4ZK8A

Copper-containing nitrite reductase from thermophilic bacterium geobacillus thermodenitrificans (re-refined)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
294
structure length
294
Chain Sequence
b'IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTHQFNHAQKGAVAMLKVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
molecule tags Oxidoreductase
source organism Geobacillus thermodenitrificans ng80-2
publication title Structural insights into the function of a thermostable copper-containing nitrite reductase
pubmed doi rcsb
total genus 98
structure length 294
sequence length 294
ec nomenclature
pdb deposition date 2015-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4zk8A00
5LDUA 5I5MA 3NJMA 1T5KA 1VLXA 5B3SB 3PXLA 3TBCA 1L9SA 2VW4A 5I6LA 1QHQA 2Y69B 3NSFA 3QJRB 2WSDA 4HHGA 2BZ7A 2PPEA 3T6VA 4KNSA 4P5RA 1PY0A 4DP5X 3T6WA 4YSQA 3QJTB 4GP5B 2EILB 1JZEA 2IDSA 4AKQA 3S8GB 4YVUA 2IWEA 4JKNA 3L45A 1WAEA 2CJ3A 4EF3A 2UXTA 1NTDA 4PCYA 7PAZA 1AR1B 3IN0A 2QPEB 3BQVA 1NWOA 4A2DA 4GXFA 2R7EB 1I53A 2IDUA 4YSAA 4E9VA 1M57B 1IBZA 1F56A 1A4CA 5I6OA 2TSAA 1TEGA 2XV2A 2IWFA 2VSMB 2FNWA 2FQDA 3X1FA 2NRDA 3X2QB 1SF5A 2DYRB 1NPJA 3ASOB 1BYOA 4ZK8A 3GXUB 4L0PB 4A2EA 2CCWA 2VN3A 2XU9A 3CVDA 5E9NA 4DP4X 1HAUA 2DYSB 2BP8A 4DP8X 3PCYA 1DZ0A 4DP2X 1OCZB 4KO9A 2BW5A 2MRYA 3QJUB 4NAJA 4BDVA 2IH8A 4YSOA 3UABA 1L9RA 1NIAA 5ANHA 1E65A 1MDAA 3JT2A 1AS8A 2OCCB 2VSKB 4MFHA 1ZV2A 4BWTA 2X87A 2I85A 1JVLA 2BO0A 3NSDA 1NIFA 3NP3A 1AS7A 3AZUA 4KO5A 9PCYA 1IC0A 1IBYA 2VW6A 1ID2A 3CZUB 2IWKA 3N2JA 2ZWNA 1ILUA 1SFDA 4M3HA 1PZAA 4JHUA 1TU2A 1A3ZA 3EH5B 5A7EA 2XUWA 4E9YA 1WA0X 1L9TA 1KYAA 1JXGA 1ZIAA 2EIKB 1KCWA 3WKPA 3WI9A 1L9PA 1ILSA 3WNIA 4F7KA 1KBVA 2IDFA 2XLLA 1PF3A 2WO3B 2GI0A 2XVBA 4UF7C 2VM4A 3QJVB 2JFCA 3OD3A 2PCFA 1CC3A 4KO7A 3SBPA 1QLEB 1XMEB 1IKOP 1M56B 2J57A 2YARA 1NWPA 1V10A 1XB3A 2DWTA 5PAZA 1OE1A 2AZAA 3CVBA 3C75A 2LLNA 2HZHA 1V54B 5PCYA 4FA7B 1RZPA 1GS8A 3EH4B 4YSDA 2CUAA 3H56A 1OV8A 3NYKA 1GY2A 3AW5A 2H47C 1AZRA 1KDJA 3N55A 5B1JA 3ZDWA 1ZPUA 1HFUA 4FAAB 3H4FA 1UATA 2EIJB 3NJJA 4N8UA 2B3IA 5FC9A 3X1NA 1MG2C 2N0MA 2HX8A 4NERA 3FU7A 1OCRB 1V55B 4GY4A 4YSRA 2BP0A 1GSKA 4YVNA 2FTAA 4GP4B 5D4JA 1JZJA 4DPBX 1J5DA 3WIAA 2R7EA 2BZCA 3FU8A 4BXVA 4HCFA 1SFHA 3FSAA 1AOZA 3ZIYA 1WS8A 1PNCA 2FT7A 2GSMB 4A67A 2AFNA 2YAQA 5B7EA 1R1CA 4DP0X 4AKPA 2ZONA 5B7MA 1AZCA 3UACA 5B1AB 1CURA 2B08A 1A65A 1BXVA 1NZRA 1NIEA 3ZX1A 3T9WA 2PP9A 1PLCA 2GC4C 4HIPA 1CYXA 2FJSA 5B7FA 1SDDA 4WKXA 1AAJA 2OJ1A 4DP1X 1XB6A 4BDVB 1NDTA 5AZUA 3AG2B 3FU9A 4DP6X 1M9WA 1PLAA 3AY2A 3GYRA 1W8EA 1A4BA 3BVDB 4YSEA 2XV3A 3AG3B 1FWXA 1AG6A 3QJQB 5I6MA 3UGEA 1IUZA 2P80A 4K9JA 1JZFA 5I6PA 3V9EA 4PAZA 3X1EA 1L9OA 4UANA 5TK2A 2CBPA 3RYMA 1N70A 2VW7A 1L9QA 2ZXWB 4P5SA 4G72B 2EINB 4G7QB 2HLEB 2QPDB 2DWSA 4E9WA 1KGYE 1ZIBA 2Y1AA 3FT0A 3UAEA 4G7SB 5I28A 1RCYA 3ABGA 3FYIB 4DPAX 4HAKA 5D4HA 1SHWA 1ET7A 4KOBA 4NB7A 1AQ8A 4GP8B 2ZOOA 2AANA 2FQEA 1OF0A 2IDQA 1NICA 2YAOA 1PZBA 2GBAA 2VM3A 3TA4D 3S3BB 1EHKB 1RKRA 2E86A 4F2FA 1SNRA 1EZLA 1GR7A 5B1BB 1JVOA 2FQGA 3ABLB 4ENZA 3UAAA 3WNJA 2TSBA 2IAAC 1MZZA 3V9CA 1OE2A 3FSWA 4A2GA 3OMNB 2J5WA 1ETJA 2X88A 3AG1B 5AFAA 6PCYA 4DPCX 4GYBA 1AZUA 3SBQA 2PPDA 1DYZA 1GY1A 1PMYA 2HRGA 3NSCA 1WS7A 4UAHA 4A68A 6PAZA 1ASOA 1CUOA 3WG7B 1BXAA 3SQRA 2P80D 4YSPA 5EHFA 4A2HA 7PCYA 2QDVA 2JKWA 2AZUA 3OMIB 3ABMB 5TK4A 1ADWA 1E30A 1BYPA 1QNIA 1NIBA 4AKOA 3NP4A 3KW7A 3DTUB 2PCYA 1ZDSA 4DP9X 2FT8A 4YL4A 3FPXA 5I6KA 2HX9A 4AZUA 2I7OA 2BWIA 3ASNB 3HEIB 3ABKB 5F7AA 2J56A 4N4YB 3OM3B 3EH3B 1ET5A 4G71B 1FA4A 3CDZA 2RACA 2QDWA 2XV0A 3FPYA 4E9QA 2HXAA 3OQRA 4YSSA 5D4IA 1ZDQA 2XWZA 3AG4B 1B3IA 3KW8A 4W9ZA 1PNDA 2OV0A 3CG8A 4Q89A 1BAWA 2BP8B 2WO2B 2YAHA 4X4KA 1W6WA 1KCBA 1PAZA 1AZNA 3NSYA 4HZ1A 3WKQA 1WA2X 3QJSB 1J9TA 1MG3C 4BXSV 1MZYA 1JXDA 3DKHA 4HCGA 8PAZA 2YXVA 2XXGA 2DV6A 2H5UA 2HRHA 2YAFA 3FSZA 3NT0A 3X1GA 2CAKA 2GIMA 2UX7A 3NJNA 1E5ZA 4E9XA 3UADA 3DIVA 1XB8A 2MTAA 2FQFA 3H4HA 3PAUA 3TBBA 1OOWA 3IE9A 4WTQA 2PPCA 4E9SA 4BWWA 5IY5B 2BHFA 4CSZA 2BWDA 3S3DB 1SDDB 4TXVB 2IDTA 2GB2A 2UXVA 3HB3B 4AX3A 1J9SA 2UXGA 5AKRA 3T6ZA 1AS6A 1E67A 4G70B 4E9RA 3EF4A 5I5JA 3CVCA 1ET8A 4QKTA 4G7RB 1GYCA 4KOCA 1PZCA 3S8FB 3SBRA 1J9RA 1JZGA 1AG0A 1RZQA 2H3XC 3PAVA 3FYEB 3EHBB 4M4RB 1GW0A 1TKWA 1OCCB 1AZBA 1JERA 3PPSA 4Q8BA 3T71A 2BP0B 2YXWA 3NJHA 3NJIA 1NIDA 1OE3A 4A2FA 1YLBB 2FT6A 1OCOB 3G5WA 1FFTB 3PAZA 4KNTA 4BK5C 4HALA 3T6XA 4YSUA 2VMJA 3ERXA 2A3TA 2PLTA 2J55A 1TEFA 3D12B 2I7SA 3QQXA 1NINA 3S3CB 1KV7A 2GC7C 5I6NA 1URIA 2XYBA 2HX7A 1X9UA 2YAEA 3FQYA 3CDZB 1BXUA 1J9QA 3X1BA 1JXFA 1N68A 1PLBA 1JZIA 2AVFA 5B1JC 4AI7A 3NJKA 5I26A 1CYWA 2BW4A 1AIZA 1BQ5A 2UXFA 2Q9OA 3ZBMA 3NJFA 1BEXA 1BQRA 1JZHA 2YAMA 3NJLA 2IH9A 3FQ2A 2DY2A 1SF3A 3IN2A 1KDIA 3IBOA 4JHVA 3FS9A 1A4AA 1ASQA 3JTBA 4RH4A 2PP7A 2JXMA 3MX0B 4A66A 4YSCA 2CALA 2Q5BA 4HHWA 3IEAA 3FQ1A 5F7BA 1GS6X 2YQBA 3PLYA 2EIMB 3FU7B 2QT6A 4W1TA 4KO6A 4YSTA 3TASA 3QPKA 1NPNA 2FWLB 4KNUA 2XX0A 2PPFA 4E9TA 1SHXA 1HAWA 1X9RA 2W8CA 3MBWB 1J5CA 5B1KA 1JOIA 1AACA 2PP8A 1AANA 1KBWA 4F2EA 2XX1A 1SJMA 1WA1X 1A8ZA 3FSVA 2W88A 4QLWA 2GHZA 1BQKA 3GDCA 4HCIA 3TU6A 3NJGA 3OMAB 4CSPA 5I5IA 1W6LA 2XXFA 4DP7X 2YAPA 1E5YA 2UX6A 2PPAA 1PCSA 1ASPA 4BWUA 3U25A 1GS7A
