1OF0A

Crystal structure of bacillus subtilis cota after 1h soaking with abts
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Characterization of a Bacterial Laccase Reaction Cycle
rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords SPORE COAT PROTEIN A
total genus 142
structure length 502
sequence length 509
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1of0A03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1of0A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1of0A02
1A4CA 3AZUA 2IDFA 2DY2A 1AS7A 1SF5A 2FT7A 2W88A 2IH8A 4G72B 2EILB 3FYEB 3QJQB 4UANA 1W6LA 1AS8A 1AZNA 3TBCA 1I53A 1GW0A 1UATA 4BWUA 1DYZA 1W6WA 1JZHA 1IC0A 3NJFA 4AZUA 1SJMA 4QKTA 2B3IA 5D4HA 4JHUA 4TXVB 1J5DA 4HAKA 1MDAA 2CCWA 1V54B 4DP5X 3TBBA 3H4FA 4KO7A 3OQRA 3FSZA 2J56A 3L45A 1L9OA 1X9UA 4GYBA 1FFTB 4KNUA 1OF0A 4P5RA 1J9TA 3ERXA 2I85A 3X1FA 4L0PB 1NPNA 1CURA 4WTQA 3X1NA 3OMIB 4DP6X 5D4IA 5I5JA 3EHBB 4PCYA 5I6KA 3BQVA 6PCYA 2EINB 1ILSA 3UGEA 2X87A 3EH5B 1RZQA 4G71B 1OV8A 1SNRA 4AX3A 2VW7A 4E9TA 2QPDB 1KDJA 1RCYA 4GP4B 1CUOA 1KDIA 3ASOB 1AACA 2DYSB 4AI7A 1ADWA 4K9JA 2FNWA 4YSRA 2ZWNA 1WS7A 3EF4A 3NJIA 2IWEA 1CYWA 1B3IA 2IDQA 3FSAA 3FT0A 4HALA 5F7AA 1PZAA 3NJNA 3FPYA 3OMAB 1ET8A 2VW6A 2YQBA 2AANA 4G7SB 1ASPA 4F2EA 1FA4A 2IDUA 3AG2B 1ASQA 1AZBA 1F56A 1NZRA 6PAZA 1AR1B 4DP4X 3BVDB 2FQEA 2BW4A 3NSFA 2YXVA 3GYRA 2YAPA 1N70A 4F2FA 2FJSA 3FQYA 1TEGA 2PPDA 2PPEA 4RH4A 3T6ZA 2VM3A 3HB3B 5I26A 1J9QA 1NIDA 2BWIA 3S8FB 1URIA 3T9WA 5I6MA 3ZBMA 2YAMA 2AZAA 4E9YA 9PCYA 3AG3B 1BYPA 2Q5BA 4HCIA 4NAJA 3QJTB 1BQKA 3UAAA 1MG3C 4HCFA 1PLAA 3T6WA 4HCGA 2XXFA 3SBRA 2RACA 1ZPUA 2H3XC 1EHKB 1KBVA 2BWDA 2UX6A 2VW4A 1OE1A 4UF7C 1SFDA 2E86A 2R7EA 3NP3A 2WO3B 1OOWA 4HZ1A 4X4KA 2PPFA 4HHGA 4AKPA 3X1GA 3WNIA 3PAVA 4DPAX 4ENZA 4FA7B 1AG0A 2CAKA 2XU9A 1AG6A 4A68A 2FT8A 4KOBA 1YLBB 4YSOA 3T6VA 1BQRA 1QLEB 5AKRA 1KCWA 4YSPA 5FC9A 3S3CB 3IEAA 5I6LA 3ZDWA 2PP9A 2A3TA 3PCYA 2HXAA 1SHXA 2IAAC 3QQXA 2HX8A 1KBWA 1OCCB 2YAOA 3X1BA 3NJHA 4W1TA 1JVOA 1CYXA 3NJGA 2IDTA 3NJMA 2J5WA 1A8ZA 5I6OA 2P80A 2VM4A 5AZUA 2HRHA 3EH3B 1X9RA 3QPKA 4BDVB 2IDSA 8PAZA 3UABA 3V9EA 1AOZA 4P5SA 2J57A 3PAUA 1AAJA 4PAZA 3S3DB 2JFCA 2VSMB 3FSWA 3NSCA 3OD3A 1OCZB 5AFAA 4NERA 5I28A 2BZ7A 1ILUA 3UAEA 3QJVB 4YVUA 1FWXA 3ABLB 3T6XA 3TASA 2AVFA 4YSQA 2GIMA 2GHZA 1PY0A 1PZCA 2UX7A 3EH4B 4YSCA 4KNTA 1L9TA 1A65A 3SBQA 1GSKA 4DP1X 2GB2A 2OV0A 4BK5C 1GS7A 4HHWA 3WI9A 1NDTA 2NRDA 1N68A 1JXDA 4DP0X 3JT2A 1JVLA 1NPJA 1NINA 1HAWA 2EIKB 3N55A 3UADA 3FSVA 2WSDA 4DPBX 2H5UA 4BXVA 1E65A 3AW5A 5B7FA 1QHQA 1AQ8A 1L9QA 2Q9OA 3KW7A 1PLBA 3CVDA 2H47C 4FAAB 2YXWA 1ZDQA 4E9XA 4E9RA 1BQ5A 4AKOA 3AG4B 1ZV2A 3DTUB 2CALA 2DYRB 1GY2A 1PZBA 2FT6A 2MRYA 4Q8BA 4YSEA 2YAEA 1JZEA 1NICA 4UAHA 1V10A 2R7EB 1WA1X 3WKQA 2XV0A 4JHVA 1PLCA 2FQDA 4DP8X 3H56A 1NIAA 4WKXA 1KYAA 2IH9A 4E9VA 1JXGA 1OE3A 3NJKA 3U25A 1BXVA 1JZFA 1V55B 4E9WA 3ABKB 1SDDB 4DP9X 1E30A 1A3ZA 2XYBA 3FPXA 1ET5A 2HX7A 5TK4A 1J5CA 1E67A 1NIEA 4AKQA 2PP7A 1BXUA 4A2DA 5B1JA 2YAQA 1SF3A 1WA2X 2XWZA 1KV7A 2VSKB 1TEFA 2GC4C 5B1KA 3NYKA 3SQRA 1JZGA 4KOCA 2EIJB 3T71A 3IE9A 3PAZA 1VLXA 1PCSA 4W9ZA 1PMYA 2QPEB 4YSAA 3X2QB 2VN3A 4A66A 4YSDA 1JOIA 2ZOOA 1KCBA 2OJ1A 2BP0A 3CVBA 4YSTA 5LDUA 1JXFA 5B7MA 5I5IA 2YAHA 3OMNB 1PAZA 1NTDA 4Q89A 2PCFA 3QJSB 3ZIYA 2PP8A 3WKPA 1GS6X 3V9CA 2GSMB 3CDZB 2I7OA 3ABMB 1XB6A 1R1CA 2YAFA 4A2EA 4EF3A 1BXAA 2QDWA 3NJJA 5A7EA 1L9RA 1WA0X 1ASOA 3FU8A 1RKRA 2N0MA 1ETJA 4HIPA 4YSUA 1AANA 1HFUA 2ZXWB 3HEIB 3OM3B 4A2GA 3X1EA 2CJ3A 1M56B 7PAZA 2WO2B 1OE2A 2CBPA 5PAZA 1TKWA 3FU7A 3NSYA 1BAWA 2AZUA 2BHFA 2GI0A 2IWFA 1WS8A 4MFHA 2IWKA 2DWTA 1GR7A 4KO9A 4N4YB 5F7BA 3MBWB 1IBZA 2BO0A 3RYMA 2XV3A 1IBYA 2X88A 2FQGA 3IBOA 3NSDA 4NB7A 4JKNA 3ASNB 2BP8A 3GDCA 2DWSA 1A4AA 5B7EA 2HLEB 4YL4A 2PLTA 2BP0B 2FQFA 2VMJA 2JXMA 4CSZA 4BWTA 3D12B 3QJUB 3PPSA 1JERA 2UXGA 2HRGA 1L9PA 1ZIBA 4DP2X 1AZRA 3JTBA 2OCCB 2MTAA 2UXTA 1HAUA 2XXGA 3H4HA 4F7KA 5E9NA 2PCYA 3S8GB 5D4JA 3MX0B 3DKHA 2TSBA 2UXVA 2QT6A 3UACA 1ID2A 1QNIA 4ZK8A 4GXFA 4G70B 2QDVA 1SDDA 3C75A 1NWOA 1L9SA 4GP8B 1E5ZA 1AS6A 3ZX1A 2PPCA 4GY4A 3TA4D 2PPAA 3NP4A 1KGYE 2UXFA 3TU6A 5I5MA 1CC3A 1BEXA 2XX1A 4E9QA 1A4BA 1PNDA 1J9SA 3CVCA 5B1AB 2FWLB 1E5YA 2I7SA 3QJRB 2BW5A 3CG8A 2JKWA 2GBAA 3FS9A 2BP8B 4GP5B 1XB8A 4G7RB 5B1BB 1OCOB 1AIZA 5B1JC 1PNCA 1XMEB 2XV2A 2W8CA 1NIFA 2DV6A 1M9WA 1WAEA 3GXUB 1JZJA 5I6NA 2XVBA 1GS8A 1BYOA 1J9RA 4YSSA 1AZCA 4BDVA 2YARA 1W8EA 4DP7X 4N8UA 2XX0A 5PCYA 3FQ1A 3S3BB 4KNSA 1MG2C 3FU9A 1GY1A 4A67A 4YVNA 4BWWA 1IKOP 2GC7C 1ET7A 1PF3A 4CSPA 3FYIB 4QLWA 1OCRB 1ZDSA 1NIBA 2FTAA 2AFNA 1MZZA 2P80D 3CDZA 3PXLA 2CUAA 1RZPA 3PLYA 3IN2A 5ANHA 4KO6A 3WIAA 1SHWA 3FU7B 1MZYA 1M57B 3FQ2A 4A2FA 1GYCA 2LLNA 3KW8A 5TK2A 3WNJA 2B08A 2BZCA 2XLLA 1EZLA 1T5KA 3N2JA 2ZONA 7PCYA 5I6PA 1DZ0A 1NWPA 1IUZA 3G5WA 4A2HA 3NT0A 3WG7B 2EIMB 1ZIAA 4BXSV 1JZIA 2HX9A 2Y69B 3ABGA 4M4RB 2XUWA 3SBPA 3NJLA 1XB3A 3CZUB 4M3HA 3AG1B 5B3SB 4E9SA 5IY5B 2HZHA 5EHFA 3DIVA 4DPCX 1TU2A 3IN0A 2TSAA 2J55A 4G7QB 4KO5A 1AZUA 2Y1AA 3AY2A 1SFHA
