1OF0A

Crystal structure of bacillus subtilis cota after 1h soaking with abts
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords SPORE COAT PROTEIN A
publication title Structural Characterization of a Bacterial Laccase Reaction Cycle
rcsb
source organism Bacillus subtilis
total genus 142
structure length 502
sequence length 509
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1of0A03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1of0A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1of0A02
1GY1A 1V55B 2PPCA 1RCYA 4DP7X 4KO6A 3IBOA 1WS7A 2FQGA 7PAZA 1BXUA 1RKRA 2YAHA 4KNSA 1JXFA 4ENZA 3ASNB 1PZAA 3CVCA 3V9EA 2BZCA 1PAZA 4AZUA 3ABGA 2XX1A 3PCYA 1DZ0A 2TSAA 3IN2A 3H56A 4X4KA 2PPEA 4HCGA 3AZUA 1GS7A 2XV3A 3DIVA 2PCFA 3HB3B 4YSUA 2ZONA 2VW6A 1OE1A 4A68A 2YAFA 2PPFA 3ZBMA 2JXMA 3QJQB 1IBZA 2B3IA 1AG6A 2VW4A 2N0MA 2Q9OA 4KNTA 4YSRA 9PCYA 3MX0B 1W6WA 1IBYA 3IE9A 5IY5B 4FAAB 5AKRA 1PCSA 2B08A 2XYBA 2GSMB 2BP0B 2TSBA 3PAZA 2UXVA 2IDSA 2XLLA 2AANA 2XVBA 2IWFA 2EILB 7PCYA 1AZBA 1J5CA 5F7AA 4KO7A 2EIJB 1M57B 2QDVA 1PLAA 4UANA 1E5ZA 5I6NA 4E9RA 2BHFA 2DWTA 3UAEA 1CURA 1BQKA 3GYRA 4HZ1A 3UGEA 3UACA 2UXTA 5D4IA 3WKQA 1JZIA 3S3BB 4GP4B 1MZYA 1A4CA 3WIAA 1TEFA 1JERA 1WAEA 2FQEA 2GHZA 4EF3A 3WNJA 1BAWA 4F2FA 5I6LA 2P80A 2MRYA 3ASOB 1MG3C 4YVUA 3T71A 4K9JA 2IDTA 1W8EA 2Q5BA 4KO9A 2J57A 1EZLA 1BXVA 2UXGA 3V9CA 1L9OA 5FC9A 5I6KA 2FT7A 1BEXA 2PCYA 1N68A 1TU2A 3NSFA 3OMNB 3TU6A 2I85A 1IC0A 2BW4A 4L0PB 2EIMB 1AIZA 1T5KA 3ZX1A 4G7QB 1AANA 1E65A 4WKXA 4AI7A 2H3XC 3X1GA 4N8UA 1NIBA 3SBQA 4YSAA 1SFDA 2W88A 4G71B 3OD3A 4UAHA 4FA7B 3WG7B 4AKPA 2IDFA 2PLTA 1ZIAA 2UX6A 2HX7A 1ET8A 5I6MA 1WS8A 1A65A 4Q89A 2IAAC 1FFTB 1ET7A 1AOZA 3AY2A 2HZHA 2YAMA 2YAPA 2PPAA 3AG3B 2QPEB 1BXAA 3NJLA 1ASOA 1OF0A 1ZV2A 3NYKA 3CG8A 1JVLA 2GC7C 3FQYA 2IWEA 4E9SA 4BDVB 3NJNA 4ZK8A 1VLXA 1PY0A 1GYCA 3PXLA 1DYZA 1CYWA 2BP0A 1PLCA 1MG2C 4AKOA 3CZUB 3FU7B 1BYPA 1KCWA 1J9QA 1SDDB 1OOWA 1GW0A 2GI0A 3T6VA 1L9TA 3NP3A 3MBWB 4AX3A 3T9WA 1AS8A 2GBAA 2IH8A 2YQBA 2MTAA 2YAOA 2QT6A 5PCYA 1IUZA 1ZIBA 3L45A 1JZFA 2HX9A 4P5SA 4A2EA 1NWPA 1J9RA 1WA2X 1A3ZA 2VSMB 2XXGA 2A3TA 4JHVA 1GR7A 3JT2A 3QJRB 1KDIA 2VSKB 5B1AB 3NSCA 4E9TA 4YSDA 2P80D 2CAKA 2XU9A 2YAQA 1V54B 4M4RB 1HFUA 1KDJA 2J55A 1IKOP 2BWDA 4DPBX 1KCBA 2FT6A 3S3CB 3X2QB 4Q8BA 3SQRA 1OV8A 4E9YA 1AS6A 5LDUA 3KW7A 1UATA 4GP8B 4DP0X 8PAZA 3QJSB 1X9RA 1KGYE 3CDZB 5B7EA 2PP8A 2PP9A 3NJIA 2WSDA 2HLEB 2DV6A 1ASQA 4QKTA 1L9RA 4HAKA 1KBVA 1KBWA 2WO3B 4HCIA 2X87A 1F56A 1NIDA 2DYRB 1M56B 2CJ3A 3FT0A 3FU9A 1JXGA 3IEAA 2EINB 1WA1X 4YSOA 5I26A 1JZJA 3N55A 4YSTA 5B1BB 1ILUA 2XWZA 3NSYA 1NDTA 3BVDB 4A2HA 1XB3A 2CALA 3ABLB 5I5MA 4TXVB 3CVBA 2PPDA 1JZGA 5AFAA 2IH9A 2VM4A 4BWTA 2E86A 1J9SA 2R7EB 5EHFA 2GC4C 4NB7A 3NP4A 3ZIYA 1EHKB 1AAJA 2Y69B 4DPCX 4GXFA 3HEIB 4HIPA 1GS8A 4KOBA 3NJKA 3RYMA 3JTBA 3NJFA 1ET5A 4GYBA 3TA4D 3UAAA 3G5WA 4E9QA 1NZRA 3PLYA 1W6LA 4E9XA 3AG2B 1J9TA 3EH4B 5I6PA 2J56A 2OJ1A 6PCYA 3FSZA 3FPYA 3FU7A 6PAZA 2QDWA 4YSQA 1SDDA 2HRGA 1E5YA 1RZQA 3D12B 3EHBB 4KOCA 3WI9A 2AZAA 3GDCA 1BQ5A 3OMIB 4WTQA 4DPAX 1URIA 1L9SA 3FSAA 3QJUB 4DP8X 4G70B 3QJVB 4HALA 3DKHA 3AW5A 3X1BA 4P5RA 3EH3B 2VM3A 1NINA 2CUAA 2XV2A 4BXVA 2BW5A 2UX7A 2BZ7A 5B7MA 4A66A 3NT0A 4M3HA 1SHXA 1HAUA 1SNRA 4YSSA 5B1JA 3QPKA 1FWXA 1AG0A 1AR1B 3OM3B 3FSWA 3X1EA 4HHGA 1OCRB 2UXFA 3FS9A 3N2JA 4GP5B 1BQRA 4F2EA 5I5JA 2XX0A 3SBRA 4JKNA 3CDZA 1NIFA 2DY2A 4YSEA 1MDAA 5ANHA 4W1TA 1YLBB 3AG1B 3KW8A 4DP5X 1KV7A 4CSPA 1R1CA 1OE2A 2ZWNA 1AZRA 2H5UA 1E30A 3ERXA 3U25A 3FYEB 2YXVA 3ZDWA 5I5IA 3FU8A 1SJMA 3AG4B 4G7SB 4DP2X 1FA4A 3SBPA 3NJGA 3PAUA 3X1NA 1PLBA 4BK5C 2OV0A 3H4HA 1RZPA 3IN0A 2J5WA 4DP1X 1AQ8A 2WO2B 1NICA 2R7EA 1AS7A 2X88A 3DTUB 1SFHA 1ETJA 1JVOA 2CBPA 5D4HA 1QNIA 4KNUA 5B1JC 1GS6X 3TBCA 3BQVA 3NJJA 3T6ZA 2FQFA 3CVDA 2IWKA 2BP8B 3UABA 1NWOA 2EIKB 2DYSB 4CSZA 3X1FA 3PPSA 2NRDA 5AZUA 5E9NA 4A2FA 1A4BA 4BWUA 4BXSV 4KO5A 1ZDSA 2YXWA 1XB6A 1GSKA 1QLEB 1WA0X 2VW7A 1PNDA 2XXFA 3TASA 4HCFA 1J5DA 1V10A 2GB2A 4YVNA 3OMAB 2RACA 3S3DB 1M9WA 4E9VA 1GY2A 2CCWA 1TEGA 3WKPA 2I7SA 1SF5A 1ZDQA 4A2DA 4NAJA 4MFHA 1B3IA 4DP4X 1PMYA 3NSDA 1PF3A 1BYOA 2FNWA 1L9QA 2AFNA 3EH5B 1XMEB 1XB8A 2GIMA 1AACA 1L9PA 1A4AA 4BDVA 4HHWA 4UF7C 3C75A 2QPDB 2JFCA 2XV0A 4G7RB 1KYAA 2HXAA 3UADA 2IDUA 1ADWA 4JHUA 1HAWA 2OCCB 3H4FA 4PAZA 1SHWA 2Y1AA 4BWWA 1NIAA 1JOIA 1JZEA 2FTAA 4DP9X 1PZCA 5F7BA 2VMJA 1AZNA 3OQRA 4F7KA 5TK4A 2AVFA 2HRHA 1AZCA 4YSPA 1N70A 4PCYA 5A7EA 1OE3A 3EF4A 1ASPA 2DWSA 1SF3A 1ID2A 3FPXA 4W9ZA 5TK2A 2BO0A 2I7OA 3FQ2A 1PNCA 1JXDA 3T6XA 2BP8A 2BWIA 2LLNA 3GXUB 4DP6X 1ZPUA 3QQXA 1ILSA 3TBBA 4G72B 1A8ZA 5PAZA 3S8GB 4E9WA 1I53A 2AZUA 2H47C 3ABKB 1JZHA 3ABMB 2XUWA 2HX8A 4A2GA 1OCOB 3FQ1A 1NTDA 1OCCB 3FYIB 2JKWA 1TKWA 1CC3A 2PP7A 3PAVA 2ZOOA 5I6OA 5B3SB 2IDQA 2FJSA 5B7FA 3NJMA 4N4YB 4AKQA 1MZZA 3S8FB 1E67A 5D4JA 1AZUA 4RH4A 1NIEA 4A67A 1X9UA 1OCZB 3NJHA 2FWLB 4GY4A 2YARA 2ZXWB 4QLWA 3QJTB 5I28A 4YL4A 1CUOA 2FQDA 5B1KA 1PZBA 2FT8A 4YSCA 3T6WA 1QHQA 4NERA 2YAEA 3FSVA 1NPJA 2VN3A 2W8CA 1NPNA 1CYXA 3WNIA