chains in the Genus database with same CATH superfamily
5I5MA 2ZOKA 3WKMH 1WK0A 3TBCA 2HTKC 1WZ1H 3AS3A 1CGXA 1IIKA 3KWWB 3LHAA 4KTDH 1QHQA 3SYQA 5I17A 4HIXL 5MP6L 4KZ0A 4FQXD 1F02I 1U8LB 1PY0A 1QRNA 2CDGA 4PJDB 3IDNB 3CN2A 2CLZB 2EJ1A 5HHOB 2PABA 3P4OA 1MQKH 2ZNXA 1KTLB 5EBGA 4JJ5B 1CGVA 3ZTNH 4TSBL 1UD2A 2WXFA 1YEIL 1K8DB 1Z9SB 1AR1B 3GHBL 4NN7C 4RCAA 3IN0A 5DD0L 2P5ED 5ENWB 4JHZA 2BJMH 1YAZA 1HI6A 3L3IA 4QNPE 4IYKA 4ZFGL 5AOMA 2XG5B 4F7PB 4J4PA 5E56A 2WBKA 4FXGA 2ZAGA 1XF3B 2CE6A 3O11A 3O3AA 1BAFH 3DX2A 1CBJA 3OHXC 4K5NA 2NNFA 4EO5A 1X4YA 3KPPA 2DJMA 1IZKA 2BVQB 5IROC 3GJEB 2YRBA 1SF5A 1Q9WA 3F85A 4XE0A 5DJDB 4AQ1C 4PLJD 5E9NA 1AE6H 1VAHA 4MQTB 5KUMA 2J4WL 1YY9D 4D9LL 3BQUA 4DP8X 5FFLA 1A7BA 3ARGB 5JTWA 4R7DB 3BVXA 4FS0A 1IGJB 2KMWA 4CRPA 2WK2A 3H9SE 3NZUA 4HPOL 4LVHB 1OWRM 2QGEA 4DP2X 1U9KA 3NESA 3E1F1 3VMPA 1PVHA 1L9RA 5C0AD 1Z9LA 2IJ0C 5EZOH 5D7JB 3NG5A 1AS8A 1YNTA 4P23D 2HFFB 4MQXC 5AL0A 3RWDA 2HJLB 3INOA 5T1LD 4DGVL 1PD0A 1IZJA 3C9NB 3KR3L 4PJGA 4WSGA 2MCG1 3DMMB 1EV2E 5JLZB 3NP3A 4R8WL 4UQEA 5D7KE 1IBYA 3KPPB 4IIZA 1CE1L 2C1PB 3BZ5A 1WZMA 3N2JA 1NCWH 1OGPA 4Z9KB 4ELME 3QUYB 4AQ1B 3AROA 4WFHE 3LQZA 5C0CA 3HZVB 1MFCH 3OR7B 5JDSA 3O41A 2J6WA 3LV3B 2Y07L 2HG5A 1RUQL 1NDMB 4HLJA 5HDBF 5C8JA 5B4MC 3GFUA 1ONQA 2E7BA 2ZT9C 4APXB 2PCFA 4MB1A 3FT1A 1MWOA 1EJ6A 2FE0A 3QI9D 1A02N 4R4ND 4X42A 1PZDA 5D7JC 2J57A 1EX0A 4AL8H 3EDJA 3F01A 4XCFL 4FTVD 3B7TA 1T21B 3DJ9A 2D7TH 3JWOL 5ESAA 3QXDA 1Q9KA 3UTSB 2BFVL 5J3HD 1D5BB 3BWUC 3VNZA 3VRLE 2Z34A 3ARYA 3ILPB 2IPKB 3QJOA 3DOHA 1COBA 1OAYH 2AF2A 2VNCA 1PX4A 1MLBA 2EDWA 3VFNA 4X98B 4F2MA 5BUAA 2BMKB 3OB0K 5IBUB 1F1AA 1KY7A 3BDBA 5C0CB 4I48A 4RFEA 2WYTA 4NM8H 5FC9A 4OQTA 1KULA 2R4SL 4M7ZB 1BMWA 4ODXB 5D7SH 2QTEA 3K2KA 2NY4C 1CTMA 5TFSH 4GP4B 4OM0L 2ZUUA 3WIAA 1PKQA 3FU8A 2X4TB 4KQ0A 3DTXB 5A2CA 1YZZA 4K3EH 2YLKA 4MBRA 5E7FA 3SBWA 1OSZB 1TJMA 1AQDB 1U41A 5CINL 4DOHE 5CSZA 4EDXB 5D1ZI 1HESA 3C6LB 3F6LA 2D7OA 4OSUH 3V0FA 4FG6C 1Z0MA 4L3EE 4MZ2A 4GUQA 4LU5H 1D5BA 3VAEA 5ACZA 2N59A 4PRPB 1CURA 5LBSH 2IPKA 5I9QC 3ZX1A 4PJ5B 4QTFA 4HD5A 4OF3A 3SDDB 1U8OA 1C12A 1Z9OA 4FMVA 1AIFA 3AT0A 4XTRD 5HI5C 3NH7H 3BEVB 4M7ZC 3V6FB 4FYTA 1NSNH 2WLZA 2A1WL 2FYYB 5E1QA 1UOVA 2ATKA 3F7VB 5ACLA 4FFYL 1UCTA 4UDUA 3VD2A 1KJ2B 3NCJH 3FTGB 1NOAA 1FORL 2V6HA 3WMQA 1OSPL 4Y16B 3UJJH 1N4XL 3DX8A 4GMSH 2K3TA 2LU7A 4NZ8A 3RA7L 4PCTA 1K4CB 4HAFA 4TRPH 4JCMA 4TYUA 2NY5H 3CSBA 3RQ3A 4N25A 3OWRA 4JRXD 5BRPA 1XQ4A 2EINB 3ME0B 1AYOA 2L8AA 4GMSL 4AC2A 3CFJA 1AXTH 3M86A 4DPAX 5HYJD 3BEWA 3GLZA 1IAIL 1X5XA 3EIFA 3MROB 1P7QD 4J23A 1G6RH 3VM5A 2XZZA 4JDTH 4KHXH 1RIVH 2VLLB 5CKGA 5K9OB 4TKWA 3CN4A 5JZ7C 5L6YH 1K5NB 3DA0A 1GZQB 4B9FA 2D03L 32C2A 3FFOA 4JO1L 3RVXD 5I1JL 4N3TA 5EN3A 1UUNA 1CTOA 4P2RA 4WI4A 4N2LA 1LE5A 1JVOA 2IBGA 5EPMB 2AVGA 3KEDA 1G6RL 1THCA 3DVNA 2R8SL 2IQAA 1IGFL 3IRPX 2DL2A 3BPLB 4JFQA 3V9CA 2P8MB 4M9PA 4DSYA 4B7LA 4B53A 1ZK5A 3SGEI 2HTKD 2J7LA 4AT6A 3E8UL 4X99B 5EC2B 3WUWA 3ZKQD 1QD0A 2VL5B 4UM8B 2HVJB 2QSVA 4PG9B 1A7PL 1RJLB 5KVDE 2IVFC 4HKZA 1CUOA 1TO4A 1F86A 3KLAA 4DUWA 4MCMA 2R1YA 4Y1AD 1TFHA 1L9NA 5FYKD 4OLZL 3LRKA 1RY7B 5I1LA 1BA9A 2PYED 2EXYC 1EHXA 4AW7A 4BFFA 4M48H 1N3NA 4OD3L 5MP6H 3TYGH 1A0QL 2AITA 2BOCA 2NXYC 4YL9A 1F58L 4NQCB 3CCHB 3OV6A 4J3VA 2VDMH 4N9GB 3ELQA 3CX2A 1BFVL 1JTOA 5ITBL 1IM3D 1MQKL 3TOPA 3V7AG 1RSFA 1WFJA 1HILB 1KLGA 3CFBA 3ZYZA 1JCKA 2XWEA 3P3SA 4JFXA 1VA9A 1OXYA 4N2FA 1YCSA 3DK0A 4ZMNA 1P4IH 3A6OA 3SE6A 2FO4B 2CGRH 4PIRF 3V4UH 3QDGD 2GJ6D 5EV7A 2Y23A 4D3CH 2CCVA 4XI5D 5AWNH 1F45A 2XV0A 3STZA 5ICZA 2C7FA 1BVNT 1ZDQA 4QRTA 1OGTB 1ZRUA 3LEYH 2DAVA 1D5RA 4Y4KC 4CMHB 2NYZA 2YPKA 4PB0L 3L2MA 4BKLB 4U1GB 1TQSA 4HD9A 1UURA 3QK0A 4KX8A 1CD1B 2WZPD 3KGRA 4UBDC 1ZLWH 4LHUA 4HW6A 5LDSA 2PO6D 4FNTA 1JPGA 1MZYA 3MREA 1JL8A 3UIZA 4P2OD 5IF0B 3ULUF 2N1KA 4XP1L 1E4HA 3B5HA 3WFCL 4K71C 3NT0A 1W80A 4GKOA 4JM2F 4OLVH 4X0NA 5AKVA 1X5IA 2GIMA 4OZIE 2ZX5A 2AJVL 3TCLB 1IEHA 5C08D 1UEMA 1QNZL 4ZMTA 3DIFB 3SKJL 4KVNL 3JWNG 3PAUA 3FO9A 5CBEB 3LB6C 3OJVC 4Y1SA 3OL2A 5F96L 1U0QA 3O9WA 2D4DA 1WTGT 1DVFD 1MJJA 4BFIA 2Y7QB 5IT2L 2YFNA 4FLQA 1HEZB 4XX1E 3MA9H 3GSNA 2BHFA 3BKCL 3ZDYE 2C1OB 2V3FA 4RISH 2X4RB 3PQYB 2XZCH 5IB3A 4AUUA 1VPOL 3FMGH 4BK8A 2YMTA 4HEME 1WFMA 1JWUB 4GQQA 3QG7H 1PU0A 4MA8L 1ZVHA 1UVQB 5CGYD 5HGDB 4G1MA 2D73A 3KXFD 4JM2D 5L9DH 3EF4A 3UGUA 3WNNA 3DI3B 4CN6A 4JHBA 4ODUB 3BKCH 1WZLA 2WINA 5CJBA 3FSOA 1J9RA 4P2OA 4AENA 1SXNA 1I1YB 5L88L 3H3PH 3T4YA 4EJ1C 1ZGLM 3LCYA 5T3XL 5GGRA 3QG7L 3ARDC 5DMKA 3HMXH 2CO6A 2BIHA 4UOZA 1OCCB 4OLWL 4LKCA 6FABH 5KYYA 5I5RA 3VXUB 4PJ7A 3NJHA 3B7YA 4PJ7F 4F7EA 3O4LE 4UOW1 5HYJE 1GJIA 4JX0A 3VD4A 3L5JA 4I0CC 3PDOB 4BK5C 2BDNH 1E50A 5AB2A 3FQNB 3I3EA 2DKMA 2MFNA 4HC1A 5IHHA 3IGFA 2AJYH 4BZ2H 4XHQA 4MS8C 5GS0H 1FVDA 3PJSA 4HX1B 5EBMB 3U1SL 3P11H 4XNYL 2DBJA 5CHNB 1JK9A 5A43C 3KZ8A 1MI5D 1R3KB 1QKZL 4C54A 3NDZE 5BXFA 2W9DH 5F88B 4LSSH 