33A 3DARA 1RZGB 4QYAA 5HDQL 4IHOB 4P07A 3CFMA 1Z32X 4JAMA 2YBGA 2JE8A 3EYUH 2YMXH 5EZIL 1KYAA 3SIKA 2N7SA 2YD8A 1AZCA 3TWCL 2NZ9D 1NM9A 4R5VA 5I74B 3LPPA 2ED7A 4I3GA 1KBGL 3FOMA 5KVGH 4LBEB 2R39A 4QRPE 3BP6A 3OXSB 1BFVL 3LVEA 3MLPA 1QWUA 3GMMA 3MLZL 4QYOB 2NY3C 5FYKH 1E0OB 1I8KA 3QXAB 1GY1A 4MX7B 4WU7B 2DM2A 3ZZ1A 3IJYB 1G9NH 4LU5L 3BGMB 2WJ5A 4FJZA 1ZA3A 4ETQA 1QEWA 1CI3M 2VDQB 2J8HA 2X4UA 4JHWH 4PY7A 1PFCA 1TVHB 2YSSA 3BUPA 5FFLA 2BCKA 4MRBA 2B16A 1R5IB 4HLZG 1GTFA 3D39E 5D2LF 2PWFA 1SDDB 3IU3B 1HYSD 3WFDL 3FTYA 2JB6A 5JIHA 3VI3E 1V3LA 2DQFB 5KYWB 4AOFA 5DLLA 3MA7B 3PWUB 4AM0Q 1X5ZA 5FUZH 4NDMB 2EUZA 5AWNL 3UG4A 4NZUH 2RFXA 1O9VA 1KB9J 4YE4L 4FQJL 5CR1A 2AQTA 3ARSA 1Y18B 3DX6A 3HB3B 4N0YL 3RX9A 1I9EA 4Z78A 3N55A 4N8CL 4Q6IA 9PCYA 3U79A 1A0QH 4IOFC 3K46A 1L9RA 4KJWD 4WNQB 5DLML 3PP4L 1E6JH 3BPLB 2Q1EA 4HKJA 1I9JL 1T7ZA 4KZDH 1KIUA 2D7NA 4N2IA 3QPKA 4UI2A 5CJOH 2E7DA 3VQMA 3GEFA 4M5ZL 1IGCL 3GSNA 4MKMA 4G7VL 5DGQA 4IDLA 4OLZH 5I8KH 4P46A 3RIFK 3R1GH 1M2VA 2VMCA 2WVVB 4LHUD 2FAUA 9CGTA 2F74A 2LOEA 1A1OB 4A7GF 5EZLA 3HRZA 4NZRL 3S35H 2R7EB 5ALCL 4JZNB 3L48A 5FO7A 1BEYL 3I6LE 3Q2CA 1PIFA 3VG0H 4YO0B 1TZIB 1UQSB 3AAZB 2XJKA 4IKKA 2XN0A 2WZ6A 1FYTD 3OR6A 4NQDD 1OVZA 2AVGA 1FC1A 4XP1H 2VDOL 5CCKL 2Z64C 1P69B 3T0EE 2ADJA 4FZ8L 4KO5A 1N5AA 4AGMA 4GQ9L 4BIKA 3V0HA 2GEQA 4HEPA 5AKSA 1K4DB 5B22A 3UABA 4IOFD 2ZT9C 1S7QA 1FVCB 3GSQA 3JWOL 4P9MH 4QRRE 4WWKA 2BSSA 2V3EA 4NQEA 4DPCX 3MRPA 5CWSA 5AVXB 4FMFA 4XMKL 4CADB 4OW6A 4R3SA 2XIIA 3MRBB 2OI9C 2C8NA 1UZ6E 2V5MA 4F9PA 1F02I 3QDJE 1RP9A 2NLJA 3NJXA 1AMYA 1ECYA 5D9SB 4U1MB 2GEEA 1KPVA 3C5ZD 2YXFA 3VFTB 4KKCD 4C58B 3O9WA 1THCA 1G6RA 3FB5A 2ZUUA 4J3VA 3PXHA 3BWSA 4XCNB 3CQFA 2DH3A 2JF1A 1A6UL 1MIMH 8FABB 4A68A 6FABL 5DJAA 4JO1L 2WO4A 5I15L 4N0FB 1MAJA 1DJYA 4WEEA 3TF4A 3EYSL 1NL0H 2ZCLL 3FO9A 4MJ5B 4AXWA 3CFDA 3TNNA 4L0YA 4KROB 1C16A 4GG6F 1EEYB 4YUEL 4UNVA 2CHDA 1D5XB 4WO4B 4L1DA 4NIYE 3GKZA 3LS5H 3NJFA 3RWEB 3V8CA 2PXYB 3U2SA 5T1LD 5D71H 2FWSA 4XPGL 4A7TA 3CN0A 3NJNA 4JHAH 4JR9L 2IAMD 2VLJD 3MJ9H 5KUMA 3V79C 5C0BE 3N44B 5CLZA 4K3DH 5F7BA 3QYMA 2E74C 3SBQA 4XR8C 1CFTB 2H3NA 3QRGH 4J7RA 4Y4HA 1KCRL 3EH3B 2CJUL 5I1KL 3LKRA 2BNQB 2X6MA 2F68X 4EOWH 3D2UD 5E2WL 1Q72L 2HUEA 5F6HJ 1LE5A 2ZICA 4JB9H 2C1PA 3C6SB 4FCHA 1F6LL 1Q0YL 5D7SH 3S5LG 3X12B 2ORBL 5A2AA 1B6DA 1S7TB 3AMKA 3EO1B 1K8IA 1MCQA 1DDHA 4APQC 3TJEH 3KEDA 3PCYA 1RKRA 4LGPB 1LXMA 1QYGL 1RJZA 3G5XB 2GG1A 4HSQA 1OSEA 3T6QC 4N87A 2FE0A 3ZZLA 1QLFA 4ZFOL 5IWLC 4WTZA 4YS4A 3OKKB 4JE0A 2X70B 5C2BL 3GBDA 2JI3A 4TSAH 5IQMA 2JCCF 4XP4H 5HYFA 3A67L 1TEFA 4WJ5B 4OTXH 5ERWA 4OVVA 1V8HA 4TOYH 1WA2X 