4QXUH

Novel inhibition mechanism of membrane metalloprotease by an exosite-swiveling conformational antibody
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFIFSNYAMSWVRQTPEKRLEWVATISGGGRNIYSLDSVKGRFTFFRDNARNTLYLQMSSLRSEDTAMYFCSRENYGSSFTYWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti_MT1-MMP Light chain
publication title Inhibition mechanism of membrane metalloprotease by an exosite-swiveling conformational antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2014-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qxuH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qxuH01
5GS1A 5JOPD 3WFCL 3BE1L 1T1ZB 3C8KA 1FG2B 4CVZA 4K7FB 5D71L 3X12B 4QF1A 1UZ6E 5CBAB 2AJ3B 1AD9B 3VXOB 4GH7B 5E8OB 2FNBA 4ZNCD 2CD0A 2A0LC 1YA5A 2Q20A 3CGTA 3D39A 1K6QH 2XTJE 1KCUH 4M6OH 1AXSA 3RIAK 5T5FL 1DQDL 1NAMA 4F7EB 5EO0B 4OQTL 2O5YH 4RAUA 4NKIL 5ISZA 1JPSH 2D7MA 1QFWH 1VFOA 2BP3A 1CIUA 3O2WL 1A4JA 4KHTH 1D5ZA 1S7TA 1FLTX 3KXFE 1U8JB 3RIFK 3QHFH 5KVMC 2DLFH 5L2KB 4FHBD 2DKMA 2Q7YB 3MRFB 3E8UH 1JE6A 5EOTB 4ALAH 3ETBF 4PJ8A 4CMMA 4M6NH 3C60D 4L5FH 3UTSA 1NCUA 3V7AG 2VDLH 4PTUB 4PYHA 2GTWA 5IVZA 3MJ7A 3ULUF 4L3CA 2W07A 1HHIB 2XXCB 2C7UA 3UPRA 4LHJB 4YDKL 3ZLQC 3QXTA 3QSKB 4W4NA 1ZKAA 2ZUTA 5DK0A 5IV2A 3V4UL 3FB8A 1ND0B 3UC0H 4O5LL 1M7XA 1ZWIA 2BJMH 4QCIB 1C1EL 1HQ4B 4XXCA 4XWOD 1WT5C 4O4YH 3R0MA 2EDRA 4KQ3H 3ZKMD 3QA3B 4V1DB 1K2DB 3ARGC 4EUPB 2A6DB 1DQLL 3P0YL 5IW6A 2CRIA 1CLZL 3MRLA 4OF6A 3GSQB 5JR1H 3G6DL 4KTDL 3SDXF 3QT2A 4X9HA 2FJFA 5GIRA 4DVRL 3SOBL 3TBYA 3M8OL 2Y23A 5BVJB 5ICZA 3RTQD 5AZ2H 1KUMA 3IDYC 5HHNA 1A7BA 2H2PC 3RVVC 2HVJA 2VABA 1GZPB 3GSRB 5CGYD 4NQVB 1XZ0A 1B3JA 2EH8L 5K59F 2VDRL 3PWJB 4WI4A 1T7WA 3FOLB 4Q58C 4ZUWB 1YQ2A 3UDWC 1A6TB 4BSWB 3KDMA 5D2LA 3DXAB 1S78C 1FNEB 3CUPA 4AQOA 3HLAB 5LXGH 3MRIA 4G43A 2XTJC 3AREC 2Z31A 3NGBB 3ULSA 2AV7B 1P4IL 3NFNA 4GFTB 3BISA 1FE8H 3U0PA 2UZXB 3LKSB 4X6DA 3RGVA 5D7IE 3IDJB 5DD1H 4WUUB 3BKMH 5AG8A 2VXVL 1P4BH 3RVUD 2ICCA 4LVEA 3T77A 5C0IA 2VWEE 5TE6L 3V5KA 2Q8BH 4M8QB 3O41A 5FK9A 2I26N 5GSRA 4OCNC 3SN6N 1DANT 4OLWH 2NY3D 3KPPB 5FIEA 3Q5TA 1DANU 1K4DA 4OZGA 5E56A 2G9HB 2X1XR 1TFHA 4XCNA 5BXFB 5KSAA 1YJDC 4FFWC 3UJJL 1T5XB 4NQTA 4LNRA 4BFIA 1RV6X 4XCEA 5HY9A 4H1LB 1N26A 1P53A 1QHPA 3QXUA 4LCYA 4M1GL 1I7TA 4CAGA 3V5DB 1NLDL 5JLZA 4ELKA 2R8SH 3ISWA 4NNPL 3MFFB 2WBWB 3HUJE 4XVTH 4H0HB 4NKQB 3KS0H 5I19H 1ZE3C 3WNLA 2CQVA 2IBGA 3DARA 1PD6A 4PJBF 1U95B 1MY5A 3BI9X 4R2GC 2X4PA 5HJ3B 2HFFB 5IBUG 3AS1A 1TPXC 3O9WA 2M2DA 4N8VB 5D7LE 5T1MA 3DX8B 3SQOH 5DQ9A 5F1OB 4YDLB 5I8OL 2ED9A 4YDIH 2GAZB 4HKJB 3ORJA 3VMNA 5BV7B 2VDNH 2Y6SC 3QCUH 5CLTA 1DBKL 2F74B 2IJ0C 4PLKD 4XP1H 3W9EA 1XIWA 4U4BA 1LK3H 4MAUH 3VRJA 4EBQH 3UTOA 3I2CH 1CFTA 5FOJA 4G9FA 1YNTA 5E2VL 4ODVH 4G7VH 5KVEH 2ZG1A 1CS6A 4FQHA 5JIIA 5ADPL 4WCYH 4GRWB 3ARUA 5LBSL 5CJOH 5T3XE 1I8IA 3QO0A 3WFBH 1CN4A 4GKSB 2F19H 5D1ZA 5EUOA 4AQ1B 4JFYA 1RK1B 3B5HA 4N90D 3QWOA 1FVDB 1CGUA 3NIDF 5EOQH 2QR0B 4IRZL 1Z5LA 1QLFB 3FAWA 4XNMA 5F3HA 2JELL 3FT2B 5ENWA 2YPLA 4CNIB 4KRPB 4R0LB 4Y16C 4W81A 1E4KA 3WXWL 4PGZA 5CILH 3HPJA 1FNLA 5JDJA 5KSBA 1PSKL 1ZTXH 1BVLA 2EDEA 4Y2DB 3MO1B 5HHOD 3N9GL 2E6QA 2OSLA 5J06A 4FXKB 5IMKA 3SE8L 4Z7NF 3CFBA 1Q8MA 4I18C 3MRJB 3BP4B 1QR4A 2XNAA 4XCFH 2D03H 3U9UA 1LO0L 2HT3D 4YDJA 4L8CB 1CLCA 3LB6C 1JIBA 2VL5B 2PTTB 4JZOA 2MQCA 5DMJB 1S9VA 5A2IH 3X17A 4KJQC 1T83C 3JBG7 5EZIH 3FT3B 5D7JD 3QIWB 2AKRA 5BS0A 5I1EL 1NBZA 1PEZA 5A43C 4OV5B 4UI2A 3EOBA 1RK0B 3MJ8B 3HB3C 1YEGH 1UCBL 4MGXA 4OFYD 5FUCE 1Q0YL 4CMHB 3K74B 5E5MA 3CFDB 5GRUL 1ZANL 3S98A 1J9CT 4POZD 1KPUB 1X4XA 2IPKA 3MUGB 1MCKA 1CD1B 1LEKB 2VUOA 3IVKB 5L2JA 3U30B 1JNNH 3MV7D 3RVXD 4XNYL 3B9AA 1UWEH 2AJYL 2XICA 4FS0A 5J9PA 1ZLVH 1WFOA 3BDYH 5KSUA 4YQXL 2WWKO 1HKLL 2Z91A 5IB1A 1HDMA 5ICYA 2FIRT 2OMBA 1J1OH 2CLZA 3RWCB 4PJDE 1A21A 3P9WB 3IJYB 4HGMA 2EIZA 1UYWH 4IDJL 4H8WH 4I8DA 3BP6B 1DVFB 3U2SA 4HX1B 1DP0A 3F12A 1DBAH 2I60L 4FQXD 1QRNB 2GIYA 3MLPA 3ZE1F 1CFSA 3MNVB 4H26B 1UVQA 5IKCA 3DSFH 2GY7B 4JCLA 4ONGL 1PKQB 3KGRA 5DJ2B 2GFBA 3SDDA 5CGMA 2DBLL 3GZKA 1XEDA 2AJXL 1EHLL 5DT1H 2F53E 4E41B 3MBEC 2AGJL 1YYLH 3O4LE 1NGXB 3GSNA 2N7AA 3KPQB 5DMYA 3LMJL 3CX2A 2IPTH 1NAKL 3QPQD 1UH2A 5TQ0H 4XNQB 2DYPB 4DAGL 3QIUD 3UCRA 3RAJH 4YIQB 1UADC 1U8MA 3LS5L 1YQVH 4YHPA 1CYGA 1XFPA 4LP4A 3QRFM 3MRQB 3E2HC 3TEUA 4PP2A 3DRQB 2E7LA 4Z7UA 1G0YR 2EDNA 4HK3N 2Y07H 5DF0A 1FGNH 4XBPB 2A9NL 1GPOH 2I27N 2HFEB 3MRCA 4OIIL 1DBBH 5D6CA 3IFOB 2DD8H 4MAYB 3PQYE 4Q6IC 4DKEH 4P4KA 1LQSR 3VGFA 4JY5H 4EVNA 1UT9A 3BKJH 2EE9A 3VXSD 2J8UE 4XXDA 3D3VD 4TTDD 4LLUA 4YDVA 2HRLA 5DDHB 3MV9D 4GLRH 2VL4A 2WBKA 4GBXC 4HUXA 5D2NB 1I9RL 3RHWK 3U4AA 3EDDA 3HE7A 3T1FB 5IJKC 5FECA 5FYKH 5FGCE 3T3MF 3JWOH 2B1AL 3MA7A 4L9LC 4AEFA 1NJ9A 2XN9A 3VH8B 4GXVH 1OP9A 3N1FC 4NHCH 4UQ2B 3RKDC 3ARYA 5I0ZA 4Y4KB 1IAKA 1E4JA 3HR5A 1GIGL 1YNLL 2C3XA 3C8DA 1DSFL 1W72B 1TJGL 1N59A 1T0NA 2HJKB 4FNLH 2V6HA 1K5NA 4K23L 3TNMB 1FGVL 4OJFL 1N6QH 1CFQA 3VJ6B 5LWYH 3S36H 2EC8A 2YPVL 3T0BA 4GT7A 2BX5A 3WO4B 1CFNA 1U8KA 3D6GA 2AJZB 5BRZE 1JZ8A 4XWGH 5ACMA 1F8TH 