4ZK8A

Copper-containing nitrite reductase from thermophilic bacterium geobacillus thermodenitrificans (re-refined)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
294
structure length
294
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Structural insights into the function of a thermostable copper-containing nitrite reductase
pubmed doi rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Oxidoreductase
total genus 98
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4zk8A00
2CJ3A 1JZHA 3FS9A 4JHUA 1L9OA 4AKPA 4KO6A 4UAHA 4G71B 3NSYA 1UATA 1TEFA 1IBYA 3ZBMA 1IBZA 4TXVB 5B1JA 2DYRB 1WS7A 5I6MA 4KNUA 2HRHA 1OE3A 3CZUB 1WA2X 4HALA 3KW7A 2QT6A 1CUOA 4HAKA 5AFAA 2FJSA 2EIKB 4M3HA 1AS7A 4BWUA 1L9TA 2XX0A 3WNIA 1M56B 1TEGA 4X4KA 5IY5B 4YVNA 2FTAA 5I6OA 5I6LA 1OE2A 3NJIA 3L45A 4A67A 4GP8B 3NSFA 3V9CA 3QJVB 3WG7B 3EF4A 4FA7B 1YLBB 4G70B 4GP5B 1AZUA 5I5IA 4NERA 1N68A 3EH3B 4F7KA 3QPKA 1J9SA 3TBBA 1J9RA 4YSTA 3V9EA 5B7MA 3JT2A 1XB3A 3N2JA 3T9WA 1M9WA 1FA4A 4W1TA 2YAQA 2DY2A 2H3XC 3ABMB 2IH9A 4YSSA 3U25A 2XWZA 3WI9A 3DTUB 1J9QA 3FSVA 3JTBA 2PPDA 2NRDA 2QPEB 2BW4A 1RCYA 4P5SA 4DP2X 2ZONA 3NYKA 1JZEA 1AS8A 3S3CB 3AG1B 3C75A 2Y69B 2BWIA 3UAAA 1N70A 1JXGA 2GSMB 2GIMA 3IN2A 3NJLA 1GR7A 1BXVA 1SHXA 3S8FB 1BYPA 2PP8A 3T6VA 4YSOA 4A66A 1FWXA 1E65A 3ZX1A 5ANHA 4BXSV 4AI7A 5I28A 1IKOP 1SDDB 5EHFA 3KW8A 4YSCA 2XV0A 1GYCA 1XMEB 2BP0B 2HX9A 4YSDA 3SBPA 1KBVA 1R1CA 3GYRA 4UANA 3ZIYA 1GS7A 1XB6A 2XXFA 2XXGA 1AQ8A 3OQRA 2VW6A 1BQRA 3X1BA 4DP4X 3FYEB 3QQXA 2XVBA 1A4CA 1EHKB 1MG2C 1HAUA 3DKHA 2VSMB 2Q5BA 1OE1A 3NJNA 1X9RA 2DWSA 3FSAA 4NB7A 3SBQA 1J5DA 2I7OA 4DP5X 2H5UA 3WKPA 4E9TA 4KNTA 5A7EA 3NSCA 5I6NA 1QLEB 2HX8A 3ASOB 1OCCB 4P5RA 1HFUA 1GY2A 2YXWA 1J5CA 3FSWA 3EHBB 2PPEA 2WO3B 3H56A 1SNRA 4ENZA 1PLAA 5F7AA 2FT8A 2X87A 1EZLA 4AZUA 1BQ5A 1E67A 1PNCA 4E9VA 1MZZA 2AANA 4E9QA 3IN0A 4E9WA 1V55B 2CCWA 4KO5A 3X1FA 2TSBA 2HZHA 2B08A 4W9ZA 1ZIAA 3CDZB 3CVCA 2WO2B 1NIEA 1L9SA 1OCRB 1OF0A 3SBRA 1AS6A 1NIAA 2XX1A 4PAZA 2IWKA 2BP0A 1ET7A 1KBWA 2ZOOA 3WNJA 3UAEA 1JVLA 1AZCA 4GYBA 3PLYA 3EH5B 1NIDA 4YSPA 3ABLB 3N55A 1TKWA 4MFHA 1NDTA 1AACA 2FNWA 2P80A 2UX6A 3IE9A 4YVUA 2FQDA 5I5JA 4BK5C 1L9RA 3MBWB 1NIBA 2YQBA 3ASNB 4F2EA 2GC7C 4KO7A 1A4AA 2IWFA 3QJTB 1F56A 3TBCA 7PAZA 1KGYE 4YL4A 3X2QB 2PPCA 1PMYA 3S3BB 5AKRA 1W6LA 3ZDWA 2R7EB 2J57A 3OMIB 3QJUB 1IC0A 2WSDA 3H4FA 1BYOA 1JOIA 4Q8BA 3DIVA 4PCYA 3RYMA 1E5YA 2JFCA 2VW4A 3AG2B 1XB8A 1A65A 2B3IA 3GXUB 1SHWA 2DYSB 4DP6X 1ZDQA 3T71A 5I26A 3MX0B 2TSAA 4L0PB 5LDUA 3FU7B 4DPCX 2XU9A 4BWWA 4EF3A 3HB3B 2YAHA 3UACA 4G72B 1V10A 2XYBA 1SF3A 3NJGA 3PCYA 3PXLA 1ET8A 1ZIBA 2IWEA 4YSQA 2CALA 1CYWA 2HXAA 4DP8X 1BAWA 4G7QB 5D4HA 2BHFA 1GY1A 2E86A 4AX3A 1ADWA 1AAJA 2PCFA 2PPAA 1ID2A 4E9RA 5B7FA 2EILB 1NWOA 1AZRA 2EIMB 3FSZA 3PPSA 2YAOA 4DP9X 4HHGA 1BEXA 2VM4A 4HCFA 4KOBA 1PZAA 3ERXA 1VLXA 2Q9OA 1ET5A 1RZQA 2DWTA 4A2FA 1A4BA 3NJKA 4A68A 3OD3A 2QDWA 1GS8A 3FU8A 4YSAA 2IDQA 3G5WA 1ZDSA 3NSDA 4A2DA 5B3SB 2AZAA 1KDIA 2LLNA 1WA1X 1E30A 3PAZA 3NJHA 1I53A 2BWDA 1L9PA 5B7EA 1KYAA 1KDJA 4CSZA 4AKQA 4HHWA 5D4IA 1AG6A 1AZNA 2UX7A 3AW5A 1MDAA 1PZCA 5B1BB 5F7BA 2YAPA 5B1AB 3CVBA 3ABGA 1MG3C 2BO0A 3FU7A 4N8UA 1PAZA 1T5KA 3GDCA 6PCYA 1PZBA 2UXGA 1V54B 4AKOA 4DPBX 3CVDA 2HLEB 2BW5A 3PAUA 1NTDA 3FT0A 1CYXA 2VMJA 3BVDB 3HEIB 3WIAA 3OMAB 1B3IA 2PP7A 1QHQA 4YSUA 4WKXA 2ZWNA 2MTAA 3UADA 3UABA 1SDDA 4HCGA 4NAJA 5B1JC 1JXFA 1WAEA 6PAZA 2P80D 1HAWA 1GW0A 3OMNB 5TK4A 3AG3B 1NICA 3UGEA 4DPAX 5PAZA 1AOZA 4GY4A 2MRYA 2DV6A 3PAVA 3EH4B 1BQKA 3NJMA 3ABKB 2AFNA 1ETJA 2JKWA 5PCYA 2J5WA 1WA0X 3IEAA 4N4YB 1ASQA 1SFHA 2OCCB 2XV3A 4RH4A 2FQEA 3FPXA 1FFTB 1OOWA 3WKQA 2EINB 3QJSB 2XLLA 2BZ7A 2XV2A 4GP4B 2PLTA 1SFDA 1QNIA 2GBAA 2A3TA 2J55A 2HRGA 1A8ZA 2ZXWB 2AZUA 4UF7C 4E9XA 3S8GB 2BP8B 1L9QA 3X1NA 2GB2A 3NJJA 3QJQB 4YSEA 2IH8A 2QPDB 3D12B 2FQFA 2CAKA 4HZ1A 4BXVA 4QKTA 2UXTA 1W6WA 2OV0A 2GI0A 4QLWA 2VM3A 2PCYA 4HCIA 2PP9A 3CDZA 2EIJB 2VW7A 4CSPA 1JZIA 4E9YA 2VSKB 4G7SB 5D4JA 4BDVB 4DP7X 3T6XA 4F2FA 3S3DB 1GSKA 1ASOA 3TASA 4KOCA 4DP0X 4KNSA 4M4RB 1JXDA 1AIZA 3FQYA 4K9JA 3T6ZA 1NPNA 1KV7A 1MZYA 2W8CA 5I6PA 1JERA 1RZPA 2CUAA 1JZJA 5AZUA 4WTQA 2JXMA 1IUZA 1JZFA 1KCBA 1WS8A 2AVFA 2FT7A 3T6WA 1NWPA 4FAAB 3TU6A 2IDTA 2IDSA 3FYIB 2XUWA 2RACA 1BXAA 1OV8A 2GC4C 1RKRA 3X1EA 1W8EA 1URIA 2YXVA 1CURA 4DP1X 1A3ZA 2IDFA 4E9SA 1SF5A 1NIFA 1DYZA 2IAAC 4GXFA 1NINA 1OCZB 2VN3A 2YAEA 2R7EA 1BXUA 1J9TA 5I6KA 2BP8A 4KO9A 2FT6A 2X88A 4JHVA 3QJRB 1AR1B 2FWLB 2HX7A 3X1GA 4A2EA 2N0MA 3OM3B 1NPJA 3FPYA 4HIPA 1TU2A 3FU9A 5I5MA 3H4HA 1ZV2A 4G7RB 3FQ2A 2UXFA 1AG0A 5B1KA 4BDVA 1PF3A 4YSRA 2IDUA 1SJMA 2YARA 3AY2A 4JKNA 7PCYA 1PCSA 4Q89A 1ILSA 2UXVA 1JZGA 1OCOB 1JVOA 1ZPUA 3AZUA 1PLCA 3CG8A 1PNDA 1DZ0A 4BWTA 2BZCA 1X9UA 2J56A 3NP4A 1AZBA 2CBPA 3TA4D 2FQGA 3SQRA 1ILUA 1M57B 2GHZA 2YAMA 2Y1AA 3NP3A 3NJFA 2I85A 4A2GA 1PLBA 3NT0A 1ASPA 1CC3A 5E9NA 1PY0A 5FC9A 3IBOA 2PPFA 2QDVA 3FQ1A 1NZRA 3AG4B 9PCYA 8PAZA 4ZK8A 1KCWA 2YAFA 2I7SA 3BQVA 4A2HA 1E5ZA 2H47C 1GS6X 2OJ1A 2W88A 5TK2A 1AANA
