1OF0A

Crystal structure of bacillus subtilis cota after 1h soaking with abts
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
509
structure length
502
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SPORE COAT PROTEIN A
publication title Structural Characterization of a Bacterial Laccase Reaction Cycle
rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 142
structure length 502
sequence length 509
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1of0A03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1of0A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1of0A02
2R7EB 3WKPA 1SF5A 1BEXA 2ZXWB 4KOCA 1AS7A 1J9SA 2XV3A 1SHWA 1M9WA 4BWUA 1OE1A 3ASOB 4F2FA 2DWSA 1JZEA 4HCIA 4HCGA 4X4KA 4N4YB 4PAZA 4BDVA 2EINB 1MG2C 2Y1AA 2XLLA 3ABLB 4MFHA 4AZUA 3UGEA 5D4JA 5B7FA 3MBWB 3CVBA 3UAAA 3UACA 2UX7A 1JZIA 3D12B 4YSRA 1GSKA 3T6XA 1ET7A 3AW5A 3TBBA 4P5SA 2YAMA 3H4FA 1ZDSA 1PCSA 2GHZA 1X9RA 6PCYA 2VSMB 3NT0A 3KW8A 5D4HA 7PAZA 1HFUA 4HZ1A 3X2QB 4G7QB 4DPCX 1CURA 2YAEA 1L9RA 5AFAA 3NSDA 4HCFA 1N70A 3WIAA 4G7RB 1PAZA 1E5ZA 2GC4C 4E9TA 2J56A 2AVFA 1YLBB 4NB7A 2HXAA 2FQDA 3S3BB 2GSMB 4BK5C 1HAUA 4KNSA 2Y69B 5B3SB 1PF3A 2AFNA 2BW4A 1DYZA 2FNWA 1MG3C 2JFCA 2XVBA 3GDCA 4ZK8A 3UABA 2BWIA 2HX9A 3QJRB 4A67A 3MX0B 5PCYA 2PPEA 1WS7A 4YSDA 4DP8X 3IBOA 3NJJA 1BXVA 4CSPA 1KCBA 2BHFA 1J5CA 2I7OA 1IKOP 5ANHA 3T71A 2WO3B 3IEAA 2DYRB 2A3TA 2XXGA 2IDFA 3OQRA 3PAVA 1XB6A 1A65A 1KBWA 2UXVA 1L9PA 3AZUA 1RCYA 1L9QA 3S3CB 3PPSA 1AR1B 4P5RA 1CC3A 4AKQA 1SHXA 2YXVA 1AZRA 3X1FA 2Q9OA 1CYWA 5F7BA 4AX3A 5PAZA 4BXSV 1AQ8A 2I7SA 3FQYA 4A2DA 3CVDA 3EH4B 5B7MA 3ERXA 1AANA 1V55B 3NP3A 2YAHA 2HRHA 4K9JA 3CZUB 4KO6A 1KGYE 1ZIBA 2I85A 3WNIA 1NIEA 4UANA 3X1GA 1OE2A 4YSPA 2EIJB 4PCYA 1CYXA 4E9WA 4Q89A 3AG4B 1JOIA 3CG8A 1L9OA 4BWWA 1PLCA 1I53A 5I6MA 4AKOA 1E5YA 3FS9A 2BZCA 2IWFA 1J5DA 1ET5A 1BYPA 3S8GB 1TU2A 4W1TA 4KNTA 4YVNA 3CDZA 3NJLA 4JHVA 1PLAA 4AKPA 2CBPA 1MZYA 4TXVB 1QHQA 2HZHA 1OE3A 4RH4A 3X1BA 1AAJA 3TA4D 4YSQA 4CSZA 1CUOA 1NDTA 1ILSA 2X87A 4DP0X 4BDVB 3IN2A 4YL4A 1TEGA 2QPEB 4JHUA 3FU8A 3QJTB 1WAEA 4YSSA 5B7EA 2BP0B 3S3DB 3OMAB 5I6LA 3T6WA 2IH8A 5E9NA 3PAUA 1NWOA 2UXFA 2XYBA 2PPAA 4GP5B 3SBPA 4BXVA 1MDAA 2IDUA 1RKRA 1ADWA 1JXGA 3IN0A 2UXTA 3NJMA 4JKNA 5I5IA 2IDQA 1KDIA 1UATA 2IDSA 5B1BB 5I6KA 1OF0A 2VW4A 2W88A 1BXAA 1QNIA 1R1CA 2TSBA 1AZCA 1NICA 2OJ1A 1SDDA 3KW7A 4EF3A 2RACA 4DP7X 3BVDB 3GXUB 1EHKB 1AZUA 5TK2A 4DPAX 1AOZA 2IH9A 3PXLA 4UAHA 1ILUA 3NP4A 1A4BA 4Q8BA 2QT6A 2VN3A 2DV6A 3PAZA 2R7EA 2CALA 3FPXA 1T5KA 2YXWA 3X1EA 4G70B 4DP9X 1SF3A 2GI0A 2XXFA 4DP1X 1GY2A 3FSVA 2FJSA 3FU9A 4A68A 1AG0A 2QDWA 1JZJA 2ZWNA 2UXGA 1ZDQA 1JZHA 1ZIAA 2PP8A 3GYRA 2YAFA 2OCCB 3TASA 2VM4A 1AACA 3QJSB 4YSCA 7PCYA 3SBRA 3AG2B 2LLNA 5B1AB 2IWEA 6PAZA 3NSCA 2YQBA 4FA7B 2PPCA 3QPKA 4E9YA 4KO5A 1AG6A 5I26A 3OD3A 3TBCA 1HAWA 3EF4A 4NAJA 1NIAA 2P80D 1J9RA 1WS8A 3QQXA 1B3IA 1ASPA 1BAWA 1SFDA 1FFTB 4YSUA 4A2EA 5F7AA 3RYMA 3ASNB 4E9RA 2PP9A 2YAQA 5D4IA 4HIPA 3G5WA 3T9WA 1ASQA 1BQRA 1M56B 3AG1B 1JVOA 2XV0A 1IUZA 3ZDWA 1ZPUA 1F56A 3FT0A 4GP8B 5EHFA 4WKXA 2FQFA 1GS7A 1NINA 2GB2A 1QLEB 2IWKA 3EH3B 5TK4A 4GXFA 1NPNA 4YSAA 2XV2A 2AZUA 3T6ZA 2Q5BA 2XU9A 5FC9A 3T6VA 4DP5X 3DIVA 3CDZB 1PMYA 2VMJA 3WI9A 1W8EA 3FQ1A 3ABKB 3ZX1A 2ZOOA 3FU7A 2VSKB 2GBAA 3NJNA 1NWPA 2YARA 2H47C 1A4AA 3NJFA 3NJIA 3EHBB 5AZUA 2PPFA 2X88A 3ZBMA 1GS8A 4DPBX 1NZRA 2E86A 3WKQA 1PNCA 2BW5A 4YSOA 4QKTA 2W8CA 3FYEB 3UADA 2XX0A 2HX7A 2P80A 3NJHA 3FQ2A 4KO9A 1W6WA 3FPYA 4WTQA 1V10A 1L9SA 3PLYA 1NIFA 2BZ7A 1WA2X 1AZNA 1N68A 4F7KA 1PZCA 4E9XA 4ENZA 1SDDB 1TEFA 1PZAA 1BYOA 1PNDA 1W6LA 1ZV2A 3L45A 3N55A 1JVLA 4DP2X 3X1NA 2WSDA 4A2GA 1PLBA 2YAPA 4A2FA 1XB3A 3ABMB 1A8ZA 3PCYA 1NPJA 4F2EA 1DZ0A 3AG3B 3H4HA 5I6PA 1OCZB 1V54B 1KCWA 5I6NA 2BP8A 4KO7A 3ABGA 4E9QA 1J9TA 1VLXA 1OCCB 2VW6A 2BWDA 3NSYA 3V9CA 3C75A 3NJGA 4QLWA 3HB3B 3QJQB 3WG7B 1M57B 2FTAA 1GS6X 3DKHA 4G72B 2JXMA 4GP4B 4DP4X 1WA1X 5AKRA 1BQKA 4DP6X 1AS8A 2JKWA 3FSWA 1SNRA 2PLTA 3UAEA 3CVCA 2QDVA 3TU6A 3OMNB 3JT2A 2BP0A 1KBVA 2AZAA 4GY4A 1EZLA 2DY2A 1BXUA 2OV0A 2DWTA 1SFHA 5I28A 2N0MA 3NYKA 2CCWA 2QPDB 4YVUA 1KV7A 2GIMA 3WNJA 1MZZA 2UX6A 4KOBA 1NTDA 2FT6A 9PCYA 2J55A 1JZFA 3S8FB 2FQGA 3ZIYA 1GW0A 2XUWA 1IBZA 5A7EA 2FT8A 2HLEB 1E30A 1AZBA 3EH5B 3OM3B 4A2HA 1RZQA 1WA0X 4KNUA 2GC7C 1E65A 1ID2A 4M3HA 1OCOB 1X9UA 1NIDA 5I5JA 1NIBA 2WO2B 2DYSB 1GY1A 1ASOA 2CUAA 2CJ3A 1KYAA 1FWXA 1OV8A 2XX1A 3OMIB 3FU7B 3AY2A 5B1JA 1A4CA 2MRYA 1JERA 1L9TA 2HRGA 2B08A 2PPDA 4A66A 2FT7A 4NERA 5I5MA 3QJVB 2PCFA 4G7SB 2XWZA 3SQRA 2CAKA 2MTAA 2IDTA 2B3IA 4W9ZA 3IE9A 3FSZA 1IBYA 2EILB 4YSEA 4BWTA 4FAAB 2EIMB 1SJMA 5LDUA 4N8UA 1AS6A 4HHGA 3DTUB 5B1JC 2AANA 1JXDA 3FSAA 3N2JA 2PP7A 3NJKA 4G71B 4YSTA 4E9SA 4HAKA 1OCRB 1XMEB 4AI7A 1RZPA 1JXFA 1ET8A 3BQVA 4GYBA 2PCYA 2ZONA 4L0PB 5I6OA 2J57A 1URIA 4HHWA 1IC0A 2YAOA 3NSFA 1JZGA 1ETJA 4E9VA 3V9EA 2IAAC 1PZBA 2J5WA 1E67A 2TSAA 1GR7A 1OOWA 5IY5B 3JTBA 1FA4A 3QJUB 3H56A 1TKWA 1GYCA 4HALA 2BO0A 2H3XC 2H5UA 8PAZA 1A3ZA 1XB8A 2BP8B 1PY0A 2VW7A 1J9QA 4M4RB 3FYIB 2NRDA 2HX8A 1KDJA 3U25A 2EIKB 3SBQA 1AIZA 2VM3A 1BQ5A 5B1KA 3HEIB 2FWLB 4UF7C 2FQEA