1XSJA 5DWUL 3GXTA 3UAJA 3D85D 3SODB 1L9MA 3WELA 2GYSA 2LTQC 3F62A 5IBUG 2OJEB 2VDQL 3UBHA 1T5WB 2ZKWA 3HNVL 1AO7A 4UZGA 2OYLA 2V7NB 1A6WL 1E9OB 2VAJA 5DRZA 4OJFL 5IFJB 4OV5B 4UAOC 1TYRA 1OT1A 2IQAA 1I85C 1AR1B 4KK9C 3B5HA 1I1AA 4RX4D 1U8MB 2XQBH 4GAGL 4H8UA 2AXGB 2YXMA 4U1NB 4APQD 4JPWH 4OZIB 5LBSH 4GG6E 1JWUB 1FZJA 5HGDB 1QFWL 2CPUA 4PWJA 4MVBC 5AD0B 3QCVH 5KN5A 2AEPH 3HHSA 4P5TD 1BOGB 3I85A 1C1EL 2BW5A 3B9EA 3MV7A 1ZS8B 1U36A 2Y07H 1BZ7B 4P2QB 1WDAA 4ZMXA 3A6CL 4WI0B 3ZHKA 3Q8FA 4NQXB 4F8NA 5CMAA 3NVQA 1KBBA 1UB6B 4MNQE 4QHUA 2FNWA 5D7KE 1KYFA 4YGAB 4M6MH 2YMXL 4AYMC 4JQXA 2HLEB 5KS9F 4N5EC 3IXTA 3PABB 4LLAA 3O3AA 4PYHA 3QDME 3CX5K 3D4YA 4U1IA 3K0WA 1J9RA 4KMLB 2XPYA 4FTDA 1NJ9A 3QJVB 4P2OB 43CAB 2NY2C 3MCG1 1TYEB 1LO3H 1SHWA 1WGOA 3KXFE 4QTHA 5INCB 4KK9D 5TDNA 2KDYA 2Y3NA 4MAYD 3SPCA 3SOTA 4WO0A 2Q5BA 1G9NL 2ED8A 2X7LB 5GS3A 1ZHKB 5E9DD 1K5NA 5GRVL 3E3QE 5KYUA 2JCCE 4MVBD 4TNVK 3ARUA 5HI4D 1D9KB 1HAWA 1HEZA 1MY5A 1KTKE 2AZUA 3TYFA 1Z9NA 4PJCE 4X6EA 1OSZA 4G9DA 4JN2A 5I76A 2W9EL 5ID1B 5ACMA 3NJHA 1BG9A 3CUPB 2YD5A 5F0MB 3SPJA 2AF2A 5FUZL 3L3HB 1TR7A 4OR1A 1FG2A 1YNTF 2L8AA 1VENA 3ULUE 2JKXA 4N5ED 3C9NA 4OCYH 1DANT 5F9AC 4CU6A 1DQMH 3VFPA 1VGEH 1V5JA 2NY2D 3GSXB 3PE9A 5K9KA 3H3BC 1TCRA 1XH2A 1GYVA 4U1JB 2UXFA 2XBDA 3VD9A 2K6WA 1SVBA 3LAFA 4KKRA 4AQAA 5CJOL 3S34H 3UZVA 4JPVH 3HKFA 4GBXA 3WIHA 3PDGA 4OLZL 5J7CC 5I9QC 5I8KL 3IDYB 3R1GL 5JW4Q 4PJ8C 4YHYB 3FF8A 1ICTA 2Z6FA 4KO6A 3HVNA 5JHLA 4YVNA 3DX9B 3RI5F 4YDNA 4IBYA 5HHMB 5LAPA 1NGPH 1U8IB 4Y5YC 5JR1L 2NW3B 3UMTA 3VG0L 4BFGA 2F9BT 3LH9A 4N2FA 1TLMA 1C5DA 1Z2KA 1BQKA 1JNLH 3U0TB 1PTZA 2YKKA 5EO0A 3FF7A 1U8CB 3G7TA 1OM9A 3TURA 3QI9D 5D93B 4UTAA 1QSFA 4M62H 5JIPA 3VFWA 4RAUB 1YNKH 3FT9A 3M7OA 1P6WA 5FM5O 4EI5A 3AUVA 3LQMA 3VE0B 3JV5A 3BKYH 2Q86A 3AJ7A 1N8ZB 1EZUA 2NR6D 3KG5A 3AGVA 3DTDA 2ED9A 3V0GA 2WKOF 4DP9X 25C8L 3REVB 4PD4K 4JHUA 1F3JA 3ZL1A 1T04A 3OM3B 5IVNA 3C8KA 3ROOB 3ZT7A 5BMFL 5GHWH 4H5SA 2NY7H 2XV3A 1GTNA 2QKSA 1EDQA 3ABMB 4TSCH 3H4HA 3IMWA 1SLVA 3HR5A 2V5SA 3CHXA 4BDVA 1MIML 2ZG2A 2CKBB 5F1NB 1RK1B 1QRNA 3P73B 1JGVH 2J6EH 5KVDL 2DMBA 3AVEA 2OMVA 3FRPB 2VT0A 5C0GB 2A77H 4AQOA 1AXTH 3F05A 5DUBA 3OKOB 1QLRB 5F8RC 5C08B 4IOIB 5HYQB 1MHEB 4QXVA 3AQDA 3QZMA 3KPPB 3Q3GB 3LS5L 1REIA 1FAIH 4M3KB 5GSVB 1A66A 3NFPB 1J5CA 4JHAL 3VXNB 1XGRB 4OF3A 5FGBC 1CDYA 3QJZA 4H2AA 4F20A 1LVEA 4UILH 3TS8A 4GAFB 2AJUH 4E41A 3PWPB 3N41F 5FA3B 4KKZA 5FB8A 4LCCA 3UPRA 1FCCA 4EZJA 3IVKA 4V1DB 4OAWA 3CVHL 2DIBA 2E8ZA 3KBPA 3CDZA 5EUOB 5EU5B 5I74C 1QABA 1XGTB 1D7FA 1XB8A 4JB9L 1FNGA 3JT0A 5D7SL 2FO4A 3BP4B 1X6NA 3SEPA 2CDGA 3M6DA 4OBRA 4ZPTB 5F72S 