chains in the Genus database with same CATH superfamily
4JFFE 5C09A 2OTUA 1HNGA 3UDWC 2Z91A 2N7BA 3MV7E 4Z76B 4PJ8A 5LGHH 1UATA 3Q1SH 4I5BA 2O6FA 1KUMA 4HS8L 5D1QD 3SE8H 5C0CD 3KPSB 4EZLA 2IVFC 4QXTB 1ECZA 2WLLB 4N0UE 4ZPTA 3F6JA 1WA2X 5LNGA 5DGQA 5ICZB 3QQ3A 4PGEB 5K93A 3T0XA 4JFXB 4OCNC 3VI4A 3GGWB 1JDDA 2AMGA 2XN9A 3WDHA 1NC2B 4NDMA 1A6AB 3U4EB 3K81A 5E5MB 7TAAA 1E8XA 3EOTL 2PABA 4ZAKA 4ECNA 4MGXA 2XZZA 3JVFC 3ZKXC 4A67A 3U2JA 1UH2A 2YN3A 5FKPA 2WTRA 2DICA 1L0QA 3RTQA 4OD1H 5SWZA 1IT9H 4PV8A 3ZTNL 5KSAB 1T5WB 2DB8A 4GI8A 3TC9A 1Z3GL 3FTUA 1LJMA 1C08A 4XPBH 2OJEB 4Z7VA 3VFUA 5IEKA 1I7ZA 4BSWB 3T77B 2IH9A 3CFDA 4YSSA 1EAJA 2ZUQB 3D48R 3VFRB 4Q6KA 3O9WA 4ADIA 2NRDA 4NQVB 4DP2X 2ZONA 2FO4B 2C8NA 4ETQA 1YHPA 4JY4A 3TWCL 3VXPA 1T21B 2BWIA 4KK5D 3L17A 3F84A 3NCJL 3Q6FB 4M8RA 3SCMA 1YN7A 2OM5A 4AVJA 5C0DB 3S8FB 3P3RA 4MXWH 3IFPB 3MNZB 4N2OA 3BH8B 1O7DC 2Z8VC 3LEXB 3CN3A 2BDNH 4S0HA 1T4WA 2QL1A 3LZLA 3MLWH 4JFFD 4R4ND 5F0JB 4DZBB 5I8OL 3VXMB 5FDWB 1UH3A 3WN5B 3KCPA 1IKOP 4OVVA 4F37K 2EDEA 4R0LC 3OJVC 1UADC 4IDJH 3MCLH 4LDEB 1KJ2L 4UANA 1KCUL 2MCAA 3TBWA 5I6XB 3PDOA 3CX5J 3TWYA 4XPHL 2A9DA 2NCMA 5DVKA 2EYRB 4YO0B 5KVGL 5F71A 3DSFH 1K2DB 4F15B 4GO6B 3HRZB 2YMOA 3K6OA 3LH2H 1JL8A 3LDBB 3B9KA 1MHCA 3OL2A 4ZFOA 4HA1A 1FAIL 4OLUH 3S34L 4CC4A 5ANMB 4ES9A 1ORQA 2AK1H 3MQIA 3C09B 2I7OA 1IGJB 3IMUA 3VI3E 4JL2A 4Y2DA 1RZKH 5GRUL 1QLEB 5DZOA 5FW8A 5HHVH 5FIEA 4X4XA 5IVXF 4JPSA 4P2QA 1T6BX 5LBSH 2MFNA 5DEFA 1A5FH 1ZAGA 3FSWA 2XVGA 3NDYE 1QKZL 3PWVA 1S7WA 4ZS6D 4FN0A 1HINL 1U8LA 5FYJL 2DQEH 4LNRA 4E9QA 1YAZA 2R1XA 2VMEA 4AC4A 5EIVA 1NUDA 2IGFL 4QOKB 4DOHE 1SXNA 2BJMH 2TRYA 1P4BL 2ZCKL 1XZ0B 4UTBL 4G9FA 4HKZA 3LTVA 4GH7B 4P9HH 1I8MA 1S7UB 4L8DA 4N2NA 3QEQA 3C2AL 3JVGA 3QQDB 2EYTA 5CBEB 1O9WA 3E6FB 3KZ8A 2FX9L 4H7VA 5EDXA 3VE0A 4JFOB 5C6PB 2FLRT 4U1HA 2IALA 1NIDA 1ZVHA 4XNXH 5HJGA 1IJNA 1DVFD 4PJAA 2J6EA 3ESNA 1MJUH 2A7BA 5D6CA 5TE4L 5HVWA 5I8KL 3DX2A 3CZFB 2OYPA 2YOCA 2EDMA 4EBQL 5E6IC 4NKMA 3O11B 3MOBH 4Z7UF 1NFKA 3FB6A 3O6ML 5T1LB 4CW1B 3T09A 4JREC 1XSKA 3QIBC 5CHNA 3MRDA 4M43L 4XVUD 3UAJA 1FVEA 1KJ2B 2APSA 3KH4A 4UB0H 4X42A 4IRJC 2AEWA 3X11A 4F91B 2Y3AA 1INQA 2WXMA 3FRUA 3GIVB 3ULUC 3CWGA 4H1LB 4M9OA 4UI2A 2A1WH 2J6EH 2YLHA 3PP3H 2YA2A 3QZBA 2LV4A 2JKRM 1CLYH 4JFEE 4RZCA 4HK0A 3PGCA 2VW4A 5AUMA 3T08A 1UXMA 3T4AC 3G5XA 4LARL 3HJ0A 5K9OA 2DYSB 3RZCC 1LM8V 2Y2TA 3OPUA 1K8IA 4WUUE 4F20A 5AOLA 2XTJE 1IEBA 5C0GA 2Y25A 3VRLF 4J2XA 1LO0H 3I85A 1U3HD 2CO7B 3V4PH 2OMNA 3ULUF 4I3RL 3GMPB 3K5RA 3D6GA 2BNQE 2WM0A 2APTA 1G7LB 4H25B 1MFCH 2AXWA 2C9UA 3CZGA 4JFQB 1MXGA 2E5EA 4PY8J 3ULVE 4FERA 2XIIA 2ICCA 1OAKL 4YH6A 1NCBL 2R0KH 1R3HA 5TH2B 4LZKA 1M6OB 4LCWB 3WE6A 4YHOH 4KY2A 5I0WA 4HIHA 4D3CL 2Y22A 2PMZA 1N7ML 3DOHA 5K39A 3SB3A 1Z9NA 2JVUA 3ZL4L 3P3UA 1TVHA 3ARBD 4CILA 4E2OA 4M1DL 3VYNA 3TFKD 3A6BH 1NCAH 1CG9B 43CAB 2BRRL 1MPAH 4YHZL 3CD4A 3H3KA 5GXBB 3MUHL 3EO9H 1HIMH 4KJYA 2R4SH 4TQEL 2BOCA 4U3XA 3GB7B 4GRWF 4MB5A 1HCFX 2QPSA 3CFCL 2BVYA 4UT6A 1WBXA 1YMMA 1KXHA 2WBKA 4P2OD 2VL5B 1HQRA 2PTTA 3SKUD 3VXRA 3DV6B 4Z0BH 1REIA 5HJ3B 5B7EA 4CNIA 3QDGA 3VXTB 2ZYRA 4KXZI 1NGQL 1C12A 1NJ9B 1TQTA 4MAYC 4UM9A 5DMGC 3NEXA 3TBTB 5GS1B 2OL3A 2J1XA 2X6MA 3CVBA 2ITFA 4L4TE 1A6WH 3TVMA 5CEZE 4X6CA 1DFXA 1CLZL 3OR7A 4LCYA 2ORBL 5BZDB 3O4LE 3APFA 2AJYL 4XHQA 3SDXA 1YYLL 1PZBA 4CJ1A 1USZA 4UIMB 1O5PA 4JVPA 1AR1C 4DPBX 2HLEB 4H0IA 2IH1A 4WCYH 5JW4N 3ECQA 2P8MA 4HZAA 3QWOA 3AC0A 2A6DB 4G8EB 1XL6A 2ZYSA 4LVNB 4XBGA 3DGGA 3LHAA 1B3IA 1CXEA 4ZUVA 3WUWA 1XAUA 5DK2A 4JQVA 3VDAA 4G6AC 3RIAF 5FOJA 4ORGA 3H7LA 5HY9B 2WQUA 3EJPA 2OL3H 1QR1A 2BNQD 4NQEB 2NY6C 3BPLC 1NC4A 3BSZL 4CVUA 5D93B 3ALPA 1A9EB 4O2FB 3NRPA 4OLZL 2VQ1B 4P49A 1OTUC 3UGEA 3W1ZA 3B8SA 2WWKO 5IM7B 5D7EA 5JZ7C 4OZFA 5GZOC 1IGFH 4XCNB 1IARB 2WKLA 3Q5TA 2YD1A 4P4RB 5T3ZL 5IFAL 2B0SL 3O2DA 5IJVB 1F8TH 2WGNB 1LYQA 2NY3B 1E9QA 4WY7L 5F1IA 3B5HA 2XV3A 4DCQA 4W6WB 1VEPA 4Q6IB 4ZW5A 3D05A 1KBGH 2I32A 4ABVA 3R7RA 2VDRL 1LK3H 2VH5L 1LQBC 1UWEL 4PJGF 3L5WB 3VQ2C 3KYAA 4GP4B 4GRMB 4RGND 4ZTPH 5KYNA 3NGBB 4JDZB 4OZIE 4I18C 2XOTA 3GS0A 3M7OA 4XCFL 2XZQL 2Z0UA 5HHNA 4DKFH 3TV3H 1LO2L 1F58L 2OBGA 3VWKD 5JMOC 3QJQB 3FFCB 4MJ6B 5GGVY 1DJIA 3FH8A 3FO1A 5TPWL 3HN8A 3UTOA 4XVTL 1AMYA 1FYTE 2DI8A 4HCIA 1FL5B 3GC3A 2VW7A 3MJ8B 2UY6A 5CEZD 3T8MA 5EC1A 3MYJB 1FVCB 3CC5B 3O4LD 2ZUTA 5DHYA 1KGJA 3WEBA 2A5UA 2QQLL 1SJHB 3LKSA 3LNIA 2JE8A 3QO0B 4PFEA 3BUYB 3RVUD 4PB9L 4PJHB 3IDMA 1S7RB 3TT1H 4PYHA 3D87B 3N42F 1WD9A 4WQOA 1MFEH 4I1RA 2WTOA 4HG4K 3OTTA 1I8UA 3V6BR 4LE8A 1GH7A 3N0AA 4FAAB 5IB4B 2FVNA 3NA9H 3L9YA 2FX8L 3CZKA 4GW4B 4AW7A 4FTVE 1IEHA 2GTWB 1FC1A 1M53A 2IQAB 3S5ZA 3HI6L 4DP1X 2I27N 2IDFA 4HKJA 2VMDA 1CFVL 1ZLUH 3HE7B 3INUH 2D7QA 4GXFA 5C8JA 5GS0D 4BELD 4ELKA 1XTMA 3U7WL 1J9TA 5J56B 1D6EB 1FC2D 2X88A 4GFTB 3NZ8B 3UTTE 3JTSA 1I8LA 3FPYA 4F7MA 2IXQB 4G7YL 1TU2A 3U46A 4TVPL 4IRSB 2CRMA 5FA4B 1F42A 1RP9A 4TNWF 1WBYB 3D85A 2XKSA 1IC7H 1BX2A 12E8L 5F6IC 5HHPB 2XWJB 3WGVB 4PS3A 4PBWD 4OLXH 5EOTA 1S5IH 1IGCL 3K4ZA 4AXWB 1DQDL 5BJTB 3AAZA 2WP3O 3WNPA 1YDPA 4FQXD 