chains in the Genus database with same CATH superfamily
1V55B 1SY6L 4M7ZC 5CLXA 3WNNA 3UZQB 3F7VB 3QISA 4Y5YC 1VFMA 1NBZB 4G6JH 1A7OH 3ZKND 5LUMA 1MRCL 4TNVF 1NSNL 4N2HA 4QXGL 1EJFA 3V9EA 4O2FB 2CXGA 2BZCA 3CIAA 3MRQA 4AZUA 2NNAA 4MJ6B 2X1QA 4NIKB 1DVTA 4NRYB 4EXPX 1B9KA 1XR8A 4U0RB 2WBJD 4OCNC 3VACA 2ZOTA 1S4IA 4JG1H 3M8OL 4YSUA 1FAIL 4R96A 5SWSA 4CMMB 1D9KD 1BZ9A 5DHVH 4A7QA 4AW7A 3RURA 4MD4B 4DESA 1FLRH 1A7RL 4IMLB 4E41A 5IB5A 1ACYH 1F4XH 2HA1A 3DK0A 4M93C 3RL2A 3TURA 4F7PA 1FDLH 4YFLF 5E6IC 3GBEA 3K6SB 1IBYA 3OJ2C 1UM5L 1RLWA 3LHAA 1KPRB 4G8FA 3VFMB 2DICA 5ACZB 1ZK9A 2OA9A 2AAAA 1U95B 1ZMYA 1QBLH 4YDMA 4LGRB 1VESA 3MVSA 1FVCB 2GBVA 4QT5B 1V7ML 2A83B 3ZYJA 15C8H 1XGTA 1FV1A 3WSQH 4QTHB 4YQXH 1IZKA 2B1HL 4KO7A 5HGDB 4JRWA 1Q1PA 4UANA 1TQSA 1CE1H 3TNNB 1XR9B 4MMZA 4FKKA 4DWHA 3UAEA 1TVHB 3UGEA 4IRZA 4FNRA 3HAEA 3TVMC 3WIHA 4M1DH 2EEBA 1UG9A 1KELL 3EGDB 2E47A 2J73A 4YHYC 3DUSA 4N25A 5EEWA 2H6PB 2E8ZA 1WRFA 2W91A 3WNJA 1SHMA 5EUOE 4W68A 3STLA 4J3OH 4XVUD 4LVHC 5AQ0A 1Q0XL 3FJTA 5SX5K 1X5JA 2YPVL 3FOMB 5EBLB 5CGYD 2IANE 3U4BL 1NL0L 1JWSB 4Z7WB 1I1AA 3TA3B 4DGYL 1TTBA 5ES4B 4NHCL 5IFHH 3STZA 1N68A 2G2RA 4NZ8A 3SPCA 2WY3B 4ZXBD 1XH2A 4PREA 4Z7VA 4JY4A 5DJZB 4C4KO 3I3EA 4LSDA 4UOJA 2BRRL 4Q9BA 1T5KA 3T4YB 3PWLB 4R83A 2HJFB 2JCCF 5HHPB 5IFJB 1OCWL 4WEBL 2OMYB 3ZTJH 4G71B 5E51A 4FA7B 1HKFA 2NZ9D 5G4OA 5KS9F 5BS0E 1TJIL 3CLFH 4PBWD 4ZMYA 2Z35A 5GSRB 3VFWB 3ES6B 4QNPF 4P9ML 1GGCL 3EOTL 3P4MB 4PJEF 1OXYA 1SOSA 2YD6A 3IRPX 2AERT 5DZVA 4D0CB 3FULA 2O30A 4HGWB 1OP3K 4ZUTB 2AXGA 2ZSVB 4L1DA 3VFVA 3FTGB 3SDXF 1QFWM 2E9IA 1ZLUH 3V4PA 4WDIA 5D1ZD 1YEGL 1A2YB 1IGFL 2X28A 3I6LD 3NJLA 1T7XA 4ZFQA 5JORB 3QZMA 2NY5L 4UCFA 1NCNA 4KXZI 4PEEA 3ZT6A 2DQGH 2GC7C 4B5EA 3FQYA 2ZZUT 2EO9A 2P8PA 4K07A 4OJYA 4KZEL 2Q3XA 1W15A 4LBEB 3UEZA 4L9LC 5JHLH 5LCVH 4HJTA 3SGJA 4FFVD 1PLCA 3CSGA 1O0VA 2H2SD 1KBGH 4XXCC 4Z18A 3RDTB 3AUWB 2FGZA 1U93A 3QE5A 2AKRA 4JJ5A 4N26A 5HXMA 5E4AA 5I16A 1JHLL 1FBIH 4OGYH 3FB6B 2OYPA 5GZOC 1DFBL 2ARJB 5PCYA 4XVTL 4BCXA 2YQ2A 4PWEA 4GMTH 5D72L 1QR1B 2HX9A 5FOJA 1I7UB 2WGXA 3HLAB 1JL8A 2BSEA 2Y06H 3ATFA 1AGCB 3MUGA 4MRCA 4HISA 4I18A 5AYUH 4DGVH 4OZIA 3NSCA 5C09D 5IBLD 4XPHH 3SE8H 2Q3AA 2XU9A 1XBRA 5J1AA 4PJHA 4PHZA 4J2QA 4PY8I 3EFFA 4IHBA 3U48A 2BINA 4UM9D 4ODXA 2QSCH 3O41B 2ICEC 4HV8B 1C08B 1RPQA 4XMTA 2WMPB 3V52H 3KW7A 2Q87A 2XCMC 3VXRB 5JPMC 2OMVB 3IJYA 4UNVA 3APDA 1IAMA 3NJIA 1JN6A 2XQYG 5C0CB 1KCUH 2WO3B 3NTCL 1N5YH 3LKRB 4Y19A 1NGXA 2V9TA 3WMQA 3RL1B 3C5SA 5F44A 5JQIB 4GG8A 4YHLH 4ZX3A 4OCYH 4OF8A 4ONGL 1LDPL 1IC5H 1J18A 1E3XA 3LN4B 2WQ8A 3D0LA 3MA9L 4I0PC 3VMNA 1DO6A 3WLWD 4QAWA 3ZKSD 2JKNA 1CDBA 4Q4IA 3HC4L 2DL9A 4JPWL 4JFFA 4OZFB 3KLQA 3WKMH 2CBOA 1OWRM 2AJVH 1K6QH 1ZT4A 1KPVB 3EBIA 4OTXL 2XQYK 3L3JA 1F00I 3DVNA 2BOBA 1TCMA 3MRFB 1XGYH 4HF5H 5D7IE 3QS3A 5D7SL 3KHOA 4RMUA 3CZNA 5AZEH 4LBAA 1LEGB 4G83A 1IGYA 3V4UH 3T8VA 5I1JH 2FDBP 5DHYB 5C0FA 3UAAA 4QHUB 2FWSA 5F6IC 4CVZB 1G6VK 3UTSB 1NZRA 4IDJL 5KBDA 4U3HA 3BO8A 4WGKA 2QDWA 3O6FC 2YC1B 3P3RA 4BSVB 4OGQC 5EOQH 4C59B 3SODB 2R69H 2DMGA 5IUCA 2IAND 4HSQA 2XPZA 3LZLA 3F7VA 3SDDD 3UZQA 3LMJL 4N0UE 2J3SA 4EN2A 4DPAX 4ZX5A 1A14L 4H1LH 4WHCA 2FYVA 4DEPB 2OK0H 4O2FA 4OZFG 1UVQB 4POZC 3SDAB 4MJ6A 3AQXA 4NRYA 5FHBL 1TZHB 4G11A 4JM2B 4XNQA 4HW6A 2X4UB 4CMMA 2C1PB 4BK4A 1OAZL 4K71C 1B6DA 3LXBA 3UO8B 3K2UH 4MD4A 4MBRA 3GHEH 5DK0A 1S7TB 4K3GA 4IMLA 4ZJ9A 2ZKXA 3S35H 3VRJB 4N3TA 3MRJB 2F19H 1W91A 2EDTA 3BYYA 4XHJD 4MMXC 4Y2OB 3K6SA 3NCYP 3QA3A 4AG4H 3VFMA 2Y36H 3PREA 1UCTA 1JZ6A 1YLBB 1E27A 3VM5A 3VG0H 5ACZA 3QIBD 1U95A 3MTXA 2Y1YA 2Y2TA 1MCRA 4QT5A 1ZOXA 2NCEA 3U7AA 1KGCE 2ZKMX 5GS0D 1LO4H 1S3RA 1S7UB 4NHUB 4PUBH 1FC2D 4KKAD 4TUUA 4WI6A 5HGDA 3VTAA 3G5VB 2WJ5A 2ZAIA 4JKPH 4EI6B 4WHYG 1CE6B 1T6BX 4PRNB 4OCWH 2VLRB 3EGDA 1JDAA 4WK4B 4KV5E 5B4MD 3VXNB 3QG6B 4M9PA 2WXJA 4G6AD 1N64L 1XF4B 4OZHF 1GS6X 3MOBH 5SV3A 3VUAA 2FQFA 3N41F 1IFGA 3ZKXB 4HEME 1WBYB 4F8NA 2FWOB 1UXWA 3MNZB 1MCWM 4UWQB 4A7GF 1IM9A 1BQUA 3FOMA 5EBLA 5AZUA 1JWSA 1H9VA 1MCJA 5FKAB 1KC5L 3IRCA 3M7FB 1FIEA 4OQTL 3G6JE 4G6KH 1AI1H 3PWPE 5K9QG 4JHWH 2WXRA 5DJZA 3V7AG 4Q6KA 1U6AH 2R2CA 3PWLA 2HJFA 5HHPA 2FUTA 5IFJA 4OIAA 2OMYA 2R59A 1MCPL 3E3QC 3BEVB 2HT3D 5FCUL 3GTVA 2V6HA 2D31A 4ZO8A 4LCIL 2GB2A 1QA9A 1UXMA 4FJZA 2X6VA 1NCAL 4NO0D 7FABL 5DJ0B 5DVPA 3OG4B 3P4MA 4Y4FC 1DBJL 2YK1L 3HI6H 3ARRA 4D0CA 4Y1SA 4TQIA 4MYPA 4WUUB 5FUCC 2ZSVA 3NQKA 3FTGA 2BVEA 1NCBH 3FQWB 4GXUN 1A2YA 4S1DC 5JORA 4TLKA 5JIIA 3AC0A 4KVCH 4OGXH 2AJUL 4TMPA 1TEYA 2KHAA 2ZJSL 3L4WA 3VTTA 2EUVA 4X5QA 2G75A 4BFFA 5CZVL 5FDWB 4ZMVA 3U2JA 4LBEA 1PD6A 4OH2A 3T3PE 3O0RL 2XQYA 4IMKC 2F58L 4L4JA 3QAQA 4ZAKD 3KCWA 3RDTA 4WWKC 1TQBB 5CEYB 5FOBB 3UZVB 4ZMQA 4PGCB 1ZA6B 3S3PA 4PGEB 3N1QC 1RJZA 4BWWA 3PP3H 4FOMA 3FB6A 3IMBA 1GOFA 2ARJA 4P07A 5E2VH 1AZNA 1GCYA 3QEQE 3WFDH 5I23A 5HI5C 2Q8BL 3VCLB 2BVOB 3KGRA 1I7UA 1P7KB 3GMRB 3KWUA 1XGQB 2EH7L 1MCFA 4RNRB 4JRYE 4N0CC 2DKSA 2YRLA 1LO0H 3KPSE 1YO4A 3V6OA 3A6CH 2FLMA 1H15B 2X2UA 1DVFD 4ANXA 3RG1C 1MHPH 4CBPA 1C5BH 1JZDC 1NM4A 4TLTA 4XP1L 