4ZK8A

Copper-containing nitrite reductase from thermophilic bacterium geobacillus thermodenitrificans (re-refined)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
294
structure length
294
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Structural insights into the function of a thermostable copper-containing nitrite reductase
pubmed doi rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Oxidoreductase
total genus 98
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4zk8A00
1PZCA 3CG8A 3KW8A 3AG1B 3WKPA 6PAZA 1BQRA 1GY1A 3T6VA 4AKPA 3EH3B 1KGYE 4N8UA 4K9JA 1PY0A 1PNCA 3FPYA 3ERXA 4DP1X 2FWLB 3X1EA 3UABA 3NJLA 2PLTA 1XB6A 1TEGA 4HIPA 1JVLA 2HX9A 4BXSV 3ABMB 2JXMA 1CYWA 1ZPUA 2EIJB 2VSMB 2GHZA 2TSAA 4KOCA 4AKQA 3SBRA 4YSTA 1AOZA 1AR1B 2VM3A 3FSAA 3NT0A 2N0MA 3OMIB 4ENZA 5B7FA 2H47C 3TBBA 3JTBA 2BW5A 2PCFA 1MDAA 4RH4A 3X2QB 2QT6A 3QJRB 4DP7X 3T6ZA 2FJSA 1ZDSA 4YSSA 2W8CA 1CYXA 2PPFA 3PXLA 1GW0A 1PLCA 1BQ5A 3X1BA 1J5CA 2EINB 1WAEA 4NERA 2FT6A 2QDVA 1TKWA 1ZIAA 1R1CA 3GYRA 4A66A 3NP4A 4GXFA 1QHQA 2CJ3A 2AVFA 3CZUB 3AG2B 5B1AB 1IBYA 2CUAA 1AZBA 1J9RA 1SHXA 3PCYA 2UXFA 1PF3A 7PCYA 1TEFA 4DP6X 2DWTA 1QLEB 1WA0X 5FC9A 2PP8A 2Q5BA 2AZAA 4E9TA 1KCBA 3NJMA 2CBPA 4E9QA 1VLXA 3V9EA 3AG4B 2J55A 3WIAA 1ASOA 4HCGA 3G5WA 4YSEA 2BWIA 4KOBA 2XVBA 3SBPA 3QJTB 4YSOA 5B1JC 2IAAC 3PLYA 5I5JA 4W1TA 4YVNA 4BWWA 2HZHA 1XB3A 2BO0A 1KYAA 1JZJA 1ET5A 1GSKA 3QJSB 1NIAA 5B7EA 1SFHA 3AY2A 2JKWA 4YSPA 3KW7A 4Q8BA 5PCYA 3UADA 3UAEA 3N2JA 3AG3B 3OMAB 3TASA 5E9NA 3FU8A 2DYRB 2FQFA 2PPCA 3FQYA 3FU9A 2OV0A 5F7BA 2IDUA 3ABKB 2X88A 4HHGA 1WA1X 1DYZA 1GR7A 3CDZB 1B3IA 2YAOA 4DP0X 1JERA 2YAHA 2EIKB 2XU9A 3X1GA 4A2DA 2H5UA 3ABGA 2XYBA 1FFTB 4YSRA 4CSPA 2UXGA 2BWDA 2NRDA 4KNUA 4A67A 4A2GA 2HXAA 2CCWA 2FQDA 1JZIA 3H4FA 3WNJA 1RCYA 5I26A 2FT8A 1HFUA 3BVDB 1E5YA 4DP2X 1JXFA 1PNDA 4KO5A 1ZIBA 2BP0B 3QJVB 3FSZA 2GC4C 1GS6X 1A4AA 1AAJA 1NPNA 1W8EA 2HLEB 3CDZA 4KO6A 1CC3A 2PP7A 1JOIA 4WTQA 3T6XA 3ASNB 4L0PB 4BXVA 2A3TA 3WG7B 8PAZA 2IDFA 1XB8A 1JZHA 2J57A 4ZK8A 1BYOA 3NSCA 3CVDA 5D4HA 2J56A 1XMEB 3FS9A 3PPSA 1L9QA 3H4HA 1CURA 4BDVB 1SF5A 2I7SA 2TSBA 4QKTA 2WO3B 4DPCX 2GIMA 1X9UA 2FT7A 5B1JA 4DPBX 2IH8A 2EIMB 4AI7A 7PAZA 3ZIYA 1AG6A 1FWXA 4E9VA 2I85A 4E9SA 2GI0A 2JFCA 2X87A 1W6LA 3X1FA 1L9RA 5PAZA 4BWUA 3ZX1A 3GXUB 4KO9A 3FYEB 1AS6A 2YARA 4HHWA 4Q89A 4PAZA 4AKOA 1A65A 1T5KA 3ABLB 2H3XC 5TK2A 1KV7A 2P80D 2VSKB 4YSQA 3T6WA 4AZUA 4DPAX 2GBAA 5B7MA 1NZRA 1WS8A 1A8ZA 1A4CA 2PP9A 1AZCA 4JKNA 2HRHA 5ANHA 1E67A 3GDCA 1SDDB 4E9XA 3H56A 1PLBA 2AANA 3NJFA 3S8GB 4TXVB 6PCYA 1EZLA 1PZAA 2XXFA 1UATA 2YXWA 2YXVA 2IH9A 1BXAA 2PPDA 2YQBA 3CVCA 2RACA 3FU7B 4HALA 2IWEA 1NWOA 4GY4A 2IDQA 3DIVA 1BEXA 2XV0A 4GP5B 4E9YA 1IC0A 1AS8A 1ASPA 5I6NA 1V54B 2GSMB 3AW5A 3FPXA 5I5IA 2XX1A 2CAKA 3EHBB 2IWFA 1ADWA 1J9TA 1GS7A 2R7EB 3NSDA 2OCCB 3NYKA 1AG0A 2QPDB 3NP3A 4G7QB 3X1NA 1SNRA 1SDDA 1ZDQA 3V9CA 4DP9X 4E9WA 2PPEA 2QDWA 3IBOA 3S3BB 1L9PA 5A7EA 3UAAA 1RZQA 1NIDA 3ZDWA 1OOWA 2E86A 4A2FA 5F7AA 5B1KA 2YAFA 3FSVA 4UANA 3PAUA 1HAUA 4UF7C 3SBQA 1SHWA 3EH4B 2PPAA 3CVBA 4GP8B 1NICA 1ZV2A 1MG2C 3TA4D 2AZUA 1BAWA 1E65A 5AFAA 3OD3A 4KNSA 1I53A 1OE2A 1WA2X 2R7EA 4G7SB 1E30A 2OJ1A 2Q9OA 4YSUA 2XXGA 1IUZA 2VW4A 2UX7A 3MBWB 1PMYA 2YAEA 5IY5B 2BW4A 2FNWA 2UXVA 3S3DB 1KDIA 2EILB 4JHUA 2CALA 3NSYA 3NJJA 1BQKA 2FQGA 1OV8A 1YLBB 4E9RA 2PCYA 1A3ZA 1V55B 2DY2A 2FQEA 1QNIA 3C75A 2DWSA 1W6WA 1ET7A 2AFNA 2DYSB 1X9RA 3ZBMA 4A2HA 4YSCA 2IDSA 2ZONA 3U25A 1ILUA 3OM3B 2YAQA 5AZUA 2HX7A 3PAZA 9PCYA 1TU2A 2BZCA 4HAKA 4YSDA 2BZ7A 5I6MA 3NJNA 4G72B 2XUWA 3FSWA 1MZZA 1CUOA 1OE1A 2ZXWB 2BP0A 3FQ1A 1PZBA 1J9QA 1BYPA 2XX0A 5EHFA 2LLNA 3SQRA 4F2EA 3RYMA 3BQVA 4JHVA 3WI9A 1KBWA 1BXVA 3IEAA 4HCIA 2W88A 1A4BA 2VN3A 1GY2A 1DZ0A 1NIFA 2Y69B 4M4RB 1ETJA 4A2EA 2IDTA 3WKQA 3D12B 3EH5B 4GYBA 1NIEA 2B3IA 3OMNB 4BDVA 4YSAA 2VM4A 1SJMA 1JVOA 3S8FB 2VW6A 2MRYA 3IN0A 1JZEA 4EF3A 4NB7A 2UX6A 2I7OA 1PAZA 2WO2B 2WSDA 4WKXA 2FTAA 1J5DA 3OQRA 2YAPA 4AX3A 4F7KA 1JZGA 1AIZA 1PCSA 4UAHA 3UGEA 1MZYA 5D4JA 1AQ8A 4YL4A 3AZUA 2GB2A 2XWZA 3QPKA 3MX0B 3NJHA 4N4YB 5I6LA 4HCFA 1F56A 4PCYA 1AACA 1OCZB 1IKOP 4FA7B 2BHFA 2MTAA 1M56B 3NJGA 1WS7A 4M3HA 3NJIA 3FYIB 4P5RA 2HRGA 1SF3A 1BXUA 4BWTA 1AZUA 1KCWA 4HZ1A 1NIBA 2GC7C 1RKRA 3QJUB 3N55A 3EF4A 5LDUA 1URIA 1AZRA 1IBZA 2B08A 2DV6A 4G70B 4DP8X 5I6KA 3HEIB 3S3CB 4A68A 2P80A 1HAWA 1J9SA 2VW7A 2ZWNA 2Y1AA 1OF0A 4DP4X 3ASOB 4MFHA 3TBCA 5I28A 1OCRB 5B1BB 1ET8A 5I5MA 1KDJA 1AANA 2IWKA 1E5ZA 4P5SA 5TK4A 3DKHA 3FU7A 3L45A 4QLWA 3IE9A 3T9WA 1OE3A 3FQ2A 2BP8B 3T71A 3IN2A 1NPJA 4YVUA 1JXGA 1V10A 2XV2A 2XV3A 1N70A 2UXTA 1GYCA 1ILSA 2YAMA 5D4IA 4FAAB 3FT0A 1FA4A 2J5WA 4CSZA 4DP5X 1RZPA 2ZOOA 4KNTA 1KBVA 1MG3C 1PLAA 3WNIA 1JZFA 4G7RB 3TU6A 1AZNA 3UACA 1M9WA 3DTUB 4NAJA 4X4KA 1JXDA 1SFDA 1GS8A 5B3SB 2VMJA 3JT2A 2XLLA 1M57B 1ID2A 4BK5C 3QJQB 3HB3B 1EHKB 3PAVA 2BP8A 2QPEB 4G71B 1NWPA 4GP4B 1OCOB 5AKRA 4F2FA 1NTDA 5I6OA 1N68A 1L9SA 1NDTA 1ASQA 4W9ZA 3QQXA 3NSFA 4KO7A 2HX8A 1L9TA 5I6PA 1OCCB 1AS7A 1L9OA 3NJKA 1NINA