chains in the Genus database with same CATH superfamily
1TQUA 4KKLC 2EDTA 2XDHA 3KPRD 4U2YA 1HINH 2DIAA 1J0HA 3QJZA 1FLRH 4K7PH 5LXGH 4R84A 4M02A 4Y1AB 4KVNL 5DS2A 3V0GA 3SDCC 3IGAA 5CN3A 5I17B 3MLXL 1D5IH 4L9LA 2XZQH 3WE6A 4PJHA 3RVWD 1NCJA 4JFSA 1SUJA 3WHE1 3ARPA 5LQBL 4GS7B 3K4DA 4UQ3A 3V0FA 4WI2A 5FKAB 5IMLB 2VDMH 4GSUA 5EUOB 1S9XA 2OZ4L 1BOGA 3QIWB 4HFWB 3UZQA 4BFGA 2HH0L 1DVFC 2HRPL 4WVRA 1YEHL 1U8NB 2CIIA 4OIBA 5E5LA 4LPWA 1ORQA 4FQQA 4S2SA 2E7BA 5IR1B 3BVNB 3VI4F 1JF1A 2VSCA 1WPCA 1FL5B 2RFXB 4KNUA 2NDGA 1LEGB 3O6MH 5CIPA 4EUPH 2RHEA 1Q9WA 5T3XH 4UT9H 2Q76B 3G5ZA 1CGSH 4OT1L 3VW3H 1AKJB 4WTQA 2NZ9D 5F96H 5HGAA 3RL1A 2J43A 5BXFA 3ARGD 4C56D 2JXMB 4MJIA 3P3YA 4N2AA 3UMNA 1FGVL 2X2JA 1E9PB 2Z92B 2K6WA 3KBEA 1SNRA 1YEFH 3H7BA 5EZJA 5I1AB 4WENB 4GG8A 2CRMA 1WZ1L 4U4IA 4ESKA 2DYSB 4NNXB 4PG9A 5EBGA 3SDCB 2ZSWB 3F65A 1FI8C 4LLDB 5E7BA 2GTZB 4ZQKB 3W1ZA 1MXDA 3SGKC 5BCAA 1BM3L 5BRPA 1X7QA 1WT5A 1FZKB 1J11A 1BEYH 4MKTA 3VA6A 1UC6A 1DSFL 2MNJB 4IK7A 1RP8A 3OMAB 4WFGE 5JA9A 4JKKA 1FA4A 4GQ9H 1ZS2A 4LLAA 1I8IB 1FZJB 4PJIB 1IJNA 3TVMB 2EDQA 4NCDA 5DVNA 2AKRA 4MNGE 3GEFA 3HHMA 3O2VH 4PJBF 3FQYA 3FB6B 5BRZA 1ZVSB 2P8LB 2YWYA 4LCWA 3V5HB 3QWOA 1QOKA 1Q1JH 3G7TA 5TDPB 3O4LB 5MENA 3HE7A 4BHUI 2YSSA 3DX8B 2X0WA 3HPLA 2ED7A 5GGUB 3FW6A 5SWSA 1FG9C 3G08A 4NWTH 4AEIL 3P3UA 2ZSVB 1KF9B 4Z95L 5FCSH 3ZDYB 4F9LA 3C5SB 3RE0A 4WV1C 3KPRA 5D6DC 1BQKA 4DK6A 4PJBA 1AGFA 1LYQA 2VLKE 1RMFL 2RACA 1EHKB 5KN5B 2BIQA 2CK0L 2FJUB 3SZKC 5HYQA 2FEJA 2WAHA 1OE1A 1UFUA 1N5AB 1G87A 2NY6D 1G6VK 1OT1A 3ILDA 3MNZA 4OZHB 4XNXL 2R7EA 3TNMB 3VMPA 2BNRB 4HZ1A 1CFSA 4JVWA 1DQLH 3UJIH 3O6ML 3HPJB 3RUGE 4HYTB 2D4FA 4NZJA 3FQXA 3TT1H 1I7ZB 4M6MH 1FNAA 3T6VA 1QLEB 5D1QA 1H15B 1TQTA 4XPFL 4JZJB 5IVXB 5HJ3A 1SYVA 3S4SB 1I1RA 1DBAH 4LGSB 3ZL4L 1WFUA 1B90A 3I75A 1PKOA 3BH9B 4XXWC 4HU8A 3ARXA 1QVOA 3T3PE 1NM9A 4OLUH 4P2QD 1FNEB 4OV5B 5AWNH 1MFMA 3FT2B 3PWNB 3NJGA 3QIBD 2IDTA 4UV7L 5E8DL 3QDMB 2W0FB 3OBAA 1NKOA 2C9AA 4D8PB 5FHAH 4YE4H 3AXLA 3GLDA 1AOZA 4PAZA 4DZ8B 1F6AA 3WIIH 3EFFA 3KWVA 1MWOA 3NJVA 1HVXA 2OMUB 3VWJA 3ZDZF 4HPOH 3PDOA 2CO2A 4M7LH 5D7LA 5MERB 4UOW1 1S7QA 3BKCH 5FFLA 4LRIC 2YLHA 5IHUL 1PY0A 3QEQD 4LU5L 3ZDXF 5BRZE 4JGJA 1U42A 4H0GA 5EOQH 1IBBA 3NRFA 1JGVL 1UXWB 2ZUYA 4LQ1A 2ODIA 4MB1A 4K5MA 3HZKA 4F27A 3GSVB 3V6FA 3V95A 1GS7A 3LQAL 1DE4B 3FF7A 3IDXL 4JFQA 4DETA 2WBJA 5H35B 2VIRB 3TEXA 3OR6A 4KZEL 2QFRA 4D9LH 2ARJQ 1SDAB 1YRKA 5GGSB 4YBQC 2JJUA 4AGPA 5ACMA 3F12B 1SMAA 1TYJA 1WD8A 1I3UA 2VLKB 3MLVL 3Q9QA 3PGDB 4NZTL 4YWGH 2GJ6B 3UZEC 4H25A 5B39G 2GSGA 3WS6A 3ZLQC 2YPVH 4F3FB 5CBAB 5I1AA 1LE9A 5FO9A 3IXTA 1P7QA 2CIKA 1A66A 5C70A 4UQ2A 3E6HA 4KJYA 3WN6A 1OARH 3Q05A 1TMQA 3PQYB 3T4YA 3U4KA 4YSEA 1S9VA 2YAEA 1JZEA 1S9VB 2AEOA 3CDGB 1V10A 2AK4B 3FUFA 3QZWG 4MMZA 2Y5TA 3A6CH 4FJ6A 3W9EA 3LRLA 2JCCE 4G2AA 4AIOA 1KLFA 5GJSH 1TF4A 1YEKL 1MJ7L 5IROA 1A6TA 2XWRA 4XMKH 4JFHE 1XH0A 1TG8A 3VWJC 3OB0H 2Z31C 3QEUA 1NGPH 4J3OD 3CD4A 2MQGA 3MKKA 4MA3B 1JCVA 1T20A 5SWSE 1QMUA 1T1XB 4OCWH 3L5HA 1KEML 1IZKA 4Q74A 4AENA 3VAEA 1P69B 2NXZB 1LO2L 1UH3A 2QHRH 3OMZA 4DVRH 5FYJD 1SM3L 2APFA 3NCXA 1GW6A 3TBSB 1WA2X 2A6DA 2XWZA 3WIIL 4P2YA 3TA3A 1QFWM 3ZDXB 1COBA 1LO4H 3EJJX 3SQRA 2IAMB 4YE4L 2VH5L 5DYOA 2Z8RA 3R8BB 3ZE2F 1I7RB 2CM6A 4LLYA 4NKOA 2OYMA 2WW8A 4YSDA 4ABVA 4DGIL 4GKLA 3S3PA 4JK0D 1TJMA 3P3TA 1I31A 1A47A 5T5FH 3I74A 5LDUA 4F8LA 1WIOA 4E0RA 4POYA 1Q4NX 2MQCA 4N0YL 3WTWA 1CXFA 2CR0A 3R1GL 1F86A 3RWEA 4BCXA 1XZ0B 2YGOA 5F7MC 4Y5YB 3DXAE 3P4OB 3UDWA 2YN3A 3EGSB 4HS3B 2E6JA 2J7LA 5ALCH 4OLEA 1S7XA 2X40A 3ABMB 5E1QA 5CBEB 2OK0H 25C8L 3WJJC 1CTMA 2BC4B 3SDXE 5KTEH 4XCNA 1L9RA 1KB5B 4LOVA 3MRQB 2N0MA 3DVGA 3OM3B 3PIQB 4OF3A 3X1EA 3EJTA 2OA9A 1ZD6A 1TKWA 2H26B 1H15A 1G7IA 2YMXH 2NYYC 3GRBA 5IVXA 1EO8H 3SDAB 4KZDH 3LNDA 4YGVA 4R2GD 1HZHH 4FFYH 3HB3D 3FT3A 4EI5A 2NCMA 2OSLB 3DUSB 2B20A 2JIXD 1OP4A 5CFHA 1NFIB 4PJXF 1UB6B 1A9BB 2Z6FA 1DN0A 4G9FB 1NFKA 3VRIB 3SBWC 1RZKC 5DVKA 3QULA 5B7EA 1W8OA 4DZBB 3P9LB 4MNHA 1VGEH 2YQGA 4YL4A 5DJ8B 4IRJB 1MW2A 1YNTB 4YDIH 2YSTA 4BK8A 4ZO6A 2BK8A 5JR1H 3AXIA 4FFWC 3MJ7A 1UM4H 1BD2E 2J8OA 1U8HA 3HN5A 3O3UN 5FFOA 5JMRA 4D0DB 4M29A 2N0KA 3D30A 4O51A 4PJBB 5FYLL 2VKXA 3JBG7 5T3ZL 1Y1DA 4KZCA 3MBEC 2COQA 5GPRA 3GSQA 4WW2B 4XCEB 1IE4A 2OL3A 2VLRB 4NQEE 3SB3A 3ZZLA 5L8JB 3OLGA 3FAWA 4WCYL 5JW4R 4EN2A 1DE4A 1MCHA 1UT9A 2CRZA 4NJ9H 2PPCA 4BZ2A 1HU8A 2EE6A 3I75B 2R4SH 3UJJH 2BNQE 5KYXA 3T5WA 4J27A 1FL3A 3LPOA 2YIHA 2GSGB 4F3FA 1LE9B 2X0VA 3K91A 4R6UA 1BWMA 2WYIA 3D25A 5JIMA 5DUBA 1KT2A 3WUZA 4JFTA 4GBXA 2FD6L 5DLMH 4P0DA 4WDIA 4CL7A 3GRWH 4NKQB 3OKYA 1N12A 3PHQA 3U9UA 1MI5B 3LRMA 4ZAKA 3F84A 4Q2ZB 3C60D 3QCUL 2EADA 2APSA 2ILLA 4WLCA 4IBSA 4PY8J 3GRWL 3ARFA 1XGQB 3IDNB 1GS8A 1BYOA 2VDRB 2QSCL 3TO4B 1AZCA 4LLMB 2CO7A 2NNFA 3BGFB 3P1VA 4HKBB 2PWGA 3U46B 1PLGH 3BFQG 1ZGLM 5T33H 2AK4A 3M6DA 2VNCA 3REWB 3GHBL 5SWZE 15C8H 4Z7QF 3C09B 1QKZL 1F13A 5MERA 3F58H 3DHUA 4JFYB 3VRLF 2N4IA 5DJYB 3ZHNA 5E1HB 4P59L 4NJAH 3C60C 4BA0A 4QLWA 4JJOA 1WIUA 5BQDA 1MZZA 4G6AC 1E8YA 3CDZA 1GTFA 3QQ4A 2BH0A 2CUAA 