2JK5B 2BDNL 1KJ2H 1TCRA 1U3HB 2QVMA 2IOMA 4CC0A 2BW4A 1F00I 2XNAA 1U8HB 1NL0H 2AEQH 1QUNA 1UH3A 1W9XA 3PU7A 4FI8A 3CD4A 5HGBB 1SY6H 4NDMA 1AFVL 3B3IB 1MHCA 5D5MA 3VTTA 3BAEL 1BQRA 4P9HH 1VDGA 2GIYA 5GRUH 2FATL 3CE1A 3FQRB 1XAUA 1YMHB 5HVFB 1OAUH 4LNVA 3M1BA 5KZCB 3ESUF 3SGDH 2O6CA 4E41A 5DA4A 1ZS2A 1MREH 1OW0C 2ITDA 3CFEA 3TO4A 2ZX7A 3WIIL 1UOWA 3QEUB 4Y5YA 3TN0D 4HKBA 2HT3D 4NQXA 3U2JA 4LGPB 4YE4H 2VWEE 3GEFA 4ORGB 4XN4A 3T0EC 3TASA 2XVLA 3TV3L 2FWLB 4MQSB 1RIUL 4LP5A 3GMRA 3BZEA 1U3HC 3QUXC 2GKIA 1JOIA 1OB1A 1NANI 1VF5C 2R1WA 4GAYB 2YD8A 4WJ5B 5DEFB 4AYFA 4LCWD 3WFHA 3FJTA 3TLRA 1A6VL 1I9EA 4YZFE 2OXHB 2FJHB 2WXHA 4RWYH 4U2YA 1UCBH 5HBBA 4HJEA 5ACMA 2R56H 2VJ0A 1NAMH 4Y19E 2ITDB 1F6AB 4JO8A 4JUTA 3EBIA 2YAPA 4NP4H 5I19L 4XP5L 2PPAA 4Z78B 1FNAA 3R7RA 5B8CB 4WO4B 3RFZB 4CUCA 2E6QA 3NJMA 3BXNB 2A5UA 3TVMD 1J8SA 3DRTA 5I6LA 4EZJA 2LAAA 3PJLA 4EBQH 3PY9A 4E41D 3QH3B 4Y4FA 5INDA 3ZYIA 4H8PA 4AIOA 3CDCA 4U6VH 2K45A 3KYNA 1U95A 1T0MA 4GFXA 4PJXF 4X5WB 4XXWC 1QZNA 2BCKB 4JKNA 5E2TH 2CJ3A 2H1LM 1PFOA 4XC3H 4I0PC 2DQJL 3JV0A 4M6NH 4H26B 5DDHB 1XXFC 3HE7C 1X7TA 1HCVA 3KLDA 2BVOB 3P77B 2E9BA 5AW9B 4Q52A 4JRXB 4YXKH 4IMKA 4X6DB 3QQ4A 2VN7A 4JM4H 4XBPA 1N18A 1T5WA 2VQ1B 1K2DB 3CU1A 1BDYA 2FQDA 1MCNA 2NRDA 1Q1JH 4E5XG 3NMEA 3PWUA 3U82B 4ZS6D 3TZVA 1BYOA 3THML 2DWDA 5FLUA 4HIEB 2YKKA 3DSFL 2Y4SA 4ICWA 1VFOA 5C0RL 4JFED 4X4ZA 4ZS7L 3ALWA 3BAYA 2CA3A 4FMKA 3STLA 1KTBA 3VU2A 2IALA 3DBXB 4YO0A 2DH2A 5EEYA 2FWOA 1OCZB 2IH1A 3CHQA 3JZYA 3KDMB 5IHZA 1T03L 2BIOA 3HZMA 4B96A 4MRBA 2VLRA 2OX5A 3I74A 5KBNC 1J1PH 2GJPA 3WXWL 4MA7L 4HLZH 1M4KA 2NPLX 5TDPB 4YXHH 4XN5A 3P77A 2WP3O 4UM9A 4Y19A 3TURA 1Q9WB 3AZUA 4XGZA 4CN1A 1RZIB 3ILQC 1DJWA 3WXWH 1LJMA 1ITBB 2NY7L 2Q7YA 3CFMA 3U7AA 1R47A 4WV1C 1HH9A 4EZKA 1K4DA 5A2BA 1BLNB 3IMVA 1JDAA 1CI5A 1N8ZA 5IW1B 1VZHA 3R1GL 4NI3A 3QYCA 2Y1VA 4IHOB 5DFVC 3TBSB 3UYRL 2XVBA 1J1OL 1KOAA 2XWDA 2FIKA 3EHBD 4PVNA 5KYWB 3O0RH 2IG2L 4FABH 5D1XA 2Y5EA 4M5YH 2V2WB 4HKJB 1D5ZB 3QWQB 5C0CD 4BCYA 4PTTB 2VITB 2MCAA 1KIQA 2CDGB 3P4MB 1G1CA 5BJTB 5CN3A 3OKDB 4ZQKA 3C8HA 2AQ2A 4YSDA 2NSQA 5DD1L 2OXGB 4PS4L 2F8OA 4DGYL 5DR5H 1HFUA 4A6YB 4K7PX 1PLGH 3HJEA 1B0IA 5IIEB 4U1NA 5C9JB 3L9BA 4ZUSA 3ARBD 3IMBA 3IU3A 2WQWA 4XNAA 3EJCA 2C3HA 4JAMB 4YSRA 4ECNA 1ZLUH 4NT6A 4XXDA 2EEFA 4QAWA 1QSFE 4OCYH 4YDJB 4JM2B 3DYPA 3I6LE 5BRZB 1X7QB 1ZHLA 2HLAA 3C8KB 3CFCL 3OJ2C 4QYOB 5CJOL 5EO9B 3VXME 1KEML 1RJZA 2GSMB 2VXSL 4MDRA 2GJ6B 2ZUQB 4XAKD 4FOMA 3F7YA 4X6DE 1ECZA 2X44D 1AZCA 5FX3A 1VFAA 2FX9H 2WD0A 5C0CE 5CINH 1DBBH 1N9PA 4N90D 2QPFA 2WVTA 2BERA 3CFCH 3MU3A 3AY4A 2E47A 3DDGA 5E0FA 1OTUD 4I3SL 5IMKA 3SJVB 5GS3A 3U79A 3D69A 2C9AA 1KB5A 5IFJB 4BM7A 1AZZC 4B9PA 3V6ZB 1W8EA 3ZN6A 1J10A 1UKQA 2CBOA 1JHTA 3D18A 3WDIA 4UOW0 5C07B 5D2NA 1KNOB 4EOWH 3HCVB 1ZS8B 8CGTA 2ZPKL 5ICXA 3L3HB 4Z7UA 3D0AA 1YEEH 5C0EA 5TK2A 1ZLEA 1DQLL 3QWRA 3L81A 2VW7A 4P5SA 9CGTA 5JDSB 4ES9A 3RVWD 4DN4H 5LN8A 1NGWB 2DWSA 3R0MA 1QQDB 3V10A 3FT0A 4G9FD 4EOWL 3LVTA 3QEQA 1CF8H 4Z77B 1BOGA 1SHWA 2VR5A 4UNIA 4XAKE 2Z93A 3VNYA 2WQVA 3AWFA 4PWEA 1BMGA 1EEYA 1JF6A 2AJZA 1OF0A 3HG1D 4QXGH 1XZWA 2DIAA 2OJEB 4L5FH 2X1OA 5GJTH 1Z9NA 4W9KC 4D9QE 4WGVB 3RGVB 4NRZA 1I9IL 3ARFB 4YE4L 4OZIA 4JO5A 3FUJA 1QASA 3D18B 5HDBB 1AH1A 4A6YH 4FFTA 1ZT1B 3R0NA 3WL9A 4RLDA 2F53D 1MIML 1ZS8A 3LNGA 1UHVA 3BCDA 1Q9LA 3HUJA 2TSBA 1I8MB 5FYJD 1DJYA 4TS6A 1S9WB 1NFDB 3K4AA 3S9DB 5D2LA 3IJ7A 4PPTA 3AG1B 1XR8A 4RRPG 2N01B 2NLJA 4W4NA 4HWEH 5CAYB 3ULVD 2E7MA 1H3PL 2K70A 2PYEB 4YDMA 2PNDA 4M43L 3IJ8A 5HPMB 1A7RL 5J57B 2CU9A 4UTAH 1G84A 2NR6A 5FF6A 1YJDL 4U1KA 1NCJA 4RSYA 3LMJH 2XBZA 5IUSA 2DYPD 2JKWA 4EDXA 5BQDA 3U0WH 3C6LA 1KXQE 2NW2A 3VSVA 4Z3FA 5DWPA 4GO9A 1OSZA 4H20H 4WUKL 3GHPA 4AKOA 4R7NB 3KW7A 3CMOL 5CSZB 5AZEH 1OOAA 1I7ZA 2A6IB 3VWJA 3CBKB 3GSVA 2CO7A 1A6ZB 1LK3H 3K6OA 1A6TB 4AZ8B 1QACA 5DVLA 1IJ9A 2A77L 3LS5L 2NW3B 2C7UB 1JTPA 3ZMNA 3RWEB 1OARH 3S37H 4G6AC 4TLUA 4KNQA 3ASNB 3F7VA 5HHMD 3RKDC 4R83A 4X98A 1TYJA 1RUPL 2W07A 4M03A 4MDJA 3TJHC 4JREB 2V7HB 1JXKA 3EH3B 5L7XL 1QW8A 2F1BA 2Z7UA 3V0VA 4PSPA 3DHUA 4ZW3A 4OB5L 1JV2A 4PJBF 3QP3A 1ZT7B 3H42L 4YZFF 2A4CA 2V2TB 2XWZA 5EUOE 3LKNA 4M8RA 3LPWA 3HC4L 4X7CC 1BVOA 4NQCE 5MEQA 3MLUH 3WTVA 3G08A 2EDMA 2XC8A 1H8LA 4I0KA 4J3XA 4XN8A 4M7JL 4POUB 2E8YA 3ZHKA 1DBKH 5FM8A 5L2JA 5CFHA 1OTUC 4KRLB 5F70A 3WXVH 4BQ6A 1XH2A 2C7UA 4TVPL 2Z7YA 4JFXB 3TO2B 3TWYA 3L1OL 3CXHJ 3MRNB 3WTXA 5KS9E 2Q86B 3RL1A 4A04A 1UOLA 4L4VB 2E7LC 3MJ8A 4IBSA 1E5ZA 4D9QD 5BV7C 2JKXA 4KROC 1U8PA 1WFTA 1XL4A 2QSCH 3OPUA 5E7BA 3UTSD 4P46B 2LAGB 1JXJA 3H4HA 1C16B 2X2IA 3ZE0B 2H8PB 1OGAA 5I66A 3KXFB 3WJMA 1XHHA 3NIGE 5IJBC 2ZX6A 3HFMH 5DRZB 1XVSA 2Q8BH 4RAVA 1HHIB 1YMMA 3VJ6A 4BH7A 4CSZA 5IY5B 2VL5A 2VR8A 2WXKA 2OFQA 4ZO9A 5D70L 3UO1L 4Z3TA 1KWKA 3S8WA 3B83A 3C2AH 3PS6A 3AXIA 1UM6L 1E67A 1OLZA 4PJHA 2FAUA 4CJ0A 4K9EH 5J9PA 2EP6A 5HD8D 1F0LA 2XZCL 3DVGB 2AQ3A 4P5TA 3QIBB 4HVBA 3AWEA 3UYRH 1A14H 1J1OH 1FV1A 3HBGA 4U0QB 4M7LH 2EH7L 3BEWB 3TIEB 5MEOA 4XODA 4ONHA 4Y9GA 2HLFC 2XCMC 4H8WL 4PV8B 3HMXA 4OF5A 5DRXB 1AZBA 3KPQA 4PJCE 3AS2A 