2A1WL 4HV8A 4JHZA 4PJCE 1N7ML 2WP3T 4LOVA 2WMPA 2OZ4H 5FK9B 1MRDH 4N2EA 3VXRA 2OMZB 4XAKE 2O61B 5EF1A 3ARPA 2AZUA 4QRQB 4P5TB 5KVEL 5L2KB 1XZWA 4NFCA 5J3HD 3UG4A 3LKRA 4PB0L 4N8CH 2DBLL 5ACMA 3BH4A 5ANME 1AGDA 2R2BA 5T33H 3RL1A 1C7TA 1FLTX 1I85C 3LN4A 2UWEF 3HBQA 4M7LT 3S8FB 3RX7A 3D4CA 4RH4A 1NIEA 4A67A 3L1EA 3BSGA 3E6HA 4JDTL 3RGVA 1KGCD 3F2LA 4IKIA 1JE6A 1LQBC 4OSUL 3OKNB 1NFDE 1KXTB 1FH2A 3SGEI 4I0KA 3LPOA 3MRFA 2B15A 3TL5A 3T6WA 2Z93B 3WFEH 4JN1H 4UDUA 2BS71 3FSVA 1GGUA 1SJHB 3OVUB 1KCSH 3S4SB 1RVFH 1LEGA 3WNIA 4JPKH 4RESB 3ZOAA 4F9LA 1I8MB 1PQZB 4H0IA 4LQFH 4WK2B 1WIPA 2KI6A 2ZWKA 1ZS8B 3GRWA 1JV2B 1UACL 4BH8B 1PKQB 2AQTA 5ICUA 5FF6B 5KSVA 2ZXCA 1LEKA 1K85A 2RMNA 3F7QA 4X5LA 3OMZA 4J4PC 1ZXQA 4TVPH 5I19H 1MLCA 2QKIB 3E2HB 4WKZB 4ADGA 2XV3A 2YC1A 4BSVA 2PCFA 4GSDL 3EJZC 4ONFL 4D7BA 2UZYB 5KW9L 2XBZA 2YIHA 3H2PA 4OVVA 5EU6E 2IBGA 2PETA 2PPFA 3KH3A 2C9QA 2J8UB 4XH2B 4ZPTB 3VGBA 5JW4M 3HFFA 1YEKH 4QGTA 4KJPD 4DGIH 5J9PA 3PWPD 4G7YH 1AHMA 4N2MA 3HN3A 4UQDA 4P3DB 2XACC 5IB3A 3QZBA 5I66B 1Z3RA 3RA7H 1W9XA 4FAAB 4LVNB 4JM2A 2HMID 2D9QB 2C1PA 3F6LA 3DWTA 2ZXAA 3VB9A 1TFHA 1ADQA 5A2CA 2AANA 2XVBA 4OLVL 3BPNB 5DUJA 4PJBE 4FG6D 3K6FA 1NCDH 5D2LF 4Q4EA 3U4EA 3GZQA 1UXSB 4L9DA 4O02A 5KG9B 3UJIH 3AU1B 4UTCA 1JV5B 2AQ2A 2RIKA 4ODHH 5FYLE 3ZL1A 4MA3B 3LKQB 5D4IA 1PZ2A 4HS6B 1RP9A 3S3BB 1CN4A 3GRGA 1RZ7H 2XQBH 1SXNA 1S7UA 1TITA 4NHUA 2ZG1A 2J43A 2CK0H 4XOBA 3G5VA 3FW6A 1PPIA 1JTPA 5KTEL 2XN9A 1MRFH 2XY2A 4EI6A 3S98A 5FA3B 1CE6A 4F37K 3P1VA 2WNWA 1KY7A 4QO1A 1QFUL 4GEJA 3QPXL 3OR7B 3VXNA 5I1LB 1RSYA 4NYLB 4A6YH 1H3WM 2ZUXA 3ARED 4YWGL 3QEQD 5HHVH 4PBDA 1TZGL 1YA5A 3KNBB 5TQ2H 1WBYA 3RE0A 2FWOA 3OAZK 4JGMA 4AQAA 1IC4L 3KXFB 5E1AA 2JCCE 1NIBA 1SEQL 2AI0H 4JRYD 5KVFE 3RIKA 4YJZL 1HN1A 5JHDB 1REIA 3KPSD 5EG6C 3TO4A 4QJ4B 1D5IH 3MBXH 2LHAA 5A2AA 5IP4A 4MA7H 1FFQA 4YE0A 3SYPA 5KS9E 2DD8H 4GSQA 5C0BE 4IRSD 4ORZC 4P2OC 2G3NA 2X3AA 4QF1B 1QFOA 4JFVA 4PJAB 5F7FA 4QNPE 5ABAA 1KGUA 1DZBA 4PJEE 3EJYC 3VI3F 2X4RB 1JNNL 4XAKD 5J6HB 4JPVL 2VDRL 5ID1A 3CQQA 4KJWC 4OAWB 1JGVH 5E2TH 1BXAA 3BEVA 1FO0B 1ZV2A 2D3NA 4L48A 4WI5A 5CZXD 3F8UB 4BDVB 1E8XA 4ZK8A 5FECB 5DJ0A 2DLHA 1GYCA 4B9CA 4XCCH 4AQ1B 1L9NA 3ZK0A 2YEVB 5CEZH 4WFED 2CUMA 4WUUA 3RLSA 2C7FA 2EE2A 3FQWA 2UZIL 2O93L 3BEWB 3RVXD 1P7QB 2J25A 2Q2LA 4AX3A 5MENA 1PFOA 3LPPA 2LR4A 1AXIB 3KYMB 3S0PA 4J8QA 2X0UA 1T04A 2W60A 4LQ1A 5EORH 1T83C 4U6VL 5L0QC 3HRPA 1WP6A 4JHVA 1UC6A 1QLEL 5CEYA 2VSKB 3P11L 2PYFB 4WU7B 1ZA6A 3QH3A 2FX9H 3LZNA 4P04A 2R0ZL 3P30L 1OQXA 2BDNH 4KDTA 2E59A 4PGEA 5CCHE 2YGOA 4BQ9A 2VRAA 1BD2B 1RIUL 1HIMH 1PG7W 2NY1B 2VABB 2BY0A 3TZVC 2QVIA 1P7KA 3GMRA 1UATA 3QUXC 2RALA 4KC3B 1NC2B 4RNRA 4R97B 5B7EA 1KGIA 2LOEA 5EU6D 5CFAA 3MA7B 2VQUA 3C6LB 4JRLA 1ASQA 1QRKA 3TBTA 1JGIA 2DF3A 1H15A 1MRCH 4Y9BA 5FV2A 1JDDA 1TSRA 5EIQA 4HSCX 4L3EB 3VRLF 4XP6L 2XICA 1OGSA 4F91B 5FK9A 1FNHA 4GRLD 3C60C 3AU0A 3UZEC 3M8OH 1G1KA 1OT2A 2OMZA 4F7MA 1JPFA 2O61A 1E4JA 4QRQA 3EOAB 4WHTA 4PWFA 3IGLA 5AOJA 4KMTL 5DS8B 5L2KA 1YDPA 4XC1H 3EZ8A 2QSTA 1H3TA 5ACLA 2QQKL 3MV11 3JTSB 1JFQH 1AHWC 5CMAB 2XPYA 1KJ2L 4X6FA 1KBPA 4XP5L 5FYLD 2DIJA 4N28A 4YE4H 1IGMH 2WOYA 5AVUB 3JZYA 4AV4A 2AQSA 3NJFA 2JWYA 1GAFH 4F15C 3D69A 4OIFA 1G7LA 1NUNB 2BSBA 5K9JL 1JGUH 1EPFA 1KXTA 2B1HH 2VKWA 4J28A 4N2AA 3INUH 1WVZA 4JN2A 5C0ND 3GKZA 5GGUB 2Z93A 4DK3A 3IDXL 2J8HA 3P3UA 1X7QB 2A0LD 4YHKH 2YR3A 1I8MA 1CBVH 3PHQB 1PQZA 2X6BA 2ZYIA 3O3BA 3PJLA 3ZHDA 1BQ5A 2JXMB 1ZS8A 3OMIB 5LQBH 1JV2A 3GTTA 4BH8A 1PKQA 1T5WA 4FLRA 3QJUB 3HNSL 3BPLB 1H5BB 2IF7A 1NBVH 4N2BA 5GS1C 1DLFL 1TTFA 2WCPA 3K1DA 2X9YA 1RI8A 2QKIA 4WKZA 4PP1C 2NXYD 3FB8B 3WIFB 1BOGB 4AYDC 1RJLA 2YPVH 3U2IA 2BZ7A 3BWAA 2H3NA 1FNGB 2HUEA 1P84K 4ZPTA 4XH2A 2J8UA 3MJ8B 4JO5A 2MPAH 5C0BD 3GSOB 3DX6A 1E7VA 4P3DA 4U1NB 3FS9A 1RUAH 2P5WB 1CG9A 5I5JA 2BLFA 2BRRH 5BRZE 5FB8B 5I66A 3L48A 2LTQB 4NZTL 1R5IB 3BAEH 5B8CC 1MCOL 3FQUB 2BXZA 4U1MB 2CRYA 4ZMOA 3MRHB 4WEBH 5GZNC 2VXUH 2N7SA 5CXPA 3OG6B 3K6DA 1PTZA 4KRMB 1TJIH 3ERXA 4FULA 1X4ZA 3PYCA 4TULH 1GGCH 5C7XL 3BUIA 5IF0B 3WO3B 5KG9A 3AQDA 4JFZL 4OJFL 3AU1A 4J12A 4GFTB 1I9EA 3DMMB 1S8DA 1CMOA 5IROA 3LKQA 3C5ZC 4FHJA 3LKOB 3FO1B 2NUPB 2Z7UA 2PR9A 3EYVB 4IOFC 3W82A 2YGQA 1U8OB 4FQXB 5GXBB 4QXVA 2J1WA 4LAQL 1F2XK 3GSXA 5FYKU 5I9QB 2PTTB 4P2QE 4FI6A 4O2EB 1UFUA 1UXLA 5FA3A 2L04A 3WNOA 7TAAA 3CK0L 3FH8A 3IGUA 1TVBB 1LQSR 3HUJB 4O51B 1G5GA 3OR7A 5SX5H 1JHLH 3L3HB 5DD5L 5IBTL 3WMPA 1AKPA 2N3JA 3HNTL 5DRZB 1KBKA 1WT5C 3N1PC 1ZWIA 4HD9A 3KNBA 2ERJC 4IQHA 5D71H 4ODSL 3KXFA 3MUY1 4J3TA 5JHDA 5JXED 2ARJQ 5CJ5A 2ZOLB 3VGAC 3FT4B 3FQRA 3GBNH 1HXYB 5ICYB 2B4CC 5F96L 3UPRB 1E8WA 5DWPA 3OMAB 4MAYD 4QF1A 3GGWA 4PJAA 1IAOB 4RFNC 1C16A 3I74A 4MJJA 1A3RH 4QRPB 1BVLB 4GBXC 5J6HA 4KK5C 3WN5C 4OAWA 4X0NA 1VCAA 3MRGB 1FO0A 4OFIA 2Y7SA 2WLIB 3LH2L 2AEIT 3T1FB 4JG5A 1OP3H 5GGVL 1CXHA 4BDVA 5FECA 2NY3D 4AQ1A 5FW8A 1OM9A 3HS0C 5C07B 4ONGH 1LDPH 5BZDA 1OAYH 4MNGA 2RA1A 2YEZB 5EDXA 4N1CA 2ODHA 2O6EA 3HC4H 2V5RA 2WTPA 3VFTB 3BEWA 1SHWA 2CBTA 4PJ9B 1NIAA 1P7QA 3B2PA 1XWVA 1QI4A 3U46B 4W81A 