3ZK0A 1S46A 3NESA 3TCTA 5JDSA 8FABB 5DMGD 2ESVA 3L3DA 5AVRB 5ANHA 5TTRA 1DBKH 3LMJL 3QZBA 4CKVX 3HOGA 4FQQB 2VQ4A 2WXIA 4NXSA 4PJDE 5D1QC 1OGTB 1HINL 1T1YA 1H3XA 1JPSH 3ENEA 2AK4E 3PY9A 4RFOH 4LOUD 3QT2A 5TE7L 2EKSA 3RZWA 2R0KL 3FRPG 5GGVL 4A2HA 5ILTH 1HSBA 5CCKH 5E1AB 2WWMC 5KANG 3ZKND 3H3BC 1JPGB 4A2MA 4E2OA 2ZUQB 2OTPA 3IDUA 4ABUA 5F97E 4MJ6A 5DZLA 2EEDA 5IY5B 3TVMC 4PJEF 2OMVB 3QEGH 4AT6B 4TOYH 4JCWA 1CL7I 5D1QD 5E9AA 1KELH 5GGRA 2BC4A 4Z1PA 1W16A 3EO9L 3RFZB 5A3IC 5FGRA 1U30A 1QFHA 1JD7A 3GMQA 4TV3A 3S4SG 5JW3H 4K94L 2ZAGA 5AG9A 5C09B 3ZRFC 2JCWA 4FYQA 5I2IA 1NQBA 1CXLA 4WI6A 3G9AB 4EOWL 4Z0BL 5AW5B 1X6NA 3TBCA 1CLOH 2EDYA 4JG0L 4TLSA 1SXBA 2DH3A 1PJWA 2F58L 3L4XA 4FFVC 3NIFB 3KYKL 2WYHA 4W6YB 1DJSA 3NJFA 1SJMA 1QAWA 4NHUB 1KLUA 1MFBH 2FEDC 1AP2A 4UDUB 5HHNA 4B9PA 1UJ3B 1QWUA 2JKIS 2OYPA 2R23B 5JNYB 4PJIA 4A6YA 1WFOA 1NCHA 3EHBC 3CJJA 1FPTL 1J1PH 3D8MA 3ETTA 4J6IA 4M7JH 2V2WA 5JHAA 5LDSA 4OCYL 1YEJH 1VZGA 4PLKD 5F72S 1BA9A 4AQ8A 1IBGH 4P5KB 1GKOA 5F70A 2CM5A 3ERXA 3DMMC 4HUNB 2ZP8A 5DWUH 5EZIH 3T04D 3X1FA 4XHQA 3J07A 1O9ZA 3HE6B 3WN5B 1OXYA 1PU0A 1CURA 4GPVA 2M8XA 1NJ9B 2HPOA 2H1PL 3QXAB 4F80A 4L8BB 4PJIF 4W9GC 4OQTA 2PYEB 2C7UA 4NN5C 3BQVA 3VFPB 3GMPA 4DGYL 5ILTL 3U48A 1BLIA 2C9RA 1AD0A 5AG8A 3S35X 3VXUD 2BNQA 4MD4B 4LL4A 5HYSA 4S0SD 3I85A 1UZ6E 3POCA 5CCJA 2VZUA 1YN7A 3BIBX 3HRPA 1AGDA 1JPTL 5D9SB 4NFBA 1CMOA 4AGOA 5DHVH 4F33A 2GABA 4BUQA 4I0KA 5D7JB 3HC3L 4XN8A 5F6IC 1LM8V 2D3JA 1QI5A 4RDQF 4PV1C 3BWSA 4GSDH 4P5MB 2BHZA 1A2YA 2P8PB 3FQXB 5DJAA 2ZXBA 1JJUA 4FQCL 4YZFE 3L1EA 1FYHB 4FZ8L 3BKYH 4P5TD 4DTGL 2YAPA 5JHBA 3C5JB 5BMFH 1EEZB 1N70A 1YNLL 1KGJA 3VFUA 1VFAB 1LO0H 1OAKH 1ES0B 2VM3A 4F7TA 3CFMA 3L81A 1QFUL 5F8QC 3FHAA 2XN2A 3L95B 3MNWB 4FQ1H 3S8FB 1AIFA 2X4NB 5AB9A 4LFHD 3MUY1 3FB7B 3FCUB 5A7BA 4NQXB 4XWGL 3ZBMA 2IC2A 1IBGL 3DV6A 4E9YA 2R2HB 9PCYA 5ID1A 2CGYA 2HVJB 5D5ME 2JTDA 3HMXA 3P77A 4BCYA 4PP1C 4LCCA 4DFHA 1LJMA 1RK1B 2FVNA 2GW5A 2VLRA 2YPVA 4OIIH 2Z7YA 4PJFA 4QHMA 4L0ZA 3VQ2C 4I1RA 3RTQA 4QHNA 3KPMB 1EO8L 2H3XC 1I75A 2W5PA 4AGLA 1E9PA 4BGLA 4RZKA 3BWUC 2VDOH 1REIA 5C86A 1CTNA 2E86A 1E3XA 4XVJH 4YDLC 4JPKH 3KPSE 3L5XH 5F0MB 3R0NA 3RWDA 2XN9D 4EAEA 5HGHB 2CXGA 3MXVH 3F7VA 2F5AL 4YNYB 4IIZA 4RX4A 3GQFA 2YPKA 4KTGA 5LXGL 1AG6A 2AJSL 3C87A 3TVMA 1YEDA 1G9MC 4GLRI 4M43H 4HH8A 3G6JF 4KI5E 4L8DB 4RAVA 3RNKA 1I3RA 2B2XL 1R0AL 1HH6A 4RSVA 1KTKE 2X2HA 2X4RB 4JRYA 1TJGH 1P84K 4YFDB 1OQOA 3ALPA 3ZDWA 1R0AH 3CSYA 5LKNA 3PWPE 1BG9A 3DPBB 5IK3B 1SHXA 4JAMA 2OKMA 4MAUL 5CJOH 2EO7A 2J5LC 2YAOA 3VWKC 1ZSDB 3WEOA 4JB9H 5B8CB 3WXWH 3NACH 2R0KH 1IGMH 3D4YA 1ZK5A 2ZKMX 1GGIL 2JIXA 5ACLA 2JJWA 4L05A 2XI9A 3FCGA 2JK5A 4R4ND 1SMOA 3CCHB 5L2KB 3HHSA 4YDKL 5I9QC 2BX5A 5DJDA 5CZKA 4IS6B 4X80L 4IS6A 4FL4B 3M1BB 3S97C 1PTZA 1BZDA 2V5TA 4W9KC 4ATTA 4F7PB 3KPRB 3RHWK 5L4FA 3T2OA 3CFEB 1HKLL 4GO9A 3IKKA 2H2PD 4H0HB 4F9PC 5K1NA 1OVZA 2A99A 3OKOB 4MA7L 3IM1A 2PTVA 5DMKA 1A6WL 5BVJB 3STZB 4LCUA 1EAPA 5D2NB 5L0QB 4OCNC 3W2DH 1TVDA 4EO5A 3CX2A 5DHXB 3T2QA 4DEWA 4QOKD 3U7YH 1MFNA 5JOPD 3KWUA 1CDBA 1ZANL 3SQOL 4HHWA 1NMAL 3VG0L 3LEVH 4HZLB 4NQEB 4PJ9B 4DP0X 3PF2A 3JWNC 1NPJA 3EO0B 2O6DA 3QJOA 4KKLD 4PJ8A 4XXDA 3SY0B 3V8CA 2XJKA 5HGBB 3NEXA 4NM8L 3GSRA 4UV4L 5KJ7E 4P3CH 2UWEB 4RISL 2AJXL 2P8MA 1T04B 3QI9A 4HWBH 4XZUA 4Y16A 4WF7A 5HVHC 1P5UB 4PJDB 1I8KB 4HETA 5IJVB 4ADIA 2EECA 4Y9CA 1AKJD 3AWGA 1KFAL 2K70A 2Z93B 1W80A 2I9LB 4P4KA 5FW8A 2FB4H 2VRAA 1KB5H 1F6AB 5I1LA 1BQLL 4Q9CA 3IGLA 1WA1X 2AEWA 1CR9H 4UB0H 4JHVA 4NQCA 4HC1A 4JG5A 1YPZF 3AJ7A 4NSKB 4OD3H 2YK1L 4MNQE 4H88H 4EZLA 1J5HA 2IH9A 4IRSC 3BUYB 3L3JA 3WAKA 1TSHA 5AVZB 4C4KT 2E56A 1H5BA 2K8QA 2DMKA 1SDDB 1JPTH 3Q8AA 4BZ1A 5FR3A 1FV1B 4K7PL 5GHWH 1U8IA 3FPXA 1ET5A 4KQ3H 1U92A 3VG9B 1ML0A 1E6OH 2Z34A 1EHAA 2OLDA 4QRPB 3APDA 2KC0A 1OD7A 4NBXB 4A2DA 4H8WC 2EE2A 2ITDA 3B9AA 4XPTL 1IEAB 4IRSD 4W70A 1YEGH 2Q0ZX 1IMHC 2RD0A 1SBBA 2ZCLH 3L3OA 1CU4H 4R8WH 1DANT 4PJGA 3JWDC 4XN9A 2VERN 4G9DA 1BDYA 4HUCA 3KLHC 2EIJB 1PCSA 3BVUA 2I9TB 1WC7A 1U8MA 5J9PA 5ANME 5AUMB 5DMIL 3HNVH 2PO6C 4H8QA 5KS9F 3QUKA 4BE6A 4YSTA 3AADB 5GSVA 1IAIM 2F58H 1JXFA 5B7MA 4A04A 1JMXA 1QABA 4M6ML 3R4RA 2QJDA 3JWOC 3EOYG 2N1KA 1NGWB 3JVGA 2CHZA 2HJKB 3SE9L 3V9CA 5C2BH 4J3BA 1YDPB 4K73A 1U93A 3IK2A 4M3KB 3JYBA 3F05A 2DQEL 1OEZW 4ZFFB 3FU8A 1V8HA 1ETJA 2WYTA 3O6KL 2FJHA 1T03H 1L9MA 1KYUA 1KC5L 1R3LA 3KLAA 4FRWA 4G1MA 1PPIA 1GKEA 2V9QA 2XFGB 1IC4H 4S2SB 4NC0B 3AU1A 4H20H 1NKRA 1WSST 3B9KA 5DMJB 3NSYA 2ZP9A 2PW1B 3RPBA 4G6JH 3ZKXC 3BHBB 2XNAB 1GOGA 4TPRH 3QJFB 1UCBH 2Q6WB 5HVHB 2ETWA 2X3AA 3FUNA 3MBWB 4CSTA 3BP7B 5ESAA 1VIWA 4F7TB 2A6JA 3JUZA 4V1DD 5GS1C 2GFBB 3LB6C 2WWOA 4X4MA 5MENB 2X1XR 2ITCB 1TT6A 2Q7YA 2CDGA 3FN0H 2FQFA 2IGTA 2X1WL 4QRTB 1K5WA 4DF9A 4XGZB 4A7TA 3NABH 4PG9B 1IAKB 3HIZA 2W9DL 4MD0A 3D85A 3Q3GA 5DRXA 3QQ3B 4Y4FA 3LXCA 5T1LA 2VERA 4G6FD 4OLZH 2BOCB 3DXAD 5D96B 5E2VH 3N5AA 3X3GL 2E9GA 5E6IC 5AZ2L 2A2QT 2Z4QB 4CN6A 2JI1A 1IGFH 3I2CH 2GK0A 2M83A 4M93C 2NY4D 2AJZA 1S8DA 2FCBA 5IVXF 5FHBL 5DC4B 3V4VL 2F1AA 4ZMNA 1DLFH 4JFFA 1G7MB 