chains in the Genus database with same CATH superfamily
3RVXC 1KEML 2VXUL 5SV4A 4OFQA 1NEUA 1UJTA 3HNSH 3JZYA 2IFFH 1Q9LA 2ARWA 3VRJA 3MVSA 4FDWA 3AVEA 3OZLA 5FKPB 1E3XA 3HG2A 5TE7L 4AIEA 2K45A 4H8UA 2HLAB 1OD9A 3VGBA 3FCUB 3K4AA 4G8GB 1IB5A 4K8RH 4QJ4B 2XN9E 2XXMB 3IGKA 3QEQD 1ZHLA 3UEZA 3DYMA 1S7VA 5FO7B 2JELH 1YY8B 3BXNB 1BFVL 4UOQA 5AB0A 2A73B 3KXFE 4XPHL 3U2IA 4URKA 1JTPA 1JE6A 1JD7A 2X2YA 4Z18A 1J05A 3LIUA 3ABLB 3CSPA 1N0LB 1O9WA 4Q74A 5B22A 5CSBA 2H0JA 5IJKC 3IPFA 4OCNC 2R69A 5JMRA 4KK8D 4HK0A 1BD2D 1HT6A 4BK5A 1FFOB 4P5SA 3P9WB 5AD0A 1IGFH 4K2UH 2A6JB 3HAEG 4ODWB 4PB9H 3MXVH 4P04A 5CP3H 2B4CC 2VDPL 3RY5A 2NSQA 4D9QE 5I74C 4LCUA 1HEZB 5A7BA 3EG9B 3P73B 5FUZH 3VCLA 1S9KC 5E99H 1MIML 3SBWA 3W3BA 5D93B 5GRVK 5SWSD 4IBSA 4HUWB 4G1MA 1UT2A 3JVGC 4Y88A 1XO8A 4I4WB 2WW8A 1CTOA 2P4AB 2EABA 2ZSWA 3FUMA 3LZPA 1BFOB 4Y4KA 2YGNA 3OKKB 3ETBJ 2LHAA 2OYPA 3RGHA 2CNZA 1G5GA 4HUKB 5GS0D 1NJ9A 5D1QC 1OP5K 3UCRA 1FJ1B 4JAMB 4PY7B 1TTUA 3ZHKA 1J5CA 1S9VB 5I1EL 5ITFB 1IKOP 4IRZH 5C0ND 2MSPA 1MCBA 3EJYD 2VNCA 4XGZB 1WWBX 2CIKB 4UIMA 2W92A 4J27A 5LXVA 1A65A 5H37H 1CLCA 2G5RA 4R0LB 1YEJH 5CEZH 3VXNB 3U4BH 3VSUA 2SODB 5HVGB 1A14H 4OF5A 4P5RA 4ANXA 4Q2ZB 1CC3A 3TYGL 2P5PA 4N8VA 4IOSD 3T0BA 1MFMA 4K73A 3BVUA 4YZFE 3O3BA 3REWB 2CDFB 5DUPH 1A7RL 1D2OA 1YEEL 5MEQB 4PJXE 4ZMVA 3IGUA 3Q01A 4IRSD 5IW3A 4D9RE 1O5DT 4FKHA 5IK3A 4U31A 3GBEA 1CK0H 3NP3A 1VKXB 2QKIC 3IDJB 2DBLL 1GTNA 4XMLL 4I89A 5F9JA 4I48A 1MIEH 4LDOB 2B59B 4LHUA 2EIJB 2XICA 4F9LC 3HNTH 2AEOA 4R7DB 1Z5LA 3TF4A 3I9GL 2JKXA 5I0XA 2QGEA 3NFSH 3JV6A 1W0WA 4XNZB 4YK4C 5DFTA 5J12B 4GB9A 2E46A 2BOBA 1AH1A 2BFVH 2VRAA 5E24E 4FRWA 1OK0A 1NCHA 4XTRD 5IR1B 4G8GE 3LPGA 5L8JB 2FSEA 4BINA 3P30L 1DBBH 1K8IA 3B3IB 5FOJA 1CQKA 4NQEE 3ES6A 3ELQA 4YE4H 2GJ6B 2XQBL 4YSQA 4KKQA 4K8RD 3G6AB 4X99A 3OVUB 4P2QD 4GQZA 4YL4A 5T3XE 5L6YH 2VZUA 3I75A 1U3NA 5FB8A 4CU8A 3DOSA 4AGQA 3BP6B 2XWRA 4IU3B 1WT5A 4DO6A 1DE4A 4DTGH 5CF3A 1U9KA 2YA1A 5GJTL 1U3ZA 1WEJL 5AYUH 1MDAA 5M95B 5C8JB 3VWJB 1RKRA 4HIEB 4FFYH 4M5SA 4OZGF 2ZAIA 2R69H 5A2AA 2ICCA 5EOQH 1WGVA 2XN1A 5D1QB 2OMTB 1RZGA 3AY4A 3BT2L 2XZCL 3MA9L 4HX1B 5B39G 3RGVC 1JI2A 2TSBA 3MRBB 3KGTA 1AGCA 1DVTA 2HT2D 4TNWK 3PF2A 3P4NA 1LE9A 3IDXH 4JG0H 4R4BA 3V4VL 2YPKB 3S4SB 3V6ZA 1GGBH 1H8SA 4XHQA 4ZJ9A 1RLBA 4OCRL 4QGYA 1JSYA 5F7WC 5DQ9A 4JFYA 3FQWA 4ZXBA 4MD4B 2J6WA 1HE8A 1N3NA 4QF1A 5EO9B 1RIVH 4NYLA 2FL5B 4ODSH 4G70B 4BH7A 3K0WA 2GAZB 1SYVA 3ZDZB 3ZHLA 3L4CA 3U1QA 2FEEL 1DQTA 2MNJB 1FYHB 3O9WB 3STLA 2BSTA 1F11A 5C6PB 2QVIA 3VWKA 3EJUA 4MGXA 2QKIB 1SM3H 3MRPA 4JPIB 4WLCA 3GMOB 2QR0A 1WTGT 3KVPA 1F90H 2PCFB 2R2EA 3TASA 1A2YA 3TN0D 5CEZD 2KDGA 1RUKL 3RIFK 2KZBA 4ELMB 2Z4QB 3AB0C 4K3DL 3VGFA 1AXSA 1HCFX 4P2RE 3O11B 5B21A 5I1DA 3F6LA 1JZ5A 3HBPA 1KLGA 3WU1A 5DCCA 3QCUH 1CMOA 2FIKA 4JDEA 4M4PA 1SJHA 1LO4L 2PYFA 3SE8L 1UD2A 5DHYB 3QQXA 4PG9A 2BVQB 2OJEB 4HFWB 2BS71 1CICC 3RFZB 1X4YA 3ARPA 1U8LA 3VYOA 5I1JH 3QORC 2HN7B 3MUJA 3M17A 4AE1A 5JPMB 3ARED 3FUIA 3L08A 4XH2A 5ANMA 5GS1C 5C0CB 3ZTDC 2EJ1A 4Y16D 4A7GF 1IUZA 4Y9FA 1F56A 4GJTB 4OZIB 3E1ZA 1MCLA 2FQFA 3N9GL 1Q1PA 3DX0A 1WDAA 5EFIA 5IF0B 3BZFB 4NRXB 4HYTB 3QWRA 4JANB 3SYQA 1FUNA 4JRYA 4NQDD 1AGDB 2DQUH 3T6ZA 1FRGL 3QIBD 4AQEA 4ONGL 5HI3C 1QLEH 3UTSA 3D39A 5T1LB 1W8EA 3LEXA 2GSIB 3PQYE 3U0TA 3RDJA 1U6AL 1TSRA 4C57C 2R1XB 3OWRA 4IQHA 4LFHD 5GIRB 1BBDH 5HHVH 1JN6A 3ZBMA 5D1XB 4PJBF 2N0KA 1RU9L 1QFWL 3RGVB 3LQAL 4ENED 5FLVA 5MENA 2ZF9A 4MWFB 4M61B 1HU8A 3VE0A 4BFJA 5IJVA 3DGGA 3PXJA 3MLTB 2VXVL 1F3DH 2I60H 3VFVB 1WLHA 4KO9A 1A21A 2G3ZA 4K7PY 3HC3H 1BVLB 2IPUG 3E9UA 3SE4A 4DZ8B 2A6DB 2X2UA 2OX5B 4LCYB 1M2OA 1PKQE 1RJZB 3CZJA 1MCRA 3HNVL 3NK4A 3TO4A 3S96A 2HG0A 4ABVA 1OGAA 5CU9A 1DJHA 1F18A 3ISYA 3O8XA 4DKAA 3AU1B 4Q9RL 3BEWB 3BUPA 3WNKA 1W6LA 2AEPL 4KHXL 1KCVL 2HUHA 4Y2DB 3N55A 4YXLH 2ZJSH 4LKXA 3GS7A 5F1NA 5K1JA 2BFGA 1NOFA 4JVWA 2L7QA 2P5WD 4P5MB 1QBMH 4XPAH 1IKFL 3NFPA 3ECBB 3L2LA 3U6RA 3K7UA 3QDJE 1CT8A 2NSXA 1IQWL 1KCWA 1PKOA 4AM0A 2FJGA 3NABH 4HHAA 4FNLH 1TITA 5EZIL 5I5RA 4YHIB 2CBMA 3BN3B 1L0YA 4EZKA 3EYSH 3FFOA 5EBMB 5L4IA 2DLGA 5DC2A 1EHXA 2W59A 1C12A 2JXMA 2MCG1 3SQBB 5FGSA 3TBVA 3KLKA 3QORB 3T77B 5FFLA 5AOJA 2I32A 1G43A 4ZTOL 2RH0A 2OFQA 4WUUB 2QDVA 1FFPA 4FKKA 5C0AA 1NOAA 2DKUA 2R27A 4LLUB 5IB5B 3V5HA 2NY4C 3O41B 2G5UA 5DJ8B 2EYRA 1D7BA 3ZN6A 3L7EB 4WK0B 4KRPB 5JHDE 3T4YB 2Z3FA 5E23A 2QPDB 4PRBA 3HKZA 5ALCH 5E2WH 3WNJA 4YHLH 4ODHH 3H6JA 4ZAKA 3GF8A 2IVFC 3QWQB 3SO3C 3B9KC 4F9PA 2J55A 4XCEA 3EYVA 2X9XA 5DGRA 4ZMPA 3GMLA 3TPUA 4XMPL 1EPFA 2MMXA 2AXJA 2HLEB 2X4UB 2YZ8A 5DJ2B 5IEHB 5HJ3A 4ODBD 3WXWH 4LHUD 2OTPA 4RZKA 1JFQH 1BX2B 2H9GA 4HPYH 5AZ2L 4A2HA 4U3CA 4TL4A 1FH2A 2P46B 1CDIA 1AP2A 1SJEA 4HFUH 3RX8A 1ITBB 1NDGB 4JL1A 3WMSA 4WTWA 4HIHB 4PTTA 2GY7B 1Q0XL 3R06A 1G7PA 2BRRH 2G2NA 3HPLB 3FQTB 5I66B 4LLMB 4WNSA 3V4VB 3BO8A 3QG6A 4LSSH 1CBVL 4JHWL 4LSRL 2YQ3A 3L3OA 4KKLD 2MRYA 5IQ7L 4H1LA 2UWEA 2AJXL 1NFIB 1RQ5A 3D5OF 1MCKA 3KDMB 4ODUA 4I0PA 2ZIDA 4M43L 1AKJA 1XXDC 4N0YL 