4OTXH 4XNXH 4DP9X 5J6GB 4DPRA 3IPBA 2QR0B 4R7VA 4BSWB 3EBGA 1WFJA 3KYMA 2ADFL 2FX7L 1BFSA 1A1NB 1HWWA 2BVYA 2M2DA 3X13B 5FO9B 3SQBB 4OLYH 5F7EH 2XZQL 5IT2L 2F5AL 3A21A 4PWKA 1NOFA 3F12B 3J7HA 4WU7A 5ADOH 2WBWB 3MNWB 4XPBL 5E56A 2WKGA 5LGYA 5JOFB 5F3BB 4A2LA 1MVUB 2YPKB 1BAFL 3SE3C 2VABA 3AAZB 4D9LL 5E24E 1BFVL 1XT5A 4HWNA 5FFLA 3BSZL 3P4NA 4G6FB 2GK2A 3EZJB 4R0LC 1CT8B 4LLMB 3IGFA 3DBXB 4MSWB 3C6LA 1YNKH 1V7NH 4PTTB 5L4IA 3FB7B 3NZUA 1CDJA 3EH1A 1XIWA 2F5BL 3VW3L 4OCLC 4B50A 3UPCA 2X4NB 3O8XC 4BV1A 4L3EA 1T7WA 5BRZD 2LVCA 3EUUA 5FHBH 2L4OA 5E7FA 4YOKA 1PS3A 4HUWB 4E5XB 1XSOA 4L3AA 3VVVA 1YC7A 2X89A 1QVOA 1WIOA 3HI1A 4AMKL 5BO0D 1ORQB 3EOAA 4YGVB 2YARA 4H8WH 1BZQK 4KQ4L 2APTA 1TQVA 2J5LC 3CSPA 5D1QE 4ZQKB 3RVWD 3JTSA 2VLLA 1WEJH 3O2VH 1NFIA 2HVBA 3ULVF 1WAPA 2H3KA 1E4KC 1I1YB 2ADGA 2CRIA 1NPNA 3D3VD 4G1EA 2J4WH 4HGMA 4JKWA 4EDWL 5DZNA 1ZEAL 1I3GH 1NGZB 4HWUA 4DP7X 2R15A 3HZYA 4GXVL 3ESNA 1TVDA 2X1WL 4YMPA 4W9CC 3IFNH 1UEYA 2R9HC 1ZV5A 5AW9B 1OTSC 4P2QD 1GRWA 3T2NL 3RTQB 5GGUA 2DJMA 4LL1A 1QSFA 1CZ8L 3K3QA 1KCRH 2PPEA 1G1CA 1UA6L 1X7QA 1A9BB 4KAQL 4APQC 5T3XL 3UGUA 1OW0A 3PHQA 1UOKA 3VWKC 1OE1A 1G0XA 5T1KB 5D96C 3REWA 4MA1C 3L4TA 2VTFA 2JXMA 2EUXA 1IBZA 1UT9A 3LRLA 1WICA 2EO1A 2CMRH 2GYSA 1BGXH 1N64H 3MOAL 3C8DA 4DAGH 2ZT9C 4LLWB 2B4CL 1TJXA 2IC2A 3T4AB 4A7UA 2WB1A 2XY1A 4NNPL 2AJSH 3FB8A 4PI2A 1N8OE 4LCUB 3WIFA 3RRQA 2J6EL 1NBYB 3AQYA 1HU8A 1MI5E 2XJKA 4H8QA 1JS4A 1WZMA 4HIEA 1G0DA 3NIDF 1FNGA 1HVXA 1CXEA 3NEEA 3NQIA 3WAKA 2CO3A 4YLQT 3GSOA 3LRSB 5CBEA 4PU2A 4U1NA 1EWHA 2VDLB 4Z9KB 2P5WA 5D2LE 1D5BB 2HWZL 4ZD3L 4RFOL 2DWTA 3TPKA 3VXSE 2E7LC 2K7PA 4QRTB 3GYRA 4N1EA 3FQUA 4U1MA 5H4ZA 1NCUA 3G5ZA 3FUHA 1JYWA 1MZYA 1WWBX 4M5YL 4NWTH 5FCUH 5F7DB 4WGVB 1UYWL 4OZFH 3WY4A 4FQHB 1CI5A 5TH2B 3Q1SH 2WCSA 2AJ3B 1YEWA 2YKKA 1FSKC 1CFBA 3X12B 5EEUA 4MXVF 2HKAA 4PJXB 2LGNA 3O9WC 3QDHA 3TTYA 1J11A 4DN3L 5E6ID 1H6EA 1BXVA 2YK1H 4PSPA 1TO5A 1HWHB 4MD0B 3LKOA 3RIAF 3RX5A 4AVJA 4F8TA 1ZGLB 2NUPA 3O0LA 2X12A 2OQJB 4HX1B 3S48A 5KSAC 3D08A 2TRHA 4FQXA 5IMKB 3GSRB 3PGDB 2ZJSH 5AWNL 1P4UA 2PTTA 5CZVH 2BFVL 5T8IA 3MI6A 4O2EA 1E65A 1U3ZA 1WWWX 4K94H 4PG2A 3O0RH 1KPUB 4RGMB 4J8RB 3FH5A 4DZ8B 3SOBL 3HUJA 2J88L 3TVMD 1KUMA 2H0PA 5HHQA 1MCDA 5DD6B 3H3KA 4JY6B 1ET8A 4ZZKA 1VF5C 4HPYL 3ARWA 3EW3B 5DRZA 3WIIH 4JL2A 4Q89A 3C5XA 4TSCL 2AP2A 4GQRA 1ES0A 2VC2L 4NDMB 1C8PA 4FQ1H 1GGBH 3K0WA 2EH7H 3VI3E 4F5CA 4AEEA 2IAMA 4BZ2L 4L18A 4Z7UF 3FT4A 4F7CB 2IGLA 4LE8A 5ICYA 4HKJB 3UPRA 1I1AC 2GEEA 1VRSA 4UQ3B 2YKLL 4HFWA 4XRCB 4Y2DD 4E9SA 3NJNA 3AS2A 1H3PL 1BAGA 3P4OB 4XP1H 3LD8B 1Z32X 4QRPA 2A73A 5CINL 3WJLA 1BVLA 3VYNA 3MRGA 2BZDA 2AXFA 1JXKA 1X5XA 3CDYA 4FQQB 4BQBA 1JF1B 1RJCA 2WLIA 1PDKB 3S37H 3JWDC 1GGIL 3FAWA 2P47B 3DUHA 2YAOA 2WAHA 2QT6A 5D1QD 1IUZA 4K5NA 4I1RA 1EJ8A 5C07A 4A7SA 3FO2B 4X8JB 2YEZA 3JUYA 3O6ML 5IHUL 3WELA 1VADB 3DNKA 2P80D 2CAKA 3HMXA 1G84A 1Z9MA 3VFTA 3OC8A 5IMOB 5TQ0H 1N0XL 4ONHB 4PJ9A 2XC8A 3U46A 4OSUH 5J6GA 4WRLA 1IILE 4BSWA 5EBWB 1L9MA 4Q8BA 1BG9A 2QMJA 4KI5C 3I3DA 5IZ7A 4E68A 4LSSL 2ZCLH 2QLVB 5E08H 1A1NA 3FFCD 3X13A 4EIBA 5CJOL 3VFOB 2AHIA 3F12A 1YAZA 1Z9SA 1UWXK 2B0SL 1XCQB 1HSAB 3MNWA 1UACH 1QSEE 1KBWA 2DLGA 2FRGP 2P45B 3DVGA 2ESVE 2VL5B 5F3BA 1MVUA 2P4AB 2YPKA 3GSVB 3UC0H 3AAZA 1S9KC 3T3MB 3EOBB 4BZ1A 2VZSA 4MJIB 2K8MA 4PJGB 1MI5D 2CALA 4ONFH 4Q58C 1AJ7H 3EO9L 4C47A 5CSBA 1CT8A 4N9OB 3DBXA 2UVFA 3H1ZA 3DOSB 3HE6A 3FB7A 4H0GA 3N42B 4I18C 5IEHA 1DLHA 2E86A 4FLHA 3V5KA 4NB7A 4PJ5B 4AJYV 2MTPA 3IKCA 4UBDC 4GS7C 2X4NA 1OM3H 4ZOBA 2HLFC 2VJ0A 1S7WB 4L29B 4X80L 3VXSD 5AENA 4WF7A 3QUKB 2XV6B 4HP5A 1OT4A 4HUWA 1QR4A 4X6DF 4AQZA 5D1XE 4YDJB 1ORQA 4YGVA 2NNCA 1A3LL 4OLVH 3BLKA 1MFEH 3O2DA 4FXGB 3JV5A 3G04B 4E9XA 4MJHA 2PTVA 2ZX9A 1Z3GL 1PEZA 4XX1E 1Y1UA 2BIQA 3ECUA 1UH4A 1EHNA 1E6JL 2MCAA 2I32A 3MGOB 4APXB 2Z9TA 5HPMA 5C6WH 1E5CA 4NKDA 4I0PD 3DGCR 2DL2A 2CNYA 2H0FA 1K5WA 4UV7L 1VKXA 3U36B 1BZOA 4R3SB 5SWQB 3WIHL 1UM4L 4NWUH 2EACA 4W9GC 3RTQA 3H0TB 4B9FA 5KTEH 4GEIA 2CUAA 3R06B 1I1CA 4G9DB 1P6WA 3ARTA 4U7MA 1A9BA 2EEAA 3D9AH 4WO4A 5DEGB 3U1SL 1XGZA 3IMWA 4LB8A 3ET9F 3QPXH 4OUUA 4XBPA 1OCRB 3QSKB 1TENA 2AW2A 2EDJA 4JZNA 4KK9C 4M02A 5DURD 1DR9A 4LEEA 2JQAA 4LLWA 1TZGH 1WAAA 3T4AA 4YSEA 5EWIL 1DBKH 1FN4B 1B0IA 1FGNL 1XH0A 1YG9A 4R90H 3L2NA 4LCUA 1IC4H 3HJEA 1RPUA 2CU9A 3AABA 4RSYA 2JKJA 3MV7B 5D7JC 1QLFB 3CX2A 2O5NA 3ARFB 5LHDA 3FFOA 2AK4B 3Q7JA 1IT9L 2DI7A 2ICCA 2WKOF 3FYEB 3LRSA 3NUKA 3O3EA 4X6CA 5IFAH 3BRFA 1SVZA 1D5BA 3MRRA 3JWDL 3VFGL 3W56A 1P5UA 3X14B 2BXYA 2X4TA 5HYQA 1MJJB 4GQ9H 2J5WA 4XO9A 1JNNH 5IW1B 4JPVH 3SY0A 1V5JA 3BAKA 3GQFA 3RWEA 3OZKA 4MQTB 5F7DA 2VZ3A 3N1MC 4J6IA 1BW8A 3NRFA 4KY2A 1P4IL 4FQHA 3RKPA 2ZYRA 5TH2A 5L8KB 2AJ3A 3Q2CA 1G4MA 1II4E 3X12A 5BUGA 4WGWB 4TLSA 4PJXA 4U1JB 3V4PL 1F13A 1HSBA 4MNQA 3BDYH 4FP8H 4XP9L 2EUZA 3QWQB 4PGZA 2VZOA 3CMOH 4D0BB 2R0WL 3QWOA 4MD0A 4Y7OC 4M6NL 4X9GA 2EDLA 3HW7A 1P5VA 5ITBL 1UD3A 2BNQE 3U0PB 1KLUB 2CXKA 5IMKA 3GSRA 3PGDA 4KXAA 2XVKA 5CN1A 1KPUA 1P53A 4HCFA 4DZ8A 4NAQA 4FFWC 3JWOH 2H0JA 3QO0A 2HFEB 4LCCB 