1T66D 1JHLL 4M4RA 1NFDF 2ZKHL 2LFEA 3AZUA 3F85A 1JF6A 3W11C 3M46A 4P46B 2Y06L 3VA2C 4E36A 2Y2YA 4P5TD 4F7PA 4H0HB 3GSUA 2FX7H 2BIMA 4YGAB 3VG0H 1AQDB 4BQ8A 4PJIF 7FABL 1NGYB 1AGDB 4L3EA 1OW0C 3GSXB 3UJIH 3NCEB 2ODHA 3NP3A 1IC1A 3ROLB 4FNRA 1EANA 3Q01A 4FFZA 3NDZE 1PTZA 4U1NA 3U0PA 5F3BB 2BOBB 3ARVA 3RUGE 4YXKL 4PUBL 5AW6B 1YAIA 1P7BA 1P7QD 3EGSB 4PB0L 1QOKA 1CGYA 3K72A 1SOXA 5BPPA 2H0FA 2ZSVB 1TPXC 1SVCP 4NM8L 1M1SA 1R17A 4KFMA 3MFGB 4AYDC 1NLBL 2Y23A 4XN4A 1XGYL 4PJ5A 5DJ8B 5I1EH 2Z35A 2CHWA 2X9WA 2BSSB 3IXTA 1EEZA 1CIUA 1VEMA 4Z5RB 2C9RA 2OMTA 1HHGB 3L3GB 1MFNA 2R0WH 4AQAA 1PDKB 2CUMA 1OQOA 1OE3A 1D5ZA 2HKHH 5F9AC 3HC4L 4AL8C 4NS0A 4A7UA 3BIKB 3UTTD 1A6PA 5CWSA 4LSVL 2W95A 3WFHA 2F7RA 4EI5A 2PO6D 3ESVF 1GZPB 1TQCC 3KGSA 3PIQB 1NOFA 3VQMA 4K5MA 4YVNA 3UPRB 3AS2A 4JN1H 4KKRA 4GW5B 2VXVL 2VXUL 3AQYA 1T0NB 3AS0A 4FQQA 3WG7B 3KLSA 3WAKA 4FA7B 3DC0A 1MKFA 4HC1A 3BZEB 5FS5A 1J9SA 3HRPA 3K0YA 3LRMA 3O3EA 5D5MB 3WXWL 1KWGA 1NUFA 3FT9A 4NJAH 1LQSR 4ZJ9A 3V7MA 1EJ6A 1FA4A 2EQDA 1ZHNA 3ABMB 3R19A 2V9QA 4XNYL 3BGFB 1SOSA 1LWJA 4K94C 2PYEE 4Z3FA 4P5SA 2F1EA 4Y8AA 3D9AL 3LX9A 4FLSA 3IPBA 1DBAL 1QWNA 4JY6B 2XNAB 1UZGA 3BIBX 1A66A 1FCGA 2Y69B 3GSRA 5CGMA 1QZ1A 1B4JL 2VDOL 5DC9B 3L95B 3SYPA 4E0RA 1CU4H 4GKZA 3FQNB 5F9DC 2E46A 3MXVH 2V5SA 3QZNA 4QRPB 2FJFB 4P59L 1EO8H 3HG1E 1NSNH 5EBMB 2BIIA 4A66A 5DJ6B 3ZTEA 4HOWA 1FG2B 1HCZA 4UV7L 4HG4J 5FYLE 1FVDA 4HWZB 3BESR 4N5EC 2RIKA 3FXIC 4XODA 2AV1B 3F7VA 4GAGL 4Z3IA 2CA3A 5K9QG 2EVGA 1JDCA 1WLHA 1X5IA 1GYCA 3DGCR 3C5ZA 3HLKA 1S9VA 3TA3B 3GYRA 1MCOL 1A7PH 4PS7A 2UWEA 4FFTA 2ADGA 5FGBA 5BW7C 3HB3C 1GPOH 1A6UL 4UZGA 4OIFA 3LZRA 1GYUA 1WZ1L 3GM0A 3GZQA 4P57B 3JUZA 3I6LE 3GSNH 3I9PA 4GIOA 4OIIL 1HXMA 4N68A 5D9SB 2Q10A 1VB9A 2W9EL 1BFVH 1OTTD 4KTDH 4PH8A 4NOBA 2OZNA 5I73C 3WFBH 1I9JL 1YEJL 3DIFA 8CGTA 5I19H 4NBZB 1J0ZA 1QI4A 1VPOH 5A7EA 3ZMRA 3ZTDC 3GMQB 3EDKA 2WLIA 3A47A 2OA9A 4R97C 5ENWA 1DQMH 1TXKA 3WNLA 2E27L 4XB8A 4JM4L 5DYOB 4TUKH 5E2WL 4Z0XA 2PPEA 2XKNA 4P0DA 2NW2B 1QSZA 4XNZC 3T2NH 1E67A 3FT4B 3AB0B 5GISH 1RPKA 3A21A 2DQIH 2PYED 3ISYA 4G6FB 1RJLA 4N2HA 3UTQB 5HVFB 4N8CL 2TSBA 4XXDB 1Q1PA 1U36A 3PWJA 3QQ9D 3QUMA 2JKTM 2YBRB 3S3SA 5KJ7E 1OCRB 1FO0A 4NNPL 5GRJH 1NCTA 2YPKA 2JKIS 5CIPB 2EVHA 1TTFA 2NY0D 1BEYL 4X7DC 4CMHB 3K6DA 3UAEA 4H2CA 5EOCJ 4BKSC 3BXNB 2ZG1A 3HG1D 4MJ5B 4W6XB 1FUNA 1EXUA 1IC5L 4M7JL 4ZXBB 2JWYA 1E28A 2ENYA 1PEZA 5JW4R 3ULVL 3OC8A 3STBA 1CXIA 2WCSA 5HYJB 5B3JE 2ZX7A 2Q76B 1LP9B 35C8H 3MRRB 3MRQA 4IM8A 2BIPA 4Z7QE 3DJRA 4JQXA 4S2SA 2D03L 3VCLA 1KJVB 5HDQL 5H8DA 1FO0H 4KAQL 2J1WA 4TLKA 3QIUD 5EWIL 4ESKA 4HT1H 1J05A 1JTTA 1YC7A 5L8LB 3UYPA 4M48L 4DPRA 4LK4A 3M7FB 5J9PB 4DK6A 1YN6B 4HSCX 5AL0A 1IL1A 1PU0A 4HIEB 1IEAB 2ARJB 3GMOB 3I6LD 1QSEA 3LKOA 1FHNA 3D0LA 3TH4T 4DEPC 4KJWC 1EZUA 1VGEH 2QQKL 3QS3A 2HJLA 2VLRB 2QADD 3LNDA 3LQZA 4PCYA 3MROB 5AKSA 5ECJE 2Z0BA 3QQ4A 3TCTA 1QLFB 1E40A 3KPQA 5TQ2H 1KPVB 2WLJA 4UIKH 1AO7D 4Y2LA 3F5WB 4MMXA 2G9KA 3B4NA 1WBZB 1CE6A 1HCYA 4XOAA 4CSTA 1BJ1J 2YKLH 3KXFB 3QXUA 2YUWA 3QS2A 4G72B 5ABZA 5FECA 2BHYA 3GO1H 4FG2A 3FC8A 3GFUA 3DBSA 4V2CB 3U2SB 1DJYA 2YOAA 2GBUA 4FXGB 1V05A 5A2FA 1ZLSL 1G84A 5KSBE 4DQAA 3T0EB 1QBLH 2N1KA 5GZNA 2VR3A 5I0YA 1MCWM 5DJZB 3LXUX 1DQIA 4R26H 2FJUB 3B3IB 3G04A 5IVZA 1NEZA 3VFSB 3PPSA 4Y5VC 5EIIG 4HHGA 2VITA 3S36H 1L7IL 5F1KC 4A6YL 1PZUB 4HW6A 3A67L 3LZQA 4I48A 5EBWB 3ZR6A 1OPOA 2ZYHA 1WRFA 3FU8A 1BMWA 3LMJL 1XR8A 1YJDC 4CADB 1ZDSA 4QCIA 4U6XB 4BRVA 1SY6A 1Q9LB 1A7QH 1EMTL 3VGFA 1KG0B 2WZPA 4EOWL 5CZKA 1LE5A 4CRPA 1P0SE 3T6QC 4AIZB 1KN2L 3W5NA 1I7TA 1Q1JL 4UMGA 1RFDH 1OARH 3KNBB 3MX0A 1FPTL 1RMFL 2PR9A 5AAMC 3OKEA 4N22A 2EIEA 5BS0B 4F9LA 2NT1A 2M26A 3QG7L 4K23H 4K0OA 6PCYA 4K3GA 2F74A 1P4LA 1R5VB 2OTWA 3IDYB 2IPTL 2I9LB 2R4RH 3DJTA 5F7FA 1M1XB 2BW5A 3IJEB 2WVVA 1CGUA 4Z78B 5CNHA 1BBJA 1VFAB 3U30C 4KJQD 3UGUA 1XXDC 4C59B 2ZWNA 3P9MA 1GAFL 4BCZA 4AENB 4FI6A 4O58L 3ARDB 4KPHL 4YDKL 4FYQA 1SN5A 2H41A 4M5TA 3IMVA 4QD2E 3DUUA 3W9DA 3LIZA 2B59A 3DA0A 2ZP0T 1T1WA 3C8KB 3SGJA 4LAQH 4ZW6A 3IGLA 2CDFB 4YBLC 1E8WA 4XMKH 3N41F 3PQYA 2K3TA 5LJYH 5JHDB 3ETSA 1MVFA 2AFNA 3OJDB 4FP8L 1M05B 2WWNA 3QG6A 2JKWA 1Z9LA 3QIWB 5SWQA 1TSHA 1A6TA 5CJQL 4JRLA 1C5CH 4IJ3C 2ZWSA 3KEHA 1IM3D 1M7DB 1UA6L 3MUJA 3WKQA 2FH6A 1BLIA 2D8KA 3DX7B 1XF4A 3HFML 5DF0A 4F9PA 4ZMPA 4J28A 2XLLA 4UDTB 2Y5TB 4PCKA 3OWEA 1NGPH 5IQ7L 3GLAA 4HUNB 4KWUA 3T8VA 3ARSA 4OGYH 3T2OA 5JOPE 1J11A 1BLNB 1ZHLB 3V6OA 2J4WH 2DYPA 5FCUH 3MV01 5E4AA 5LO7A 2FQFA 4HZ1A 3PJLA 4IGBD 5TQ0L 5DZPA 3VXME 4LSSH 4QLWA 1KT2A 2Y36H 3ZZ1A 5CU9A 5KG9B 1QLRB 3EBAA 4JHWL 3GRBA 1MCDA 4DP7X 1FGNH 3KPSD 2QVFB 4DHLA 4ABQA 1U95B 1JGVH 3CSFA 3GKWH 2VDLL 3Q8BA 1DUYB 4S11A 1PX4A 5EF0A 5D70H 5EUKB 1NC2D 4A7QA 3WIHL 5C0FB 3RWEA 4PGBA 1U3YA 1VA9A 1CFQB 4I9XA 5C0AA 2ZWYA 1RJYB 3O8XB 4DKEH 1C5DB 3NIDE 1QPPA 1JNJA 4PS8A 2ESVE 3P3TA 2A73A 3HE6A 3V6ZA 5HYQA 1U8NA 2CPUA 2IDTA 4HP5A 1F6AB 2XUWA 5KSAD 1D5MB 3QCUL 1QZNA 2D4FA 4JFPA 4YX2L 4OKDA 4U1LA 4Z7OF 2F1AA 4TSAH 5CLZA 1QRNB 1FF5A 1CR9H 1AGEB 4HJJL 3T65A 4DZ8A 4HS6A 1J8RA 