3C6SB 4Y1AA 4GW4A 4JRYB 1NFDA 4K71C 2BVPA 2XZAL 3BWAA 5DR5L 4O58L 2MHAA 4D0CB 2OI9C 3OXRB 4NUGL 4HUKB 5KVFH 1A7OH 5T1KD 4DOHE 4FN0A 1U8LA 2J7LA 4NO2A 3SDAD 3TH3T 3CH1A 3MODL 5KS9A 4PJHA 3KPLA 1MVUB 3KXFD 1JGDA 4M6ML 4WFHD 1R6VA 2HTKD 1Z0NA 3VFTB 3MXWL 1CFVL 4IJ3C 1YECH 3VXUE 3VWKB 4Z77B 2VTFA 3VFVA 3UTZA 1AGDB 1Q9LA 1JTPA 3UTQB 2ENSA 1I8MB 1V7NH 4DGIL 5EIIA 1T0PB 1WV7T 4OTXL 1OAKL 1CXLA 4P5MA 2AI0H 4GG8A 4GJTB 4ZO7A 2VRAA 1A1OB 4M5ZH 3BYYA 1LD9B 4BKLB 3RZCA 4JO1H 2NY0D 3L7FB 4DUVA 5DRZA 4UTBL 3L5WA 3UYRL 1VGKA 4M7JH 3DROA 3NBNA 2VLRB 1MJJB 3KS0J 3RDTD 3G5VA 2FB4H 3H9SA 1UACL 1CQKA 1KT2B 1XAUA 1H9VA 3FO1B 1CD9B 1R5IA 4OBRA 2P8LA 1JZ7A 4IIQC 2LU3A 5C1MB 4ELMA 5FCUL 2MNUA 4JO2L 3WFEL 4J1UA 1JGLL 2Y36H 4RGOL 1YMME 1NGYA 1EH9A 1T1YB 1CL7I 2LQRA 1YY8B 5H2BB 1IEHA 2E27H 4NKOA 4U1IB 1YNKL 2B1HL 3O6LH 1I7ZB 4PJCF 5IUSA 1GJIA 3TO4B 1FNGB 1RZ7L 2Y06H 4HK0A 2BY3A 3L3DB 2Z4QB 3QUXD 2OMNA 5HHPB 3BQUC 1NMCC 2XFXA 4WV1A 1ONQA 2A1WH 4RFEA 4OQ1A 1P9MC 1ZVYA 3GSNH 2Q3AA 2YPKA 1U8IA 5EZLB 3WJJA 5FOBB 2H3NA 1ES0B 3KLSA 4Z7OE 3ARSA 2BSRA 1QFHA 5TDPA 3QDJB 1IC4H 4BK5A 5F9JA 4FA8A 1EEQA 4DQOH 3PWUB 4JAMB 5I8EA 3KYMA 4P5TD 1RIHH 1OCWH 3D69A 5IEHA 3MRKB 4U0QB 4ZTOH 5KTEL 2DQFA 2BRRL 2JK5B 2W65A 3KJ6H 1RIUH 4OKVB 2O5ZH 1Q1JH 4L3AA 4WHCA 3D0LA 5L9DH 2YS4A 2PNDA 2ERJC 1WZ1L 4UIKH 5DRWB 5IJVA 3GMOB 2EXYC 1DUYB 2BC4A 3UTTD 3B9KD 5I66B 1VB9A 4HQQL 4PJ5A 2K1MA 1FDLL 3HAEB 5TGBB 1BVKA 4JN1L 1AKJA 5EORL 4WI2A 4P2QA 2LVCA 2V17L 1I8KA 2FR4A 1EFXD 4NPYB 1Y18A 4LSTL 2Z9TA 2JIXA 1ADQH 5GS2D 1F2QA 1Q9OA 2Z93B 3CFKA 3FB5B 4JRXB 4PJBB 3WSQH 2NY1B 5ITFB 1M7DB 4P23D 1QBLH 3C5SB 1F6AB 1FLRL 2YSSB 4DN4L 4YX2H 4Z7WF 1U92B 1CG9A 4NQCA 1WWWX 5B8CC 4L4TB 3GJFB 4AIZB 1W8NA 4JM2D 1IBGH 4J7RA 4NRZB 4P2CG 4FTVB 1JFQH 4HS6A 5AG9A 2QV2A 5IVXA 1ZGLM 4HGKC 4WEMB 4ZUUA 5C9KA 1GHFH 1U42A 1VKXA 5D7LD 1JV5B 4JGMA 3K1DA 2ESVA 1ZHNB 2R39A 1F4YH 5DJ8B 1P1ZB 1S9WB 3OMZA 1IM3B 5JXED 5E6IA 2DWDB 4GRLC 4N8CH 5C0ND 1E6OH 1KIRB 3DTXA 2BNUA 1WEJL 5JXAL 3FO9B 1MQKH 1BPVA 5FHAH 1IKNA 3QUMB 5EU4B 4FQJL 3CSBA 4R4NC 2P7TB 2ICWI 1CGVA 3NA9H 5KANI 3LEVL 4XMPH 2ID5A 3NA4A 1GAFL 5E4IA 5C0CA 3RNKA 4MNHA 3QEQE 4QRPE 5T3XD 3MRBB 4AENB 1JWUA 1T1XA 3QI9A 3MLUL 3U36A 3CPLB 4ZAKA 2PO6C 4UOW1 4MXVF 2ARJA 2YKLH 3WCYA 3TBWB 3EDEA 3DX6B 1T2QL 5C07B 3A67L 3D2UD 3STZB 1ZT4B 3ZTNH 1D9KA 1N0XH 5KAQG 5CP3H 3CJJA 3OPZH 1DLHA 1MRFH 2AEQL 5LQBL 2C3VA 5BQ7B 5EBWA 3O2DA 2DLHA 1S8DA 2JJSA 1DQMH 2IQ9L 3NIFE 2R29L 2R2CA 3O11A 5JIHA 5B38G 2A9MH 4MB5A 5J6HA 1UFUA 1ZVSB 1UZ6F 1T3FA 3EO0A 4WTWA 3T0EC 5BZDB 5GZND 3HS0B 4ZO9A 4R26H 1JGUH 1JWMA 2WQ8A 1OGAE 1QFWM 4NKMA 3STLA 4M7LL 4WWKA 3KG5A 3MLYL 4L4VD 1F13A 3QQ4A 4X4ME 3V9FA 2AXJA 4XHJC 1CR9H 2AJVH 4IOIB 3G04B 2NY6C 2V9TA 3BPCB 2B2XH 4GAJL 2VLJB 3OJMB 4JPIB 2FBOJ 3LQMA 4UNUA 4L8DB 1T66D 3BH9B 1I1AA 3U46B 4M9PA 1SM3L 4XVUD 3IFNL 5DD6B 4K8RH 1F2XK 1MLBB 4NJAH 4NKDB 5EZJB 1KIPB 2K3TA 1T2XA 4YHIA 4N0FA 5GS1C 5I1CL 2B8OT 5T5NG 2F5AL 1Q9WA 5IG7A 1A7QH 5T3XL 1UGNA 3H3PL 2QQNH 3TT3H 25C8L 5J13C 1RUPL 3K4AA 1QR1A 1TETL 1Z3GH 5MEQB 4NC1C 5T3ZH 2F8XC 5DFWH 4R6UA 1UKTA 4M5YH 1FL3A 3RPIA 4HXAL 2GYSA 3DECA 1D3CA 4MD4B 4HIXL 2J6EL 1G7IB 4PJAE 4ZXBD 5J8OA 1YDPB 2R9HC 4QTIH 3CFCH 3KPSB 3IDXL 2D31B 3VI4E 2XA3A 4Z5RB 3QDME 1LK2B 5F3BB 3AU1A 2D3VA 1AQDB 1ITBB 1T1WA 1HCVA 1U93A 4UDUA 2LTQB 4PJ8C 5FO8A 3ZSSA 1MY7A 5F1KC 4OGXH 1W0WB 3QCVH 5F93C 2KZWA 5HGDA 4XPGL 2OYPA 3QIBB 4Y4HD 5DK2A 1BD2A 1WIOA 3G6JE 4S10A 1N5AA 1IKFH 4JG0H 3O4LD 1OM3L 5IP4A 1EGJL 2X9XA 4G8FA 2V9RA 3MRRA 4OLUH 5I17A 1BZ7A 1PFCA 4OFKA 5CKAA 5F7MC 3VXQA 1KN4H 2FCBA 4JLRB 2CK0L 4YPGA 1QFPA 1QEWA 1UQSB 3U1SH 2EYRB 2X1PA 2FGWL 1RZGA 3VFRA 2DRUA 1OSZB 3MLXH 5EU3B 3GB7B 4XXCC 3MOAH 2CMRH 2VSCA 2X4QB 4RSVA 1T7ZA 4OUUA 4KK9D 5J1AA 5A16B 3TFKD 2VOTA 4I3GA 5JW4R 2NY3B 4IMKA 4WW1B 4ZS7H 4X8XA 2Q86A 4PG9A 2DN7A 4QRQA 1QBMH 3U7WL 2BOCB 2FECI 4LSUH 3CFJB 5JHDB 1NMBH 1T20B 1XGTB 1A7PL 2ZPKL 2NW3A 5F7LB 1YY9C 2MSPA 1J10A 2ICWA 4G9FE 2GSGA 1CICB 5EZOH 1T1ZA 1Q0XL 4JFXB 3X12A 3A6OA 5GGTL 2Z31C 3QAZC 5FYKE 2R23B 5GHWL 3L6FB 4NFCA 4PJIF 5C7XH 4O51B 3RGVC 2CRMA 2V2XB 2VKWA 3HUJF 2ZCHL 2I5YL 4WFEE 1XGYL 4HKXA 1BWWA 3Q5OA 4F7EA 1HH6A 3JV0A 3O6FD 2YPLE 4YHOH 5D1QB 1S7UA 3WFZA 3MA9L 3O2DH 4KTEH 2HG5B 4X6BB 3TVMD 4APQD 1NC4A 3VWJA 2QSTA 5JTWA 5ESQA 3S3SA 2X4SA 2ZZUT 4U6TA 3C6LD 2Q7YA 3MRFA 1OSPL 5E7BA 5LCVL 3LRGA 5KSAC 4J6RH 1ZOXA 4XNXL 3GMQA 4OM1L 3QFJB 4AEHL 4OZIA 1MIML 3MV8B 3B83A 4KKAC 1N64H 1PQZA 2DQTL 1JK8B 2IGFL 4M7ZC 4PGJA 5E03A 1IGJB 3MRDA 4P9HH 1IL1B 1CL7H 1FAIL 4F37F 4NHUA 3T0XA 5CLWA 1NBYB 3WL9A 3TZVB 5DJXB 5E08L 5T33L 3N1MC 4FQ1H 1A3LL 4WHDA 4ENED 2PTVA 2XTLA 2C26A 2P24B 4JFZH 3JTTA 3KR3H 3O9WC 2F9BT 3RI5K 5F8QC 1LVEA 5SX5H 2FJHA 1OAUL 1HQ4A 1NCNA 1NL0H 2DL9A 1IC1A 2QEJA 4JFFB 1KJ3H 5CCKL 4NDMB 3ZDXF 5HHOB 1OAXL 5HHQA 2A6DA 2BVOA 3FRUA 5CSZB 1S7QB 1AGFA 1EO5A 5EC2B 3MLZH 5EU5A 4ZTPH 2BNQE 3RP1A 1OLZA 3ET9F 1XIWC 3DUUB 1JPGB 5IWLA 2VLKB 1UB5B 4Y5XA 3NAAL 3FOLA 4ZD3L 4ERSH 4NBYB 1KNOB 3O6KH 4FQLH 1A6TA 4UV7L 12E8H 1G6RA 1GVIA 5D1ZC 3ZHKA 1FNEA 4X7SH 5ESAA 3JWOC 