1BVKB 4NERA 2NQDA 3HZVA 4GKSA 4ZSOB 2XWZA 5FYKD 3W0WA 1IC4L 2PWFA 3MX0A 3PG2A 1AOHA 2COQA 3MRNA 1JWUB 1VADA 3HI1B 3HRZA 1SMAA 2J7LA 4JG9A 1RPKA 1V5JA 3SQOL 2YQ2A 3BKJL 5BQ7B 5FOBB 2OYMA 3C9NB 3RTQA 1UWXK 1IEHA 1UWFA 1KLUB 2FWOA 3T08A 4UNVA 4U6VL 2XRAH 3FSAA 2PP7A 5E9DB 1EV2E 3NK3A 2X0VA 3DRQA 3LH9A 3LS4L 4ILDA 1GSMA 2L8AA 5GZNA 3PGCB 4FQ2L 4M6AA 1FHNA 1E67A 4H8WH 3HPJB 5MEPB 3DYOA 4PJEE 1L3NA 4I9WD 3BDYH 3EFDL 4G1EB 1VF5C 4M1DH 4NP4L 4APXA 4CRPA 2ATPA 4I3RL 4X0KA 4OM1H 3QDMA 2F8IA 2FJUB 1SXSA 4WUKL 2XZQL 3ULUD 1HIML 2ESVE 2PTVA 3UYPB 5EA0H 2BP8B 4ZXBD 1RMFH 1IGML 2XIBA 3QNFA 4AUUA 3MC0A 2PO6A 4FQ1L 4UU9B 3KD4A 5A40E 4UT6A 4GUCA 2H45A 3CVIH 3EJCA 3QEHA 5C07A 5EUKA 1XD0A 5I8OL 5AW9B 4WCYL 4L8BB 4FLOA 2X1XR 5MHSD 4CVXB 2IALA 2R7EB 3ILDA 1OAJA 2LU3A 4HIXL 1MH5B 1FCGA 4XWGL 3U7WL 2EH7L 3MOBH 4S0HA 1EANA 4UQDA 4N9OB 1AGFA 2Z9TA 4YDKL 3S35X 1TT6A 3UEQA 3DMMB 3V6BR 3MLYL 1SDYA 4JJOA 3WXVH 5H37G 2LAGB 1QSEA 2CDGA 3WD5L 4B95C 1OW0C 2DJMA 1AGBA 3MR9B 3U82B 3W9DB 1BQHG 1DVUA 4FNPA 3TBYB 2ZXCA 3QEQB 1N6QL 4DGVL 3IMVA 1KXQA 3RA7H 8CGTA 1R5VB 1KGXA 4UWQB 4JM4L 5SWZA 4QTIH 5KN5A 4AEIH 1ZVNA 3F7YA 1IX2A 4KMLB 5D7LB 4GNKB 3R4DA 2W0FB 1GZQB 3GSWA 5AB1A 3T2OA 1ZGLA 4LL4A 1TZHB 1HFUA 2MJWA 4PWEA 4B3VA 1AC0A 4WSGA 3WTSA 1TQWA 2FBOJ 1XSJA 1LEIB 3HE7D 2FHCA 1PL3A 2VIRB 5DSCB 4MS6A 3G04A 3QWRD 1WFIA 2D3JA 4JRYD 3GIVB 2D7TH 4MMYA 4QHPA 5D7SL 1U2HA 5FYLH 4Q6KA 1BVNP 4BHUA 4XE0A 3UTSD 3D39D 1OP3H 4DO5A 2HXAA 5ISZB 4L3EB 1QSZA 1RFDH 1ES0B 4TLTA 2BWIA 5I19L 3QXVA 1DFBH 5T3ZE 1J48A 3QXUA 4TUOB 2V2TA 1I1FB 4L8SB 5C0IB 4U1NA 4LCWA 1QRNE 3K8LA 4LFHG 3P54A 4AGMA 1K5NA 3ZVVA 4UQEA 2DYRB 2QVTA 3EBGA 4PB0L 3RUGA 5EDXA 3LSOA 2CE6A 1KPRA 1KBWA 2E47A 3HB3C 2VDNH 3FRPA 3E2HB 3O2VH 2IBZY 2WVVA 1YUHB 3AZUA 3LIZA 3NRPA 4PD4K 4OD2B 4I18B 5CILH 5D1ZB 4XP1L 3S3CB 1K2DB 2BSCA 4LMQI 3DRTB 4QD2E 4YE0A 1RP9A 3FU0A 2BSED 3TO4D 1NGPL 5C6WH 2B2XH 5J9PA 2CBQA 3JTTB 3O8XD 3FC8A 5DZNA 1RPUA 3IFOA 4FG4A 3A67H 4LRIC 4QLRA 4KPHL 4Z0BH 3WFBH 5BW7C 4JY4B 2VLJE 1EJOH 1C1EH 2P48B 2X5PA 2I85A 3FULA 3IDUA 4IRSB 2IBZX 3HOGA 2BSRA 3MBEA 4U1JA 1LP9A 4YSPA 4B9YA 4Z7OF 3MREB 4R7VA 3OR7B 3WLWD 1ZTXH 1HYSD 3SKOB 3MKGA 2Y9RT 4M8VA 4XMXA 2Y2WA 2AXFA 3PHQA 1EAOA 4K0OA 3C5ZC 1Q9OA 1ZXKA 4A7UA 3KEDA 5DU7A 1DDHA 4L8DA 5J3HD 4XC3H 4FJ6A 1JNJA 3MLVL 5E51A 1S7XB 4JHVA 1DVYA 3DVNA 2OMVB 3H7BB 2YRZA 3K5SA 3MI6A 4R3SA 3FN3A 3QQ3B 5C0AD 1IM9B 3HBQA 1S7TA 3AUWB 3MNZA 4OGZA 4HIIB 4X8XA 2VJXA 4WU5A 3SGDI 3QEQE 5DRZB 1LVEA 3UC2A 1M7UA 3T1FA 3SOBH 2GEQA 2Q6WB 3WKYA 5HY9A 3KGRA 2MEJB 3MFFA 1J1XL 1DBAH 4GKZB 5CCJA 5D7LE 5HYQB 1LQSR 3QHZL 5A16A 2C26A 4P2QB 5D8JL 1UXMA 43CAB 2OMUB 3QQNA 3RQ3A 3LKQA 4ZAKD 3L4UA 5ICZA 3PAUA 4N8VG 1P4UA 3OSVA 1BD2E 2AQ2A 3MV01 2C3VB 1YQVH 2XOTA 4H25B 2R2HB 1CS6A 4J3UA 2IDQA 4BFEA 2GVYA 1OTSD 3C87A 1KB5A 1AI1L 1JIBA 4Z95H 3FAWA 5ISZE 1KC5H 4LHUG 5LAXB 2Q8AH 4NO3A 1EBAA 3JWDC 1NEZB 1BQLH 4QGTA 4UAHA 3BC9A 3SKNA 2GTWA 4A55A 2J8OA 3U4EA 2ZX8A 3BIBX 3CFJA 3C5SB 1QLFA 4DP9X 4I0PD 4IGBB 2R0KL 5ENWB 4TQEL 4W4NA 1LTXA 4BGLA 4XPBL 4Y5XC 3W0WD 3MUGB 4U7MA 4HJGA 4M5ZH 5FYKL 5FO8B 1MLBB 2GYSA 2ZWNA 2G5BA 4LCCB 4EDWH 1PX4A 5EO0A 5JOFA 2C9QA 4HGKC 3LEVH 4AYDC 1UJ3B 1NANH 3RILA 3EYUL 3L5XH 3AU0A 4N0UE 1S7WA 3RTQD 1FZOA 5KYYA 1HSBB 5BZWB 1BZQK 1SBBA 3JWOC 1IGYB 5CJOH 6PAZA 1WHPA 1OSYA 4FQIL 4FA7B 2W65B 4HKZA 1J1PL 5JW3L 2WK2A 3ZMEA 5KYXB 3QEUB 2XPGB 1AJ7L 2Z1KA 3WNPA 4EKJA 5CEXB 5D5MB 5GZND 5JHAA 1DQQA 2LAAA 1BQHB 1N7MH 32C2B 3BP4B 4X6BB 1PQZB 3BKCL 1K4DA 2N1KA 4A6YL 1W0VA 4F9LA 4PG2C 3A6BL 2O72A 4YGAB 4ZFZB 3JYBA 3MNWA 1U8IA 2N59A 2ZYHA 3EJZD 2B16A 1FIGH 2JJWA 4S1SL 3LDBC 5L2JA 5C0GA 3MLXH 1QPXA 3RVTC 5KS9A 3DNKA 3ULUL 1AY1H 3FT0A 3US9A 3Q2VA 1AD9A 2HVKB 3QI9B 5J1AA 2C7FA 1GS7A 3RJOA 4Z7UE 2PO6D 5IMKA 2CJUL 1FVDA 4L9DA 5INDB 4YSAA 1NPNA 2ATKA 4Z0XB 2X4QA 2K3TA 2NR6D 5C07D 2B0SH 4WEEA 3WIIH 1W8NA 4QRAA 4XNMB 5GGQH 3WI9A 4GUPB 4YDIH 1T1XB 3K1DA 4X6DA 4XP5H 3MJ9L 4I5BA 4HXAL 1QBAA 3D34A 1LDPH 3SY0B 5IV2B 2YARA 5AZUA 3S35L 3BOVA 1P9MC 3KPSA 2GUYA 4P2QE 4K4KA 5IIEB 4TMPA 2AITA 3VRJB 1RIUH 1T03H 3V95A 3ZTEA 1A6TA 4G82A 1M3IA 1QSED 1W72A 2WYZA 2VKXA 3CFDA 2HTLC 1Q9WA 1D7FA 3WEXA 1IAKB 5DD5L 1UKTA 3MLUL 4ZD3H 4G6KL 1ZHLB 1BG1A 1S7VB 3NDZE 3EZ8A 1GGYA 2Y7QA 3RL1B 2GT9B 3FT2A 2DQTL 4MZ3A 4TSCH 3IDMB 4QAMB 2NZ9C 1Z66A 4P07A 4DN3L 1J05B 4GRWE 3N43F 4OV6F 4HU8A 2B4CH 1HJBC 4Y1AA 1VFUA 4L0ZA 3WO4C 1NL0H 2NSMA 1YN7A 2PR4L 3PL6C 5A2CA 3GMRA 4M93B 2XKNA 5C7XH 3VFMB 1HL4A 1XBRA 3FO1A 3KWWA 3UTTB 1NFDF 4OGQC 4RDQF 1N8ZB 5IP4A 4F2EA 1JDAA 1KYUA 3H4HA 1JGEA 3D05A 5KVDL 4ZTPH 2IGFH 4OQ1A 4FLSA 4HLJA 1OAYL 1MXDA 1I75A 2CUHA 4N85A 1L6XA 4FFWD 3V9CA 4ZMYA 3A47A 2GSGB 3D2TA 3MRGA 4JLRB 4G1MB 5E7FA 3NPZB 4QWWC 1HZHH 3NIFF 3JWNG 1CVSC 4WU7A 3WY2A 1AO7B 1LWJA 5CZKA 4JO3H 4Y4KB 4PJDF 4FXKB 2C1OA 1SNRA 3LV3A 1NJ9B 4JPKL 4Z8FH 3IPBA 1UUNA 3T2LA 1RK1B 4GQQA 4F3FB 1OEZW 5D5ME 5EMYA 3SCMC 3BDXA 4M02A 5CN1A 2B7DT 5IWLC 4AGLA 2Y25A 5LLIC 3L9RB 2HG5B 3K2UH 4PJIE 3I02A 1CICA 4YVUA 1OF2A 1KMGA 4EI0A 2EXSA 3AMKA 5CBAB 5GS1A 5HVFB 2C5DC 3ZDYF 1GMEA 2CR3A 3S8FB 