2IAAC 4LKCB 1OCZB 3VXUE 4GBXC 2HT2C 3WDIA 4X0KA 3VXSB 5HHOA 2CMRL 4XMTA 5B39A 5JPNB 3QJRB 1E4HA 4XH2B 3LPFA 1F3JB 1NPJA 2VZ1A 4FXKA 4BCXA 3AVEA 4JZOB 2YN5A 4LOFA 2CXKA 4P3WA 3TO4C 4KK8C 1CF8H 2AKRB 3L6FB 3FU9A 1NMAL 32C2B 3N1GC 4TSBL 2AQ2A 2BXYA 4FGMA 5I2IA 3KLHD 1V7MH 2UXFA 1DBMH 5C6TH 4ZMWA 4ODWA 1U8QA 4G8GE 5JOPD 2WWMC 1IIIA 3WO4C 4FE9A 3MKKA 4HX1B 4EAEA 1RK1B 5IJKC 2R15A 2H6OA 3MTXA 4FL4C 1ZT7B 1H9VA 1S4IA 2ZCLL 4H20H 2PWGA 4QHNA 4Y2OA 3VXMD 5B38A 3ESUF 2Q87A 1XSJA 4PV9B 4QWWD 4UAOC 4D9RE 4P4KB 1JGLL 5BMFL 4NHUA 4GG8A 4TUJB 1I3GL 2I60L 3DX6A 5AW3B 3V4LA 4F1SA 5IK3B 2GJJA 3BGMA 1AY1L 5GJSL 1Y7VA 3ISWA 3NH7H 4QAMB 4M6MH 2ITCA 4YK4B 3BPOC 3GSVA 3ASWA 3IBEA 4KKCC 2F7IA 2QDVA 3M17B 2X4SA 5IBTH 5CEYB 1HQ4A 4NC1C 2LU7A 2WLYA 2CR6A 3K2IA 2EXYC 1KTLB 3CTTA 1UOLA 3UYRL 1MHHB 1LO4L 4WO4A 4ZK8A 4HH9B 3HAEA 3D8MA 3RFZB 3HW7A 1FV1B 3MLZH 1GS6X 1WFTA 3SDYL 4HFWB 2WK2A 1TJGL 4MBOA 1FFPA 1JN6A 4HHAB 4HKXB 2V9TA 1CQKA 4G6JH 4MXQC 4L3CB 1B6UA 2XWDA 3AITA 3EG9B 3MJ7B 4BCYA 4U6VH 1Y6KR 3PGFH 1CBVL 5A6MA 4GSDH 3HZKB 4QOKD 1ZRUA 3T1FB 3AWFA 3P4LA 4WHTA 4UBDD 3RDTA 4NNXA 3ZVVA 1S3KL 4BV1A 3WNIA 4FNPA 1J8HB 1TEGA 4X4KA 1JWSB 5JORB 3SE4A 1U4FA 4KHXL 1SMOA 4A39A 3A5VA 4Y5YC 1NFIB 4LRNL 1BBDL 4XPAL 4MA3A 3VWJD 3OXSB 2OSXA 2NXYC 5DO2D 5DJAA 2XWXA 3CMOL 2OMUB 4QTFA 4QIRA 4RMWA 2LABA 3CGTA 4M1GL 2B3RA 1XB3A 4HH8A 4Y9GA 2AK4B 5C9JA 3MRJB 1U8JB 2C3VA 5T1LD 3TF4A 2NY1C 4F27A 4QTIH 3AGVA 4Y4HC 3BH9B 4DSYA 3GSQA 4FG6D 4OM0L 1JZEA 5I1DB 3VJ6A 3NACL 3MBEB 1FFOA 2VXTH 2WZ6A 3WUWG 3WKNA 4TKWA 1KIRA 2CK0L 2FB4L 3PP3K 1I1AC 2HRPL 2JJTC 3WY4A 4XXCA 4Q9QH 2G4EA 4OCXH 1CTMA 1MAML 3VSQA 3K1DA 4LU5H 3QORC 5HSFA 3WSQH 4X4YB 3ZX1A 3QULB 2FR4A 1G94A 1X5FA 3NUKA 3TIDB 4PJBF 1KEGL 4GKLA 2ERJB 3IB4A 1E4XL 2JCCE 3SDDA 1DN2A 4NQDE 1SDDB 1OGAE 3QFJA 4B0MM 5AVWB 5CMAA 1SDYA 4FFYH 3V10A 4ELMF 5L2KA 4WRLA 5HGHA 1GC1L 1RIHH 4XTRC 5ALCL 4XWOD 3DLQR 3I3DA 5D7IF 5F1NA 5CJOH 1NPUA 3T4YA 5LCVH 4EN3C 1FNSH 4S1DC 2YA0A 4PJ7A 3DBXA 4AJYV 2GITB 4S1RH 3DKHA 4LCWD 1QVOB 1C7SA 4LSPH 5KW9H 1OE1A 1K8DA 4NUJA 2V7HA 4NRZB 3KWUA 5KANI 1UFUA 3WJLA 2LFGA 4JO3L 3HMWH 4OGXH 1SJEB 2NY4B 4DP5X 5T33L 4M61A 5GJTL 5IHUL 5JW5A 3BJLA 2Q3AA 4K55A 2BC4B 4WV1B 3V7AG 1OB1A 3WFZA 2HX8A 1BVKB 1THAA 3BQUA 3ASOB 5AYQA 3T0AA 4DEWA 3L3IB 3EFOB 4NNYB 4KXZH 2PW2A 1S7VA 1L0XA 4YHLL 3P3YA 2QTEA 4TNVK 1LMIA 2G5BB 3H9SA 2NLJB 1HEZA 5F7AA 3IK2A 2HMIC 1PNCA 1CDIA 3EYOA 2OZ4A 5HD8C 3WS6C 2J21A 2KDYA 2DLEA 1WAAF 4LXFA 4J4PD 4E9WA 3PUCA 4KO5A 2XG5A 3SPJA 2HZHA 4XX1G 4ICWA 2RQEA 3CDZB 3KDMB 4RAUB 5BV7H 2D0HA 3G3LA 3ATFA 3JWDC 3OXRA 4QUOA 5DSCB 2JQMA 3QAZB 2AQNA 4J1UB 3UTSB 3ZKMC 3G08A 2KYIA 1IZJA 2EO9A 3HKFA 3CDCA 3OZ9L 4MQXD 1IQWL 5AVSB 3UERA 2VDQL 3PXJA 3VFOA 3ZE1F 1A64A 2JSFA 5HDOA 2CJSA 1BIHA 4GQZA 3VFVA 1U6AH 3PL6B 4KKQA 1JVLA 1XF2B 4H0GA 1T7VA 2XIDA 1I9IH 1OOAA 4MNQB 4IIQC 5D1QC 4PJHE 3E8VA 5LXVA 1RP8A 1HH9A 3FHQA 4N28A 2EO7A 2UUDK 1DVSA 3MRKA 3O2VL 5C0BA 2L7UA 3BAXA 2J71A 1OGAD 5DDHA 1JXJA 2VDKH 1TYJA 1XXFC 3HG0A 3C6LC 1ZHBA 1YMHB 2GPZA 2P8LA 3P2TA 5FR3A 4PN6A 1RURH 1XX9C 4D9LL 3MRHA 3UDWA 2AEIT 1JI2A 3OLEA 3DUSB 3KLQA 3OHXB 1MLBB 4WUKH 4OFQA 4B96A 5IVOA 3WAJA 4NRYB 5IW3A 2J57A 2JK5A 4MQ7B 1GCYA 3FTSA 2ZOLB 4U1IB 5DUPL 3SHSA 3V0GA 3SJVA 5TF1L 4HQQH 2A6IA 2NY3D 2AJSH 4QF1A 3IXAB 4APXB 3BAEL 2UZIH 4GAYB 1VRSA 2BVEA 4RQQA 1D9KB 3DTXA 2V9UA 1QFUL 1HZHL 1R3IH 4PRIA 3LJ3A 4B9YA 3CHOA 4IMKC 4FZ8H 2NZ9C 5CZXD 3OPZH 4YIQB 3UACA 5DLLA 3V0JA 4QTHB 2XYBA 4RMRA 4UILH 1RAMA 3DPBB 1N2RA 3NZSA 3MTRA 3QR0A 1UB5B 2E6JA 2WCPA 1MFAH 1GOHA 4TULH 4CU6A 1PPIA 3DO7B 4JG0H 2YPLE 4WU7B 2FGWL 3DURA 4ZTEA 3WD5H 1ID2A 4R4NC 3BP5B 4OJEH 5I1JH 1YEGH 1Z66A 1FI8C 5EU4B 3ILPB 2EIMB 4U6HB 2CM6A 4DN3L 2VDQB 4LSDA 4I9WE 2F5AH 4G1EA 3D08A 3KPRA 3V5KA 4Y4KB 1CZ8L 1F4HA 4AEEA 4U1KA 3G5WA 1ZGLM 3GD1C 5F1OB 1F90H 1EDYA 3P73A 1KDIA 3PF2A 2ICWI 5D7HA 2KDGA 5JLZB 2XT1B 2B5IC 2XDHA 4LKXA 1L9PA 3T5WA 3L3JB 1COBA 4Q0XH 4HU8A 2B1AL 1P7KA 1AG6A 4N6RB 3HE7D 3SKOA 4R0LA 3MGAA 1RQ5A 3X17A 5DMKA 1XGQB 2DQTH 1TVBA 4G1MB 4Z23A 5IVXA 5EF1A 4UQ3B 3HCVB 3KWXA 4HCRH 1W0VA 1KLUB 2X6AA 4R7LA 1T5XA 2H3KA 4JQIH 2EUXA 1RZGB 1RUAL 4IMLB 3VMOA 1YY8B 1D5IH 4IRSD 5T3ZD 1CDGA 2GJ6A 2BHUA 5F7WC 2NY2B 1Q9WB 5LGHL 1ZE3C 3GJEB 5I82A 3BKCH 1GMIA 3U9PH 4DJMA 1J8KA 3L3HA 4U0RC 4UINL 1KF9B 2H2SD 1U8KA 3U4BL 3PNWA 1LDPL 1NA8A 2X4QA 3DJ9A 3F7YB 4NAJA 4AG4L 3BN3B 4RX4D 4WSJA 4EJ1C 5AAWC 2H6UA 3Q8EA 4ZDHB 5K33A 3JUYA 4P46D 4UQCA 3ABKB 3KPLB 3PWUB 4NCC2 5AVQB 1IB5A 3IAGC 3UJJH 1DVFC 2P47B 3ENEA 4BK4A 3B5GA 4R7XA 3G6JE 4L29A 4PG9A 2BIOA 4OD1L 3UO8B 1CGWA 1KB5A 4Z7UA 1FFTB 4I9WD 4PLNC 2VLJE 2HG5A 1I8IB 1WO2A 1UH4A 1W15A 3H9HA 3WMQA 4QRPE 2QHLA 3W9EA 3X1NA 3QDJA 3IVKA 3CNKA 5LG1A 1YUHA 2QPDB 3D12B 4FNLH 4ZUTA 4BXVA 3K71B 3ZYJA 4GQRA 3V6FB 1RPQA 2I9TB 5IQMA 2J8OA 3BFOA 3BUPA 5D71L 5E6IA 3WS3B 4F37F 3S9DB 4KROD 4HJGB 4QHLA 3AUWB 4PS4L 1NMBL 4LL9A 1UWYA 3KPTA 1KB5H 4PTUB 4RA0C 1OSZA 4XNUH 3E6HA 1OD9A 5FHBH 3TT3H 1GA2A 5CCKL 1V3JA 1ZLWK 5JIPA 1KCSH 3QIBA 5A40E 1K5NB 4KOCA 4DP0X 5SWSB 1OSEA 1YPZB 3IFOA 4TPRH 