3SDDD 3CSFA 4V1DE 4B9JA 1E9PB 1DLHB 1U8NA 2JKTM 3T71A 3FB8B 2YXWA 1MKFA 3BQUD 4PBWD 3WEBA 2J71A 4GSDL 3SE3C 1QFWH 3G04A 4L0ZA 2JF1A 3OLDA 4P48A 3ERXA 4WGWB 3RZWA 3FCGA 2HWZH 5LO7A 3C5ZC 4BJLA 4D8PA 4M5ZH 1THAA 3JQOB 4EI5A 2GSGA 3VFGH 4O02L 5DMYA 4L9LC 1KBPA 3MJ9L 4JVPA 1FYTE 1Z6JT 1MPAH 2XQ0A 4ALAL 5BO0D 5LQBL 3QIUB 4J4PD 2OR7A 2YAEA 3P9MB 1BXUA 4JK0D 1BQLH 4APQB 3E6HA 1M53A 1INDH 2O5ZH 2MJWA 2OSLA 3J27A 5BVJB 4L0YA 2CPCA 2N0KA 4PBVC 4UT7H 4RGOL 2C9VA 1BVLB 4N2BA 5H94B 1XWVA 3MBED 1M6OB 3DTDA 5F9JB 4KK9D 5LXVA 3P69A 5I1DB 1S7QA 5EBLA 2BOBA 4LLVB 1INQB 3IF1A 1FZOA 1UT9A 3VSQA 4YGVA 1FAKT 1TJXA 3ZRFC 4UT7L 1W15A 1DL7L 4N6RB 1M3JA 2W5PA 4F7MA 4K4KA 4OKDA 4PY7B 1NFIB 3L4XA 4K23L 5KTEH 1YAIA 1WWWX 4G9DB 4GOSA 4ZX5A 4ZPTA 1M7DA 5KG9B 3D2UD 4YC2B 2ZP9A 4KJPC 1E5BA 5KSUA 1GZPA 2NCMA 3LX9A 4RVBA 3ULUL 2UZYB 2MHAA 3TV3H 4Y2LA 1XGUA 4I0PD 4NKDA 1IQWH 1B4LA 1P1VA 4PWGA 3F7RA 4QXUL 3GM0A 4CNIA 4DN4L 2Y6SC 5IEKA 2A2QT 5EOTB 2PWFA 2WMPB 1BHGA 2ZAIA 3L3GA 3ML8A 5E6ZA 4NQEB 5T33L 5EDSA 4DP7X 3CFKB 1NC2D 3QQDA 4JO3L 4NQVB 3KCWA 5F44A 2AS5M 3DVNB 5LNGA 2IQAB 3TNNB 5T3ZL 3JWNH 4WDIA 3KLHC 4K3DH 3TGXA 3VVWA 4LL1A 2VDRH 2VUKA 5IEHB 5DU7A 4HFWA 1PG7W 3AU1B 3S96B 2OJZL 3QJTB 5DT1L 3TXAA 1GZPB 3HKFA 4OD2B 2IWEA 4ORZC 1XGUB 2GYSA 3BH9B 3GI9L 2XBTA 3DETC 3Q2CA 5EUKA 3WY4A 3VVVA 3FQNA 3SE9H 3RPIB 4LAQH 3RVUD 4I88A 3A0OA 1RIVL 4XCNA 5I1KL 3RWIA 4HMCA 4NQSB 2UWEA 1VFBB 4HOXA 2DTSA 2ESVD 3QXWA 5J6GB 3GLEA 5HHXH 1YEFH 4XVUD 1OIOA 2TRHA 4OCMC 2CRIA 3OQ3B 2VO8A 2P44B 2BS9A 3CV5A 4R5VA 4MD0A 1A64A 2EQDA 1D7DA 1UD6A 1XH1A 3UBXG 3EOTH 2W60B 4NKOA 1U95B 2WIMA 3CMOH 3O9WC 2DS4A 3CHSA 1IC4L 3IDUA 1NGPH 4QCIB 2NY0D 3H2WA 4U05A 1HAUA 3QDMD 3GSUA 5BV7H 4ANKA 4O00A 5K9QI 1SJXA 4WWOA 4AYGA 1YEHH 5K39A 2BSSA 4CADA 2ZWZA 3B9DA 4ZYKB 4C55A 15C8L 3FQXA 4TMPA 1C08B 5AYUL 4UT6H 1MCJA 4JLRA 1JGEA 1FYTA 1UD5A 4ZXBB 4TNWF 2WANA 5ANHA 5C09B 1G9EA 1Q72L 3OKMB 4I1PA 4XHJC 4RMRA 2W59A 4DGIH 2X1PA 5DJ6A 4I7ZC 1WITA 4ISVB 3D06A 5GGVY 3MGTA 2VW6A 3IDMA 5I0WA 3FRPA 3RY5A 3C2SA 1SFDA 4R4FH 3RWCA 1ZT4B 3MKKA 4GQ9H 2JSFA 2H0FA 3WFHB 1BFVH 3K71B 4Z76A 1L9TA 1KYAA 3RJQB 3OKNB 3WY1A 4PGCA 4LGRB 4E42B 3G7TA 3EFOA 5F1SA 2CGRL 2VM4A 2Y07H 4OF8A 4YHNA 1ZGLP 1VZIA 2E3VA 2V7NB 1RUMH 3VTMA 4BK5A 5JQ6L 3II1A 2WQAA 5A2AA 2PTUA 4X7SH 2GK0B 3IETA 2QHRL 4WFFE 5GXBB 5D72H 4R0LB 1MFUA 3K6IA 4XVTL 1JPFA 1DE4A 1OPGH 2Y2YA 3K2IA 5D6DC 2XKUA 2BFVH 1IE5A 3H4FA 4HJGA 3QYMA 5AALA 3QRGL 3HS8A 4U6HB 4G2AA 5DEZA 4HMDA 4XCCL 4DFIA 1ZOXA 2YPLA 4NM4H 3O4OC 4G5AA 1HOEA 4YVNA 5BZZA 1OAQH 3VXMB 4DPBX 1USZA 2YA2A 4R97C 5AVYB 4ZUUA 5I74C 3IVKA 5F7EL 2I9LB 3APFA 5MERB 4H8VA 1HL5A 1Z7JA 1TJIH 5A2IH 4MKTA 3FOLB 1IKFL 3RBSA 1AOZA 1T83A 4AYMC 1MF2L 5EF3A 5I6XB 5DUBA 4V2BA 3FRPG 3VYPA 5EUOB 5B7MA 2J2ZA 2B4CL 2OZNA 5B1AB 2BHUA 2Z8RA 3K2UL 5MHSE 2NT0A 4Y7MA 1U3JA 3VD1A 4IKIA 3UP1A 3RL2B 4YN3A 4XHJD 1KG0B 2YKLH 4A7VA 3FUHA 5IVXA 4CSSA 3ZT6A 4YMPA 4N8CH 3AT9A 5E2UL 3ARDA 4XOCA 1EDHA 2J3SA 1U8HA 4KMTL 1YQ2A 1CDHA 3TJEL 4XO3A 2FLBT 1FH5H 4EQ2A 1KYFA 2DQGH 3AG3B 4MJ6B 1FI8C 3S4SG 5TDOB 1Q90A 2VZOA 3WJLA 1MXDA 4S0HA 2BZDA 3EO0B 2VDPB 1L9OA 4XOBA 5HVGB 3QULB 5E2UH 5HYSG 2EC8A 1KCSH 4GKNB 1H3GA 3CJJA 4F1ZA 3EOAB 3MTXA 4TRPL 1FJ1A 1BX2A 1WTLA 5DHVB 5IB1A 4MVBD 4JQXC 3S5LG 3DOIA 1WGVA 4JO2L 3CK0H 4XVUC 4EVNB 4LLYB 4Y4FC 1P4LB 1ET7A 3V5DA 4GUPB 4BV1A 1OM3H 2KLTA 3I6GA 1GPOL 4LESA 4GP8B 4Z95L 3EJRA 4NNPL 3RI5F 1NGZB 4BIKA 3Q6FA 1PYWB 1T7XA 4QRFA 2V17H 4FYRA 3TEXA 4M1GL 2VDPH 3V52H 5FGRA 3RVUC 4HKXA 4LIQL 3TA4D 3GBMH 4TQ8A 5A6LA 2XJKA 1LO3L 4I0PA 4BZ1L 1NFDE 2AJXL 3GKWH 2BSCA 4NWUH 1W72L 1EZLA 1IAKA 3ABLB 1BQHB 3T3PF 1VGKA 4QHNB 1GPOH 4OZGB 4M29A 1NFKA 1DQKA 1TSRA 2CSPA 1WFUA 1IL1A 4NNXB 2FATH 2Y3AA 1OW0A 2J5WA 4L4TB 4JKMA 4PR5B 2X88A 3ZTJG 5F7KC 4JY6B 5FECB 5CIPB 4QRRA 3L4VA 3QJFB 4R90H 4KBPA 1DYZA 2B5IC 5E00B 3T0EA 1I8IB 2LW3A 2XKSA 4IDJH 1EXUA 4KK6C 4XBEL 2NMSA 4YDIL 3V5DB 4OGYH 1GJWA 4NRZB 2EVGA 5B3JE 2AAVA 3ARPA 4F37K 2LV4A 2F53E 3JV5A 2FIKB 1CK0L 4FP8L 2HUEA 5KZCD 4MNQD 2ZAHA 3QEQE 3QDGB 4V11A 4WNJA 5E1HB 3ZGIA 3DX6B 4TSCL 2BXZA 3IFNH 2VDRL 4L29B 5HJDA 3U36A 1EERB 2QL1A 1WLHA 3QG6A 4WJG3 1F3DH 1H3VA 5GS0D 2OP4H 5DHXB 4UQBA 1NC4B 5HPOA 3QSKB 1TJGH 2WNXA 1S7SA 4QPEA 4Z3IA 1JYVA 1Y6MR 3GSWB 1TNNA 1ZGLB 2H0EA 3Q01A 4Z8FH 1KJMB 1DUZA 4J6IA 5HGHB 2MKLC 3MHZA 2Y9RT 2J73A 5F6HI 2EXTA 5KOMC 1FA4A 1WP6A 3DRQB 2XVGA 3PNWB 4Z18A 1HNFA 2YD0A 1KT2B 1RUPH 2B39A 3SPGA 4P4RB 1B3IA 4ZPVB 1P7KB 1FLRH 1PNDA 4Q7DA 1DFBH 4WKZA 1BVZA 1KGXA 2BP8B 2YAHA 5J8OA 2C9PA 3FCSA 1MHEA 1Y18A 4S1SH 4ONFL 2DQEH 4OKVA 5DVMA 4JRYE 5F9AC 1INEH 3HE7A 4BXSV 2BJML 3DKHA 4HYTB 4F15C 2BY3A 2D2CC 3H6AA 2ADIB 5KSVB 3GSWA 2GSIB 1I7RA 2A38A 5J1SC 3FSZA 1T4WA 2XQYG 4FQCH 2MWCA 2YQGA 3U0PB 3KXFE 4L1SA 4NJ9L 4G1EA 4QOKB 5LLIC 3MNWA 1NMAH 3DIVA 1E8XA 2QGCA 2M2DA 3VD9A 3L3KA 4FI7A 1ITCA 5IMMA 3OLGA 2HH0H 1JHTB 4RSVA 4XP9H 4ZXBD 3IDYB 5FUOH 1O6SA 4WTQA 2DM7A 3FT3B 5ISZD 4KKLC 3THMH 1TVHA 1KB9J 1H9DA 3S3DB 2H3NB 3SDDC 4JQIA 1CE6A 3F64A 3MRBA 4X0KA 1JHLH 2NY6B 5AKRA 4Z7WF 4FZEH 2K7QA 4N2NA 4GQ9L 2GCYA 2E7DA 5TE6L 1ED3B 