4ZK8A

Copper-containing nitrite reductase from thermophilic bacterium geobacillus thermodenitrificans (re-refined)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
294
structure length
294
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the function of a thermostable copper-containing nitrite reductase
pubmed doi rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
total genus 98
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4zk8A00
2WSDA 7PCYA 3NSDA 3OMAB 2BHFA 2AVFA 3ZIYA 4DP4X 1ADWA 4PCYA 1V10A 1SFDA 1JZIA 4KOCA 2DWTA 1W8EA 3CVBA 2B08A 3FPXA 3SBPA 5PAZA 1SNRA 4A2EA 1JXFA 3NP3A 2J5WA 2BP0A 1M57B 2IWEA 1E30A 2CAKA 2YAHA 1X9UA 3SBRA 1J9TA 2IH8A 2TSBA 1BAWA 2VSMB 3WNIA 1CURA 2Q5BA 4KO5A 1T5KA 4KOBA 3ABLB 5E9NA 1KCBA 2BP0B 3N2JA 2HRGA 1GR7A 1XB3A 2VM3A 1GY2A 2DWSA 2GI0A 3NJFA 4FA7B 1OE3A 2GC4C 1JXDA 1NDTA 3PAZA 2GC7C 4HCIA 5I5MA 1PLAA 4M4RB 2YAMA 2GBAA 2UX7A 3GYRA 3T6ZA 4A66A 3OMNB 4BDVA 1SFHA 2PCFA 2Y1AA 5B7EA 2IDTA 4YSAA 1URIA 2QDVA 5I6MA 4KO9A 4HCGA 1CC3A 1ET5A 4YVNA 1JZFA 3QJQB 3X2QB 3NSCA 4PAZA 5AFAA 1BQ5A 3DKHA 2UXGA 1JOIA 3HB3B 4BK5C 1SF3A 3FSZA 2DV6A 2VMJA 4YSSA 1KGYE 2XXGA 1MDAA 4TXVB 1L9QA 2PPAA 2J55A 2I7SA 4JKNA 4P5RA 1NPJA 1L9PA 2XV3A 2EILB 2EIMB 1HFUA 3NJKA 1A4CA 1TU2A 1ILUA 4HHGA 5I6LA 1A4BA 4YSTA 4E9TA 2NRDA 3OQRA 3QPKA 3FYEB 3NJGA 5I6OA 2E86A 1SJMA 1J5DA 3NJNA 4ZK8A 5FC9A 3WNJA 4DP1X 2BP8A 4KNUA 4E9YA 4N8UA 4HALA 4YSRA 5B7FA 2RACA 1JZGA 4HIPA 1SHWA 5TK2A 1ET7A 2YAFA 5I5JA 4DPBX 3FU8A 3PAUA 1BEXA 1OCZB 3S3BB 4E9WA 1NIBA 1WA1X 1R1CA 1ASOA 2HXAA 1AQ8A 4JHVA 1IBYA 4UF7C 1JXGA 1ZV2A 3IEAA 3NT0A 4YSOA 2VW7A 1CYXA 1JZEA 3FQ1A 7PAZA 2DY2A 3WKPA 2IAAC 2IWKA 2PPFA 1DZ0A 1PZBA 4UAHA 4KNSA 4DP2X 5F7BA 4E9VA 3PLYA 2Y69B 2BP8B 2OJ1A 4GY4A 1AIZA 3EH3B 2GHZA 1RZPA 1PMYA 4WKXA 3CG8A 2IDQA 4G71B 1A4AA 1BXAA 2AZUA 2BZ7A 3NSFA 4L0PB 1BXUA 4GXFA 2UXVA 4QKTA 3AZUA 5B1JA 5PCYA 4CSZA 4AI7A 5I6PA 3T71A 4A2FA 4AX3A 1WS8A 1A3ZA 3FQYA 3T6WA 3IN2A 4DP6X 1NWPA 2I85A 2QPDB 2FT7A 1PF3A 2VN3A 4W9ZA 3UACA 4F7KA 2QDWA 3NYKA 3AG4B 3GXUB 3MX0B 2N0MA 3BQVA 2IDSA 1IUZA 8PAZA 1WA0X 3G5WA 4HCFA 2PPDA 4NB7A 1DYZA 3NSYA 2BWIA 3PAVA 2PPEA 3UABA 2AFNA 2UXFA 2ZONA 2VW6A 1FWXA 2R7EA 2XYBA 3DIVA 2W88A 5B1AB 3UGEA 1SDDA 2JFCA 3QJTB 1OE2A 1L9TA 1MZYA 3AG1B 1KCWA 2I7OA 3X1FA 1IKOP 4DP0X 4KNTA 1PLBA 1AZCA 4G7RB 4G7SB 3DTUB 2FQEA 3TU6A 1ETJA 3FU7A 6PAZA 1PNCA 3ASNB 2ZOOA 1OCCB 4YSQA 2HX9A 2HZHA 1RZQA 3S8FB 2FQFA 1TEGA 2ZWNA 1IBZA 3D12B 3EHBB 3IE9A 4DP8X 4K9JA 3X1GA 1ZIBA 2TSAA 1E5YA 2FT6A 3QJUB 2BWDA 1AANA 1ASQA 5A7EA 1BQRA 1PNDA 3FU9A 4ENZA 1AG6A 1UATA 3C75A 1J9QA 2YAPA 3S3CB 4DPAX 3UADA 3ZBMA 2FWLB 4YSUA 3QQXA 3CVDA 3FU7B 3T6VA 3X1EA 1GSKA 1TKWA 1AS6A 1ILSA 3IN0A 4HZ1A 2HX7A 4Q8BA 4FAAB 3KW7A 3CDZA 1ET8A 3QJSB 1AS8A 1NPNA 2FQDA 3CDZB 3X1BA 3PXLA 2YQBA 2AZAA 1OF0A 4A67A 1JZJA 3TBCA 2OCCB 4W1TA 3JT2A 2CUAA 5B1BB 1I53A 3H4FA 2PLTA 1KV7A 3QJVB 3EH5B 3WKQA 3OD3A 4BXSV 2BW5A 4A68A 1WAEA 1AAJA 1AOZA 1KBVA 1NIDA 4G72B 3EF4A 1AR1B 1XB6A 5I6NA 1J5CA 1MG2C 1J9RA 1ID2A 3PCYA 4GP4B 5I6KA 1W6WA 2YAEA 4UANA 5I28A 1VLXA 1KYAA 1SDDB 5I26A 4E9XA 2W8CA 2LLNA 4YSEA 4GYBA 1EHKB 3FSAA 1SF5A 3TBBA 1JVLA 1PCSA 2XVBA 3WG7B 5LDUA 1AACA 4AKQA 3NJJA 3ASOB 1V55B 1NIAA 3V9CA 5B1JC 1NIFA 1B3IA 3AW5A 2FQGA 4M3HA 2CALA 2EIJB 4BXVA 2DYRB 4Q89A 1KBWA 1N70A 1L9SA 4GP5B 4GP8B 4YL4A 4E9SA 3JTBA 4P5SA 3TA4D 3ZX1A 3AG3B 2EIKB 2XUWA 1ZDQA 3H4HA 1GS7A 4MFHA 1F56A 1NICA 2H3XC 2QPEB 1WS7A 3MBWB 1PAZA 2X88A 3FQ2A 1ZPUA 2HRHA 4KO7A 1KDIA 2VM4A 4AZUA 2EINB 3UAAA 1M56B 2CCWA 3HEIB 2P80A 3CZUB 1PZAA 4DP5X 5AZUA 3FSVA 5ANHA 4F2FA 5B1KA 1GY1A 1OOWA 2FTAA 1PLCA 3N55A 2QT6A 2PCYA 2H47C 3X1NA 1W6LA 1E67A 3ABGA 2HX8A 2CBPA 2IDUA 1GS8A 4NAJA 4AKPA 1PZCA 2DYSB 1AZUA 4A2DA 1GW0A 1A8ZA 1KDJA 2HLEB 3NJHA 1E65A 2FJSA 3TASA 2GIMA 1BYOA 4RH4A 1HAWA 4G70B 2VW4A 3FPYA 4BWUA 3ABKB 1JERA 4A2GA 1M9WA 2H5UA 2CJ3A 3FYIB 3T9WA 4DP7X 3FT0A 3QJRB 2J56A 3BVDB 1QHQA 1N68A 2GSMB 2XWZA 3EH4B 1XMEB 2BW4A 2MRYA 4WTQA 5D4HA 1CUOA 5EHFA 5B7MA 4HAKA 1L9RA 2P80D 3NJIA 4E9RA 1AZBA 1AZNA 5F7AA 1NINA 1BQKA 1HAUA 2MTAA 2XXFA 2YXVA 3ERXA 2VSKB 1QLEB 2J57A 1GYCA 5TK4A 2JXMA 4CSPA 4DPCX 3WIAA 5IY5B 2YAQA 3NP4A 4BDVB 3H56A 2WO2B 6PCYA 2XX0A 3V9EA 4BWWA 1A65A 1ZDSA 1OCOB 1PY0A 1ASPA 2PP9A 4HHWA 2B3IA 3AG2B 4QLWA 2ZXWB 3NJMA 4AKOA 2WO3B 3S8GB 3ABMB 5AKRA 3FSWA 2JKWA 1FA4A 1E5ZA 4F2EA 2XU9A 3L45A 2IWFA 1RKRA 1OCRB 1J9SA 2PP8A 1NTDA 4EF3A 1BYPA 3WI9A 5D4IA 1MG3C 2UXTA 4X4KA 4YSPA 1XB8A 2X87A 4N4YB 2R7EB 2XV0A 1BXVA 1AZRA 1X9RA 3IBOA 1WA2X 1JVOA 3AY2A 2YARA 3SBQA 4E9QA 1JZHA 3S3DB 2AANA 4KO6A 3ZDWA 1NIEA 4JHUA 3OM3B 1CYWA 2PPCA 4YSCA 3T6XA 1QNIA 1EZLA 2FT8A 2UX6A 3FS9A 4YVUA 1NZRA 2PP7A 3SQRA 3CVCA 1TEFA 5B3SB 1V54B 1NWOA 4A2HA 1OV8A 1MZZA 2YXWA 4G7QB 3RYMA 3UAEA 9PCYA 3GDCA 3U25A 2IDFA 3PPSA 4YSDA 5I5IA 2XLLA 4NERA 2IH9A 3OMIB 2BZCA 2YAOA 3NJLA 1RCYA 2OV0A 1IC0A 1SHXA 1FFTB 2A3TA 1AG0A 1ZIAA 1AS7A 2GB2A 4DP9X 2XX1A 2Q9OA 2XV2A 1GS6X 1YLBB 4BWTA 1L9OA 1OE1A 2FNWA 3KW8A 5D4JA 2BO0A
chains in the Genus database with same CATH superfamily