4IRJA 1K4DB 1RHHB 3AXHA 2JIXB 5ILTH 1ONQB 5AZUA 2V2WB 3ZSTA 2KLTA 4PPTA 3TCXA 2BY3A 3VI3F 2AVFA 1WIOA 3BP6A 3T4AA 1QTYT 3S7GA 3RZCA 2F53A 4ZMLA 1RKRA 1DQTA 1W8EA 3FZUD 3QR1A 5CZRA 3ARBC 1FNGA 3CC1A 3DSFL 3EGXA 2JB6B 3ME0B 5IMMA 1KGWA 2WVSA 2FIRT 1NIFA 4AGPA 1DYZA 5IOPB 1N5AB 5IF0A 4GUPB 3TBYA 4CMMB 1AGFA 3D4CA 3ULUH 4EI0A 2AK1L 2P1YA 2FWLB 4YOKA 3X1GA 1T04A 2BZDA 3QZWB 3N04A 2GTZA 5EIIB 3MLTB 5G4MA 3PWPE 5C09B 3HMXH 2OTUB 4D7PA 4FNTA 1H9DA 1S78D 2W07B 2E4TA 2Z91B 2DS4A 4PJ8B 1J1XL 4G7RB 1FNEA 2VLJD 4HFUH 1G1OA 4HEME 4I5BB 2V3DA 1P5UB 4J2QA 4LASH 2DQEL 1P84K 4QRPD 4ZPTB 1HXYA 1RSFA 4BUHA 3CVHA 5AW7B 1A2YA 3QQ3B 1IC4H 4M62L 4DGYH 3VI4B 1MIMH 1CE1H 2XN9B 1Y1DA 3V0WH 3QH3A 3RVTD 4EE2A 2H0PA 3RVXC 3GXNA 1DZ0A 1TZHB 2BWQA 4O2CA 5SX5H 1XCXA 3TA3D 3MKGA 5FKPB 4J3OD 4R2GB 2WTRB 2XTJC 4MCZA 3AU0A 4AVIA 4MAYA 1WCBA 1NGXA 3L8QA 4XNXL 5SWZB 5E9NA 1G7QA 4PV8B 1NAMH 4AMKH 5FYKE 1FRGL 1A3LH 3EYUH 1BZ9A 2LR4A 1C08B 3GMMA 2QFPA 3A4AA 1H3PL 1M9SA 1I7ZB 2MCPL 5IEKB 1OAZL 3LV3B 3IMRA 1FL3A 3CFDB 3HVNA 3MOBL 3VUAA 4CGTA 1RZJL 3ULVC 1IFGA 2VLRE 4OY9A 4XMUA 4TOYH 1KCWA 4FRWA 3O9WB 3ZDZB 1CTNA 1DDHA 4JFUA 1Q0EA 1AANA 4H26B 4N3TA 4AKPA 1VDGA 3VRJA 1IAIM 4ETQB 4JY4B 4UB0L 1ZV9A 4QRUA 4B9CA 1C8PA 4ZODA 4X9HA 1BIIA 5T3XH 2RAMA 1WS7A 2J6EL 4G6FD 3SCMB 1YN7B 2WAHA 3ULVF 1CLYL 4PJGA 3FTZA 2VISA 4N2GA 2E7HA 3EDJA 4HD9A 4ZTOH 1AKJA 5DHMC 3VGGA 5I17A 3VWKC 4JCWA 1HI6A 4WEBH 2YEVB 4OBRA 1YQVH 1JK8A 3FTXA 1KTCA 4GAJH 3T0EE 1OE2A 4M6OH 3V4PL 2WPGA 2J1ZA 2BVPA 3EF4A 4KQ3L 4FJZA 4OJCA 4TUOB 2F7QA 1DE4A 1EA9C 3EH3B 4AE1A 1INEL 4LLVB 1BZ7A 1GIGL 5HYJD 2R0KL 4I18A 4R8WH 3B9KB 4G83A 4YHOL 1MHCB 4ZFOB 1IBGH 2VTFA 4ZOEA 4BQCA 1ORQB 1INDH 3OJ2C 1NCAL 1BD2A 5C2BL 1AJ7L 4Y2DB 2MCG1 1JZ6A 5A43C 1KCRH 4X4XB 2EDFA 3EO9L 1HIML 2N01B 4P2QB 5FYKD 2R4SL 4FFVC 3LB6D 5DEFB 2VRQA 4QPEA 3CLEH 4QYOA 3PWVB 1S7WB 4UT9A 4ABWA 3F12B 5BS0E 2HYMA 1U8LB 2HH0H 1UCTA 4LNRB 2VLRD 2R1XB 1MREL 1ZEAL 3T6VA 5E2TH 4QGTA 4TLSA 3GEWB 5GS0C 1J0KA 3H0TB 5I76A 4AI7A 4G9FB 4HKZB 1MIEH 4LGRB 5J3HC 2ZYIA 4FQ2H 4L8DB 3QEQB 1TVDA 4JS7A 1OALA 5I1AA 1TLMA 5AAPA 2EYTB 5KEZA 1R0AH 3GHEL 5AVXB 4LL1A 3VE0B 4BQ6A 2H0EA 2CGRL 4YDMA 3H8NA 4LOUD 1BQRA 4UT9H 2IALB 4E41A 1EHKB 3Q8CA 4PJAB 2HFEA 3D07A 1M7UA 2NY5H 1QHPA 3O45A 3D3VA 15C8H 1E5BA 4GEIA 3CSPA 4OLVH 5JHDE 4AEHH 1U8PB 3ILDA 4NKMB 3T0ED 2ZP9A 2DTML 3R0MA 3FB6B 1NFDA 2VR7A 2ARWA 5F93C 4XNDA 2O5YH 2FIKA 2OL3L 3GSWB 5E7FA 1JGEA 3UPCA 4KRLB 3VFGL 3D50A 5E8EA 1WDAA 5CHNB 1JZ8A 1JHTA 1RY7B 2IDCA 3MPCA 1MI5A 1KC5H 4PJIA 4OZIF 1FVEB 1RZFH 1P84J 2WO3B 2FUTA 4JHZA 3X11B 1INQB 3FRUB 3DXAA 1SYSA 4WKZA 1W72A 5HDBB 1IGFL 4U0QB 1ZWIA 1UT1A 3QPQD 3IDJA 1F8TL 4LVOC 4MS8D 3PGCB 2B08A 1KGCE 2VC2B 3G5XB 1RIVH 5T5FA 5K9OB 5FDYA 4LLUA 4HF5L 1K8IB 4L9DA 4WGVB 3ZT5A 1IEBB 1DBBH 4LQFH 4ZTPL 3PS6A 4Z9KB 5BS0D 1WZMA 2XZCL 3DETC 4L1BA 1OW0A 4NO3A 4DKFL 2PCXA 4I0KA 2P5WA 3PLYA 4G6ML 2V7NA 3VMPA 1A6ZA 2DL9A 2E3VA 1VEOA 4KI1A 4OQTH 3RWFB 3SE9H 5JHLA 1XFPA 2P80A 4ACPA 2JKXA 5CSGA 2ALAA 3QZOA 1IILE 5LQBL 1KXVC 3B43A 3JWNH 5EZIH 4PR5A 1NDMA 5E8OB 4LHJB 1R5WA 5JDSA 5K39B 3ARDD 2PO6C 1TVHB 3L1OL 1I7UA 5B39G 5C0EA 3KBFA 5MENB 4DF9A 2GABA 5MI0B 4Z3GA 1P6FA 1KJMA 3QHZH 2JH2A 4OM1H 5E5LA 5EC2A 3ZXAC 4KJYB 4Y1AA 2EVFA 1I1FA 1DFBH 3R8QA 2BOCB 5E2UL 1QRNE 4BFRA 1EXHA 3HI5L 2ARJQ 2R0ZH 3RJDA 1E9PA 4E5XA 3TT1L 5JHDD 1OAJA 4AGQA 5BUAA 3OKMA 1WBXB 1UYWH 1YMMB 3Q2NA 4N0CC 3QIWD 5FO7A 3VXSE 2CHXA 1H8NA 2YQ2A 3DJZA 1BZDA 5DS2A 5HGDA 1TMCB 3NA9L 4NWUH 3RWCB 4CNIB 1PZ5B 3EXJA 1C12B 1R3LA 2YRBA 3GI9L 4UM9B 5B38G 5I26A 3VG9C 3RWJA 3TVMB 1Q9OA 4X6CB 1XIWD 2ZJSL 5INCA 3RWIB 3OR7B 4LCYB 3UPAA 3SD2A 3PV7A 4XGZA 3SDXB 4AYID 2A2QT 3BMWA 2WMPB 2VWEE 3NJGA 2X9XA 2CGZA 3EYVA 1NCCH 1CFBA 2EABA 1KGCD 2IH1B 3BO8A 3UP1A 2P8MB 2FL5A 3QWOB 3J2PA 4DO6A 4XBGB 4DP8X 4ZUVB 5E9DB 4MRBA 1AIFB 3S5LB 5DK2B 5AVUB 4APQC 2YD0A 3KDPB 1AE6L 2PWEA 5M7QA 4ORGB 2IQ9H 3BT2H 1S5IL 2OSYA 1SN0A 3HAEG 4B6ZA 1QR1B 5EU6E 1IVTA 1NWOA 1NC4B 2HVKB 3ARZA 3CFNA 3FSZA 1S7TA 2YAOA 3DYOA 3F05A 3Q9PA 3UCRA 3RUGF 1YYML 2V2XB 3ZLQC 2WXPA 2QGBA 2Q9OA 4TQIA 1AMXA 2HAZA 1G9EA 4YEFA 4UQ9A 1S9YA 3O8XD 5ETUA 5E5UB 2FX7L 4OZFB 1JHKH 1EDQA 1MW1A 3GBLA 3N0PB 3VG0L 5F44A 3MGOA 4FLRA 4ZT1A 1WAPA 3UJIL 1E9QB 1ADQA 4J7RA 5AD0A 2YZ1A 1OTTC 1U21A 4IOIA 4Z8FL 4K5PA 2EH7H 1QRND 3RPBA 3SODB 4PJCA 5DUJA 5I1KH 1UASA 1RJCA 3C5JB 5KOMC 5JQ6H 1YEKH 1IJ9A 2DAVA 3HUJE 1PAZA 3VXSD 5HHNB 5BW7A 1S5HA 4LIQL 4K9EL 3U7YH 2X41A 3PHAA 5ERWA 3F65A 1Y18B 5I1EL 3FO1B 1NTDA 4RRPG 1G9NL 3G7TA 2DQUH 3IU4H 5E9AA 1PX3A 1FLRH 4B41A 5HI5C 2HT3D 4WVRA 2ZTBA 2DQ6A 2R0WL 2EJ1A 3QQ9C 3LH9A 5EC1B 4BZ1A 5DHYB 2R2HA 4QRRE 1OWRM 3C8HA 3FUJA 4NGHH 4WJKB 2ED6A 3LKSB 5DCCA 3U0TA 1F0LA 3QDMB 4FQ1H 2G3NA 3N1FC 4I77H 5GRXG 3T1WA 2WUBL 4GY4A 1RULL 3FCSB 3IDMB 2K1MA 3AUVA 1DQVA 2AK4E 4UQAA 4ALAH 4P4KD 1A8JH 3U6XS 5JO5B 1QACA 4JN1L 4B53A 3LPPA 4K3DL 5CJ8A 1KENH 5PCYA 4YN3A 1UD8A 3BDYH 2BPBA 5T1JA 1KPUA 1T20A 2ZXCA 3L54A 1L9NA 5CGYD 4EUPH 4KITB 3VFWA 1MEXL 3PWLB 4DN4L 1OOWA 4RWYH 1YCSA 5DURD 3QIUC 4HKJB 1EEYA 1SFDA 3EJYD 