4QHMB 4EF3A 2J20A 4I13B 3TJEL 2CLZA 1BPVA 1QG3A 4RMQA 1LM8V 2PCFA 4TXVB 5E5UB 1JMXA 2I25N 1DEEB 3PHAA 4ODWA 5A2CA 1S9VB 1OCCB 3L3IB 3FS9A 4XP4L 4HUUB 2YUWA 4GJTB 5L2KE 1IC7L 3UTOA 4YSSA 1WBYB 5DVPA 2O6PA 3IKCA 5LG6A 2R56L 3RDTA 4KHTL 2XSKA 3MV9B 3CHQA 3IDNA 4I9WD 1BBJA 1MW3A 4JY4B 4CVZB 3K0YA 1AGCB 1QBBA 4N2NA 3HC2A 3WO4C 1AANA 3RTQB 1IC1A 4NBYB 3Q44A 5D7HA 1UXMA 4FQ2L 1PNCA 2XV2A 4AEHL 2VLLA 3T0XA 3NFSH 4AE1A 4L3AA 2G5BA 1RJYB 1DVFC 2NMSA 4LLUA 2K0RA 5AVRB 5CJQL 2BMKB 3BLBA 1YY8B 3LIUA 4HEPG 2VM3A 4XNUH 1WT5C 1QZNA 2AMGA 3CBRA 3DIFB 4O9HH 4JZOA 4JPWL 4BK4A 4K8RC 3DVIA 1X5KA 2F53D 4JRYD 4GRLB 3UGXA 4IJ3C 1SN2A 3EKCA 3LCYA 2FSDA 1W0VA 2YN3A 3QCVL 4S1SH 4NUJA 5FHBH 1CE1H 2R2EA 3BE1H 3DDFA 1BAWA 4NC1E 5ISZA 2ZSWB 4AYEC 1G9HA 2J8OA 4XVSH 5HDBF 5ESVB 3MR9B 5LN8A 3EH4B 5BRZD 3IDJB 3OHXB 1WZ1L 3MJ7A 3QJHB 2P5WE 4L4TD 4MJ4A 1NCGA 4UOJA 4LRIA 5GGRB 3HB3D 3NCJH 4NQSB 4U1SA 4DESA 2ZOOA 5DMIH 4AMWA 2R69L 4ODSH 4XAKE 4A2GA 5I66B 1DVFD 4JS7A 4M5TA 4QHLB 3F12A 3KYKL 1LO3L 3PU7A 3KLKA 4N90D 3DC0A 3I50L 3PQYA 4XB8A 5J56B 2HH0L 4MAUH 5JDSB 4K8RD 3D05A 4N2LA 4X98B 5TE7L 3KZ8A 2WLIA 4I2XB 1BIIA 3JWNG 4Z3HA 2EDFA 1EXUB 3PL6A 2Q3AA 1N59B 3DBXA 5D1XC 5H94A 3VSQA 3HG1E 4WEBH 4ODXB 3N5AA 4QCIB 4NYLA 3S3PA 3FTVA 4OZHB 1ZHNA 2X4TB 3X14A 5EEWA 4AEEA 5EBWA 5KVFL 1JZIA 4MQXD 4XX5A 3NCFB 5E6IB 3WENA 3VWKA 2ZXCA 1BVKA 1MEXH 2P5PA 3W11C 4YDJA 3WTXA 1FJ1A 5C3LD 1SJEA 1C8PA 4MJID 2WWMC 4P0DA 1KG0B 4MXQC 4X0KA 1OK8A 4RCAA 1OGAA 2YA0A 5TE4H 3KLAA 2OQJA 4WW1B 3Q1SL 1VGEL 2W65A 4WTZG 1D2PA 2CH8A 4J3OG 3KYOB 1QVOB 2VM4A 3L2MA 3L3OB 1ADWA 3LPGA 3O4OB 4RRPA 2LHAA 5DS8A 1EFXB 1UADC 3L4CA 3RWCB 1UOVA 1AKJD 3S34L 4JPVL 1FC2D 1NUGA 1KLGA 2G75A 1ND0B 2IDTA 3Q6FA 4PJ9B 4ZFQA 4IK7A 3UAFA 1FP5A 2AQ2A 2OV0A 5ID0A 2N7AA 2AEQL 3FT4A 5D1XD 2OMZA 3LOWA 3QDGD 4FOMA 5HDBE 5C0CB 2CE6A 1NCDH 3FHQA 3PAYA 1U58A 2NNAB 4FQLH 1EPFA 5KBKA 4PAZA 3TM6A 4E5XB 3H6AA 3REWA 3VI4F 5CEZE 3BH8B 3P77B 3W11D 4GI8A 1JNLL 5FAAA 3U9UA 1GW0A 3N40F 2UXGA 4MXQD 3SB3A 1CDGA 4ZUVA 1U42A 2C3WA 2YA2A 2QSQA 2IH1B 1LK2B 2FQFA 2HVJB 3GMRA 1BD2A 3HC4H 4HXBH 5DDHB 3SCMC 2XVLA 4M7LT 1EO8H 5KOMC 1YNKL 1UH4A 2MQCA 4L8DB 2Z92B 4YSEA 3TLRA 4HG4J 3QPQD 4P5SA 1KCSL 1UWGL 3D9AH 3DUSB 1L7IL 3SE4A 5LKNA 1SXSA 2ZSVB 2DLHA 4DO4A 1FL3A 2D3JA 3V7AG 3U7YH 1ZJAA 5GJSL 5GHWL 3WKYA 1OOWA 1NDTA 2BHZA 4TSCL 3L4TA 5C0EB 1K6QH 3EYVB 2X9ZA 2WYTA 4QHKJ 3ECVA 1KULA 4CNIB 1JGVL 1BVOA 3FONA 4KQ4H 1E4XL 3HPJB 5JW4R 5E6SB 1AXTL 2NXZB 2XV0A 1S7SA 1HZHL 2J25A 4PWHA 1JXJA 3W9EA 5MENE 5DHEA 1ZT1A 2F58H 5F7LB 2UY7B 3R06B 1PDKB 3FU0A 5F7AA 2MRYA 1OHZA 1INEH 2R0WH 2G4GA 2ZWNA 4NHUB 3B6SA 4NT6A 4BM7A 