5AEAA 3UPRA 5IFHH 1KJ2H 3P3SA 4UILH 4B0MM 5B38B 3O3BB 2XFXA 1FGNL 4P99A 3UMTA 4WW1A 1SHMA 4U0RC 3MBED 4AWJC 4LLDB 5IK3B 1KJMA 2N7AA 2X7LB 4WO4C 5KJ4A 4NQDE 1ASOA 3F7LA 5HYJA 3RVXD 2E9JA 4JREC 2W5PA 1A7NL 4JKPL 2MQ3A 4IM8A 5EEVA 5HTSA 2WNGA 2WGXA 3BAEH 5ICYA 1WJ3A 5JUEH 3NZHH 4JFHD 2MPVA 3G08A 5DR5H 3DXAA 4JFOA 2BOBB 2CLVB 2PPDA 2FO4B 4KZDH 1G6VK 3WEMA 2FT7A 1LJMA 2GTZB 2VGLM 2DQCH 4G7SB 4XNUL 4FQQA 3WO4B 5AYQA 1E6JL 4ANKA 3GM8A 4LLQB 4FG0A 1A3QA 1GIGH 1K8IB 4N25A 5ACMA 1DQDH 4DGUA 3W39A 3ES6B 2ZCHH 4HOXA 3HN5A 4HHGA 3K5RA 1W72H 3SGJA 4ZUVB 4KMQA 1MIMH 1ZS8B 5DJ0B 2Y06H 5IQNA 3SYCA 4Z7NE 5IOPA 4HKXB 4G9DB 3OJDB 2V17L 3I9IA 3FQUA 1R75A 5HDLA 3ZYIA 1Q0YL 4OZFA 2AXGB 2QV4A 4M6NH 1UD3A 2FE0A 5AW2B 2YAOA 5K9OB 4R90H 2P43B 4KZCA 2XN0A 5IHUL 2NY3C 5F7NC 2BIMA 4R5XA 3ZQXA 5KSBA 4N87A 1IGCH 1EDQA 4I2XE 3T09A 4A6YB 1Y18A 1X7TA 2G9HA 1CFQA 3P4NB 1Y6KR 4F15C 5L2KB 2VDKL 3FYIB 2CGYA 2DTML 3IAPA 3NRFA 1N64H 1KTBA 1KV3A 2Z92A 5DQ9B 4IJ3B 1BQ5A 4LXFA 2CKBA 1N3NB 2NY6B 4NUJA 3J27A 1A7RH 4H1LG 4XCNB 4WJ5A 3QP3A 2WQAA 4E0RB 5AW8B 4W9GC 4BWUA 4B27A 3N41F 1TVDA 2BSTB 1F11B 3ZW3A 3GSOA 3VWKB 4JHAL 3GSQB 3CFTA 2DEWX 2GJZA 3MRPB 4KNQA 4F80A 3BPOB 2CO2A 4XCCH 3FJTA 4BDVA 2D7OA 2R2EB 4PHXA 3V10A 5E95B 2NNFA 3CZGA 3P4OA 3QQ4A 3W1ZA 2NXZC 3QUZB 2NT1A 4MD5A 4NO2B 1BYNA 4HT1L 2EEBA 4KTEL 3VFTB 1PJ9A 2PXYC 2F8OA 1T2XA 1DCLA 2BH0A 5LVEA 2FIKB 3FQ4A 2UY6B 4JDEB 4RMBA 1GH7A 4P23C 3LS5L 5ESVB 1UH3A 4TRPL 3WTWA 1Z0NA 5LGKA 2BNUB 3TO2A 1EAPA 1O6TA 5GPRA 5DEGA 1NGYB 4MNQA 2UZXA 2EZ0C 3MJ8A 5DRXA 5TE6L 2FH8A 1QLRB 1ZY9A 3V0HA 1L9RA 1CFBA 4FP8H 3KPPA 5EZPA 1FL5A 4UT6L 1KBKA 4TVPH 3VGEA 3T0AA 1FBIH 3GRBA 3MMEB 2FQDA 3DJTA 3INUH 2ITCA 1UEMA 3B2VL 1PF3A 5HVHC 2D8KA 4FTVA 5FYKE 2BOLA 1ZHNB 4PJAF 3EOAA 3HS0A 3FO9B 3KPSD 3IBOA 1WQVT 3L95B 1B2WL 3ATFA 5FGCE 1M42A 3IU4L 3DVIA 1JN6B 3D51A 5DJAA 4MB3A 3RJQB 2QMJA 4G3YL 2Z35B 2DWDA 1MNUL 1OGPA 3HTLX 5F71A 5MENB 1DANT 4IKNA 1VPOL 3JZ7A 2VLRA 4X4XA 3T6QC 2HA1A 1ZA3A 5IJVB 3RPIA 3IDIA 4PJ6A 3V52H 3UJIH 4RFOL 4XX1G 1BLNA 4DN4L 5T1MB 1GKOA 5J6HA 5I1IH 1BG9A 3KHQA 1YG9A 4P3WA 4X4MA 3RAJH 4PWKA 4I9WE 1E28B 2E9GA 3DV4A 3FNKA 2X4NB 5JXEA 3GLDA 4M6OL 3S96B 1OGAB 1ZIBA 3ULUE 3O8XB 3NQKA 3EO0A 1R3JA 2EDRA 3UO1H 3KEHA 4LASL 4HW6A 3VB8A 4LNVA 5BRPA 3AG4B 4XWOC 4LKXB 5F1NB 1LYQA 2ZWYA 1FO0A 4DAGL 3HZ3A 5EIIA 2J21A 3LCYA 5C9JB 2Z64C 3L3HA 1HH9A 3FS9A 5CINL 1XL4A 2F08A 5MHSE 3NFPB 3O4LA 2NXZB 4RESB 1CT8B 1ET5A 1CZ8L 2FGZA 4EOWL 5IKCB 1YEGL 2FJGB 5HXMA 2X4PA 5C2BL 5I1KL 4PLNC 2YR3A 3NIDE 4CC4C 2EO1A 4RH4A 5E08H 3UPCA 3WTVA 2X4SB 2JXMB 2XT1B 2X70B 4KY1H 3LIZL 4PGEB 5F93C 4JHUA 5BV7C 5TE4L 4IHBA 3VGAC 3FRPG 1CICD 1JPTH 2JKJA 4MA1C 5ABZA 1A1OB 4NZRL 1FRGH 3IF1A 4JS7A 2EYRB 3A21A 5E9NA 5KYUA 4XBGB 4JG1L 1PCXA 5HGDA 1A7OL 3QUYC 5ESQA 1ADWA 1U6AH 2DMBA 5ANME 2UXTA 3IFLH 3GSNA 4LF3A 4LSTL 3WEAA 4P57B 4PBXA 5H2BA 3GI8H 5DT1H 1MRFH 1CXIA 4OF3A 1GOHA 4BSWB 5G4OA 1NICA 2OJ1A 4OAWA 3GBNL 5HI3D 2CPCA 1HXMA 2HT4D 4JRYE 4PJFE 5DC0A 5HYJD 3O6ML 3P2DA 4IIZA 4MSWA 1SXNA 3TBWA 3U4KA 4CAGA 4KUCD 4TVPD 2H9GB 4BSVB 3UTSE 2OM5A 1J8KA 3D39E 2AMUA 1E2VA 1A4BA 4KK5C 5E5LA 5I8KL 1AP2B 4DK3A 1JDDA 1J0ZA 1V3JA 2YRLA 3FCSA 3X11B 3JWNE 1XH2A 3Q6GH 4XN2A 3WFDH 4ESKA 3R06B 3DXAD 1VESA 1YEDA 3FSVA 4YUEH 3CSBA 2VDKB 3QG6B 1OHZA 4LLVA 1JV2B 2AQPA 5T8IA 4DESA 4ONHB 5E2UL 2UWEB 1UD6A 4UM9A 4D7BA 4UYPA 3MRDA 1ZKAA 2MOGA 2YJQA 1AKJB 1CL7I 1FP5A 1H6UA 3IGAB 4Q4IA 3VXOA 1G7LA 4D0DA 3HZVB 5SWQB 2JTYA 4XN9A 4YSCA 4LNRA 4NRYB 2VMCA 4QUOA 3MRNB 1JCVA 2PPCA 3QCVL 3H54A 3NFNB 1RJCA 3FF8A 1UWGL 2ZZUT 4O58H 1WO2A 2ALWA 2HP4A 3CX5K 3ARSA 2FWOB 4RMVA 5BW7A 1FZMA 4NUGH 1NIAA 2VDML 4KQ0A 4RQQB 5HHOA 1IT9H 4BZ1L 3CDGA 4KTDL 1NBYA 4W9CC 1PYWA 1YMHB 1KB5L 3BPLB 5AOIA 5C86A 1P7HL 4Y2NA 1HINL 2AV1A 2XVKA 3MUZ1 1QFPA 1D6EB 4APXB 5C0RH 2ATPB 4X0KB 4JMXA 3US0A 2VQ1A 1JPFA 3QDMB 1FO0H 3VXTB 1DSWA 4YZFF 2V7HB 4DZBA 4MA1B 3NZUA 2ZF8A 2R0LH 4LESA 4PJXF 3DIVA 3UTQA 3VQMA 3UTZB 2A9CA 3B2PA 1P53A 3L9YA 3U46A 3ZE0B 1MREH 4JFVA 2G30A 3FONB 3QEHB 2NY4D 5C0AE 1NWPA 1A4AA 3DJZA 3MPCA 2FLMA 4HLZG 4WI0B 4BCXA 2KLTA 3LAFA 1R24A 1DR9A 1E2WA 1N0XH 4DVRL 4NNYA 4X80H 3L6FB 2WBJC 1SDAB 1CFMA 5J0BA 1N5AA 5TGBA 1AGFB 1BM3L 4ETYA 1NDMA 3ARWA 1TJXA 2E7HA 3PWLA 4WI4A 3RVUC 1QABA 2IGLA 3MCYA 1HE7A 2WYHA 3F83A 3LKNB 2BZ7A 3DX1A 4S0TD 4LBAA 2VDOB 4ONFH 1AGBB 3CN1A 5I0YA 4YHZL 4OLWH 3KWTA 1PZCA 1CU4L 3IBEA 4M43H 3E3QC 4WDIA 5ADPL 2AQQA 4L23A 1MRDL 5IQLA 4Z3EA 1AR1C 2WLJA 1ZV2A 3P0GB 3LKPB 5KN5B 1JYWA 5SWZB 3ULVD 4BFBD 5K39A 1JP5A 3PJNA 4KQ3L 4MNQD 5DUMH 15C8H 4A2FA 4HUNB 5DJCA 3MV9A 3SD2A 2H32A 2H0FA 3GSWB 4O02H 4Y4HB 5DMIL 4PCKA 5IVXA 2WO4A 2AP2A 3C5JB 4NC2B 4HJIA 4TULH 3G04B 1OCCB 5DLLA 3RWDA 2CDEA 4Z9KB 4ZW7A 4L0YA 3LS4H 4FTVD 4Z3GA 3W0WE 2HFGL 3DKHA 1ZEAL 2DQDH 2AQ3A 1SYSA 2P8PA 1KTDA 1MHCA 3EFDH 4PGZA 7FABH 2V2TB 4OD3L 2RD0A 3BPNB 1EJ8A 3GRWH 4LCWB 4WUKH 5IB2B 1CDJA 1HL9A 1AC6A 2DY2A 3LB6C 1BXUA 1BZ9A 3TWCH 1IGMH 1C16B 3SKMA 3B7TA 1SMDA 3WS3A 1O0VA 3HHRB 3LSOB 3QEGH 4PJ8C 1KPRB 5HHXL 4G6MH 3VACA 2X4TA 2WVVB 4Z5RA 1NTDA 1VZIA 2OMXA 4A7VA 3OL2A 