4XC1H 2F5BL 2YD4A 3QCUH 4HPYH 2AQRA 2XIDA 1KGCE 3VXTA 5C0CE 4TNVF 5FYLD 3L3GB 4ELMA 1JHKH 2PCXA 2BCMA 3L4CA 4JO1L 2XXMB 4XCFL 2F74A 3DSNB 3NP4A 1KGYE 1G43A 3AWFA 3SQOH 2BIIA 4BSJA 1FFOA 2O30A 5CHNA 1A4BA 1ZS8A 1AXSA 4FYTA 4OZHF 1AQMA 4C4UA 3DMMA 1RHHB 2IALB 2BW5A 4AIXA 2WSKA 4BFIB 2VMEA 5JHDE 2UYLB 4IBYA 4JO3L 4KUCF 1FZOA 4WIQA 2I26N 4B5EA 1E9QB 5KOMC 4OFDA 4IRJA 2ZF8A 1KWGA 3ZL2A 4R97B 1JRHL 4GRLA 3N44B 1EHLL 3JT0A 3M17B 4AEFA 1GZQB 4L9LC 3RKDC 1EA9C 3AB0C 1G1OA 1LK2A 2CJSA 2F18A 2RBLA 3MLYL 4OCMC 4Z3IA 1U8CB 5E6YA 2E7LC 4YDLB 2W07B 4ISVB 5JOFB 2XX0A 3BEVB 4NAQA 3T2NH 5T3ZH 1DVFA 5D70H 3ARDC 4KNSA 1YNKH 4R2GB 5EO1B 4JRXA 4CSPA 2COVD 1XD1A 3B1TA 1OCRB 1ZVHA 4OB5H 4WK2B 2WKLA 4MB4A 4QO1A 2XZQL 4Y5XA 4DCQB 3VM7A 1TQSA 3EGXA 4FS0A 4PJCB 3T0EA 5C0EB 2YXMA 5CLWA 4GJTB 5HHXL 3MBXL 5C3TA 4F9LC 1TZHB 2VR6A 1UACH 5FGCE 4WU5B 1F4HA 2R0LH 2E6QA 1A0QL 4EN3D 4R83A 4DHLA 2WKOA 4JREB 3SE8H 5LGYA 3P30H 5DHMC 5E6SB 4HUKB 4PRPA 1KZYA 1Z9OA 4V1DE 4CAGA 3CHPA 4ANWA 3EOTH 4FZEL 2YPLA 4HX1A 4I0PC 1L7IH 4H2AA 2BNUB 3GSOB 2CUIA 2HX9A 1MFDL 1I3VA 1MFBL 1LWJA 4NRZB 4D0BA 4TQPA 3EW3B 1DQIA 5I1JH 2WQWA 4NUQA 4LL1A 4C83B 5GSVB 2LU4A 1MY5A 2L7EA 3TWYA 1XCQA 5MEPA 4LLVB 2E74C 5IW6B 1GRWA 4BFKA 4Y9EA 4F7CA 5FEBA 3D6GA 4TNWK 3RZCD 4QRPE 1H5BB 2VDKB 1KIUB 2GVYA 2JI2A 5D93B 4H8UA 5H37G 3LH9A 5DRWB 3BUYA 5F7UA 1OAYL 1S7UA 4P2RD 1A4JB 1O5DT 3D39A 3ZKQD 1QR1A 2KLSA 3FTSA 3VSQA 1E28B 1E4XH 1N4XL 1XGTA 2EH7H 3GTTA 5EZLA 3HZYA 3O6FD 3NDZE 2AV7B 2WCSA 4JRWA 3UC0L 4APXA 1JBJA 4GRWB 4HS8L 1S7SB 4NN5B 1BAFL 1V54B 3IJYB 4BELD 5I1IL 3H4FA 4BZ1L 1ACXA 2CQVA 3H2QA 2IJ0C 3RVUD 2F7OA 2YUZA 3ECWA 4K3HA 3VRLE 1N3NA 3IMUA 5J13C 3GD1C 3DX3A 4XP6H 4ODWA 3O41A 4GQZA 1X9UA 4PRBB 5E4EB 3KLSA 4Q4EA 4RRPA 1L5GA 1IAMA 1UACL 2BSEA 4QHPA 2ESVE 2QHRL 5DD1H 3MGOA 3RIAF 4ONGL 4AM0Q 5IMOA 4PD4K 1GAFH 2DL2A 1EV2E 5ESQA 1KJVB 4Y4FB 1WC7B 2AQ1A 3IDYC 2DOCA 3ZGHA 1QPXA 2ZYIA 5D4IA 1RZJL 4LLWB 3SDXA 3RNQB 5DU7A 5AAWA 5C09D 4F1SA 1EANA 4XNZB 5JIQA 4WWKD 2WIIA 1OP5H 2C34A 3UGEA 5C08D 1U2HA 2V2TB 3MFFB 1UEYA 2CMRH 1RCYA 1H8SA 3P4OA 4IU3A 4XHJD 5I24A 2YZ8A 1A3LH 3CN0A 2J1YA 5C9JA 3CPLA 5KUMA 5EA0H 4X7TA 1JG9A 5ERWB 2E6PA 4NYLA 4OJFH 4P2OA 3BHBA 1LGVA 3HNVL 1E8XA 2WQVA 1FORH 4NM8H 4IHOA 1ET8A 3ATAA 4HK3N 4JQVA 4OSUL 5I76B 4MDJB 4CU7A 4XHJC 4YWGL 3WFCL 1AR1B 3KYAA 1NZRA 5AKSA 2RA1A 4WNQA 4ZUWA 3FJTA 4O2CB 3VG0H 3LYRA 4H0IA 1J8HA 4JDEB 1CPUA 3UGUA 3VXUE 1E9QA 3HR6A 1D5ZA 1FGVH 2BIMA 3NAAH 2OSLA 2CGRL 3DUSA 1OWWA 4HXAL 2WXLA 4IHBA 5I26A 5T5NG 5IT2L 4JAMB 4HS6A 4XGZA 1HCVA 1E3ZA 4B7IA 4AEEA 4FF9A 1GTNA 4NIYE 2WZPD 1L6ZA 2F61A 4FI6A 4JREC 4P4RA 5BRZB 1CYGA 5L7XH 1DVSA 1MJUH 3SY0A 5DFWH 2JK5B 2XTLA 3NPSB 1THCA 1INDH 1P4IH 2OXHA 4HPOL 5IQLA 4YFLF 3MRQA 3L54A 4HIJA 1HEHC 1KXQA 2FLMA 3HC0B 3KL0A 3RKPA 3SBRA 1T0MB 5C6TL 4HKJB 4ZSOA 5KAQF 1WE5A 1BQLH 4N2LA 4X8GA 3QZOA 1DVZA 3HPJA 5J11B 3LKOA 3K2KA 3BEWB 5IHUH 2BNRA 4FCHA 1XGZA 1M05B 2OJEA 4L3ED 4NP4L 5LBSL 4CVXB 3BGFC 2BSSA 2XKNB 4HHGA 4Y2DB 5JW4M 4G8IB 1M7IB 5DD1L 2A9MH 1EEUA 2C4XA 3RVVD 5L6YH 3H3PL 3HE6D 3MUGB 5IIEA 5DRZB 2FT8A 4A68A 4IBQA 3OXRB 3BN9C 2VQ1A 5LGJA 5DEGA 1AXTH 1A7QH 1INQA 2D7NA 2NQDA 2R56H 1AQKL 3IEAA 5CCGE 3IAQA 2R2BB 4YPGA 1N7ML 4X0KB 2ZCZA 1XMWA 1KBWA 5I1HH 1CDGA 2X6BA 3JZYA 1J05B 3UIZA 4KGLA 1OW0C 1EEZA 3T08A 4JRXE 1NPUA 3C6LB 3LQZA 5TGBA 4GRWH 5A43C 3HG1B 5E70A 5D7IF 1Z9SA 4S1DC 1KXTB 1OTUD 2MCG1 4CJ0A 2W81C 3BPNB 2PMZA 3PGFH 1BG1A 3TT1L 1G0DA 1FVEB 2V7NB 2Y22A 4Z7OE 3U0WH 1KB9K 5HJBA 5BV7L 5I6XB 1B2WH 3IMBA 3ZL1A 3OD3A 4LASL 1HSAA 2X4OB 3ARBC 1HS6A 2W0LA 3WIFB 7FABH 4WW1A 3P73B 1VEOA 2IPUK 3ARTA 1MF2L 3FUMA 3STLB 5JTWA 1LEIA 5DUML 3LPPA 4KX8A 1J8KA 4L8SC 3D33A 1QHPA 4TM9A 3CGTA 4I2XB 1DVUA 1OOAA 3VFTB 1AHKA 4YR6B 4PJEA 4YXKH 5DD0L 5EN3A 2FJHB 4PY8I 2HN7A 3WI9A 3E7JA 3UZEA 2QGCA 1UQSB 4MLSA 4O2EA 3MV9D 3WBDA 3ULVE 5INDA 1IARB 1XGYL 2PYFA 4LBAA 4JDZB 4KXZI 3AUWB 3GSVA 5C0BE 1FJ1B 3D39D 3INUL 3L4YA 4NQTA 1Q0XH 3U1PA 2BCKB 1G5GA 1AJ7H 2QADD 1UGKA 4FTVB 5MEQB 1P1ZA 4XX5A 5CJ8A 5F7YC 2XRAL 1NAMA 1F2QA 4J4PA 1CF8H 1X7TA 3DSFH 2Z31A 5EC1A 4CC0A 1WTGT 1QASA 2A9NH 1F97A 2DIEA 4EE2A 4OJEH 2NOYA 3EJZC 4JO2H 4AVJA 1X5XA 2EVJA 3IDJB 4H7VA 4ZAKC 4XMTA 4H1LH 1M2VA 2CLRA 4LPCA 4FEMA 3QNZB 3PNWA 2C9SA 1NLDH 5DJYA 5JHLL 3EBHA 4L3CB 4A6YH 3DDFA 2XNAA 1E67A 5J6HA 2APVA 2NY1D 2PW2B 2PW2A 5EBLA 4GUPB 2H9GB 3UTOA 1NM4A 1SLUA 3QDGD 2VR8A 3EJZD 4NPYB 5FECB 4FNSA 1QSEA 3ZOAA 4PWEA 2IAMC 2EKSB 1ID5I 4WFFE 1J0YA 4CW1A 4TQHA 3BZEA 1S7TA 1I3GL 5E4AA 3QQ9C 1CXKA 5T1KD 1MNUH 4IDJH 4GMSL 4A66A 1ZSDA 1G9HA 2BY3A 1O7DE 3L1GA 2LU7A 1O7VA 3DA0A 3MCLL 1G5AA 1UA6L 4MJ2A 3SDCA 1XR9B 3U6XA 3VJ6B 4AIZB 3FOMA 3KGUA 4RESB 2YD3A 3C6SA 3CMGA 3P4LA 4GKNB 3TL5A 4M56A 2Z4QA 1XCTA 1GCFA 2FX7L 2B16A 2CA3A 3NIDE 4PIBA 1CK0L 4FXKC 3MX0A 4FQXD 2X6AA 3DETC 4DN4H 2XWJA 5HVFB 1I1AA 1AP2B 4F7PA 3GJFH 3DDGA 1FBIL 2JWYA 3KAAA 2JI3A 3ARDA 2XPYA 2G4EA 2VUOA 5J6SA 1F6FB 3UC2A 4ANXA 2NY3D 4CGUB 2LLGA 4DGIH 3OKLA 4F5CA 3WTSA 5C0JA 1KBBA 5CJ5A 4NCC1 4OJYA 2AZUA 5C0AB 4MCZB 4FQXC 4G8GB 2DQHL 1WFIA 4MA8L 