4KKBD 2HRGA 3MNVA 2ZXWB 1N0XH 2Y07H 4JRYA 3PAYA 1IAMA 4NLAA 2FATL 3MRCA 5D55A 2VUYA 4MSWA 3KPOB 3JTSB 3SPIA 2A4CA 2VAJA 4XAKD 3SQBA 4AGLA 3M88A 4LCVA 4X5WB 3QCVH 1U8MB 4K71B 3U46B 4HJIA 4LBEA 5DHVA 1F6FB 1RVFH 4J39A 3BZFA 4Q56A 2QADC 3V4VH 3VTAA 5DQJB 4CSPA 3D85B 4LPCA 1BX2B 4V1DA 1CU4L 2Y6TE 5EO0A 5EOTB 1GMEA 3BPCA 5E6SB 3RL2A 3MXVL 3SDAC 1MJ8L 5KSUA 3U48A 3AAZB 3TASA 2BS9A 1YDPB 1NSNL 2ZKWA 2ZOTA 3MREA 4KNSA 4M4RB 4ZUSA 1BWMA 2Z93A 5KYWA 5G5DA 4BFNA 2CHDA 1T2QL 4PGCB 3RAJL 3U36A 3ZTJH 3GSUB 3KYOA 2C3XA 1HWGB 4PJ9C 4XNQA 4TVSa 3ZYZA 1A7PL 4L3EB 5FYKU 5BXFB 4NX0A 3RX9A 3MOQA 4JBSA 3U0PB 1FORH 4L0YA 3WL9A 5F96H 2AK4D 3F2LA 4O51A 5I0XA 4RNRA 1DL7L 1NQBA 1KTDA 2H9GA 4YL9A 4N86A 3E1ZA 3K72B 3EO1A 5D72H 5I1LB 3W5MA 1BFVL 1GGIH 5J13B 4X5RA 4A2MA 3HG5A 4M6NH 3CSGA 5CSZA 5I19L 5DGRA 1OAUH 1VPOL 4X5XA 4HWBA 2Z35B 4AT6A 3IXTB 3MBED 1EEZB 2VZUA 4L1SA 3C9NB 2O6EA 3H4HA 4NIYE 2OMTB 3FQ2A 1H3XA 5IWLC 5B1KA 4L8BA 3T2NL 4AQAB 5JNYA 4FKKA 1F02I 1D5ZB 4Y5VA 1AD9A 3UZVB 3UZQA 2AABL 1GKOA 5CWSB 5B3JF 3QAQA 3TYGL 2Z31C 4MVBC 1TMQA 4IK7A 4EI5B 3CG8A 3FL7A 4HXBH 2BP3A 4Z7QF 3FQTB 4P2AA 5GRJL 2KS0A 3SSGA 3VXOA 1MUJA 3MLXL 2Z65C 1OAQH 2CKBH 4M7LL 4FQQB 1CFSB 1Q94A 2Y1AA 3BPNC 3VO0A 2I85A 4KJQC 3JWOC 3QZLA 4AGOA 3NT0A 1CC3A 1DEEB 3Q2VA 4HLZG 1TT6A 4H44C 3EFDH 3G9VA 3O3EB 5AAMA 3P3SA 4JPIA 1MRCH 3B7YA 2E59A 3AU1B 1HE7A 2FHFA 35C8L 1ZHNB 1UB6A 3QUML 3BCFA 2NY4D 3N40P 1FO0L 2YAFA 4N0YH 5E8PA 4BA8A 4NUQA 1E2VA 4W81A 2P28B 4HJUA 3KBHE 3FUFA 3FT1A 2R1WA 1TSRA 2G5UA 2XBZA 3PXHA 3FS9A 5HJBA 1FNAA 3BE1H 4NHCL 1WC7A 3GSRB 3OB0H 5L4FA 3OGCB 3ZBMA 3KL5A 1P1ZA 4GKZB 1NBVH 1CD9B 1VGEL 3MN8A 1T0OA 2SODB 4DKAA 3RBGA 1VCBC 3V0VB 4DFIA 4RFEA 3DDGA 1R9FA 1KEMH 2HFTA 1CO1A 1CICB 5IQOA 1BQLH 5KSBF 1FVDB 2YXMA 1VGKB 3F7VB 4WNQA 2V9RA 2VDPH 4AYBA 2M1KA 4IGBC 1EZSA 3C5ZB 3PL6D 4OFYA 1S9VB 1RU9L 4KX8A 2YKLL 4NKOB 1TITA 3L16A 3ZDXE 5BO0D 2ADGB 3BKJL 1G0DA 5C86A 1DQJA 4BSVA 5J12B 3TBBA 5JXED 5ISZE 4B0MB 1J9RA 1O6VA 3NVQA 1N64L 4B7IA 2GVYA 5GRWA 1QBLL 1AQHA 3NPSB 3FSVA 2Q7AA 1BF2A 2EXWD 3ZIMA 3I02A 2Y0SA 4R5VA 1K85A 2B1HH 2WLIB 5ENWB 3GM8A 5HP5A 3S3CB 5C97A 4KGLA 1UZ8A 1DDTA 1VSCA 5HDLA 5DS8B 1J18A 4MDIA 2ZP8A 3RZWA 3HR6A 2QKIB 4UTAH 4XB3A 1CDYA 1LVEA 2WBWB 3D1MC 1SYVA 3G6DH 1RJLB 3LKNA 1A7QL 3RJOA 3FUMA 4NZRH 3UEZA 4JGJA 5I18H 3ZRFC 4XC3L 3QUMB 4QXUH 4GMSH 1D9KD 1P5VA 4FS0A 3IJSA 1U58A 2LTQC 5E56A 3V8OA 1OARL 1H6FA 1J8SA 5EHFA 2YPKB 3LKRA 1LNUA 3N9GL 3ZIYA 4TNEA 1KELH 4KUCD 4G6KH 5DT1H 1SQ2N 1BAFH 3LRSB 3KLHC 4UOW1 3QQXA 2NYZA 5E00B 1KLGA 3QJOA 2XVBA 1EXUB 4JRXB 4OZGE 4X7CC 1E28B 1Z3RA 2Z4TA 4JO2L 5E6RB 3ET9F 4JLRA 1SY6L 3FT2A 1PJ9A 3LN9A 4GBXA 4L9LB 3MRQB 4KZ0A 5AG9A 3E9UA 1G9ML 2FNBA 4I1PA 4S2SB 3VCLB 5L7XL 2O6PA 3EIFA 4XP5L 5FXCH 6FABL 2H1PL 3TO4A 4C56A 1J05B 4H4NA 3VTMA 4ZNEE 3UBHA 3UYPB 5IP4A 3MZGB 5ISZD 3CIQA 3H56A 5JUEL 1IL1B 3AM8C 3QXAA 4LSTH 4N6QA 4MD4A 4Y4KD 1QSEB 3LKOB 3D0LB 1PLAA 4F15C 3OAZH 1LD9A 1S7XA 3HRZC 5IJKA 1KGXA 3US9A 3LDBC 4CKQA 3ZE0B 3QQ4B 1SBBA 1OIOA 1SM3H 5KJRL 5KTEH 4L2YA 3NN8A 4MMXB 1JPTL 5HDRA 4UTBA 3LIZL 1NGPL 3KBEA 2ROYA 4NUPA 1NIAA 4N90D 3K6IA 1M3JA 5J5EA 1CE6B 1R3KA 1G7PA 2BFGA 4PJFF 2ZOOA 5CXPA 1KFGA 2NX5E 1MHPH 4OGYL 2HFGL 2BINA 4XN9A 4Y19A 5CM1A 3EH5B 5FECB 5FCUL 1YPZE 4J3BA 2FO8A 3ABLB 4YZWA 1PEWA 3TONA 5C0IA 5C7XL 2HVBA 3OR6A 5DFTA 2X42A 4BK5C 4V33A 1ACYL 4NENB 3ZHNA 1WFIA 4LSSL 3NIDF 2NY2D 1MCLA 1LE9B 4DVBA 3CFMA 1CD1A 2XC8A 1N4XH 3MLRL 4UBDC 3DROB 5B4MD 5F89A 1FGNL 3QA3A 4QMEA 1PZ2A 3G04B 5IVZB 1NEZB 1K3ZA 3QJTB 2NSXA 2VITB 4X6EA 1J5OH 5ITBH 4LLMA 1WV7T 2BVOA 3V95A 3VWJC 3T3PB 4AV4A 3HNTH 1A7RL 1R33A 4DKEL 2WQVA 2MH4A 5DRWA 4QCIB 5GGVH 2ICWB 5JTWA 2VDNB 1UWGL 2C4FU 2B3IA 2P5EA 1S9WB 3BWSA 1SHWA 1SXBA 1ZCRA 3H9ZA 4X6DA 5E8NA 3ZE2E 1LE5B 2J25A 4XN7A 4XXWC 2CHNA 1I7TB 4N2DA 4NN5B 4MMYA 5DEGA 5AB0A 2DH3A 1ZGLB 1PZDA 3MX0B 4Y5YA 3TZVB 5C3TA 4FG6C 2CO6B 3KR3L 5K69A 1XF5B 4BWWA 4JFTA 5D7LA 2H45A 4JHAH 2F74B 1P4LB 4BIKA 3D51A 3W3BA 3VI4E 2MHAB 5EORH 1YO4A 4QO1B 2EDOA 1BXXA 3FU6A 3N44F 1TJHH 5EOQH 2WVVB 1OP4A 1I3VA 3OF6D 3J07A 1BBJB 5BRZA 1RZKC 1V7ML 5AVYB 2YO3A 4JDEA 5C6TL 4UQDA 4HUVB 2YMTA 4H8WH 4WGKA 4PJBA 2MPAH 4Y4HA 1BM7A 3AWEA 3DX9A 3MDJA 4MD0A 4RSVA 5LBGA 4JG1H 5SWSD 2APXA 2B59B 1U3ZA 4PY7A 1HEHC 1T1WB 1PZAA 4ELMA 5CP3H 5D96B 4JFWA 1J7VR 4OCRH 4XWOC 2DM4A 1JXKA 1I1AA 1QR4A 3GTNA 2JJTA 3OD3A 1O7SA 4MNGA 4LSUH 2EP6A 4K5LA 5F6HJ 2Z4QA 2IDQA 3QG6B 4UU9A 3QORA 3WDJA 2AXHA 5C0NC 1EFXD 1AZVA 4P9HC 1A6TB 1AD0A 2WQ8A 5J57B 1Z0MA 3C6SA 3NH7L 3BZ5A 4XPGL 1XF4B 4X80L 2R0LL 4RMUA 1M71A 4ODHH 2VCOA 3KBPA 5F7BA 3SE6A 5E24E 5IBTL 3KS0J 2WXNA 2K9FB 3Q06A 5GS2H 1W16A 9CGTA 4BINA 4JKKA 3R4DA 2R9HD 1R5IA 3BW9B 1TFPA 2DQDL 1Q4NX 2C9XA 4EN3A 5BRPA 4BKLA 3OJMB 1YEHH 2WANA 4M00A 4G9DB 3KLAA 3RTLA 5C09D 3NAAH 2E7BA 3OMAB 4PJ8D 5AEAA 3V0FA 3AMKA 1KT2B 2XA8L 2X1WL 3G9AB 4S1QH 3RB5A 5AW1B 4WKXA 1H5BC 3FMGH 3UABA 4WDIA 4NN7B 3JQOB 1KULA 2AQTA 4LHUA 4FHJA 5GGSA 3FRPB 4GSDL 4I87A 2WBXA 2WNWA 1S7SA 2XN9D 4K8RD 1X4ZA 1YNTB 2HT4D 1E50A 3BSZA 2UV3A 1JRHI 3F7QA 4P2RA 3WNOA 