2P4AB 4PJCB 4OLXL 1LEIB 3OJDB 5CJBA 4ZS6D 1GGTA 1KJMB 3IAPA 1UG9A 1YMMD 4K2UH 2FSEA 4GAGH 4WUUA 2DQIH 4FRWA 3EZJB 1CT8B 1E4KC 4P2YA 5IBUB 4JZJA 4F8QA 3G08A 4HZLB 4MJIE 3DURA 2V7NA 1KCUL 1WAAA 2FATH 4M8QA 3QWRD 5B3NA 2E7MA 5EO9A 1FZKB 2NY4C 5DEFB 1AR1D 2WZPD 1BBJA 3W9DB 1WBXA 2GTZA 5EA0H 2O5YL 4FXGA 3BIBX 4LAJH 1JPSL 1QFWL 4NCC2 1J86A 4D0BB 4OCSH 4KHTL 3VXNB 3QHFL 3RWFA 1IT9H 3VGHA 4I0CC 2DLFL 4X7TA 1T5XA 2NPLX 4L9DA 4R7NB 5GGUB 1INQB 2AJSH 1FCGA 3TPUB 3E8UL 3REVB 4O2FB 4PJDF 4ALAL 3S37H 1JPTH 2ICEB 4UTAH 1NEZG 4M6NL 5IM7B 4WI3A 2VDLL 3V5DA 2NY5H 4PTTB 5F1NB 3WNPA 3QP3A 3SEPA 3BGAA 3V7MA 3TO2A 2AK4B 4K7PY 5GJSL 5C8JB 1TQCC 2WLYA 4Y2OA 2YD1A 1KEMH 2R1WB 1M7IB 2HA1A 4UB0H 2XA8H 3MGTA 4YHNB 1RURH 2GAZA 2WBJD 4FQPA 1MWAA 2RQ8A 1F11A 1L7TH 3SO5A 4K3HA 4PRPE 3UC0L 4Z7WB 5KAQF 2ADJA 3QIUB 2CDFB 1OW0A 2A74B 2YXFA 2BJML 4G6MH 1SMOA 4XCYB 1JHKL 1JP5A 4NCC1 4O4YL 2XN9E 4IRSC 3EYVA 4KQ3L 4YHML 3TP4A 1I3GH 3O45B 3ZYOA 2PN5A 5JR1L 4WI8A 3CNKA 4YGVB 1EAJA 1EEZA 2CDEB 1S5IH 4DKFH 5LGHL 3GO1H 1JYVA 1ORQB 5ACLA 2CLRB 5AZ2L 4QWWC 1DLFH 2DMKA 4XAWH 4I4WB 1ZLSH 3MYJB 3ESUF 4GAYB 5E4EC 5EPMB 5FA4B 3JV5A 4I2XA 3ZSTA 4HWEH 4IEFB 1NGQL 2QJDA 3WKNA 1F58H 1VSCA 1X5GA 1OHQA 2YEZA 3M45A 4KFZC 3VXSB 1A9BB 1QLFA 1YPZE 3WYRA 4HIIA 4S2SA 3SDDC 4X4ZA 3FT2A 5LXGL 2IANB 5GS0D 4CNIA 2RR3A 1NFIA 3LV3B 2MQ3A 1VFAA 5JW4N 4OCXH 4QXUH 2D0HA 1FE8L 1OF2A 2J8UF 5DD1L 5JOFA 3BKML 3MO1A 3KLHC 1E27B 1EIBA 3QEQD 4QRPD 1F3DJ 1AE6H 1P4BL 4MMZC 4F3FB 3BP4A 4MWFB 3C8HA 3JWNC 4Y5YA 2Q8BL 3BZEB 1U6AH 5T5NF 2ZUQC 3FOMA 4YBHA 2F5BH 3SGJA 4L8CA 3OBAA 1RZIB 2PTTA 2E7LC 4OLWL 3PHQB 5EWIH 1CFBA 3V6ZA 5JW3H 3KAAA 5KJRH 3MPCA 4CADA 5C0DB 3IXAA 4GG6A 2OLDA 1X4ZA 3K1KC 2FEDC 1J5OH 4OV5A 4KDTA 4P4KC 1OGTA 2EKSB 4S1RH 2JJTA 3ARFD 4JQVA 5E2UH 1QQDB 5HD8C 3WFHA 1U8OA 3BDBA 2XTJB 3AREB 2R8SL 2ZCLH 2YMXH 4Y8DC 4XVTL 3SBWA 1H3GA 1LEKA 3RFZC 3Q1SH 1OGAD 4I5BB 3H9SE 5I19L 2IBZX 3HE7C 1G6RH 5E94B 1IEAB 4N0UB 3GGWB 3KXFB 1SJEB 3HNTH 3C08H 1WQVT 3SQOL 1OARL 3DV4B 3DV6B 4MCZB 4KKBC 4WU5B 3EDKA 4YDIL 1CD0A 2QSCH 4OLXH 4M48H 2VDNL 5DO2C 1PZ5B 3QCUL 5GS0L 1R5WB 3RWCA 5JPMB 1X3DA 3HZVA 3OKMB 3W0WA 4I48B 4XP1L 1D5MB 1LK3L 4EBQL 4NQDA 3H3BC 3I2CL 3LRSA 5CUSH 1DVFA 5CJ8A 3C5ZD 4JEGB 4HX1A 5DGRA 4ODVL 4G7VL 3DMMC 3OSKA 1DCLA 5DFVD 4Z6AT 3MNVA 4FFVC 3RDTB 4BK4A 5CJOL 5E8PA 3WFBL 4ONFH 2BCKB 2F19L 4JFDB 4KHXH 5DJ2A 2XWJB 3P4OB 4EXPX 1UWXK 1FC2D 1M05B 1IGFH 5EOQL 5DC0A 5T3ZE 1VESA 4E41A 1K4CA 3VW3H 4R2GB 2GJJA 4FQIH 5B4MC 1LHZA 1G0XA 1XCTB 4AZ8A 4C57C 1S9XB 1WGOA 3MUJA 2YD4A 4XNQA 4HWZA 5CILL 1LEGA 1MSPA 4Y4FD 4YIQA 1FO0L 3KJ4B 5TH2B 1C12A 3QDMD 4Y19A 4S1DC 2XQYG 4MA8H 1DN0B 5FGSA 3LKNA 1D5XB 3DRQA 4OGAD 4NP4L 3BXNB 4CU7A 4XCFL 2D03L 1MWAH 1TQBC 1U8NB 3QDAA 2JCCA 2E7HA 5FV1L 3RZCC 1N3NA 1ZV5A 3IRPX 5GJTH 3R1GH 2HFEA 2NNAB 1H0DB 3S88L 2VN4A 4C56E 3X13A 4UU9B 2OP4H 4OM0H 1BGXH 4HT1H 5IMLB 3EFFB 2QADC 4RQQA 5EZIL 2DLIA 5E00B 4U7SA 3SDCA 2NYYC 4NN6B 5E2JA 3BVNA 1Q72H 3EHBD 5GQBA 3UJTL 1Q9KB 5DDHA 5CZXD 4NQCE 3PDOB 4PRBB 3QUZA 4LFHD 4JFEB 3MCG1 1KIQA 5T1LB 3QQ9D 3PWVA 1B0GB 3QQ3B 3LKQB 3EYFA 4U6HB 4Y16B 2EIEA 1JF6A 4JKPH 2E3VA 1IGCH 1IAIH 2DQJH 3LKPA 4IRJA 3TN0D 1CK0H 2GSIA 1LDSA 5IHZA 1BLNB 1JNNL 2XG5A 3T04D 1UWEL 2W60B 3KPOA 1X5YA 1W72A 4BSJA 4MS8C 3TH4T 2HJKA 4I18B 4AT6B 2WWMD 1CDBA 1EFXB 3BDYL 4K8RC 2PETA 4WV1C 4ETQB 3K2UH 4K94L 1J1OL 3WJJC 5B39G 4LHUG 4PRAB 4JR9H 1QSFA 2R0KL 4HV8A 4PJIB 1KB5L 1JPFA 5C0EB 3HUJB 2XWTA 1UYWL 4LVHC 3C6SA 3GEWB 3OXSB 4U6XA 4H8WL 4G80B 4ODTH 5FYKD 4JRYA 4KJWD 3WKMH 1DBAL 1JRHH 2VLME 3OGCB 3J7HA 2BVYA 1MHPH 3LN9A 3OXRA 4WFED 4ZSOE 3DSFL 2X7LB 2R1YB 4RA0C 2AEPL 2X9WA 4AL8H 1U91A 4PY7A 3K4ZA 2R2BB 1KBGH 5DT1L 2EDXA 3FQNA 2HJFA 2K9UA 1L7IH 4WNQA 4OFDA 5LGJB 4PJFA 5GZOD 1TIUA 3CVHA 3V4VH 2IPTL 3QISA 1QA9B 5HDQH 5TQ0L 3ARZA 3P2TA 1U8PB 3WDIA 1RPQA 4J3XA 3RAJL 4PRIB 3TJHC 3HC4H 1X44A 3GSOB 1P84K 1YQVL 3ALXA 5DZLA 4BJLA 1IFHH 1KC5L 3G6AB 1A1OA 3JV6B 1OB1B 1LD9A 4MNQB 5D5ME 2J8HA 3IRZA 4BKLA 4LCUB 1I7UA 2Y07L 5JPNB 4IMLB 2BNRB 4ESKA 1EV2E 3P73B 3EOTH 3LSOA 4XPFH 1FGNL 3P4NA 5BJTB 1GPOL 3HNSH 1DBBL 3BZ4B 2WWKT 2APFA 4IOSD 3FB7B 1MREH 2ADGB 3K8KA 3OKKA 3BRFA 4H88L 1KT2A 3PHOB 4HWBA 4DKEL 5IR1A 1LE5A 5BCAA 4JY5L 3MRMB 3BKJL 1BF2A 2EYSB 1N4XH 1ORSB 4L4JA 5E6IC 4PV8B 3ROLB 4MYWB 1JHTB 4TUOB 1GXEA 3F7YA 3MOQA 5FYKL 2PF6A 1PEWA 3ARBD 2BNQD 2O61A 1GL4B 1IKNC 4KXZH 3JWOL 3NIFF 1LGVA 3TO4A 4GXVL 4LMQI 2JJVA 1KN2H 4NHCL 1BBDH 5MENA 4GKNB 2Z4QA 1K9TA 3PGCB 5CWSB 3E2HB 3F6IA 4CVXA 3IF1A 5HGBA 1XGRA 5CEZE 1MOEA 4FNLL 4K7PL 1FQ9C 1RZJC 4LHUD 4DGYH 5LWYL 3QI9C 4ZAKC 3WNNA 2OR9H 1GOFA 4FP8H 5F88A 5TDOA 3PWUA 5MERA 4Q6IB 2KH2B 3L5XH 5DJ6B 5DMIL 1D9KC 4XWGL 3MJ9H 3WV0A 1F8TL 3O8XA 3WNOA 4N5EC 1ETZB 5KW9H 2JK5A 2DM7A 4MXWH 4MJID 2X89A 1T04A 2JJSC 3GMLA 4GBXB 2VDKH 1NUDA 3GMOA 5F89B 2XIDA 3KHOA 5MEPA 2ICES 5KVFL 1LO5B 3D9AH 4P2RE 1NCCH 4GKZB 4X7EC 4X6FB 3HAEA 2X4UB 3MLTB 5D2LF 4PJDB 3U0WH 4YHZH 4S1QL 4WWKC 1YECL 1YN7B 2CXGA 1QYGH 1WCBB 1I9IH 3SJVB 1SQ2N 1WISA 2FEEL 3RWEB 4NZUH 3HMXA 1CIDA 1V7NL 4YE4H 3CFEB 2BSTA 3FB5A 5H35B 