1KPRA 4KO9A 1CLZH 1USZA 3UYRH 5CR1A 3HE7B 1DCLA 3MA7A 3OKNB 4PB0H 1FV1A 3VXQB 4DEPB 4U6VH 4FTVE 2EDKA 2Y4SA 2O5NA 2I5YL 2VMCA 5EN2B 3TP4A 2PO6D 1CDJA 2VXUH 2W38A 3RX7A 2A83B 2NZ1A 3F6IA 3PP4H 5F9DC 1IM9A 1JK8A 1FFPB 1IGJA 3HCVA 3UJIL 4PW3A 5TDNA 2R8SL 3BESR 1OAQL 4YX2L 3UGXA 2NSXA 4UM9B 15C8L 1A7PL 2I9LA 4P4KB 2IFGA 1AC6A 5T33L 1FAKT 3ATDA 1T4KA 3MRGA 4XX1E 1RFDH 1BMWA 4FNTA 3EH2A 3I9PA 2QSCH 1TCRA 1U8LB 3TN0A 3LN5B 4DUWA 4MZ3A 2M1KA 2OL3B 1F3JB 2X2UA 4U33A 4JFXB 4J3OH 2NY5H 3F7KA 4ZOBA 3MJ9L 1XSKA 3E8UH 4FL4C 4N1CA 2LTQC 4NUPA 3K4ZA 3QRLA 5D7JA 5JXEA 1TSRA 5I9QB 1SDDA 3ILQD 2ZXDA 4L48A 5ES4B 1E5ZA 4ZOCA 2XY1A 3HLKA 3IU4H 4KX7A 1EFXB 1TZOA 3DGCR 5DJXB 5TE7H 2EZ0D 2Y5QA 1DJYA 3IFLL 3LPWA 1RPKA 4M8VA 2X4NA 5AALA 1EGJH 4DO5A 2JQAA 4ALAL 2I7SA 3PV7A 4PJ7F 1FL5A 6FABH 4GSDL 2QPSA 2JKWA 4DOHE 4QHUB 2BFVH 1T0PB 5J7CC 1ERNA 2EXTA 4LLQB 4KH2A 5M7QA 3FUDA 4PVLA 1WAEA 2H2PC 3AY4C 5H94A 1R24A 3UROR 3WEAA 4WUUD 4H8WL 2YRPA 3RUGB 4J8QA 2VDOB 1ITCA 3SY6A 3UYRL 3WE6B 5I75B 3UOAB 5AW1B 5FPIA 4LSQH 2X4SB 5J11C 5I8EA 4OD1L 2X4TA 3ESVF 4G42B 5HGHA 1PDKA 2IF7A 3VI3E 2ADFH 1IKOP 3I6LD 2E47A 4Z7WA 2APBA 2GAZB 1E4WL 1ZY9A 5SX5H 4JHBA 1LWRA 4LCYA 1NFDB 5F9JA 5SWZD 3H42L 4V1DB 2GCYB 2GUOB 5BVJA 2ESVB 3L3DB 3DI3B 5G4OA 3WIAA 3OG6B 5LG6A 3BLKA 4NOBA 1KLGA 1XVSA 3ULSA 5CNHA 3WNJA 3BDYL 3IJSA 4R26H 5CP7A 3KJ4B 3KLLA 5KUKA 5D72H 3WIHA 1KTLB 1EZLA 4JM2D 1LXMA 1IAIL 4Z76A 3NG5A 1U8PB 4GBXC 5JUEL 1DQLL 4QRRE 4CA4A 2P5WB 3WG7B 3OG4B 3HNTH 1DLHA 1KN2H 2VM9A 5HPMA 2JJTC 1CXEA 2GTQA 3MI6A 1T7XA 3F7RA 3X11A 4BH7B 4OZGB 4NQED 4PJ9D 2A6IA 1RZ7H 4A7VA 4LPTA 4ZTPL 3FKUS 4KVNH 2JKNA 2OTWB 1U21A 5D2LE 4RNRA 3U9WA 4G83A 2ZUVA 5FF6A 3FDWA 5FYJE 3X14A 4DGUA 1IGCL 2EILB 2GIXA 3U4AA 3B2PA 1EH9A 5HYSG 3GI9H 1HC1A 2ADIA 1UATA 2EDJA 4AC4A 4BWUA 4NOFA 3KLHD 3ROOB 5HHNB 3D08A 3T1WA 2B3IA 4MB5A 1J5DA 1PVHA 3LKSB 5BW7A 5KS9A 3NN8A 1Q9LA 5C0GB 3WY1A 4DP5X 4N1HB 4KO7A 1RY7B 1SXNA 3IMSA 4HUXB 2ZCHL 1AYOA 5MHSD 5A2JH 4JNXA 4TSBH 1K3IA 1MCEA 4RGND 4I0PD 1AHWC 4U1NA 4UDTA 4A7SA 4Q52A 4FFZL 3ARUA 3WV0A 3O8XB 2O6EA 3WGVB 1NMCC 4AMKH 5CEZH 5ICYB 3IRZA 2UVEA 3QDGE 1ZOXA 4YMPA 3OX8B 4U1SB 2PTTB 1WISA 5A16A 1EDHA 1AQHA 3GF8A 2R2EA 1T89A 3MUZ1 4MD4A 3N40F 3KCPB 3SPJA 2X4UA 4WU7B 1H6EA 5L9DH 3EOBA 2XWJB 2R29H 2IAND 3EH5B 4X6BB 3IETA 1RZQA 3K5RA 1LE5B 1ZT7A 1MCBA 1E5UI 1W72A 1N5AA 1ZV5A 5EFIB 1XCTB 1FL6B 1MSPA 4ICWA 5HDWA 3QFDB 1CUOA 1KBKA 4JE0A 1GGYA 1Z66A 1YEFL 1CB4A 1HCZA 2FEEI 4Q56A 4CC4C 2D4DA 1UGNA 4J3OC 2R1WB 2R1WA 2DLGA 5D7LB 4XPHH 3LZLA 1JIBA 1QG3A 1RUPL 3N1PC 4DQOL 1CYWA 3OJDA 1BJ1H 1EK3A 2AEQH 4XPHL 3NJNA 3MGAA 5GS2H 3MV7B 3WTXA 4XRCA 4HEPA 1F4YL 2V3DA 2DTSA 1ASQA 1AZBA 1F56A 1B2WL 5DVMA 4OF0A 4HC1L 4FABL 4HXBL 2FQEA 5DJXA 2ZUQC 1A6UL 1ZA6A 1WITA 3GEWB 3LKPA 4XO9A 2CPUA 2H32H 3DJSA 1IFHH 4DUVA 1B9ZA 4LBEA 1TOXA 2CLVB 3IF1A 4LXFA 4GBXB 4WRLA 1SM3H 1ZVNA 4YUEH 4GT0A 5BZWA 1J9QA 3MRFB 4N2NA 4OVVA 2UY6A 3OGOE 3T9WA 2MPAL 3HC3H 3W11C 3Q13A 4MDIA 3MV8B 3O0RH 5AVQB 1MNNA 4JPVL 4TSAL 1BVLB 2QLVB 12E8H 1F41A 5MEOA 1T21B 1A6VL 1OGAE 4AEHH 4ZXBA 3KGSA 5DD3H 3HVDA 3FRUA 4N2GA 3FRUB 1OK8A 3U36A 1D5MB 1CE6A 4I9WE 2OMVA 3WOVA 2OJZH 3ALXA 3DJZA 3P0GB 5MEQA 3MN8A 5A6IA 4XB7A 4IBWA 4U0RC 1IO4C 1G7QB 3DJTA 4UQAA 2VXSL 3DARA 1EJOH 1KTBA 3EJYD 1BVNT 1OOWA 1I9RH 2VGLM 1FZKA 1M53A 1PEWA 3BISA 3MRDA 3O2DH 1CBJA 5I75C 1MWAB 3TO4C 3LKPB 3CZKA 1Z9PA 1UG9A 1EMTH 2YXFA 3DLQR 4H2CA 4LNRB 4UT9L 3SHSA 3UTPE 2RB8A 4JM0A 1YEJL 3K7UA 3R4DA 1A14L 3WXVL 1HZHL 2IH3A 4AIEA 3OKKA 1LNUA 1BQRA 1A14H 9CGTA 4NFDA 3UO1L 5JNYA 1XIWC 4JFZL 3E3QC 4J4PD 3QJFA 4GI9A 4Y4FD 1NAMH 4F7MA 3HI5L 2V17L 1TJIL 3NJHA 5BXFB 1HXYB 3QEQB 3V5KA 1QI3A 1CYXA 4PWJA 4F2ME 4MHHG 1UCTA 4DAGL 3CVHB 3VYNA 2NTSP 4P9HC 5F3FA 3APFA 1E43A 3C5ZA 4KQ4H 3VFGH 3QUHA 1NJ9A 2X41A 1XGPB 1L6XA 2VSMB 4OCXH 1TO5A 1OCWL 1XCXA 3G6JB 5AFAA 1OTTC 1IT9L 2XPZA 3AROA 4WHYG 3BAIA 3UAEA 1ADQA 4F92B 2GTZA 5K9KB 3I84A 4WSJA 4QT5A 2RCSL 1F8TH 5ANMB 3JWNG 2R0WL 3RVVC 4CVWA 5IQ9B 4IQHA 1IGYB 3JV6A 5E6IB 2GHZA 4Z0XB 2IQAA 3P2TA 1J7VR 1Q1JL 1DO6A 1UD3A 2J6EL 2R23A 3EO0A 1A65A 3LN4B 5FB8A 2AJ3A 2OI9B 1RERA 4PJ8C 4GUPA 1OP5K 4MMYB 2GB2A 2J21A 3BVWA 3KPLA 3HMXH 2QLYA 1IGIH 3TWCL 2V33A 3LNIA 4GINA 3TA3D 1MAJA 2KZKA 5AZEH 1AO7B 1BFVH 1XH3B 2ZXGA 4LSUH 3CLEH 1U8QA 3NCFB 1EAOA 3H55A 4U1MA 2PXYB 4FQJL 1C8PA 4LHJB 2JB5H 3VWKA 1IQWL 1G6RA 3MRNA 4IIQC 4OVUA 3MRBB 3SDYH 1CXIA 4QD2E 1BBDL 1QBMH 3TYFA 3EJSA 5JXED 3ZKXB 1JF6A 4G6ML 4R5TA 5BW7C 2ID5A 1HHGA 3O11A 3GXIA 1YEKH 2C5DC 3ARYA 3IJ7A 4WTZG 1XF5B 3QWRA 4Z7UB 3DK2A 4HMEA 4AC2A 3I6KA 3UXFA 4TNFA 4XVSL 3D06A 1BV8A 3ZUNC 3BUDA 4NSKA 3WIFA 2F53A 5K9OB 1Z5LB 2V6HA 3S5LG 2C1PB 1DR9A 3KHQA 5JXEC 2JTYA 2VO5A 3B9EA 1EXHA 1NKGA 1MVYA 1AO7E 4Y1AD 1U8JA 2BVEA 4YLQT 3FXIC 3TN0D 1QATA 4FQLH 4XPGL 4IK6A 1RPQA 4P5MA 4PV9A 1UB5B 2E59A 1RSFA 4QRPA 2XWTB 1EJFA 4KI5C 2JJTA 1HNFA 4WWKC 3BKJH 1GC1C 2LLLA 1X5HA 4NM4H 2CU9A 5EB9A 2CLVA 1UWGH 2X4UB 4WU7A 3BPCB 5GGSA 5GRJL 5JPNB 2ENQA 3WTTA 2E9JA 5F7FA 3K6DA 4D0DA 2FR4B 3OX8A 3NK4A 4RGMB 4H13C 5LQBH 1B4RA 1JOIA 3TESA 4XBGB 