1A6AA 1WC7A 2HYMA 2Q3AA 5JW4R 3ZIYA 4HUUB 2FR4A 5JXED 1RPQA 2Y3NA 1GOFA 3V7AG 3WO3B 2PW2B 5J9PB 3Q8BA 3BFQG 1QSFA 3G7TA 3TZVB 3WY1A 3TH2T 5D70L 3GXFA 4H88H 4MQSB 3IJ8A 4WV1C 1E65A 4MCZA 5C0BB 1INDL 1NIDA 2DLEA 1GY1A 3GHEH 5C07E 4WFHD 4U2YA 4U1JB 3D0LB 3WD5H 1LP9B 1UHVA 4IDJH 3EGSA 3F2LA 3O4LD 2AJUH 4HIJB 3QIUA 3B5HA 1V05A 1CLZH 4WRLA 5E4EC 3S36X 5B1JA 2DIAA 2AXFB 4ODXA 3EOTL 4MA7L 1F45A 4NKOA 4MKMA 5KOMC 5KVGL 1DDHB 3VXUD 4BCYA 5I5MA 2IG2L 5DMGC 3SQRA 2QADD 3APMA 1OP5H 2IDTA 3WJJC 3TNNB 1M7XA 1C08A 1AQKL 1QSEE 1ZS2A 4A7SA 1CXFA 1I82A 1MY7A 4V33A 4E2OA 3OG4B 1DUZA 2FVNA 4XX1E 1OCWH 2V5YA 5B8CC 4UQCA 3A6CH 1KXQE 4FCAA 5GGTL 4UOJA 5HY9B 1K8DA 5SWZE 4R7NA 1A7PL 5KSAA 3MFFB 1G9ML 4YLBA 1HH6A 5HI5C 3N1QC 4JZNB 3QUKB 1RUAL 1N26A 1OSZB 3NOIA 1UB5A 5ADOL 3JWDH 4KAQH 2R0ZH 1TZIB 4GW5A 3MA7A 3KGSA 4DJMA 2VDMB 2WIMA 4CA4A 3BP7B 3BH4A 3PWPD 4R4FL 5FK9B 1CFVL 5FA4B 1CGSL 2R1YB 4JFEA 2C3XA 4P4KA 1R0AL 1JPGB 3C09C 3X3GL 3VMNA 2FB4L 2X1PA 4HKJB 4LP8A 3SKNB 1I1RA 3N3EA 1BZ8A 4LCWE 4G8EA 1BOYA 2FQEA 3KPRA 4OF8A 2VB5A 2EXWC 5B3JE 1BEXA 3HB3D 3KL5A 4BFFA 3GSVA 3Q3GA 4U49A 1DHKA 1NBVH 1S3RA 3K46A 2D3VA 3RUGE 1DJXA 2IPTL 3JWOH 4GXUM 2DEYX 4HJGB 1QNZH 4WV1B 4HCIA 5JOFB 3N85H 1M9SA 2XTSA 2H4EA 3QGVA 3ZKNC 5DK2A 2WQ8A 3FUEA 4HXBL 1GZPB 1S7WB 3EHBC 4QJ5B 2ZXEB 4AZUA 3U30C 1RZ8A 3EYQD 4JRLA 5AVUB 3ARBC 4PJHA 2C9RA 4YOKA 1MCJA 2XZAH 2ZOTA 5E4EB 3PP4L 5HHOD 2APSA 4HKZB 4OZFG 5F7HA 2JWYA 2VLKA 2XC8A 3KH4A 3TS8A 2WOYA 4FABL 2YAMA 4Y9CA 5F3HA 4G6AC 5FHAH 2PCPA 2UYLA 3LQZB 1IIIA 1W0VB 1D6VH 3SGKC 3V4PL 1P4IH 3NCJH 4PV1C 5C6TL 3BUYA 2DQJL 1ID5I 4RMUA 1KENH 2V8LA 3PWVB 5AZEH 4DPCX 4EO5A 4KZEH 2TAAA 3OPUA 4H8PA 1JGDB 1NMAL 5L2JB 2C1PA 1JHKH 1AHKA 2HTKC 3E6HB 5KS9B 2EO7A 1PBYA 1A4JB 1QX1A 2ADFL 3IJEA 5J1AB 1CFSA 2WTOA 4JFHE 5CGYC 2CKBL 4JGNA 3LN9A 1FVDB 1BJ1H 1N59A 2XG4A 3B9DA 2GSMB 4X8JB 1CXHA 1F3DJ 1T7XA 1UZ6F 3BT0A 3CLFL 1L7IH 1N4XH 3EH1A 3M8OL 3MNMA 1HC1A 4JW3A 1NH6A 1PZDA 1F2XK 2O4EA 2WUCH 3BIAX 5JIPA 2AVGA 2J5LB 2X2HA 5I17A 4X6DB 2X3CA 5TQ0H 1CD1A 1XGRA 5FHBL 2R56H 1KTLA 4XZUA 1QO3A 4QJ3B 3I85A 3GJFA 1F8TL 4UTBA 2W0KA 3EJQA 3VA6A 4ZOCA 1A6TB 3C09B 4ZMLA 1SHXA 6TAAA 1W2KT 1YNLL 1Q9WB 1CE1L 3VX1A 3EO1A 4YHPA 4XPGH 5AOZA 3SEPA 1E7VA 2HWZH 5ID1B 2Y7QB 1KLFA 4YX2L 4K3EL 4Q0XL 3FT2B 3TIDA 4QXWA 5D2NC 2YAHA 4K9JA 1FPTL 4MMXA 4NZUL 4Y9GA 3ULVL 1P84K 5K9JH 1FH5H 2VXQA 4LL1A 4MHHG 2ED7A 3MV9D 4Y1AB 4DK6A 1S9YB 2J44A 4GRLC 4LSQH 3C12A 3GMRB 3CG8A 1YNKL 3UIZA 1HQRA 2R29H 3EADA 4JM0A 4JZJC 4JE4B 5LNDA 3KG5A 1FVCA 1NGXB 2X40A 1YPZB 2ORBL 4JCLA 4GINA 4QRTA 2CHXA 4PUBH 5F7MC 4KVNL 1N6UA 3ARBB 1EZVX 3HI6L 3T3MB 1DBJL 3V6OA 9CGTA 4LVOC 4PJEF 5E6UB 3JTSA 2NNXA 1MZYA 3BZEA 3SODB 1E4KC 2HZHA 1FDLL 2W81C 2WAQA 3OB8A 4K71B 4TUKH 3L1OH 2DL9A 3WY4A 1S9WA 1RD6A 3AADB 3QJFA 4I85A 1JK8A 3IT8D 4H40A 2XJLA 3VI4B 1LEKA 3I6LD 3LV3B 1I8UA 5DD6A 1KN2H 1WAEA 3LZFH 4YGVA 2PXYA 1E3ZA 1YEKL 5D6CB 2HKHH 5FUOL 3I2CL 2HRLA 5HPOA 4BXVA 4OM0L 4P0DA 1DJGA 4HJSA 4NJAL 3TBTA 3TJEL 1BGXH 3I02B 1TNMA 3RVTD 3RU8L 5HGBA 1JXGA 3O0LA 3MJ9H 1QYGL 4NFCA 1RIHL 3BD4A 3NJMA 5D55A 2P1YA 4WK2B 1EEZA 1QSFD 2D0HA 3BH8A 5DRNB 2MOQA 5B1BB 4DFIA 1U95B 5BOPA 5KS9E 1MAKA 3MV7B 2CJTA 1A4KA 3HMWL 3UPRB 1FL6A 4X7SL 4PREA 2MCMA 1Z3GL 3TFBA 3VXRA 4FXTA 2XFXB 1N18A 3VGHA 3PGDA 2O5ZH 4PJ9C 3JSSA 4TQPA 4XVSH 1BW8A 2M83A 3CZNA 4EI5A 4ELKA 4R9HA 3DIDA 2IQAA 3S36L 5EIIG 3FT4A 2Y1YA 3VI3B 3EZJB 4H26A 5AW4B 2FYYA 4UIKH 2DQTH 1R3KA 3EJSA 3KPSE 1OAZL 1AG0A 1N9PA 2DI8A 4X5WB 5ICYB 5KWYC 2G0KA 3GKZA 5EBWB 1M71B 1KG0A 4NWTL 3GKWL 3G08B 2HTLD 1JXJA 1QA9A 2PR4H 5E56A 3Q5OA 2NX5D 1W16A 1SXAA 5J13B 4Z7WA 5LBVA 3QJSB 4TN9A 2NZ9D 2NLJB 3W9EB 2VWEC 4R8WH 4GRLB 3ME0B 3U9UA 5GS0C 2NNAA 2ZUVA 2YQBA 3WKMH 1JD9A 4QRRA 4X7EC 5KVDH 4JZJB 1TPXC 2BY1A 5KSAD 3V7AE 4PJCA 4JFFB 3PL6D 1FZKB 3OHMB 4Y5YC 4OIBA 4LQ1A 4NAMA 1E8ZA 3GSNL 4Y1AE 5EPMA 3OXSA 1UT1A 3TFKC 3OLDA 3UBXI 1A9VA 3TNMA 3CFBB 3N04A 1J8RA 1XAKA 2J1ZA 4ODVH 3SDAC 5C9KA 1TO4A 2CRIA 1UA6H 2AK1L 4FZEH 4AGNA 4GW4B 2KI6A 5FKAB 3I3DA 4NNPL 1DSFH 3T9WA 4AQAB 4MB1A 2R59A 3HI5H 3VTMA 3ZDWA 4RWYH 3L4ZA 3T3ME 2V7NA 3S5LB 2LLLA 4MJHA 5EHFA 3VFGL 3GGWA 4CNIA 2DYPB 3C08H 3LH8A 2J4WH 5A3ID 4P4KD 2IJ0C 5KSBB 4NKMB 3GSUB 3PWNA 1MFDH 1G0DA 3G5YA 4UTAH 1H0DB 4YDNA 1KCRH 2JLLA 2OZ4L 1TEYA 5IQ9A 3V4PB 3T0DA 1VFAA 1CFQB 4DQOL 4F91B 4MVBC 4XPTL 1LO0L 3KPRD 3GXNA 3DSNA 5KVGE 3SCMD 2Z92B 2E59A 3QZBA 1MEXL 2PPFA 3RHWF 4BA8A 2RTTA 1NCOA 4WJ5B 1HILB 5LWYH 3A23A 2K0RA 3DUUB 1TQCC 1FNEB 3G9VA 4LVHB 5D7IE 1A1MB 4HU2A 4X4ZA 4RZCB 2VABB 4OZHB 3QUYA 4WWKC 1UWXH 4JKPH 3GSOB 1W6WA 1M6OA 4H8QA 1I9IL 3VB9A 1M2VB 3TTYA 2VZ3A 5CJ5A 1PG7W 2YUZA 1AZNA 2VLKD 1XGPA 1GKEA 2HT3D 3K71A 4MD5B 1XF4A 4EAEA 3C6SA 1XZ0B 4UQIM 1F6LL 1R33A 2NUTA 3IXAB 1T2QL 3D8MA 3IRZA 5IW1B 4WEMB 1X5LA 1CD0A 1JVLA 4GT0A 5HYJE 3SDXB 5CZXD 3W2DL 4HOWA 3CZSA 1CXEA 4XMVA 1TZAA 1J7VR 3MNVA 1U93A 2OSLA 3AG3B 3BVNA 1HXYA 2IPKA 3TO2B 2KPWA 5EU4B 2EICA 3DXAE 2ZX5A 3MJ8B 4ES8A 2YQGA 1JHTB 4NQUA 4P3DB 3MODL 3T3PB 3IXTA 4PP2A 3V0WH 3EUDA 4JFUA 3TVMA 1FL5B 3S9DB 3OKNA 3H53A 2MCAA 3WSQL 3OKMA 