chains in the Genus database with same CATH superfamily
4PJ6A 3AG1B 4OKVB 1BZ7B 2AK4A 2WN2A 5I1LA 2FZ3A 4Q6KA 5DGRA 3ERXA 1EZVX 3LRKA 4FEIA 5L4FA 3TZVA 1VGEH 2R1WA 3UPAA 2PW2A 3BZEB 4MB3A 2K7QA 3FF7A 5E00A 1K72A 2VXVL 3ML9A 4GKZA 3HZKA 1NANH 1KZYA 2A9NL 4XB7A 5FXCH 4ZFOL 1BM3L 2MSPA 1JWMA 3O6MH 3DSNA 3U0TB 2WWKO 4YO0A 2A74A 1N8OE 4IRSB 5IFAL 1OAYH 4FERA 4DKTA 5F7DB 3C12A 4Z76A 4JN2B 3FHAA 1JGLL 1VADA 2VLRD 2J73A 3P9LB 3VACA 4ZMPA 2G60L 2R29H 4MD4A 5K1JA 2HMID 1XZ0A 1JZ4A 4WNQB 4KGJA 1R3LB 4B9YA 2FBOJ 4DKFL 1I31A 4ANWA 1MRFL 4ZX5A 1BQ5A 1TTRA 3GMNB 4I85A 5EOTA 3UZQA 4F57H 3AS3A 3B1UA 1IGTB 2ZJSH 3REWA 4B53A 5MEQA 4F37F 3CSYA 2CIKA 5AOIA 3RJOA 4RGNB 3HI5L 1DFBL 4XB8A 5IVNA 4HWEH 4JG1L 4FQQA 4KDWA 4YE4H 1MF2H 1IBDA 4Q9QL 1MIMH 2H6UA 1RV6X 2FX8H 3F7VB 4OFKA 4OLZH 4TLUA 1C8QA 2K78A 2LU7A 3V5KB 5C7XH 1XGZA 4ZRGA 4KJPC 4AIOA 1M6OA 4JPIA 4MWFA 1UCBL 1TSRA 4LB8A 4DVRL 3MZTA 2OSWA 4ABUA 3EJSA 3QEQE 5EBLA 5FHBH 3TYFA 4OCMC 3HUJF 3KPRB 2FAUA 3IE4A 4GQPH 4N90E 4OFDA 3L3GA 3KDPB 4P4RB 4NWTL 5C0BA 5EZOL 5ETUA 3GJFK 3G04B 4GAFB 1A6AA 5ESAB 2Y24A 3C60B 2W9DH 3W11C 1P1ZB 2GJ6D 5B7EA 3AY2A 1F6FB 3X3FL 2NY6B 1NGPL 4UM9B 1Q38A 2E4TA 3FTUA 1BLIA 4QRRD 3TNNB 1X5MA 5MENB 2Q7AA 3QEHB 3DX1A 3SDDB 4NENB 4PUBL 3B8SA 4FX5A 3CFBA 4UDUA 1OTSC 2Y1YA 3MV9D 4KRLB 4QHKJ 2J8UA 4NWUL 2W60B 3N1GC 2W9EH 1ZGLP 4IRSC 4J7RA 3K2UH 1IVLA 4I0PA 2GG1A 1ZD6A 5DQJB 2R29A 4HIIA 3LPOA 1MI5E 1CD1A 1YEIL 3JUYA 2XBZA 3CFKA 3ZSTA 1P9MA 3FC8A 2PYFA 2WLHA 5I66B 5E5LA 4PJ5B 1CDHA 2L7JA 3DROB 2ADGA 3SE9H 5I19H 1R9FA 2BNQE 3LSOA 3QUYB 1Q1PA 3HHMA 4YDIL 5HSFA 4OFVA 5IFJB 2A83A 3CHOA 1YPZA 5AUMA 1RZJC 3CBJB 1P2CA 4IU3B 43CAA 4PS8A 2OMTB 3L3IA 1GZHA 1RZ7L 3K6NA 3TZVD 3ULUE 2APFA 5DJ2B 1PKQE 5KVDE 4OD1H 2K45A 5AB1A 4UNUA 4Z7WA 1XR8A 2OL3H 1SPDA 1Z66A 4L3EA 2XJLA 3LHPH 1HXKA 4QPEA 3I6SA 3L8QA 5F9OH 5EZPA 4EN3D 4Q2ZB 1H3UA 2ALWA 4L8CA 3MODL 3MUZ1 2R2CA 1NPNA 2HA1A 4G8IB 3GSRA 4S1DD 1BAFH 2J3SA 4XMLH 1HI6B 4GAJL 1OAUH 2C34A 3ECWA 4YGVB 4NM8L 3POCA 1WBYB 3RFRA 1BEYL 4I9WE 3FB6A 2BIOA 3TO2A 4HUXA 3OXSA 3VDAA 1WIOA 5IOPA 3DI3B 4MD5A 1IC4H 3PPSA 1L9QA 5AVSB 3BLBA 5CCKL 4YQXH 5HYQB 4JPVL 3BKJH 5ADPL 5KBLA 3VFMB 3MUGB 3NSXA 5DURD 1IGYB 2J1ZA 2XXMB 1ZGLM 2HLAB 3OR7B 1X9UA 3C60C 3IJ9A 4U1MA 3GS7A 1AMXA 1SN0A 2R2HB 3AITA 2NY6C 5D2LA 5A3ID 5CSGA 5HJGA 1TENA 4EUPH 2Q6WA 2K4AA 4ODWA 4HIXH 3OB8A 3PF2A 3V0VA 4PJHE 2K8QA 4CADB 1HHJB 3C8KA 2GI0A 2XKNB 3RHWF 5BJTA 2Y5QA 3NCBB 1KGCE 1HOCB 3ATDA 3KYNA 4KKCD 5GISL 4XNZB 3AADB 1FO0L 4B3EA 3GXUB 1TG8A 1V7NH 3MRMA 1FN4B 4JGUA 1VIWA 1QI4A 3E9UA 2YARA 4HHWA 4YPGA 1JF5A 2GK0B 4OCNC 1QTPA 5E9DE 1RHHA 3C9NA 4N22A 5L2KB 4R26L 3B2PA 1HSAB 2AGJH 4L4VB 1UWFA 5T1DL 5KJ4A 1B4TA 1N67A 3HPLA 5IW1B 2F68X 3T0WA 3T4YA 3QUYC 4NGHL 4ZXBA 5KVMC 2VDRL 4N8VA 2UY7A 2OMYB 4BHUA 1E67A 4PTUB 2IGFH 3GSVA 3M45A 4CMMB 5JPMA 2OL3A 2HJFB 1RVFL 2FE0A 1EZLA 5L8KB 1MHCB 3GIVB 2BIMA 3BZFA 2HFGH 1FL3A 1T5XA 2HB0A 4D2NA 4D8PA 3WTYA 1OPGH 3QRFM 5IBUB 2IGLA 1DBBL 3QWQB 3DA0A 3CPUA 2Z93A 3DX6A 5D7LD 2AF2A 5J1AA 4Y19A 4CDHA 3C6SA 3SDXF 1A7QL 4FHBD 4I0PD 3ULVH 4KMLB 4X98B 1OF2B 3V6OA 4KXZI 4EAEA 2ED9A 5GRUH 4LLUB 1WZ1H 4LOFA 3O9WD 1OALA 4PRAA 4YXLL 1I9JL 1IC7H 4N3TA 2C7FA 1H6EA 1NJ9A 1WUZA 5G5DA 1C5CH 3V6BR 1J0IA 2EE6A 4HFUH 5T5FA 2KERA 2WKLA 3CDYA 4JPWL 2OMWA 1T20B 1YMME 2HTKC 1S7SB 4WWID 2NUTB 3FU6A 4Y7MA 5DVLA 3VG0L 1CLZH 3RJQB 5BPPA 3LQAC 1I85C 2EH7H 2XRAL 4RAUB 5CEZH 1YQVH 1SUJA 4XMWA 1SDYA 2C3GA 4Y5XA 1G5AA 1CYGA 1MG2C 3NIDE 1A9VA 4K8RC 3D51A 1IJNA 1AQMA 3SGJA 4XNZC 1CG9A 2WNKA 3DXAA 2BY3A 2YLKA 2R7EA 3CFIC 1U0QA 1NUGA 2DWDA 5B39A 2NY5L 2CHDA 4AUYA 4QRPA 5G4NA 1C08A 3Q5OA 1OGAB 4EZJA 3KCPA 4QHLB 3D3VD 2VE6B 4NT6B 1S9XA 2CALA 2MCPH 3QQDB 2FD6L 2N0KA 4C58B 1BQKA 3ARGB 1U8IA 2MOGA 3HNVH 1XL6A 1A7OL 3LX9A 1AC6A 2YKLL 1WH0A 1V55B 2GSIB 4XC1H 1KJ2L 3KPQA 3MNDA 4AQ8C 1W6WA 4CGUB 3O2VL 4IMKC 1DJIA 4NNXA 1NC2D 1DQQA 3U2IA 2PO6D 1FDLL 1UD8A 3HOGA 3HE7B 4WFGE 5CWSA 5TQ2L 4PGDB 4YDKL 3A67H 2R69L 1A6TB 3C5JA 2X6MA 5IR1B 2ZWZA 3LXBA 3IJYA 4V2CB 2VR6A 1WWBX 3EO0A 1LO2L 1S7RA 4WJ5B 4Z23A 1G84A 1CUOA 4WY7H 4WI2A 4DQAA 1T7XA 4G6ML 4BFJA 2WHVA 3QJHB 3AABA 2DKMA 2VN5A 4P3DA 2PWDA 4N9GA 3KGSA 1MW3A 1PW3A 1RZ8B 3L1GA 3N43F 4L05A 1DCEA 3Q43A 1LDPH 1UH4A 3MREA 4J3BA 4L4JA 1ZPLA 1A7NH 1H6TA 5FLVA 2M26A 1QLEL 5IEKA 3BUBA 2JH2A 4PJIF 5CIPH 2FO8A 4O4YH 4KROD 1A2YA 1C5DA 4JKPL 1YA5A 3QPXH 5DVMA 5E6UB 3MA9H 1LNUA 1PAZA 2N7BA 3PYCA 4XHJC 4I4WB 3VI3E 3WIHL 4PJDA 3DK2A 1JRHL 3N5AA 5TF1H 3FW6A 2ZAIA 4X7DC 5C6TL 4JQIL 1MIEH 1AJ7L 3ZSSA 3FUEA 5FECA 4NHCH 1T1XB 4AQZA 4ONGL 3O6KL 5HHNA 3ZGHA 5FO8B 5BUAA 2JQMA 3EYOB 3GJEB 4N4YB 2EEXA 4IMLA 4R90L 1WC7B 3P4OA 3ARGC 4PCYA 1AACA 2R23A 5FYLL 3R18A 2CBMA 4WU7A 3FJTA 1NCTA 4HUUA 5JA8B 3SCMC 1HQRA 4UINL 1EXGA 1RKRA 1YYLH 2UZIH 3D0VB 3F7RA 4LE8A 3EF7A 1T89A 4G1MB 2CLZA 1E8XA 1E7VA 1GOHA 4NUJB 5I30H 3HE7C 2QGBA 2H3KA 3QORA 1YZZA 1GGCL 3IDIA 1HJBC 2YUXA 3BZ4A 3JV6A 3Q1SH 4BELD 1NDGA 1ZT4B 4IRJB 2VRKA 2IWKA 1KB9K 5I1IL 2EYRB 3Q2CA 3STZA 2F54B 4YK4B 3SYOA 4K9EH 2G3NA 4JFHD 5KBMA 2WWMD 4Q0XL 3N91A 2D2CC 4JFDD 