5C08E 5ITFA 2Y5TB 1M7DA 4P9HC 1CGTA 1Z6JT 3C5SA 3CMOH 1F6AA 3B6SB 2UWEE 5TDNA 3I6GA 2X5PA 5F7KC 4M5ZL 2I9LB 1U92A 1I1AC 3SCMD 3VI4F 4LPUA 3QNYA 4J3VA 4AIZA 1H3WM 4M7JL 1GGBH 2F53B 5CEYB 3C9NA 3OQ3B 3EBAA 1ZHNA 5C09D 3D25B 1OTUD 2EECA 2GW5A 7FABH 1HINH 4PRPD 2V2TB 4RFNC 4LPCA 5GSVB 1KIRA 4U6YB 3P77B 3VGAC 5B38B 4NQEA 1CGXA 2CO7B 2HTLD 5F97E 4RGMC 4IJ3B 5HYSA 2EZ0C 2P7TA 2E27L 1RFDH 5L8JB 3U0TB 1UJ3A 1G84A 2VR5A 4H25B 1PGRB 1C5BH 3RVWC 3TCLB 3L3GA 1KFAH 1QPXA 2Y06L 3WS6A 4UNVA 5I1LB 1I3RB 3PQYB 3HMWL 1WUNT 4AENA 4MQSB 2A1WL 3CPLA 3GSNL 4RAVA 5C6PB 4LDOB 4N0CC 3I9GH 3TBWA 5L8LB 3DX6A 3CVHH 2BHUA 5EU6E 4HG4J 3STZA 2GT9B 1N8ZA 3ILPB 5IIEB 1ZT4A 2J8UB 1TJIH 1IC4L 3CSPA 3D1MC 1ZS8B 2G2RB 1MCSA 3MBXH 5D9SB 4DQOL 1FFNB 1TZIA 1CLOL 3PWLB 3VFPA 1YEFH 1S7XB 1RIHL 1OCWL 1UM6H 2NZIA 1J0YA 1ROWA 4ZTOL 4HC1A 1H3UA 1RIUL 2O5ZL 2PW1B 1Q1JL 4KK5C 2G75A 5L9DL 3RWGB 5BZDA 4NNXB 3GSXB 4NGHL 4JFOB 4EOWH 3HS0A 4DFIA 4GOSA 1EXUB 3H9YA 3INUL 5EUOF 5DA4A 2ADIA 4Q9BA 2NXZD 4MB4A 4MCYA 1OAZH 4LHQB 2DQDH 3VFWA 3TVMB 2L0DA 4WENB 4APQB 5BRZB 4IMKC 2DI9A 1NMCB 2JE8A 1NGWB 4OAWA 3W11D 1UA6H 2NY5C 4JDZB 3TA3D 1ADQL 5C0JB 3B2UC 3C60A 4L8DA 3WSQL 1QBLL 1R3JA 5DD6A 3G5ZB 3U4BH 4HUVB 2GJ6B 3NIGF 4YX2L 3DVGA 4O9HH 4TSAH 4DOHB 2WAHA 3CU7A 1J1XH 1IBGL 1K8IB 2EIDA 1JFQL 4U3XA 2F58H 1GHFL 4HIHB 2P1YA 1V8HA 3BD4A 3VXUB 1FC1A 3AB0B 3BAEH 2ERJB 1F4YL 1BECA 4MX7B 4EZMA 3BKCH 4DKDC 1XGQB 4DEPB 4DVBA 4N8CL 2HRPH 1IMHC 4HHAB 1E6OL 1ZHLA 4MD4A 3DIFB 1BQHA 3BH8B 1LO4L 1MQKL 4HPYH 3MRNA 4LCWB 4WRLA 1HHHB 1FYTB 5FHAL 3WEXB 5SWSE 3ECBA 3TWCH 3KPNA 3VWJC 3IDGA 2A38A 4Z5RA 5CD5C 3RTQA 2FWOB 4QHUB 4U0RB 2VITA 5F3BA 4P3WA 4XMPL 5HGAB 1AQDA 4HEME 1SVCP 3OG6B 2C1OB 4ZMAT 1KCRH 1FV1B 5KVGH 3M07A 1KLUA 5HHMB 2YKLL 4U2YA 3P0GB 1XR8A 3H7BB 2VB5A 3HMXH 4KV5E 5F1IA 5T3ZD 4BFEA 3GBLA 5F7YC 4PJEE 5C0FB 3ZTNL 1N0XL 4WDIB 3MV01 1EJOH 1BIIB 4P46D 3OPZL 4QHKJ 5IB5A 3GUTB 3UEZA 3SGEI 3T8XB 2VQTA 4U1HB 4WHTB 1DQML 3OHXA 4JFQB 5CKGA 2ARJQ 3O3AA 1OSZA 2A9ML 4NKIH 3GB7A 3RWIB 3L3IA 3QNZB 5A16A 1EHAA 2I9TA 4R26L 1JGUL 4QRTA 3P4MA 1Q94A 1FYHB 2ZNXA 3IAQA 4P5KB 4WO4D 1PDKA 4C56D 4JJ5A 3IYLW 3BN9C 5IFJB 4RZCB 3HG1E 4HZAA 2BOCA 4NCDA 3CFJA 3IKKA 1XF2B 1CR9L 2AJVL 4QHMA 5IWLC 1NC2B 4EQ2A 4Y5XC 4KKLD 2OTPA 2B2XL 2PO6B 1BIHA 3AAZA 4MLSA 3RWDA 1QNZH 1NDMB 1RUQH 4QGTA 3I6LE 2GHWB 2VNCA 4K8RL 1XT5A 3GSWB 1AO7E 5HPMB 1AD0A 2J3SA 4I2XE 4FXLA 4Z7UF 1UM5L 4FZEH 5J1SC 5IMMB 1CGSH 1S7SB 1B6DA 3OB0K 1XR9B 2QQNL 3TT3L 2L7UA 3X3GH 1GGIH 1HNGA 1JWSB 4F7PA 5JO5A 4UT9L 1Z3GL 1P5UA 4JZJC 5T3ZL 3DWTA 2CR3A 3TIEA 3RX7A 5GRJH 4JM4H 1AR2A 1WZLA 2X4OB 4X6BA 5GGSY 1GZQB 4E0RB 1D5IH 2Z92A 4HC1H 5F7NC 2GQHA 2X70B 3ESVF 3M8OH 43CAB 5EC1B 4DJMA 2Z8VC 1D5BB 4L8BA 4W6XB 4QTIL 3CFCL 1I4FB 2NY6B 3GMPA 4XPTH 1BQSA 1T80A 4D0DB 2VLMD 3RY6A 2EKJA 4NO3A 5EG6C 4XMLH 4W6YB 1F4XH 2VDPH 3O3EB 4DW2H 5CEXA 2HLAA 4OGXL 3H9HB 3QCVL 1IGJA 4KROD 4R9HA 2CUMA 1R5VA 3C8KB 2ITCA 4CVZB 1SJHB 5BMFH 1P4IH 2RJMA 3CMGA 5DJXA 4TTGA 4QF1B 4A6YH 1IKFL 2LE9A 1OP5H 4JG0L 3MJGX 4LASH 5J13B 2DOCA 4HUUA 2VXVH 4OLUL 2X41A 3VFUA 3D39B 5JHLH 4YDLC 1F42A 3FN0H 2H2SD 3DETC 2CIIA 1YUHA 1CXKA 5HHOA 3U1SL 1JHLL 5BV7C 1SBSH 2X09A 3QEQB 1NFDF 3EJYD 4QRPB 4GMTH 4GRMB 1OW0C 5ISZB 3H0TA 3MOAL 4EJ1C 2JB5H 1DDHB 1S7TB 1PJ9A 4WTXA 4CN4A 1MCBA 3UJJH 3WXVH 4KUCD 5AAWA 1VPOL 1UB5A 3F7QA 4ZS7L 2MCPH 1OT2A 1HYSD 5M94B 5F9DC 5F96L 1QBML 1ZXQA 4Y0GA 5D7JA 4LSUL 3JUZA 3UTSB 1NMBL 3MLWL 2B4CC 5JZ7D 4NIKB 4NNPH 5IVZB 2C3WA 4L3CB 1NEZB 5I1HH 4OFYA 3PP4H 3ARFB 2P48B 3OJDA 5EZOL 2C7UB 4M7KH 3UPRB 2FHCA 4R0LC 1F00I 3FFDB 5GRXG 1P7QD 5DK0B 4X6CE 5IV2B 3MV7A 4WU7A 2EE2A 3VG9C 4RMWA 5C7XL 4NYLA 4LCCA 2OR7A 1TTUA 4NUJA 5D96C 2X4RA 5CEZD 1E4XH 3ARTA 1B6UA 2EO9A 4YHOL 4Y5YC 1OQOA 3DI2B 5IW6B 3O2DL 3MRLB 5E8DH 1NMAH 2YD8A 3WD5H 3SGJC 3X11A 5E2VH 3VXNA 4ELMF 1URLA 4RWHA 5B3JE 3WUZA 5A40E 4Y19E 5GGUA 1INQA 4NNYA 4D9RE 2HVJB 2VABB 3TPUA 2I07B 1X5JA 2FIKA 5F6IC 4J6RL 3FQXA 5DUPL 2ATPA 3TC9A 4FQXA 5IESH 4OD2B 5I74B 3CIQA 4KDTC 2FX9H 4PTTA 3KDMB 5D2LB 4HH9A 1EVUA 5DEZA 2JJTC 3CUPB 1N64L 4LNVA 4JQVC 5C8JA 3MRIB 1MHEA 4LLAA 3R8BB 4G43B 4P9HL 2Z31B 4P2RD 1JCKA 3ULSB 3SBWC 3REWA 1J05A 1FFOB 3U0PB 3WE6A 3RGVB 4FQ1L 4LAQH 4YHNA 1EFQA 2J88H 4JFZL 2IG2H 1YZZA 3TBTB 3T77B 1HKFA 2A74A 4IOFC 3NOIA 5C08D 4Y4FB 1LO0H 1NL0L 4NZTH 3QDMB 1KJ3L 1OD7A 2NXYD 4PJGA 5CFHA 5J12B 3M1BA 2NX5D 4U1NA 1ZEAL 4QOKD 3O45A 1K4DB 4G9DA 4YGVA 4ZTPL 4KI1A 5KSAB 4XCNB 3PE9A 2QSVA 3AXLA 1DVFC 3MYJA 4GAYA 2LU4A 4KRMB 4LNRB 5EPMA 4BFIB 4K9EC 4GUPA 4XCEB 5CEZL 5HY9B 3ARXA 1C8PA 3BUYA 5ANME 4OFPA 3OB8A 4ERSL 1QSFE 2PXYD 3O6KL 1ZANH 4FQLL 4LEOB 4M7ZB 4OCRH 5TQ2H 4TVSa 3BZFA 4LCYB 3VXSA 12E8L 1I7TB 5JLZB 5I8KL 4LSPH 3D3VA 4X7SL 3K2MC 2Q3ZA 3MV9A 5FYJU 5KN5A 1MI5E 4N1EA 1IAIM 1SJVA 2DL2A 2X4PB 4DTGH 3VI3F 4GAGL 3UPCA 4KMTH 3TN0B 2DQIL 5DQ9B 4YQXH 1E27A 4RMVA 1HKLH 4M6AA 4MQ7B 1H3TA 5J57B 2FATL 5C3TA 3FCTB 1D6EA 3W9EB 3PXJA 1RZIA 5EU6D 1XIWB 5EA0L 3VRJB 4R90H 2CKNA 1CFTB 2VYRE 4G9FB 1YNTB 4OCSL 3VA2C 5KOMC 3RL2A 4RMTA 3RBSA 3VCLA 3BRGC 4QEGA 2NR6C 2AJSL 4BZYA 