4X7DC 1CDJA 4FTVE 3VW3L 1INDH 1G6RA 4JO3H 5E6YA 3FO2A 1FL5B 3P3RA 2DYPD 4ZUTB 3FO2B 2DDQH 1ADWA 2ZSVA 4LARL 3RURA 4HS3B 5DEFA 2E9GA 2NXYD 3P11H 4B41A 5IHLB 5EUOA 2E9BA 4JN1L 1FL3B 1P9MC 2G60L 3MRFB 4JPIB 5KVDE 2J8OA 3OHMB 3QJZA 5CZXD 5FHBL 5F6HI 3NFNB 1T04B 1T03H 5D7HA 1LWJA 1ZSDA 2C9SA 2Q76B 1YEHH 5M95B 1G1YA 4G6JL 4GO8A 1IGIH 1CWVA 3VO0A 3QUXC 5IROA 5JQ6H 3BAXA 3GSUB 4X9IA 1SJHB 2XFGB 3P9MB 3NG5A 2X9YA 3NIGE 2C9XA 3PL6A 1F58L 4M8RA 1RY7B 1SMDA 2ADJB 2BSTA 4PLKC 3KM2A 2X05A 3OPZL 2DQJL 4HJIA 4RFEB 4XZUA 4ZMQA 5C0FB 1FH2A 1DUYA 1LO3H 3GYRA 2WVVA 4Q6YA 1VJSA 4DGIH 1QLRA 2DBLL 4EI0A 1FJ1A 2DQHH 2MWCA 3O11B 4PBVC 1MCKA 4XNBA 3BMWA 4MA7L 2JJSA 2P5EB 4DTGL 4Z7NF 3NBNA 5GJSL 2AQ1A 5DUJA 4NQEB 3RDTC 2JQAA 1Q90A 1SM3L 3VX1A 4DKTA 5BZDB 3IK2A 2OMBA 4JDZA 4C58B 4TF4A 1YC8A 1U8QA 1S46A 2PKDA 4IW4C 5F0JB 2CHDA 3BLBA 1M2VB 2XXGA 4XP9H 3BZFB 3MV8A 1L9QA 5AAWC 3QCVH 3S5LA 3FT3A 4JFPB 4LGSB 3ZDXE 2FO1A 3M7OA 1NPJA 3D8MA 2HT4D 3DXAB 3NJKA 2VDKL 5T3ZL 2AEOA 2IWGA 4WHCA 4L8DA 3MRDA 3AUWB 3SCMD 4IOSA 1A4BA 5KYWA 2QGDA 4F8OA 2W9EH 4PRAA 1QWNA 2KZ1B 3UYPA 2KUTA 1RK0B 4J2QA 5ITBL 3Q48A 3QUZB 1A1OA 4H0GA 1TLMA 5F1NA 1RH8A 4P2QD 5I18H 2E8YA 3BFOA 4WI5A 2BIIA 5F9JA 4HIEA 1JN6B 4ZFZA 3QUMA 2XWTA 4OI8A 5ESAB 2P5WE 2NY6D 2WXJA 4MZRA 2YAFA 2ARJB 4NQCD 2FIRT 3PAUA 3UO1L 3RZWA 4NWTH 3S3BB 2IJ0C 3GGWA 3RWHB 3TF4A 4NQCA 4IRJA 4IK7A 1ASOA 1HXMA 1PFOA 4HIJB 1QR1B 2X89D 3LRSA 4JO1H 5EO0B 1HXYA 4W9KC 2RHEA 3NT0A 4JY6A 3L5HA 3ML9A 4G6KH 1NFIA 2VLMD 5JUEH 5FYLD 4RGNC 2AEQH 3GI9H 5D7IF 5FCUH 4H1LA 5DRNA 4YDLC 3LPWA 3U7AA 3N40P 2FX8L 4MA8H 3OC5A 1OK0A 1XHHA 2ITCA 5FA3B 5LBGA 5IMMB 4UZUA 5H4YA 1BVNT 1T20B 1Z9SB 2FX8H 1RZPA 4FFZA 3GSWB 3GO1L 3IMVA 2ZXAA 1TQBB 4PPTA 3KJ4C 1CS6A 1OPGH 4M6OL 2BVTA 4Y5YA 3WTWA 4X5WA 3UDWA 3AZUA 3CZLA 1RZ7H 3T71A 4P9ML 1NCNA 1O6VA 2Q6WB 3MJ7A 1AGFB 1XSOA 2YD7A 4OCRH 4N2LA 2ADYA 1OGAE 3REVA 4RZKA 3KHQA 5DMGD 4ZOBA 1HT6A 1DQQA 4NOBA 2MPAH 4RNRA 5F3FA 3UIZA 2YPLB 4RVBA 1FC2D 2MQCA 4XOAA 4CGUB 1K9TA 5FYKD 1QPKA 4EKJA 1E28A 5LCVH 1LEIA 3L4CA 1AD0B 4JRYB 4MAUL 2VXSH 4DKFH 2YJQA 2JQZA 3K5RA 5TF1L 1K8IA 1XTMA 3BUDA 3D9AL 3QCUH 2D7MA 1GMEA 4JUSA 1JZ6A 1AY1H 2C3VB 4FHJA 4AYSA 4JDVB 3KWTA 3V7AG 1QR1A 1JPGB 3VQLA 1G9NC 1ND0B 3ZOAA 5EEUA 4B5EA 2OZ4L 3GMLA 3VD5A 4FNTA 4OZHB 1CFTB 3LQZA 1L9TA 3VD1A 4W9EC 4A2MA 5B38G 3KWWA 2IGFH 1UENA 5CJQH 3H3BC 3LIZA 4OZIF 1NLBH 2J6EL 1OM3L 2EABA 4XP9L 2J73A 4OLUL 2R29H 1WAAF 3MZTA 3L3HB 1OCCB 5I1GH 3BYYA 4JLRA 5FAAA 1PQZB 3IJSA 2ROXA 5F0MB 3D0VA 4X0KA 3UYOD 2VMEA 5FO2A 3UJIL 3DHJA 3DO4A 1BJ1J 4F27A 3AXLA 3EYFB 1UVQA 4GI8A 5E24E 2PXYD 3L3JB 3GZQA 3AQYA 2D2CC 4B50A 3VXSE 5CGTA 5IHUH 4OGAD 2VZSA 4G1EA 2WCSA 1VEPA 1YNTA 1Z9LA 2HUEA 3C5SA 2UY6B 3I6GB 5DZJA 2NTSP 4FMFA 1L5GA 5KSBF 3BHBB 3DX9B 3V5KB 1WIPA 2FJFB 2F8IA 3ULUH 2AHIA 4ELKB 2SEBA 1MQ8A 3KW7A 1O0VA 1KXVA 1MY5A 3VXTB 4PTUB 4J5VA 5IEKA 1IC7L 3DK2A 3DMMB 1MLBA 1CJYA 2YQBA 8FABA 1CLVA 4L5FL 1T21A 2LGNA 2V3DA 1MCEA 3M86A 3TBCA 1U3YA 5F1NB 3S88H 3BVXA 4FOMA 4MNQE 5F9OL 2C34A 2G9HB 4K7PY 4QRPD 3UPAA 4FI6A 3MTXA 5EEWA 5BS0B 2YD0A 5I1JH 1C16A 1WAEA 1NIDA 3LRLA 5CCJA 4Y2DA 5DDHB 1FFOB 4C55A 2A7BA 1AQKL 5JORB 5K39B 3FCBA 3ZDZE 1QQDA 3EBIA 2Y23A 4X7FC 1ZS8A 1S4IA 2V5TA 3LKQA 1XBRA 4YH6A 2YAEA 4QXUH 3WUZA 4RWHA 4ODXB 4WTWA 2I32A 5BZDA 1GKOA 4K5MA 3B34A 1CQYA 5C09A 1T22A 2UY6A 3RIAK 2I24N 3RUGF 4JFQA 3MU3A 3LKNB 1OARH 3PWLA 5LHDA 4B96A 2KERA 3CAFA 3B7UX 4QTHB 4XMPL 5DFVD 3CDYA 4NUGL 4HJGB 2I60L 5KJ7E 5F7HA 3LZPA 4QD2E 5HJ3B 4WUUE 1TO4A 3E2HB 4FD0A 1ETB1 3FN0H 4FNPA 4HCRH 3VGBA 1JD9A 3TA4D 2ZZUT 3KYKH 4LSTH 1SDAB 4GXUN 2LQRA 3CBJB 1IQDB 4O4YH 4CJ0A 4TLTA 1ZVYA 4WF7A 4MJ5A 3GINA 3MNWA 4L05A 2WAHA 2JJVA 3G9AB 2AC0A 3MLUL 4GFTB 4OCSL 5D7LA 4BRJA 2DI7A 3QG6B 5GISL 1HHHB 5LGKA 3IKKA 2F54D 1W15A 3ARFC 3U4EB 3LDBC 3ULSA 1JTTA 1BQLH 1PLCA 4GBXB 4GH7B 4NO0D 3BP7A 5F6IC 2VZ3A 1WLHA 1IM3D 3NCWA 1KZYA 1CFSB 4ISVB 4N2BA 3VXUA 3SDYH 4A55A 2BVOA 3CFJB 3FO9A 5EO9B 3MRKB 3QZMA 1LD9A 4NAJA 4LOFA 4LVHC 5D7KD 4PV1C 3J07A 3EYUL 2Y3AA 5D2LA 1ORSA 1BF2A 3GJFH 4M43H 4HLZG 1IC1A 2VW4A 1WZMA 4NZTL 5D2LB 4H1LB 4DN4H 1U8JB 1AO7D 3QIBA 2Y22A 4YPGB 4KX8A 4GG6B 2QPUA 2DBJA 2OS7A 4D9QE 1FGVH 1NCWH 1QR4A 3L3HA 3MLRL 1WFOA 4XN4A 2BW4A 2CD0A 1PQZA 3IJSB 2K45A 1CIUA 5KEZA 1NCIA 4DHLA 2FL5A 5DLMH 1U4EA 1DL7L 1HL5A 4JQIA 3TJEH 1IBGH 4ZXBD 1S8DA 3LZOA 1NINA 2JI3A 4FG4A 2AABL 4PJXE 1RUQH 2G2PA 2VLKE 1Z9PA 2DKMA 2KKQA 1L7IL 1FV1B 3H55A 5TK4A 2IPKA 3MNWB 5EBMA 2XFXA 3ES6A 6PCYA 5JDSB 1TCMA 1ZDSA 1OCOB 4MJIA 2AQ3A 2X44D 4JCLA 4P5TA 4NAQA 4NO3A 3ZYZA 4BFOA 3QUYA 1XCQB 1XSKA 4WUUD 4MJID 5FK9A 5HHME 5JYMA 4X8JB 4FQCH 3ZKXB 3H9YA 3PDOB 4KDTA 4PJAE 1AGBA 5DWUL 2DJ4A 5DEZA 1AHMA 2BFVH 2JLPA 4Q6IA 5DLML 2CRYA 3GXFA 1L0QA 2F18A 2R29A 2X2HA 3FK3A 4JRXB 3S98A 2PO6C 1GIGL 1O6SB 4PLKD 3U30C 3NDYE 2XV0A 3QGVA 5EOCJ 1OP9A 4XB8A 3KJ6L 2F58H 3ZGIA 4BZ2A 4ZZFA 5FWQA 1L0PA 1JVOA 2CRIA 4M48H 2YGOA 4XB7A 1URZA 4FX5A 3B9KA 4UNTA 4Y2LA 3VJ6A 2PCFB 2OAAA 2W1NA 2WVVB 3CFDB 4DERA 4U0QB 3VJ6B 4I0PB 3ISYA 4UDUB 2AP2A 5E03A 2VZVA 5FYKH 