2FGZA 3V79C 4PGBB 3LNFA 3PAVA 3TEXA 3WTVA 4IBTA 2V33A 2PWFA 2F08A 3WS6A 5SX5K 1OCWL 1F41A 4YLBA 4BA0A 4R2GD 1FGVL 2A73B 2WZAA 3HE6B 3IEAA 3BOVA 5HYQB 4DAGH 1U8NB 2UVFA 5SWZD 3U1PA 4P5MA 43C9A 2SEBB 2FQEA 2Q8BH 1MWOA 2G75A 4JFPB 3VNZA 4U1LB 4ODUA 4M4PA 4KVCH 5J7CC 1MVUA 2X53A 3GBNH 1IAIL 1MRFH 3CFQA 3Q43A 4DZ8B 3AXLB 5E99H 2XXCB 1EHXA 4NO0A 3ATEA 5HHOB 5B39B 2MPVA 3O9WD 4IIQA 5D1QA 3MLYH 4KXCA 5C0CA 2QBWA 3EYFB 3O0LA 3MZTA 2JCCF 1VACA 1Q8MA 2RA1A 2DDQL 2VXTL 2NY3C 4HIJA 5I2IB 2C4FT 5MEOA 5DJCA 5T3XE 2WWKT 3C6LA 4G7SB 3RIAK 3MBXL 4ODWB 4Q9QL 3SCMD 2O5XL 1HSBA 1RUKH 1QFWM 3OLDA 4OCXL 5F9OH 2C1OA 1DP0A 5EZLA 2FYVA 3WSQL 3ML8A 5DWUL 3KVPA 4KC3B 4QHNB 2UVEA 2P44B 3QC6X 4QI3A 2A74C 5CLXA 5KYUB 1JZJA 2YC1B 4NHUB 4ZD3H 4GG8B 3BISA 1IUZA 2CK2A 3KPMB 1T89C 3DX6B 2Q7YA 3O6FD 4ANWA 3FCBA 4BRJA 1RIHL 3QNZA 3BVWA 2JJVA 3BGMB 2D0FA 4NT6B 5CJOL 3D0VA 3X1EA 4OB5H 2D73A 2QQNH 4RGMB 1FNHA 3EXLA 4HJ0D 5T1MA 2CNZA 2E75C 4S1RL 3AREC 3ARUA 4XAWH 3GJFA 1HDMA 5SX4I 3B9KD 4IMKA 2H2PD 5DMIH 1LGVA 2HLFC 2R7EA 5IB1A 1BXUA 1WT5C 4WO4B 2YK1H 3HMWL 5KAQF 3E9TA 3HAEB 2N0MA 4HMEA 4Y2DD 1IRAY 5TFSH 1QFHA 4F7TB 5DD1H 4XWGH 4P2QD 4U1MA 1J1PH 3N3EA 3QWQB 3RLSA 4UZSA 2EDLA 4JFFA 1KYOK 1AG0A 4BDVA 1G6RA 1KCVL 2E9GA 3MV7A 2EUWA 3K2UH 1PD1A 1MFBH 3HE7C 1XT5A 4PJHF 4YR6A 3V5HA 5E03A 4UV4L 1HT6A 4N0UA 2Y7MA 4NQCA 1B2YA 2IBBA 4G9FD 5DD6A 1PNDA 1MVYA 2A9CA 1QUNA 3X14B 4NIKB 2J56A 1X9UA 3ETTA 3MO1A 5DRXB 5T3XD 3QJZA 1BREA 5MENE 2D7PA 3MCG1 1QATA 4DH2A 5DQ9A 1U6AL 5JHAA 4QY8B 3P54A 1YYCA 2CPCA 1G6RH 3S96A 2BVTA 1I9EA 5DJAB 1KTKE 5CBAA 1OGPA 2H2SC 1VESA 2K4AA 4NM4H 1P69B 5JIMA 5T1KB 1V3MA 1UM5H 3VXNB 3FQ1A 1YMME 4HAGA 5C9JB 3CZEA 2C3VB 4NUMA 2VDKL 1XVSA 4P46C 2R8SH 2IG2H 2AERT 4HEPA 2CLZB 1CPUA 3TIEA 4N8VA 1RURL 3L3KA 5I8EA 1HL5A 2DWEA 3SPVA 1T22B 2HFFA 3AT8A 3EYSH 4TNWK 4WUKL 1U30A 2CUIA 4EXPX 2L7JA 3IF1A 1KIRB 1HZKA 3E80A 3HS8A 2LE9A 4W9GC 1OTSC 1XWVA 2PXYC 3LRGA 2WLNA 3R06A 4OLEA 5AAWA 3O81A 4KRPB 3W2DL 3PP4H 2X0VA 4FC3E 6CGTA 4HV8A 4DGIL 2FJSA 4PWFA 4GT7A 2FR4B 2OSLB 4MZRA 2CCVA 1MFUA 2FHCA 2WW8A 3DV4A 5E9DE 5SV4A 2UYLA 3SDDB 1RZ7H 1DVFA 2PCFB 1HN1A 5J11C 1D5BA 1R3IL 3IKCA 5CMAB 4GP8B 4OD3L 1ZGLP 5L2KB 4FZ8L 3OPZL 5HGHB 1QAWA 4KROC 5FM5O 4BGLA 1U92A 5AZ2L 5F1NB 3E0GA 2ATAA 2IMNA 4NERA 2R29H 4IBYA 5DTFA 3T4YB 3TJEH 4PJ7B 3AADB 3DBXB 3JWNE 3P0VH 4JB9L 4W1TA 2AXJA 4TULL 2ZZUT 4MCMA 4JG0L 1UM6L 1YVLA 4NUJB 4GKSA 5MEND 3WJMA 4X7FC 4HYTB 3FOMB 2OI9B 1R3JA 3GSOB 1ND0B 4R5TA 5JW5B 3NZHH 1EGJH 3FO0H 1FZMA 4I4WA 1OB1B 2BSCA 3BQUB 3RIFK 4J5VA 5CLWA 2E8YA 2XA3A 4L8SC 3VI3A 5DD0H 2F5AL 2PW2B 1S7VB 4FNUA 4FI8A 4WTZA 1O5DT 3O41B 1YMMD 3FZUC 1BXVA 1HHJB 3EYOB 1SHXA 4YE4H 3QXVA 4EKXA 5DUMH 2PP8A 3RVWD 1FJ1A 5IIEA 3PJNA 3NTCH 3E3QE 4PRBB 5GSRA 3SOBH 5ANHA 4JO1H 5CSBA 1BFOA 4UM9D 3OXRB 3RX8A 3TGXA 4X6BA 2BNUA 2VSDA 2CDEB 3B6SA 3G08B 1HNYA 4GNKB 4XMLH 5F7MC 3KW8A 3TVMD 1FH2A 3OAUL 3RGBA 2DQTL 1LO3H 5TDNA 1R1CA 3MHZA 4M5ZL 3VFVB 1S78C 1GS7A 3GMRA 3HPLA 3O2WH 3PWNA 3OQRA 4PIRF 4JQIL 4GRLC 4WWKB 3ARBA 2DZEA 3QDME 5A2BA 2PWHA 2RH0A 2Y1ZA 3CFEB 4H8VA 1HAUA 5ESAA 4BD4A 4OIAA 1UZ6F 3ZT6A 1JIBA 5E9DD 2GW5A 5C0BB 3MRKB 3TN0B 1OL0A 2AI0L 3G6JF 3BKCL 5DDHB 1QI5A 3WN6A 1F4WH 1KXQE 1EEUA 2AITA 4HZLA 4P48A 1OZTG 1PW3A 3WFDH 1ZHBB 2P8LB 3AQZA 5I6NA 2VDMB 4L1TA 3WKML 1KYOJ 4B9IA 3TA3C 1NDGA 4PRHB 3HR5A 1FFQA 4XMPH 1T03H 1B0GA 1GY2A 2YXWA 3K4DA 1CGSH 4OZ4A 4ONFL 4L8CA 1PD6A 2NQDA 4PIBA 2VZVA 5HI4D 2JK5B 1EZLA 5HGBA 2A9NH 2AANA 1NCNA 3LN5B 3SJVB 5E4EC 4KDWA 2L8AA 4RFNC 4N2CA 4JVUA 5A3ID 5F8RC 1KBBA 3O6KH 4JFEA 4XBPB 1EHNA 2KQNA 1X4YA 1TJIL 3HA0A 4GOSA 4RQQB 1CFTA 2E0PA 4R7NA 4BHUA 3FB5A 1A1MA 2XYCA 3DTXB 5AB1A 3UO1H 5LWYH 2B20A 3LSOA 3ZKXB 4GXUM 1USQA 1AS6A 1KPRA 3KWTA 4WUUA 2OP4H 1OSYA 1YEFL 2QMJA 1H8LA 1XGUA 5AYUH 4FMKA 4XO8A 2WBJC 1C1EH 4LLWA 1GGYA 3VD1A 3DVGA 4WFEE 4R4FL 1TKWA 2ZIDA 1WD8A 1G0YR 4UQEA 3Q3GA 1ETA1 2ZUVA 3HBPA 3FK3A 4QRSA 2UZPA 3DVIA 1HH6A 3WLWD 3DURB 1KB5L 4XNUL 3MBWB 3HBGA 4FI7A 4LOEA 3DO3A 3UCQA 5KOVC 3TT3L 1DANU 1KCSL 4UMSA 1HJCA 5CR8A 2EE2A 1YY9D 1T7ZA 3QDMD 1OLLA 4RDQF 1KGYE 4TPRL 4CMHC 5DR5L 5KANG 2PUQT 3S3BB 4EIBA 4G1EB 3WEXA 1D5RA 5ILTL 3KPRB 4ONOA 3V5KB 1PKQE 4KY1H 3UTZA 3Q0HA 4U1KB 1NAKH 3WENA 3T8XB 5D1ZC 4GUQA 3ALXA 3P73B 4NP9A 4QXWA 3VWKA 3REVA 3A6CL 5E70A 5BVPH 1P7KB 2A6JA 2P8PA 3RNQA 3ELAT 3SKOB 4BE6A 4R0LB 3U0WH 2G2RA 5DMKB 5KVEH 1TVBB 5IVXB 2I25N 5IB3A 2JELH 1ZA3B 1YNLL 3ULUL 1NEUA 4L4TA 1K6QH 3LB6C 4WHYH 5DU7A 5ADOL 1W0VB 5A2CA 3OWRA 1T5XB 2UY7B 3O4LA 3PCYA 4WLCA 1UWXH 4LSRH 1Z5LB 3FJTA 2V0AA 3MLTA 2HXAA 5LG6A 1FZOA 1T6WA 5E6UB 2GJ6B 1T4KA 2XTLA 3D85D 3S4SA 4G7QB 3SKMA 3V4UL 1AI1H 1GY1A 3CH8A 5E4IA 3WLBA 4UT7H 5IB5B 1LILA 4X5LA 1U8KB 4LASL 3PNWB 4K3EH 3ZQWA 2DW5A 3D2UA 1CK0H 5B7FA 1G5GA 3SBWC 1PQZA 5DVOA 4ZSOE 4F57L 4WFED 1IC4L 3WXVH 1H15A 1MCHA 3EBHA 1MIML 5H2BA 3V0WL 4PW9A 2FBJH 5DZAA 1DSFL 2FO1A 1MCWW 2X4UA 3GBMH 4M9PA 3BD3A 2FH8A 4FXGC 3NSDA 1M7IA 4LCIH 5IFHL 4QLRA 2AZAA 5DLMH 4Z95H 4L29B 3O4OB 3PAZA 1JPSL 3VFPA 3S97C 2XICA 2AJXH 1OWWA 3T0EC 4CSZA 3H2QA 4OSUL 4AUJA 