1TYEB 3EGXA 1KYOJ 4LPTA 1M57B 1GS6X 1L0PA 3B56A 2FEJA 1KPUA 2AKRB 3ZDXB 2ITCB 3AWEA 1ZV9A 3D25B 4UUJB 1NGWB 2ADIA 5F9OL 2ADJB 4FTVB 5A2LH 4F2MB 5I1AA 1S7QB 1PY4A 1EUTA 3AMLA 5JHLH 3EOAB 3HS0B 1OP4A 2DF3A 1UQSA 2Y5TA 3FW6A 4NKIL 4LEOB 3KYNA 1KFAL 4Y5VC 4ZS6C 4GXUN 5CCHE 4Z7VB 2NY2B 4G2AA 1DFXA 5ERWA 1O7VA 2DTMH 3UDWA 4Z76A 1I7UB 1A6VH 5H94A 2NY3D 5BO0D 2GIMA 3AM8C 5BVPH 1KNOA 2VLRB 4LGSB 4J28A 2E6JA 1C9SA 9PCYA 4LKCA 1ZA3B 3IDIB 5DK0B 5DD1L 5IFJB 1TQBC 2DL2A 5KSBE 3FZUC 5J6HB 2N01B 4RGND 5C09D 1CDCA 5LDSA 1EWHA 3QUMH 1CLOH 2F19H 4K7FA 1TQCB 4LEBA 5AOKA 5IESL 4PRPB 1WFTA 3OX8A 1X9UA 3RDTC 1I9RH 1LK2A 4HJJH 2ZUWA 1FNSL 4L2YA 3S3JA 1TQSA 4WWKB 4OJAA 5A43C 2G9KA 4JO4L 1Y0LA 4K5LA 1PIFA 3PHAA 3TYFA 1HH9B 1OD7A 4FMFA 3BKYH 1NQBA 5BZZA 1A9BA 1I4FB 2G60L 3O4OC 4HPHA 4N0CC 2WBJA 4UV7L 3UERA 3MOAL 3LVTA 1JNNL 4JZOB 3ESNA 3OC5A 5EU3A 3L1FA 5BV7H 2X4PB 3ILEA 4IBYA 2E9IA 4N2CA 3DJ9A 3ZE2E 4PVBA 4JN2A 4Z7UF 2QSVA 4NI3A 3KR3H 1CGTA 3CVHB 3FO0H 3MKKA 3ZL4L 3V0AC 1MRCL 1BV8A 2DLFL 3PABB 4MS8D 2PXYD 1HWHB 1EDYA 4J4PA 5LKNA 5I1LA 4ZYKA 1JV5A 2EVHA 3QWOB 5E2TL 2A77H 2QBWA 2Y2TA 4NPYB 4PI0A 4ZW6A 1AR2A 3ARGB 2QPFA 2PCYA 4ISVA 2ZONA 1ZRUA 4KROC 4L0PB 5A2IH 2X44D 2YKLH 3IF1B 3QJXA 2X28A 3IETA 3D3VA 4OFYA 1V7NH 5C08D 4C83B 3ULVE 1H3WM 3RIKA 3RI5F 3JTBA 3RNKA 3PJSB 5KSVB 5BVJA 5L88L 3EIFA 4JPVL 4MNQE 3VXRD 1GYCA 2F74A 4QRBA 3O3AA 3T3PE 3BKMH 2YWZA 4F7TA 1KCLA 4WEUD 2WSKA 2O5XL 5GS2H 4EI5D 5C0EB 1Z9SA 2YD9A 1WAAA 2VDOH 5DDHB 4XMKH 1D5XA 2VW7A 1E4XI 1HXMB 5BUGA 2APXA 1UCBL 1VPOH 2BK8A 4JRXB 1KN4H 3HLAB 3KLHC 3OAZK 4FTVE 4GRWF 1VEPA 4DVBB 1UACL 1M1SA 3SDYL 4PGJA 4G7YL 1B4RA 3MRJB 2NYYC 2YAEA 4BUGA 1KXVC 3BWUF 3ECQA 4EE2A 4Y4FB 5JW5A 4AUJA 2ZXWB 4NO0B 5GSVA 2XV3A 1TQBB 3LH2L 3H2PA 5IBLD 3HCVA 2H6UA 3SDDA 4O2CA 3MRLA 5K9QG 1O75A 1HI6B 5DEZA 4PJ8A 2GJRA 4ZODA 4YPJA 3X12B 4UM9B 4P46C 4LASH 3RIAF 3TX4A 4IBTA 5EEYA 3VXOB 4QRRD 4D0DB 5HDQH 1LO5A 4FJZA 3ECVA 1SEQH 4B0MB 1J5OL 3QFJB 3CVBA 4X4ME 3PV7A 2C4FT 5KVFL 4GAGH 5BS0A 4XNQB 1AMXA 3WKNA 3GIZL 3T6XA 1ET7A 4XWOD 3O4OB 5E4OA 4NN7C 3KJ6L 5AKSA 3L7FA 3V0JA 3GJEB 5HHOB 4TVSa 2DLTA 5D5MF 1X9RA 4FXGB 1M7DB 3NT0A 2C9VA 4HOMA 5GRWA 4BK4A 4WFHE 1A1NB 1QWNA 2H26B 2H2PC 4PJIF 2WJ5A 5JHBA 4WW2A 2VDQL 3O4LE 2AV1B 5AYTA 5AFAA 2IH1B 2N3JA 4J3TA 2E7DA 4JO1H 5BMFL 1S5HA 1ND0A 4UQ2A 4NQCD 4PJ5A 5HHMD 5CD3B 4XCFH 3IAQA 2WQWA 4QYOB 1JPFB 4LRNH 2JFCA 1MOEA 3WJJA 4M03A 4DZBB 1B0IA 2F5BH 3AUVA 4HIQA 4XOEA 2JQMA 4FG6C 1JGLL 2ERJC 2QPUA 5EIQA 1OTTC 3QAZB 1BXVA 4XBEH 2K8MA 2VERA 2A0LC 3MNDA 5K93A 4ZX4A 3T71A 3S3PA 1HHKA 1D5MA 3OLIA 4EIZC 1TTBA 4D8PA 3OQRA 5SX4I 5EZOL 3QUYD 2FUTA 1MJJB 1R24B 4JQIA 1FORL 1SXBA 4E68A 1L9QA 4NNYB 4NZTL 4F7MA 1X5AA 1F1AA 1BCIA 5TGBB 5DJZA 4E42A 4AKQA 1JVKA 5ECGA 5EOTA 4ZUSB 2C8NA 1F1GA 3CD4A 3IMUA 1TR7A 4LHJB 5T5FH 2D7PA 2G2RB 3QZOA 1NAKH 4XP9H 1AANA 3MLRL 4QHLB 3X14A 5BXFA 1RUQL 4YIQA 4WFFD 1LNUA 2FBJL 4G42A 4MA3B 1TVBA 3PWPE 4KK5D 3M1OA 1I8LA 3FXIC 4TQHA 4WDIB 3RKDC 4ZBJA 1ADQH 3QFDB 4N2GA 4UQ3B 4K15A 3E7JA 1AXTL 3RTLA 5AB9A 4JEGB 4Z7NF 4X4YB 5DHVA 1RV6X 4BWWA 2MKWA 4DKEH 4Q9CA 1TQVA 4Q58C 1NC2A 3HR5A 4GUOA 3MV9B 4L9LA 5TF0A 3X13A 3NPSC 1YECH 4OT1H 2PWGA 3ZL2A 1JRHI 2FO8A 2VDMH 4N5ED 3CDZA 4NM8L 3RWDB 2CDEB 2Q0ZX 3A3YB 4KTDH 2HKFH 1MN4A 2R2CA 4AGOA 3KHOA 4HZAA 4ORGB 1ZHBA 4ZO7A 3QUXC 3FUKA 1ILSA 1B88A 3ROLB 1JNLL 1I3VA 1TTGA 2WINA 2QQNH 1KTDB 5DJDA 4Z7QE 2WNKA 5SV3A 4KXZI 3HMXA 4YSSA 2YMXL 3ZRCC 1J12A 1G6RB 2BC4A 2OTUA 1UWEL 4XMTA 1X5FA 1Z32X 4YDJB 3ZE1E 1UXLA 4PWHA 5HHOE 3LRMA 4HS8L 3OQ3B 3P2TA 4G83A 4U1HA 4KDVA 2Y6SC 1EHNA 2XTLA 4ZMZA 3KPNB 2H3NA 1I8IB 4LVEA 3PWJB 4WENB 3GB7A 3SD5A 2NNCA 1OF0A 4GAYB 3O6KH 1WC7B 2WD0A 2QLVB 4XXWC 4IIQA 2VR4A 2FR4B 1AZCA 2IADA 2BDNH 1AKPA 3ZLQC 2DDQL 3DHPA 2K3HA 1VGKB 2C7UA 1U8PB 2GBUA 1QOKA 4M4RA 4OKDA 4DPAX 4KKRA 2XNAA 4HGMA 2ZOLA 1I1AA 5DMKB 2X12A 4MCZB 5EUOA 4XBPB 4N8CL 3IJHB 3O81A 1NCCH 4ZPVA 5TQ2H 1AIFB 2AABL 2YXWA 3HBZA 1PS3A 1TJGH 4ETQA 2OYLA 2J88L 3EGSB 3FH8A 4NQVA 4XC1L 2V0AA 4P2OA 2WBJD 1D5IH 3IGFA 3CNKA 3QIUB 3W82A 1QBLH 1QFHA 3VD5A 3ZZSA 4NC0B 3VXMD 2EADA 1MRDH 1R3HB 4RISH 4ODXB 3T2NL 3RVUD 4M7KL 1FE8H 1NLDL 4BM7A 3RBSA 3QZNA 1SJXA 1BIIA 3GYRA 3F00A 4AXWB 4KVCH 3T0WA 4AC4A 4ERSL 3H9SB 4J4PD 5HHNA 1C08B 4KMTL 3NSCA 4HJ0C 1P5UC 1BBJA 3QPKA 4E9YA 4KO5A 5JYLA 4FNQA 1AR1D 3BQUC 4XN8A 3F64A 2G3MA 3UAFA 4V1DD 1CDHA 1UXSB 5I18H 4HWUA 3D3VD 4AL8H 2WQRA 4OLYL 3CSFA 3NCCB 4DW2H 1A5FH 5LGYA 2NY1C 2YAQA 4JN1L 3ZU8A 1BM7A 1HH6B 4BCZA 1IFHL 1WCBA 4E5XB 3MV9E 4P59L 2AI0H 1M56B 3SGDH 5IVXE 1VEOA 5G5DB 4YHMH 5HHPA 3AS3A 2QSTA 5E9AA 3IU3A 5ILTL 1SEBA 2AK4A 3MA7B 4WKXA 4NZJA 43C9A 2G75B 4N6RA 1QSVA 2NYZA 2AZUA 2A6KA 5JORA 3O3EA 2CCLA 4JDZA 3SE9L 4LQFH 2BVTA 5LCVA 4JFEB 1E4KA 1B4JH 5I71B 1ZLEA 4Q4EA 1OLZA 4F93B 2EE6A 3FFDA 1IE4A 2VDQB 1UGKA 2X53A 4C4KO 3F7QA 4G6FB 3D48R 3ULUF 2W0PA 4G11A 3NJIA 3VRLE 4HGWB 1R5IA 3SDDD 5IBUG 1CQYA 2HJLA 1T21A 4L1LA 4LBEA 2MPAL 4PJ8D 2AQTA 1RL1A 3K1KC 4LEXL 3F7PC 2E86A 4PRIB 3CFKA 4QRSA 5GISL 2EAEA 3I6LE 4NNXA 4HAFA 1AD0A 4IKLA 4QKTA 1YNTA 1A6ZA 1YYLH 3FYEB 