1D7CA 2XV2A 3KD4A 5CIPA 1DJXA 1J8SA 5D4IA 2QTVA 3POHA 3LTVA 5FOBA 5BV7H 1R0AH 5E8PA 5IMKB 2AV1A 2YEZB 3J2PA 3QIWD 4PP2A 3Q3GB 6TAAA 3GI9L 4G6FB 4PRPB 2VAAB 2WXPA 3Q8CA 2X53A 3W5MA 3WNIA 4HF5L 1RIUL 1VCAA 4AQ1A 3HPJB 3ZJAA 4LPWA 5EV7A 5CCHE 2D7TL 2XN9E 4AIZB 5I0ZA 5CEXA 3OF6A 3X17A 1R5IA 4AUJA 4F3FB 2M2DA 5EG6C 1M57B 3UTZA 4LCYB 4GKNA 5LJYH 3QDGE 4FLQA 3RL2B 5D7KE 4BH7A 4F2FA 2BP3A 1DL7L 4JVPA 4IKLA 4CVWA 3D0LB 5KVFE 2AQQA 3WELA 2WN3A 1ASQA 4QOKD 1XO8A 3QNZB 4FTDA 2Q87A 2O93L 4YAQB 5C97A 2NZ9D 4DPRA 4L5FL 9CGTA 5KZCB 2J6EH 1AKJB 4PRHE 2LR4A 5I0DA 3FH7A 4L8DB 2H26A 1KGYE 3AT9A 4UM8B 3FULA 2WZ6A 1K4CB 2V3EA 1S2EA 5KUKA 3NJLA 4J23A 5BOJA 1YY9D 3VFRB 5FF6A 2ZOLB 1F90H 3MI6A 2JXMA 1J8RA 1RK1B 2NY1B 4XN7A 2IFFH 2OLDA 2PWHA 2YD8A 3U48A 2AQ3A 2TSAA 3LKNA 3SQOH 2CBOA 3SBRA 1NGYB 4PG9A 1PS3A 4IRJC 2X70A 1M2VA 5GPRA 5I1CL 2Y2TA 3BCFA 3BQUA 5E0QA 5D6DA 1VFOA 2PCFA 4KXDA 4YK4C 1YO4A 2N56A 3VQLA 4Z7NF 2EDWA 4PRDB 4YSSA 2ZUQB 4X7CC 3PY9A 3SB3A 4ABWA 5I0WA 5A6IA 2EINB 1NMCB 1WAEA 2WYIA 3RIFK 43C9B 3QQ3A 3ZR6A 3S88L 3UPRA 1NLBL 4NERA 5TE6L 4KWUA 5KYUB 4ZBJA 1KJVA 3EOTL 2VDPL 3AGVA 1CF8L 1TKWA 1ZIAA 5EOQL 4Z7QE 4DFHA 1HWGB 4OH2A 3GGWB 5DF0A 3B1TA 4I1NB 4TTDC 4M4RA 3MCKA 1L7IH 2WWKT 3MBED 4JL1A 3IETB 5FUCC 1MREH 1GZPB 2XTSA 5B8CB 1VGKB 2FLRT 2K6YA 3QW9A 1TEFA 4M61B 4FQJH 4P5MA 3TJEH 2VISB 4MA7H 5IWLC 4HK3N 5FA4A 4BM7A 4Q6IA 4WHDA 1PAMA 1WAAF 3QIBA 5H37G 1UGKA 1PG7W 1J8HB 3AFLA 4NO3B 4HISA 2O30A 4FMFA 4RZCA 4KOBA 3WTTA 2J6EA 4Z7VF 1ZHNA 2NPLX 3BGMA 1DVTA 3VXSA 4B0MM 4W1TA 5K1NA 1S7TA 2VERN 4P5KB 5CAYB 5IK3A 3FT3B 5C0GB 4YMPA 3L17A 4PJXF 3N06B 3LH9A 3PWPD 1FYTA 2ATPA 3MYZA 3FUHA 4JB9H 5C1MB 2YPVH 1SM3L 5AKVA 2OYPA 4LIQL 1KIQB 1EBAA 2WLKA 3AQYA 5H8DA 4OAWA 2EYSA 2X89D 3ZL4H 4W9JC 1M6UA 3TOPA 3UTPD 3QO0B 1B4LA 1TTUA 2NY1C 2DJMA 3H8NA 1LWRA 2R1YA 5E4EB 2AERT 3SGKC 4MNHB 5I0VA 2DYPB 5I8OH 3L6FB 4QHNA 4XP6L 4RMBA 1IZJA 2WQWA 1F8TL 1W0WB 2CNYA 2G5UA 3A4FA 2MCAA 3FAWA 1TJHH 4X0KB 5SV4A 3VWJB 2EKJA 2AQ1A 3WUWA 3EGDB 1N4XL 5KG9B 5EEYA 1NAML 2ZG2A 4PGCB 2FGWH 1UADC 2H1PH 2X44D 2ZUQC 4I3SL 5JR1L 3ASWA 5CNHA 1F4YH 3MN8A 3TBVB 5C0CD 3E1F1 4CSPA 4W4OC 3ZTEA 1NMCC 5MI0B 4N1EA 3UZVB 3CN2A 4UBDC 3WNJA 4BZ1A 4NO0B 1RCYA 2KL6A 3EGSB 5SX4H 2GEQA 5FV1L 3VD5A 5FPIA 1GYUA 3VXRA 1SBSH 1EAPB 1CFTB 5FGBC 3ZTNL 5I75B 4K23H 4JFFB 1HC1A 3FSZA 5TPWH 1G43A 3B9KD 5D1ZD 2QKSA 3KGRA 4GRLB 3VNYA 3CDZA 1RZJH 3PGDA 1DJHA 2BVUA 2DPKA 5B38A 4YHNB 5HPMA 4V1DA 1B0RB 3BQUD 3U2SA 1BBJB 2ROXA 3K0WA 1J0YA 1S8DB 4TULL 4N86A 4YHIB 3V0IA 4PJEF 2A73A 2VZVA 3K6DA 2Y2WA 1GC1H 3FN0L 4ZK8A 2NW2A 3EYFB 3FS9A 4BZYA 2E9BA 4QXWA 4ZW3A 5KVGL 3N04A 4DEPB 4G2AA 4N1CA 1LMIA 2KC0A 4OZHE 5ES4B 5DHMC 3FO2A 1UOLA 1UGNA 2YPVA 3ULAB 2BNRB 4H8UA 2BXZA 1V8HA 2GFBA 2QQNH 1RPUA 4Y7OC 5DK3A 2DWXA 1ODAA 4OR1A 3X11B 2FWOA 4OFQA 1AG6A 3L4ZA 1JTTA 4LLWA 4MQTB 4G83A 1UA6L 2JFCA 1G9MC 1GW6A 1VFAA 2CWRA 4RGMB 4J3WA 3SJVA 2EIDA 2Z7WA 3C5ZD 5E4EC 3W81A 3X1FA 3PGFH 5IEHA 1J0KA 4I1PA 3VI4F 3T08A 4JCWA 3S37H 4C56E 5D8JL 3FYEB 4JZJA 3MLYL 3QIBD 4XPAL 5KVEH 4EZMA 1JIBA 5JW4N 1TYEB 1M2OA 3VWJC 2YLHA 5T3ZD 1HU8A 4HH9A 4P2RD 3VE0B 5DMGD 3UROR 3VXSD 3TNMB 2VITB 4DIXA 4IRSA 3C5SB 3OZKA 3MCG1 3P40A 5F7DA 4H5SA 1TLKA 1EA9C 1U3ZA 2FWUA 4JN2A 4RCAA 4U1LA 2BX5A 4PJAE 4U6XB 3P9LA 5GS2H 5MI0C 1PL3A 3AMLA 4KHXH 4Y4FA 5GGTL 4HUVB 5D72L 4HUWA 1YEEL 3IPBA 4NIKB 1PZAA 2EXWD 5CLWA 4R2GD 3ZT7A 5JDJA 3SD2A 4I48B 1CE1H 5IB2B 5I75C 4R2GC 1KC5L 3OWRA 4FDWA 3GSNL 4NQCD 3RUGA 4HZLB 4GRLC 4IK7A 1TNNA 3NQIA 2N7AA 3VMNA 3O0RH 1MPAH 3LY6A 4IRZL 2J7LA 2PWEA 4IEFA 4JW3A 1XIWA 2QQKL 2LABA 4IIZA 3RWEA 3QHZL 1E9PA 3U82B 3D39B 5BVPL 4QTIL 3F7VA 3IXTB 1AY1H 2ZXGA 4K94L 3V5KA 5JNYA 1CFSB 3GFUA 2DLEA 5H35B 5KVFL 4JRYD 3APCA 3NSJA 5C2BL 2EDMA 1KB5H 1ZAGA 4DEPC 1AC0A 1QBBA 3G08A 1MW2A 1RUKH 4HXAH 1L9PA 5I16B 3HE6B 3KPRA 3LQMA 5GS0L 4AJ0A 1LEGA 5JW4Q 1C5BH 1CMOA 4CU7A 2A9AA 4L4TA 4Q9RL 4KDVA 3IDGB 5I1AB 5CCGE 2DLFH 1MXGA 5F8RC 3F7YB 3ECQA 4AZ8B 2B59A 2AZUA 3C60A 4PJ9B 1IM3B 4RGMC 5JHBA 1PLGH 3CN1A 3FQRB 2V2WB 4UM9A 1OE2A 4V1DD 3U9PL 3LQAH 3UBFA 3QEHA 2FO4A 1OT2A 2Z92A 2DBLH 1KELL 1ADQL 3KVDD 4UQ2B 1BQHA 3TV3L 5EUKB 2R56H 4B96A 4JFEB 5H2BB 4P3WA 3DK0A 5DA4A 2AEOA 4H0GA 1XCXA 4K8RH 3PIQA 3RIAF 3WTUA 1KBPA 2ADFL 4A7GF 5DJZA 5CFHA 2ZKXA 3EOAB 2DQEH 4RRPG 2ODHA 2FQEA 2ZPKH 1QNIA 2ZWLT 1A47A 2DWSA 2YPLB 3OKLB 1MHHA 3IFOA 4WW2F 2RCSL 5DT1L 5AWNH 4MXWL 5DFVC 3IFPB 4HMEA 2YOAA 5AZUA 5DZ9A 1EBPA 4GBXB 4GG6E 3W11D 1NBYA 1XSIA 5LXVA 4B5ZA 2UUDK 5L88H 3EO9H 1MNUL 3X14A 1R3IH 3UTTA 2Q2EB 5AW9B 4GI6A 5JQHC 3GUTA 4FF9A 1E2ZA 2P45B 4TKWA 4H8HA 3TVMA 3CFCL 1NCOA 2IH3A 3FB7A 4Z7AA 2LTQB 3BISA 3MOBH 2YRBA 3US1A 2W0KA 1BIHA 4X8GA 4HJTA 4J1UA 2LLNA 1KB5A 3SQRA 5E6ZA 2VDKL 1KBGH 4G8IA 4IRSD 4N0FA 3WI9A 1HI6A 2GITB 4E41E 5HDWA 4ODHH 1BXVA 4YGVA 1KXVA 4HCIA 4O02B 5DHVB 4XNQA 4DCQA 3VD4A 3E9TA 3HE6C 2Y69B 4LKCB 3WKQA 2AQRA 4Z0XB 2NY2B 3S35H 3M8OL 4F1ZA 1X5LA 2DTMH 1IGYA 2VDML 2VCOA 4UDTB 1G4RA 4PWEA 1ACYL 4NB7A 3MLPA 1B90A 1QSFB 2WYHA 4N24A 4PJ9C 1I85A 5F2FA 4EI6B 4RGND 3K0YA 3IXAB 2FLBT 5ESQA 