4Q9CA 4A2LA 1I8IB 4W70A 4GS7B 5EUOB 3ZT6A 3S37L 1JPTL 4KH2A 4LL9A 3SDCC 3QWOB 5C6TH 4DFHA 2O26U 1Z5LB 3QEUB 3ZKND 4I5BA 3QUZC 5A1AA 2OZ4H 5T1KA 2YPLB 1ERNA 1IEAA 3SDAA 3LMJH 4F9PA 1NAKH 1KEML 4TPRL 3KXFA 4B0MM 4IRJC 4DAGH 3HPJB 1X5AA 1BVLB 4UB0L 1QRKA 2XA8L 1IGML 3DV6A 1RURL 2WIIA 4WU5A 1JTTA 5IMKB 2NY4B 2R1XA 3CFBB 1PZ5A 4JFPB 5ID0A 1R5WA 5JPMA 3OKMA 1TITA 3ARRA 4I48A 3OGOE 4G6ML 1D5MA 3GIVA 3UAJD 2EYTB 2D0FA 4JZOB 2H1PH 1I3GL 1S9VB 3K8MA 5E1AA 1S5IL 4DKFL 2JTDA 3GO1L 4KI5E 1MQ8A 4MVBD 3BD5A 2ORBL 1DLFL 4K3GA 4XAWL 5BS0B 5D5MF 1ZLSL 3LRHA 3RDTA 43C9B 2GITA 3H3KA 1F58L 5E5MB 4KUCF 5HVHC 1M05A 3WNKA 3PWNB 2P44B 3H42L 3UZEA 2ZSWA 3T4AA 3E3QC 2B1AH 1PX3A 4KZEH 5L2JB 3FQRA 1XCTA 5SWSD 1RVFH 3GFUA 1OQXA 5DQJA 1S9XA 4OCXL 5LG1A 1CE1H 1GIGH 3ARBB 3WUWA 5J9PB 4K23H 4LSVH 5EB9A 4UOJA 4RDQG 5KSUB 1FBIH 3OKNA 4OJFH 3VRIA 4U31A 3TBSB 4CKVX 3SGDI 2Z91B 1AE6L 1HDMB 3QUXA 5ICYB 2YPVH 1AGBA 2CLZB 3OAYK 4HWUA 2Y9RT 2HMIC 1MCWM 4MZ3A 2F5BL 3GHEL 2NNAA 1FVCB 3BYTA 3VFGH 5B39B 4LHUB 2EIZB 5EWIL 1OTSD 1U2CA 1I75A 3QNXA 5KJRL 3U2SB 5E4EB 5FUZH 4B41A 3WLWC 3F12B 5DR5H 1N5YH 4P5TA 3FO0H 1H3XA 4O58H 1CFSB 2MJWA 5D7IA 1J5OL 1Y6NR 4CDGC 3EZ8A 1UVQB 4NJ9H 2LVEA 5DA0B 4OLVL 4S1RL 5E8EB 2VZ1A 3FT4A 3LPFA 4F7TB 5ACZA 4PRBA 2GFBB 3HE6D 5GGRB 3SDDB 5E2UL 3HN3A 2GUOA 3MODH 3RIFF 1B0GA 3QQ3A 3G5YA 1QZ1A 4LOUD 2YMXL 4PJXE 1TZHB 3VD4A 3Q1SL 3UTTA 3B9KA 3V5HA 1QSEE 1G6RL 3GSNB 1BLNA 4QGYA 3LEYH 3VU2A 2R69H 4DGIH 3ZHDA 1MH5B 3HG1D 5C0BE 3TO4C 4OZHE 1KYOK 3MRHA 2HJLB 1EFXA 1U8MB 2ZUQB 1UWXH 2NW2B 4EDXA 1RIVH 2QSCL 4KKCC 3Q2CA 4JKLA 4M48L 4KK8C 4PRAA 1WBYA 1ZHBB 4OIAA 4P23A 4HS3A 3N50A 3I6LD 1YYMH 4XB7A 5FGBA 3HUJA 3MRCB 5D4QA 1CVRA 4ZYKA 5FM4A 1AO7D 5D6CB 3VFMA 5CUSL 4JM2A 5FO9B 2C4XA 3ZYZA 2XWBB 3O8XC 3IDMB 1C08B 4EVNB 2ZUXA 5D7LA 5I73C 3WFEH 1HI6A 2X7LA 4HJ0C 4ONFL 1AI1H 3HKFA 3F7RA 4KHXL 4LLUB 2YBRA 3ILQC 4YDVB 3EJZD 4MB3A 2OBGA 3WJLA 1SYSA 5JXEA 4HUXB 5GXBB 3QG7H 1KV3A 1IGFL 2R2BA 2GKIA 5FECB 1PY9A 3MA7B 3NTCH 1NJ9B 2XN9B 5LGJA 5KG9A 5A3IC 2K7PA 4YXLH 1IAKB 3HR5B 2ZNWA 1HEZB 3EUUA 1K5NB 3GSOA 2HT4D 4MA8L 2R0ZH 3G6AA 5JORA 4OZFA 1U3HD 3JV6A 1OB1A 1S5HA 2NY1C 3PJSB 2DTSA 3QDGE 1FNAA 2WINB 1U8KB 1MWAL 3P73A 4KVNH 1P4LA 3D2UA 2XZQL 5GJTL 3R1GL 3HI5H 2YRZA 2OP4L 3FB7A 4OM0L 5DEGA 1RHHA 4HT1L 2BRRH 4WGWB 4Y1AB 5TF1H 1BAFH 2BVPB 1VGEH 2J6EA 5DMGC 3BWAB 3GJEB 2MHAB 1Q72L 3KYNB 4KY1H 1A4KA 4FMKA 4WY7L 1EMTH 4PV8A 3LZFH 4A2MA 1U8LB 3ROLA 4NO2B 5JNYA 4P2OD 3FAXA 3K4DA 3CAFA 4LVNC 4OZIF 5EORH 1SHMA 3KPLB 4JKPL 3RKPA 3FFCD 3VE0A 3Q0HA 1IGCL 1IAIL 2DQJL 2V17H 4QHLA 3VFVB 3SY0A 1J0IA 2NXZB 2WW8A 4L4VA 3UTZB 1UJ3C 5JIPA 4GKNA 3PGCA 1RUMH 5EIIB 1SBBA 2J5LB 4F2MA 3FQTB 4BELD 4P5MB 4GG8B 3WS6C 3OKDB 1EGJA 1TQBB 2GJZA 3E6HA 4CN1A 1QFWI 4ZUVB 2VXSL 2NY7L 4G42A 4W68A 1VGKB 1YC7A 3DROB 5DJ6A 3B9VA 2QADB 1X9QA 5DURD 3G5VB 3H9SB 2Y4SA 4LLDA 2OK0L 5GGVY 1R5IB 3ALWA 3KPRE 3WKML 4HIEA 5HI3D 1HHKA 5FB8A 1JRHL 1NUGA 5LJYH 4ZPTB 5C0AE 4ELMB 1MHPL 3PWPD 1WEJH 2FDBP 3L1OH 5F89A 1BZQK 3NZ8B 4IBLT 4TUKH 3IDNA 4J1UB 2DMBA 3FTGA 4X0KB 4X6FA 1TZGH 4N9GA 3MLTA 4AL8L 4PGEA 1DEDA 4PIRF 1CD8A 4NN5B 3LEVH 1L7IL 1GAFH 1YN7A 4ZXBA 4QNPF 3NCCB 1F45A 5ESVA 4D9RD 4HK0B 2Y5EA 3V4VL 3NCYP 5HDQL 2DLTA 5H35A 1JNHB 1ONQB 3MLUH 5GGTA 2Y5TA 2YPKB 2ZSVB 1U8IB 3HC4L 4LQFH 2H3NB 1M6OA 2AQ2A 2R4RH 1IFHL 3C60C 4MDJB 5HTSA 1C16B 4PGDA 5TDPB 4WTZG 4LVHB 3VGDA 1WAAF 4UINH 4KWUA 5F9JB 4Y4HA 3EOTL 5GS2H 1QFOA 1MUJA 2VJXA 5CEYA 5I8EB 3KYMB 3PV6A 3O4LA 5BZWB 4JANA 1MREL 1GCFA 4P46B 2DQFB 2W65B 4NQSA 2IFGA 2AXHA 4U33A 2V2TA 3D0LB 2AEIT 2FH6A 3P77A 2BVQA 1LP9E 1N4XL 2BC4B 4JHWL 4PJ5B 4XWOC 2H8PA 3U0TA 1BVKB 5C92A 4H25A 3ZKMC 4F15B 1AKJB 2RB8A 4P2QB 1I8KB 4GAJH 4WO4B 1GOGA 1Y18B 4C56B 5HYFA 1KN2L 2V7HB 1NPUA 3D85D 5ICXA 4S0SD 4TUJA 3RTQC 3AMKA 5FYLE 3IDUA 3CFKB 2A6IA 2V2WA 1QSFD 1JGEB 5CGYC 4GAFB 5CP7A 4RIRB 1FCCA 4WVRA 3U7AA 2F54D 2GT9A 3VDAA 3ILPA 1NCDL 5IIEA 4DGYL 3S3PA 4YXHH 4JB9H 1F4HA 3QIBC 2OR9L 1JGVL 3BSZL 4NQCB 2XOTA 4FP8L 4OZFH 1XGUB 1II4E 4RNRA 1MI5D 5T3XH 5D9SA 3H3PH 3R0NA 3WN5B 4DN3H 4HS6B 3MJ9L 2FBJH 3PWLA 4ZUUB 4QHNA 1VKXB 2EXWD 1YN6A 5CHNA 1A6UH 1K3IA 4N90E 4HGWB 2YA0A 2QKIA 4GRWF 4FZ8H 5E6IB 4NNXA 3IU3A 4JFOA 4HXAH 2VDKL 1TJHH 3DTXB 2BNUB 4HD9A 4PJ7E 3HC3L 4ZO8A 3S37X 3O6FA 3RVUC 3MLRL 2V9QA 1EEYA 4D9QE 3D9AL 1IGIL 1M71A 1J7VR 3TVMA 4APQA 4B5EA 3HRPA 5JQ6L 2NY3C 5I0DA 3C6LA 3OJVC 5C0CB 1QYGL 4JDZA 3RNKB 4CUCA 4QLRA 1ZHKA 1I9IL 4NZUL 5C0JA 4YE4L 3QZWA 1T1XB 3QI9B 5HYJD 4ZAKB 3CMOL 2ARJB 1OAQL 1EEUA 3G5ZA 3VD5A 4ZSOB 4KROB 1EGJH 4I9WD 2CDGB 1K8IA 2CJUL 1GGBL 3BRDA 2ZWLT 4CVWA 4EKXA 1G9MH 2C3VB 4XCCH 5EBWB 3TF7C 1S8DB 2KQMA 3QFDB 2P5WE 3IETA 4AJ0A 3O11B 4KJPD 4X4YB 4MX7A 5J6HB 7FABL 4GG6F 1HINL 1T3FB 5HYSG 3BH8A 1JWMB 4NKMB 2WUBL 4DUWA 1YEHH 1HCFX 5D5MB 5I2IB 2X10A 4PLKC 1RFDL 4RBPH 1K85A 1BREA 4KI5D 2FD6H 5FKPB 2C1OA 3CDYA 1WK0A 4MQXD 1IGTB 4PRHE 4K3EH 1BFOA 5IK3A 3RY6C 1BVZA 3E1F1 1O0VA 3I9GL 3H9ZA 3CVHL 3LKRA 1MRDH 5GGTH 1JF1B 1TJIL 5DGQA 4WDIA 4N0FB 5C9JB 3FONA 5GHWH 1YMMA 5IG7B 1Q9WB 3MBXL 3O3DA 2R0LL 4RA3A 1J8HE 4RISH 