1EJFA 4ZSOE 4DQOH 1A3RL 4IHOB 4X5XA 2OCJA 4LDOB 4P04A 3SYOA 2OSWA 1S3KL 2LV4A 4M1CD 3RPIA 3NJXA 1KGUA 2I9LB 4OKVB 4KZEH 5A2CA 3P9WB 3O6LL 4V1DA 3U82B 2FX9H 3GSVA 2VDRB 2YFOA 1NCBL 2OXGA 2A3TA 5EEXA 5FW6A 3NESA 1U8CA 1OB1A 1FZKB 2GTWA 3UTSB 3LKRA 5KVFL 3DX7B 4WIQA 3PGCB 3C5ZD 3KW8A 2EEXA 4HUNB 5DVMA 1JFQL 3WUWA 1OTUD 1SM3H 4JO4H 2LAGB 5KBKA 3U2SA 4XBGB 1I3UA 5F72S 2WIIB 2BHFA 2WXRA 4HEPA 4N9GB 1YYML 2XBTA 5A3ID 3S96B 2B77A 2VDNL 4W93A 4ESKA 1F13A 3V4PA 2GI7A 4JMXA 4RGMC 1ACYH 3SDDB 1T1XA 5CD5C 4A2EA 1RU9H 4YXHL 3GZOA 4M7KL 1SJEA 2GY7B 1QBAA 1YEIL 3HBZA 4GIAA 2WKLA 1MWAL 1D9KB 4J6RL 3QZLA 5ETUB 4GUQA 3ABLB 5C7XL 4BYHA 2MCPH 5GZNC 1BVLB 1RUPL 4BCZA 4NLAA 4FTVA 3D69A 2EXYD 3HCVA 5D70H 3D3VE 5JOPE 4N68A 4WNQA 5FM5M 3STZB 1ORSB 4R96B 3ARSA 3HFMH 1ACZA 1G9EA 4F57L 2FJHB 3H54A 3SE9H 4HCRL 4IU3A 4DN3H 4DZBA 4GG8A 3QFJA 4G6ML 5L4FA 4JQVC 3BQUC 2HTLC 1CGYA 1WHOA 4OFPA 5IW1A 5AALA 2I60H 2P24A 3GBNL 3MN8A 5EZOH 4P4KB 5I6MA 4KXBA 4HCGA 1KIRB 2DMKA 4R6UA 4TL5A 1HHJA 3GXNA 1YMMB 4N8CL 5H8DA 1YA5A 4AL8C 2RTTA 5CLZA 4EN3C 4IDJL 3S0PA 2WAQA 4CSSA 2XPYA 2R9HC 4HA1A 1SMAA 5IBLD 3V6OC 3VRIA 5E0FA 2BSDA 4HUUA 2LU3A 4UNUA 4LVNC 1DQJB 4OKDA 2DIAA 5JIMA 4J1UA 3UTSD 2IPUG 5IROD 3QXUA 1EERB 4KY1L 1KJ2L 1P1ZB 1KPVA 1UOVA 3RTQC 4MX7A 3AABA 5BRQA 3UTOA 1KWGA 2NY6B 3QRGL 1DQIA 4HWEL 4KUZH 2M2DA 3PQYB 1KXQE 4P3WA 1XGRA 5DYOA 2QHLA 4PJ5E 2X89A 1WZKA 4TQPA 1G9NH 4PS3A 4G8EA 1D5BB 4G6MH 2C7UA 4WWOA 1JRHH 5BS0D 3U1QA 5KVGH 2VDPL 4P06A 2B4CC 3D06A 1TETH 2DQGH 4NHCL 4YBQD 2RACA 3FU0A 4LDEB 1G7QB 3RY5A 2ARWA 3VE0A 4JHAH 4NENB 3S97C 4NI3A 4GPVA 5KOVC 1DSYA 5FOJA 3JZYA 3LKSA 1JE6A 3TWYA 4L8BB 4Y19B 4ZQTA 1PEZA 4PJBA 1RQ5A 2F7PA 3QWNA 2FK9A 2WGNB 3FRPG 1QABA 2OMWB 4P3DA 3TOPA 3ZO0A 3IEAA 3NZSA 2IH1B 1ZXKA 1FO0H 3CLFL 3NIDB 4YSOA 3SCMA 4BFBD 1QD0A 4W70A 5IHBA 2IAAC 2PPFA 1A6VH 2AEIT 1TZAA 2OL3H 2APWA 2Y7SA 1T89C 1VKXA 1ROWA 2OP4L 1WK0A 4PJIE 5AOKA 4MLIA 2NXZC 1KUMA 4CILA 2ZUSA 3TA3A 4S1RL 4ZFOA 3BVNB 3L13A 1DBKH 5CIPB 1KBBA 4IM8A 5KVFH 2YMXL 1RZKC 1MHCB 1FZOB 2A6IA 1EEYB 3ECUA 4FFWD 4X6DE 1I7TA 1J88A 4XNQB 4XNYL 3ZZQA 4Y5YB 1HTYA 1WS8A 2N1KA 3T6WA 1NCBH 2LLLA 4EUPH 3MACH 5FOBA 3BN9C 1EGJH 1ZGLB 1BEYL 5J7CC 2AF2A 4R4FH 4HX1A 4OT1H 1MEXH 4OJFL 1TQSA 3I6SA 4UWQB 4F9LA 4ZFFA 3HUJB 2IDSA 4MMZA 2CMRH 5CEZL 3GSOA 3QUGA 4OV5A 2I26N 3QUMB 2VXSL 3S36X 4DKFL 4CC0A 4X7TA 4NKMB 4MXQC 1A6WL 3PAVA 3RB7A 1XF2A 4F1ZA 2HJLB 2LE9A 4ZODA 3RWHA 1T80A 2O5XH 3ARDB 3RDJA 1BX2B 4JFFE 3UAJC 3BP5B 2VDML 2V2WA 4Z7VA 3FFCB 3X1FA 4DO6A 4HJ0D 3QJHA 4AGLA 3VM5A 4K3GA 3VGAB 4PB0H 5IV2B 1FLRL 3P4OB 1M2VA 3TT3L 5J4MA 5CR8A 4GW5B 4PJXF 2FNBA 4XP5H 2CO2A 1N7ML 4R2GC 3ZMEA 2K6YA 3W2DL 2I69A 3TYFB 4QNPE 3E9TA 1JGLL 4XP6H 1A6UL 3D08A 2XVLA 1K85A 3PIQA 2D73A 1TR7A 2CRMA 2H9GA 3IWUA 4Z7VE 4WFGE 1KLFB 3WFCH 3N85H 4Z77B 2MNWA 2WQRA 4L9LC 3B4NA 5FR3A 2AABH 4NC1C 3ZE2E 3BKCH 1QBML 5C0RL 5HHXL 1JHTB 1JPFB 4YHPB 3MLYL 1G7HB 3QG6A 3L3OB 4KV5F 1D5IH 1DDHA 4LEXH 5CZRA 2P5PA 3QUXD 3VFOB 1D5RA 4MZ3A 4GG6E 3MROA 3A67H 5F3BA 1TYEB 4HMEA 4KI5C 5DD6B 2H32H 3V0WL 4LLDA 4AXWA 4PG9A 2EUZA 2X53A 2EDQA 4N6RB 1EAPA 1A21A 3EYUH 1LE9B 1KV7A 4P9HH 2I9TB 2ZWZA 2W9EL 3D6GA 2BCKB 2DQJH 1JGLH 3EF7A 4TSAL 2YD1A 4M61A 4G72B 2ZXCA 5D7JA 3VUAA 1EPFA 2P42B 4OZFG 1ZLWK 3P4OA 2QGCA 3DSNB 1WZAA 5K59E 5DS8B 4E68A 3CTTA 3O8XA 1D5XB 4MNHA 5C0AD 3B8YA 3T0AA 4E2OA 1MELA 3CSYA 5F44A 3VWJB 3TS8A 4J8RB 3ZL4H 3OKYA 1AQDA 1SDDB 1F90H 4WWKB 5FYLE 1ZE3C 1HH6A 3KR3L 1HCVA 5C6PB 4QWWD 2IQ9L 1CBVL 1THCA 3DYPA 3HG1E 4E5XA 4EMZA 3KLQA 4JK0D 3U4AA 5A2BA 3EJUA 3BDYL 1BF5A 3L4TA 2IH3A 1E9OA 2M26A 5F2FA 4OTXL 4TKWA 4DPRA 1YNTB 5JMRA 1HIML 4JFOA 3KG5A 3O3AA 4R0LC 4GUOA 3DROA 4HJGA 3T0DA 1L9SA 1AD0A 5DHVB 1F6AA 2ZSVB 3VFMB 4DGYH 5AVZB 5DF0A 5GS1A 4K55A 2EIKB 4PIRF 1F58H 4FTDA 4KK8C 3WTVA 3KPPB 1UADC 1IQWH 4FQJH 1MJ7L 1P4LA 3I9IA 4GQQA 2AJZB 2OZ4A 1ZHNA 2WZPD 1IMHC 4G8GA 4RCAA 4WVRA 5BOZG 5CMAA 1CE6B 1HL9A 3VFSA 4YHML 2VM4A 2DLTA 1M56B 1A7PH 3ZRFC 3BP4A 1DR9A 5F3HA 4Q9RH 3ISWA 4J3OH 5ANHA 4F2FA 2XWTB 4LRIA 1L4IA 3N55A 4XVJL 4NQXA 5MENA 2EYRA 1C5DB 5ACZA 2HX8A 4JRWA 4NZRL 1R3IL 3GHBH 3I3BA 4NKOB 2ENYA 5DJ8A 1JGVL 1T83A 4ONGL 1BBDL 2HLEB 3NJHA 2YUXA 4X5QA 2ZQKA 3LEXA 3BXNA 4ELME 1DSFL 4G70B 4X5XB 5C0EA 3FPYA 4ZW3A 2ICWJ 4ILDA 2CJ3A 5A43C 1KXTB 5I66A 4FYQA 5DC4B 1QHQA 1R5IA 1XMEB 1A14L 2BY2A 4KMTL 1IC7H 4WU7A 4DGUA 2GUOB 3FQTA 3SSGA 3GMNA 2P80D 3D4YA 4A6YB 1ZKAA 2R0WH 5IVXF 2PXYB 2P7TA 5TE6H 3VXNA 1IC4H 1JGUH 5JW5A 4JBSA 2G0KA 5IIEA 3HA0A 3D0LB 1LEKB 1X5GA 2DH2A 1BQKA 5A2JH 2XXFA 4YC2C 1GH7A 3F6IA 4XPHH 4F2MB 1NCTA 3CZNA 4G5AA 5BO1L 1D6VH 3L2LA 4X7SH 4DPCX 3T2NL 4L3EA 5IY5B 3NP4A 1T2QL 3V9EA 1U8OA 4Z77A 5KVGL 2OTPA 3L5XL 2B3IA 5HD8C 4AIXA 4TOYH 3QFDB 4JFFD 1IBBA 2E4FA 5D1QB 1QRND 2BK8A 2XA8L 4KQ3L 4OZGE 2IBBA 1U2CA 3LV3A 4F7EA 1JZ8A 5MP6L 2CO6B 2VZTA 3QHFH 1DCLA 4NBZB 2JKWA 2YC1A 3HI5L 4S0HA 4FNSA 1VZGA 3NAAH 1KJ2H 1PIFA 1NTDA 3BP7B 3FHQA 2E76C 3VSVA 2DM2A 4XCFH 3Q2VA 1A9EA 4S1SH 4BD4A 2LVCA 2R0WL 3SZKC 2J5LB 4QHLB 3MCKB 1KPUB 1I85A 3FUKA 1ZVSB 4XAKE 4Z23A 1MJ7H 