1X4YA 3CSTA 2FTAA 4OF5A 4R4FH 3DYMA 2ZCKH 1MJ7L 2Z8WC 2J12B 4K3DL 4CADA 4FCHA 1TZAA 2XZZA 3MRNA 2XKNA 1FFOB 3UG4A 3BRGC 1HOCA 1Z3RA 5CUSH 4DGWC 1G6RB 4XMZA 1T80A 4YLQT 1FN4A 5IQ7L 2NUPA 5FKPB 3G5VB 1BREA 3C6LB 3H42H 3KPRD 5JOEA 5T5NG 3QK0A 4IOIA 4BWTA 4L1HA 1AVAA 4P46A 3MJ9L 3LZFH 3OJMB 2XG4A 1LWHA 3SKNB 3MRKB 4G70B 3RGBA 2PN5A 3LDBC 1SHSA 1NCJA 3C60D 4GBXC 2OMYA 3KAAA 2ALAA 4YDNA 1EEZA 3VVWA 2NY6D 1WCQA 1OF0A 4UM9D 3ZTJH 5MEND 2HFEA 4JZOA 3WTWA 1HHKA 1OSZB 1RK0A 1Y07A 4NNYA 3SDDD 2LTQC 2H41A 4EZLA 1G7IB 4D9QD 3ECBB 4NXSA 4ELMA 3REVB 5DRXB 1M7UA 3CXHJ 4N8CH 5KTEL 2NLJB 3O11B 1NM4A 4YH6A 3FQWB 4M62L 4JDEB 4WIQA 3APDA 3OHXA 4LRNL 2C4XA 4X6CE 4OIFA 2F1EA 4M03A 4PJ5D 4KV5E 1DBMH 4ZX3A 2NY2C 3JUZA 4IOSD 3WY4A 3QUYD 1P4BH 2BC4B 2X5PA 5K9KB 5EUOB 4ZD3H 5L2JB 1U95B 4TQPA 4EVNA 4FG4A 1MRCL 1DHKA 5E08H 4PJFE 1AD9A 3VFNB 4Z3TA 1YJDL 2A6IB 2K7PA 4HA1A 2QMKA 2HT4D 2IALB 2K8MA 4M29A 1XF1A 4OCRH 1OP5K 2CKBB 1CGSL 3HHRB 3GLEA 2VYRE 4P07A 2BDNH 1EHKB 2ICES 4M6ML 2GCYB 4ZAKB 3PV6A 2X6CA 4KJWC 2BFVL 2XBTA 3LXAA 2XZQL 1FHGA 1WTGT 3UYPA 4HOWA 4NZ8A 3MA7A 3WNPA 2V17L 2Z7YA 1JZDC 3V4PB 1UTDA 4X7SL 3C6LC 4R7NB 1PZCA 1GYAA 3CIQA 1LO0H 1RPKA 4AKPA 2CSPA 4N8UA 2VE6A 1E3ZA 3QUML 4FULA 4GB9A 5E4AA 1FV1B 5D5ME 4PJHF 2EYTB 3ARGA 3SPVB 1SEBA 1WTLA 2HTKD 5FCUL 3K91A 1DCLA 1UM4H 1M3IA 2NR6D 1XTLA 1T3FA 2EDQA 2P24B 1ECYA 2XQYA 2BVYA 4JLRB 3SCMA 3T2OA 3E3QE 3MGOB 5HGGS 5SWSB 1R6VA 2ZXDA 2GUYA 4IM8A 4Z6AT 4LEEA 1JVKA 1ZV9A 4MJIE 5FB8A 2CR0A 3UBXI 4K8RD 2CCVA 3HE7A 5DI8A 4PGDA 4PN6A 3ZE1B 1NUNB 1EMTH 2QT6A 3DX7A 4ERSL 4LPXA 2FJSA 1YN7A 2G5RA 1OT4A 2JQZA 5E94B 5L2KD 4M6OH 1O5DT 3BN3B 4IDLA 1D2PA 1V05A 4L4VD 2FL5B 2ZX8A 1IIIA 4RWYH 4ETQA 1G1CA 5EBGA 1LD9A 2W65B 2DQFA 5C07A 3L4XA 3NDZE 3FZUC 3J8F7 3S5LG 4Y2NA 5JIMA 1MCFA 5B1AB 1T0MB 4QRAA 4ZW7A 3QE5A 3V7MA 5I1HH 5GGUA 2ZXAA 1E5CA 1TJXA 3KEHA 1FPTH 2Z35A 2A9MH 4KAQL 5FC9A 3S2AA 2AZAA 3PQYE 1HNYA 2ENSA 5ANMB 5FCSH 4KKZA 1FFNB 5DD3L 1FBIL 4GG8B 2IBGA 3BH8B 3EADA 3IJ7A 2BHZA 3OAUL 1X5JA 3WIIH 3JTTA 2BWIA 3WOVA 4JHAH 2DZEA 4PIRF 5T1MB 1RK7A 2FX7L 4XN2A 5E95B 4K3JH 2H2SC 1BGXH 2FIKB 1T1XA 3V9FA 4H20L 4NNPL 5FO8A 3UH8A 2EDYA 3OZLA 4P57A 3EYOA 4J2XA 1NFDB 1WC7A 4IHOB 4PS3A 2V5YA 1KG0B 4QYAA 2RFXB 4UMSA 4OZGE 1BAGA 1KEMH 2WCGA 5IW3A 3FQYA 2DBJA 1HZHH 3BAXA 3TYGH 3GMPB 5L8JB 4F8LA 3UX9B 2L0DA 3G6JF 4XHJD 1DN2A 4GAYB 1QVOB 2E27L 1FGNH 2VL5A 5JHDB 3UJJH 3LPPA 4CNIB 4GIPD 1BOGB 3K80A 3N0AA 4JM4L 3LZLA 4IRJA 3MFFB 3K4ZA 3NIGB 4LQFH 1C7TA 2EVIA 1INEL 1OGAD 5I1GH 3VU1A 3IMSA 1P84K 4K55A 5D7SH 5E2UH 4HDIB 3ARGD 4MJ5B 1HFUA 4G9DB 1HVXA 3ZKQD 1WP6A 1A3QA 2QSTA 2DL9A 3U6XA 5DSCA 1F2XK 3GWJA 3TPKA 2C1OB 4OD2B 3TFKC 4LPTA 1TCMA 5KUMA 3OKYA 5IMKA 3O3AB 3BAEH 5J56B 3Q3GA 4WFHD 5DZJA 4PRPA 4ZTOL 3H9SB 1EO5A 1HILB 4GUPA 1KXQA 4NQTA 3WS3A 3CH1B 5E5RB 3HE7D 5FM8A 2DQUH 4XPGL 4FRWA 3HPJA 1HYSC 4NJ9L 3JQOB 8PAZA 3EDJA 2PR4H 5HHXL 1HKLL 3NSCA 4O5LH 3BD5A 3PAYA 1LTXA 2OSYA 1U3HB 4NP4L 2IH1B 3J07A 4H2AA 5E6IA 5IWLA 3GRWH 5D7EA 3GF8A 3QWOA 4PY8J 4UTAH 1ML0A 3P0VH 3WU1A 1QI5A 4YX2L 5JMRA 4LVEA 3D0LA 1AD0B 1UA7A 2EE2A 3CFEA 4XNBA 4HQQH 5KBDA 3PDOA 2R39A 3QXUA 4PS4H 2O5XH 5EEZA 4L29A 4B41A 1TT6A 3HBPA 5I1EL 3ZIYA 5JXAH 3D4CA 4L8DA 3TT1H 3H9HB 1YEDB 1H5BB 1RZFH 5EBWB 1IMHC 4UM8A 2CHNA 2ZWYA 5C0DA 1YY8B 5PAZA 4BWUA 1K4CA 2E6PA 2V4LA 4UT6L 5C71A 5DC9B 3PHSA 3CUPB 3CVIL 2Y22A 3CE1A 3HR6A 3KR3L 2HFFB 3QRGL 4AKOA 2H32A 1FNLA 5J11B 3DDGA 1R19A 1N6VA 1IGCH 2WUBH 4EIBA 2HFTA 1QYGH 2UWEB 3DURA 2B77A 3L5XL 3SGKA 4LESA 1LEIA 3VW3L 3RWIA 2AJ3B 2CIIB 4TF4A 4GINA 2VLRE 5GJSL 2PP9A 2LAGB 1EDYA 2D31A 3H9ZA 4LSVL 3S97C 4X83A 3LN9A 1JPGB 3OSVA 3KL5A 3ESMA 4PRDA 1E5UI 3VXTA 3UEQA 3S8GB 1A1MA 3CBKB 2RHEA 1WEJL 2QVKA 2G2NA 4W4OA 1Q72L 1KYFA 2PNDA 2PWFA 3QZNA 1KYOJ 3ZYOA 1WQVT 4GQ9L 2PPDA 1FH2A 3HAEA 3HJ0A 4HUKB 4PJ7B 1EFQA 3ZUCA 4BINA 3PP3H 5KYUA 5AL0A 1E27B 4GP5B 4EDWL 2IFGA 4AGMA 4OGAC 5JW5A 4L1TA 4HUNB 3P3SA 4KHTH 1MFDH 2AEQH 5FGBA 2C8NA 3MRPA 3LH2L 4FZ8L 1REIA 4FP8H 4IKNA 1GZPA 5JHLA 3NCWA 3RP1A 1WJ3A 1U3HC 4UTAA 2HJLB 5EU5A 4GSRA 3SKOB 5ID0B 4IRJD 1NMBH 5IREA 4DGYL 4D0DA 2DQTH 5EWIL 3MQIA 1CS6A 1IAIH 2F54D 1NLDH 3MNWA 5CZXC 3P9MB 2QSCH 3NUKA 5B1KA 3ZE0B 4UF7C 4IGBB 4ZSOE 1IU1A 2EC9T 3OL2A 1SHWA 1COBA 2MCG1 3WD5L 1BP3B 4UOW1 4EDXB 4F8OA 3QFDB 5EU7E 4QXTA 1H5BC 4UZSA 2EIZB 4G6FD 4PRPD 2XFXB 1TQSA 4OGXL 3LNHA 4PJBB 1NH6A 3HMWH 3PFUA 4TTDD 1E30A 4NI3A 1QABA 1DR9A 2CUIA 3QO0A 3IMRA 4H1LG 5J11C 1PD1A 4X99B 2IG2L 4TNVF 4MNHA 4PJGE 2DYPA 5INCA 3L6FA 4H44C 4M8QA 1NCCL 3B2UC 3DV6B 3IFLL 3LKQA 4ESKA 2DEWX 1ED3A 4X0KA 3IKCB 2IAMA 2CO7B 3NH7H 4J4PA 4AEFA 3IGAA 4YNYB 3B7SA 5JDSB 4ZODA 2B4CC 2HUEA 2VDNB 5HDRA 4FQ2L 4PREB 3UP1A 1KNOB 5DD1L 5IQ9B 2VR3A 4LDLB 5KZCD 1AKJD 3TBVA 3CQPA 4XRCB 3JVFC 2AK4E 5DWPA 3ZOAA 1AGEB 1T22A 5I23A 4Q14A 4PLKD 2WYTA 3UZVA 4KFMA 2CLVA 4HAKA 3QC5X 4NO0A 4MA8H 4D7BA 2L7EA 4L9LB 4AT6B 4I13B 5AAPA 1KLGB 2OYMA 1EAPA 2NT0A 5DCCA 1SHMA 5J4MA 3NZSA 2NY1D 4JFFA 4ZOBA 4YWGL 1NMAH 2ZE0A 2ENJA 4S0HA 4NPJA 1BJMA 2R1XB 5F3BA 3EH2A 1NCAH 3LVEA 3PABB 5EHFA 4XPTL 3TEWA 