1YEFL 2KUTA 4UBDD 3NCFB 1UM6L 4U1HA 4Z0XA 1P7QB 2DKUA 2P5EE 3B3IB 3MC0A 4JFQA 4J8RB 2VR4A 2JKXA 3T0DA 1NLBH 5E8NA 2VAAA 1FL3B 3PL6D 4RGMB 4C54A 4EOWL 5C6WH 1JMZA 4KDWA 4I13B 4X6CF 4YFLF 1PBYA 4G6FB 3GMMA 1JZ5A 4BFBD 2HT3C 1OAZL 3HFMH 4RZCA 1C7TA 2DQDL 1XF2A 2PR4L 1XGPA 2HP4A 5FO7A 5CS7A 2XPGA 1MIMH 1X6LA 1UA6L 1T1WB 1U93B 2PYFA 3EO9L 4UDUB 4ZFOA 5HVWA 3T2PA 4X7DC 4YBQD 5D7JC 3SE4A 2DIBA 2APXA 2WQRA 4G8GE 4D9LL 5L2KE 2DBJA 4TOYH 4EDWH 5DK2B 3QJHB 1BD2B 3U4BL 4UIMB 1N5AB 5HPMA 1A3LH 4RRPG 4FFVD 4O9HL 4I3RH 3IKCA 4TSAL 1J1XL 4G8FB 1QSED 3MRRB 4POZC 1BZ7B 2JCCF 1S7SA 1JNLH 1XR9A 1V3KA 1JWSA 5C0BD 1NDGA 4YPGB 3D3VE 4LGRB 1QEWB 2WBJA 5HDBE 3RVXC 4DK3A 3BAEL 1L6ZA 4LCCC 1RZGB 1BQHG 5J6GB 5DJZB 3G9VA 2X4OA 2Q87A 4MHHG 4OUUB 5HHVH 5J1AB 4Z95H 4HPYL 2L7JA 1KELH 1I4FA 1MFNA 4WWID 5DQDH 3VG0H 3NAAH 5SX4H 1MCJA 4PG9B 1GRWA 3O81A 3MCLH 3OV6A 1ACYL 4FQXC 3H9HA 1P84J 2GSGB 3MMEB 1TCMA 4MXQD 1SJHA 2L4OA 3HMXL 3OKOA 4YC2B 3RNQB 1T7XA 4KTYA 2C1PB 1EJOL 4E42A 5EN2A 4H20H 1X5LA 3DGGB 1H8OA 5DRXB 4HKXB 3QPQC 1WF5A 1HH6B 1FZJB 3QEQA 4QRPA 1S7UB 3QIUC 4GRMA 4GLRI 4ZUTB 5ALBL 5L7XH 1DDHA 1H5BA 3QDGD 1CTNA 4WFHE 1NC4B 3VWJB 5ESQB 2X4SB 5EU6B 1KULA 3OB0H 4I0PD 1J87A 3BP5A 2A77H 2ZP0T 4G7YH 1R24A 3I85A 3IS1X 3GMQB 2IQAA 5IGXL 1ZMYA 3JV4A 4OZIB 4PJFF 1P7KA 1J12A 1NEZA 1PQZB 5GJSH 1QNZL 3ARFA 1RUQL 2BHZA 1FO0A 3MRDB 3NCJH 3F7PC 5J0BA 4NHUB 4TTDC 1JNJA 1AIFA 4L8SA 3WL9B 3VD7A 5LGKA 2FJGA 1OGAA 5JW5A 3Q6GH 3FFDA 2XZZA 1FFRA 4KQ4H 1FJ1B 4GW1B 4FZEL 3PDGA 1CGSL 3JTTB 5IHUH 4X4MA 4F7CA 3X3GL 1GGIL 1AGCA 2FJHB 4LLMA 1RHFA 3W5MA 1JHKH 4YHMH 5HHQB 2BVOB 5GRJL 3FRUB 4JM4L 5LKNA 1AGFB 1D5IL 1I9EA 5EU5B 5LGHH 4HC1L 3LN5B 2CUHA 3N85H 1B0RB 3QJFA 2FEEI 2I07A 4Y5XB 2YUZA 1F90H 4JKKA 4AEIH 4XPTL 3C5ZA 1NGQH 1VA9A 2P8PA 3KPRD 4OD2A 2CIKA 2CKBL 2WP3O 5JMRA 1IQDA 1PG7H 4XMLL 5C0AD 1G6RB 2P8MA 1DL7H 1F4XL 2VDPL 4DW2L 4ZFGH 5ESAB 2YWZA 5MI0C 5BW7A 2BERA 1AY1H 1AQKH 7CGTA 5BMFL 1WIUA 2FSEB 1FFOA 5DJCA 4A6YL 4LASL 3SDAC 4PJAA 4F9PC 3AVEA 1ZA6B 4GMSH 5SWSB 3HRZA 1CQYA 1CE6A 2C3GA 2ZOKB 4JZJB 4PBXA 3G08B 2HTKC 1KB5A 3TBTA 15C8H 5E5RB 2ZG2A 3DURB 5HI4D 3WHXA 5JHLL 4Y4FA 2V7NB 3FN0L 4RWYL 5EU7E 3QDMA 4O02H 3FZUD 2KQNA 4G5ZH 5EO9B 1AXTL 3UTTE 4XRCB 1BBJB 1SBSL 1WBXB 2GTZB 4FXGB 4GMTL 1H8NA 4LKCA 2JB5L 3CC5A 3RWFB 4PV9A 1MJUH 4HUNB 4X7TB 1FORH 3ARDD 3WXVL 3G6JA 4XI5D 2D7TL 4TSCH 2MCPL 4BZ2L 1JJUA 4UILH 2HFGH 5DJYA 1I8LA 3HC0B 3VRLF 3F65A 2EDJA 1J11A 1NGPH 4LEOA 3RDTC 4DCQB 1A6ZB 4CJ0A 4F9LA 2E6PA 2YD7A 2XKNA 4KRNA 5I1HL 4UAOC 3TO2B 2ITDB 2WLZA 3PP4L 5E9DE 5F71A 2EDBA 1G6VK 2PKDA 4M7KL 3ZKXC 1NGZA 2XV6B 5TE7H 5EO1A 4MJ6A 1YEDA 3SQBA 3TN0A 3MNWB 3MGTB 1OARH 3PHSA 5LVEA 2PW2A 1MWAB 1U41A 3HI6H 1F11B 1SMAA 3QXDB 3CXHK 3KJ4C 3NABH 1V05A 4MQ7A 5FYLD 5GS0H 4B7LA 2ADJB 4MLIA 4PJXF 3FCTA 4Z78A 1LE9A 5IOPA 1BEYL 1E4XL 4AM0A 3QUXC 3EYVB 3V8CA 4HKBA 1J0ZA 4E5XA 2JF1A 5E8DL 3RWJA 1NMAL 3WD5L 1EEZB 1Q38A 4JHAH 3QXAA 3ULVH 4LARH 1AO7B 4KDVA 4I2XB 2N4IA 3IFPA 4QY8B 4U1KB 2P46B 4M1CD 4TNWK 2XXMB 4GKOA 4P5TC 1X5IA 4NN6C 4IM8A 5IESL 4IS6A 4EI5D 1EUUA 2DLEA 2FX9L 2YEZB 3PP3K 1D7FA 2X40A 3QEUA 4U05A 4YNYA 4HIIB 1OAYH 4S2SB 5HHXH 2FO1A 1JN6A 4JCMA 4OZ4B 1KLGA 2VWEC 4D9QD 5F7HA 1NFIB 1VFAB 2HN7A 3GRWA 5I1GL 1QSZA 2BY1A 3B9KC 1OF2B 3VG9B 4RGNE 1FO0H 4J4PD 2Q1EA 1PKQE 5JOFB 4JVWA 4LAQL 4ZFFA 1LO2H 2J88L 4KPHH 5D96B 2IG2L 4JPWH 1G9NH 4HG4K 3ZMRA 4NP4H 4JFPA 2EDLA 4EQ3A 4PB9H 4Y5YB 3BPOC 3FOMB 4NZTL 2Q8AH 3VXRE 4U1GC 3ZKQD 1OLLA 3S88H 1DBMH 2EYTA 3KYOB 4L4VE 4AY0A 3V6ZB 4P23C 2X9YA 3V6OA 3D87B 4CADB 2DDQL 5FGBC 4BSVB 1UB6B 3E6FA 4RCAA 5F6IB 4X4XB 4GG6B 3IXAB 43C9A 4JM2C 1OGTB 3UJTH 2P5WD 3WBDA 5EDXA 3MUZ1 4HLZH 3PWNA 3I3BA 4OCRL 5TQ2L 3WFHB 5JW4M 1U8OB 4PLJD 4LSPL 3RA7H 5E2WH 2XT1B 4W6WB 3WJLC 1FP5A 5JXEC 5C0NC 1IQWH 1LWRA 4P2OB 3SPVB 1RULH 5D8JH 3ARBA 4DTGL 2BNQA 1I7RB 4KMTL 4EXKA 3I02A 5SV4A 4C59B 3OWEA 4X5LA 3ROOB 3TBSA 4L1HA 4PBVC 4PRHD 3B5TA 1UZ8A 2FRGP 3FB6A 4K94H 1CGYA 3HZVB 2R0KH 3W0WB 2KZ1B 1T7VA 1KB5H 1FVCA 4YHLH 5B39A 4LHUA 4R90L 4NQDB 5D7KE 3LRSB 1PAMA 3KYAA 4TNVF 4UV4H 3RRQA 4XP6H 3QWQB 2CSPA 3CH8A 4BYHA 3GMRB 5JQHC 3UYPA 5E70A 1J8HD 3FN3A 5E8PB 3ZDZF 5E8EA 2P5ED 1BQLH 4X6CB 4F7TA 5IFHH 5GGRA 2OS7A 2AEPH 4MJIA 1FVEA 1WWBX 4OSUH 5C6TL 1HZHL 1TMCB 1GC1H 1K4CB 1TZHA 5CSBA 2OZ4L 4BH8B 1JBJA 1MPAH 5GZNC 2DB8A 4U49A 2VMFA 1MH5A 4HWZB 1LEGB 4UT6H 5CZKA 5D1XD 2HJLA 5I1DA 2F15A 1C12B 4Y19B 3QDHA 1IJ9A 1C5CH 1KC5H 3P9LB 4TVPE 2NW2A 3LKNB 3QUYD 1ZHBA 3B5GA 1JUFA 4G8GD 2XRAL 5I75C 3DUHA 4J3OC 5L2KD 2JCCB 1N3NB 1NUNB 2RHEA 5FUCC 3ULUE 1T66C 2H1PL 3SCMA 3X13B 2EDKA 4XVUC 2APBA 1CDGA 4H88H 5BVPH 5FO9A 3RI5F 2XWBA 4RQQB 2DIJA 1N0LA 1GOHA 3IDMA 1KTDB 2IAMD 1C08A 4XP4H 3ALPA 3SDCB 1CXHA 1Y0LA 2VISB 3OAYH 3BVNB 4RMRA 5C09A 3MOBL 4Y89A 3QUZB 4PRPA 1KIQB 1MCLA 4K3JH 3PWVB 3U6RA 3EYFB 2YD9A 4RMUA 3UROR 1KXTB 1ADQA 3NPSC 4M93B 3LKPB 4IRJB 3WUWG 4KZEL 2GSIB 2CLVB 5JW4Q 3F8UB 3N1QC 5IHZB 1E28B 4ISVA 1IM9D 1RVFL 2Z8WC 3FQUB 4WW2A 3SDXE 1CE1L 3KPOB 1DZBA 1HEZA 2DF3A 4HBCH 4ORGA 4ZXBC 1LP9F 1BM3H 3F62A 4ZNEA 3GRWH 4K7PH 4LSVL 4PR5B 