5L2JA 4FS0A 2BSRA 2BMKA 3G08A 3QNZB 1BVKA 5KSAA 1WBZA 1NIEA 3B7TA 3G08B 2DKSA 1UKSA 3QIBB 4ODUA 3CFTA 5T8IA 5J11C 3A4DA 3DI3B 3RWCB 3NRQA 1DJGA 1SEQL 3CMGA 4ODTH 5EN2B 3QAZC 3WGUB 5EOTA 4RIRA 5HHOE 5L2KD 4JFHD 3RYMA 3HPJA 4NZUH 4JAMA 2WKOF 2NDFA 1KG0A 1Q9WB 1UB5A 1GHFH 2MKLC 4NERA 3C6LC 4M9PA 2BZCA 3ETTA 4FADA 3NJLA 4L37B 1UFUA 1IC0A 4J27A 3LQAL 1KYUA 2GB2A 5DVNA 1NDMB 3THML 4QOKB 2ZOWA 5IVXA 1SVCP 3EJYD 3DHUA 1AVAA 4D0CA 4H8VA 4G9DB 4M02A 3SOBH 3WSQH 1OE1A 2BVQA 2V17H 4NRXA 3ZRCC 2LW3A 1IQWL 5D4JA 4K5NA 2KZBA 3V4UH 4OCYH 4E41E 1X5LA 3HRPA 5KAQF 3WE6A 3O4LB 4XNDA 3MKKA 1MCQA 2ZPKL 4GSDH 4I2XB 3UX9B 3HMXL 3CN0A 3U2SB 3K3QA 1ZVHA 4ZAKB 2VE6A 1W8EA 3T3ME 5HHVH 3MCKA 4CBPA 4MAYC 4NO0B 4ZFQA 4HK3N 3DHMA 2KQMA 1YPZA 4LOVA 4X4ZA 4HKJB 4XP1L 5IBUG 3AT0A 3R8BB 2D8KA 3LEVL 5IB2B 1UWFA 4HKJA 4LNRA 3QDMD 4F15B 3HZMA 4FKEA 4L8BA 3JWNE 4DVBA 4L9LA 4KK8D 1D5ZB 1S7RB 1OD7A 2GJ6A 4NC0B 2EEBA 2BP0B 4P0DA 4Q74A 3HHMA 4KAQL 2DB8A 4G6FB 4B9IA 3EXJA 3W37A 1GY2A 2V5RA 4JPKH 4Y16A 4QXTA 2YK1H 3D07A 1I7UB 4G5ZH 4UQCA 2R1WB 1LXMA 1QO3A 1Z2KA 2YO3A 3HW7A 4KZDL 4M4RB 1BZ9A 1Y18B 1U4FA 3VFRB 2IDTA 2BOCA 1QFWI 3QFJB 2ED7A 3US0A 1NUNB 2VITB 1OAYH 5C09B 1CC3A 4W9DC 1EXHA 4P46B 5HGHA 3DUUA 4G9DA 3TZVB 4PAZA 5ESQA 1TU2B 2PYEA 1YNTF 1K3IA 4NRXB 5DMJB 4KFZC 3TT3H 5CP3H 5DJ6B 5ABAA 1OB1B 5I1IL 1H3TA 1FLRH 3VRJB 5I1CL 3WFZA 1WFIA 3LKRB 3K6DA 3RWIA 4P2OA 3CPUA 2QPFA 4HPOL 2WWMD 4QXVA 4DFIA 3H7LA 4RAVA 1FNFA 4ZS6D 4P2OB 3U9WA 3W5NA 3GM8A 2VN5A 1VESA 2YPLD 2BY3A 1MLBB 1KPRB 1V3KA 4Q9QL 1D7FA 1DO5A 5C8JB 3M1BB 2EIMB 1ZLVH 5BQ7A 5EZIH 1HXKA 4ZMOA 4LLAA 3S36H 1AKJD 2XQBL 3O45B 1JZ3A 4G9FA 4M3JA 3K46A 2W65B 5I17A 2NRDA 1W16A 4IYKA 5C97A 2QKIA 5I6OA 3V7MA 2F5AL 3WNJA 1HNFA 4GKOA 2VB5A 4DFHA 3CFDA 5AW6B 3UYRL 2JCWA 4ODSL 3DUSB 4NFBA 5IJKC 4JEGB 4OU3A 1XGTA 2VDRL 5TK2A 2VR9A 5EMYA 2R1WA 1Z3GH 5JQ6L 4Z7VB 1K6QH 5TQ2L 4QHLA 1QW8A 2E7CA 3D4GA 3OZLA 3ZKND 3BEWA 4CA4A 1IFGA 1R3JA 3MLVH 5F6HJ 1DJSA 1P6AB 3T2OA 5FKPA 1T2XA 2HXAA 2VRAA 4I4WB 4Y4FB 5KBMA 3P4NB 3BCFA 1F3DJ 3LKSB 4D3CL 4NYLB 4XN5A 1M53A 4JGUA 1ZLUH 1H3WM 1DBKL 1VADB 2IO5A 3WFDL 2KI6A 3MA9H 3WKPA 2KLTA 3TGXA 2QKSA 2WJ5A 3TWCH 1QVOA 2VDLH 1REIA 1HOCA 1TZIB 3R0NA 2JF1A 5IQNA 3VCLB 2FR4B 2VR7A 1CQKA 2AJVH 2WHVA 4X99A 5LGJB 1FUNA 2PCPB 4WFHE 1YEFH 1INDL 2EDKA 2GHZA 3KBPA 3ZW3A 1VKXB 5DD3L 1FFRA 4WGVB 2CHXA 2EXSA 2D03H 2BH0A 2WLZA 1HHKB 3P9LB 3PP4L 5E2JA 1ED3A 2WOYA 4S1SL 5E6SB 4ACPA 1VF5C 1XR8B 2W9DL 4MDJB 1THAA 5D7LB 1FYTD 3V6ZB 4HK0B 1FCCA 2H45A 4QGYA 1B0WA 5AOLA 5BRPA 5ANME 3A21A 1M7DB 1OAUL 2V9TA 4KK6C 3RWDA 4N2AA 2CDGB 2DLGA 2QDWA 3T8VA 3LZFL 4JDVA 3APNA 3KVDD 3GXUB 4ZW6A 1JNLL 1ORQA 4XXCA 4ZTPH 1T0PB 4YDZA 5IOPA 3QORA 4LLUB 1YQVH 1S7SA 8PAZA 4HWBL 5HDWA 1LE9A 4K8RH 4LLUA 4JFUA 4ZQKB 1I8LC 5DFTA 3RWFA 1ZTXH 3OHXA 2P8PB 4FFTA 4ATTA 3AS0A 3IPEA 4Y4FA 3U1SL 2HA1A 1Z66A 2RCSH 2X4OB 4FHKA 4YXKL 3DURB 5B38A 3QZOA 2G2RA 4L4VE 2EO7A 2ZONA 3B9KB 2ENJA 4HWNA 4MMXC 2VW6A 4B7LA 4RFEA 4IIQA 2DH3A 3DGGA 2JFCA 4LSSH 2W0FB 3PWJA 3KLDA 1A1MB 3MLXH 2UUDH 5JR1H 1IJ9A 3OKKB 4XMLH 1BX2A 1YEEL 4MAYA 1FZJB 1PNCA 3V4PH 4FABL 3FQXB 1K72A 4ZFGH 3BLKA 4I5BB 3D12B 1ES0B 2X3BA 2JCCB 4YZFE 1VGEH 4GRLA 3D3VB 3VWKA 2ADIA 3BCDA 3QP3A 4MBOA 4A6YH 5IP4A 1IGYB 4ABVA 5E8DL 3UOAB 3JTSA 3MJGX 3FTZA 4ERSH 3WU1A 2MOQA 5DYOB 2AI0L 3MLTB 5LGHH 1SYVA 5J9PA 1G9NL 1F18A 4GEIA 4R97C 4XNMA 4DZ8B 1A6TB 3N1QC 1T1WB 3SE9L 1D5BA 1SHMA 4NUMA 3WE6B 3ARWA 2H7WA 5IWLA 3OKOB 4TSBL 1IBHA 4HZ1A 4MDIA 3DX6A 2OSXA 1S78C 3NIDF 2FLBT 3BZ4A 4BSWB 3ILPB 2E9JA 3VE0B 2Q0ZX 3K4DA 3A22A 5F3HB 3BZ4B 5SV4A 5HGBA 2CGRH 3LH2L 4B27A 3QCTH 4ZS7H 4ANXA 1D6EB 1OF0A 4BZ2H 3BWAB 2E47A 1H9VA 4M7KH 5C0CA 3DTXB 1LE5B 1A6AA 1CXEA 3DLQR 2LTQB 1FFOA 1I9IL 2DQMA 3SO3C 1RUAL 4LP5A 2AK1H 1CXKA 5KBNC 3OXRB 3OD3A 5BV7B 4XPBL 1Z5YD 5E7FA 5HYJB 1QTYT 1SY6H 2EQDA 3UL4A 4G11A 2XI9A 5CNHA 1KB5A 1CD9B 4K3DH 4BV1A 1O7DE 1ID2A 3GXMA 5CILH 3UTZA 1BZ8A 4IOIB 5HD8D 3M1OA 4FXGB 5JPNB 4EI5D 4MGXA 1H0DB 5AB1A 3WKMH 5JQIB 4HPOH 3D0LA 3TZVA 3VYPA 1MFEH 5BZZA 4PWIA 2WYHA 1OAZH 2Z7UA 4J8RA 2XSKA 2ZJSH 5FM5O 3FSAA 5ILTH 3EDFA 3UMTA 3U7WL 3P3SA 5LDUA 4WCYL 4YXHH 1G84A 1I8KB 1RK0A 1V55B 3VFGL 5CN1A 2FQGA 3TFKD 4R3SB 3G6AB 4LCCA 1RJZB 2YQ2A 1BOGB 5T1KB 3C5JA 1RJZA 2DQUH 3BIKB 4NPKA 5IT2L 4RAUA 5F7FA 2APXA 5A2IH 3V4PB 3L9EA 3OKMA 4ZPTB 3SKJL 3MMEA 4P8QA 5AW1B 1GS7A 2JIXD 3MBWB 3GSRA 3VFTA 3RWDB 1Z0MA 1BZDA 1IFHL 2CO4A 3L81A 3WDHA 1B4LA 1U92A 5ISZB 2CCWA 5JHDA 2X9XA 1FN4B 3L5IA 3O9WD 3QQ4B 4LSDA 5F7LB 3RTQA 4IBWA 4ZD3H 5AAWA 1N8ZB 1KULA 3EHBC 3PGDB 1NC4A 3FL7A 1ZMYA 4MZ2A 3RBGA 4X4YB 2Z0UA 3BUTA 2XOTA 3WDIA 1YEKH 4AVKA 2QBWA 2YN5A 1AZUA 4GSDL 5IMMA 1A8ZA 4HLJA 2HFEA 3FONB 3CFKA 5IJVA 4ODWB 2GIMA 3L3KB 2COQA 4IBQA 3TYFA 3SCMB 4BWUA 2WBJC 3C8KB 4BH8B 3SGJC 1JCVA 1LL1A 3QJRB 4NO2A 2LLGA 2QKIC 2VLRD 1CDGA 2XIIA 3GSQB 5HDRA 1CTMA 1RP8A 4XODA 2CHWA 1AGFA 2DTSA 5D4HA 3UC0L 1JZ2A 4HUUB 3QWQB 3GI8H 3NJIA 2FJGA 4LKXA 1AGDA 3RVWD 4YPJA 3E6FA 5F1IB 1R9FA 3OLIA 3ULUD 2VDMH 2F5BH 3HR6A 4D7BA 4NT6A 4PJ5A 4WSJA 2QFRA 4H8WC 2UWEB 2A99A 