2GITB 4TTGA 3DWTA 4V2CB 2BNQB 4F58H 1LLAA 1WZLA 3L4UA 1QWHA 1LEGA 1MCWW 3QI9D 4HH9B 4KI5D 4M7LL 4DO4A 1AQKH 3KWWB 4GLRH 1F8TL 3ARFB 4WW2A 4HD5A 1KSRA 3EADA 1L9NA 1OAUL 3UYPA 3OZ9H 4KAQL 4PS4H 3H9ZA 1RVFH 4HMDA 2Z31B 2GSMB 1OAUH 4FQXA 4ZZKA 3N91A 1GC1L 3GKZA 1VB9A 3MRDB 4ZAKD 2A6KB 1NAMB 4I3RL 3RGVD 5A7EA 4Z3EA 5FO7A 5DZAA 4JO5A 5E94B 1RKRA 1IAOA 5CCHE 3NFSL 3MV01 1I82A 4QLRA 4Z78A 3K6NA 5KSAC 4Z78B 3V0JA 4WHDA 2HFEA 3MJ9A 3GIVB 5FWRA 4UQDA 3FQRB 3RY6A 4LSVH 5E99L 5GRVK 4AENB 3ARGC 3VFRB 2FECI 4K0OA 2HKFH 3QCTH 3R8QA 1BVKB 5IBLC 1EZVY 2W9LA 3HZVB 4FMVA 5D1XE 5F9WB 3AQXA 3LTVA 4R26L 3RWCB 4MDIB 5F6HI 3UX9B 1QFWI 3EJCA 2L7UA 1JRHH 4QHUA 1EHLH 4WKZA 1JNNL 1X5YA 2GJ6A 3GWJA 3MOBL 3FB8A 1U3YA 3C8HA 3FT1A 5ADPH 2VMJA 1S9WB 1DN2A 3QBTB 2JXMA 4MJIB 4EEEA 4EZJA 4XP9H 1U8PA 2F15A 3GMOA 4LHQB 4OGXL 5CSZB 1K85A 1N0XL 1DBJH 3T4YB 2J2ZB 2JB6B 3DETD 4R90L 2BVOA 4DP2X 4HEMA 3TJEL 1MRDH 3ZDXE 4YHPA 2DQCL 4MWFB 2K8MA 3H4HA 2YFNA 5L2JB 3QO1A 5FS5A 5BJTA 5C9JB 4R4BA 3DRTB 3UACA 4Y16D 4NQDD 3ECBA 3VMNA 3MFFA 4LCYB 5F9JB 3ZTNL 2BS9A 3QUMB 1T20B 1EAPB 2CPCA 2YD7A 5D2NA 1QEWB 4N0UA 3KGTA 1WWWX 1KPRB 1SXSA 1JD9A 3SD2A 3SYOA 4WNQB 3ZE2B 5BS0A 2C7FA 3MXWH 1BBJB 3LXBA 4XMPL 3CVCA 3I02B 4ZI8A 2KT6A 1F3DH 4WSKA 1JYVA 1P7KA 4F7EA 2CUMA 3NIDB 3CG8A 2EEAA 3VD5A 3WFEL 3MNDA 2BP8B 5D1ZA 1YJDH 1EHNA 1H3TA 1QO3A 1SYSA 2C8NA 2FUTA 4FYRA 4HIHB 1KULA 4JKPH 1UVQB 3OVUB 3U1QA 3FBQA 3EGDB 1JRHI 3APNA 4U1IB 3LSOA 4DERA 5I2IB 3EYFB 4ZMZA 4AIZA 1WZ1H 1RK7A 4J2XA 1FGNL 1W8EA 4PRPD 2ZOTA 1O7SA 1FP5A 4BZ2L 2ZUWA 1FGNH 1Y0LB 3KNBA 4HBCL 4OGXH 2ALWA 4N8PA 4N9OB 4ANKA 1KXVC 2GC7C 5DHEA 3I9IA 4XCCL 2ADIB 4RFNC 2X9ZA 1OAQH 1NIBA 1T83A 4FERA 4PS3A 2NY5L 1TJIH 3QFDA 2X10A 1BX2B 3QDMD 1ZLUH 3U2SA 4WO0A 3IE4A 3TEYA 4GXVH 1UZ8A 1UM6L 4KO6A 1NC4D 4J3OF 4WJG3 1YMHA 4W9CC 1X5GA 3CZEA 3DOSA 3QWNA 2Q7AA 5DEFB 2P8PA 3QIBC 5TK2A 3RHWF 4OZIA 2HMIC 4TRPL 2ZUXA 3AFLA 2NSMA 5GISL 5GRVL 3RWFB 3W56A 4TVUA 2VDQL 1U95A 5HYIA 2E4TA 1CFVL 4QAWA 2G4GA 2GEQA 1RUKH 2KBGA 2WBKA 2Y7MA 4UM8B 5EUOF 1A4KB 3I6KB 3FT2A 2V8LA 3ZMRA 5H94B 2XTJB 4ABWA 2HMID 1X44A 1KN4H 1NGXA 2BNRD 5CJOL 3TV3H 3WNPA 2NY5C 4PJCF 1FCCA 3I6GA 4AWJC 3DC0A 3HBPA 4OLYH 2VLRD 3UH8A 3O8XD 4OFPA 2DY2A 1MW0A 5FO9B 3PNRB 1C5DA 2Y7LA 5FOBA 4BINA 2J3SA 4J8RB 4W9HC 5L6YL 1HHHA 4QXWA 1MXGA 3IT8D 1CXHA 5I1GL 3WY3A 1SOSA 4PSPA 3TFKC 4DOHB 5IMKA 4ZMXA 4DPRA 1JYXA 5A6MA 5EBMA 4V11A 4LSSH 1HDMA 2N3JA 4XOCA 4XN2A 1I9JH 1U2CA 4HAKA 3F58L 1CBVL 5TH2A 5DTFB 2W9EH 5B39A 4BA8A 5B38G 2VDNH 3MGOB 4KFMA 1FL3B 3D0VA 4NRYA 1PZUB 3BP6A 1JZ2A 4W6XB 4UTAH 1BCIA 3WXVH 5I18H 2R1XB 3GBMH 2HKFL 1OF0A 4K15A 2Z64C 4WJKB 5INDB 1BF2A 2LU3A 2MJWA 3I3BA 2NNAB 4BIKA 1ADQH 4L0PB 2P4AB 3U7WH 2ZCKH 3X1NA 1MCSA 3V2AR 1S3RA 2ZYHA 4H1LG 2Q2EB 4KDWA 2F54D 2YD8A 1MCOH 4HJ0D 1WZMA 1JWSA 4RFEA 4ETYA 1DUZB 7CGTA 3QARA 4UMSA 1TPXC 2ITFA 4LCVA 3WFHB 2BDNH 1TLMA 3V5KB 1KDJA 3S36L 3VXNA 3ALWA 3C5ZD 3ASOB 2VO8A 3SE6A 4IGBB 5KVDH 5L4JA 3HS0B 3A6BH 5FKAA 2YD9A 3VXRB 1G7QA 4Z7IA 3BXNB 2YGPA 2VWEE 5FX3A 2NUPA 5T3ZE 2HFGL 3WMPA 1IJ9A 1NOFA 3FSAA 1S6NA 4TSAH 4M6NH 2Q6WA 2KMWA 1ZHNA 3BVNA 5C0JB 4AQAB 1T2XA 2H6PA 1ZTMA 6PAZA 3WS3A 4Z8FL 5AZ2H 3ZYOA 4IMLB 2WMPA 5D70L 5C8JA 1QNZL 1W91A 1A64A 3OHMB 4K23L 3RY5A 5EDSA 4M9PA 4P2RE 3MRKA 3NA9H 1EAJA 2IG2L 2FYYB 5B4MC 3HB3B 4WQOA 1YYCA 2QZ5A 5DC9B 5IM7B 3AMKA 3LZQA 4TVSa 4YHKL 4O2CA 5I73B 1IVTA 1XXFC 4M4RA 2BWIA 4PGCB 3V0WL 4QRSA 4RVBA 2WD0A 35C8H 2AK1H 3IXAB 4HW6A 5FKPA 4XTRD 3QNXB 4MZRA 4BSVB 1K72A 3SO5A 1ZHLB 4FXGA 3EYFA 4KUZH 4U1JB 3BUQA 4JQIL 3LEVL 2YGNA 2NYYD 3NCYP 3S5LA 2VLJE 3QO0B 1MVUB 3UTQB 5T3ZD 4UT6A 1MDTA 3C60B 4F8TA 5I30H 1WV7T 4R2GC 1VEMA 3C9NB 2VW4A 3IJHA 4GRWF 3OKMA 1EZSA 2Z91B 5DK2A 4Y4HC 4O00A 3SE3A 2X6CA 3ZYZA 3TX4A 3OWEA 4D9QE 1F11A 3N04A 4HKJA 2H6OA 1ADQL 3DX9B 1R17A 2X1PA 3MOBH 4NZFA 2YJQA 4YHLL 4AKPA 2HWZH 4LCWD 5TQ2L 4ILDA 3PAVA 3V6ZA 4ENZA 5E9DB 3V6ZB 3NJXA 1SDYA 1HTYA 3RZCA 4YPGB 3EUDA 3QEHA 4YO0A 4L8CB 1BPVA 1NCCL 1YLBB 3A0OA 2KLRA 4ADJA 4M62L 1G7PB 2YOCA 3RTLA 1IM9B 4HWZA 3UBGA 3WFZA 4Z7NE 3P4NB 4NUJA 3S3CB 2ZZUT 3MV8D 5LBSA 2A3TA 3SPCA 3ZN6A 5EN2A 1SJVA 4DKDC 2DQHH 4FNRA 4MA8H 4YZFF 3MBED 3PWLA 2XVKA 3X1BA 4F1ZA 3D39E 3WS6C 3D52A 2EDHA 3LXAA 4OV5A 4W1TA 3KPNA 2BMKB 3TH4T 4A63A 1IEBB 2F08A 3NJMA 2J5WA 2D2OA 2F54E 5I6OA 5BZWB 4N26A 5C0CB 4HWBA 1TQBC 5HYJB 2F7RA 4MJ4A 4O51B 4ZMPA 3RU8L 2J20A 3Q6GL 5EPMB 2CO4A 2YLKA 2QTEA 1CD8A 4UQCA 4Y5XB 4HUVA 1KIUA 1FLTX 2HTKD 5DUJA 2UY7A 4LT7A 5HHME 2TRHA 4BFJA 4CN4A 1MI5D 4JY6B 4ETQB 4QOKA 4F58L 1GIGL 4X7FC 1EO5A 4F2MB 1TUPA 1YEWA 3P11H 4A7GA 3NEOA 3PHAA 1GGBH 4X7SL 5C07A 3LDBB 4GBXD 3HAEA 2AJYL 3K2MC 4KK9C 5T5NF 4P4KC 4OCRH 3NCEB 4Y9BA 1JGUH 4Y4KB 1T80A 5JUEH 2MPVA 2FX9H 1HQ4B 3PREA 4FI8A 3HZKB 3SE9H 2Y25A 5C2BL 2IADA 3HI6L 1JN6A 3BP7A 4IJ3B 1QA9A 3U4EA 2DTML 4HKZA 3WLWD 5F71A 3T0EE 1WWCA 5LAXB 2X0UA 3DYMA 2KPNA 1EMTL 3O6LH 4O9HH 3N1FC 5TF1H 3RKDD 2MNUA 3SKMA 4U1GB 3MJ9H 3SKMB 3BIKA 3TBWB 3BLPX 1FSKC 2H2SC 4KK8C 4RCAA 4G6AD 1D7CA 2DQDL 4FFYA 1B4JL 4X9BA 4XOBA 1EVUA 4PFEA 1J12A 4P9HH 1DQML 3UAJA 