3ZZQA 3VAEA 2ZAHA 1RQ5A 2A5UA 1Q9LB 2VC2H 4QPEA 2AJUL 4G3YH 2ZG1A 1F6AA 1T1ZA 3AADB 2BRQA 3APCA 2FJUB 3AS3A 2C9RA 1RZIB 4FKKA 1CJYA 3VXQB 2EDOA 4MHHI 3ULVC 4NB7A 2WMPA 2HCZX 3BGAA 1OKEA 3O41B 3LKPB 3OVUB 4Q9BA 1DBKL 2L7JA 3QBTB 3VI4E 3O3EA 2XKNA 4LP4A 5JXAH 3P4LA 2XPGB 4BFRA 4RAHA 4BH8B 4JG1H 4OLYL 5H2BA 1JDCA 1A3QA 4AH2A 2DQGL 4NN6B 3L1GA 4ZJ9A 4EUPA 1IC5H 4OGXL 3MOBL 1KGCE 2N0KA 4WSGA 4ELKA 3POHA 3H54A 3GMNA 4CBPA 3LDBC 1W6LA 3LV3B 4KHXL 4LP5A 1A7PH 1RFDH 7TAAA 2JIXD 4QRFA 4NNPH 3OAYH 4XNXL 3SY0B 5B39A 1A7OH 3CCHA 4YC2B 5HHPB 4B5ZA 1VB9A 5K93A 2XNAA 4M7KL 2V2XB 4HZLB 3VFUB 2V2WA 4XXCC 3AS1A 3RWFB 3G6AA 2NNFA 3NFSL 4WW2C 4LSVH 3ULVD 3N2JA 5KYXB 1A6TA 1FZKB 5T3ZH 1F3DH 4PRID 4MZ3A 4LEBA 5J11C 3WMQA 4HA1A 4AT6A 2C26A 3U6XS 1NEZB 1AD9B 2VC2B 3TO2A 4GY4A 5SV4A 1S4IA 3WNKA 2GHZA 3OAZH 1D9KD 1MNNA 1P5UA 1BQSA 4S1SL 5FHBL 1G7LB 3DXAD 5BOJA 2XFXA 1NC4A 2VDNH 2KDGA 1P5VB 1WFIA 3QORC 5GS1B 2WWNA 4ZMLA 1AHWA 2IGFL 4O58L 2BVPA 1JERA 1HVXA 1ZHLB 2VW4A 3F64A 3MBEA 4PJBA 1VFAB 2CBMA 1O6SB 2PW1B 2BNRA 3E8VA 1ZV9A 3KGSA 4G42A 5C0RH 1FZOA 5DEJA 4DCQA 2HMIC 4NNYB 4RQQB 2J7LA 4OZGE 4PW9A 4NXSA 1A4KB 4FFYA 1TJIH 5I71B 1F8TH 2WV3A 3MLWH 5ICXA 4R4NC 3WTWA 2VH5H 4PW4A 1ZWIA 1IFGA 3BHBA 2KUTA 2Q8BL 3FN3A 4AQZA 2OXGA 5AW7B 1TTCA 2EE2A 2YC1B 4WEBL 4AYFA 3FCBA 3QORD 3RVXC 2OMUB 3K2IA 4JREC 4OD2B 4PRHE 3VD0A 1MLBB 4NN7B 1M7XA 1A1MA 2CO7A 4J3WA 5E5MB 3IBEA 2WYIA 4OLXH 4Y5XC 5AW3B 3LIZA 1ZOXA 3EFOB 2DJMA 2PN5A 4WFED 5IBLC 4TQHA 2HMID 5HGBA 1JHTB 4MMZC 3B1UA 3OMIB 1OP5H 2W88A 5F93C 2D4FA 5TE4L 1ZLWK 2QHLA 1ES0B 3MV8E 1EZSA 4J6RH 3KPRA 4E2OA 4LPCA 1X4XA 4CBZA 2VDNB 4MXVF 1N6QL 1MN4A 2X4RA 4R4ND 4U4BA 1M1XA 3W0WE 3DJ9A 3DVNB 4IGBA 3UO1H 1A64A 3CPLB 3FQWA 3BAXA 3MNDA 3WLWC 1AGEB 3L7FA 1V3KA 3D07A 3OD3A 1LTXA 2B15A 3GJFB 2YZ1A 1DVSA 4PUBL 4ES9A 1ORSB 4XPBH 1V7NL 2Q7NA 4MZRA 3H85A 4M4RA 3RVXD 4DK3A 5MEPA 4MBRA 1FGNH 5FYLD 3WNJA 2HXAA 4QRPA 2RB8A 5DU7A 2YAPA 4HKBA 3X13B 5HBBA 2J73A 3B34A 4HC1H 5AZEH 1G84A 5IBLD 1JVOA 2XWTB 3IFNH 2BERA 3QXUA 1RVFL 2CLVA 4JUSA 2ZUWA 1T66D 5HY9B 4HXBL 1B88A 1DQLH 4EE2A 2WY3B 1EO8L 1UXWA 3W39B 2CCWA 3N0AA 1RD6A 1IM3D 2BFVL 3D39A 3DSNA 2W07B 2Y7SA 2V9RA 3SDDC 1FO0A 2BDNL 3VDAA 3C60C 2WUBL 3PWPD 1ZLSL 5DTFA 3WLWD 2PWDA 3HC3H 2D9CA 5IMLA 1RZ8B 5AW5B 1N7MH 2FL5A 3F7RA 3ISRA 3NEEA 3U7YL 4HCGA 3F7LA 3HZYA 1SM3H 1NSNH 4IIQA 3MOQA 5JTWA 4FQHB 1U3HA 4K73A 4GRMA 4FXGA 1IQWH 3JV4B 2EVJA 3SDXB 3UYPA 2P80A 4KQ4L 4NHCH 2GJZA 4XH2A 4XCCH 4LSDA 4FXLA 3HPLB 4JDEB 1ZPUA 1IL1A 1FGVH 4I4WA 2ICWI 5ECJE 1MWAH 3SKMB 2AXFA 4AM0B 2BSTA 5MHSD 1Q9OA 2J5LB 5DEGB 1EHXA 1NWOA 1V7ML 1M71B 2YAQA 1RP8A 5GRJH 3UBXI 