4Y4KD 1A0QH 4YHLH 1JK9A 3MYJA 1QLEB 5F88B 1CFVH 1SEQH 4ODTL 5DU7A 3MGAA 4YBLC 1A6WH 5DHVH 4FQCL 3O4LA 1B2YA 1UACL 3N43B 2K6WA 3LVTA 2P49B 4G3YL 3GIVA 4HHAA 3AG2B 2CMRL 4RFNC 1OP5K 3RDTA 5CEZH 1UM5H 3HNVH 5MI0C 4MJ4A 3RDTB 4OJFH 3RZCB 4FE9A 5LBSL 2C9PA 2FHCA 1DVFA 5EU5A 4YXLH 1FA4A 3HG1A 4I18C 4FYRA 4PG2C 3V7AE 2XU9A 3NACH 1K2DA 2PTVA 4BJLA 2HKFL 5JIQA 3QEUA 5C0GA 2ZNXA 3QVAA 5FUZH 2YC1B 4X6EB 4EF3A 5HBBA 2O4EA 1WICA 1MHPL 4YSPA 3P0YH 5H37A 4K3JL 4N4YB 5DJAB 3FUHA 4EUPA 1OF2A 3CIAA 1VHPA 4S1RH 5IB4A 3IDYB 4G8FB 5MP6H 4MNQB 3EFOB 2B7DT 3H3PH 1YQ2A 4NNPL 3UTPD 3AY2A 2GHWB 3OAYH 3V8OA 1VB9A 3GSQA 2OW7A 4JFSA 4L0ZA 1B2WL 2GJZA 3MJWA 5G5DB 4BZ1A 4D94A 3LPFA 4IBVA 1ZA6B 1P9MA 2NOYA 2BSRB 4MA1B 3T6XA 2XTJC 4D0DB 4XXDB 3HVDA 3ZXAC 2ZUVA 1JUFA 1OD9A 2QSVA 2X9WA 1A64A 4NUGH 1U93A 3S35X 1TEFA 3AU1A 3JTSB 5EF1A 1OTTD 3QNXB 4TSCL 3T3PF 3VXMD 5CJXC 4M1DL 5E23A 2FYYA 2RFXA 5I16B 1TTRA 1IEAA 3O8XC 4JQIH 4RGOL 1QATA 4ZRGA 5AUMA 5HHOD 4HAFA 1EXUA 1GS6X 4Y8DC 3Q6GL 4X0NA 4YIQB 2MHAA 1U3NA 2VQ1B 2WYZA 3C5XA 3ZDZF 2WLYA 5J6HA 3TT1H 2BOBA 5EH1A 3ZZSA 4EI5C 4D7PA 3L3DA 1AQKH 5L4IA 4FXLA 5KTEH 1VACA 5HI4C 3VB8A 4PJBE 2CBQA 3VI4E 2N7SA 1ZV5A 3MMEB 2MSPA 4OCXH 2AVFA 3SZ6A 3TEWA 4WUUA 4TQIA 4ODHL 4CVXB 3BH8A 2XHNA 3EJSA 3CZFA 3T65B 2DWTA 4PREB 3FBQA 2MTPA 2AV1B 4JO3L 5EFIA 2EDJA 1JXFA 1I3VA 3UBXA 1BFSA 3W82A 3G6JB 4ODVL 5FB8B 1H6FA 2JI1A 3LRSB 3HCVB 2CAKA 2ZG3A 3TNMA 4I88A 5IHHA 2V2XA 1YJDC 2FEDC 2X4QA 1F42A 3O2VH 2QTVA 3BUBA 2JJWA 4RISL 4Z7QF 3MUJA 5E9NA 3HS8A 3MBED 4YFLF 2MNJB 3N6YA 2HJFB 5KN5A 2HRGA 3OJ2C 1AO7E 1NGPL 5CUSH 3D52A 1T7WA 1EFXD 1DBAH 4FQIH 5EC1B 3CSYB 1GJIA 4HCIA 1DBBH 1PLAA 2ZCZA 3G5YB 3AWFA 1W0VA 4AUYA 1DJYA 3WS3A 3D2TA 3ULVL 2VSCA 4FQPA 4W9GC 4PRHA 3VI3A 4G9FD 4F57H 1ET5A 3WLWC 1R3KB 4MD0B 3VXMB 5I76B 4NNPH 3VD7A 5KWYC 3O4OB 1GL4B 4YHNA 1TMCB 3L7EA 1NDMA 1XEDA 5C3TA 2YOCA 1DCEA 4JR9H 3MXWL 2Z31A 2O1AA 5JHDE 3HS0B 3R19A 2YSSA 4LASL 1YHPA 2XJLA 2OMYA 4M1GH 2XV3A 3ARTA 4JY5H 5G2NA 2CKBB 3M17A 1UD6A 5D1QD 3QO0B 1UM4L 2JJTC 1EMTH 2X7LB 2IFFL 4N6RA 4K3HA 4D0BA 3QPKA 2DM7A 4JN2A 4QF1B 4KHXH 5AB0A 3OKNB 4X6FA 2YKLL 2OL3B 4R7DA 3FZUC 1ZGLP 4JO4L 1JFQH 2DS4A 4KNUA 4DWHA 5LGYA 3L4YA 1HEHC 2K7QA 3ZHFA 1AH1A 2R0ZH 1P5UC 4PJAA 4NKIH 1JZGA 2NXYB 3TEZA 2MPAL 3QDGD 1D5ZA 1OF2B 1S7RA 3UTTD 4Z7UF 4EJ1C 3SGEH 1EXGA 4W9HC 2DQIH 3SPHA 3L7FA 1JHKH 1MWOA 3T4YA 1IAIM 4I1RA 2J2ZA 4HETA 3VACA 2MH4A 5L0QB 2IC2A 2IGFL 5CJQL 4GSUA 4Y1AB 1E8ZA 1MHHA 1CYXA 1QSVA 3OBAA 1TJHH 4NBYB 1IAII 1DE4B 5EU6E 3QQNA 5CP7B 2OZ4H 1PZBA 2GYSA 3E9UA 1D2PA 1U93B 4IRSC 5I75B 4NC1E 1UZGA 1XCQA 4QHNB 2E9IA 3PLYA 2WIMA 5AW9B 4QT5B 5H37G 4ABWA 7FABH 1JI1A 1KEGH 1TNNA 5C0ND 5SWSA 4PV8B 4ZUWA 3KLKA 4F58H 2X1PA 2D9CA 3PHQB 3MLWL 4AG4H 2HVJA 3KJ6H 3GF8A 1PJ9A 3EZ8A 3N3EA 4XPTH 1G9ML 5B1JA 3FFOA 4KI5E 1E5CA 3RFZC 3WCYA 4AVJA 1CE6A 3P9LA 1A3ZA 5DURB 1RZGB 3IN2A 2ZP8A 4ZX4A 2JB6A 1UKQA 3QIBD 4NJAL 5I74C 4AJVA 4F7KA 4H5SA 4MQSB 1R24B 1AHKA 1HINL 1T04A 3MAWA 1DVYA 1FNHA 2VLKA 4PGEB 3SJVE 5DK0B 3WO4C 3BZEB 2W95A 1U3HA 3L3IA 1OGSA 5GZOC 4IBSA 3G5WA 3GO1H 5F8RC 4B9CA 2PPDA 3BOVA 1EBAA 5F1OB 3VD3A 4PP2B 3FCUB 1LNUA 3BRDA 1V7NL 2EDYA 4PRHD 4GS7C 5CJOL 3K1DA 2ZKMX 3QUMH 3BYTA 1TTAA 3IXTA 2ICCA 4IU3B 1QFOA 2R7EA 3QJTB 3TJEL 4F9LC 1TVHB 3SKUD 4KNTA 4A6YA 4PS4L 4L1DA 3QQDA 3QPQD 3IETB 4V11A 4XNYH 3MI6A 3JQOB 4LLYA 2PMZA 4FZ8H 4ENED 4TUJB 3NK3A 3QEGH 2P45B 3N1GC 4GAFB 1W0YT 2R69H 2XTJE 3CXFA 1YCSA 3FQWB 2TSAA 4C56D 3WIHH 1BFVH 2EH7H 3REWB 1YDPB 5CIPH 1AANA 1BQRA 3KPLA 5KG9A 3O45A 2A9DA 3BRGC 1W91A 3UADA 4KI1A 3FULA 1I8IB 2X70B 5LO7A 4KH9A 3RVXD 3HS0A 5FKAA 4A04A 2NNAA 2VR4A 4U6YA 2ADGB 3UYPB 3Q43A 2EO1A 3QUKB 4ZO8A 4UTAA 5DD6A 1TKWA 3LB6D 1AS6A 3KL3A 1H6EA 3IN0A 3K2IA 2F6AA 4Z7OB 3HTLX 3PHOA 1IGIL 2VSDA 3HN3A 2EYTB 1C08A 1NANI 4HS6B 3CLWA 1OAKH 2X12A 3PQYE 1JBJA 2P28B 4WI9A 3UPCA 1K3ZA 4KJQC 5CILL 2A9ML 1KFGA 4YL9A 2HG0A 1BAFL 2I07A 1VRSA 3U4KA 1PPIA 5GGQH 2HCZX 5GGTA 4MJ6B 1W2KT 4WV1C 1YMMA 3NCEB 3C6EA 2OJEB 1Q4NX 4FZEH 4FFVD 5T3XD 1FC1A 1WD9A 4AIOA 1UXWA 2LT9A 3T4YB 1MAMH 3Q8FA 3CU1A 1YJDL 4OZGB 3D39D 4DCQB 4GRMA 4DETA 4KY1H 5DFWH 1NQBA 3FQXA 2QGEA 2QR0B 2YPLE 4ADGA 4JDEA 3NCFB 4POUB 4LSRH 1KYAA 4QI3A 5JPNA 2DLFL 4GYBA 4P46A 3BW9A 3KBHE 5CLXA 3WS6A 5KSBA 4QKXB 3HUJE 4NM8H 2XVBA 3IDUA 1SN5A 3WG7B 4C56B 3CFEB 3LKOA 1KCSH 4U6YB 4HV8A 1F2XK 1CF1A 3ASOB 2FO8A 5GS0H 3P11L 1NIFA 3AW5A 5EIIB 3PDOA 4GNKB 1JF6A 3N42B 5I1JL 3QR1A 2IBZX 5TDNB 4Q9CA 1IEBA 3QORB 2JJSC 4XO9A 4NN5C 4R5VA 1BOGA 2NY5H 5I30L 4RQQA 1MJJA 3A6CH 3DV4B 1OAKL 3H53A 1XFPA 2VKXA 3SKOB 2CGYA 5DO2D 1DUZB 1UTDA 5HGBB 2A0LC 4JQIL 4RGOH 4JL2A 5GRVK 4XN2A 2JI2A 3V6FA 4MB3A 1M71B 2V37A 3O41B 4M29A 2ZX9A 5TDOB 3WEOA 1QSEB 4TTDD 4ZS6C 1LK3H 4WFHD 3UEZA 2YRBA 5JR1L 5B1KA 3GMLB 2J12B 4W6WB 2HJLA 4LDCA 4LSSL 2BHZA 5J12C 4BRVA 4EUPG 1SBBA 4M7LT 1SOSA 1W6LA 4FNLH 3DIFA 5G5DA 1X7SA 4UINH 4WI0A 4WW2C 1RIVL 4M4RA 4N3TA 4R90H 1KB5B 2NY2C 4OKVA 4XRCA 5E8OB 5KYXA 4CMHC 2ITFA 3AXHA 2AXFB 3L5JA 1E3XA 2CPUA 4P99A 5AZ2L 3ARFA 3CFKB 4KI5D 3PPEA 3D2UA 4ZDHA 3KPOA 