2ZKHL 1L7IL 3NOIA 3QZLA 3VDAA 1J5DA 3OAZH 1QSED 1D5XA 2ESVD 1LEIA 4X98B 3FUMA 5DYOA 2G30A 1NGYB 4KKNA 3WKPA 1N12A 1OP5K 2G2NA 4A2DA 5IVXB 4LXFA 3ZQ9A 1NC4D 1A6UL 4NDMA 4C8XA 1TQCC 1CFNB 5AYTA 1OD9A 2KLRA 4JL1A 5BV7B 1XF2B 2IPUK 1PYWB 4R26L 3N06B 3SCMD 3ARYA 4F7CA 1EMTL 4FFYA 3KL0A 4HKJA 2FBJL 2NY2D 4LCWE 2A38A 3L4CA 4FI8A 3GXIA 2R2HB 3FO0H 3MNVA 4UQ3A 2Q86B 4XRCA 1W0WB 4IDLA 3VH8B 5JHAA 3LY6A 2BJML 3P4OA 4YDLC 4EEEA 1BF8A 3OC5A 5IQ7H 3TWCH 1SXBA 1BHGA 4ZYKB 5D1XD 2VITB 3H4FA 2XTJB 4XBGB 1HEZB 5ISZB 1QWHA 1YNLL 4FQQA 1JF1A 1PDKA 2FEEL 3NIGB 1CGXA 3ZRCC 1TMCB 3B7TA 1GTNA 4XNAA 1URLA 4F7KA 4XBMA 5C0AD 3UTTB 1IB5A 1CFVL 4FRWA 1KCVL 5IQ9B 3FB5A 2WWNA 1LM8V 1ERNA 3C2AH 4B3VA 3CDCA 4Y4FD 1VADA 2XWXA 3FPXA 3QUZB 4W9ZA 5TK2A 2VZVA 2WN3A 3BC9A 1JZ7A 5C3LD 4WNQB 5EBWA 2R0KL 3QHZL 3WJJA 4N0FB 3TBBA 5I76B 1O75A 3QQ3B 4WJ5B 3IDXH 1E40A 2CG9X 2M26A 3B7RL 3L9RB 3VH8G 5LVEA 1GZPA 2KUTA 4B53A 2VWEC 3VFOA 3ZDYE 5DMYA 2BHYA 4PS4L 1OCOB 1XCQA 1HSAA 3OXSB 4Y16A 3DTDA 5G55A 4N24A 4QOKA 3OL2A 1NFKA 3OF6A 3GSVA 4GO6B 1NLBL 3POCA 4F27A 4XWGH 1QACA 3H55A 3EOBA 3V5HA 4TYUA 4YBLC 5GRZA 1CFTA 2CUHA 3P0YL 5CSGA 1Q72L 3ZPDA 2KS0A 4LK4A 2R23B 1OCZB 4P2RB 3QDMB 5IW6B 4ZW8A 2D2OA 3BZ5A 1PZBA 3V6OC 2NUTB 1B0WA 2ADIA 4Y1AE 5KYXA 3THMH 5E8DL 3H9SE 1A6WH 1J0ZA 1EEUA 4L29A 5EU5B 2YUWA 3ULVE 1S7QA 1NPJA 2V3DA 2DWDA 2WVSA 3QUKA 2I9LB 5B21A 5SWZB 2ATAA 2WJ7A 4MD5B 1XCXA 3NACH 4YDJA 2QADC 2WWMC 4P46A 2ZSWB 4S1RL 3NCFB 4F93B 4BFEA 5I1CL 3DUUA 1SXSA 3H85A 1HS6A 5J89A 1FZMB 5HHME 2WXGA 3D0AA 4XHQA 2WVVB 1M05B 5KSBE 1BIHA 3G04A 4H2AA 4LGSB 3ABGA 3PCYA 3MNMA 4MAUH 3DSFL 4XPTL 2YEQA 3BI9X 1EFQA 3KYAA 4JFZH 4OJFH 4JDVA 1X5KA 2QVFB 3MGOA 4Z7VF 2W65A 3A23A 3DX2A 5CKAA 5IKCB 5GJTH 4PW3A 1TTAA 2BNQD 5FR3A 5D5MB 1OZUA 3EFOB 3RGVC 3BVNA 4FYQA 3QQ9D 4R3SA 5CCGE 4HIQA 2EDEA 3IFPB 4M61A 1WFOA 2EP6A 2K9FB 4KK6D 5BRQA 4YHZL 5AG9A 3H0TA 3K1KC 4XMKL 4QI3A 5IY5B 3R06A 4QKXB 3RVUC 4X9IA 4MLSA 1O9VA 4HUNB 2BWQA 3P3SA 4XNMA 5DEGA 4AYGA 3MJ6A 1GYVA 4OFPA 1KJ3L 2VL4A 2IOOA 4PI0A 3V9FA 2LQRA 5F7AA 2VM9A 3T65B 4MVBD 4V1DA 4X7EC 4XPGL 2QDVA 1PLAA 2VXQH 3MRLB 3BISA 3GPEA 4GKOA 1FN4A 4KI5F 4ODSH 3HBGA 5GHWL 2XKUA 1VGEH 1FYTE 3MV7A 4CN1A 4JFED 4K3JL 2LLLA 1QLFA 2F1BA 1RUQH 2V3EA 3EJZD 3ARFA 3QUYA 4UZUA 4LCWD 1H3VA 5F96H 1D5MB 4X4ME 3UMNA 2OR7A 2R1WA 3UYRL 2B2XH 5G2NA 3ULAB 5GRUL 5I6LA 4JRXB 2AJXH 4JB9L 4FADA 4MXVE 4DEPC 3FTXA 4ZOCA 2X9ZA 4UB0L 3X14A 3QFJB 5ABDE 2ITCB 3TFBA 4IBUA 3TX4A 1J12A 3F58H 5DD3L 3MRDB 1K8IB 2F08A 1CR9L 1TU2A 2WIMA 4NNXB 3LH2H 4RDBA 3QNYB 25C8L 3S5ZA 2X3CA 1ZA3B 2IPKB 3SDYL 4YFDB 4OZIF 3BKML 5GGVH 4U1JA 1GIGL 1JCKA 2NR6C 4KHTH 1WD9A 4D0BA 1YJDC 1D6VL 1KIQB 5F9WB 2E6PA 3Q5YA 5H37G 4URKA 3ARDD 3QIUA 3ZY7A 4XAWH 1RJYA 4Y5XA 4CSTA 3U0PA 1A6PA 1KLUA 4DVRL 3CBJB 3UJJL 3WTYA 1UCBH 3CVIH 3LS4L 5DEJA 5C08A 5I8OH 3FCSA 4BFRA 3HHRB 2F54E 5T3ZH 4JZJC 2APSA 3A6BL 4UTBA 5J11B 1E0OB 4PMEA 2ADFH 1QFHA 5ICZB 1G9EA 5DFAA 2F5AH 4LCCA 2R27A 1FIGH 1T4KB 1JVLA 3UAFA 1NGPL 1GHFH 2F53A 5AZ2H 5DVOA 3AT9A 5I8CB 3ZTDC 5IVXA 4LPWA 3VD7A 3RGHA 3T0EB 4G3YL 4F8QA 2XZCL 4RDQG 2UY6A 5DWUL 2N7AA 1QFWI 3Q9QA 2YOAA 4N22A 4MQXC 1PYWA 3QUMB 3MU3A 1H9DA 5E94B 4A7VA 3DSNA 1WCBB 3MBWB 3LEYL 3FCBA 4GI9A 3TO4C 3T2OA 2F5BH 3T9WA 1AS8A 3VW3H 3RDJA 4HJ1A 4Y1AD 2R2HA 5JOPE 3GO1H 4L1TA 3H9SD 5L2JB 1JZFA 4P2OD 3VH8A 1FHNA 1NWPA 3ULVD 1OK8A 3HR6A 2XXGA 4ZYKA 2VITA 3EJYD 4PRDB 2YA0A 1HEZA 3L5JA 4AMKH 5JW4R 2G4EA 4YDKL 4HJIA 3HZMA 4KQ4H 5HHMD 4M4RB 3QR2A 2A9MH 5HVHC 2HUHA 5EA0H 3UTTA 5FGBA 1R33A 1I7ZA 5IQ9A 5DSCB 5BOJA 1VERA 8PAZA 1MJ8L 2VDOL 3NCYS 4LFHD 3VFNB 4ERSH 4W4NA 4X5WB 4ZFOL 3WUWB 5IMLB 1JPGB 1ZEAH 1B0GB 4HHAB 3H3PH 2OMNA 1B2WH 4D3CL 5GJSH 1P7HL 2R1XA 3JWNC 4WNQA 3UP6A 2EKSB 3ZU8A 3QQ3A 1YVLA 4WJ5A 1HNFA 1CZ8H 1EO8H 3GRWL 2VR8A 2V2TB 1UA6H 1G7JB 2E56A 3MDJA 1H8OA 3FU3A 4KAQH 1BJ1J 1SJEB 5T3XH 1ZXKA 4KUZL 4YHNB 1UZ6F 2EH8H 2XG5B 4EI0A 1IE5A 4NQXA 3OXSA 4Q2ZB 3MOAH 4AH2B 3LTVA 2ATKB 2BHZA 2B4CH 3HEIB 4M8QB 5DUBA 1BM3L 1U42A 1FRGL 4P99A 1HH6A 3BUPA 3TZVD 4EXKA 2J6EH 4X7SL 3QUXD 1B4JL 2R23A 4QRSA 2V5TA 2VO5A 4JANB 4Z76B 4P3CH 4E9QA 4TOYH 3WUWG 3QORB 3WUZA 1TT6A 3HRZC 2NUTA 1VACA 4J5VA 3AGWA 3VXTB 1HOEA 3ZO9A 2VSDA 6PCYA 5EU5A 3WFCH 4ZD3H 4RFOH 2I9LA 3MJGX 3MV9E 4FTDA 4JMNA 4MD5A 3P9MB 2H6UA 4NENB 2ZSWA 3C60D 5DD0L 5FGCE 4E36A 3D85A 1YJDL 2ZE0A 1AFVL 4G5ZH 4M5YH 4O02L 5T1LA 1UYWH 1FZMA 2ZAGA 2VMEA 1BWMA 4DP8X 4LLYB 3IFLH 1M05A 3D2UD 1I8AA 2X40A 5CWSB 3QJVB 5AEAA 5MP6L 4ZMPA 5HJDA 1NLDL 5TE6H 3ROOB 2Y7OA 3M1BB 1BYNA 1NOAA 5BZZA 5ENWB 3EO1B 5AAPA 5AAWC 3KAAA 3TLRA 4OGZA 4W6YB 1XEUA 5EZIH 5IKCA 1BVOA 4TRPH 1N67A 1R4XA 2MOQA 5HHXL 3O4OB 4ZPVB 3H53A 3IFOB 5TF0A 2WWKT 3SKOB 4WU5A 3EFOA 1M2VB 2ED6A 4RISH 1G5AA 4XPAH 1BQRA 2WXLA 5AWNH 2F54D 5HI3C 3IFPA 2OX5B 3JV6B 2BFVH 3CBRA 2FBRA 4WI2A 4HKXA 4RMVA 4BZ1H 3ARBA 4J1UA 4CSPA 5DDHB 4JDZA 3VGGA 1HI6A 1OE2A 5DLML 3WL9B 4DNLA 1UWGL 4ECNA 5E1GA 2G3XA 3T65A 2NY6B 3PIQB 1B0RB 2JB5L 4HPYH 3V0JA 1SN5A 2NT0A 1PX4A 1PW3A 1R3IH 4TSCH 5H37A 1U41A 4LASL 4NO2B 4RRPM 2MCMA 4KJYB 3KBEA 3V0FA 2A9DA 1MCHA 