2APVA 2VJ8A 5IB5B 5DD6A 3LVTA 3RDTB 2N3JA 1Q1JH 3H7BA 3FHQA 4WU5B 4AYSA 3HBQA 5DJXA 2NTFB 2VN3A 1KGUA 2J8HA 4YHIA 2QHRL 5DS8B 5AYUH 1LEKA 4DW2L 1THCA 2E7DA 4RZKA 2XVGA 3EYFA 4U0RB 2BSED 2G9HA 4JO2L 4DH2A 1FG2A 2N59A 4OLWH 4K7PL 4IGBC 4WLCA 3CLFL 1DBKH 2H0JA 35C8H 5M7QA 3ZPDA 3TBTA 4UBDD 1UWXK 3L3HB 1MUJB 5JHMA 4GUOA 5BS0A 1ZJAA 1E40A 4W9GC 1X4XA 1E4KC 5I76B 5E56A 3ATFA 3ZLQC 1R24B 3X11A 3RTLA 4AX3A 2VDLL 2NNRA 4UAHA 5F0MB 2FDBP 4MX7B 4W93A 2CO2A 1AQ8A 1KGIA 3I2CH 3PU7A 4KZCA 5FYJH 1A3RH 2HKHL 3AZUA 3NTCL 4KUCD 3HVDA 3O2DA 3BE1L 1SXNA 1LK2A 3VH8G 4F1SA 4V33A 1GVIA 1M9SA 1JP5A 5A6MA 4N20A 1J8HD 5AZ2L 4MJ6A 2BM3A 3FOMA 4N2OA 4XBEL 1NCIA 2F1AA 1H8LA 5C0BE 3VE0A 2Y1ZA 1OQOA 4UIKH 5DWUL 5J89A 1KCWA 3K71A 4HZ1A 2V33A 5SX5K 1OGPA 4FE9A 1Q94A 2VN7A 5DS1A 1D6EB 1UEYA 3KLHC 4WTZG 2AJYL 2P80A 1D7DA 1HAWA 1NGQL 2VW7A 4HUVA 1OW0A 4XNUL 2W0LA 5DUPH 1XWVA 4PM1A 1WBZB 3TBCA 3KWUA 3RVXC 4L9LC 2DQJL 1CXKA 5L6YH 5LXGL 2J8UE 2Z4QB 1K5WA 1ITCA 4XXWC 5L9DL 2XTJB 1ZWIA 3MV7B 2DKSA 3EUDA 4GW4A 1INQB 5IROC 4APQB 3NJXA 3RDTC 1UUSA 5ESVA 2BJML 3IU3B 1RSYA 4RIRA 3L9EA 5CINL 3VWJD 3R1GL 3THML 1RURH 3IAGC 5EIIB 1YECL 1NCGA 4JDZA 1FG9C 1PD0A 1L7TH 2VDOB 1JZ8A 5CN2A 3ARFB 4XT1C 3RPIB 3UC0L 4J3TA 4U0RC 1CFSA 1RUQL 5LAXB 1SXAA 3VUAA 1FYHB 3FRUA 1AI1L 1YPZE 4DOHE 3O4LB 5E1HB 4FNLH 3ESNA 2E7BA 3FNKA 2VWEE 3WMPA 2XCMC 1JZFA 2RB8A 5LDSA 2O1AA 1JGVH 1RZIA 3LXUX 4EO5A 5FUZL 5JW4M 1MCRA 4O02H 2A6JA 1H15B 5DHVH 1MJ8L 3TIEB 4Z7WE 4F8TA 3RWJB 1QZ1A 4JY5L 4L3EE 2D7PA 4ACPA 1I1AA 4KU1A 4S0TD 3IDGA 4L8SB 5E70A 4BK5C 4JFFD 5I1AA 2AV7B 3K5SA 3U9WA 4GRLD 5AKRA 5IB3A 2F5BH 1IKNA 1KOAA 4ALAC 3L08A 4GI9A 5HJDA 3T0XA 1QMUA 2V2WA 5DLLA 5B3JE 1O6VA 2Y5TB 3B9EA 3TCLA 3HKFA 1NCBH 1CQKA 3LEYH 4G43B 4EKJA 3AWFA 1EHLL 2OZ4L 2QFRA 3GSQB 4FA6A 1K9TA 3NIFE 2DJ4A 2YD1A 3IWVA 4F33B 1OTUC 2K3HA 4ZUTA 3BYTA 3MKKA 2FWLB 3S36H 1G6RH 4CKQA 1KIUB 2J2ZA 2X4RA 2DIAA 2BNRD 1D6VL 5D2LE 4PRIE 4DSYA 1F4AA 1G9NL 3RWGB 2MQGA 3KLAB 4BXSV 4HWZB 2YWYA 5J5EA 4MZ3A 1V5JA 3OKLA 3FTGB 3I02B 3KPMB 3FQTA 2CD0A 2HWZH 2Z8VC 4LGSB 4N2FA 3LRSA 5CP7B 3IFPA 3PS6A 4UB0L 3TO4A 2XTJC 2ICEA 3ISRA 4GBXA 4YHKL 3IAQA 4JQVA 3ZDXF 6FABL 1AQHA 4BFIB 4OIAA 5DJ6B 4APQC 4NKIL 3CPLA 3T6ZA 3O45B 2ZICA 2KZKA 3VX1A 2AXGA 2WXQA 1NUDA 3NZHL 1E3FA 1QA9A 4HK0B 3AS1A 2H1XA 4X5LA 4XBMA 1I7UB 1JPFA 4JR9L 5E8OB 3ARFC 2W07B 4HU2A 1KB3A 2AJZA 3MBXL 4PHXA 5F9WB 4OQTH 4ZMNA 2GITA 1NFKA 2V7NA 2VLLB 4NZRH 3T04D 3UCQA 1Q9OA 4XBPB 4IDJH 3VQ1C 3DGCR 3BAJA 1U42A 1H3XA 2Y3AA 2M83A 4LKCA 3EJPA 2CUAA 4MMXB 4Z0XA 2V2XB 3FT4B 3NZ8A 1OHZA 3NCXA 5C3IA 3S96B 5DFVD 3WKMH 4PRBB 4G3YL 4FYRA 4L8SC 4Y19E 1E4WL 4I3RL 3QYCA 3V6OE 2XA8L 1Q0YH 2FHBA 2QGCA 2XPZA 2CO4A 4TUJB 4EI6A 1PZ5B 5F3HA 4R7XA 5E2WH 3L3OB 1BW8A 4NM4H 4YSOA 5TFSL 3D39D 4BWWA 5IFHL 3EBGA 1RXLA 1FZMB 1MCCA 4LASL 5C0IA 1NM9A 3ZY7A 2CKBH 5KW9L 1G6RA 2DRUA 1ZSDA 2AABL 4FQHB 5FS5A 3R0NA 1SJHB 3TWYA 4TYUA 3G5VA 3F5WB 3HE6D 1VPOL 1UG9A 4QRQB 4PGJA 3EYVB 4OGYH 4IW4C 2CXKA 3KPOA 4RMSA 1I75A 5K69A 3V4PH 4HPHA 3ZUNC 1E2WA 4FYQA 2HKFH 4M1GL 1D7FA 4KITB 5F7BA 5FYJD 3IB4A 3MRKA 5E51A 5DO8A 5A2JH 3CZEA 2Y06L 3DV4B 1RJLB 3DXAE 4PJ9D 1IM3D 1S9YB 4K7PY 5ILTH 5T3XH 1K2DA 1OSZA 2AI0H 4HULB 2VR8A 4EBQH 1MHEB 5KJRL 4QRPE 1XGYL 1NCDH 2H5UA 4J8RB 4JFED 2JKJA 3QDJB 4OCLC 1SOKA 4LU5L 4DN3L 2BWDA 3BIAX 4KI1A 2F7OA 4JAMA 4LZKA 4OQTA 1MLBB 4BEIA 2NLJA 3O11A 3Q6GH 5F9WC 3HFFA 4P4KB 3VRIB 4GKSB 4PV9A 1XEDA 1T03L 2IWGA 3VRLF 1DVQA 1NC4B 4DZ8B 1HZKA 1I7ZA 1NA8A 2YPLD 3QJVB 1DBBH 4MMXC 2EDRA 3VGEA 2F74B 3ULVE 3DRTA 2KDYA 1JWUB 4GBXD 5ERWA 5F1IA 3ZT5A 1HESA 5CJQL 4KXZH 1FRGL 4GS7B 2J57A 3BH4A 2KS0A 5AAWC 3C2AL 1YN6A 5FA3A 4AXWB 2GVYA 1I8LA 5FGCB 4J3OC 3L3OC 4FLOA 2E9IA 2IALA 3OKDA 2A9NH 4N8VG 4FI8A 5DZOA 5EA0H 1PDKA 3VYNA 2HN7A 1MFEH 2Q3AA 2E74C 1EDHA 2ZUWA 3D48R 3K74B 2FECL 3E6HA 5IFAH 4ES8A 4RNRB 1AXTL 4F7MB 1JGLH 5EU6B 4Z18A 1DLFH 2IH8A 4I2XA 2G60H 5CEZE 3L5WA 5DTFB 2EIMB 3V4PA 3DIDA 4KJQC 1GRWA 1DQMH 4HJUA 3SZKC 2JV6A 3IS1X 1ZLWH 1VGEL 2I85A 2NY2D 4AWJC 2VDQB 4JFQB 2CHZA 1ZHBA 2EYTA 1L9RA 3SPVA 3SDAA 3I74A 1T83C 1IBGH 1QSFD 1UM6L 4KX8A 1A65A 4PJDE 2CRZA 4NC1E 4D0CA 3ILQC 3IDYB 1PU0A 4Q9QH 1BLNB 3ISWA 4U6YB 2YD2A 1TZ8A 5DRWB 3TGXA 5EBMB 2O5ZH 1FIEA 1WS8A 3CK0L 3RWDB 5HGHB 4EUPG 1N59A 4KJWD 2HRHA 2KLSA 1BF2A 3U6RA 4DVRH 1HHHB 2UVEA 3W39A 4KPHH 4TXVB 5HYSA 1Z9SB 2ZJSL 4P4KC 3C6LD 5K39B 1XGTB 3NABH 4LLDB 2IH9A 1E9QA 2FL5A 2H45A 4NCC2 5J6HB 1UH2A 3ZDZB 1BMGA 1MF2L 3FB8B 3P3YA 2BFGA 2NW3B 5E8NB 3ZTCC 2WKOF 2FX8L 4OLZL 2XV0A 2Y7MA 1N8ZA 1I3RB 3GMQB 5B39G 5C7XL 5IMLA 2BVOA 1W0VB 4TQHA 5F7EH 4DETA 1D3CA 2ESVB 4N2CA 4W4NA 2MEJB 5F6IB 3UMNA 1KPRB 4KI5C 1J1XH 1UJTA 5D71L 1Z9LA 5FHBL 1QWNA 3UJTL 4NWUH 4YR6B 4UTCA 4I18B 1FFNA 3O3DB 5FV2A 5IJKA 3LIZH 1BQSA 4GQRA 3BH8A 1UD2A 1KCRH 3UAFA 4A2FA 1MCOL 3LZNA 4CILA 4R3SA 2LLLA 2P42B 2ZQKA 2W9DL 4GAGH 5J1SC 2H8PB 2PPAA 2FIKA 3L4VA 4PR5B 1N9PA 1KIPA 1L0QA 4YDIH 3BKCH 2IADB 3PUUA 1X5ZA 3FZUD 2DDQH 3FQ4A 1OSPL 4IHOA 1E5AA 2FEEI 2V5RA 3K6OA 5DJAB 3I6KA 1CLVA 1TDQA 2EVGA 1UD6A 4AM0B 1PMYA 4AYMC 4AYFB 5DJ8A 