4AE1A 1I8LC 1HDMA 2F54E 2DBLL 4GRWH 1DR9A 1KIQB 2IH3B 1SLVA 4B97A 4GO8A 3FONA 1JZGA 3H9YA 2OMTA 2DI7A 1IM3B 2WW8A 3D39E 4MWFA 3AS0A 3FYEB 1KN4H 1UA3A 1GW0A 3BN3B 3S5LA 2W65A 1A6ZA 1NCWL 3JYCA 4N5UA 1KUMA 4QRPE 4WV1A 5AVTB 1MFAL 4LARL 5D7LA 1NKGA 2KS0A 3EBHA 2J8UE 3VG9C 3FZUD 3NDYE 2PR4L 4PV1C 1RUQH 3GMNA 5KSBA 4JG1L 1UM5L 2FSDA 4IRZL 4N85A 2OW6A 2Y2TA 1RP9A 3HI5H 3BW9B 1E4XH 4LSRL 3IJHB 2CJUH 1MFAH 4QYOA 2NSMA 3HG0A 3P3TA 5LGHH 3X11B 3IWVA 5MENB 3BUBA 1YYLH 2COVD 1ZT7A 3EYQD 2V2TA 3T4AC 3KLSA 1FUNA 5BO1H 4KKRA 2CRMA 4HSQA 3B9KB 3QXUA 1GOHA 4N2EA 2ZKHH 4AVJA 1AHKA 2XIDA 3NJKA 3P3RA 4LSRH 4Y4KB 1ZCRA 4P23C 3MCLH 3OG4B 5LBSA 4UNVA 3V7MA 1RZKC 4AT6B 5C8JB 2KPNA 3VRJB 1Z2KA 1V27A 4FL4C 3QQ3A 1SQMA 1I31A 5F2FA 2PCFB 1KDIA 1EGJA 1QYGL 1YSOA 2JJSC 2UY7A 1BD2D 3FS9A 3PGCB 4OVUA 1WE5A 3JZ7A 3UX9B 1DSYA 4Q9RL 1PZ5A 4A7TA 4XZUB 3VFWA 4ODWB 4HUCA 3QIWD 4HF5L 2BHZA 2Q5BA 5KSAD 3RWHB 1JN6A 4PLJC 1CVSC 3PUCA 4FD0A 5FO9A 2YKLL 5EMYA 1AGDB 2XDHA 2PW2B 4RESB 3AGWA 3C6SB 5IQ9A 3QAZC 3SZ6A 2NR6C 4Y4HB 2XX0A 1DBMH 1NGWA 1CZ8H 1OLLA 4HPYH 4PJ8A 1W0WA 4AMXA 2W94A 5T1MA 4M1CC 1F11B 5I18H 4GI8A 4MMXC 4PFEA 2A74A 4OCSH 1QFPA 4GQPH 2NUPA 4ANWA 1ZK9A 3NH7L 5HGAB 3WHXB 4LSTL 3BO8B 2CDEB 1NSNL 3IRZA 4ZMQA 5I8CA 3NQKA 1GC1H 3NJGA 4F9LC 4QHMB 3R4RA 1H3XA 3A21A 1O7SA 4HH9A 4HJ1A 3ULUH 1T22B 2GJJA 1A7NH 5E4OA 1OPOA 3QQ9D 4BELD 3HNSH 3VFWB 1FORH 3OKKA 3QEQD 1UCBL 4HXBH 4I8DA 2XETA 4OZFG 5GGRB 1PQZA 4XPAL 3NEXA 2O61A 1IGCH 2PCPB 4XPGH 3IPBA 1EAPA 3MBXL 2VDPL 2Z8WC 2A6DB 4PJ5A 3OKYA 3DARA 3BZ4A 4F37F 3QWRD 1UD8A 5E1AA 1QTPA 1T1ZA 1HHKB 3SJVD 3U0TA 1P6FA 1AIFB 1OAKL 1FL6B 3WEOA 2ALAA 4JW3A 4XMVA 2GABA 4KJYB 3KYOB 3OF6A 2K0RA 4PGEB 4Q0XL 1AXTL 2VDNB 1PD6A 1GHFH 3DJSA 5FCUH 3D25B 1JSYA 3L45A 4K8RD 2IXQA 2YD9A 3C5SA 3WO3B 2VXVL 4AYSA 5JA9A 1E6OH 1ND0B 3MMEA 1DJGA 1MFBL 2B14A 3LIZA 4N68A 4UI2A 2OR9H 2NNAB 3TBVA 2D03H 1I53A 2IDUA 4JO1H 5AVVB 3DOSA 1I8UA 4J3BA 1FL3B 2BNQA 5CR1A 5JOPD 5L8LB 4JHAL 1EEZA 4GBXB 2AABH 2Y7OA 3UTSE 5JPMB 3WDJA 4BCXA 4XNDA 1D3CA 2VSMB 1OKEA 2Q0ZX 3D05A 4PVBA 1AY1L 3AGVA 2IPUK 3SODB 1H5BB 3KL5A 3DUSA 1HH6B 4ZFZB 1F8TL 2XIBA 4ZO7A 5DZLA 2DMBA 2YPKB 3FOMB 2WWNA 2QVTA 1CD9B 3K8MA 2QGDA 3V0VB 2ZG1A 1DZ0A 5A3ID 3FTYA 3JSSA 4N1HB 4ZMYA 3II2A 1RK1A 4N3UA 5E9DA 5SV4A 4LPXA 3P0VH 5IFHH 3R19A 2XZQH 4FCAA 4WFEE 1HHHA 2QADB 1JVLA 4AV5A 5JPMA 3CUPA 3SOBL 4KXDA 2MNWA 4PRNA 3FAWA 1G7HB 3VFVB 5JPNB 2ADJA 3IMWA 3LZFH 4OZGE 3VXNA 5JHLA 4JGUA 4RETB 1E6JH 4P4KA 1JXGA 2NY5C 3TWCH 1M6OA 2RFXB 3S97C 1LP9B 2HTLC 4M4RA 4MJ2A 3WI9A 7FABL 3ESMA 5L0QB 3KDPB 5L4MA 4H8QA 5T5FA 2MH4A 3SDCA 1YYMH 2YLHA 4K3JL 3V4LA 2EEAA 2XTJD 1DVXA 4IU3A 3KWXA 2EVJA 1P2CA 2W0KA 1E2VA 2NXZB 3Q5OA 1WFOA 4PGDB 4PRHB 4AENB 4XMLH 4ZFFA 4WZ9A 3LEVL 4JANB 2P8LB 1RUML 1UXWB 5I8EB 3RNKA 3ZMEA 3ZSSA 4DUVA 4IGBC 3BP7B 5JQ6H 1N0XL 3IMRA 4PJHB 5FUOL 3IJEB 4FLOA 4FNLH 3N55A 5KG9A 1AXSB 3ZDWA 4TSAH 3IAQA 1PX3A 5D7EA 2A9DA 1S7VB 3NJJA 3DV4B 2J6EH 3QDJD 3UTQB 1NFDF 4OQTH 2LU3A 3ZE1E 4PMFA 2LLGA 4AEFA 5F8QC 2UWEB 4F7EB 4CJ1A 2Y7QA 3HS0C 2WN2A 4IOFC 1V55B 4M00A 5E6IA 1GSKA 5IEKB 2F6AA 2B9BA 4G82A 4XCYA 1Q0YH 2R7EA 2FSEA 3DX9A 3EHBC 5C0JB 5G5DB 5KYXB 5EEWA 2F58L 3MRLA 3RTLA 1BEYH 1KYDA 4JR9L 4PI0A 1GC1C 3VGGA 5SX4I 4FFWC 3TA3C 1H15A 3NA9H 3TZVD 5KVMC 5F9DC 4ZFQA 2FT7A 3G9AB 1AQKH 4OBSA 3ROLA 2XPZA 4P2OB 5H4ZA 3V0IA 4KK5D 4AQEB 5EIIB 2EUVA 3BD5A 1HL8A 2PXYB 3SD5A 4D2NA 1D5MB 1BXVA 4PJ9A 3N40P 5FYJH 2Q87A 2YWYA 1NCOA 4JL2A 4A37A 4HIPA 2YEZB 4H1LA 4L5FE 4LL4A 2WPGA 1XTMA 3WLWC 5HYEA 1ADQH 1TEYA 4H2AA 4O51B 1RVFH 4ZX6A 3W11D 4G6FD 5D96C 3MJ7A 3OR6A 3EJZC 3WN6A 2FR4A 1JK8A 1P5UA 4H5SB 4XB7A 1O5PA 4OI9A 1XD0A 1YYLL 5I6MA 3HZ3A 2H32H 3CHOA 5F6IC 2FB4H 1KXVC 4OFYA 4TVSa 5D2LE 5DRWB 3RU8L 5F3FA 2FEEL 3SE3A 1M42A 3CH1A 5D1ZA 4Z6AT 1D6EB 3MCLL 4Z76B 1RAMA 1ROCA 4CKQA 2F74B 3OLIA 4ETQA 1HH9B 1EDQA 4OGZA 2VABB 5ETUA 2P49B 3C5ZA 5MI0B 3VSUA 2OLDA 5HYSA 5J11C 2AAAA 4L9LA 5E70A 5IB4B 1MFVA 3QARA 1VKXA 4L23A 2VZ1A 1J5OH 4JPKL 3T1FA 3LRSA 2EIBA 1WBYB 1JUFA 4PJDE 5D96B 4CMMA 3SDXA 3RDTA 4UMSA 3GO1L 4PTTA 4X7DC 3KPNA 3EO0A 2ESVE 1JK8B 3FTWA 1TVDA 1IGYB 4RMUA 4Z78A 4XOEA 4Z95H 3MLZL 3NN8A 4GRLB 3JTTB 2FQGA 2BK8A 4S1DC 4KITB 3I2CL 1IARB 3O8XA 2AXHA 2A0LC 3OMNB 4X6DF 4WF7A 1HCYA 3SPVA 3EDFA 1DQQA 3TTSA 2VLRB 5GZOD 3LXUX 1DBJL 4LAJH 4NPYB 1HYRC 2DW5A 5JO5A 2F8XC 2VWEC 2ZYIA 4MNGE 3HPLB 3GRWH 4C56B 6PAZA 3MYZA 2NQ3A 1BBDL 4WNQB 3W0WB 5A16B 5DSCB 1I1FA 4UV7H 5I16A 3QUZB 4UT9L 2WXGA 4HJTA 1TJHH 2WQUA 2IGTA 2EYTA 4GAAA 4JQIL 3S36L 4OW6A 2YIHA 4E41E 4AJWA 4WW2A 4WVRA 3BAJA 4OUUA 1D5XA 5M95B 4HK3J 1E4JA 3HI1B 1CICC 1AO7B 2OMNA 1TQBC 3FN0L 2EICA 4U49A 5T33H 3UPRA 2PWGA 3ATDA 1M1SA 3S37L 1K72A 4Z3EA 1U93A 4HIXH 4P49A 1A6AA 2VLRE 5C71A 5K1VA 3O6FA 5AVQB 4WNQA 1NJ9B 3U9WA 3PHQA 4U1MA 5AW8B 3S3JA 3W82A 2VDLL 3KPOA 3ZTNL 4OIFA 3VFRB 5GRJL 1UZ8B 3BAWA 4WTXA 3S88H 4PN6A 1KXTA 2H7WA 2WO2B 3QFJB 3UC0L 1HE7A 3EJYD 3O4LA 1R5VA 2YGOA 3VXTA 3W5MA 5HHVL 3RWJA 5JXED 2R69L 5E5RB 3RG1C 3WFZA 4HCRA 5AG9A 4QGYA 4JM2A 2BLFA 1I8KB 4MAYA 3VFUB 4ENED 1WT5A 1CTNA 1X7QA 1ZHLB 3C8KA 1G1YA 