4KK5C 5JHLA 3CPUA 1FYTE 4Y19B 1MCNA 4YBLC 2FQDA 4WFED 1G0XA 3PE9A 4YHMH 3EJPA 3GSNL 3QCVL 4CDHA 5KSBF 4KQ3L 4HLEA 3G5YA 5I66B 4M3JA 1A6VH 4KK8D 3HC0A 4KHTL 3VQ1C 4RX4D 5FFGA 5JYMA 5G2NA 2DDQL 2DMHA 3ELQA 3F3HA 5AVWB 2AKRB 1E30A 4EN3C 3AGVA 3ZQWA 3F7PC 2VJ0A 2WXGA 1F58H 3FAXA 4XNUH 4FFZH 4GKZA 4D3CL 4CADA 2VDKL 2I07A 1ESOA 2Q8BH 4TN9A 3F12A 1OD9A 4G6KL 4V1DA 2K1MA 5DRNA 3U82B 2QPFA 1BD2B 1BD2A 5T8IA 3WU1A 2AAVA 4KDTA 4ZPTB 2PWHA 1BGXL 2Q20A 4A7UA 4B6ZA 1DQJB 4LVNB 1CBVH 1WGVA 1JZ4A 4U6XB 1MHPL 4G11A 3WJLC 4XMLH 1UADC 4L1LA 3QRGH 1UYWH 1VESA 5E6RB 4FHBD 4YSAA 3QYCA 3L48A 1ZA3A 1RUMH 5IBTH 2XTJD 5D1ZC 3CVBA 5FYJL 3PU7A 5EOCL 5D71H 4OY9A 1CCZA 1WBXA 4QTIL 1E6JH 1QTPA 1QTYT 5DJDB 1OSPL 2KERA 4OUOA 5T1DH 4WUUA 5IJBC 5JHDB 2CLZB 2PCFA 3ECUA 4N90E 4JFEA 3K8LA 3O3DB 2YAFA 3P40A 2AXJA 4IRSB 4RAUB 1E3FA 3U7YL 4WEBH 4A2EA 3FMGL 3GMNA 4DAGH 3ZE2E 4HKXA 3WNOA 2ZUSA 4ZMLA 3C6EA 1YA5A 2BSTA 3G04B 1I8LA 1HFUA 4GMSH 4YBHA 1DQTA 4ZO8A 2PYED 4KHXL 5KAQG 1WTLA 3GJEA 3L4VA 3PL6C 1NANH 5I1DA 2HT2D 5JORB 3DXAB 2BY2A 4B3EA 4MFHA 4U6YB 4PJ5E 3QHFL 4JY4A 4UIKH 3WSQL 2DD8L 5LWYH 1BX2A 4PD4J 4LIQH 1YQ2A 3D69A 4AM0A 3U1SH 2WCPA 1D9KD 3LIZA 1T22B 2PXYC 4JMNA 1IBYA 1X5JA 3GUFA 3GKWL 1RIHL 3K72A 1XSJA 5DHDA 1M7DA 5IQNA 3CZLA 5CMAB 3V4UH 3LNHA 4PR5A 3B9KC 3D1MC 3QAQA 2DW5A 1MIEL 5DD6A 2GJRA 3X12A 4OI7A 2WSPA 4OM1L 5AD0A 3KD4A 2WZ0A 2WAQA 2WANA 1NFDE 3MLSL 1UEMA 3PPSA 1PG7L 2BVPB 4IRSA 4LSQL 4RAUA 2ZNXA 1GC1H 2IDCA 2Q3AA 1E8ZA 4U1JA 3IU3B 4B9YA 1UKQA 2QFPA 4XO8A 2XPGB 2XXGA 1VAHA 1QNZH 4UTCA 3DBXB 3JTSB 4KY1H 5E8OA 4AEHL 3MBXH 1FZMA 2VDKH 1VGKA 3DVIA 5FLVA 1BECA 5EEWA 2MCAA 4U3XA 4LPUA 5FDWA 2B39A 2Q1EA 1W0WB 5JIPA 5JW4N 2MEJB 4GXFA 1A6ZB 4P2CG 3S96B 3US0A 2BP3A 1F90L 3SGDI 2IADB 3VFWB 5FW6A 4HIEA 5FO7B 1NAKH 3D0LA 1AS6A 2FATL 2G3MA 3DRQB 3ZX1A 5DGQA 1CC3A 4HXAH 4HLJA 3C6LC 3TIEB 4ZO9A 4JFDB 5D72L 1J9SA 4KTDL 5HBBA 4JPSA 4KX9A 4I48A 4E68A 3LEXA 4HCRA 4FQLL 1OARL 1YQVH 2DI7A 4G7RB 4JZJC 2NUTA 2BHUA 3F7YB 4L3EE 4LLVA 3BP5B 4UV4H 5ESAB 4N3TA 3SBWA 2XV2A 1LK3L 3BZ4A 5H37A 1EJ6A 2QSQA 2PKDA 1NCNA 1G9NH 2XG5A 2YGVA 4O9HL 5TF1L 4CNIA 5IJKA 1VDGA 1R3KA 3CSGA 4Q9RL 1R3KB 5HYJA 1NGZA 3D48R 2B5IB 4YDJB 4L23A 3U6RB 3WSQH 1MFCH 4LHUB 1RJCA 2ZWLT 5IJCC 3LPGA 5K9QI 5EIIB 2FX8H 3MJ8A 3Q01A 4JFOB 4PEEA 3QQ3A 3UEZA 3UBXG 1ZVYA 1DDHA 5KBNC 4H40A 5C07D 1PF3A 2C1OB 2VXVH 5FUOH 4WI5A 3HG0A 4MKMA 3VFNA 3G6AB 3QHZH 3MRIA 3W3BA 3W9DA 5ITBH 1HYSD 1G7MA 1A1NB 2VDNB 4N8VA 1Q0XL 5AW7B 5C6WH 4WV1B 4MA1C 5LGHL 4ZXBC 4XAKD 3QDGA 3D25B 4Z7OB 2NYZA 4JS7A 4Z6AT 1KGUA 4XP1L 5IHBA 1AXTL 5C08A 3HRZA 3MLRH 5DI8B 5IB3B 3Q6GH 3P2DA 1PX8A 1HYSC 1BQUA 1OP3K 3MRJB 5DA0B 1SPDA 3CVIH 3OWRA 5D7IA 2EIMB 2ENSA 2VUKA 3WKML 1O0VA 4Z7WE 4EKJA 4RMRA 3QC6X 2L7JA 1X4ZA 3I9GH 4AYMC 1HH9A 1BZ9A 3SYCA 4J23A 3QA3A 3IN0A 4MAYB 3WIHL 3CFUA 4ABQA 3H7BB 7FABL 3AZUA 5ACZB 3CU7A 1G9MH 4IKNA 4OGAC 2Y6TE 5F3BA 4WTWA 3F83A 1S8DB 3O6FA 2F8IA 4GRMA 5C7XL 2WTPA 2Q86A 3LIZH 1UUNA 4NHCH 4JDTL 4JPKL 3HBQA 1A1OA 3O0LA 4YHLH 3UTQA 3ZHDA 2I69A 1DYZA 1E7UA 4B96A 1T5WA 4IBZA 1MHEA 3L3GA 4M7KL 4QKTA 4U1NB 1PJ9A 3RI5K 4NI6A 1M7XA 4FDWA 3KZ8A 4OGAD 3FTWA 5BZXA 4OZIB 4PWIA 3A4EA 1R5WB 1ZEAL 1YMMA 3VXPA 2IV8A 5A40E 5IB4B 3PQYE 3O81A 4N2CA 4X5QA 3RZCB 5E6ZA 4EDWL 4N68A 4LGRB 2BRRL 3IETB 3O3EA 4IRZA 4RWYH 1KZQA 2Y5EA 1AY1L 2AC0A 2D3VA 2IBZX 3GZKA 2OCJA 3F04A 3IFPA 3FQWA 1NGXB 4XMVA 3CBJB 1MCKA 4K7PX 5E0FA 3MUUA 3JTSA 4PJ5D 4BQ8A 4G71B 1E4KA 3FCSA 3QIUB 3H9SE 2H41A 2O1AA 3IU3A 3QO0A 4EDXA 4J8RA 1GYVA 1NCOA 4X8JB 4EI5D 4CVXA 2E7LA 3Q8CA 5B21A 5IVOA 5AL0A 2BNQD 4RQQB 1G6RL 4AUUA 3FHQA 1JP5A 1YN7B 3L1OH 2AW2A 3QSKB 4UWQB 1MRCL 4U31A 1EEQA 1F4WL 1E7VA 4KMLB 4B60A 5IMLA 3QXTA 1ZLSH 2I60L 4LVOC 2WVTA 4B3VA 4NZUH 3GIVA 2ZUTA 5I8CB 3KG5A 4DP4X 3B1UA 1KCUL 2YXVA 3L7EB 3N50A 1KYOJ 2VC2H 3K2IA 1CGVA 2PPEA 3PV6A 3T6ZA 2GIYA 3BVXA 3ME0B 1Z9SB 5MEOB 1PG7X 4PR5B 1HEJC 1NLDL 2HG5A 1OM3L 2SEBA 2ZIDA 1P1VA 3BP6B 4XP5L 3UBXB 2ZCKL 4ERSH 1C12A 3HLAB 4FHKA 3SDXB 4C8XA 5IQ7L 5FA3B 4HIIA 4DIXA 4PJAF 2Q5BA 3KWWA 3TC9A 4DQAA 2DBLH 5DJ2B 3GBML 3A21A 3P77B 4JFYA 4NPJA 4Z23A 4OQTL 4MMZB 2ADJA 3T6WA 1G7JA 4B95C 5KYWA 4F20A 4MNGA 2E9IA 2NY3C 1U58B 3VGFA 5BUGA 2RQ8A 4X6EA 3ARZA 5HHOD 5F7KC 1QTSA 4O5LL 5GS0C 3ESUF 5C0RL 1NBZA 5FYKE 2EDDA 3WMSA 3DX4A 3UPAA 3LB6D 5I1EL 1U3ZA 1I9IH 3AUVA 2ZKHL 3ESOA 4UNTA 2A6KA 3FTXA 3B37A 4FA7B 1GAFL 2XC8A 5E4OA 3B6SB 4NS0A 3GHEL 1MUJB 2EIEA 3DOHA 3VFRA 5FYLE 3V6FB 3WEMA 2NY4B 3KR3H 2HFEB 4L3FA 3TGXA 3UMTA 2DIBA 3H3PH 5GS0D 3QG7H 5D2LB 3I9GL 1BLNA 3C2AL 3WKYA 1JK9A 1CZ8L 1MHPH 2H32B 4W9JC 1YUKB 3VFOA 2IFFH 3CVIL 5JHMA 3ORJA 3ULUD 1D9KA 5ICYA 4LCWE 2ARJA 1KJ3H 1X9RA 4MXQC 5EF2A 2IDSA 8PAZA 1HJBC 3H6JA 1XZ0A 4M61B 4HUWB 1XGRB 3KLKA 3FSWA 1NCBL 2MQ3A 1RIVL 2VYRE 2YKKA 2NW3B 3CN3A 3NSCA 4FFYL 4ALAC 2XBTA 1T5WB 5AW2B 2GCYA 4F93B 1KLFB 1WCBA 1ILUA 5E5MA 2ISDA 3ZJAA 1J1OL 1I1CA 2D03H 2J2ZA 2JB6A 2CHNA 3J7HA 4PGDA 4XPGH 5CLXA 3GJFB 3MBEB 3ZXAC 4JFFB 1RJLB 3JV4B 2BY0A 3L3IA 2WZ5A 1PZCA 3STZA 3LNGA 1F18A 3WHXA 4PVMA 2A9AA 4PJHF 1TJHL 3S34L 1WAAE 1FNSL 3D9AH 