4CU8A 4OGQC 2R0ZL 1BIIA 3WN5A 4MAZA 5E1GA 3IDYC 3MSPA 3VXPA 3KWTA 3BWUC 3MODH 1SXCA 3DPBB 4KZ0A 4OM0H 2CJTA 3MTXA 4ZAKD 4RDBA 2H9GB 4TUOA 3SE9L 4GAYA 5BQ7B 3WIFB 5I19L 5D5MF 4RBPK 4B0MB 1J10A 1TZHA 1U8LA 4AH2B 2OTUB 3KHOA 1WHOA 2H2SD 4WI3A 4CRPA 5CCKH 3MFFA 3UBXB 1GTFA 2YJQA 3QVAA 1S9KC 5GJTL 5CXPA 4L1BA 3HG1E 4OD1L 1KPVA 1S7QB 2BIHA 2OL3L 1O6SA 2HG5B 1CDGA 4HDIA 1JDAA 4B50A 3OPZH 2K9UA 3LHPL 5CGYC 3W9DB 1MELA 1S7VB 5F9OL 4TNWK 3RVWC 3UYOD 4E36A 2NNFA 2X4TA 4NLAA 1BAFL 1NFIA 1E0OB 4M7ZB 4XMLL 2C1OA 5SWSD 5F6IC 4P2QB 1OAXL 3S35X 3ZMNA 1F2QA 1YC8A 2B1OA 2X9YA 4S0SD 1BF8A 3H9SA 2ITEA 5F88A 1H0DB 4ADIA 2OJEB 4E68A 2X05A 1FO0H 4N2DA 4QRSA 3ZE2F 3BKJL 4Z7UA 4XN1A 4BK4A 2RQ8A 2P28B 3QJZA 1PPIA 2QPUA 4R26H 4ZFFA 3OJVC 2CJSA 1Q9LB 3UCRA 3VFTB 4Z95H 2QMJA 1SJMA 1ZT1B 1JVOA 2BSBA 2Q7YA 3DVGB 4U1NA 3VFSB 1AD0A 1U91B 3FT9A 4HIXL 4OJFH 1VZGA 1VSCA 3MNMA 4FLSA 3JWOC 2XIBA 3KCWA 2YIHA 5L7XH 1RVFH 1F4XH 5KYWB 3D08A 3BEWA 5D93B 3TFKD 1V7NL 1WT5A 4EQ2A 1YEDA 3S4SA 4HJSA 5BO0D 3KLLA 3QDMA 5EBWA 3EG9A 2VDKB 1G7JB 3W0WB 1YY8A 3IS0X 3KXFB 2O4EA 7TAAA 2X6UA 4FD0A 3BH9B 3HVNA 1HYSD 1ZHLB 2WVTA 4OUUB 5IHBA 5IIEA 3S5ZA 2ZOKB 4MNGB 4P23B 3VXSE 3WKYA 4P5RA 3QCTH 5AENA 4NSKA 2AJ3A 1FYTE 4ZFQA 3VXMB 2B08A 2XQ0A 4PD4K 4BKTC 5I6KA 1VHPA 3V52L 1IM9A 4A68A 4QD2E 2HFGL 2VC2B 1JPGA 2ZWNA 4NQDB 1S9WB 1OPGL 4JY4B 1A0QL 4MVBC 4N87A 2VDNH 1A7PL 2ITDA 2MQ0A 5D7IB 4A7SA 1P7KA 4PHZA 5A16A 3FH8A 1OXYA 4M7ZC 1E5ZA 3CD4A 3A6OA 4YHZL 3D5OF 4Y16A 3BKYH 4PS7A 4CVZB 1BVKA 5GRUL 4F20A 3X12B 4E0RA 3TTYA 4Q9CA 1FO0A 1OE3A 3BP7B 1NBZA 3OAZK 1E27A 4YDMA 3LNEA 1IC7L 1MCQA 1C5CL 3L3DA 3K72A 2CA3A 3WN6A 3VFPB 4CL7A 2XIIA 5FDYA 5AVYB 3SBWC 1GYCA 5JHDD 5A2CA 4PCTA 1ZKAA 1FA4A 1F3JB 2Z31A 5ICZB 4X6DE 1T2JA 4G42B 1T21A 2ZOOA 3RKPA 1CLZL 3QARA 2MJWA 4KNTA 3IVKA 2W95A 3P02A 1JV5B 4HKJA 2WLIB 2EDBA 1IAOB 4PY7B 4W9FC 4NZUL 1IQDA 1NOFA 1BSIA 3BWZA 4KZDH 1W2KT 5IT2H 3VXRE 4H8QA 4X4KA 1ZTMA 2OMVB 2EE9A 1QTSA 2WKGA 1KJ2H 3O2VH 5D93C 1Z9PA 4NRYB 4ZW6A 1MCDA 2BP8A 4KVPA 5HHOB 1NWPA 3EJYC 4PYGA 3BAIA 2SODB 2XFXA 3H9SD 4V1DE 2YD5A 5KYXB 2ZKMX 1FDLH 4H88L 4NP9A 3GB7B 4RQQB 2J1KA 2C3WA 4OGAD 5TQ2H 4YDKH 2R69H 1UXLA 2WINA 2B5IB 1LO5A 4AG4H 2JKNA 3HN8A 2MCPL 1RIHL 2P7TA 1U2YA 1XGQA 4P23C 5IHZA 1U3HD 3OKEB 4FMVA 4X99A 3L1FA 1EH9A 5FWRA 4ALAH 3BHBB 3ARYA 3KJ6H 4XC1L 4JDVB 1MVUB 1P6FA 1U8HA 2HX9A 4QUOA 4W9KC 4XMTA 3CN0A 3HS0B 1MCBA 3V6FA 3F05A 4JE0A 3WE6A 4NO5A 4PREA 5HYJA 5FHAL 5AAMC 3C5XA 1KY7A 2F19L 1S3KL 2D3JA 3A67L 1BVLB 3EJTA 1ORQA 4NX0A 3SJVE 4YSTA 2F18A 5IF0B 4ZJ9A 3FSAA 3BDXA 4WY7L 5L4IA 2HVKA 4AE1A 1N3NB 4L9LA 1CGYA 1WF5A 4XCEB 1OIOA 5DS2A 1EO7A 1QAWA 2JI1A 3VQMA 1JRHH 3BO8B 4R8WH 4JQIH 3PABA 1AJ7H 3B2UD 3VGDA 1A7NL 1PFOA 1FLTX 3QUMB 4Y1AB 1IKFL 1ODUA 3WFEL 1RJZA 2NTFA 2WPGA 3NP4A 3VSUA 5FM5M 4RAVA 1OHQA 1HIMH 3PUCA 3HG0A 2VXUL 4WSKA 1KJ2A 1HXMB 1MFVA 4TLTA 5IESH 2FH8A 2VDOH 2D7QA 5EZJB 3MA9L 1UASA 4IS6A 3RUGE 1UHVA 2KZBA 5EO9B 3WUWG 4JS7A 1KCBA 5CZKA 5TF1L 1B9KA 3SDXB 3QJOA 2YMXH 4FYTA 1SBBA 4MD0B 2R69A 1MUJA 3U1PA 1MIEL 1AE6H 4FNRA 3VXOB 5I76A 1ASOA 2BERA 4NHCL 4YSEA 1R24A 3MRFB 3NFNB 4M93B 2B5IC 4KUCF 1NCHA 2V7HB 2WCPA 4MX7A 4NJAH 4Z3EA 4B27A 4EN2A 1JZJA 5MERB 1UXSA 1VRSA 1YDPA 2P1YA 3MRQB 1AGBB 5I1IH 3GTNA 4WI4A 5T1JA 3KPRE 3KVPA 5J9PA 2YQ2A 3QQNA 1QEXA 4JUTA 5PCYA 1Y6KR 2UZIL 3HS0C 2W38A 3N0PB 3I9AA 1QKZH 2OMXA 4L4TE 1D5XA 4Y9CA 1HHGA 3EJRA 5B38G 2FQFA 4IGBD 4JJ5A 1ZGLA 1H6UA 5ABDE 4JZNA 1DO5A 1NUFA 2JK5B 1DVFA 3GI9H 4P2OA 1WCBA 5DFTA 3U36A 1J86A 1WBZA 2EIKB 2VQUA 2GBVA 2VL4A 3RY6C 1ETZA 1W72L 4UQCA 1P53A 4M7KH 4LK4A 4JQIA 2XYBA 2DQ6A 4LVOB 3HZYB 2YO3A 3MXVL 3MV7A 2NY3B 1BXXA 2ADIB 3L2MA 1I7TB 3MLTA 4APQA 2A9DA 2CCWA 1QO3A 4NYLB 4LNRB 4TVPH 4WO0A 5C0EA 4WHTB 5BV7L 4DZBB 5ACMA 2Z0BA 3VD0A 3L7EB 5D2NB 5E99H 3DGGA 4PWJA 2YHGA 4FFZH 3KLHD 1JOIA 5IVXA 3GSOA 3ASNB 3T6XA 3GJFB 3UTTE 1VENA 3QZBA 4AW7A 5KEZA 4LCUA 4XX1E 2G3ZA 2GTZB 3TIEA 3RVXD 3DO4A 4M93C 4APXB 4JGMA 1DJWA 2QL1A 2YD9A 1OANA 3NCMA 5KAQG 2F6AA 1AQDA 5DVKA 5HGAA 2XWRA 3QNYA 5T3ZL 5IROD 2Z8SA 1CLOH 2DI7A 3RDTD 3O81A 3D33A 1F41A 4F27A 3QNXB 2IBBA 1KPUB 2FT7A 1E7UA 1G5GA 2R15A 2Y5TA 2YSSB 3CLWA 5ID1B 1KJMA 3BN9C 3FO9B 5DJDB 4AI7A 2FJUB 3TCTA 4J3OH 5ICXB 3LNDA 4PJIB 4JPKL 3RFZC 1B4JH 4Y9BA 1MFUA 1WYJA 5DJ0B 3DMMB 3S88H 1F90L 2G3XA 3RX9A 3TBYB 5TE6H 1FIGH 2IFFL 4K73A 5FM5O 1FZOA 2JMRA 2VDPH 1CF8H 4N6RB 5EOQH 2IC2A 2XVLA 5FO7A 4EXPX 3OJDA 4KK9C 4HWZA 3N42F 5CZVH 5AW7B 1I8MB 2ICWI 2XZCH 3FTGA 1TJIL 3I02A 3RJDA 4YSQA 4KVNH 4D9LL 2BCKB 5B7MA 1SLVA 2WXHA 2BCMA 1ZSHA 4LVOC 1WZMA 2NY3C 3T2LA 5KS9A 1LP9B 4LBEB 2XY1A 5DJ6A 4E9XA 4F58L 3DSFL 1ZANH 3C09B 3O45A 2UZYA 3IDUA 1ZMYA 4RDQF 4Y2OB 1HNGA 1Y0LA 1DJZA 3MUUA 4U1HB 2YXWA 1I7UA 2F58H 5F1NA 1QLRB 2DM2A 5D2NC 2BSRB 1OTUD 4MKTA 5DUJA 2W07A 2ADYA 3APMA 4R7VA 1DUYB 32C2B 3WGUB 5KSVB 1L7IL 3UDWC 3IAPA 1LVEA 2NT1A 3HC2A 3NDYE 4JCMA 1BQHG 1AS8A 1YRKA 3P3UA 4G7VL 4XVJL 5I6NA 5IHHA 2MIZA 3HLAB 4ELDA 3BEVB 4FQJL 4JANA 4OF3A 2BNUA 2E56A 2FR4B 7CGTA 1GS7A 2C9VA 1JV2B 1VFBB 3S96A 2VT0A 2YS4A 4ETYA 4ELME 2XTJD 