5CCKL 4KV5F 1GYVA 4K7FB 4ISVA 2GQHA 4MS8D 4HWUA 1F4YH 5JHMA 3MGTB 1KTKE 4O2CB 2FQFA 3RUGE 2BSEA 1ZLVK 4LLDA 2HRLA 4HIIA 4J3OF 3IPFA 4NZUL 1NUFA 3PV6A 4RRPA 3DSFH 1N2RB 1S78C 4Q9CA 4OZGA 4W9JC 5L8KB 3HNTL 3UJIH 2GB2A 4KI5C 5K33A 1JS4A 3O6LH 2E7CA 3BP6A 1J1PL 5D70H 3UO1H 5I17B 2X4SA 5SWZE 3BSZH 3IETB 1BWMA 3U4BH 3UTTE 5HDRA 4NS0A 2Z91A 4DEWA 3FK3A 3U9UA 1RZQA 2G0LA 3E8VA 3PFQA 4WI5A 4Z7VB 5EA0L 1K4DB 5TE6H 5J1TC 3PAVA 1DQTA 4KXZH 4JM0A 3O4LD 1FYTD 2MQCA 4Z7QF 1KGWA 3AVEA 3ECBA 1TMQA 1BQUA 1RSYA 2Z1KA 3BC9A 1OO2A 3QXAA 3IFLL 3O2DL 4JO4H 4CA4A 1KIRA 4V2CB 2AW2A 2OAAA 4R26H 3RURA 3D5OF 3CQPA 4ZUTB 1JWSB 1QSEB 3MV7E 2EUZA 4M7KL 2X9XA 4G6ML 4G8EB 5EEVA 1KTLA 2QKSA 3H7BB 3T6XA 1HOCA 2K9UA 2AJZB 2B20A 3FU5A 1WHOA 4JY5H 2W0FA 2IH3A 1TEFA 2W80C 5F89A 1P84J 3L7EB 1S9KC 3UAJD 2RB8A 2R2HA 3QUKB 3ZY7A 1MOEA 3N06B 3D7PA 3HI5L 4FNPA 4P4RA 1TR7A 3VFGL 5KBKA 3VQ1C 1G1OA 4HZLB 2CRZA 3CX5K 1UKSA 1OT1A 3BWZA 4JR9H 1S9WA 5EOQL 4UBDD 5F1NB 2UXFA 2ZOLA 1QSFD 3LEXB 1P69B 2DMKA 3AB0B 4QJ5B 2JWYA 1JNJA 1JZHA 1F3JB 3LKSA 3PXHA 2JNZA 5TFSL 2X0UA 3LKOA 2HLAB 4NN5B 2NYYC 5CEZH 2FYYA 4NWTH 43C9A 4G8GE 1FNLA 2GW5A 2CALA 2JI3A 4FDWA 5KSVA 1YECH 3FQ1A 3GJFA 1B0GB 1NBCA 1OEZW 2EDHA 4TTDC 3NCBB 5GGVH 3ETTA 1VFAB 1T83C 4J6RH 4P46C 5JIKA 3S5ZA 3K6SA 3IPEA 3LIZH 1SXBA 3T0EE 4P2YA 1NPNA 1DVSA 2D3LA 4IEFB 2A6IA 3RWDB 3UZEA 1S9YB 3MRMB 1X4ZA 1MJ7L 5DHVH 3L17A 2YD6A 2OL3L 3WYRA 3X14B 2NXYB 2VR4A 5EO1A 2VDNH 2BS8A 4F33B 2WXPA 2KH2B 1I4FB 2A1WH 1D5IH 2P7TA 5D2NB 4RX4A 4HCIA 4OI7A 4XMKL 3I02A 2EYSA 1CS6A 1HL9A 1SOKA 3I85A 4ABWA 5I1CL 1JF1A 5D1QB 4OCSL 1L0XA 3HN3A 4OT1L 3HTLX 2FEEI 3FT4A 2Q6WB 3WJLC 5JOPE 2R29H 2G2NA 4YHIA 5EWIL 5ECJE 4YBQC 3TJEH 3SGKA 3ZRSA 4CAGA 2BMKA 1PG7L 3QAQA 1EVUA 1I7TB 2YPLE 2IAMD 4JDZA 3SPIA 3Q0HA 3DO7B 3MPCA 3GO1H 4HEMA 1P6WA 3IWUA 2WHVA 2ED9A 2BZ7A 2WUBL 3S2AA 5JHLL 1G0DA 2O6EA 4XPAH 3T6WA 1XGQB 2D0HA 1ZLVH 1G0XA 2PKDA 4YFLF 4LCUB 1B9ZA 1DVTA 1E28B 1XF5B 4P57B 2XJLA 1V3JA 3JV6B 4L1HA 4JO2H 3GMNB 1WAEA 1AQDA 5ES4B 4EF3A 1HHGB 1OAKH 3EYFA 4Y1AE 3U46A 7PAZA 3RVXC 2C9XA 3Q7JA 2QPEB 3BQVA 5BW7A 5EO0B 4XH2B 4U33A 4LZKA 5AYTA 1UOKA 3FFCA 1A4JA 4Y9CA 1WO2A 1UT2A 2NLJB 3KCPA 5IVXE 1NA8A 2A6DA 2IGFH 4C56D 5I6OA 1T1ZB 1JWMB 3ULUC 1T7ZA 3RWFB 4PJCF 4RFEB 3X1FA 1C5CH 2ITCA 1WCQA 4QEGA 3K8LA 1IGIL 5F9JA 3NIDE 5DLLA 4L0PB 5EPMA 2JIXD 4RAUB 4KU1A 2DLFH 3ROOA 3T65A 1WWCA 3E38A 2VXTH 1AD9A 2NTFA 2F19L 3PCYA 4FJZA 4ZJ9A 1RZFH 2AJUH 3UG4A 2WCPA 4MCZB 5HVHB 1ZT1A 4MD5A 3S35H 4OGYL 3STZB 3UABA 3QEGL 4Z7NE 1J48A 3P9LA 2VJ8A 3V0DA 5BZWA 1NCHA 1V05A 4Z0XB 5EC1B 4LVNB 8FABB 3CDYA 4PG2A 1QW9A 1F58H 2OK0H 3HZVA 2ZUYA 3UXFA 5H35B 4H1LG 4GAJH 1H6EA 2L7EA 4WI0A 4O58L 4WI2A 3MROA 2VKWA 1C16A 1IC0A 1VCAA 3ZL1A 5C7XL 3RWFA 4AJYV 3QEGH 3BO8A 1LP9E 4WW2F 3KLLA 4XP4L 4Y88A 2ZWNA 2HSIA 1PZAA 4PJEB 3UC0H 1WA0X 2H26B 3ARVA 3QXTA 2MOQA 5DEGA 3WNIA 3TP4A 3I6KB 4G43A 1FFQA 2Z4QA 5KJ7E 3Q9PA 1V5JA 1S3KH 2ARJQ 3HW7A 4ANXA 3MRFA 5GRVL 3TWCL 2VC2H 2A4ZA 5FUZL 3RIKA 3LSOA 3QIBA 4L8DB 2MOGA 2RQ8A 3KD4A 1DLFH 1B0RA 1CVRA 3N41F 4GIOA 4IRSA 2C1OA 3TX4A 2BOLA 4K3JH 3GMPA 3ULVL 3L9YA 5G4MA 3T4AA 2CWRA 4L3ED 1Z32X 3GPSA 4U1IB 2WBJC 3AW5A 3PWLA 4PGBA 1EWHA 1AZRA 1JZDC 2IANB 3RY6A 5KN5B 5DZAA 4P4KB 4LLQB 5JA8B 1UATA 1HSBA 3BGAA 1LP9A 1XX9C 1EO8L 3X1NA 4AH2B 3JXAA 1J9CT 2HX8A 3EYOB 5J1AB 1GTFA 4GY4A 3Q06A 1TZOA 2WZ6A 3K5RA 4NX0A 1L7TH 5AZ2L 1OALA 1MHHB 1WICA 5EU5A 5IF0A 1OHZA 2J6EL 1O6TA 1YEDA 1TTBA 4ZPTB 5ACZB 2ICWA 1EEZB 2A9CA 2VDLB 4GBXA 4F7TB 4ODHL 2EDRA 3RIAK 1WFNA 3ARTA 2WLLA 4XP9L 3EXLA 1Q0YL 3V2AR 3FUFA 2YAQA 5AZ2H 3B1TA 4UWQB 4Y5VA 2O1AA 3LPFA 2WBJB 3N44F 3C2AL 2Q2EB 4DAGL 2DL9A 4ONHB 4MASA 4R8WH 1RHHA 1NIEA 3CSGA 2VDRB 2PP9A 5B7FA 3UEZA 5K39B 3KYOA 4KZCA 4H1LH 3VB9A 1FBIL 1A3LL 1K4CA 4BSJA 4CC4A 5JW3L 1BFOB 4X4XA 1WIUA 3K0WA 2VLJD 1EZUA 1PLAA 3HN5A 4EUPB 4XNBA 1EBPA 3QHFH 1MEXL 3C6LD 3NZHL 5MEPB 2ZXQA 1FWXA 2Z4TA 3CQFA 4NDMB 2NNRA 43CAA 1NFAA 2YEVB 3FTZA 3RKPA 4K9JA 3F12A 1RUKH 2Y36L 5LXGL 4EI5B 1AC6A 3ECVA 4ZSOA 3UPCA 5AB0A 3U9PH 1CXLA 4QRPA 1U58B 3W5NA 3REWA 2YRZA 3QZBA 4GXVL 4NUQA 3VXSE 1GYAA 1ZV9A 2Y1AA 4E2OA 4G7SB 4GG6B 1EXGA 3EYSL 4HAKA 1PSKH 2NDFA 5T8IA 3PDOA 2Y25A 1W0WB 2ZOOA 1FVCB 5FM4A 4YS4A 1YDPB 2IDQA 1NICA 4X6CE 1BZ7A 4J1UB 1E9PA 1R6VA 4ZNEA 5I75B 1KLUA 4J6RL 1JWUA 3M17B 3HG1A 1SNRA 3WUWB 1BFTA 4JPIA 3TNNA 3APMA 1N19A 1TVBB 2HVJA 3CN1A 4QKXB 4WDIB 3RTQD 3S5YA 4YLCA 2JJSA 4WI3A 1SQ2N 4LCCC 2X4OA 4PJ8D 4XAWL 1E5UI 4Z7OB 4QJ3B 3TBTB 3DJRA 3RE0A 4HDIB 2DEYX 3B3IA 3EO9H 1Q1PA 4YHOH 5D5MB 1ZV5A 1CDJA 2ED6A 1JPTH 1GH7A 3NIGF 2F1EA 4NO2B 1FIGH 4P05A 4RZKA 1DQJA 2DRUA 1UGNA 4JFWA 4NQUA 1WS7A 4HUWA 4XT1C 1I3VA 4TVPE 3LN4A 2XTLA 5I74B 1IAMA 5DURB 2G2RB 3VXSD 1FVCA 4N9OB 7PCYA 1KZYA 2R29L 2AZUA 4MMXA 5E2WH 1DBML 1H8SA 2A74C 3G5XB 3HJ0A 4HPYL 1MH5B 1WBXA 4PRIA 5IB3B 3GUTA 4PRAA 4KXAA 3QIWB 1IQWL 2B3RA 4WEMB 3WS3B 5JNYA 4FQQB 5LBGA 3BPLC 1PZUB 3DVIA 4QXUH 2PCYA 2ENYA 3KH4A 3BGFB 3TS8A 3VB8A 4YL4A 4N6RA 1JI1A 4MNHB 2OL3B 2CK0H 5E2WL 5I6KA 1NFIA 2VZ3A 5EF1A 4GAGL 3T4YB 2H3KA 2JB6B 4IJ3C 4BFGA 2PTTB 4KFZC 1EUTA 3L13A 