4QXGL 5I30L 4J6RL 2ICEA 2ZOUA 1I1AD 3NBNA 3G6DH 1NDTA 1E4KC 2NW2A 1JPFA 5KZCD 3BH8A 3K0YA 3UADA 1ZGLP 1SJHA 4QRTA 3GIZH 1L0QA 4U1LB 1Y18B 2DF3A 5F1OB 2VDRH 5FYKH 3SOBL 1JL8A 4XNDA 5GGQH 4GRLB 4NP4H 5AVVB 1IC7H 3Q9PA 4B9KC 4NKMA 1BD2D 2V2XB 4OB5L 4YHOL 2CALA 2W0FA 5HYQB 1FH5H 5C08E 2Z65C 4N9GA 3VXSE 3GJFK 3AREA 3PL6B 3FRPA 1J48A 3GJFA 4CMHC 1IGIL 3V0VB 2XRAH 5G5DA 3WKQA 4HS3A 5GZOD 4LRNH 2FRGP 2HUEA 2OMUA 3LZFH 3H56A 4L29B 2JV6A 1OY3B 5CEYA 4ONFL 4GAFB 4KK9D 5KSAA 4JRXB 4E9VA 1MOEA 3ZUCA 4M1GL 2J8HA 5AKTA 1GIGH 2XWTA 3DBSA 4NQDA 4OFIA 2AXHA 2K6YA 2J44A 4YBQD 5C6PB 3GTNA 5AW3B 3ROLA 3RWFA 2WJ7A 5IW1B 5B3NA 1MEXL 3VD4A 5D2LF 4JGUA 1ZGLB 5I8KL 1BXUA 3MCKA 1HL5A 2DM3A 1UWXK 2K3TA 1I8UA 2XWBA 2K3HA 4LAJH 1NMAH 3DX7A 4O02A 2JLPA 1N6VA 2VSKB 3LS5L 4JZJA 4AGMA 5IF0A 1YUHA 4LVNC 5GS1A 1UB6A 3VGAB 4YQXL 3OF6A 5J0BA 1U36A 2ZPKH 1XF1A 1RSYA 3GS0A 1SN0A 1MY7A 4D8OA 1EVTC 4AQEA 5EZIL 2QZQA 1TJXA 1NAML 1VFBB 5E4IA 3KS0H 4Y9FA 4DH2A 4Y19D 3DUHA 2JJSC 3ESMA 4R3SA 4RQQA 2OXGB 2EDMA 2CO7B 2ZYSA 4M62H 3VGEA 1YY8B 4FNUA 3QFJE 1YJDC 4TLUA 3E9TA 3GXFA 4GUCA 5FOBB 4APQA 3OHXB 3G5VA 4TSCH 3UP1A 1XB6A 4MNGB 2Z4TA 5TQ2H 3RVUC 3RGHA 4UTAA 4WK0B 1WA0X 2ENYA 5DMGC 3T0XA 1R9FA 1TTGA 2X9YA 4IOIA 4YBLB 2OQJB 1AANA 2NY6B 3KWTA 3REWA 1IC5L 2FIKA 3APMA 3RGVA 7PAZA 1M2VB 1KIQA 2DQMA 4TMPA 3MLXH 4IM8A 1P6WA 5C3IA 1NC2B 1A6AB 1HEZB 4UTBA 3ZW3A 1FLRL 3MPCA 5H4YA 5A2BA 2X05A 1DUYB 2I25N 3QNYB 3IJEB 4N4YB 5EBMB 1RVFL 3Q6FA 3WIHH 1D5XB 2BWQA 3MRLB 4WUUE 4XN1A 2CDGB 4POUB 3OKDA 2P8LA 35C8L 3KBHE 3F7LA 1SMDA 1RUML 1S78D 3TVMD 4ZMOA 2BS71 3PHOB 4XAWH 3HI1B 1ZLVK 2X4RA 5JQ6L 2EUXA 2ZAIA 5I0VA 2FGZA 2BP0B 3KS0J 4X8XA 2BNRE 4Y4HD 3IDMA 1CD9B 2DYPA 3OLEA 4L3AA 2Y3NA 3MA9L 2Q7NA 1BFSA 5I1KL 1OZTG 5AOKA 3SKUD 1AZRA 4PJ7B 5C0AD 2UXTA 1RK0B 3D85D 1S78C 3G6JA 4JEGB 2DQGL 3QISA 4K3DH 1TMCB 1ZHNB 3L2MA 2IXQA 2UXVA 3QAZC 2HKHH 2JF1A 4AL8L 5I15L 4KTYA 3SKNA 1NC2A 4XOAA 3V4LA 2NUPB 3GBDA 2HT2C 2NY2D 1BM3H 4Y5XC 1FO0A 4AW4A 4G70B 4HFUL 5T3XD 1QW8A 2Y7OA 4NNYA 4XP5H 2YD1A 1H6TA 1OM3H 1KCRH 2QVTA 5DO2C 1PGRB 1OT4A 3SDAA 3WDHA 5KVEH 3TJEH 4FA8A 4FFWD 3BH4A 3G6DL 5CGBA 5C08B 1DTUA 3I02A 2X4PB 3PJSA 3BD5A 3MV9B 4IOSD 4P05A 4YK4C 1FNSH 3D9AL 3B9KD 4QXGH 3WY2A 3FF8A 3NMEA 5DJ6A 1C9SA 4RBPH 3KPOA 2GBAA 4BE5A 1T6VN 1YPZB 5C8JB 3M07A 1RI8A 4JFPA 2MCMA 2FGWH 5IB1A 4AYGA 1SBSL 4UILH 1ECYA 2VDPH 5DO2D 1AIZA 3LS4H 2PWFA 3KPPB 1S4IA 1F42A 3GSRB 1MFUA 3LQAH 1SLWA 4Y2DC 2K9FB 5AKVA 5AZEL 3D3VB 1AR1D 4HH9A 2VKWA 3O6FB 1T5XB 3U79A 4Z8FH 3RPIA 4BWWA 4KGJA 1ET7A 4Y5VA 1OAXL 1RZJH 5E8NA 5AYQA 1M3IA 3T0WA 1E4JA 2YOAA 4NFCA 3C2AH 3M7FB 3WLBB 4TUKL 1C8QA 3MV7A 2KI6A 3CX5K 4UDTB 3ZKSD 4HJJH 3QB7C 3OKEA 4U3HA 5L88L 2OMTB 4AG4L 2YBGA 5I71B 3IPBA 4PLJC 4U1LA 5IOKA 1Y1UA 4ZDHB 1OTUC 3VTAA 3F5WB 2XLLA 1F6LL 3R06A 3BH8B 4NBYB 4PHZA 1YMHB 4QTHA 4FQIL 1FPTH 2X28A 2RAMA 1LDSA 1AIFB 1N4XH 3O3AB 5J8OA 3HG2A 2XUWA 3PWVB 4S0HA 4ORGA 4PRAA 3PWVA 3CZUB 4ZT1A 4MNQB 1P4LB 4B0MB 1A6PA 3EYVA 4NO3B 3RRQA 2WQUA 3RY6C 4KO5A 4TSCL 5IFJA 4YXLL 4YAQB 3UZVB 3UO1H 2X3BA 1SFHA 1SQMA 4LLQA 1ZWIA 1S9WA 4YHYC 4XPBL 4X6CA 5E0QA 5F2FA 5ISZE 3QFJA 1FFRA 1KIQB 2B0SH 2WO4A 4G1EB 1I53A 1DBML 2BRQA 4LSRH 1HILB 1G4MA 3QR0A 1JZHA 4ADGA 1LEIB 2WKOF 3D07A 4JB9L 2AABL 1ZA6B 2BINA 2WWMD 1NL0L 4MX7A 4PJ8D 5EORH 5JZ7D 2C9UA 1MWAH 2YBRA 4IJTA 4XXWA 1AZZC 4GO6B 4MAUH 2JELH 3E38A 4MQ7B 2C4FT 2CO1A 4F91B 3JVGC 2FK9A 1K6QL 3ULSB 1LO4L 4IIQA 5C0IA 4FQCH 1DJIA 4KAQH 2EIZB 1EXUB 4G6KH 4GYBA 2ALAA 4HJJL 5E00B 4GKOA 2LFEA 4URTB 5HHXH 1QLEL 5FGCB 2WBJB 4UU9A 4HISA 4M1GH 3N40P 2QKIA 1T4WA 2QVMA 1P9MC 3EHBB 4FFVD 1U3NA 1RURH 4NIKB 1GPOL 3PL6D 3EYQC 5IFAL 2R1YB 4U49A 2FEDD 3BD3A 4E9TA 1K3ZA 3QK0A 1YYML 1JDAA 4A1RA 2V3FA 3SE3C 2ESVD 1D5BA 4XH2B 4MX7B 4MSWA 3RWIA 2JLLA 2OTWA 5T1KB 2EDBA 1H5BC 3OB0K 4GXVL 5CJQH 5CILL 4QNPF 1MCLA 4N0FA 4AV4A 4EZMA 3H6AA 1JWUB 2G5BA 3CFEA 4GKSA 3T77A 2B4CH 5IT2H 1V3JA 4QOKE 1YQVL 5C0GA 1UXSA 4BZ2H 4M7JL 5HPOA 3OKLB 4R90H 1DBBL 4X5PA 3UAJC 1UASA 3MRPA 4LLYB 4M6OH 3SPGA 5IB1B 3KPLB 1KTLA 1QHOA 2KQNA 3BW9A 1ZVSA 5B3JE 4U1KB 3SPVA 3T1FB 1N64H 2NR6C 2IGFL 3QUZA 4M7KH 2FJGA 1NIDA 4ODHL 4GI8A 3B56A 1SQ2N 1HK6A 3QULB 3O4LD 1AH1A 2VUYA 5B1CA 5D1QB 2BOBA 2P9RA 2QQKL 3RFRA 1YSOA 2C9PA 1KY6A 1XV8A 5D7LE 5I71C 3MTRA 1D9KB 3UCRA 3BRGC 3CBRA 4JFFE 4NLAA 3VD7A 4DVBA 2IMNA 2G30A 3RPKA 1G6RH 3ECBB 5DFVC 5EC2B 2BSTB 3QPQC 1U3HB 4D7BA 5EU4B 1SY6A 1YEHH 3EO9H 2ZCHH 4HLZG 3H3KA 3RVWC 1JZ7A 4X6BA 3AXLB 2BWDA 2UX6A 4OZHA 5L8LB 4F5CE 5E9DA 3FCSB 2N01B 3L5WA 5JQ6H 5IVXE 3AABA 3C2SA 3DX9A 4FN0A 2YPLD 2H9GA 1SRDA 2JKLA 1MCJA 3V4VA 2LHAA 3X1GA 1QFWL 1L0XA 3NEEA 3PDOB 5DFVD 1CO1A 3IJHB 4M1CD 5KVFH 2H0PA 1AG0A 3MOQA 4WI0B 1TZGL 4X83A 5I0XA 3ET9F 5LLIC 2HLAB 2VJXA 1U4EA 4XRCB 1LD9A 2VLJA 1ZANH 1A9BA 1T2QH 2Z0BA 4PI2A 4YIQA 4KZDL 3NH7H 4NENA 3DO4A 1E4XL 3W2DL 2GT9B 5FCUL 1AGEA 3ULUF 4MBOA 1SEQL 4E42B 4MNQA 4KHXH 1IM3D 1KMGA 1OAYH 4YUEL 3PGCB 1JNNH 4P57B 2VM4A 2F53B 5K9OA 2HRHA 3GMPB 2UY7B 3EH3B 4JFZH 3LIZL 2AV1B 3BT0A 3V9EA 4O4YL 1B6DA 3BGAA 2MIZA 3OXSA 4O2FB 3OAZK 2YC1A 2AAAA