4CMHB 4D3CH 2WNWA 1QBLL 1SDDA 1ZDQA 3MV7D 1T4KB 1JPEA 2IQAB 1DQDL 3QB7C 4APQD 4OSUH 4TUJA 3T0EB 1OY3B 2FYVA 2E86A 5HGBB 4KTGA 1TOXA 3A5VA 3HZVA 4JB9L 2YPVL 3LNIA 4IIQB 3EH4B 3MC0A 4I3SH 3ARFD 4MQ7B 4F2MB 4TL5A 5JOPE 3KEDA 2IANB 1ZV2A 3EO1B 2OBGA 3VAEA 4FQHA 4B97A 3O4LD 4XX1G 1SJHA 3DMMC 3ZL4L 1SLUA 2XPGA 1BVZA 5I1KH 2F0CA 3FCTB 4K3HA 4P3CH 2FO1A 3MLWH 3F5WA 4YDVA 3WHE0 4EI0A 1J0HA 4QRQA 5KBKA 4N2EA 1IUZA 2VW4A 2UX7A 4G6AC 3HNTL 1OGTA 2BW4A 1TJHL 1KFGA 3KPTA 2VDQH 1PG7X 4OF6A 5FYKH 4FXKB 2FGWL 1C12A 2FCBA 3SE6A 3IF1B 4X8JA 1S9YA 2VLJB 3IGLA 1F4YL 5IQNA 1AQKH 3NK4A 3U0PB 2BRRL 1P7BA 2J43A 2X6BA 3C09C 5FFOA 5D1XE 5ISZB 3C75A 1MHEA 4BH8B 3FN0H 2WUCH 1ILUA 2WIIA 5JORB 4YZFE 1T1ZA 3Q9PA 1SBSL 1DBAH 4FKEA 4KRMB 5HDLA 1M7XA 3EW3B 2K6ZA 4E42B 3SEPA 1AO7B 5G4MA 2VLKA 4P4KA 5TPWL 1UT2A 3JWDC 3R7QA 3O3UN 4WFED 2YD4A 4Y5YA 5CEYB 1T7WA 4LMQI 1RZJL 2HTLC 2GTQA 3T4AB 2ZXWB 4PLNC 4WFHE 2QSQA 3CFJB 2XX0A 2EVHA 2DTSA 1CT8A 1KLFA 1Z0NA 2JLPA 4CMHC 1I7RB 2QR0B 2FH6A 1A4BA 4TVPD 3QQ4B 5D8JH 1NBQA 4ONHB 3T0EC 1ZTXH 1NAMA 1VZIA 4PW3A 4YHMH 4AXWA 4H40A 3WY2A 4WO4B 3H2WA 3F04A 3MJ7B 2EDOA 1JFHA 5DLMH 5BXFB 5SWZA 3CSFA 4IIQC 2BOBA 3RE0A 4FFWC 1DJSA 1EPFA 3QXTA 5IVZB 5IZ7A 25C8H 2LOEA 5CJXA 2NY7H 1SJVA 4RNRA 5C07E 2X0UA 1F45A 4QY8A 5ICYA 3GMLB 4HCRL 4JO3L 1XZWA 4YHPA 1V3KA 5DTFA 4NQVA 2WXRA 2YN3A 5IBUG 1JZGA 1PCSA 3PGFL 1MZYA 1K8IA 4F8PA 2VABB 5KVEL 3AM8A 4LLMB 4RSVA 4FADA 3WJMB 1SLXA 2H4EA 2OMBA 4XXDB 5DK0B 2P8LA 1F86A 2UVFA 2DB8A 4FXKC 4E5XA 4ONFH 4NO2A 4IRZH 3VJ6A 4FA7B 3JWOH 4MNQB 1A6PA 3FYIB 2MWCA 4J3OD 1USQA 2F5AL 3KWWB 5T1KA 2LGNA 1D5BA 1HL8A 4YFEA 4KK8C 3IJHA 4QTIH 4TRPL 5EBMA 5IW6B 3E0GA 1R47A 5KYYA 1URIA 3OX8A 4PWFA 5C2BH 3K6IA 3LEVL 2YBRB 4W9CC 4WVRA 3VRJB 4K15A 5FO9A 4DO6A 3NCYP 4Z3HA 1U8MA 4DP4X 3IDMA 1Z9SA 1DQJB 1A4JB 3HR5B 3ZT6A 3V0EA 2JQAA 4X6BB 4KJQD 1D5MB 1CGTA 1XGTA 3ZQ9A 1GCFA 1MPAL 3KG5A 4JG5A 4LLDA 5HDBF 5HYIA 1G7LA 5J6HA 3HTLX 5BZZA 3GBNH 4Q9RH 1DQKA 1ORSA 3CIAA 5CHNA 2NW3A 5K59F 4HMDA 3T9WA 2BP5M 1LHZA 1K8DA 4G8FA 2PYEB 4JFVA 4W6WB 5CU9A 1IE5A 2A38A 3FFDB 1NPJA 4ZMVA 3RG1C 5EORH 3ILQD 4C54A 1KELH 1ADQH 1RUKL 4W9IC 4HXAL 3TV3H 1MHPL 4IBTA 4WO4C 4DK6A 1RZPA 2HLFC 2Z4TA 3V0AC 1U6AH 2G75A 3QDJD 3ZTJG 1UD4A 2CXGA 1F02I 2L7QA 1XF5B 1C5BL 1QACA 2XQYG 1TYJA 4FFYL 5DZAA 4F8NA 1AZNA 3MRJB 2JCCF 2ADFH 4P4KD 2E5EA 2G2RB 3L16A 5I8EB 2Y9RT 3H6JA 2IPUG 1BF5A 3RZWA 1PLGL 3QS2A 5F7FA 5E4IA 1NC4D 2H8PA 4KH2A 1UM5L 3TLRA 4PWKA 5EUOF 3T0VA 4PRPE 4PR5A 3DECA 5D9SA 1KXQE 2NCMA 4NBYB 2DBLL 3T6QC 3FO0L 3HIZA 4IRZA 4OZIE 2R56L 1XGRB 2LT9A 5DJAA 4PGEB 5FUCE 3T3PF 5EO1A 1YEJH 1OAKH 1A21A 2BMKA 3S2CA 2B9BA 1S5IH 1NINA 4AYFA 4KI5D 1W15A 4WI9A 2ARJA 1UB6B 2VXQH 1R46A 4KQ3H 5HI3C 3X13B 3AAZA 2DQEL 3IDNA 4JNXA 2VDKH 2ZPKL 1FFPB 5G2NA 4BCXA 3NESA 4BJLA 3OGCB 2VXTH 5EU6D 5AWNL 1S7UB 4IKIA 2C9QA 4AH2A 3ROLB 3EBAA 3B5HA 1PZ2A 3NGBB 2JKTM 2Q7NA 3U2JA 2GHZA 1TQVA 3EO9L 1N5AB 1JGDA 3U9UB 5GRWA 3UBXA 3GMRA 3NT0A 1JZ2A 4L3CA 4MZIA 1BFOA 3T0DA 2A6KA 4ENZA 5IKCA 1S7QA 4GFXA 5FYKD 3IMVA 1HX0A 2OJZL 2VDMH 3T3MB 4MDJB 2FJFB 3OR6B 1ACYH 2VC2H 4JFSA 5DC2A 5B4MC 5DA0B 1CD9B 1KBGL 1YAZA 1ADQA 1PLCA 4BGLA 4ODHL 1MJ7H 1U4FA 4HEMA 1LLAA 1IILE 3WEXB 3ZE1F 1H0DA 2QDVA 1P7QB 4UYQA 2CG9X 5KANG 1FH5L 3S35L 2DTML 3SBWA 4TOYL 4L3AA 4XO8A 1MLCB 1C16B 2F15A 4ABQA 3PCYA 4EEEA 2GTWB 3FFCB 1K3IA 2YEVB 1U30A 1CB4A 3QRBA 2DWTA 4ZPTB 4OLXH 1ZT1A 1TCRA 1XGUA 4JRFA 1MJUH 4PRNA 1U91A 2ZCKL 3DHPA 4P59L 3EIFA 5CGYD 1MH5B 4Z7OF 3BXNA 2D03H 3RVWD 5H94A 3EOBA 3GLZA 3I6LD 3WJJC 1LJMA 4WSJA 3QYMA 3VQ2C 4U7KA 3Q8FA 2ESVD 3WY1A 2VXQA 4MXVE 1DLHA 5IM7A 1I8UA 1CTOA 4PPTA 4OV6F 1GAFH 3A23A 4PMEA 2OPCA 3W0WA 3H42L 1U58B 3BD4A 4AEEA 4QHUA 2AVGA 5KTEH 1A1NB 1ZHLA 2OP4H 3HUJA 4PV1C 3CZLA 1MFMA 2LU4A 3IPEA 3DJ9A 4OUUA 3LZFL 2ZOKA 2BSCA 4NQEA 2MPVA 4TVUA 3D2UB 4P23A 3BUPA 3T2PA 3DX8B 5E9NA 4FJYA 3NGBC 2DYRB 3OKKB 5F7HA 3W9EB 5JXEC 3FU9A 3PP4H 2OV0A 5KSBF 3WDIA 1WRFA 2DI9A 2HSIA 1NFDF 2CGRH 1TQCB 1YMHA 2IDUA 3VXMA 4AQEA 2R2BA 2IJ0C 2X9WA 4AEIH 1G7HB 4R4NC 4CA4A 2X9XA 5BMFH 4MCMA 3HHSB 1FF5A 2AK1H 3EFFB 1MRCH 4F7TA 4GMTH 4NIYE 2XU9A 4DO5A 3X1GA 5B1CA 1W16A 1OB1B 4ZZKA 3NG5A 1FFTB 2YUVA 4L23A 1U8PB 3E80A 4YXKL 1HINL 1E4JA 1PGRB 5JPNA 2WLYA 4YIQB 3H4FA 3RWCB 5ICUA 2IPTL 4HJGA 1DBML 2BFVH 4O51B 1XCQB 4JFZL 4F9LC 4QTHA 4OW6A 4HLZH 3ME0A 5GSRB 1G9NC 4N0UA 1A14L 3I9GL 1PNDA 2YGOA 4WW2B 3B3BA 1JXFA 3DVIA 3NEXA 3QFJA 1DFXA 4RFOH 5ICZA 1AMYA 1HCZA 4G42A 5BO1L 1KTLB 1JV5A 2J1YA 3D25A 3QUMH 5LAPA 3ESPA 4L0PB 3U4AA 3ARBA 1YAIA 4QKXB 4PY7A 5FCUH 3PGCB 4N6QA 4OCRL 3LEXA 4MVBD 3SYAA 1KFAH 2BDNL 1LILA 4U1SB 1DEEB 4JFFE 2IBZY 4AV0A 2NCEA 3ZZ1A 4B7LA 4BDVB 4CKVX 4P2QD 1V3MA 3P73B 5KYXA 3M1BB 4RQQA 1SVBA 4WNJA 3QSKB 1CLCA 1RSFA 3QG6B 3TV8A 1YUHB 1LO0L 1JUFA 1LWJA 4G1EB 4D94A 3MNVB 4ERSH 3HAEG 4C55A 3HNSH 3HZ3A 3VG9B 1SYSB 5CD3B 3AXLA 3OKEA 4HUCA 4X5PA 1Y6NR 3BHBA 4P99A 5JIIA 5BS0E 4HC1L 2ZAHA 1IEAB 3ABLB 4JGNA 2X4SA 2D0HA 3QEQB 4NN5B 3QWRA 5EU3B 2VSKB 4LPCA 1UC6A 1BVLA 3M17A 3QEUB 1EMTL 1HKFA 4WUUD 3EJYD 1JZ3A 1QQDB 3MRGB 2PABA 4JO8A 