4MGXA 3APNA 1EFXD 5ESQA 1YQVL 3CSPA 5GPRA 2RACA 5GQBA 3F58H 4JFDE 1YEIH 3NRPA 1CL7H 4L8SB 5SX4H 1T89C 3IDIA 1V3KA 3SDXF 3PWJB 3VCLA 1AGEA 2KYIA 3CG8A 5C07E 3QXVA 4Q89A 1BAWA 4NO0A 1CMOA 4CVXB 3G6AA 5FWRA 1HSAA 5IW6B 3K1DA 5IB4A 5B21A 3C87A 2X3AA 3NSYA 4ZMAT 4PJIB 3FHEA 3SDAC 3DURB 1JCVA 4MCYB 1U8IB 2CQVA 4N2CA 5HYSB 3RWCB 3NAAL 4IRJD 1OF2A 4OUOA 1INEL 4TF4A 4XRCA 4AITA 2YHGA 1NCBL 2LFGA 2NY6D 3KPNB 3LH8A 4PUBH 2E75C 2DLHA 4QRQA 1KENH 2V9RA 4WU7A 4FQCL 5T1DL 4Z0BL 2CO3A 3K8KA 4M8QB 3MJ7B 5FO8B 5LKNA 2CGYA 4HPOH 4TM9A 2BY2A 5ISZA 2WB7A 5BRZE 1C08A 3DX3A 5E23A 1BZ9A 3N1MC 4IKLA 1R5VB 4BQBA 1JG9A 4EQ3A 4PP1D 5IW6A 4JDEA 3HE6D 4MA7H 4XO8A 3ZDXE 2DQHL 3KJ4C 15C8H 3CGTA 3GSXA 5ID1A 5EUOF 2XY1A 2EXSA 3WV0A 3VXUD 2QJDA 4J12A 4LF3A 3DX4A 3HNTH 4ESKA 4PJ9C 1GYCA 1D5ZA 4UTCA 1II4E 4JJOA 5E1IA 3SBRA 4ZFFB 5GRXG 5TDOA 5C3IA 1PEWA 2Z8VC 5IESH 5KVFL 1S5HA 3MNVA 2ODHA 3P4NA 2I25N 4MD0B 3AXLA 2R2EB 3ZR5A 4TOYH 1P4IL 1XH3A 3PQYD 1UWGH 2LOEA 2NY0B 4R2GD 2I9LA 4N6QA 4P2AA 2G9HA 4R4FL 4YBLC 4GG8A 1QTSA 3QCVH 2Q3AA 1LO2L 4UV4H 5DDHA 3LEYL 1NC4A 4LLYA 5AUMB 1P53A 1NIDA 5DD6B 1OE3A 1KBKA 1SN5A 2X38A 4G6KH 1U8MB 5FXCH 3MOAH 5EUOA 3G5WA 5FS5A 4NT6B 3VGBA 4B9GA 2BCKA 1CI3M 5TH2A 4LLAA 3WEXB 5D7JA 2R2BB 3D12B 5FYLH 4QHLB 4OI8A 2X12A 5CR8A 3WOVA 5E8NB 3HPLA 4JY5L 3O6FB 5KSAB 3X1BA 5B1JC 4KVPA 5DHMC 4AI7A 1QG3A 1BW8A 1B4JH 2OW7A 1MFMA 1FQ9C 2ZKMX 1A22B 4JE0A 4PR5A 1Y0LB 2V5YA 2XXCB 5C97A 4MRCA 1QA9B 1RQ5A 3K6NA 3QJFA 4Y4HD 1JZ2A 3CVIH 3QHZH 4J5VA 2J1XA 2APFA 3AREC 4LB8A 3T77A 2WKLA 2X70B 5DQJB 4IDLA 4PJFE 3OR6B 1SXAA 5AL8A 2JTYA 3IRCA 3N9GL 2F9BT 4JCWA 4N8VA 2XWBB 4N28A 1GMEA 3O0LA 4K7FA 4IIQB 3IFOA 2BC4A 4GT7A 1VACB 3ABZA 4WAFA 3DXAE 3PLYA 3E2HC 3W2DL 1BEYL 4KO6A 1MW0A 3JWDL 1WCBA 4UQIM 5GGRY 3VACA 4NBZB 3DX6A 1V7NL 1R3LB 4N87A 1CQYA 1W16A 5C0GB 2XN9D 2FECL 4AVIA 5IMOB 1TPXB 2PMZA 5DI8B 4DZ8A 1AI1L 5KVEL 3TPUB 2YPLB 3W2DH 3RAJH 4CVZA 1XCWA 3BDYH 3L5WA 3N0AA 3U4EB 4HJ0C 3W56A 1NAKL 3QFJA 1HYSD 1E8ZA 1ZTXE 2X53A 3ARXA 4UZSA 4R3SB 5LJYH 2K6YA 1X5ZA 3I3BA 4LT7A 2BCMA 2ILLA 4QLRA 1QPXA 1H0DB 3DLQR 4X2UA 2ZPKH 3KWWA 1EH9A 3DVFA 3SPJA 4GRLA 2EE6A 3IDXL 2E4FA 3IS1X 5AW4B 4DW2L 3T1WA 2DLIA 1SJHA 4RGNE 2EH8L 1MWAA 4BWUA 4DEUA 3T2LA 2CIKB 1GS7A 1NAKH 3J7HA 1Q9LB 3HUJB 4OD1H 1I8MA 2OMBA 4LASL 1OQOA 1ZKAA 2YMXL 5E8PA 1AJ7H 5F9WB 1TZGL 4OCXH 4HS6B 4F33A 5JOFB 3Q6FB 1B2WL 3A6CL 4GP5B 1QOKA 3QYNA 1F4HA 4YVUA 2C4FT 3C5JB 4FG4A 4RFNB 5FW7A 4J3OC 2YK1L 2QR0B 1YEJH 3JTSA 4PCYA 1OP9A 5AVZB 2AQPA 2EEDA 2NY5L 3B3BA 4FXLA 5KS9F 3AU0A 3L3KB 1R5WA 5TF1H 4HT1H 5IMMB 3QUYA 3TH2T 4E9VA 3WGUB 3PWVB 1WV7T 1YUKB 1FZKA 2BWQA 4KQ4H 1SLUA 2JI2A 1A4CA 2A9NL 2SODB 5KWYC 2G75A 4DTGH 5FPIA 5CGTA 1OAJA 2ICWI 4G42B 3TEUA 3MV7A 2AABL 3TBWB 1G87A 2FNWA 1B4RA 3SCMD 2F8VA 2P5EB 4I89A 5CLXA 4AM0B 2ZOLB 1H6FA 5DRNB 4A63A 1XSKA 3U2IA 4HK0B 3LH2L 2CXGA 5JW4R 4A2EA 2VN3A 1N5YL 4LSPH 3BGMA 5CLWA 4I18C 2BP8A 2MPVA 4JFFE 3CFQA 4WY7H 5ESAB 5K9OA 5C0FA 3MCKA 4LL9A 4RZCA 1GYUA 3V4PL 1S7TA 2BIPA 4UQ2B 5KANG 3BP4A 2WQXA 4AVHA 1UA7A 2X7LA 4OFDA 4HCRH 5TQ2H 1ZLSL 4PJ8B 3HE6B 2RR3A 4XE5B 3JBG7 2N3JA 5IOKA 1RP8A 4Z7AA 3MNWB 2CHZA 3QEHB 4I9WE 2DM2A 5FO7A 1CICA 2HAZA 5DFAA 2VRQA 2A99A 3M46A 4Z7UB 4KZEL 2VB5A 4CU8A 2ZOWA 3B8SA 4WNSA 2HVKB 4U1LA 2WGNB 4OLEA 3WKPA 1O5DT 1ILSA 2ZG2A 3QJXA 4U6YB 3QCUH 3I75B 4PD4K 1KTCA 4NOBA 7FABH 1NLDL 3BKJH 2FJFB 5EC1A 3UAFA 1CLYH 4QXTB 4AGPA 5M7QA 3SBPA 2DH3A 5H37H 3AUVA 4Y4KA 5F7MC 1MCWW 3TM6A 3APCA 2YPVL 3QVAA 5H37G 3FONB 2CR3A 3ZE1F 3CVBA 3VD7A 3MV8D 4PJAF 3EBGA 3V6FA 3S88L 1P84K 4XP1H 4D0BA 1KPUB 1MWAH 2CUAA 2DI9A 4ZAKD 4CKVX 1NLDH 3BKJL 4D8OA 1ZGLA 5IKCA 3FRUA 2BSRB 4FAAB 2GTZA 4KMQA 5HHVH 1JE6A 3CC5A 2WAHA 4KVNH 4YDJA 3HZYB 1WT5C 2B3IA 3ARFD 3T3PE 3DTXA 4NBXB 4NJ9H 1JPSL 2JELH 3CZLA 1CR9H 4J3OD 2H1XA 1TYRA 2CO7B 4AZ8A 4FJ6A 1OTSC 3G6JF 4I48B 4BXVA 5CWSB 5E9DE 4W93A 1J11A 3X11A 4ACPA 3GIVA 4BYHA 1LVEA 4YC2C 1WS8A 1F3RB 3T0VA 5GZOC 3LZOA 3MNZA 1T66C 4U1JA 4H88L 2VDOH 1Z66A 2I9TB 2FX7L 3B9EA 3QISA 1IJNA 3EDKA 1QNZH 3BYYA 4K9EC 4JN2A 4E5XB 1CFSB 2X28A 4S1DD 3BSHA 2NNCA 3KYMB 2WGXA 1IGML 1O6VA 3L5XH 5IT2H 1PQZB 2OYKA 5KW9H 1IU1A 1KLGB 3CFBB 4GG6E 5H4YA 4M1DH 3BH8A 4YSEA 2MQ3A 4JFTA 2MSPA 3JV4A 3SDYH 5LCVA 4F8OA 5CEZE 3GF8A 3LKSB 3X3GL 3DGGA 5I6PA 1MNUL 3N6YA 1H8OA 2WNGA 5EF2A 3DO4A 5F0LB 4L4VA 3RYMA 1N70A 2P45B 1EEYB 4YLBA 3H3PL 3GXFA 4QI3A 4UCFA 1YUHB 4W4OA 2OSXA 5GIRA 1ICTA 1KV3A 1NGXA 3NSJA 3GB7B 3BRFA 4JN2B 1NOLA 2F54D 1BMZA 3ABGA 3WE1A 3CFTA 2A6KB 1FFPB 3KHOA 3NIDB 1QFWM 3HLKA 1CGSL 3IJSA 2A9AA 4KOBA 2Q20A 4P04A 5E03A 2J5LB 3ME0A 5J56B 3ARED 3H3KA 2FQEA 2DQIH 4LQ1A 1Z3GL 2XVKA 2P28B 3BX7C 4ZD3L 5GRUL 4ELKA 2IF7A 4PJHE 4KRPB 3HG5A 1KTJA 2QVKA 3CIQA 3ZE2B 3S7GA 3UAAA 2YN3A 1CD8A 2K78A 2YUVA 1MZZA 3QFGA 5CFAA 5HYJA 4KGLA 3BZFB 1QYGH 4OSUL 4MD4A 1MJJB 3TO4C 1MRFL 2KQNA 5BVJA 3SE8H 4OCRH 2R0LL 4NQEA 4IS6A 5E4IA 3WO4C 1NCTA 4R96A 3TA3D 4B9ZA 1TSHA 5D1ZD 1XIWD 4FQHB 3HHSB 3LZNA 4GB9A 5I1AA 1RU9H 1XFPA 2CM6A 4U3SA 2GTWA 4RAHA 4YHOL 4NZTH 1A4KB 3UZEC 3WG7B 3QUXA 1MRFH 3Q2LA 3KLKA 1A3RH 4G59C 4PW9A 5D55A 4PRNB 1KY6A 