5FKAA 5LAXB 3VFOA 4V1DD 1FBIL 5L88H 5K59E 1INDH 3MV11 1QFUH 3PJSA 4PP1D 3TPKA 3DX7A 2WINA 1NCTA 3IDIB 1QSFB 4HV8B 3RJQB 5DMIH 1JPFB 2GK0A 1XMWA 5DI8B 3TNNA 1YPZA 3VFGL 2XWTB 4PD4K 4U6XB 1R3KA 5EBMB 2I25N 4Y4HC 1KENH 4JREC 1MI5B 5FUZL 1FL5A 5AWNH 1G7JA 1QP1A 2FYYA 3GJEA 4KJYA 4PUBH 1N5YL 1RMFL 2X1QA 3FO0L 1G7PA 4EN3D 5HVHB 3QDJE 5DMKA 3KYNA 2MKWA 3MZGB 4NJ9L 4CU8A 5IHLB 4LP5A 1VENA 1AP2B 2BY0A 3KPMA 2ZKHL 2DQHH 3LD8B 5HVFB 1U91B 4PY7B 4Q2ZA 3ZO0A 1ZT1A 3FQNB 2HJFB 4S1QH 1TVHA 2BVEA 4WNQB 4JPVH 4BA8A 1A0QH 4PJFB 4KK9C 3LEYL 4Y5VB 2R69L 3TFKC 3CVHB 1AGEA 3QHZL 1Y6KR 5CIPA 4JO4H 4X7FC 3FQTA 3NCBB 4YXKH 3OKDA 5DJAB 5CP3A 3TA3A 4OV6F 1RIVL 4MNGE 3GSVB 5TPWH 5IT2H 4ZUVA 4DGVH 2RCSH 2NTFA 1I7UB 3L95A 2Y1VA 3UTPE 2H9GA 1U8QA 4YH6A 3LSOB 1YYML 3P4NB 4LSQH 1OTTD 4KAQH 5C0GA 3OKKB 1O7SA 4JRXE 1L6XA 1R3IL 5IR1B 4O00A 1LE5B 5F7UA 1HSAA 3D5OF 1QD0A 4ZPTA 1A6VH 1R3HA 32C2B 3S9DB 5EULV 3THMH 3MGAA 3I3EA 3NZ8A 4L4TE 1AI1L 1CDJA 1ZLUK 1I1FB 4X0KA 3DPBA 1P69B 3QG7L 4WFFE 4HFUH 3F7YB 3O6FC 2O61B 2R4SH 2VDOL 3RWHA 4JDTH 3NTCL 1KTLA 4NQUA 3TVMC 3PUCA 4APQC 4YXLL 5MENB 3HMWH 4G6AD 4OZFG 1JNHA 3C6LC 5DD3H 1XCQA 1B2WH 4CVXB 3IF1B 5HGBB 1XGRB 2ZSVA 2UYLB 5FF6B 2Z8RA 4LGSB 2R0ZL 3BPLB 4LDLB 2B5IC 2IADA 3D18A 4MDJA 1C16A 2VDQH 1WC7A 2H6PA 1W0VB 5IW1A 5HPOA 2P47B 2QLVB 2BOBB 5F88B 4Z7QE 5TDOB 4KVNL 1NUFA 3RGHA 3NIDE 4BH7A 5MERB 2B7DT 1CLOH 2YA2A 1MLCB 3HI5L 2DTML 3O8XB 5BZWA 4Q9QL 1CTOA 1KXQE 4P46A 5I73B 1HNFA 5TF1L 3C09C 5KZCD 1BAFL 1VGEL 4P3CH 5C07E 1DQJB 4ENEC 3TLRA 1T04B 4NGHH 1YEIH 3AB0C 3GMLB 2QQQA 2W1NA 4UT7H 3INUH 5MEPB 4KY1L 4KRPD 2UV3A 4DEPC 1EMTL 5DWUH 4Z7NE 3LZFL 4ZODA 3UZQA 4AK1A 4DWHA 4V2CB 4BQ9A 3JSSA 3BO8A 4Y2DD 2QQLH 2D7QA 4QYOB 4WO4A 3VFNA 4C56A 2V7HA 4FFYL 1RUML 2HT2D 4U0RC 1MJ7L 2VLLA 4MA3B 4D3CL 3M17A 1G7HA 2BSTB 1ZAGA 3AMLA 4I77H 1JGEA 5TDNB 4RIRA 1FIGH 3I6GB 4LPTA 1V7MH 3RUGE 4WGVB 4OF5A 4NM8H 3BZDA 3QNYB 5E9DD 1XGUA 4HDIA 1GGYA 3QIWD 3L9RA 4HW6A 1KPRA 3WN5A 1T5WA 2VLJE 4YUEH 4PJGF 2YUXA 1UXWA 3C9NB 4PJXB 4ZS6C 2DJ4A 3OF6D 2YWYA 1QSEB 1G1YA 4HGWA 3GBMH 2WM0A 3BKYH 5FFLA 4RMQA 1KCVH 4OZHB 3BPNC 3L1OL 4LVNB 1LO4H 4NQEB 1XF4A 4U1MB 4OLYH 5E99H 4TUKL 2LAAA 5HYSB 1TZGL 1F3RB 4JY6A 3MRGA 1AR1C 4NQXA 1UJ3B 2AXFA 2DIAA 4BQ6A 3L3GB 2BSSA 2WNGA 3IGAB 4S11A 3MZTA 4F7MB 3IFLH 1UH4A 2Z0BA 5DJ0A 3ULVE 1UJTA 5HGHA 1I9JH 1ED3B 4RAVB 1EO8H 4LQFL 3ZE1E 2R4RL 5CIPH 1N8ZB 4ZSOA 3SE4C 3U9PL 4L3EE 4PFEA 1N2RA 4HBQA 2CDGA 3BT2H 4UINL 4XPAH 1OP3H 4GW5B 4NZJA 1MCIA 1TZIB 1OPGH 1U3ZA 4RGND 3VFPB 1I1RA 1B90A 3QFDA 4X4YA 3VXPB 1B9ZA 1LMKA 4XVSL 3F5WA 2G75B 2WBJC 5K9KB 4LF3A 5GISH 3VXRD 4L9LA 1G7QB 3S96A 4LRIA 3U82B 2ADIB 5D5MA 5I2IA 2VZUA 4MCYB 3UBXA 2DYPD 4YLQT 3QDGB 3CDFA 3VFWB 1CF8H 5SWQB 2ZOLB 3T0AA 3ZYJA 4OAWB 5FKPA 2VERN 4I0PB 2P49B 1IGTA 1A1NB 3DYMA 4N5UA 3C60B 4A6YB 1R3JB 2YZ1A 4P3DB 4PJ9D 1JF1A 3QUKA 4MAYD 4YXHL 5C9JA 4JB9L 4OCLC 2DWEB 3DVGB 1UM5H 3CDGA 1MHCA 4HWNA 5JHDE 4YBLB 4UUJA 4G6JH 4GXUN 3WIFA 5I6XC 1NSNL 4DN3L 4L29A 5GS0C 2FBJL 4OD3L 4C58B 2EDDA 4UT9H 1INEH 4TRPH 1P7QA 4Q7DA 5B22A 3B3IA 3VDBA 4J8RA 4CGTA 1A6UL 1FZOB 3BD3A 5FHBH 3CLFH 2FGZA 5D7SH 4FZ8L 2E9WA 4DVBB 1TJHL 1ZHLB 5H8DA 1BQHB 1A47A 3MRNB 1RY7B 4Y4KD 1H5BC 3ECBB 1RAMA 5D7KD 1F3DH 3KPNB 1BOYA 3PV7A 4XVJH 3ZKSD 3IDGB 3RTQB 4LPVA 5DSCA 1M4KA 2VITB 4LSRH 4JGUA 2UZIH 3QZWG 3LAFA 4RX4D 2IFFH 5DHVA 5DVLA 3WMSA 1KYOJ 2BMKA 1KLUB 5D93B 4HMEA 3EKCA 3QJHA 1QKZH 2EDWA 1XR8B 5F1IB 5C0AB 1NCWH 4UIMA 3EYQD 3ARFC 3BDXA 4Q6YA 5DFTA 5IQ9A 1XF5A 4XC3L 5BOZG 5KOVC 4P2RA 4YAQA 4CDHA 3P9MB 4L8SC 5IB5B 3QEHB 3NFPA 1G9NC 3S34H 3MV8E 2HYMA 3DOSA 1G9ML 3KNBA 4XCCL 1JHLH 4LKXB 1SEBA 1T21A 3OHXB 3DI3B 5HI5D 3O3AB 2YHGA 4TVPD 5J6GA 5DJZA 3L3OA 5GGQH 5C08A 5D7IF 1EVTC 3L3IB 4K55A 5FA3B 3UYOD 2I9TB 2UWEA 4QRTB 3P4MB 1VFBA 4J3UA 4XPBH 3VWKD 1M1SA 1Q94B 1SYVA 4O2CB 3UO1H 4B50A 1YEHL 2NX5A 1VPOH 3ULUD 1U3YA 4QOKA 3GKWL 2F8OA 4JJ5B 1OP5K 2ZUVA 4NOFA 5F96H 4OI8A 1KJ2H 4QHMB 2J2ZA 3MLWH 3ARDB 2FD6L 2XZCL 4WI9A 1AJ7H 3C5ZC 5INDA 2W0LA 4ODSH 3MJ6A 4K3EL 3AAZB 5I74C 4OFIA 5DFVC 3RWDB 2PXYA 3MMEA 5INCB 2VLRD 3OG4B 5TF0A 2EE3A 2VLKE 4URTB 5GS3A 1UXSB 5FDWA 1MRDL 1LP9B 3RNQA 4HXBH 4ZOBA 1AD0B 5CJQH 1CGWA 2C1PA 5DUMH 5BW7C 4M9OA 4FQ2H 4TNVK 3DGGA 4HS8H 3CDCA 3DLQR 4K94C 3SKMA 5F21B 4RISL 4F7PB 5DRXA 5JO5B 3CSGA 3MRPA 2HAZA 1FZJA 4JM2F 4X83A 3TIEB 4U3HA 4ZUTA 1NLBL 1W8OA 4Y4FC 3HZKA 5IMOA 4H8WC 4QRRE 3GKZA 5CSGA 2BSED 2Z92B 4FG6D 1IAII 5J12C 4OGAC 5EU6A 4S1SL 4L8BB 5HYQB 3GMPB 2R0WL 3HFML 3S8WA 1VEMA 5DUPH 3L7EA 1RQ5A 4NO3B 1HSBA 4EI6B 2VN7A 1X7QB 3QDJD 1GC1C 5CEXB 2HLAB 3SDYH 3LH2H 2Z35B 3V6OE 1U2HA 3EYOA 5I1IH 4F9LC 1R5VB 3EHBC 4TOYL 2ITCB 3JWDL 4EDWL 2FH8A 3V0VA 5CZXC 5CMAA 1FJ1A 3BMVA 3QQ9C 4GW1A 4I3RL 4HJ0D 4HUUB 1U58A 4DZ8A 1JRHI 1JNLL 3VFUB 3TN0C 4LLVA 4C55A 5EBLA 2AK4E 1YUHB 2CIIB 3LQAL 4YHKH 1C5DB 4JG1H 3CU1A 1OD9A 5AD0A 4U3CA 4QHKI 1ZEAH 1A7RH 1AC6A 2WWMC 3H0TB 3A6BH 1FSKC 3LN5A 5HHVL 3TH2T 3UTPD 4CL7A 1FFPB 3TV3H 1D6VL 5GGSA 4Z95L 1B0RA 3VGEA 4X5WA 1KELL 5CEZH 1FNSH 5DQDL 3VG0L 2MQ0A 1AXIB 4JRXD 3MCLL 1E6JL 4Z7VA 5D7JB 3FN9A 