2X88A 3L4ZA 5MEPB 1SFHA 3LV3B 3KM1A 4A63A 1T22B 1G1YA 4P23C 1EX0A 5AALA 3CFKB 1D5MA 4AYEC 3BQVA 3T6ZA 5E5LA 4X7CC 5FHAH 5KYNA 3VXME 2C9RA 1WFIA 2R4SL 4KFZC 3OB0K 3QFJA 1RZJC 3IXTA 2ITCA 1DJZA 3HHSB 4A2FA 5KWYC 2ALAA 3MRDA 1K8IA 3WV0A 3Q2NA 4NNXA 3QNYA 4K7FB 5AVWB 1BBJB 2OYMA 5DMJB 1NANI 4HOWA 4N9GA 1PNDA 2X6MA 5F3HB 4Z7NE 1KIQA 3O6MH 4K7PH 4FYSA 4M1GL 1R6VA 3C5ZD 4L23A 2Q6WB 4AMWA 5FLUA 4YZFE 1A0QL 4TSAL 4I8DA 4LRNH 3A67L 2CCWA 2IV9A 5JIHA 1Z5LA 1R5VB 1K3IA 2P5EB 4K8RL 2YD8A 1QEXA 3L7EB 1D7BA 2IXQB 4H26B 1BYOA 3F5WB 5ICZA 2MH4A 1BZDA 2GY7B 4MJ5A 2G3ZA 1U30A 1JXJA 1L9QA 3HTLX 3ZE1B 3MO1A 1XCTA 3SE6A 4OCSL 2B0SH 5I30L 2QQNL 2Z4QB 2B5IC 3PE9A 1MW1A 1QI5A 3K4DA 4HHWA 4M5ZH 2VDLH 2QPDB 3WXWH 5HHOB 5I8CA 1J5HA 4W9EC 2NY0C 1KIPA 3KEHA 1DFXA 4HJSA 1VCBC 3WS6C 4C56E 1FPTH 2OCCB 3PP4H 1KTJA 2VLKB 1AYOA 3EO9H 3I75B 2O5XL 3QUMA 5E94A 1F6FB 5DQ9B 5D93C 3SYAA 3ZYIA 3ARZA 3O3DA 4U1GC 1WCBA 3MBWA 1THCA 2D7NA 2ATPB 2H8PB 1RUKH 3QEUA 5CIPA 5L2JA 1U58B 2UZPA 5DZLA 1OF2B 4EDXA 2O5ZL 4P4KC 3O2WL 1AO7D 4BFNA 3IAGC 3MV9D 1ASPA 1LP9A 3G9VA 4FYRA 2IH1B 3N43F 4NCDA 4KK5D 3KDPB 4PJ7B 3DO7B 1PNCA 1PSKH 1A3LH 3MXWH 3T6XA 2ZUTA 1RH8A 3D52A 3GXUB 5SWSE 5TFSL 1RMFH 1VPOL 3NEOA 3IJ9A 1OLLA 1Z3GH 4HPOL 3M1OA 4O2CB 3QJOA 4M6AA 4HLZH 5DSCA 1RHHB 4E41E 5IEKB 1B2YA 4JMXA 3RU8H 4X5WA 5I1EL 2D03H 3WUWA 5IMLA 3ABMB 1B0GA 2L7QA 2HX8A 3KLSA 4RGNB 1H19A 4XOEA 4IYKA 4UT9A 3DDFA 4NRXA 4PJBA 4X5XB 3MJ9A 1UM4H 2J1XA 1CCZA 2EKSA 4EN3D 1UWXH 3ZDZE 1BP3B 2V2TA 1G7JA 2SEBB 4JFQB 4M7LL 3KPQA 2I60L 4EQ2A 3NBNA 1SJEA 3U1SH 4LIQL 1OAUL 1RIHH 2XG5A 4QLWA 1WTLA 3QJTB 4CKQA 1A7QH 2XYCA 4EO5A 2QGEA 5J4MA 4AH2A 2ATKA 2FGWL 4U7KA 2H26A 4M8QA 4X4XB 5EWIH 3F83A 4PJFB 1FGNH 4TVUA 4KJQC 3HCVB 5GISL 1RZJL 1ZHBB 1ZLSL 4KITB 4V33A 1MCWW 4JANA 2RFXB 4ZFGL 1JRHH 4TQEL 3QORA 2OJEA 1IT9H 4LPTA 1F3DH 3RFRA 3SEPA 3MLRL 3TF7C 1XIWC 3VXMD 3N0AA 3VFGH 4FNQA 3O8XD 3HB3B 2BMKB 3VD2A 4Z7VE 1JBJA 3CVHL 4KRPB 4FKEA 3DX1A 4NENA 4WNSA 3BWSA 4NQSA 5I82A 1KB9J 2P28B 3V8CA 4GMSH 5A2IH 2CH8A 5F7WC 5EFIB 4LLYA 1DUZB 1T6VN 5CWSA 2BY2A 4QRRA 1PIFA 2FATL 1T6WA 1IGCH 4PWJA 4R5TA 1ML0A 2HYMA 2X1OA 4G8GA 4NP4H 3ROOA 3M1BA 5MEQB 1MW2A 3CN0A 2B08A 2OZNA 3EO1A 1GPOL 2JVUA 4GAJH 4MB1A 5ENWA 4UM8A 4AVKA 1U2HA 3TC9A 1UT2A 3CX5J 3HI5L 3T0AA 4M6NH 5FX3A 2VDPL 1HL9A 3FDWA 4KKBD 5FM5O 5D9SA 4ZPVA 4ZMTA 3AJ7A 4PRBB 1M2VA 1R3KB 3BPOB 1XSJA 3IJHB 3L5XH 3B5TA 3JV6A 4IGBC 3BP6B 4YDVB 5FYJH 5I6NA 5BNXD 3RWIB 1OTSD 3NFSH 4KI5E 2XIIA 1JZIA 2NY4D 3IJ7A 5FYKE 5E4EC 4AQ8A 2H41A 4LPXA 2JSFA 1OW0C 2DLTA 4NZRL 1DBAL 3PIQA 1IKNA 1B0RA 1CXLA 4RLDA 1SXZA 1Z0NA 2WD0A 3OTTA 1T21B 4U0QB 2IDTA 3ZYOA 3MACH 3OZLA 3FF8A 4KO9A 4NIYE 1EZLA 2CLRB 1XH3B 2FX8L 4NO2A 5TE7L 3LDBB 4RQQA 4UNIA 5J8OA 3CN4A 3BOVA 4JG0L 1E9PA 1RZGB 1WC7B 1GYAA 1K2DB 3D18B 3W9DB 1M9SA 3B37A 3GXMA 3CWGA 4NFDA 3CPUA 3Q5TA 1P2CB 5HDWA 2NPLX 4YC2C 1NCTA 3BXNB 5F7KC 3ZX1A 5HYSA 2BNRB 2FH8A 4YXLL 1UKTA 4KTDL 2BJMH 4WKXA 2Z6FA 2H3XC 4G7VL 4PJHE 3MJ7A 3FQTB 1MLBB 3HC2A 3ZHFA 4JFXB 4AE1A 4UAHA 3HHSA 5HVGB 2K3TA 2W95A 4XGZB 4ZG1A 2IDFA 2P52A 3GXPA 1BJMA 3CDGB 3QWNA 2UX6A 2Y07L 4QCIB 2P24B 2RBLA 3QBTB 3JYBA 4ZFZB 3QDGA 2M83A 3SE4C 3N1GC 3RGBA 1CFVH 1KCVH 2B8OT 4E41D 2BSSB 1HQRA 4NNYB 1LMIA 1HHGA 4Y19E 3V4VB 1PD1A 4KFMA 1IGTB 3VTMA 3T2PA 4N0YL 3U9WA 2XFGB 3WO4B 2WZ0A 4R8WH 2NLJB 4FFZL 3UH8A 5F7HA 2V9RA 3L3DB 5I0YA 2ZX6A 4LSPL 2CM5A 3RUGB 4L8CB 4ZO9A 3TFKC 2CA3A 5JXAH 3HA0A 2R0KH 3QHZH 4JFFE 4YX2H 1R5VA 1JNHB 2P5EA 5IHWA 2EC9T 4JO3L 5JZ7D 3TEYA 3L7EA 2IXQA 4H26A 2W38A 3HG4A 3F5WA 4IKKA 1KGWA 4N2OA 3LKSA 2HTKC 4LVOB 4JUTA 1OP5H 3WY1A 3S9DB 1WE5A 1KBBA 3TT1L 4Z7OB 5FYJU 3L3KB 4ZNEA 2RB8A 4PV8A 4ICWA 1C5DB 2IG2L 3US0A 1Q72H 1Q8MA 1CGVA 1U92B 2AC0A 1NEZB 4YSDA 1CFMA 5ID0A 5JLZA 2Y5TA 2IAMC 3VFSB 3WD5L 5ALBL 1KDJA 2EAEA 4RVBA 5E4IA 1Q9KB 4GRWB 4XMPH 1JZ4A 1E9OA 2ATPA 1I1AD 3TYGL 4GLRH 1J1XH 5E8DH 5LDUA 1U58A 1WV7T 4FC3E 3RWCB 4ZTOH 2J2ZB 2OSYA 3AWEA 3CDZB 1VEOA 1WD8A 2NX5B 1LO2L 2WSDA 5FM5M 2IH1A 4AK2A 4S1RH 4DVBA 2L8AA 3G6DL 5LBSL 3MRBB 4PJ7A 5CJ8A 1TOXA 1WO2A 2X87A 4YPJA 3SPHA 1LYQA 5BQ7B 1QMUA 1WUNT 1I8IB 4BRVA 2J8UF 2XPGB 3DSFH 1UJ3B 3ARGA 4O2CA 1RHHA 1HT6A 3BVDB 3MOQA 4CADA 1RAMA 3VSVA 1KYDA 3DROA 2XN1A 3ISRA 3WENA 2AVGA 1KG0B 1UZ6E 4Y9FA 4M43L 4F1SA 5AB1A 4IU2B 5AW5B 3EDEA 3JT0A 1NEZG 4WEMB 4JZOB 1YEEL 4DT2A 4X5XA 3BMWA 4WAFA 1BMGA 4NN7C 1JFHA 2HKFL 4XMKH 2X4SB 5AAMA 4KBPA 1G6RL 4KI5D 2SEBA 2XQ0A 4JFQA 2YQGA 4NS0A 3RYMA 2Y9RT 4ENEC 5FYKD 3AS0A 4GKZA 4JPQA 3V0WL 2YUVA 4ZUWB 5BV7H 4HMEA 5C92A 2DM2A 4AGLA 5E2UH 2H4EA 4AV5A 3K72B 1KFAL 2GSIB 5F9JB 4FNUA 2K4AA 2J56A 1JF6A 2OJ1A 3FSZA 4KQ3L 4X4XA 3BZ4A 5EO0B 5JIPA 1X4XA 1BV8A 4YK4C 3EHBB 4PJ8A 5IB2B 2Z1KA 2KZKA 2XA8H 3NCXA 1N4XH 4H88L 4P3WA 5GHWH 2Z31B 3K91A 5TJWK 2Q7NA 3GDCA 3TEXA 3HCVA 1NPUA 1KEMH 3PUCA 3TPUB 1A6TB 4JR9L 2RFXA 1SN2A 2BSED 3FSAA 5HDRA 2GJZB 3IMTA 5IMMB 3D39A 3BKYH 3HE6C 1A4KB 1ZD6A 1EFXA 2W0FB 3LIUA 5GRUH 3X1BA 1A3QA 3SKMB 2QQLL 2H1PH 4JB9H 1AMYA 4P8QA 2HLFD 4RAHA 2BMKA 1A6ZB 1SHXA 4I2XB 3B1UA 3MLVL 4BA8A 2H32B 1AYRA 3U0TA 3U9UB 4PGJA 2ZOWA 