4OD1L 1BF8A 1KXTA 4G8FA 1F3JA 1ED3B 2XWDA 5GRXG 5HJDA 4DK5A 4NUMA 4HG4K 2EXYD 4Y19A 5F0JB 1IMHC 1YAIA 3PLYA 3V5KA 5GRJH 2B14A 2X09A 3BISA 1A25A 2W9DL 3NIDF 5F9WC 4X6FB 5AOLA 3C5XA 1QSFE 1RZ8B 1ZT1A 4S1DD 1S3KH 3BMWA 2CBOA 3QIWA 1EGJA 3MGTB 2GBTA 2R23A 4GRMA 2F1BA 4PJ9A 5E2JA 1SY6A 2IG2H 2IC2A 4ABUA 1GC1C 4HJ1A 5GJSH 3L45A 1T4KA 1XCXA 5DMJB 2WKGA 4NO5B 5K9KA 2OW7A 1AQKH 2B9BA 1PLBA 5TTRA 4J3VA 5F3HB 3CFEA 1EVUA 5JIMA 1FL3B 3PIQA 2PCPB 4ZQKB 1Z9PA 3V0DA 2VXTL 4Y8AA 1K6QH 4JM2A 2OYKA 3D87B 4PJ5D 3MACL 2ZNXA 4KO7A 1GW6A 3UJTL 1NCUA 5E6ZA 2H0PA 4WO0A 3RWIA 2C1PB 1OTUD 1CCZA 4QHKJ 4OGXL 5B4MC 2R39A 3QJQB 3ZXAC 2FTAA 1RZKC 1WPCA 5GGUA 4LDCA 2P3YA 5L9DH 1U8MA 4TUJB 4NQXA 2A1WH 4S11A 1ULVA 2NY1B 2NX5E 4GFXA 4PJFF 1P2CA 4XVJL 3QO1A 1CD1B 1DQLL 1XGRB 3CUPB 1KTLB 1CGSH 5HI5D 2GHWB 4OJFH 4XZUB 4OFPA 5F7YC 2EDMA 4NLHA 1IGTA 3FTZA 1V7MH 5DZLA 5EU7E 4CMHC 5KVFE 3GJFB 4XAWH 3SDAA 2VQTA 2I9TB 1IEBB 1EERB 4QXUH 2HVJB 3EFFA 3L3IB 2FQGA 4H7VA 1UZGA 5KG9B 2F7OA 3OZ9L 2DJUA 3OG6B 4MX7B 2CU9A 3RVWD 2BCKB 1D3CA 3MLZH 3ARDC 5EEXA 5F21B 1IC7H 4ZFOA 1AZBA 2IPTH 1KLFB 4JFEE 4JY6B 4KNUA 3TIDB 3DI2B 4FFVD 4MMXB 1OCOB 4XXDB 5F6HI 4X8GA 5KVEL 4RGNB 2Z31A 2BY0A 4OGAC 4NM4L 2EXWD 4A1RA 1LEGB 1M7IB 3VXSB 1OV8A 1OALA 3KPRE 1ZLSL 4WEBL 3IDNA 1HQRB 1H15B 2D31A 5AOMA 1N8OE 2X9YA 1G7MB 3LEYH 3BSHA 4NN6B 1RK0B 4DCQA 4U1KB 3KCPB 3R1GL 1X7QA 4U33A 4WIQA 4YHOH 1K4CB 5E1AA 3ZKND 2DM4A 2VR7A 2FNBA 2QLYA 3JTSB 2R4SL 3SPJA 3QZPA 1Z5YD 5GZOC 3BZEB 3MV8B 4XB8A 1KBGH 1DZBA 3C2AH 4QRQA 3L3KB 4IKKA 1RZFL 1FLRL 2KHAA 2CD0A 4PJHE 3QJFB 1JK8B 1LL1A 5LB1A 1IO4C 3CN2A 1FGVH 1MLCB 1IEAB 4G6AD 4JUTA 2VLKE 4YGVB 5CWSB 2CMRL 3NSXA 3QRBA 2ZOKA 5I6OA 2J57A 2UUDK 2PKDA 3FBKA 1XGQB 4MCYB 2HTKD 3QDAA 4N9GB 5H35B 1TKWA 5CGYD 3BH8B 2DLIA 3RY6C 2DQEH 4BH8A 1NGQL 1I1AD 2VDLL 5C1MB 4E41A 4PREB 1CE6B 5L8LB 1TTAA 2UZYA 4ALAC 4FS0A 1FZJA 4MJIB 2D03L 2IH3B 5DO8A 3QXDA 4J7RA 1RI8A 4IU2A 4OR1A 4R7LA 5IMOA 1ITCA 3H9ZA 4P2OD 2IQAB 3QRLA 4BZ2A 4UF7C 5IJBC 4WI3A 2JE8A 3ABZA 1FYTA 4M6MH 4HCRA 2N1TE 1J9SA 3QPXL 1WUZA 1FPTH 3EBAA 2DIBA 3ARDB 1MNNA 1MJ8L 1E8XA 2UV3A 1Q94B 1KG0B 2WHVA 5IBUB 3ZRFC 4HISA 1JZ4A 1JS4A 4HCGA 2OR9H 4Y8DC 3UC0H 1IV8A 1YNKH 2XWBA 2EINB 3KM2A 3CXDH 4FJYA 2JIXA 4F7PB 3IGLA 3NESA 1U8NB 1SVCP 3HC4L 2Y1AA 4S1QH 3TA3A 2VDRH 4MFHA 3U9UB 1L5GA 1MHEA 1BZOA 2AJVL 4QRRB 4EZLA 5ITBH 1MWAH 1GSKA 4QIRA 2KT6A 1N5YH 2HH0H 1T1YA 1J0IA 4RGNE 4M5YL 1MJUL 3AW5A 1B2YA 2WB7A 1NCBL 2UZIH 1C7SA 4B5EA 2GHZA 4GMSH 1XR8A 3ILQC 1J8HA 1L0XA 5JR1H 1CGWA 2IBGA 1ZVSB 4G7QB 2DTSA 4LPWA 4S1RH 4JB9H 3B8SA 1YN6B 1ECYA 4R97C 3GGWB 4O9HL 4X98B 4CNIB 1XF3B 1T2JA 4IS6B 4JKKA 2JKNA 2E8ZA 2AFNA 4OCYH 5CZVL 1QEWA 3B2DC 3HS9A 4UAOC 5C92A 2R8SH 3TEXA 3ZSTA 4KDTC 5PCYA 1NBZA 3TVMB 4FQJL 4DP8X 1SLXA 1YMMA 2CH8A 3DSNB 4JRWA 5F72S 4HMDA 2CPUA 3JV4B 4X7SH 5FF6A 2LU5A 4ZMQA 1BOGA 3OPZH 1NCNA 4RETB 2VXSH 2EO9A 2UXVA 3JVFC 3QXWA 5TDNA 7TAAA 1IKNC 4KK6C 3D52A 3FU3A 4QDGA 4MDIA 3D9AL 3UYOD 1KIRA 1MVYA 4HH9A 2W91A 5IB4B 4TOYL 1ETZB 1P4BL 2GCYB 2WNXA 4R4ND 2JJTC 5J4MA 3QIWD 5C08E 1LE5A 1AQDA 3KPQA 2I7SA 4KJWD 4LDEB 1OAZH 2GJJA 4PJ9D 3M7FB 3CVHH 1DVFC 2EXTA 3VXRE 2WWNA 4NWTH 1URZA 5EF2A 3I50H 1CB4A 1BVNT 3JUYA 4PWFA 4XB3A 5FGBA 2ENPA 4EXKA 5CCKL 2YN3A 1L7TL 3A4FA 4RMTA 4DKFL 3L8QA 1WFJA 3F12A 2VC2B 4XP4L 4PS3A 2FIRT 3REVA 1FAIL 4AKOA 1JGUL 1MFAL 3DV6B 4U1SA 2Q2LA 4U1MA 1MJ7H 2BVYA 3GEWB 4N28A 1E4WH 2IPKB 3MZTA 4MMZC 4RAVA 2Q76A 3VNZA 4XN4A 2D0GA 3MJ6A 3S8GB 2MCPL 3U2SB 4BZ2H 4WSKA 5AG8A 3GTTA 2OJZH 4CDHA 2R9HC 4PP2B 2V5MA 1KGJA 4MBOA 1OWWA 3C8DA 3FCTA 3K4DA 3O45B 1XL6A 2WJ7A 4P46A 4TXVB 1MUJA 3OKMB 4Z7WE 1ZXQA 5EU5A 3X1BA 1AZZC 2X87A 1IL1B 2W9EL 2X38A 4JQIL 1INEH 1LHZA 4O5LL 3K2MC 4QRRE 4I0KA 2QPEB 3VFGH 3QXAA 1ODUA 5I1AB 1EHLL 2GEEA 2V33A 3LRSA 5J06A 4PJCE 3NCXA 2X41A 3TFKD 1T5WB 3CHXA 5B7EA 2Z4TA 3DROA 3HG1D 3SDAD 2CHNA 4R97B 1U3HA 2JB5L 2OZ4H 4OSUH 5JOEA 1FSKB 4I77H 5HI4C 3P4MA 1NWOA 2D73A 4F92B 4NHCH 5B3JF 4L5FL 5ERWB 5FYJH 1FG9C 3DOIA 1DSYA 3RUGF 2JVUA 4S10A 4JDVA 5I5IA 5F7LB 2BXYA 1NCDH 5KZCB 3LRGA 1JF1B 4EUPH 1BXAA 4HLEA 3UBXB 3V4UL 1XX9C 2RACA 4AIXA 1AQMA 4MVBD 5ACZB 4KH2A 4LOEA 1E4XL 1C5CH 2KKQA 4ADJA 5HHME 4XN5A 1F6AB 1OARL 2FCBA 2WLYA 4Q8BA 4WNQA 2DV6A 5DI8A 1ZLVK 1LK2B 3EJTA 3H55A 2Z7UA 1IC5H 3O2DA 5D7JA 3BX7C 2VDLB 1EO8L 1BFSA 2RCSL 1H6FA 1EEQA 4DGIH 4WWNA 5F1OB 2DD8H 4A68A 4I1PA 1T22A 4OZ4A 3BFOA 5MI0C 3PNWB 3F5WA 1Y1DA 4HC1H 2XDHA 4HBCL 3TYFB 2H2SC 1Z1WA 2GK0A 4LSVL 1DVFB 1T2QH 1XCTB 3MRMB 2MHAA 1OHQA 1BHGA 1AYOA 3W2DH 1O7DE 5EU3B 4U6HB 3GMNB 3HMXL 4U1IB 4QOKA 2K8QA 5AVVB 4P9HC 1ZV5A 2ED6A 5EBLB 1YY9C 2YZ1A 3R0NA 1WG3A 1MAMH 4DPRA 2E6PA 1DJIA 3EDFA 1E9PA 1P7QA 1JV5B 1TJHL 2HPTA 1YDPA 5CD5C 2J72A 5AAPA 3EAKA 4ISVB 3SZKC 4B60A 5D4IA 4KHTL 1JMXA 3U9PL 3QQ9C 3D2UB 5F9OH 3BMVA 3HE6C 2XV0A 1QUNA 2YGOA 4XHJD 3T8VA 1ZPUA 1NKRA 4HJUA 5F6IC 3RZWA 1MI5A 5HBBA 3G6JE 5LG1A 1TFPA 4PGCA 4HQQL 4E41D 2I5YL 5EORL 4NKIH 3OR6B 2F74B 2IWKA 2EC9U 3BP5B 1XIWC 2JJUA 2XV2A 4NIYE 3TESA 1EMTH 3FUFA 3ATBA 4NHUA 1Z9SB 3D6GA 5CEYA 4MZRA 2KPNA 2BIQA 3MLWH 1G9NC 3RWEB 1JK9A 