3CZFA 3GDCA 3HZVB 4ZO9A 4MCZB 4Z7OF 3UP1A 2FCBA 3BSGA 4YHLH 5KVGE 4RGNB 3WFEL 4POYA 5DJCA 1AGDA 2EC9T 2VC2L 4JM0A 4KI5E 3SDDD 5FYKE 1FVDB 3C60D 5FLVA 3BIAX 2X6CA 4LMQE 4EN2A 1C8QA 3UOAB 4B0MM 4G1EB 3RTQD 5JW3L 5E5RB 3VFVA 2JJTC 2HJLB 3MRGB 4F3FA 1UEYA 3DVFA 4D0DA 3T0EA 4W9KC 1PKOA 3KCWA 5JXAL 1A7BA 2Q0ZX 3DSFH 2J1KA 3SKNB 4QRRA 2ROXA 2F7QA 4UM8A 4GRLD 1MDTA 1NFDF 3WSQL 1KJMA 4FNSA 1IC5L 3B43A 3ZX1A 2NY1C 4LFHG 4QUOA 2ZOKA 2AV1B 1SMAA 4R90H 3JTBA 5DVNA 1RHHA 2WIMA 2VYRE 3QDJA 2V8MA 1SF5A 4S1RH 3VW3L 2H8PA 2R9HC 3OTTA 3Q2NA 3IPFA 1RFDL 3I02A 3EJZC 4Z7UF 2PPCA 4BQCA 1A7OL 4ORGA 4JGJA 4DNLA 1LE9A 4ZW5A 2EEXA 3FH7A 3KR3H 4OQTH 5GRZA 5BVJA 4OI7A 1UD8A 2UY6B 5KSBF 1I7ZA 1VADB 1MWAB 4FC3E 2X1QA 3D33A 4JM2F 3MROA 4NKDA 3Q06A 4AQ8A 3F7YB 2KKQA 4CRPA 1KWKA 2XY1A 3RPIA 2QVIA 2X6AA 4CC4A 3AREB 1U4FA 4ONFL 4ALAH 4DKTA 4UMSA 3FQYA 3WIIL 4G6KH 3K6NA 1JPFA 2NY1D 3OX8B 4K71B 2BNQE 1OT4A 1XHHA 4KUCF 1E5CA 2DWDB 1BQLH 3SDCB 4A7GA 5AAWA 5L8LB 1OO2A 1HI6A 4NKMA 4LLWA 2P28B 3WDHA 1JHKL 2A74C 5I8CB 5JXEA 1CICC 1NBZB 3VYNA 3EJZD 5IMKA 5D70H 1OOAA 5A40E 3ETTA 5D6CA 4K5LA 1FF5A 3O8XC 2F7PA 1J8SA 2QQKL 3EDFA 4NZFA 4XO3A 1AS6A 1EANA 4X4KA 1TVBB 1RMFL 3QZOA 4B9FA 5L4MA 3WUWA 2FEEI 1LP9B 2LU5A 4PRDB 4NQUA 1XF1A 4ZAKB 5DZPA 3VACA 5JQIB 4FQCH 3VXUD 1P9MA 2Q9OA 3KS0H 4LRNH 4RMRA 1LQBC 1JJUA 2CUHA 4WFFE 3A0OA 3T0BA 1P1ZA 1LEGA 1M1SA 4LKXA 1F5WA 5D7LB 1EFXD 1FFPA 4TNFA 2X40A 3FBKA 3ARFB 5EDSA 2ENSA 4UQIM 1JGEB 1I3GH 3H0TB 4OFIA 1L4IA 2ZP0T 4XVTH 4LASH 1IKFH 1GSMA 1KJ2L 1IU1A 1CICD 4XC1L 3H53A 4FFWC 3I9GL 4Z7UE 3AY4A 5GS2H 1PZAA 4BGDA 1BQ5A 4JDVB 3K71A 1PCSA 1A4JA 2X42A 4P57B 3FQ1A 5INDA 2X9YA 4NN5B 3O8XD 4M8QB 2CSPA 4OCXL 4R7NA 1LK3H 4AUYA 4D9QD 4OZIE 4OLXL 1I7UA 2APWA 2WWOA 5F88A 3WJLC 3MUZ1 1TQWA 4LDLB 4A6YA 2PYEB 3QFDA 5J6GA 3BP7B 2CLRA 4G7QB 4WUUD 5TDPA 4GG6A 3BDBA 1CD8A 2E6QA 2Z8WC 4O4YL 4GXVH 1I1FA 5GZOC 5GGVL 1WHPA 4AZ8A 4EUPG 4AC2A 1JK8B 1Q9KB 4NS0A 4J6RL 3CV5A 2PYFA 2OL3A 3CZEA 1COBA 2MOVA 1F56A 1JGIA 4R7DB 3UTZB 3QUXC 3BT2L 3BXNB 4P2RB 3SGKA 3RGVB 3UO1L 4MNQA 5E1AB 2DLGA 1UWEL 5J9PA 1PYWA 1X9RA 3N1GC 4NZDA 2VR9A 5B39G 1F4AA 1XGZA 2GK0A 5DQ9A 2WXIA 2DI9A 3FPXA 3QNXB 4WNJA 4FFWD 5CLXA 1XIWB 3E2HC 3QDMA 1MUJB 4UCFA 1L3NA 1MCJA 2MHAA 4NUMA 3RAJH 3KXFA 1A4BA 1SRDA 1Z66A 2X1PA 4NFCA 4UYPA 1B0GA 5GGVY 3RU8L 1HC1A 4HC1L 4JFQB 5JQ6H 3IMVA 2ZCZA 2FHBA 3ZKMC 1F3DJ 2JCCA 5J1TC 1AH1A 1UD4A 5GZOD 2R23A 3KVQA 3VXMD 2VABB 3GZKA 3TA3B 1T7WA 3HAEH 4XBEH 1FFRA 3A4FA 2B2XL 2B5IB 1MHCA 2QHRH 3QUXD 2JELL 4BFIB 3O3DA 2J3SA 5FW7A 5HHOB 1UWFA 2EIBA 2VDRL 3I9IA 2PKDA 2VZOA 1ZHBA 4U6HA 2FHFA 3H55A 2DQJH 1D6EB 1T89A 1CS6A 3LHPH 