3LZPA 3K5SA 2RTTA 2DH2A 5LN8A 3SO3C 2F1AA 5EFIA 4B6ZA 25C8H 4QXUL 1KTDB 2H0EA 3KYKL 5INDB 3NA9L 2VLJA 3KWTA 4DERA 3GSUB 1TQTA 1T1XA 4IJ3B 4OFQA 4WNJA 2WXQA 2G4GA 4L1LA 3RNQB 3V0VB 4Y19D 3KBFA 2FD6L 3QT2A 1F0LA 4WCYL 2J8OA 1IAIH 5JUEH 1U0QA 2LU3A 2J12B 2WBJB 1UWEH 3LS4H 4PS7A 3UJJH 4EPSA 3LXUX 4ZSOB 1SJMA 3SY6A 2A6KA 3IJHA 4WI7A 4YDVA 1D9KB 1YN6B 2ZP9A 3BP6A 4U49A 3CN2A 4FZEH 4U6HB 3A6BH 3SPJA 5I24A 4UTAH 3AADB 3RWIA 4PV1C 4QHLA 1YQ2A 4LT7A 4LCYA 1JNLL 2VDKL 1BREA 1JVOA 3DGGA 4WLCA 5KVDH 5DUMH 3ELAT 4WO4C 2VWEE 4X8XA 3QZPA 3SYCA 3GSNB 4KX8A 3I2CL 4R4NC 1XGUA 3MJWA 3E80A 1OHQA 2WQVA 3PY9A 4W9IC 2P8MB 4MCMA 4G3YH 4GUQA 1XH3A 4NOBA 3QAZC 3BQUA 4MQ7B 5DWUH 4K3HA 4FEIA 1WC7A 2H2PD 1K2DA 3W9DA 2QVTA 2Y22A 5ETUB 1HOCB 1NGWB 1SQMA 4KO5A 4Y9EA 5D7JD 5I1HL 1TZ8A 4EOWL 1P2CA 4NGHH 3HG2A 2N1KA 2X7LA 3ORJA 4GAGH 2BNRA 3NEXA 1R34A 4MS8C 3IAPA 3KJ6L 4LDOB 1SLXA 2PCPB 3FQTA 1P5UC 4JFXA 4XVUC 1D5ZA 1MCNA 4XN2A 3L4VA 3CDGA 3N9GL 4ALAH 5TDOA 3ZUNC 4QCIA 2P24A 2RACA 3L4XA 3VXRE 4HG4K 1GY2A 4ZFZA 1CLYL 1G4RA 3DRTB 5AB9A 1B3IA 2C4XA 2DQEL 2XRAL 3HMXL 3OJMB 4UQEA 3S88H 4AEIL 1HZLA 3UFIA 1MJ8H 3O6KH 3QJXA 1OZTG 4ZXBB 3V4VA 3PJSA 1IGTA 4Z3TA 4BFJA 2NLJA 1SYVB 1U2YA 3L3DA 4NRZB 2V8MA 1I3VA 4EI5B 2O72A 4BCYA 3FT9A 3RUGA 5F97E 5CJXA 4L8CA 1DP0A 2V17L 1V05A 3ARSA 2JFCA 3ZE0F 4MTMA 2CDFB 2HT4D 3NZ8A 2WUCH 2WBXA 1ROCA 2YD0A 1CDUA 3EO0B 4I3SL 5CU5A 4KUZH 4HK0A 2IALA 3C9NA 1QYGL 2XZZA 4K15A 5EF3A 3L3KA 4J6RL 3B43A 3Q5OA 4OLEA 2Q76B 4KX7A 5D1ZB 1BM3H 2AGJL 1C5DA 3L3OB 5A7EA 2O5YL 2L3BA 1NEZA 4WY7L 2VDNB 3RNKB 2H2SC 1MAMH 1G7MB 2BWIA 1IM9D 1DBML 1Q9KA 1JGLL 3DX8B 2CKBB 3RFZC 4RX4A 2FVNA 2JJVA 4J3XA 1I9JL 3RWCA 2WAQA 4CMHC 2J2ZA 5HHNB 3N44F 2NX5A 5ERWB 1JZHA 4DKFH 4OD3H 2ZUYA 2OL3B 3BH9B 1YJDH 3MRBA 1AH1A 1W72H 2JKWA 5BQ7A 3GSQB 1I8IA 1EUTA 4JDEA 2YLKA 2V2XA 4OJAA 4D9RE 2XPGA 1U8IB 1UJ3A 2VH5L 5C09B 1NLDH 1B4LA 5MP6H 2DWXA 3U4AA 4U1KA 4L3CA 2ICWJ 1DQKA 2DDQH 1XCWA 2XVGA 4NZUL 4UM9B 2P9RA 3NFPB 4TUJB 3LNFA 4HUCA 4NN6B 1INQB 3NZHL 1CGSL 2ZCHL 3HR5B 3BP4A 3V7AE 4ELMF 4IBVA 2JELL 2OJZL 4GG6A 2X4SA 3MRKB 3WJJC 1J48A 1LJMA 3N50A 3KS0J 1JG9A 4PJIB 3LZQA 4ZUWA 3AGVA 2XN9E 1MFDL 4XO8A 3QUMH 1UWGH 4CSSA 3JXAA 3K72A 3RDTD 2GSIA 5DHVB 1HE7A 3MODL 1ED3A 1L7TL 3RTLA 6FABL 4R2GB 4OF5A 3KG5A 5EO0A 1UD8A 3PWNB 4BGDA 4LASH 4GI6A 5IB2A 2OSLB 5I1GL 2MNWA 2F15A 2Z31A 3VU2A 3TOPA 3CH1A 1G9NH 1UD6A 5I8EB 3TPUA 1A6TA 3WFBL 2B3IA 5E70A 1EXUB 5IMMA 1ZE3H 5DC9B 2Q9OA 1A4KA 3DBSA 2W0FA 3IJ8A 4MLIA 5EZJA 2C9XA 3UOAB 3ZSTA 1HINH 2XZAH 1F3JB 3SKMA 5DO8A 1W0VB 2CM6A 2R4SH 1MWAB 5IHLB 2R2EB 3EYUL 3JV4B 1A6ZA 5GS2D 4I2XA 3X11B 3TO2B 4EVNB 2H32A 4F7TA 1EO5A 1MWOA 5EUOB 3U9UA 3PAZA 5IGXL 4P05A 2IWFA 2QADD 2WWMD 4P46C 4NZDA 5EC2B 3VXRD 3BWZA 4X2UA 1KTDA 2KH2B 4JGJA 2BCMA 4NI6A 4KXBA 2IANB 3MLXH 5F21B 5INDA 2HB0A 5HYIA 1WYJA 4JFOA 1JP5A 2R0LH 3UACA 3JWNH 1S7RB 1QBML 3L2LA 4L8BB 2Z7ZA 3V0VA 1CICB 1KTRL 2YD7A 1ZVNA 2RH0A 3MAWA 1LK2B 5D2NB 1WAEA 2B20A 2JIXD 3X17A 2P26A 1A0QH 4Y5VB 2W0PA 2CD0A 3A67H 4OF6A 4WUUE 4ZSOA 3VD4A 1QWNA 4QD2E 2DLFL 4U6HA 3RGVD 3QCUH 1W8EA 4K8RH 5J7CC 4XHJC 3V4LA 5MENE 3QXVA 5FC9A 2FT7A 3WMSA 3RVUD 3NG5A 2VMDA 2HKHL 3E1ZA 4OCSH 3U30C 4FTVB 4OF0A 4CN6A 5TE4L 3UPAA 2WIIA 1T5XB 2BW4A 3QIBB 3ZE2B 2PW2B 3CC5B 1ZSDA 5IHZB 5GS0C 3O45A 2VQTA 4P59L 2P8MA 1DQML 2MWCA 2BC4A 2F2HA 2R8SH 2W88A 1K8DA 2DPKA 1U8JB 3DHMA 1E8YA 1NOLA 4MQ7A 5E99L 5J12B 3WG7B 4FMFA 2O5XH 5I17B 3M1CA 3OB0H 1PLGL 1HOCA 1NGWA 1MSPA 4UIMB 3AS3A 3QUYC 3GB7B 4HC1A 2DMHA 5B4MC 4JPIA 3KJ4C 2PWDA 4UILL 3ESMA 2O5ZH 3CSBA 1SZNA 2DM3A 1IGJB 3O2WH 5DJXB 5KJ4A 3UO1L 1HJBC 2QPEB 4N6RB 2UY7B 3L5IA 4YHOL 3MGTB 2OR9H 1KXVA 2OCJA 5F2FA 3BN9D 2BSTA 1BQLH 3CG8A 5I6XB 1IGIL 4L2LA 2CKNA 3N40F 4JM2D 1QI3A 5I8KL 1UOWA 4LEBA 3QG7H 5TFSH 4NKIL 1SJXA 4OW6A 3PUUA 1LNUB 1VPOH 3OKEB 4D9RD 4YR6B 3DRTA 4HPOH 3C08L 4F20A 1E3ZA 2GQHA 5L2KE 3DJ9A 1J87A 4TL4A 2EXSA 3LXCA 1LO3L 1HYSD 1HCYA 4R5VA 4HS8L 4ZXBA 1KN4H 4NRZA 4WW2B 4EI5A 3LNGA 1V3LA 2HG0A 1MEXL 3PHAA 3QIUC 3KPTA 4TQPA 3EXLA 4Y5XC 5AW7B 4DO6A 2DZEA 1Z1WA 2HT3C 3B2UD 2WXHA 3HE7B 3TBSA 4ANKA 2X4PB 4OZ4A 2F18A 1J9RA 3GM0A 4U3SB 1S46A 4MZRA 2CDFA 2OTUA 5DJDB 5HGAB 3QO1B 2DYPA 2I60H 4HULB 1R47A 4PLOB 1QTSA 1ZTXE 2QSQA 2XN9D 4LIQH 1DEDA 3LIZH 5HDLA 3OR6B 1ZSHA 1Y6MR 3A4EA 4O4YH 4QDGA 4LCCC 1IKOP 1KCBA 1MHCB 4Y1TA 3X2QB 2Q76A 1VZGA 3G5YB 4S0SD 1PKQE 4UMSA 1XGRA 4H2CA 1U91B 1NAMA 2OMTB 4FA6A 4W9LC 4LU5L 2ED7A 5I5RA 2ZWYA 1AQDB 2Z92A 4HXAH 3GMLB 5GISH 1RZJH 1F90L 5E8NA 4ZODA 3RNKA 5ABZA 4W6XB 5D70L 1RERA 1G7MA 4JQIA 1MFCL 3MLWH 1DSFH 1J8HD 5I1AA 4Q6IC 3KYNB 1C12A 4ZAKB 3TO4D 2A9NH 3GI8H 3IU4H 2J8UE 1OTTC 1OALA 4MDIA 1C8QA 1WZAA 2E9BA 5CR8A 1S9YB 3RAJH 3VG9C 8CGTA 2JKIS 4XMUA 4M29A 3WFZA 4OD2B 5IB4A 2GTZB 5TGBB 2OL3A 3BH9A 3CUPB 1E43A 4RSVA 5EN3A 4ABWA 3GSQA 1TJGH 3KL3A 1SEBA 4ABVA 1QG3A 5L8JB 3APFA 1TDQA 3QCVL 1X5ZA 1U8IA 3QDAA 4GW4B 5DHDA 4HUUB 2C3HA 5C09A 1KWGA 1IBBA 3NRPA 4X6CF 2FIKB 2IH3B 1JGEB 1IJ9A 2HVJB 3ILEA 1QATA 1QZ1A 1DVFB 5LNDA 3HI5H 2ZUWA 1Q9LB 1NMCC 3MLZH 3TA4D 2GK0B 1NKGA 4TUJA 4Q56A 4A39A 