1E6JH 4FZ8L 3CH1B 1G7LB 3NEEA 5FPIA 4GRWF 2FYYB 2MRYA 2RFXB 3CHXA 1H6UA 3EJQA 1OM3H 3D39E 2P44B 4LVOC 4PJ7B 5H35A 2JKNA 3PL6C 4HFUH 2VQUA 3DBSA 3ATAA 3CQQA 1Y0LA 4PJGB 1WVZA 3G6JE 3O6LH 4X80L 2J21A 3LMJL 1S7TA 5I1LA 3MJ8B 2DIJA 2DJSA 3DVIA 3D50A 3JV0A 4ELKA 3DX0A 1OTSD 3SDCB 1OSZB 4PLJC 2VDRH 4WJ5A 2VTFA 1A3RH 2JXMA 3BVTA 3FC8A 5AW7B 1MNNA 4ODSH 5IESH 1V05A 2WO2B 3NIFE 5A1AA 1SZNA 2WWMC 1TQCC 3BI9X 4OUOA 4H13C 4AV0A 3Q6FA 3RQ3A 1HNGA 2R9HD 4G3YH 2G3MA 1CL7I 4XCEB 3NJMA 2YR3A 4L3ED 4Z7VF 1A0QL 3L3IB 4OVUA 5DUPL 3IDXL 1QI3A 2WXOA 5AKRA 5E94A 2WZPA 3RKDC 5B3JF 3MFFB 3G5VA 4K9EH 1JWSB 1K5NA 3QJHB 4A2LA 3IAPA 3HG1B 4PJ5D 4Z7UA 1VERA 5CD3B 1R3JB 5D6DC 4PRPB 2OX5A 1IBFA 1T0MA 4MCNA 2CLVB 4ZPVA 5DSCA 3SD2A 5KSUB 2R7EB 4PRIE 2WQSA 5ESQB 4FEMA 4J7RA 1RZFH 3EOYG 4Q6IC 1F3RB 3Q5YA 2YARA 4LAQH 4NBXB 1IM3B 1HHJB 3WYRA 1O5DT 3AREA 1L0YA 4Y2OB 1A7QH 5INCA 1NH6A 4U1LA 1ECYA 2YLKA 5KZCB 1X5IA 3O9WA 2GK0B 2OKMA 3CMOL 1RIHL 4OLWL 3TPUA 3FT9A 4TYUA 4AK1A 5HYJE 1S9YA 4QRPA 5AKSA 1V8HA 4UM8A 1NC4D 1NWOA 2ZCHL 1YDPA 3F83A 4HUWA 4N2FA 3V9FA 3ZY7A 3FTYA 5F1IA 2J7LA 1UD4A 1CFMA 2GVYA 1E9OB 2NW2A 3PPSA 3U36A 1DEEB 2BVEA 2XWEA 1CN4A 3MLSL 3BAKA 4Q4EA 3UAJA 2Z31B 4UTBH 1QSFD 4JVWA 2WJ7A 3R7QA 4R26L 3WLWD 5K1JA 1AS7A 5ELIA 2JKIS 3L5WA 4Z3IA 2VR8A 4F5CA 4H44C 3K0WA 2NY0C 2QQLL 4ZAKA 3V95A 3FSOA 2AEWA 1TLKA 3GIVB 2WP3T 2BO0A 4HHAB 3LNIA 7FABL 4ZO9A 1UWEL 3A3YB 3M88A 3U4BL 3VXSA 3ORJA 3GSNA 4DVRH 1P53A 1MLCB 4YGAB 5KANG 1VACB 4X4YA 3ZIYA 4TPRH 4HQQL 1RZKH 1V10A 1SFDA 3DXAE 4JG5A 2JKXA 3VXRA 5ECGA 1DFBH 3O2DH 3X3GH 1JWMB 5HHPA 4WTZA 3BE1H 3EOAA 4QRUB 2BP0A 2Q1EA 5L88L 5AB9A 3WJJA 1FZMA 4WSKA 2WVSA 3QCVL 1OGTB 1V3JA 4Y5YC 4F80A 1CURA 2K8QA 3VU2A 3NCCB 4HS8L 4WI3A 3QDHA 1I1AD 2G3XA 2D3VA 4L3EE 4Z18A 2X4QB 1JSYA 3GS0A 3KBFA 4G8GE 5HDLA 2AV7A 3N2JA 3MRHB 1KB3A 1BXXA 1VGKA 5IGXL 4PY7B 4HU8A 2QFPA 2Z1KA 1CFNB 3DUUB 4HVBA 4O9HH 4MS8C 2Z8VC 4KVPA 1ETA1 2GIXA 2YAMA 1J1PL 2XTSA 2MCMA 3DMMD 1WWAX 4XC1H 1RXLA 1JDDA 1Q1PA 5SWSB 2NY3B 3G5YA 1YEDB 4IJ3C 1JNNH 3P30H 5DWPA 4LNVA 3LXUX 2AAVA 3LVEA 5F1KC 4B9FA 3MRDB 4GXVL 4FMVA 4UNVA 5KYWB 4Y4KB 3GMRA 3JVGC 2CGRL 3LH2H 4U4BA 3ZE1F 4JM4L 5LBSA 3S8WA 4PCKA 1LMIA 3V6BR 3T0VA 1EDHA 4YIQA 3G6DL 3SEPA 4WWID 1AZVA 4QXUL 4L18A 4PN6A 1N3NA 2QADC 3TVMC 4EDWH 4G7YL 1K2DB 3OKMB 2NUTA 3DIDA 3S2CA 5L2KE 3HLKA 4LIQH 2G60H 4X4MA 3R06B 1B0RB 4JFFA 4ZNCD 5DZAA 3HN8A 2OM5A 4G6FD 1CICD 4Y9BA 1JZ4A 2JH2A 3V55A 4QRUA 1KCUH 3QYCA 4I9WD 1X3DA 4U1HB 3QIWC 1K8DB 3T0EA 1I1AA 1PY9A 1JV2A 2NZ9D 2X4NA 4GAGL 3IJ9A 1E43A 4ORZC 2VJXA 1X9LA 5D1QE 1MDTA 2N4IA 4KK9D 4XCYB 1KLGA 2X4NB 2Y7OA 1CLCA 3I9GH 3LYRA 4LT7A 1BLNB 4NZJA 3DOSB 4DK3A 4APQB 3ZYJA 1ZVSA 1OB0A 5C1MB 2E8ZA 3S48A 3OZKA 4JB9L 3X14A 1AXTH 5L2JB 1WPCA 3D85B 1N64H 1TNMA 4OZ4A 2P7TB 5JW5B 3H9ZA 5IMLB 4XB3A 2A9NL 5IIEB 4KKAC 2AJXL 1NIBA 1U8LA 2VDQB 4FCAA 4MXVF 2R4RL 1JGUL 4M1DH 3Q2LA 3FW6A 4FCHA 3PABA 3QH3A 2XRAL 3I75A 1SQ2N 4TUJA 4UF7C 1PEWA 5CD5D 3QO1B 2HTKD 2VW7A 2RCSL 3II3A 1CLYL 1KG0B 3OG6B 2E5EA 2BVPB 4UAHA 5LDSA 4UM8B 1HHKA 1XTLA 2CK0H 4YLQT 3K71A 1I3RA 5CEYB 5J56B 1CG9A 1B2WH 2XFXB 4XO4A 2ICEA 1BBDH 2ALAA 1XXDC 1AR2A 3AJ7A 2ZD0A 3DRTA 3F05A 4ZTPL 5TDPB 1IL1B 3H3PL 3GTTA 1JK9B 5I71C 2IDQA 5DK2A 3WMSA 1AHWB 1A4AA 4G83A 2OJZH 3SYAA 1HYSD 4QJ3B 2AXWA 2DWDB 2UXVA 4NQVA 3CZSA 3V5HA 3E0GA 4CSZA 1RFDH 1RIUL 2VDPB 2LAAA 3MRCB 4PRHE 3VI3E 4A2FA 1LILA 4JRYD 4KMQA 1MFDH 2KH2B 5ISZA 4KRPD 4DP6X 4J3OD 4CGTA 3RPKA 4YHMH 2AJXH 2Y3NA 1A1NA 1XGQB 1P5VA 4YXLL 3CQPA 1PX8A 1N12A 3AG4B 5E2WL 4BZ1H 1EVTC 2QSCH 5I73C 1DQMH 1MVFA 1T0NB 5HYJD 2WXIA 5DK0A 2XBDA 2N59A 2R23A 3A6BH 4QTFA 5KSAD 5HDBE 2IEPA 1Q0YH 4L3CA 4ONGH 4UDUA 1PZUB 4S0TD 2K4AA 3WEXA 5J1SC 4R8WL 4YHLL 2VERN 1FZJA 1LDPH 3HC3L 1HH6B 1M3JA 2C1PB 4UTBA 1B0GA 4MRBA 1SXSA 2DEWX 1MZYA 2AXJA 3B1TA 4MNGE 5I8OH 3WKYA 3FF7A 4O58H 1MY7A 5J6SA 3RX9A 5JNYA 3V6OE 1BQSA 1FIEA 3ASNB 4JGNA 3I6GA 2HZHA 4JS7A 4N20A 4M6OH 2C1OB 1CLZH 2N7AA 3T04D 5GSVA 5C09D 1Z3GL 5EOQH 4AZ8B 5ICZB 5DHVA 1UM5L 3HNVL 3EYSH 1MI5E 5F70A 3SDCD 2DQTH 4LHUD 1BP3B 4KROC 3VSUA 2Z65C 1IEBB 2G9KA 1DLFH 1MWAB 3W5MA 2XTJD 4OGXH 2VQTA 4NNYB 2IOMA 1HIMH 3LZLA 3VM7A 4APXB 3NA4A 5EZIL 2JJUA 4R7DB 4JREC 1ZSHA 2YEZA 4FQLH 1MIEH 3S37L 3PV6A 3BWAA 5I17B 1ILSA 2VH5H 4MXWL 4FQHB 4ZO6A 4ONHA 1BGXH 3PWPE 1XGUB 1CTNA 5I6XC 2PXYC 3WN5A 1AS8A 5D6CB 2ZUQB 2FQDA 3WIFA 2AZAA 1T5WB 4N2DA 5HHXH 2G5RA 3OAUL 1DZBA 1IAOB 3CFCH 1LNUB 4F9PA 1A4JA 4JM0A 5F7DB 1SLXA 1KTJA 4C4BA 1J8KA 4NNXA 5F7DA 1DE4A 3LPGA 4NNXB 4KMLB 1N8OE 1PLGH 3E80A 1NAKL 2GK2A 2VAAB 5GGUB 3LKNA 2NLJB 3T4AA 5BOPA 3QXDB 2CO3A 2ZJSL 3PABB 2VO8A 5ILTL 1OAZL 1XZ0B 5AOIA 4ZO7A 3QQDB 3A67L 4F2MA 1J11A 1W6WA 2EO9A 3T8MA 3C60B 1HU8A 2Y24A 3QIUA 4YDMA 4R7XA 2L7JA 2JWYA 4MD0A 1EXUB 3FB5B 4ZFOB 2PWEA 5C08D 2QMJA 5H4ZA 4MJ5B 2G4EA 4MQ7A 1UYWL 4KKLD 1MIEL 1JHLH 2PW2B 3D4ZA 3FF8A 2Z64C 2UZXA 5E8EB 2HN7B 2ZWLT 4Y5XA 4JL1A 4KQ0A 4LEOB 4HH8A 3NMEA 1B3IA 3QULB 4I48B 4QRAA 2V7NA 3WLBA 1AFVL 1CFQA 4KK5C 3MRRA 4NSKA 2FIKB 4ECNA 4R83A 5EIIA 1N70A 3FQUB 3O6KL 3MRRB 3OLDA 3RHWF 2I25N 