1FYTD 1HL8A 2BIIA 3VSTA 1G7IB 2A4ZA 2AAAA 3PFUA 3RWGB 2KC0A 1QZ1A 4HWBH 3EGDB 2EDBA 2X88A 2R4RL 3UBGA 1L4IA 1SRDA 4PCSA 3K6NA 5GSVB 2EIBA 1PNCA 5AAWC 3MJ7A 2ICWI 5IESH 2R1WA 3HCVB 2HJKB 2FYVA 1IBBA 2JIXD 3SDDB 2P80A 1BAFH 4APQC 5IM7A 1O7SA 4LGRB 4GEJA 4WTQA 1O5PA 3FZUD 1USZA 3HAEA 4K3JH 4LIQH 4F58H 2B5IB 4JO4H 5D4QA 3MBXL 5FAAA 4WWOA 5EG6C 1LO5B 3GTVA 3P3RA 3CCHB 3R7RA 2Z93B 3C8HA 4OGYH 5ICXA 5CFAA 3KLSA 1BJ1J 2Y72A 3D4YA 4S0SD 4UV7H 5MI0B 5BS0B 1PZAA 3CK0L 4DEWA 2E9WA 1JNNH 1OL0A 1J8HD 3OAUL 1CL7H 4UV4H 3GSRB 4MRBA 5GSRA 5CAYB 4UOW1 2P8LB 1G6RH 5CP7A 3VYNA 4KUZH 2WY3B 1XB3A 3L7FB 1M1XA 3LHPL 5L7XH 2F5AL 5IG7B 4Q6IC 1SBSH 4JO2L 4OF0A 3RE0A 3VFNA 3T0EC 3WFCH 5IMLA 1V54B 5LCVL 2ARJQ 2VW6A 2JLPA 4XMUA 1BIHA 2D3LA 2EDDA 4JQXA 5EC1A 3UXFA 4AENA 5I2IB 4PR5A 2XN2A 4M8UA 1ND0B 2XTJD 4UQ2B 5KS9F 3GD1C 4G72B 4MAYC 2K6WA 2FHBA 2FSDA 5AKRA 1BQKA 4R26H 2R0WH 2WB1A 3KPLA 2AC0A 2OPCA 2BP0A 2WLLB 2KZ1B 3BQUA 2O5XH 1XH0A 1EFQA 3E3QE 1IAOB 4KROD 4C54A 2OV0A 4ICXA 2GFBA 4D8PB 3APNA 3NYKA 4JFSA 2RJMA 1TZGL 3D3VE 1Q72L 1X5ZA 2YBRB 5F96L 4F7MB 1QVOB 3QNXA 1UEYA 3MUHL 4E42B 5DJZB 4PJEA 2ITFA 2XUWA 2LGNA 1SY6L 4PN6A 5EOTB 3SYAA 2GABA 4KKNA 2FT8A 1YJDL 3I6GA 4OLZL 1E30A 3WN5A 3L2MA 3QUGA 4M7ZC 3BE1L 3MRFB 3QCTL 1RZQA 5DFVD 5EC2A 1WAAE 4UDUA 1NCWL 1ZSHA 3X14B 4YIQB 5BXFB 1DL7H 4PJDB 1WBZA 3WDHA 3IKCB 4K5PA 2WO2B 2FK9A 3GS0A 2AV7A 3ARQA 3IK2A 5JPNC 3TCLA 2F7PA 2BNRB 2O5YL 1KTRL 4APQB 12E8L 3QAQA 2Q86B 5LGHH 3MO1A 1NC2B 2WTPA 1DVZA 3GC3A 3LMJH 3OB0K 1QFWI 1GGCL 4CN1A 1ROWA 4L9LB 4A37A 4H8VA 1BFTA 3WJLC 2P7TB 3X13B 4P46D 3GZOA 4A66A 5F2FA 5GS0L 1MW1A 4XRCA 3ZMRA 5I0WA 3ZDYB 2CAKA 2VRKA 4LOFA 3FOLB 3T3MF 2NCEA 1RUPH 2O5NA 5JXAL 4OQTH 4I1RA 1FI8C 4L37A 4BZYA 5ICXB 4KZ0A 4YSEA 3MXWL 4OI9A 1DUYA 1ZHBB 4YWGH 5IHZA 2P8MB 4BFGA 4Q6IB 3DTUB 5E1IA 3TV3H 1HKLL 1VAHA 5BS0E 2EEFA 4LLYB 1EEYB 2BY3A 2WINB 4G7VL 1Y07A 3IPEA 5DJDB 2XYCA 5HSFA 1TXKA 1CGYA 3VM5A 2BC4B 2CHDA 4N68A 5C0FA 1UENA 1LXMA 4ZOAA 3K80A 3VFRB 1DEEA 5J11B 2PF6A 2VN4A 2H2PD 2YD8A 3GM0A 5HHQA 4ZFOL 4U1HB 1GR7A 1TO5A 3LPWA 5D7IF 2CLRA 3ZOAA 2IMNA 5F89B 1P5VA 1E9OA 3B9VA 5TPWL 3LXCA 2NY0D 4PV8B 2QVKA 3S2AA 3AGVA 3OMZA 2NY5C 1SGKA 3G6DH 3O6LH 3P0VH 1FFRA 4IIQB 4N2IA 4PJ5E 2XVLA 4Z1PA 4C56A 1NAMH 5LBSH 2C7UB 1KIQA 2WV3A 4FG6D 4M4RB 1E6OL 3Q8FA 4D2NA 4Z3HA 3GZQA 2XNAB 3COOA 2EIKB 1QFUL 1OTTD 1XF5A 4LPUA 5D7JD 3SBQA 1PLGL 2ZOLB 5IUCA 3UTOA 5EUOB 2A0LD 3F58H 4ZS7L 3HEIB 3BLBA 1ETB1 4I9XA 1U4FA 1SF5A 3VJ6B 3ARFC 4U3SA 3UG3A 3S34L 2WXGA 1RUQH 1V3KA 1YVLA 3WUWB 5K69A 4KUCF 1M9WA 1Q1JH 2ZKHH 5CJQL 3ZKMC 3KYAA 3C60A 1PFCA 1U8QB 4KK9C 4XAKD 5ETUA 3DI3B 4P06A 4NZ8A 4X9FA 3L13A 4J39A 4O51A 5JPNB 4AQ1C 2NNRA 3WJMA 3FB5A 4IBZA 2CO6A 5EN2A 5BZDA 2A74A 2PW1B 1IGIL 4L5FE 4POZD 3UAAA 1P7QD 5FECB 3UACA 2IAMA 3MROA 1BBJB 5ICUA 3CZFA 1EJFA 1MQKL 4H8WC 3L81A 1OANA 4IBQA 5E94A 5E0QA 2V9RA 3EYOA 3HZMA 4YDLC 3O3DB 3NSJA 1KOAA 1UZ8A 1MELA 2Q1EA 1JYNA 3S48A 3OZKA 2OMNA 4PW9A 2BLFA 3CFCL 2C3HA 2ZUQC 1LO2L 2EIZB 3P0YH 4NSKA 4PCTA 4H2CA 4FQXB 1MI5D 1A6PA 3KYOB 4JO5A 4NGHH 5LHDA 4LAQL 4QHMA 3WS6C 3D85A 3NCMA 2JNZA 3N41B 4FG2A 2VQ4A 1RURH 2W9LA 1GYUA 2DQIH 4HF5L 4BFIB 1RSFA 2YMXH 2B1HL 1KZQA 3C6LC 2AK4B 5MP6L 1T0NA 5CLXA 43C9B 2AVFA 5I15L 4Q56A 2WLIA 3ULAB 4OCSH 1MAJA 4ZPTA 1KY6A 2BNQA 3IRCA 5EH1A 2EVFA 1OAKL 2FNWA 5KSBF 2BSSB 5JORB 4RFNC 3D50A 4FLHA 2AQ1A 2HX9A 2WXIA 4HCRL 2NYKA 4YAQA 1EIBA 1N6VA 4UT7H 4UINL 4NXKA 2CNYA 3U7YL 1MF2L 2WXFA 2MFNA 4HOZA 5IROA 3GRGA 3VGGA 1AHMA 3N1MC 3WL9B 1FNGB 5FS5A 1S9XB 1DO5A 2PYED 3O6FB 4PGDA 4QT5A 1B0WA 4R96A 2Y7LA 2Y6SD 2DQHH 5F7DA 4AYEC 3Q13A 3NH7L 1J0KA 4RWHA 4QRSB 4KKCC 4NNXB 5J6GA 4HS6A 1I9JL 3FTWA 5DYOA 1GHFH 2ZAHA 1ZANH 1F3JB 1F58H 1Q0EA 2Q9OA 5F7BA 4NPJA 4DSYA 3OKEA 2YHGA 4OUUA 5BNXD 1GC1H 3W5MA 3QDGA 4Y19B 2F18A 3UBFA 3FQYA 2JSFA 3T1WA 3DIFA 1HCYA 1V55B 3ARFB 4PQXA 5C97A 2YFOA 4JUSA 3WNIA 1GMIA 4PJAB 5L0QC 1GGIL 5SWSA 4GRMB 4RNRB 3QR1A 5EUOE 2W38A 4PBDA 1IGJB 3LXAA 4AT6A 1EFXB 4DOHB 3E8UH 3ARVA 4J2QA 5I8EA 1X5IA 5TF1H 1FG2A 2RQ8A 4KMTH 5GGVH 1X44A 4FEMA 1XH3A 4K94L 3TM6A 4UZUA 1WBYB 4G5ZL 5K59E 4AQ1B 3GO1L 2BS8A 1RZKH 5DQJA 3F05A 2W94A 4AYFA 4JO8A 3HN8A 4JM2B 4NQQA 1HZLA 2AJ3B 3IVKA 3RHWK 3VFSB 2YPVH 4ZZFA 5C2UB 2HKAA 3ULVF 1MCOL 4OLYH 3MRIA 3FN0L 4MB4A 3VRIA 1XAUA 1WBXB 1NC4A 4YDLB 4B9ZA 1QHQA 3T3PF 1NCTA 2LW3A 1J88A 1XWVA 4FQCH 4J1UA 4OVUA 3VFPB 1XV8A 1LK3L 4PLKC 5GGUB 4IK7A 3BW9A 1U8MB 3RNQA 3GMMB 4NQXB 3BQUD 4QRPA 1RH8A 1JWSA 4O2FA 1VEMA 2XBTA 2P49B 4PRHB 3KL3A 5D2NE 5F9AC 3V5DA 4Z3IA 1P2CB 2EH8L 2BOCB 3ZKQD 2F54A 5T1DH 3OKLA 1K3IA 2YRPA 3STBA 2PTTB 4FNUA 2A9NH 2YEVB 4MCMA 4HJEA 4AYMC 4P2YA 2K4AA 3LKOA 1WIOA 1WICA 1FHGA 3FB6A 1Z9OA 2WYTA 3H9HB 2L4OA 2IPUK 2YO3A 1JGVL 3MLSL 3KLAB 4ZDHA 4DFHA 3UYRL 1JZDC 2EDKA 4M3KB 1LO3L 5F7EL 2AK4E 5JIDA 1CFNA 2VMDA 5ES4B 3Q1SH 4F7EA 1A7QH 2YMTA 2ICEB 4ZFOB 4DGYL 4ODTL 2EEDA 3HUJA 3Q2LA 1BMZA 2IANB 3BGMA 1BZ7B 3SIKA 1ZSDB 5F3BA 4X5XA 2BJML 1KCSH 2ZCLL 5FCUL 3BVXA 1SZNA 2Q3ZA 1OPOA 5E7BA 1P4LA 2CALA 1TJIL 1GYVA 1TUPA 2QQLH 2Z31B 2H3KA 5C0JA 2P5EB 5HGHA 1UKQA 2X4RA 2XQYA