2YRZA 1DVQA 4L8SC 1S2EA 4GXUM 1INQA 5KYUB 1RZFL 4WUUD 4ODBD 2Y7LA 2I27N 5I6PA 3HR5A 4XPFL 5EBMA 2V37A 3WTUA 3ZTNL 4N2GA 3FU7A 3QIWA 4HDIB 1SDDA 1BVKA 2HRGA 3MRKA 4QRUB 5MEND 5K5YA 4PJIA 5GS0L 2PXYB 4K5PA 1BEYL 4MZIA 3DX0A 3ARUA 4HWBL 1EHLH 4AEHH 3TCTA 5DHVA 5EO1B 2A6JB 4P9HC 4H25B 2BW5A 3PWNA 2FHBA 1KTLB 4B41A 3BLBA 3NT0A 4MMYB 4S1QL 2OSLA 4OF7A 4JG0H 1P1VA 4EJ1C 2QV4A 4UYPA 5EBGA 2E6JA 4QHMB 1H3UA 2DWYA 1EXUA 3R1GL 3KXFE 2HLAB 5JHDE 2G5BB 5FS5A 5C0EB 4JKNA 3RWHB 1FNAA 2ITEA 3T09A 5IWLA 1W0VA 2Q7YB 1YECH 2MOGA 4JREB 3PAYA 1EJ6A 4OFDA 2R2EA 3L9YA 3W39B 3JV4A 2H1LM 2MSPA 3QULB 1R0AL 3X11A 3TO2A 4PJAE 4EVNA 1MF2L 2B1AL 1A7NL 2ZWNA 2CZNA 4L4TB 1DJGA 1KGJA 2E9WA 3U25A 3RWJB 2ICWI 5EC2A 2QFPA 5CGMA 1WPCA 2NT1A 3HIZA 1BFOB 3HBPA 2VDQL 1FJ1A 4I1PA 2HFFA 2DQHL 4KJPC 2C8NA 5HYEA 5L2KD 3P9LB 5IQLA 1S7RA 2E7DA 4CDHA 4L8BA 2R51A 1CICA 2VMCA 1E8ZA 3SJVB 1W80A 4FFZH 5D2NA 1LK2A 1CTOA 2PR4L 4UTBL 5D4HA 3QI9C 3UBXB 3L4UA 5K69A 3BE1H 4MNGE 4Y5VA 3CN3A 5DD1L 3WJMB 3KDMA 3EUDA 4WK0B 2BP8B 4A38A 4AE0A 4CSZA 1FHGA 4YNYA 4JO3H 2Y23A 1IX2A 2FZ3B 5T1MA 5JR1H 1YYML 5ESAB 3QJFA 1ODAA 3CZFB 3X3FH 3ARBC 3E7JA 2W9DL 3WTSA 4FTVA 3TT1H 1GC1H 1CF8L 2CDGB 1I3UA 2PW2A 3CC5A 3MCLL 1RUML 4GT0A 1HKLL 1XTLA 4U6YB 3L6FB 3TASA 3EDFA 4ZMLA 3K8MA 1U8JA 5F1IB 5IQOA 3PXJA 4I9XA 3BSHA 5E2JA 1I31A 3LXAA 3T3PB 4EIUA 4UIMA 2KLSA 1MHHA 4TNWF 1TEGA 3B3IB 3H42H 3GDBA 3QNZB 1KLGB 4B9KC 4IIQB 1F4YL 3AREC 4PR5B 4KROC 3DIFB 3CPLB 3PPEA 4FN0A 5DJXA 4N6RA 2UY7A 4CN4A 3CZJA 4ZW5A 4ACTA 4OFYA 3MGTA 1DO5A 4L3EE 2FJUB 3G6DH 3EH5B 3QYCA 5JHLA 5LCVA 2B1OA 1OB0A 1UKSA 3QQDA 3VSTA 4JRYB 4WZ9A 3DJTA 3OKEA 2EDNA 5GQBA 3KPSB 2BNUB 1CLOL 3N42F 1F97A 1DL7L 4CC1A 4PQXA 3FTWA 4IRSB 5B1CA 5I74C 5IM7B 1FGVL 3N0PB 3DLQR 1HZKA 4PJCB 2YUZA 1CK0H 4M43H 4N8VB 2GJ6D 2X4OB 5IROD 2D0FA 1ZY9A 3HE7A 2Y6SC 3WTTA 2X4PA 5AVYB 3N5AA 5LAXA 5E9AA 4PSRA 4LSTH 4U3SA 2HKFH 4FMKA 4NT6A 3LEVL 1RK1B 4OLWH 2ITDB 3QO1A 5FXCH 3QEGL 4P9HL 4B3EA 3VDCA 2ZIDA 1QSFE 1BBDH 3OR6A 2ROYA 1MH5B 5LJYH 4DP6X 3T5WA 1MHCA 1KFAH 2D7MA 4JHAL 1OP4A 5I2IB 4XBEL 4KQ3H 4RMQA 4NC1C 1SGKA 1U91A 2OMTA 2VISB 2NY0D 3SGKA 3HBZA 1I53A 4NM4L 3TS8A 3LOWA 4DJMA 2DTMH 3GMLA 3I84A 3RZCA 2ADJA 4JR9H 5EUKB 4DTGH 4YPGB 3KMDA 4Z5RB 2C3GA 1EVTC 3K71B 4TTDD 1QRNA 1U3HA 2BM3A 2DQ6A 3UAJA 1LE9B 4N8VG 2VE6B 2ITFA 4NEHB 5D7LD 2H9GB 2VQ1B 3FN0L 43CAB 1R3JA 1S9YA 4UV4H 5D4JA 4NN5C 2Q0ZX 1NUFA 1OLZA 1MVFA 1X9UA 2P5WE 4HCRH 2FUQA 4OD2A 4P4KD 4IBZA 4N86A 5TGBA 3FHAA 5AKSA 1ZT1B 3BUBA 3FFDB 4PB9H 1Q1JH 4QXUH 3AFLA 4BEIA 3BGFC 4ZNCD 2A5UA 3KYKH 4GW4A 1ZANL 5HSFA 3SPVB 5JPNB 1JK9B 4HUUA 2FIKA 1LWHA 2IH3A 1JGEA 2HVJA 1E2WA 4K3DH 4NUGL 5IJKC 4R4FH 1Q9LA 1TCRA 3ZTEA 4C57C 4ODTL 1CLZH 4FQLL 2GK0A 4LOUC 5KOMC 5MERB 1OVZA 4WCYH 3ASNB 1ORSB 3LNEA 4UIKL 1UTDA 2R69A 4GRLB 4L8DB 5C0GB 2AK1L 4L3FA 1BX2A 2WO4A 5JW4Q 1IAIM 1P7QD 4HDIA 4PTUB 4QRUA 1E4WL 1BVZA 4IS6B 5BO1H 4G8AC 3E8UL 5K1NA 1DUYB 4HUMB 1KYUA 2PXYA 4M3KB 1JNLH 2KZWA 3MKGA 3EDJA 4HU8A 5BJTA 4Z8FH 2EADA 3Q6FB 2N0MA 3DECA 1KB3A 3A22A 3IPEA 3WAJA 2FB4H 5EO1A 3RJQB 3HUJE 1J05B 4UAOB 1OAQH 2GKIA 3VFUB 4H25A 3CHPA 1KTLA 5FWRA 3I9GL 3MUHL 4MMYA 1QTPA 5LXGL 3C09C 2TSBA 4B27A 3RVVD 2MKLC 4QKTA 5CUSH 4DKEL 1VDGA 2VUKA 2NQCA 4EIGB 2E7MA 4QHMA 4B0MM 1JYNA 1J5CA 4TNGA 4F5CE 2G5BA 5C0EA 4TNVK 2DJSA 3RWHA 1L5GA 1XIWD 2UXTA 3CIQA 5AVQB 3W39A 1FFOA 4BUQA 5HVFB 5LXVA 3QULA 1MCCA 2XBTA 3AM8C 3CU1A 1LE5B 4L3ED 3CLEH 5IVXF 1BF5A 2NXYC 2G60L 4L4TA 1GVIA 4QRPE 3RWJA 3BZFB 2DQIL 4ETQA 5DT1H 2WLLB 4F2FA 1BFOA 4NBXB 4Z0BL 5EULV 5KAQF 2CWRA 4YVUA 1AP2B 2WGNB 4POYA 4ODVL 4NXKA 4WV1B 4A6YB 2I07A 1XD0A 3IS0X 3TXAA 4MQSB 2YMXL 4UT6L 4FDWA 1P9MC 2X09A 4XB8A 2E9GA 3W3BA 3SJVA 4K5MA 5C07E 4PYHA 4PJEB 1O7SA 4B9PA 3WJMA 1BZ7A 3QFDA 4M7JH 2WLHA 4KXCA 5KJRH 2ZWLT 3SDXB 5MI0C 1EBPA 4HGKC 5BXFA 4IHOA 3NIGF 4R9HA 3II1A 4F57H 3FMGH 5ESAA 2X44D 1XMWA 43C9B 3L17A 1E42A 1QSFD 4HOXA 1WBXA 1QX1A 3MHZA 4LEOB 4L05A 4AQ8C 2QZQA 1WS8A 3PU7A 4MCZB 4NUPA 2YJLA 1DVXA 3DHJA 5DJ2B 5CP7B 1FFNB 3KPRB 4J6RH 1INEL 2CDGA 5FM4A 5HYJA 4JS7A 1QUPA 3VD0A 4U6YA 5AVRB 2AGJH 3L6FA 4KH9A 1FZKB 1NQBA 3DO4A 4OCRL 1NCJA 5F1IA 3BT2L 4GUPB 4WY7H 4U05A 4FQ2L 3TCXA 5A6MA 4TSBL 1KSRA 1DBMH 4XOAA 1R75A 3GZPA 4LRIC 3QYNA 1AQKL 5AVXB 2WK2A 1KLGA 1RULL 4IIQA 1CYWA 3U2SB 3VQLA 3CPLA 3CZUB 5CILL 2P5WD 4RMTA 4JNXA 1IBGL 1EXGA 5IREA 3TT3H 1YEIL 2XKNA 2YN3A 4LOFA 3TN0B 4P5SA 1A1MB 1G7QA 1EANA 2VH5H 4KV5F 4MAYC 4LPVA 4UT9L 5CNHA 3JT2A 3NCMA 4Z1PA 5KYWB 4E9TA 4G1MA 2YAQA 4N8VA 4ODUB 4BFGA 4CC0A 2F8XC 3UIYA 2PO6B 1YYCA 2X4OA 2KPWA 3BUYB 2QVMA 3EG9B 3GSNH 4NUQA 5FYLL 3SQRA 3W0WB 2WQRA 3NZHH 4M48L 2ZCHH 4Z95H 2F68X 2Z8VC 3QJSB 3SHSA 1T3FA 1IU1A 1E9QA 2CE6A 2EZ0C 3G6JF 4XTRC 1ONQA 4JM4L 2ITDA 4WFHE 3FL7A 2NY3C 3CCHB 1WGOA 2DV6A 4CGTA 2VXVL 3IF1B 4EZKA 3D8MA 3V5DA 5CS7A 5MHSD 3D25B 1MH5A 1SDAB 1Z9NA 4K9EC 5T5NG 3UDWA 3EYSH 4WWID 3R4RA 4DEWA 4CJ0A 2VUOA 3CXHJ 3MODH 2TRYA 4HC1H 3L5HA 1C9SA 6FABH 4NQDD 4O9HL 3B2VL 4QIRA 1KYFA 2R4RL 2KDYA 2VISA 2F0CA 1AMXA 2IV8A 5I1GH 4CAGA 5EV7A 1WAAE 2D73A 4OJDH 4UU9B 3UJTL 3WYRA 2R7EB