4MJ2A 4P5SA 1OIOA 5LXGL 2AKRA 2KMWA 5FDWA 1ORQB 5A2AA 1PSKH 2Z0BA 4MFHA 1F56A 2JKLA 1I82A 5C0DB 3F7KA 3NN8A 3NQIA 3BEWB 1R46A 4JZJA 1KEML 3MNZA 3TV8A 3WNKA 3FO0L 2UUDK 1KIUA 1JWUA 4TSBH 5D1ZC 1A7NL 1TPXC 5DC0A 4WUKL 3SBWA 4NZUL 4WDIA 3GMQB 3OF6A 4Z7AA 1EGJA 2G2RB 2XV6B 3BP5A 3MCLL 1RZ8B 5GGTL 5BW7A 5TFSH 1B9KA 2O5YL 2UZYB 4R0LA 3BO8A 2ZKHL 2ODHA 5KVEE 5DUPH 3BAEH 4Y2OA 2CR6A 5IF0A 4LKCA 1PKQA 1OEZW 3UCRA 5LGJA 1GW0A 4OQTA 4OM1L 5JPMC 5TE7H 5BXFB 5L4JA 4G80A 3REWA 4WK0B 1I9IH 3TIDA 5BXFA 1WAAE 1RUKH 2E6QA 4CN6A 1WCQA 1URLA 2ADIB 3GRBA 2BNUB 1ODAA 5AOZA 5LNGA 5KVGE 1SGKA 2FLMA 1PZ5A 1OO2A 3DSFH 3HMWH 2ZYSA 4G82A 2F19L 1UUNA 3IS1X 1GJWA 3KYNB 4R7NA 4DF9A 5I8CB 1J1XH 4HFUL 5BMFH 3HI5H 3NFSH 3SGEI 2DWDA 4NQVB 5BRZA 3L3GB 5F7KC 3SE4A 2CNYA 1WIOA 2VSKB 2P1YA 1JHTA 1JPFA 4YHPA 4YXKH 5GXBB 3L2MA 5IMKB 2BHUA 2Q7YA 1KJVA 1J05B 1J8SA 1KGWA 1G6RH 4G42B 1TETL 3EFDH 1ZTXL 4JDTL 4NHCH 5C0DA 2J6EA 4KROD 4E42B 4P57A 4JN2B 2BDNL 3BX7C 2EICA 4Z0BL 5JHAA 4CBZA 5T5FH 5I8EB 3LNDA 4XX1E 4PR5A 3D0AA 4UV7L 4NXSA 1BMZA 4HXAL 3ABMB 3TZVC 5CJ5A 3BZEA 4ZFGL 4H4NA 1ECZA 5E2UH 5EA0L 1E5ZA 3MRQB 4U6XB 2NSXA 3HNSL 4WFED 5IQ9A 3HMWL 1J9SA 3MRQA 4U6XA 5SWQA 4XMLL 5DMYA 1LM8V 1XH2A 1AXSA 1A6ZA 4Z7NE 3Q1SH 2C1PA 1FYTE 4GW1A 1A8JH 2WVUA 3IXTB 1RAMA 5K69A 5E4AA 3LQMA 5CINL 5KYXB 3C87A 1BQHA 1AXTL 3IU4L 1UGKA 1OP3H 1EZUA 5FO7B 1FJ1B 5JIHA 2AJVL 1DVFC 2VN7A 3OM3B 5FO7A 1KV3A 1R34A 4WFFE 2VDLL 4LLWA 2CGZA 3B6SA 4JDTH 1HSBB 1XIWB 2FT8A 3QDAA 4E36A 5BRZB 1XR9A 2R1YB 1DVUA 3IGAB 5TFSL 5B3SB 3TV3L 1KTDA 3DVGA 5IMOA 3ZE1B 1WZ1H 4XWGL 9PCYA 3HHRB 1GCYA 2O5NA 4PGCA 5HPMA 4YDVB 2QELA 4AW4A 2QQKL 1JV5B 2XLLA 3SGDH 5I5IA 2IH9A 2TAAA 4IIQC 2VM9A 4OBRA 1SHXA 2D7NA 4MVBD 3BMVA 1KTLB 4NGHH 1FLTX 2X6CA 3A4EA 3H9SD 4PWGA 3LPPA 3WKNA 4Y4FC 4WEBH 4AMWA 2BVYA 3HZVA 2QTEA 3E7JA 35C8H 3OF6D 1E4KA 4QGTA 4NSKB 3LZNA 1FVDB 3EYVB 3QYNA 1QOKA 2AV1A 3H9HA 3DVNB 3QRFM 2D3LA 1JP5A 5TF0A 5FO8A 4ZSOA 1I1AB 3A4AA 4H8QA 3PFQA 2AJ3B 4OTXH 3D5OF 3U46A 1ONQB 3HI1B 4NQXB 1YN6B 4TVPH 1JZIA 1KOAA 2J20A 1GGIH 3RLSA 4KOCA 3STZA 5HY9A 3BISA 3W9DA 3NDZE 4MCYB 4EI6A 4YHYB 4QDGA 43C9B 5DHXB 3OGCA 3MSPA 4PCSA 2HLFC 1R5WB 3KPSD 3SDXE 1H0DA 1CGXA 1A7NH 4L1HA 1KWKA 4KFMA 4MJHA 5J6GA 4NYLA 5HVWA 4X9BA 4PFEA 3NTCL 1EAJA 3QT2A 2UWEE 3DX2A 1A4KA 1AGEB 5LQBL 1KTRL 3BKYH 3I75B 2I5YH 3T4AB 4A1RA 1ADQL 4HKZB 1HH9A 4NC2B 5I1IH 3MCG1 3KWUA 5B3NA 1BG9A 2UYLB 3PY9A 3MC0A 4O2FB 4LCUA 4JZJC 3L48A 2Y0SA 3I3DA 1NDTA 3AAZB 1QFWM 2ZOLB 2GK0A 4GO6B 4JPWL 4WI8A 3KAAA 1W8OA 2CM5A 2NR6C 4QTHA 1MNUH 4P9HL 3EO9L 1AFVH 3QUXB 1C8PA 4C83B 3S4SA 4BH7B 5MEND 2JXMB 3PF2A 3TH2T 5IW6A 3B2DC 2W9LA 4C83A 2MQ3A 1B4RA 4A7SA 3FMGH 5D72L 1JS4A 4G2AA 1DSWA 4HIQA 1PJWA 1A9VA 2YIHA 3X2QB 2JB5L 3KVPA 3PHSA 3CDGB 1T66C 1F2QA 4UILH 2CDFB 4Q9QH 1JOIA 3QXTA 4GB9A 2VMJA 5IFHL 1FFNA 4X8GA 2IFGA 5K9KA 2IAND 5CHNB 4IRZL 3WEAA 4PJ7E 4XI5C 3MFFA 2J55A 4FERA 4LSUL 4K23L 3IFPA 4HZLB 4JVPA 5KYUB 1A4CA 4NIYE 5EU5B 2CM6A 4X9HA 1TJIH 2GEEA 5I8EA 4PR5B 2HFEB 4TUOA 5TQ0L 2NY2D 1NCAH 1E9QA 2AXHA 2EH8L 1J0HA 1WJ3A 2IAMA 3V5DB 4A7TA 2K0RA 1IM3A 3BO8B 2BP8A 4E9YA 3RX8A 4HIIB 2CIKA 4MNQA 2BMKB 4RMRA 1RJYB 1BCIA 1D7BA 1MW2A 3SPCA 5EUOF 1T4KA 4Y5XC 4GW1B 3LQAH 4YHZH 4PB0L 4NT6B 4O58L 2C9UA 3VGDA 4IKNA 2Y7QA 5CKAA 2FL5B 4U3SA 3V2AR 5GRVL 1DBMH 3FQTB 4HCRA 4U3SB 5I15H 1MVYA 1JXGA 4KVCH 4DUVA 2A77H 1NCHA 3MLTA 5MENE 1S7WB 4HWUA 4UZGA 4QOKD 1EFQA 1FG2A 3UJTL 4DN4L 4PGBA 3W0WE 5C6WH 1XR9B 2R1YA 3T1WA 2EVHA 4CL7A 4MJIB 5BV7C 1RVFL 2OSLB 4Y2DC 4DO4A 3LNGA 4IOSD 2WQ8A 2QSCL 2WLLA 4HX1B 1NGYB 5IMKA 4LL1A 3VX0A 2FLRT 4WY7H 4FJYA 3HR5B 4XP4H 1CG9B 4RGNB 4MD4A 1XWVA 3BAIA 1CTOA 3BKJH 2WO4A 5E2VH 4Y4HB 4BM7A 1BFOB 5T5NG 5MEOA 1U41A 3JYCA 4NQDB 4PJXB 4ZX6A 3N06B 1RI8A 1BV8A 2VLKB 3EDKA 3U48A 3K7UA 1E4XL 2OR7A 3UAJD 3OTTA 4A7QA 4JM2D 1KC5H 3KJ4B 2FT7A 2GBUA 2M8XA 4TRPH 4XMVA 5A2LH 4M3KB 3GSXB 4Q2ZB 3ECQA 4PSPA 5FFLA 3K6FA 4XT1C 2BOLA 1INEH 3UDWC 1BLIA 2CO7B 1HHIB 5E95B 1X4YA 5GGRY 4LSTL 2YXMA 2HJKB 4M8QB 2VUKA 4HCFA 4XXDA 2PW1A 4XBPB 3RL1B 5FYKU 2AXGB 1JUFB 1XF1A 2N1TE 4OFYD 3AQXA 4S11A 1E4KC 3IGLA 4MCZA 4X7SL 3LEYL 2QADD 3TVMD 3UABA 2OK0H 1FO0L 2BSSA 1CD1A 3IF1B 4XPHL 1EMTL 2PWDA 1QTSA 2Q3ZA 4NN7C 2VLLB 2A73A 4RA0C 4XNXH 3RI5F 3JWNH 4N5UA 2X6VA 4LCUB 3MR9A 3RDTD 1NUDA 1PLBA 6PAZA 3R4DA 4OCSH 3WFEH 1O9ZA 3S5LB 3RVXC 2ZOKA 2FQFA 1C12B 3EYQD 1ZAGA 1X9QA 1TOXA 3EHBB 3QZWG 1A2YB 3G5ZA 1PX3A 1B6DA 5HVHC 4RAUB 3K6SA 3EGDA 1QHOA 1F3JB 2FT6A 2H6PA 4AW7A 1UEMA 4J39A 2WUBL 2WLHA 2O6DA 3GIZH 4FN0A 1UATA 2EC8A 1BZQK 1J9QA 3CZFB 3D18B 3EGXB 5ESVA 3T2NH 2MPVA 5DMIL 3IS0X 4WU5B 5IKCB 1JV2B 5F9OH 3VFPA 3S88L 2VDOB 4Z3TA 2QKIB 2Q87A 3RGVD 2XN9A 3C6LA 1GVIA 2E56A 5H2BA 3R1GH 3RAJH 4PJBF 1JWUB 4LSVL 4NP4L 1HSAB 2Z7ZA 2OX5B 3KDMA 3IDNB 4PWKA 3B9VA 5DI8A 4ONFH 4A67A 3HZMB 5FUCC 1D5XA 2JMRA 2XTLA 2APSA 5DGQA 5AL0A 2OJEA 4OBSA 1KT2A 1RHFA 2CUAA 1CDUA 2R51A 3FT2A 3Q5TA 2EE3A 1NMAL 4GAGH 4BH8A 3RHWK 5DMGC 4GKNA 5HSFA 2YN3A 6FABH 1C9SA 4QCIB 1MJ8L 4F7CB 1AOZA 5ICYB 1PTZA 1BIIA 1TZ8A 3FTVA 1P84K 4H8PA 1C12A 1MG2C 