4PRPE 5BUPA 2F1BA 1CCZA 1A3LL 3LPWA 4FFWC 1MCPL 2Z8WC 4MB1A 2AJUH 2VXQA 4ZG1A 1EHLH 5B1AB 3BUIA 4OV6F 3CVHL 2HG5B 2ZUWA 5F7UA 1ZLDA 3F58H 1K5WA 4HDIA 2YPVH 3H9HB 4C4BA 4OZIA 1PVHA 2X0WA 5FLVA 4TOYL 5CZVL 4OTXH 4TUUA 3QXWA 1YUHB 3WCYA 2DQJH 2G9HA 4JCLA 4ZUTB 1CBJA 1NCGA 1WCQA 3FUKA 4DVRH 1DBKL 3VD4A 4X9FA 5E6IB 4CDHA 4N0FA 2ATPB 4QHLB 4MS8C 5DK0B 2JTDA 3PJSA 1FYTA 4K5OA 3E6HB 1MWAH 4JREB 4Y16C 1E5AA 4L3FA 3DRQA 3IRPX 3KHOA 1EV2E 3QIBB 4A7SA 2EIZA 2QSTA 3TNNB 4Q14A 1A6VL 3VH8B 3IFOB 1TTGA 2LVCA 4WENB 4EI5D 1QRKA 1AOZA 4F7CA 2ZUUA 4YFLI 4YJZL 3PYCA 4GAJL 4GXVH 3K3QA 3X12A 2J5WA 1P7QA 3K46A 2VABA 3CQFA 3L13A 3BP6B 1HKFA 2FJGA 3T4AB 1VKXA 3I2CH 1MJJA 1MOEA 1UXLA 2B9AA 1T7WA 2F53B 3CDGB 4RH4A 2BSBA 3T2PA 2B4CH 5DMYA 5ID1B 1DANT 4PWJA 2ZAIA 1FNGB 5F3FA 2XV2A 3EGXB 5DZVA 2HJKA 4FTVA 5IMMB 4OFVA 2UZYA 3GRWH 2X4TA 4M6AA 2A3TA 5IF0B 2AZUA 1AGFB 1UKSA 1BQHA 2NYYD 1L9QA 2NTSP 1INDL 2OMZA 3EJUA 4X7SL 4U1JB 4FULA 4GRWB 4R3SA 1HWWA 1KIPA 2O26U 1KXVA 4PM1A 3UTTA 2GI0A 3RGVC 3BLPX 3OB0K 1TZIA 5DZNA 3CLEL 1FNEB 2PO6A 3C08H 5D4JA 4G11A 3LZPA 1A7OL 2HH0L 1O6SA 3WOVA 4UNIA 4PRAA 3QJHA 1HXYB 2WXQA 1X6LA 4FQLH 5I24A 3CVHB 1A2YB 4JRXE 1XIWC 4JPWH 4LCCC 4NYLB 4IJTA 3LQAH 2KHAA 1CICD 1JDAA 3T6ZA 4EDWH 1KBKA 2WQSA 2YA1A 5CLTA 3II3A 4M7KH 5L6YH 4PMEA 4TN9A 4FQ2L 3LKQB 3LEVH 4WU5A 4D8PB 2JXMA 3ECBA 1WS8A 2F19H 2XN2A 1R0AL 1CFMA 2FT7A 4YDIL 3L81A 5LXGL 1NEPA 1BXAA 2VB5A 4UT9L 1WCBB 2GC4C 4YHIA 5FO2A 1BFTA 3R7QA 4K73A 5IOKA 4GS7C 1CMOA 3NRQA 1JFQH 15C8L 1LLAA 4JY5L 3O6LL 3BT0A 3AWGA 5A2KH 4D0BA 4ODSH 4BZ2A 1FL3B 1SDAB 2IOOA 3M1BA 2IBZY 4F7MB 2J8UE 2BVUA 3O3BA 2O5YL 1AR1B 1RLBA 3O8XC 4YHYC 1DDHB 2AJZA 5DFWH 2RCSH 3UTPE 1E3ZA 3AQXA 2C34A 1KC5L 2NZIA 4APQA 3VRJB 1RZFL 5I5MA 3U6RB 1XGRB 5LN4A 2MJWA 4NFCA 1BIIB 1CVRA 2Z64C 2FD6H 2NY6B 4YQXL 3BPLB 2WZ5A 4GINA 3FCTB 1JV5A 5CU5A 4NQUA 4CC1A 4BZ2H 2VISB 2EUZA 1AKJB 1RIVL 4ZS7L 5I17B 3POCA 4NSKA 1HI6B 1SEQL 3VU1A 4BWTA 4DFHA 3RP1A 1JK8B 2NUPA 2AEOA 2CBPA 1LO5A 1N8ZA 4S1SL 2BVPB 1HCVA 5CCJA 2X09A 1BM3L 4ZPVA 1DE4B 4JRXD 1W72L 4K7PY 2J3SA 3BP7A 4YXHL 1PY0A 1KJ3H 1PS3A 4OLWH 1TTUA 2XWEA 3OKDA 3IM1A 3P4MB 4HPYH 4XRCA 2WQAA 3LHPH 3T3PE 1XCQB 1ZT4B 2CJTA 3K91A 4EMZA 1CI5A 2VWEC 2VN5A 4L2LA 5C08E 3F64A 4ZYKA 5ICXA 4NQSB 5T5FL 1PY4A 4PY8I 4TF4A 5I71B 1JPFA 4ANVA 2I7SA 2ZXEB 1BD2B 3BAKA 3P0YH 4OQ1A 1MJ7H 2R69H 5LAXA 2H47C 3D52A 3KJ4C 1E3FA 3N42B 4TLUA 2X1QA 2H8PA 2PYEA 4OM1L 3G5VA 1FSKC 1UACL 3HTLX 1DFBL 2ZWLT 2H1LM 2BSEA 4QYOB 1TEFA 1QSED 4I89A 3C5SA 3TNMB 3QFDA 5JHLL 1MCSA 5I6MA 2NXZD 3R1GH 3M07A 1NKRA 4OGQC 4HXAL 5HGAA 2Y3NA 1Z9PA 2O5NA 3EJYC 1CUOA 2F8XC 4NWUL 1JMZA 4M3HA 2Q8AL 5I76B 4OJFL 3UTPD 3HG1A 5DD5L 4HUMB 5IY5B 5CP7B 1BPLB 3ARPA 4L48A 3CVIL 5I6LA 5I1AB 4AM0A 3WHE0 2AQPA 3QEGH 1KYFA 1DN0A 2VN6A 1Z7JA 3NMEA 3SPCA 4XN5A 2H3NA 5I1CH 5T5NF 4E41B 3CN1A 4AL8L 2DIAA 1A1OA 3TL5A 3QIUA 4RESB 3EJZC 4QHPA 2B7DT 2XG4A 3GK8H 2HFEB 3CSBA 1G7HA 1MN4A 3D3VB 3B9EA 5D7JC 1M9WA 1EDHA 5GZND 1AQKH 2YFOA 1NFDB 5BZWA 1XL4A 2IQ9L 3BT2L 3OHMB 4K3HA 1JGEB 1NCHA 2JJUA 2VKWA 4EIUA 3NYKA 5E8EB 4FJ6A 4P23C 4BH7B 1MI5B 4PJIB 4OT1L 3ZW3A 1X5XA 4PBVC 3HUJF 2XPYA 3H6JA 3ILQD 3TCLA 2GSMB 3DXAB 4PWHA 1NLDL 2ENJA 4W9CC 3VACA 3SDAA 4LHUG 3P11H 3V6OE 5LKNA 3N85H 1GSMA 3DVFA 1T7YA 3FN0H 3IJYA 5D8JH 1GYVA 4K94L 5FFLA 4ISVA 4M8VA 5LGYA 3DVNA 4U7KA 1MCRA 4LLUB 1G7MA 2EH7L 2ZOWA 5K9JH 5I1KL 3TZVD 5C6WH 1O0VA 4PJ9A 4WI8A 1XR9B 5JQ6L 1YEKL 1T0MA 3NCXA 4HWNA 4W9KC 3MBEC 4NO3B 3TESA 1JGIA 1A1NA 5EBLA 3U7YL 1E42A 2X4RB 2XXFA 2P5WB 4URKA 2R39A 4CBZA 1A6ZB 5FGRA 4UOZA 3KH3A 1JZ5A 1A7BA 4JX0A 5TE7H 4UQ2A 1ZTMA 5ITFB 1E8ZA 3IU4L 4KVNH 3IGKA 3MRFA 4PR5B 3JV5A 1J1OH 1TPXB 1ADQL 3A6OA 4KMTL 1NDMB 3FUIA 1R5WB 1BAGA 4JM2C 1WUNT 5D1XE 3RWDA 1I7UB 4M5YH 3GI8L 3H55A 4KNTA 1KJMB 3MFFA 2V8LA 3DHUA 4BE5A 3QNXA 4I77L 3SKJH 5IWLA 5EU5B 2FWUA 2Q1EA 4W6YB 1UM4H 3P77A 1E9PB 4NC0B 4XNAA 4ALAL 4E5XB 5DRNA 3MODH 1JPEA 1FN4B 1D5XA 2FT8A 5FO7B 1XBDA 2KZWA 5GQBA 1UENA 4JO4L 5E2VH 4ATWA 2H7WA 3BDYL 1V55B 4JM2F 5HGDB 4J6RH 2Z31A 4YHMH 1THCA 1TQCB 3GZKA 5JXAH 4G7VL 4EN2A 2XQ0A 4JHBA 1IVLA 3FQ4A 4BZ1L 4RAHA 2J88H 4PLKD 1Y6MR 2WY3B 3GT6A 3VA6A 3RWJB 2GFBA 3WBDA 4PAZA 4TSCH 4Z77A 2Y07L 1YA5A 2YSSA 5JW3L 2J5LC 3ZGIA 4O02H 3EYVB 4GUOA 2P7TB 4YVUA 5TJWK 3BO8B 3RGHA 3QCVL 1JRHH 3NESA 5DVPA 3B2UD 5ESVB 2WYZA 3CLWA 2W92A 2EDYA 3V4VL 4CVZA 1ZY9A 4POUB 3QAZC 4AYGA 3MV8B 3S6CA 5KSBA 2EDDA 2VZ3A 4AC2A 1S7TB 4GJTB 3ATBA 4PJXE 1F56A 2FZ3B 2IOMA 2VN4A 4YBHA 1W91A 3JWOH 2YD5A 4QRQA 3KVDD 1X6NA 4OV5A 2WLMA 5ETUB 5C0RL 1FLTX 1QQDA 3OMIB 3IS0X 4AQ1B 1X5YA 3HE6D 4TRPL 4YNYA 3KPPA 3Q6GH 1QPXA 5ICUA 4OF3A 5GGQL 5AD0B 3EH1A 2G0KA 2IFFH 3QUXC 2H0JA 5EZOL 2VE6A 1FORL 4PP2B 4PJCB 4IGBA 5TE6H 5F96L 1U3NA 2IANB 1P4UA 3A24A 1G5AA 3WTTA 1JNLH 3LVEA 1BP3B 3OHXC 1S5HB 4Y4FB 5D72L 3HB3B 5HHOD 4BUQA 1QABA 1GGIL 1QFWL 5ERWB 4CL7A 3STZA 2YMXL 1OAUL 2NR6D 1OAYL 2IWEA 5DUBA 1M2VA 2YWZA 5FUOH 3BUDA 3UBXA 4A55A 4PGEA 4JFXA 4ZMAT 1T83C 2EADA 3GGWA 5DHEA 3PABA 1GRWA 1NBQA 2CBTA 4BKTC 3B2PA 1C16A 2QVTA 2X2HA 4KKNA 1D3CA 3M45A 2HTKD