3OKMA 3T1FB 4PLOB 1MFEH 1FUNA 2ZOTA 3OMZA 1JN6A 3BGFB 3VXSB 1Z5LA 5I6MA 1KTRL 1JNJA 1CDHA 4HH8A 2VJ8A 4WI3A 3GFUA 2RA1A 3BCDA 5EPMB 4XCCL 3NIFF 4Q7DA 4DP5X 5BXFB 1IILE 4PB9H 4D7PA 1H9VA 1MWAL 2YS4A 4NRXB 3FTWA 1CD1B 3BUYA 3NP4A 3APDA 5GRJL 4GW1A 4J3TA 4Y16C 4YX2H 1MRFH 1AE6L 2XTJC 5DZJA 5HHME 2XG5B 3MLSH 4FG2A 5EC1B 3TVMC 3BUIA 1GMEA 4UIMA 5DVLA 3AT8A 1CLYH 2ZUYA 1YNLH 3EJTA 3FUEA 4DHLA 1KBVA 3MOAH 1PY0A 1U95B 3ARDC 2CIIB 4Z5RB 2H1LM 2JKJA 2BVUA 4Z77B 2CRIA 4G6MH 5CCGE 4ONGH 1NEPA 1JTPA 4EI6B 1F11A 2HFGH 3B83A 3DSFL 4WRLA 3ZO0A 3QUMB 4NNXB 3MKKA 4OCRL 4BBWA 3BYTA 3RPBA 3MRRB 1FH5L 3HAEB 2C4FT 2IPKB 2P1YA 4CDGC 3DMMC 5D1ZB 1QUPA 2Z0UA 2GUOB 1MCFA 1I3RB 2P8LB 4JFXA 2QJDA 2HTLC 4XNZC 5EEXA 4R90L 1RUMH 2EXYC 4EO5A 5FDWB 3AQXA 1TOXA 4Y16D 3QWRD 4KY2A 2DWXA 3QZPA 3V6ZA 1I7RA 2RBLA 5AVQB 5A2LH 1M7IA 1BBDL 3TVMD 1T7XA 2BS9A 3SDAA 4Y2DA 4BFKA 1PVHA 3LPFA 1L9QA 3NZUA 5J12C 3WMPA 4F91B 4LLVB 1YNTA 2P8MB 4KUZH 5C08E 5I28A 2APXA 5G2NA 2YJQA 4CVUA 4JFOA 1ML0A 1KNOA 5H37G 2KLRA 4OFDA 2I60H 5I8EA 4PU2A 1SDYA 4PRPD 3MLUL 3BO8A 5CIPH 2VXTL 2WK2A 2EUXA 3DMMD 3L5XH 2CIKB 1BHGA 2W59A 4G6KL 4Y9EA 5IHZA 4LNRA 2JTDA 4P3DA 2HTLD 2XKUA 3KWWB 4V1DE 3GHEH 3OAUH 5FKPA 3LRSA 3J2PA 4KTDH 1NAKH 1KIRA 3QA3A 5TH2B 4XGZB 5BV7B 2XCMC 2NYYC 3KYAA 3L3JB 3OMAB 2V2TB 1A3RH 3U9PH 5E4EC 1MSPA 3S97C 5JHMA 3QEUA 5EA0L 4F7PA 3TBVA 2DLTA 3EGDB 1YEGH 2DM4A 2IBGA 1OTTC 3SKOA 2G2NA 5BQ7B 3NCEB 4YAQA 1ZCRA 2L4OA 4JFDE 3AT0A 3K2KA 3EFFA 5FO8A 4O02A 3V9CA 5DMKA 2K8MA 3IDXL 4G8GD 3EXLA 4Y4FA 3CFKB 3WIFA 2OXHB 1JRHL 4S11A 3HLKA 4HS6B 4Z1PA 3IEAA 1KLUA 3MV9E 4ZPVB 1GYAA 1AXSB 4L0PB 5ALBH 4BHUI 3SE8L 2DL9A 4TNWK 3NIDF 2WM0A 3ZE2B 1E8YA 5SWQA 4YHMH 4IRJC 1K3ZA 3QG7H 4GSXA 1QQDB 3CHSA 2NYYD 1IQDA 4EBQH 3W9DB 2EDNA 5AVTB 1RUKH 4Y1AE 1WGVA 2AXJA 4GSDH 1BLNA 1NCCH 1SEQH 2XQ0A 3O45B 1M2OA 4I0PA 3N42F 3NPSB 3KHQA 1OARH 1T21B 1WQVT 4HUWB 4WK0B 2EKSA 4PRAB 1IX2A 1C12B 3CFCH 3RVUC 5I1GH 4Z7NF 3G5VA 1UCBH 5DK3A 4KPHH 4YZFF 1ZGLP 1EEZB 1UWXK 1RERA 4MS8C 5I1DA 1DBBH 3QUZB 3IETB 1BV8A 3OJMB 5C0DA 3PWJA 3T3PB 5EZOH 1R3LB 2FJGB 3V0EA 4E68A 4BSVA 4P5RA 3MNWA 4HJSA 4UDTA 5DFVC 1EJOH 2Z34A 4E9XA 4YLQT 2NX5A 4Y1SA 3ZXAC 4GT0A 2VE6B 4G8FA 3QIBB 5FCSH 3GINA 1DBML 1NGWB 2P5WA 4IRJD 5I82A 1U8QB 1TPXB 3FB6A 3SBPA 3ZDXF 2CKNA 2WQSA 1JD9A 1JF5A 2WLZA 4XPFH 2EILB 4KDWA 4IDJH 2Z31B 3RAJL 4FEIA 4F93B 4JPSA 4B50A 1BW8A 2Q7AA 3MPCA 2GFBA 4I2XE 2X0VA 4PG2C 3RVUD 2CQVA 3AQZA 3FUJA 3L1OL 3ATFA 4MS8D 4X5XA 4UM9B 2AXHA 3AWEA 3NJIA 4U1LA 3FHEA 4JLRB 2ZTBA 2O61A 4LDEB 2YWZA 2X4SA 1H6EA 2A73A 1SEBA 2MCMA 3HG1A 2FX8H 3O4LD 4OZHE 4BK5C 2PPFA 3OQRA 2EEFA 2GW5A 4ILDA 1MCHA 