1A9BB 2PO6A 4GQ9L 1XIWD 1A2YA 3G5ZB 1JGDB 1UJ3B 3CFQA 4V2CB 3W9EA 2GSIA 5DZ9A 3H0TA 3T5WA 4UOW0 4NJ9H 3OKDB 5CFHA 3F00A 3O6MH 3UJJH 1JDAA 4LLVA 3KNBA 2ICWB 4U05A 3SY6A 1J87A 3FBKA 4H0LC 4DEPB 5JDJA 3PYCA 1YEIH 2WNXA 1EZSA 1ZHNB 3UZEA 3PJLA 3VFPB 1Z9OA 1KBPA 4PBDA 3LIZH 4YHOH 5EBLA 3OKNA 1MJJB 4ZMXA 1YYMH 2OXHB 2PTTA 2BLFA 3AREC 3IGFA 4MA1C 1U8PA 3RIFK 4X8CA 3NJVA 3QULA 5D8JH 3X12A 4L29B 1CFQB 1RPUA 1I1FB 3JBG7 5IOPB 4JZOB 1UYWH 3HHSB 4DEWA 2EVJA 1YY8B 3IJYB 4PJHE 1KELL 5IB3B 1B4TA 4C54A 2W0LA 3ZO9A 1OGTA 4Y2NA 1X4ZA 1ZPUA 1OW0A 4KKAD 3E2HC 2EINB 3PV7A 2FSEA 4L8CA 2GFBB 3B7YA 2HH0H 1RJYA 3H2PA 1B6UA 2HKFH 2YBGA 5FA4A 1GY1A 4H1LG 3VNZA 4Q6KA 4UOJA 4OFDA 1DQLH 3EJJX 3X1NA 4WU7B 4H2CA 5AZEL 5KUKA 5LBSH 1KCVH 4RWYH 4WY7L 2AQRA 3IAQA 4UZSA 4AKPA 4TQHA 2DYSB 1M1SA 3GRWH 4IGBB 4WI6A 5GGUA 4A2DA 3QIWD 2ZX6A 4DVRL 3AY4A 1HK6A 1E65A 2FJSA 1RVFH 3NZUA 2OYMA 3UZQA 3Q06A 1IIKA 4Z78A 2IAMC 1XCTB 3LN4B 2FCBA 3L4XA 4N0FB 2UZIL 3KWXA 3PWNB 3AMKA 4LPTA 4Z3FA 4AEHL 1XXFC 4LHUB 4GG6F 2DTML 2PWHA 1HHGB 2H26A 5EUOB 2B5IC 5FV1L 4Y4HA 4LCWE 5MEOB 3EXLA 2NNAB 1AKPA 3FU5A 4GW4B 4AL8L 5DWUH 2Z7YA 5JPMA 4DGVL 1GYCA 3WFCL 3WIAA 4WU5A 3OWRA 4P2RA 2BSBA 4E5XG 4PJCE 1N5AB 3OSKA 1AC6A 4GKSA 1E7VA 3W2DH 5AAMC 3GRWL 1RD6A 4IKIA 3ARDD 4AKOA 3WAKA 1T0MB 3ABZA 4FYSA 1RZJH 4OT1L 5AZEH 4HWZA 4P23A 4WHYG 3O4OC 1YAZA 4QR7A 4L4VD 4MDRA 3RFRA 2IWFA 2J88H 4OIAA 5I0WA 2CHNA 3MRJB 1GZPA 1MCPL 1P7QA 5LVEA 4I2XE 1VZHA 5BPPA 2BXYA 1RZ8A 4HLEA 1PD1A 4HOZA 3EOBA 4MHHG 3CE1A 1Q0XL 3CN3A 5FV2A 5LLIC 3EFFA 3OKKA 4NRZA 4AWJC 4OCNC 4JHWL 2E6JA 1U42A 1UASA 5F97E 1IZKA 2KDYA 2ZP9A 4JFDB 4G1MA 5HI5C 4I18A 2Z7WA 3ULAB 3B3IB 4QRFA 3IKCB 5L2KA 1XV8A 2EUVA 2DD8H 4P4KA 2PO6B 3B3IA 2KZKA 1ZT4A 4Y7OC 3CFNA 3BGAA 3AU0A 4OR1A 1EHNA 4PVNA 5E2WH 5C08B 1ZRUA 1KMGA 5DCCA 5MEPB 2ESVA 1P5UB 3DA0A 2NT0A 4R3SA 3KYNA 1RSYA 4GLRH 1HE7A 4FXKB 4R4FL 3TCLB 1UA7A 5FXCH 3LMJH 2CSPA 3REVB 1N2RA 4XVOA 4OV6F 3ATDA 1KPVB 1MFEL 1RCYA 1G5AA 5GJTH 1R5VA 5IBTH 5C3LD 1YEHL 2Q9OA 2VDNB 4YK4B 3W0WA 1YLBB 5FFOA 1MAJA 5M7QA 2GJRA 5DEFB 4OFVA 2XPGA 1L6ZA 2D31B 2WZ6A 4FQHA 2G30A 1EUUA 3UMNA 1XCWA 4XMKH 2HVKB 4OCMC 5F9WC 3LSOB 4ETQA 2NY4D 2C7UB 1D5MA 4L8SB 2ZSWA 2BVOB 3CFJA 4WTZG 4YDJB 1W8NA 3RY4A 5D2LF 3PGDA 4HD5A 3QPXL 2XKNB 1MFVA 4G59C 3CHPA 5IG7B 5C0AB 3JWNG 1KJ3L 2FECL 4YE4L 5KVFE 4H8UA 1XF4A 5G4MA 2FSEB 5CCKH 4GKNB 2J5WA 4L8CB 1BM3H 2JNZA 3OAZH 2IG2H 1E30A 2YAHA 3BD5A 1FL6A 4BFIA 3RFZB 4HG4K 3ECBA 2Y7QB 3IVKB 3BSZH 3R8QA 4RISH 1FNSH 2BNUA 2MQ0A 2R4SH 2HPTA 4E41D 2EC9U 3IVKA 1QG3A 4XN9A 1BVOA 4UYPA 1NDGB 5JO5B 3O8XD 1KCBA 5I74B 4AE1A 1ZJBA 3BDBA 4B6ZA 2ZKXA 4PQXA 4ZMLA 4NQDE 5L7XL 5I30H 1ETZA 3F7VB 4P46D 2NY4C 1CO1A 4OJYA 3B6SB 3C2AH 4LESA 3FCTA 1A7BA 4PG2A 5E6IC 4HXBL 5DUML 1PZ3A 4HGKC 4A66A 1LWRA 1RZIA 5GGQL 3QEQD 4ES8A 1DHKA 2DDQL 4NXKA 5FM8A 1KJVB 2CBTA 2Q7YB 4HPYH 2XKSA 4UOW1 2IALA 4FFYL 3AITA 2E6PA 4P2OD 4WV1A 3ZUCA 4NDMB 2OR8A 4ERSL 1NA8A 2E59A 2VR6A 5D70L 3VXTA 4N26A 4NM8L 1WAAA 2UY7B 3J2PA 4L8DB 2MCPL 2OMXB 3DWTA 3GBML 4UIKL 3D51A 4YSSA 3N04A 1KGYE 4M1CC 2B59A 4JKWA 4QRQA 4TXVB 1VA9A 1VFBA 4UQEA 4HIHA 2I7SA 1UH3A 3BDXA 5CJ8A 4QRQB 1IGCL 4UQAA 5TE4H 1L9PA 4LXFA 3UG3A 1WDAA 3GNML 1HFUA 4I8DA 3MBEC 2X28A 2YLHA 1KXQA 4XNZB 1F5WA 1U58A 1YN6A 2FATL 1BPLB 3N0AA 4NHUB 2DIEA 2P48B 4BFFA 1A4JB 1X5ZA 4H8WL 1MCOL 2D9QB 2FYVA 3B2VH 3QS3A 5DJ8B 5DR5H 5ANMB 3VXQA 3AS2A 2F74A 4JX0A 3ARVA 4CU7A 1DLHA 5DJZB 5EU3B 2X38A 3BGFB 2GT9A 4HF5L 4HJUA 3UH8A 3I6LE 2C3GA 4I3RL 1ZHKB 3QS2A 2YBRA 3QEGL 3V4LA 4Q0XL 3NABL 1YEJH 1IIIA 3BP6B 2C9QA 4MA3A 3SYPA 4WO4C 1OAUH 3K2UH 3FQWA 1D7CA 5E1GA 3V0FA 2W59A 1HOEA 1MWAH 1R1CA 4YDVA 2OXGB 3BAWA 3N43F 4LPXA 4I3GA 4K9EC 3ZTDC 4X6CE 4PRDB 1N59B 5AL8A 3BUPA 2XQYA 5E2VL 1V7NH 3GLEA 5L9DL 3NGBB 4WSGA 4AT6A 2ZICA 3D9AH 3MDJA 3WN6A 2Z8SA 2FEEL 5JW4Q 2IAMD 2XCMC 3JUYA 4JM2B 3ECWA 2GCYA 1AYOA 4GO9A 3U9UA 4ONOA 5DK3A 1QASA 2DQFA 2OTUB 2PYFB 3N1PC 3QCUL 1ZD6A 3EH3B 1HI6A 2BJMH 5CBAA 3GKWH 2DQFB 4M48L 4ZSOB 4EN3D 5IHZA 1UD8A 3KGUA 4RSYA 4UDTA 2V6HA 4OF8A 4TQ8A 1Q0XH 3CSGA 1AO7B 3U4EA 5HTSA 3DO3A 3GM0A 3MNMA 2A1WL 1DO6A 4CADB 1F4WL 3KXFD 2F5BL 3FH8A 3N40F 4WI4A 5E7BA 3QZBA 2YPKB 5MERA 1IGJB 4QXGH 3DURA 5K39A 4PJAF 5AW4B 2VN3A 3UACA 3UC0H 4D8PA 4EO5A 1A4KB 1AGEA 2QQNL 3KGSA 1UA3A 1KB9K 2ZCHH 3SN6N 3NYKA 4OZIB 3LS5L 1FZMB 5IQLA 3BKJL 4PJIA 5ISZD 1RIHH 3O9WB 3X13B 5LWYH 3OR6B 5KVEH 3I02B 1B4JL 1MCWW 3WHE0 3ESVF 3U1PA 4IGBD 4Z3HA 2YD8A 4YWGH 4R7LA 1I8LA 3VRLF 3SDXF 3IKCA 4N90E 3SYQA 5EDSA 4J3SA 3QR0A 5IK3A 4IRJC 3TBSA 3E6HA 3T3MF 2DM4A 2W88A 4LCIH 1JXJA 3HB3C 1SDDA 1FI8C 4X4ME 5B1AB 5HDQH 3OKDA 5I15L 2ERJC 2FGWH 3FTUA 4G7SB 5T5FA 1BVNP 1TZOA 4LLQB 3KYOB 4KRPB 4XPTL 2WXQA 2HX9A 3MV11 1IEAB 3MOAL 4NKIL 4NN6C 5DJ2B 5CBAB 1NEZA 3RGVB 3BSGA 5FEBA 3VMOA 4O2EA 1NFDF 3HOGA 4NNYA 5C0CE 1ZLUK 1DVQA 4RBPH 4XOEA 1M42A 3UG5A 1FNLA 4BQBA 2ZX7A 3US9A 4MMXA 4F91B 5HHOB 4X8JA 3FU9A 3CHSA 4R7VA 5C9KA 4CMHB 2YAPA 4EIBA 3ZTJH 1LE5A 4OB5H 3LN9A 4D8PB 1EO7A 4JG1H 2VDKH 3MRKA 3PFUA 1RUQL 4R2GB 4UV4L 1BQLL 3AMLA 1CICA 2YK1L 2GIYA