5I8KH 1L9NA 4GS7C 3I6KA 4KJWC 4NZDA 3R06B 3GI8H 4L4TD 1LNUB 3HZMB 3AY4A 2HLFD 1Z9OA 4FTVD 5DHVH 4WFFD 1CDIA 1MHHB 3HR6A 1NH6A 1CCZA 2Q6WB 2OJEA 3OR7B 1ZA6A 2FHFA 5SWSA 3B4NA 3MV7B 4H20L 4WU7B 2ZOKA 3VFSA 1JZ4A 4NYLB 4LCCB 2VUYA 4OGYL 4NUJB 1JI1A 2IANE 2X4RB 5GZOC 1MELA 1YMHB 3BEVA 4XRCA 4PRHB 4N0YH 1ZSDA 3VXME 1NANH 5L7XL 4YFLI 3X11B 4KXZI 2EICA 3TYFA 2AAVA 1QVOA 1CU4H 1OL0A 4PJEA 3V6OC 4NNYB 2M26A 5J11C 3T2NH 3HC0A 2FIKB 2A77L 4G7YL 3FQXB 3HHRB 4DKAA 2ATPB 4FQXB 3CX5J 4OCYH 4DCQA 5IEKB 1A6ZA 5C07D 1MIEH 3FHAA 4HH9B 3ARWA 4ZQKB 4JN2B 2P5EB 3NN8A 2ITDA 4XNUH 5IB4A 1MHEB 3HE6A 1N7MH 1QLRA 3NCJL 4G8IB 4TPRH 3REWB 1J05B 1EAPA 3WE6B 3MNWA 1IGMH 3Q6GL 5ITBL 4KQ4L 1T03H 5C09E 3LOWA 3DGCR 3ARBC 3S35H 3QXDA 4C83B 1DTUA 5K9QG 5IHUL 1V3MA 4N9OB 3HG1A 4R97B 2ED7A 4Z76B 5D1XB 5IB3A 1DFBH 4XGZB 4PJGB 3QUYB 4N0UE 3M1BB 2DI7A 4U1NB 4HLZG 4G9DB 2ZUYA 4G8GB 4UMGA 5I8CA 1CXFA 1A5FH 4ZNEE 2ORBH 2VLJD 3JVGA 3N85L 5I9QB 5TE4H 5KSVA 2WV3A 3AXLB 1AO7A 2FLRT 5C2BH 1KSRA 4GUPB 4OT1H 1F90L 3QUML 4QY8A 4U1KA 4AEIL 5JA9A 3BUYB 2F8VA 3RVTC 1U0QA 2IAMB 3FL7A 1PG7L 3BZFB 1HH9A 5I18H 3H42H 1DL7L 3UPAA 3D3VB 4ZFGL 1MCRA 4QRSA 3HNVL 3IXTA 2IC2A 4OZ4A 2DM4A 3MV9B 2IWGA 5KN5B 5B21A 4ZFOL 4UQ3B 2FL5A 1AY1L 1AQKL 4XP5H 4HCRL 1I1YB 1VCAA 3F7VB 3BX7C 4KK6D 4JFDE 1GH7A 5A2FA 2OL3H 1W0YT 3BIAX 4ODXA 4GMSL 1IM9B 1FL6A 2KBGA 4XB8A 15C8L 3ULVD 4O02L 1D6EB 4G5ZL 3GHEH 1U3HA 5IB2A 3KPSD 3KYOA 1FG9C 2IH3B 5DTFA 4L3ED 2VR9A 2BFVL 4XZUA 3RL2B 4BSVA 1UB6A 3T0VA 1CBVH 1MJUL 3GNMH 4HIJB 4LIQE 4X4XA 3SCMC 1FORL 3VCLB 3RY4A 2SEBA 5DXWA 4TSCL 4OLVH 4UILL 2HFGL 3QULB 2WSKA 4LRNH 1KCSH 3QIBD 1NGPL 4EIZC 5MI0B 4LFHG 4XTRD 3P0VH 4EN3B 2MCG1 4F8TA 1OTUC 2YZ8A 4NN7B 4JJHA 3LVEA 5IHBA 1PVHA 3MXVH 2AXGA 4PRNA 5T1KB 3FRPG 3FJTA 3SDAB 4P2OA 4XMKH 3SPVA 2JB6A 3FFCA 2IBBA 1I7RA 2WP3T 5TE7L 2BY2A 2HTLC 2YK1H 4R4FH 3E0GA 4WW2C 2WIIB 3ROOA 4JFEE 5AYUH 1UENA 3HI6L 3SKOA 3QCTH 3PP3H 2VZOA 2R1XB 4CW1B 5IBLD 3NABL 5ID0B 2R2EA 3EAKA 2NZ9D 3GIVB 3BHBA 4JHBA 3I75A 5L6YL 1KJVB 2PYEE 2NY0B 2G60H 5IVNA 3GM8A 3MNZA 5E1AB 5JHDD 4JQIL 3TBVA 4JHAL 3GMRA 1J1PH 3ULVL 2OTUA 2PCPA 3IJHA 4LARL 2GITB 2J4WH 5DLMH 4X6CA 1CICD 2QBWA 4N0RA 3K8LA 4PJIE 4UAOB 1A1MA 1A7NH 5DS8A 1WTLA 3PWPA 2ZSWB 3T4AB 3ZKXB 1OAYL 4U7MA 5HHXL 4BH8A 2DQEH 1QO3A 5CINH 3TM6A 1R3LB 3FQRB 1F4AA 4AEEA 3PGDA 4F57H 5DHXB 5DQJB 1EUTA 4OB5H 3WUWB 3OKYA 2NXZC 1A3QA 4D8PA 4IHOB 3DX9B 3V2AR 2XQBL 2CUIA 3Q6FB 5D1QD 3P9LA 3OKNB 1LO2L 3VRIB 1QSVA 1F3JA 4KPHL 3HA0A 1EZVY 1T6VN 3EYUH 2J5LC 2R15A 4JPWL 1G9NL 3QUXB 4OCMC 3L3KA 3K0WA 3MJ9A 1AGBB 2APTA 4OLZH 4PB9L 3BUTA 2A73A 3W11C 1WWAX 4UDTA 2UZYB 2Q8AL 1U8HA 5J3HD 3TA3C 4X8JA 2XZQH 1DUZA 1OVZA 3GSUA 2DQGH 1DBML 1KGCE 2IALB 1NAMH 3EO1A 3K80A 1A6WH 3QNXB 3QPXH 4PRIE 4M7LT 3QFJD 2A6JA 2V5YA 4QT5A 1CLYH 1KTDA 4Z7OF 2VAJA 3MV8D 3P11H 4P5TB 4MNQE 4PS4L 5D7IB 2VISA 3BIKB 5IBTH 3FT4B 2BNRE 4WY7H 4Z7QF 1NKRA 5ACZB 1CZ8H 3OKLB 5KZCB 1FH5L 4HFWB 1S7WA 2GUOB 3TZVD 2CGRH 4J23A 5F1SA 2EH7H 1FPTH 1MCWW 2NY2D 3G5YB 4X5XB 4YHYC 3L5IA 3RA7L 5E2WL 3ZDXE 5IF0B 2IH1A 3UTTB 2CLVA 3B9KB 4MQTB 3S97C 1E28A 3V5HB 2EE6A 1WBZA 3FQUA 1IQWL 4NN5C 1RULL 5D8JL 1FAKT 1Z9SA 5IROA 4JFFD 2FZ3A 3MRHB 4PR5A 5LAXA 5EBGA 3BPOB 2E6JA 2APVA 3D85A 4U1GB 4EDXB 2ZJSH 5ANMA 2VXSH 2NY7H 3ME0A 3O3BB 1WBYB 8FABB 2WMPA 2DM2A 3IDIA 3S4SA 4P23B 4HS3B 2EIBA 2F54A 5IW3A 5DI8A 2VLKD 2APWA 4YHLL 3GK8H 4ZYKB 1N6UA 5EBMA 1A02N 3VFMB 1FFQA 5E9DB 4UV4L 4JM2B 1MI5A 4XP6L 5DD5H 2AVGA 3UP1A 2OK0H 1A2YB 1B4JH 3K3QA 4P46C 5D7LB 3RUGF 1XH3B 4I0KA 1HI6B 1BQLL 2YBRB 5IFHL 1AP2A 1SYSB 4OSUL 4QRRD 4BUGA 1GC1L 3F58L 3KWWB 5KG9B 2P42B 3B43A 1MPAL 1TNNA 4Y5VA 4F15C 1P6FA 2FX8H 3WDJA 4WO4C 4UT6L 4F33A 1HXYA 2N7BA 4HF5L 1S3KH 5DJAA 1C5CL 1WVZA 1HHGA 2OR8A 4IRSA 4OZFB 5JORB 2W9EH 1S5HB 3GSVA 1J88A 2GK2A 2RAMA 4KKLC 3VA6A 5HYJA 5MEOA 1FRGL 5IQ7H 5C0RH 3NCMA 3F6LA 1P4LB 1PX4A 1A6AA 3QRGH 3D2UB 4WTZA 3SJVE 2HKHH 4LSDA 4ODWA 1HXMA 3ULVF 5DEGB 1RHHB 3FQWA 4HJJH 1BFSA 5BVPL 3WN5C 2C4FT 5E24E 4LLQA 2C4FU 4ZUSB 2C5DC 4XP4L 1QOKA 4RGNB 32C2A 4LBEA 2AK4D 4LK4A 4H5SA 1A4KB 1AFVH 2DAVA 4JHWH 1I1FA 4NRXB 5SWZE 1KEGL 5F70A 2A0LD 5JNYB 4K3JL 3W82A 2IBZY 4HKZA 6FABH 3VXRB 3VE0B 3QG6B 5I76A 4QHLB 2MFNA 3SY0B 4L4VB 1BFVH 2UUDK 5C3LD 4HBCL 3PABA 2YRPA 1BM3L 4Y7MA 4YGAB 4F2MB 3BGFC 2UYLA 5FF6A 5I15L 3GRWL 1CDYA 5GRVL 4X6EB 3SKNB 3ZL4H 5I75B 1NCDH 1CDCA 2GJZB 5L88L 3CZFA 3E6HB 4P59L 1TVDA 3QHTC 1INDL 4PRDB 4U6VH 1MEXL 1W0VA 4NFDA 5DUBA 1QFUL 3BSZH 1JGVH 1JI2A 2BOBA 4G42B 1F5WA 3L3HA 1JF5A 5FXCH 1MLCA 4PJ9B 4KROC 1VACB 1T4KA 1KENL 1UEMA 4LLDB 4Y88A 2H32A 4GSDL 5AWNL 3LKOA 4MHHI 4HIEB 1DQJA 1HHKB 5JUEH 5FB8B 4PUBL 3QXWA 1QLEH 2EEAA 3HC3H 2IAND 4P57A 4UZGA 3MLRH 3LHPL 3U4EA 2VZ3A 3IDNB 5ETUA 2H2SC 4P4RB 1IGIH 3FTGB 3NPSB 2DQHL 4JFHE 4N9GB 3PL6A 2V5RA 3H8NA 3JTSB 3VXMD 4PGEB 3FKUS 4ZFZA 4LRIC 5JQ6H 3EJYC 4LVOB 4QYOA 4JQXA 4ZXBB 4JPVL 1A0QL 5ESVB 2UY7A 1F4WH 1MCOH 3R8QA 3ARGD 3RL1B 4MA3A 3H7LA 5FYJH 4JO4L 1E4XI 1ZLUH 4PJAF 4YXKL 1OAQH 1M6OB 4ONHB 1HYSC 3CXHJ 2HVKA 2NX5E 3PIQB 4QOKE 1EERB 2H2PD 5TPWL 3RVVD 5IT2L 4PGDB