1AZNA 1NGQL 5K1VA 3X1FA 5IGXL 4Z95L 1XZ0A 3G6JB 4MNGB 5E2VH 4AQ1C 3ZDZF 3DNKA 1M3JA 2LU3A 2WVTA 4JZJC 1UM6L 4WIQA 3FT3B 5AEAA 4RIRA 5K33A 2PP7A 2K6YA 1Q1PA 1I8MA 4OFKA 2DQJL 1T5KA 4OCNC 4PJAB 1HQ4B 4Y89A 3BEWA 3FDWA 2R27A 4J3SA 3GMOA 3UIYA 1MIEL 3HKZA 3WUWG 2BVEA 2J2ZB 1MELA 3TZVB 2KBGA 2FX9L 4NQQA 4G5AA 3KD4A 1X5YA 2AP2A 1Q94B 2BCMA 2ZUQC 4NWTL 4OKVA 4N85A 5EU7E 5E08H 1O6VA 1PAZA 1YAIA 1NPUA 2FT7A 4GW5B 1Y0LA 3NRPA 4L9LC 4DEWA 1TZGH 1SHSA 1FIEA 4NAJA 3ZHNA 2J88H 2IBZY 5HGAA 3O11A 3ZQWA 1W16A 2W92A 4YX2L 2VIRB 1E43A 4LQ1A 3NCWA 5C0CE 1OZUA 1PD1A 3JV6A 1WTLA 1I9IH 5DS1A 4D0CB 3HBQA 4JFZH 1CLYL 5EV7A 3TIDB 2VLKB 1IGTA 1E9PA 4BFOA 3DV6B 1JWSA 1NCHA 4MDJA 3R7QA 4UYQA 4JNXA 3MOAL 4N6QA 2PR4H 3V5DB 2EADA 2XRAL 5E56A 1KACB 4HUVB 3QJFB 3DJZA 3ZUCA 1OF0A 3LKNA 3RWGB 4G6ML 2FBRA 3NG5A 5D6DC 5HVWA 2NZIA 5E8DL 2HFGL 4I77H 3SE3A 1U3JA 2Y23A 4LP8A 1XTMA 5DQJB 3BUBA 5BO0D 4R4FH 1DSFL 4MA7H 1NC2D 5KANI 4PTTB 4AEFA 3BWZA 5C09B 2YRBA 1BDYA 1FVEA 3W5NA 2E4TA 3O2DA 4M1GH 3RKDC 1HHIA 4HGWA 4BA8A 5E70A 4ZMQA 1HOEA 4JY6A 3C5SA 1S3KH 5B1KA 1P7QD 4YNYA 3T2LA 4W4OC 1SF3A 4JAMB 6PAZA 2NNCA 2KC0A 4MD5A 3ZDZE 5JPMC 4QOKD 4GKSB 4N8VA 2CHWA 5ES4B 1PG7W 4QGYA 4ZOAA 1QBLL 4C4KT 1ZEAH 4N25A 5AAMA 3GKWH 4K8RL 4DH2A 2RMNA 2MNWA 3BP6B 4L1TA 4GKNA 3BZEA 3RB7A 1JNNH 4MMXC 2CGRH 5MENA 1ZVYA 4ENEC 2I60L 1D5RA 4LLMA 4MA1B 5IREA 4ETQB 2C1OA 1QEWB 1J0JA 4NKIH 4OGAC 2WBJB 2N59A 2X4UB 4TVSa 3FPYA 3L5XL 3EFDH 4MA8H 2YSSB 4XN5A 2BCKB 2J6WA 1M05A 4N20A 3GHEL 3MYJB 4D3CH 1FBIH 1XL6A 3RKDD 4KTDL 4JO4L 2QZQA 4TM9A 4UNTA 2JB6B 3PWVA 3BQUB 2O5XL 1KENH 3MLVL 1A3RL 3U9PL 3B7TA 5AW8B 1ZTMA 3AWFA 2IEPA 4YHIA 2XZQL 4X8JB 5AVYB 3FO2A 5HDRA 3VI4A 4KNSA 5DJZB 1YEGL 3X2QB 4Q4IA 4U6VL 3TU6A 4Z78B 3KPLA 3TL5A 1A5FH 2R1YA 5K9JH 2IALA 4KJQC 2ICEC 3BFWA 1VCAA 4ONHA 3TCLA 4ENED 1CGYA 1KIUB 1QR4A 3TA3C 4I3RH 2HJFA 3CWGA 3ZMRA 5E8PA 4OGAD 4P46B 4DO5A 1S5IH 4NPJA 3ESNA 2ARJA 2K9FB 3UEZA 4LIQL 1JXGA 5EU6E 5EZLB 2EO7A 3HRZB 2VDLH 4E9WA 4YXLH 3DI3B 3QJSB 4IOSA 2A4EA 3DOSB 3QG7L 4NUPA 3BVVA 2OZ4H 3D50A 4O2CB 3H2PA 3EGXB 4IMLA 3D0LB 1RUKL 4HIXH 1AP2B 3GSUB 4GSDL 1FCGA 3QZNA 5FX3A 3V6FB 3WD5L 1A9EA 5FM4A 4XX1E 1DFBL 5I5JA 1N5AB 1U8LB 5E03A 1VPOH 4FL4B 4ELMF 1S7QB 1NCUA 4UTBL 5I1GL 1HE8A 1RULH 4WWKB 1T20A 3BFQG 1UCBL 2SODB 4M48H 5JZ7D 4KPHL 1NDGA 2WXHA 1NBYA 4R2GC 2BWIA 5CWSB 3ZRCC 4R3SB 3TA3D 4PGEA 4U3SA 1HNFA 5EZOL 4LT7A 4YHNA 5JOEA 1GAFL 3CFBA 5HYIA 1KPVB 1EJOL 3GMPB 1IT9L 3PHOB 5C7ZA 3O9WB 2PCYA 2Y5TB 3MX0B 3VO0A 2OAAA 4U1GC 2QDVA 2R1XB 1MI5D 1VRSA 3CZLA 2WCPA 4OLWH 4HISA 1I7TA 2R1WB 5EN3A 3QP3A 2FIKB 5DJAB 5GPRA 4F27A 4OZGA 5F6HI 3HMXH 5E6ZA 4XPFL 