5DS8A 1QPKA 3IDXH 4GLRI 1OAUL 3P0YH 4M7LT 4LOUC 1BBDH 2MOVA 4RWYL 2CA4A 3NCEB 1E30A 5JW5A 3MV9B 4F7TA 3GI8L 2AXGB 3ROLB 5MEND 1CLOH 5FW6A 2QSQA 4G9DA 3BD3A 2KZ1B 4LSTH 2N7SA 3OKEA 4ODWA 1XF1A 4PSRA 1ZD6A 4JQIH 5CJQH 1JV5A 3WU1A 4Y2OA 3EFFA 1HTYA 2XPYA 3CFEB 3TO4B 3GXMA 4PJ9D 3ZE2E 4RGND 4B9KC 4KI5E 3GXIA 1CD1A 4U2ZA 5IQMA 5AOLA 4W81A 2BWIA 2I27N 4YEFA 3ABKB 4MQ7A 3MREB 5EN2B 3WIFB 1BJMA 4NENB 2XWJB 3VX1A 5IWLC 5H94A 2J56A 4PP1C 2L0DA 1ZLWK 3CWGA 4WWKA 4FGMA 4G71B 3UIYA 2BNUB 2YGVA 3BPNB 3M45A 3O6KH 4BKLA 2C9SA 3FDWA 4I5BB 3MRGA 4XOAA 1OSEA 3CBRA 1MY7A 5D4IA 5BZDA 1NBYB 4AYFB 3WHXA 4HZAA 1EJFA 1KFAH 2COQA 5F88A 4QHMA 2C4FU 1KLFA 3P1VA 2ZJSH 1ETZA 3QORA 2R1XA 4D8PB 3CXFA 5KSBE 3ORJA 1CL7L 5I8OH 2NY6C 2CKBA 4HWBA 1UXMA 3IK2A 3T2NH 1XF4A 1CIUA 4IM8A 2QQKL 1C5BL 2HJFA 4MNQE 5D7LE 5FGBA 1N5YH 2QV2A 2FLMA 3O4OB 1KTRL 4Y5XB 3FTXA 2DV6A 3QNYB 1M71A 1MCCA 2KUTA 4S1RL 5SWSE 1T3FB 3RDJA 4NPKA 3VXUA 4FFZH 5D93C 5E1AB 3OAUL 3UADA 1TUPA 3GRGA 1C8QA 3OPZH 5CMAB 2ZYHA 5I76A 3VWKB 4XCNB 5DJ0B 1JFHA 1ZSHA 3QI9A 3OWEA 2WXNA 4ALAC 1I8AA 1OOWA 2HB0A 3A23A 4JG0L 5ALBL 4ZFGH 3SDCD 2KLRA 3OKLA 1GA2A 1X9LA 4LMQI 3RZCD 4UOQA 1U2HA 1CDCA 3QQDB 4M48L 3QRBA 4Z0BH 3VGDA 1HJBC 1V3LA 2BVYA 5ADPH 4W9IC 2WINB 2CLVA 2DQUH 3FF8A 4GEIA 1I1YA 3X3FL 1JHKL 4CNIB 2BNRB 2I24N 3ETBF 4IBUA 3NZ8B 1DVFB 4XC1L 1XF2A 5AAWC 2ORBH 4D9LH 4RIRA 5CEZD 3BUIA 3MUJA 1VEMA 2VO5A 1T5WB 2Y1ZA 2X1WL 5C0RH 3JUZA 2J1YA 4QTHA 2GUYA 3T08A 1FL5B 5EULV 4JS7A 5I30L 4PJ7B 5F71A 4M4RB 4FYSA 5H2BB 4F3FB 1BAGA 1FG9C 4XO5A 4X8CA 5DJCA 3WD5H 3BUYA 3PPSA 3VD5A 1KTDA 1UJ3A 1U4EA 3EGDA 4MB3A 5C09D 2FT6A 2VLJB 4HJSA 5B1CA 5GISL 1PX8A 3FCTA 2A3TA 3QIBC 2AV1B 4CU7A 3D39A 1A9EA 1QBBA 1SUHA 1TNMA 3MJGX 3UPAA 3BE1L 1KV7A 4UUJA 1EHAA 2XKNA 4OZFA 3QPQD 3WFCH 1UD3A 3II3A 3MRJB 3VSTA 3PWJA 2EXWD 4S2SB 4Z23A 1PY4A 4J27A 5T5FL 1EZVX 1PLBA 3G6AB 1JZIA 3RY6C 3BRGC 5HDWA 3X17A 1OAZH 1MW3A 4FNLL 5I26A 1AIZA 1FZOB 4NPJA 4BUQA 5TE7H 2Q9OA 5SX5K 1F6LL 2ZUVA 3NJFA 3ZUCA 5CZXC 3NCYS 2NUTB 4FHJA 4UOJA 4L4JA 1CJYA 2DY2A 3AT8A 2LFEA 1MCIA 4JHVA 4M1CD 4ERSL 1EO8H 1PW3A 2XOTA 1QMUA 4L4TE 1A4AA 2ADGA 1ASQA 1MHCB 1KEMH 2HCZX 2JXMA 4PLKD 4KZDL 2X4NB 2MKWA 4UAOC 4G7VL 2W9EL 2AV1A 2YQBA 1EFQA 1QHPA 2PXYA 4GAYA 4WJ5A 5DEFA 1YECL 3QPKA 5KSAC 1UTDA 4Y5VC 3TBYB 2CHNA 3MBEB 4E9TA 2PPFA 4EN3A 1B4TA 2XRAH 2ZCHL 3B2UC 4QXVA 1GAFL 4FNUA 3H0TA 1FJ1B 1MCRA 2NY3C 3OZ9L 3NCMA 4L8SA 5IJKC 1HCZA 4ZYKA 2DIEA 5FUCE 4PRHD 4CL7A 4DQAA 3FT9A 1JFQH 1X5KA 3GJFK 3AWGA 4IBYA 4LBEB 3L1FA 4QLWA 4X4YA 2HJKB 2XBDA 5C0JA 2VLKE 1A3LH 1S7XA 4L8BA 5JIQA 2GBTA 5CIPH 5JQIB 1MJUH 3TZVB 5HGBA 1E5YA 1CGSH 1N6QL 1QSED 1FE8L 2FD6H 5GS0L 3NZHH 1PCSA 2F54A 1GCYA 1XGRA 4XNYH 1MCPL 3ARDB 5IJVA 3VFTA 3U30B 2R2EA 5DO8A 4DGWC 1T5KA 2PXYD 4BSWB 1D5MA 3NBNA 5IQLA 4PY8J 1G7PB 2FWOB 5IHZB 3KWTA 4JFOB 2YEZA 3O81A 2CNZA 5FLVA 3T6VA 3VFOB 3MUGB 4P5RA 2X2HA 1SN0A 2WYZA 2EYTB 4ELMF 1N4XH 1HCFX 3QA3B 2EILB 1OM3L 3MRPB 3KBHE 3ZO0A 3VGEA 1LNUB 3EYSH 2R2BA 5TTRA 2EDQA 2G2RA 1GOFA 3NA4A 5DD3H 1I82A 4BZ1H 4XBPB 1EGJL 1A1OA 4GXFA 3WAKA 3K4DA 7CGTA 3NEOA 4DKFL 3GPEA 4X5WA 2Y7SA 1M57B 3ALXA 1DQDH 4ETQB 3SE4A 5TDPA 1A25A 1K6QL 3QFJE 3VFTB 4YEEA 5I8KH 2DICA 5LGKA 3TJPA 2V5SA 2A73B 3H9SB 2VN5A 1AD0A 1S8DA 2V8LA 3KWUA 4HMEA 4CVUA 5ERWB 2X10A 4WO4A 5CJQL 4JVUA 2A6JB 2DYSB 3Q5YA 2UZXB 4MJID 5C09A 5IGXH 2FO1A 2NY1D 2VITA 2H45A 1JDCA 2JJTC 3C08L 3TT3L 4AEHL 3DRTB 4PH8A 4QRRB 5CS7A 3PNWA 2R56L 2QLVB 3QUML 3D87B 3ARBA 2GT9A 1TQCC 3LS5H 3BPCA 5T5NF 2GUOA 5D1XB 1U8CB 3T8XA 3TPUA 4PW3A 4GUPA 1J8HE 4O2CA 9PCYA 4X8JB 1OY3B 1OF2B 1QBMH 4IRSD 4M3KB 1A1NB 1P1ZA 4Z7QB 3KM1A 4PJFF 3M8OH 3SZKC 3BN9C 5BOZG 3RPBA 5GGTL 1DQMH 5KEZA 5IIEA 4MJ6A 4EXKA 1L9PA 3N50A 4WUUB 1YG9A 5TQ0H 4UF7C 4KHTL 3B2VL 1CB4A 1YQVH 3BZDA 5AW1B 2X4SB 2WOBA 3V0EA 2LVCA 4KO7A 4X9BA 4AGNA 1L9MA 4JZOB 4LVOB 1TQCB 5CIPA 4B41A 3OAUH 2CIKA 1GJUA 1Y1UA 1YPZF 1QWUA 2VC2L 1QTYT 1SXZA 5DZJA 1CLYL 5KYWA 1LWHA 1RZPA 3Q2WA 3SDAA 2IH1B 3KDMA 3B2VH 4I1NB 4X0KB 4K3HA 3BPOB 1GY2A 3TH4T 5B1JA 5L7XH 3MRDA 1BV8A 1U93B 3HN8A 2P5PA 4HGWB 3VFSB 1WPCA 1NFDA 3IMUA 1MFEH 4HJUA 3H6JA 1BJ1H 4PW4A 1OCRB 2BP0A 3GQFA 2HG5B 2BNQE 3MCG1 5L2KD 1X5HA 3H7BA 4QTIH 1T03H 4C4KT 4NZJA 3GD1C 4WK2B 4A7GA 2ADIA 4DNLA 4BE6A 2Q7YB 2YO3A 1S9YA 1I7RB 1SDYA 5I2IB 1AC0A 2N56A 4NQEE 3L9RA 2WYHA 4TVPH 4U3HA 3X14A 3U0PA 1CFVH 1N5AA 4WGKA 4YXHL 2FH8A 4QHPA 3S48A 2B1AH 1QVOA 4YE0A 4OCWL 1DP0A 3ARRA 4S0TD 4YBQD 2Y1YA 4UINL 5C3TA 3U7YH 1K8IA 3UDWC 3EJUA 2NY7H 4DGIL 3WLBB 4P5TC 4RZCB 5J11B 4MNGB 2Z8SA 3T3MF 4A7SA 3MLVH 1AAJA 3FFCD 5AQ0A 4PTUB 4MNQB 1X7SA 3LHPL 5CCJA 3HCVA 4RGMC 5CD3A 4KXBA 4AGQA 5EEXA 3GYRA 2H8PA 1Q94A 3LXAA 1NMCC 3BVDB 3GBDA 3FQWB 2UWEE 1J1XL 4QRRE 1MCBA 2KZWA 2V7HA 4JO4L 4WI6A 5E8EB 1MEXH 3DROA 4GRLC 4GW1B 4Y4FD 3GMOA 3IDGA 1KB5B 1YRKA 4PJIE 4FKKA 5KAQG 4GO6B 1AHMA 1DFXA 5LNDA 2VDMB 2JH2A 2ZKXA 4E5XA 1S7RA 4GXUN 3OAZH 4WV1B 2D7PA 1FO0H 3D0VB 1E42A 3SGJA 3SKNA 3FO1B 1Y18B 3PF2A 2EO9A 1RCYA 2DQCH 3NTCH 4NN7B 4F24A 2FLRT 2EDLA 3D85D 3EJPA 4GRLD 4H2CA 6FABL 2QFRA 4R7NA 4TNVK 2OMZB 1FCGA 5FYLL 1RJZB 4M02A