3W0WD 1GJIA 3KXFD 2KDGA 4PJCF 1N3NA 4QGTA 5GRVL 2UWEF 4XCEA 3FU0A 3RA7H 3CC5B 1OM3H 4DGVL 1B9ZA 1N0LB 1WFTA 1HSBB 5GZNA 4P23D 1ONQB 3RU8L 3OAWA 4HV8B 2FX7H 2JKXA 4WW2C 4X6EB 4OZ4A 3FU7B 2DM7A 3QUMA 1XDTT 4LCWA 3VXMD 3WS6C 4HBCH 4XPBH 5I1HL 3JV0A 4LKXB 5IMMB 1SGKA 5TDPB 2XX1A 1FPTL 2WBJA 4NQDD 1N5YH 2A9ML 2O6EA 4JKWA 3KL0A 1YNKL 2BH0A 3IDJA 3S3PA 3SY6A 1MI5B 1JZ5A 1C9SA 3O3BB 1T1YB 2F8IA 4S1DC 3OLIA 4WNSA 5EZJA 1BFTA 2P5EB 4G7QB 3RVVC 1IAIM 1JJUA 1XXDC 4X5WA 3Q06A 4JHAL 3SDXA 4AJVA 3ALPA 4MD0A 4X6DF 2H1LM 1TO4A 4K3JL 1CD8A 1RZQA 3VXOA 3ZDWA 1NEUA 5J13B 3MRFA 2A4ZA 5F7AA 4C8XA 5I2IA 3B2MA 2AXWA 4ZUVB 1PKQB 5IMOB 4BBWA 3VG9C 3Q2WA 2VUYA 3I75B 3D85A 4GP8B 4W68A 5DFWH 5MERA 3L9RB 4FFTA 1INEH 1EO8H 1BAWA 4HHAB 1RUPL 2GUOB 1XBDA 3GXMA 4DT2A 1WA2X 3SDCB 1ULVA 2P8PB 5HHPA 1HZHL 2OS7A 2PR9A 3TYGL 5F6HJ 3RFZA 4NN5C 1RLBA 1ID5I 3VXUA 1OK8A 4FFVC 2P8MB 4IU2A 1Q9KA 1UEMA 2PW1B 3EDFA 3NSYA 1FGNL 3N50A 2JK5A 2LQRA 2Y0SA 4PJBF 3NJJA 5HHOD 4PJ8A 2C1PB 4DUXA 3PJLA 1HEJC 2OMUA 1NEPA 1YLBB 1EVUA 1GGUA 4XPGH 3ARXA 3TBWB 3ZBMA 4NP4H 3ROOB 2AQPA 3HZYA 2X0VA 4UV4L 3ZHNA 2HX7A 4G9FA 4UV7L 4PJHB 3U0WH 1TU2A 5IG7A 2BZ7A 2F7PA 2NYKA 4PV8B 4JM2F 1ESOA 3PWJA 2HVJB 4PH8A 5MHSD 3BAEL 3NJVA 3HCVA 4HIQA 1ZS8B 5D2NA 2EKSB 3H3BC 3QWRD 2BOCA 3ZKNC 5I1EH 4Q56A 2DQUL 4S1RH 1SJEB 5AW3B 5F0JB 3JV4A 5DD5H 2PR4L 2MPAL 4MCZB 3S3JA 3KDMA 4QCIB 3O9WC 4P8QA 4J3VA 3GRWL 3JWDH 3B2DC 2VR7A 3CHXA 1UOKA 3I3DA 4UTAL 2IV9A 1A6ZA 5J13C 3KBPA 3D12B 1T5WA 1MRDL 2QKIB 3ULUC 4BQBA 1MCIA 3L5XH 3OLGA 4KKQA 4HQQL 3DPDA 5H4YA 4HD5A 1CR9H 3GC3A 1I3GL 3FAXA 4ORGA 4MASA 1JZEA 4OCXH 4Y1AD 3T8XA 5GJSH 4FXGB 3RUGF 4LSVH 5JXAL 3TT1L 4O2CB 4F7EB 5ID1A 1B0GA 3SDCC 2V5MA 1ETB1 1G0XA 2IQ9H 3T8MA 2BVPB 3II3A 2CM5A 2HH0H 5E1IA 1CXHA 1Q72H 3LRMA 5DJ0A 4GQ9H 1ZLSH 4MDIB 3QPKA 1TETL 1IGCL 1UJ3B 4P9HL 2WUBL 3SIKA 5DYOB 1QYGL 2OXHA 3IBEA 5E5MB 5DZPA 2XQYK 4G80A 3CMGA 5A2LH 3BPCB 1G9ML 1DUZA 1CICB 1YMMB 3HZMB 5J57B 2C26A 4ANKA 5DUBA 1I8MA 1PJWA 3A21A 4FZ8H 1BXUA 3DUSA 2IPUK 1C7SA 4MHHG 5T1LA 3VFVB 3W2DH 2BY0A 3LV3B 3WENA 3HN3A 1FQ9C 1J9SA 3NIDB 4GH7B 5CKAA 2DN7A 3BN9D 1B2YA 3F85A 4U1HA 1GYVA 2OQJB 3GLAA 1DUYA 32C2A 3WD5H 1SXSA 2AEQL 3CZGA 3IE9A 1TVHB 3NVQA 4FP8L 3G5ZA 4QNPE 3B37A 3G6JB 4N2NA 1UWGH 4OGXH 3HLAA 4YLCA 3BEVA 1R33A 4KK9D 4AIEA 2FR4A 1NMBL 1MVYA 2DS4A 2G5BA 2DQTL 2W5PA 1CK0L 2GAZB 2L04A 3NK3A 1IAIL 1JV2A 1VFBA 5CR8A 3HI6H 1CFBA 4HKZA 2IG2H 2EO7A 1T4KA 2NY3D 2BXYA 4WI7A 1HEHC 4PBVC 1XFPA 4XAWH 5J6SA 3RB5A 3IFLH 4K7FB 5CZRA 3ARWA 3T0EA 3FUNA 3PHOB 4FXGC 4XO4A 5HGBA 2CMRL 3L13A 1FVEA 4NAJA 2B1HH 4Q4IA 4XCFH 3WKNA 2A6DB 4JFOB 1NCWH 3J27A 3QJQB 5DMIL 2FBJH 3PXHA 3HB3B 5TD4A 3AREB 4QRUA 1F18A 1U8NA 2P5WA 4TSCH 3FO1B 4NRXB 1I1YB 4RFEB 4X4ZA 1UJ3C 3NSFA 4B9JA 4I87A 3SQBB 3NCJL 1R3HB 1FZKB 4MSWB 4FXLA 3WJLA 2Y7OA 3EH3B 4XCNB 4YWGH 1DE4A 3IWUA 5GGVH 2D3NA 3BMVA 2XG5B 4FXKA 4XPTH 1FZJB 1HS6A 2XWJA 4RFNB 4XNAA 4AQAB 5BOZG 2VLJA 3DRQB 1A02N 2BS9A 4I2XE 2N7SA 3U0PA 4HOMA 2ICWB 3A47A 3AU1A 1F97A 2XN2A 4BH8A 2VSMB 4J3SA 4WI0B 4YBQC 4JO2H 1Z5LA 4MA8L 4GQQA 5DJYB 2YGVA 3CLFH 4GIOA 3DMMD 5KN5B 3ORJA 3TT3H 2ITCA 1MDAA 3QI9A 5T3XE 4DK5A 1N6UA 3RVTC 3DUUB 3QJRB 4H7VA 4QJ3B 4NPYB 2XIDA 5CEYA 3AQXA 4G6AD 4CUCA 5EH1A 3X1BA 1J5CA 3CFJA 3CVHL 2PTTB 4P2AA 5C08A 3PWNB 2DQDH 3F7LA 4F5CA 5HDQL 5IQOA 3NTCH 3FUFA 3ZHLA 2QR0A 4CW1A 4JRXA 1R34A 4A66A 3QQ4A 4HIEB 4RAHA 2DQIL 4OLWL 1M05A 4KK5C 2NDFA 1DBKL 1MCWM 4HK3J 4UIMB 3QIWC 3MJ7A 3MLXH 3MTRA 2DKUA 1T04A 4GLRH 2X1WL 5IVZA 2X42A 5HVHB 4E9TA 4X7TB 3HB3C 3ZL1A 3AREC 3BVNB 4ELMF 3DVNB 3P69A 1NGQH 5FYJL 1A3RL 5DQ9B 1JTPA 4K07A 2HTLD 3HG5A 3E8UH 5AW4B 3NAAL 1XB3A 2VABA 5L9DH 1HE7A 3O8XB 1GSKA 1DN0B 2DQHH 1WAAA 3BP6B 2NZ9C 4BE6A 4U1GB 1SMDA 4UIKL 4RFNC 2XWBA 2XTLA 3T0ED 3ARSA 4KTDH 2XDHA 4Z7VA 4CN6A 2MQ3A 2VQ1B 3PWPB 3EFOB 5DHEA 3FU8A 5I8CB 2CH8A 4FFWD 1TTBA 2X4UA 4PJXA 4Q97A 2IAND 1IEBB 1PZUB 2R2EA 1AI1H 2WXIA 3VD9A 2VRQA 1I8KA 3OGOE 5L6YL 1IB5A 2PCPB 4XVUC 4UNIA 5FDWB 4LDEB 3DOHA 1X5XA 3MRIA 2FYYA 3O41A 1DQJA 4GSQA 4NC2B 3ARUA 5I73B 1A4KA 1E9OB 1D5MA 2HAZA 3CZKA 3HRZA 3RTQB 1WE5A 3CGTA 1L5GA 1T6VN 2DEYX 2WMPA 4XPFH 4ZMAT 5ENWA 3H9YA 3TN0B 4A67A 1EFXB 4PRHB 4OY9A 1WUNT 4A2GA 4B9ZA 3MZGB 3BIKA 3KPLB 2FQDA 5FEBA 1L7TL 4ZTPH 2MNJB 2ZG3A 3FFDA 2VLJD 2OFQA 1QHPA 5FK9B 2WVVB 3KYOB 5GGSB 1AGCA 5ISZD 1E90A 1ZLVK 4FNLL 2I07B 5K33A 2R51A 1EHLH 2OZ4H 4KK8D 3NIGE 4WDIA 4PFEA 1JGVL 2J5LB 4KY2A 4NOFA 1VACB 4YXHH 2ZOWA 4O02L 3AS2A 4HKXA 3BW9B 3ZKMC 2Z9TA 3QRLA 1B88A 2YA1A 3FU5A 5HVHC 2XBDA 2EO1A 2OR7A 2WYZA 3FRPA 1AO7D 3BGFB 4U2YA 3DO7B 2G2RA 5I8EA 5D4HA 4N25A 1DQVA 1KENL 1FL6B 2X6AA 1G9NH 2Z91B 2F5BL 4FQLH 1W72B 5E1QA 3FK3A 4HFWA 1ZS2A 3ZIMA 1X6NA 1P0SE 3H9SE 1IAKA 4WJKB 2CQVA 2WP3O 4WKZB 3O8XC 3IM1A 4LSQL 3T0AA 5HYSG 3GPSA 5DEJA 3FQXB 3I84A 4YHKH 5DEFB 1BDYA 4KI5F 4Z7UE 4XP4H 4U1GC 6FABH 3WJJA 4PJEA 2OR9H 5HBBA 4NKIH 4Z7QB 2GIYA 4A37A 4HAGA 5GGRA 3V79C 4QR7A 3S36L 1SOSA 4KQ4H 3NZHH 5AALA 4WO4D 4UOQA 1A1OB 1QRNA 5G4OA 5MEOA 3X13A 1SYVB 2OSXA 2WBXA 3TJHC 3QGVA 1WHPA 4XNXH 1N6QL 5EZLB 5EO0A 2CRMA