3CFDB 4AXWB 5ICYA 5KJ4A 1T2JA 1C16B 2A9MH 1JZDC 1WAPA 4XRCA 2EDWA 3GXDA 2VDLB 4F15B 5CZXD 1UXLA 3D30A 1ID2A 4R2GD 4HCIA 1OW0C 4KX9A 1U3NA 2OPCA 1JNHB 2CK0H 3LQAH 2JMRA 5J89A 3BPCA 4H8PA 5CR8A 4RFNC 2FX8L 3BQVA 4Y4HB 5JPNB 3F7VA 2QADC 4PRHA 4DN4H 3LKRB 3F8UB 3D69A 1U8PB 5T3ZE 3UZEA 2H0EA 2IAAC 1NUFA 2GSGB 5AUMB 4QHPA 5E2VL 3LSOA 5IVOA 1CC3A 3KVDD 4A39A 5IESH 4FQXA 3LNFA 2C1PB 4ZMTA 3UACA 2D31A 3MRCA 2ZX9A 5CCHE 3P3RA 3NJLA 4X4XA 4HUXA 4X99B 3WXVH 1QX1A 3ULSB 1XAKA 4HAFA 5FEBA 4S2SB 4P59H 5A6MA 1RJZB 1HIMH 4G5ZL 4ZD3H 3IJ8A 1J9CT 5HGGS 5I30H 2APVA 3MV8A 1R0AH 5E08L 4DP4X 1E67A 1ZVSA 4CKVX 4ELME 1OAYL 3C12A 5D1ZD 1BOYA 2PO6A 5FFOA 4OM0H 5CZVH 3VXTB 2Y06H 3W0WA 4DWHA 4HOWA 1RZGA 1TZGL 2VCOA 4K07A 1LO2L 3SO3C 2J88L 3TIEB 5K59F 2IPUG 1B2WH 2Z8RA 3OB0H 2Y7MA 3EG9A 4BV1A 3F6LA 1JPEA 4Y9CA 4DZBA 3BSZH 1J0KA 2NYKA 4PJEF 2BIIA 5CZKA 2H1XA 3U0WH 4GI9A 1I9IL 4LBEA 4PGCA 3OXSA 2QADD 4Z0BH 3MUUA 3WFBH 3K6FA 3Q8BA 5D7JA 3RVWC 1UJ3C 5DRZB 2F7RA 5SWZE 4HULB 5GXBB 4MX7A 4WU7A 3CX5J 1QOKA 3BGMA 1R46A 2PR4L 2Y69B 4WY7L 1GZHA 5IUCA 4KVNH 1TVHA 2ZKMX 3VGBA 2H47C 1EZLA 3CU1A 3T9WA 1R5IA 2CHZA 1FZJB 3V5KB 2A4ZA 1YEJH 3IU3A 3OPZL 2G5RA 4G80B 1OTSC 1UD5A 2XN2A 2WXGA 3I6GB 1KYOK 5KN5B 5E2TH 3ZE0B 3CVIH 3EDKA 2DQFA 3UIZA 1LMIA 5KYWA 4ZUUA 1KEGH 3MA7A 3MV7B 3PWUA 1CGSL 4FFVC 2AAAA 4C54A 5I2IB 2AEOA 4K3EL 1P4BH 5HGHA 5CMAB 1Y18A 4BINA 3FUDA 3MHZA 4UF7C 1LWRA 4ICWA 3VGFA 1Z9MA 2OTUA 2Z7YA 2WINA 2ZXAA 4WNQA 4S0TD 3SDXE 1ZGLM 1CXLA 3RVWD 4NC2B 3IXTB 3DO3A 1BVNP 4Z3FA 2DB8A 1EVUA 1DSYA 4L1HA 4ABVA 4UQBA 4U1IB 4KQ3H 1NJ9B 4P2YA 3IN2A 5TDNB 3B2UC 1JNNL 5MI0C 1A1OA 1D7CA 4FAAB 4Q58C 1AMXA 1BWMA 3I75A 4G9FB 5B21A 4RGNE 2YD2A 3DOHA 4L23A 5I1CH 1OTSD 5CP7A 4WUKH 2YPVL 1JHLH 4GIAA 4NKIL 1PW3A 5IBTH 4K3JH 2IAND 1RUQL 1HEZB 1PF3A 5K59E 1ZV5A 1Y1DA 4MA8L 3TYFB 4HBCL 3TA4D 4AVIA 5GIRB 3AAZA 2WNWA 1OSZB 1FBIL 2ZXQA 2E6PA 4FFVD 1P4IH 2FBJL 4JN2B 5JHDD 4PJEE 2X28A 4PB0H 3EO0A 1G7PB 5CBAB 1LP9F 4DEPB 2FATL 3GXUB 4QAMB 1K4CA 1PCXA 1FVCA 1XGYL 2GAZB 3QQDB 5FWRA 4OGQC 5CGBA 4AGNA 2GIXA 4N86A 5A2KH 5J6HA 3C9NB 3EBHA 4XVUC 4CADA 1CL7L 3B3BA 1I4FA 3R4RA 1S5HB 5KBDA 5I0WA 3H2WA 2X89D 3VFPB 4U31A 5K9KB 4LESA 5K9JL 2H7WA 3FH5A 5FK9A 2D7PA 3QUZD 4KXCA 3DIVA 3UZVB 4GKZA 1QFWI 4I3RL 3N3EA 4ES8A 4XCNA 1UFGA 4PD4J 4X7FC 2H41A 4EIUA 2Z65C 8FABA 1FV1A 1ET5A 2XWCA 2KQNA 4AGLA 4HHGA 4MJ5A 4UQ2B 3AACA 3V0FA 5A6LA 1OF2B 2X3AA 2H3XC 4NPYB 1CFMA 3T4AC 4JFED 4BZ1L 1EEYA 4F37F 4OU3A 4WO4A 4X7DC 2FEDC 1NLBH 4RVBA 1T1YB 1XXFC 4ODHL 2GTWA 2XQYA 4I0CC 5I23A 4XVUD 5F0JB 5ITBH 2HG5B 4H7VA 3MCKB 2R0LH 1EK3A 1KBPA 4CN1A 1VPOL 1GH7A 4ZSOA 4DGWC 2IMNA 4Q8BA